BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10131_c0_seq1-m.49 complete 96-1217(+) 374 (+)
         (373 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|511007002|gb|EPB88304.1| hypothetical protein HMPREF1544_0488...   400   e-109   Mucor circinelloides f. circinelloides 1006PhL
gi|254572089|ref|XP_002493154.1| Golgi GDP-mannose transporter [...   388   e-105   Komagataella phaffii GS115
gi|384484594|gb|EIE76774.1| hypothetical protein RO3G_01478 [Rhi...   386   e-105   Rhizopus delemar RA 99-880
gi|344304934|gb|EGW35166.1| GDP-mannose transporter into the lum...   380   e-103   Spathaspora passalidarum NRRL Y-27907
gi|326468871|gb|EGD92880.1| GDP-mannose transporter [Trichophyto...   380   e-103   Trichophyton tonsurans CBS 112818
gi|315049129|ref|XP_003173939.1| GDP-mannose transporter [Arthro...   380   e-103   Microsporum gypseum CBS 118893
gi|327301381|ref|XP_003235383.1| GDP-mannose transporter [Tricho...   379   e-103   Trichophyton rubrum CBS 118892
gi|302652448|ref|XP_003018074.1| hypothetical protein TRV_07910 ...   379   e-103   Trichophyton verrucosum HKI 0517
gi|302501987|ref|XP_003012985.1| hypothetical protein ARB_00868 ...   379   e-102   Arthroderma benhamiae CBS 112371
gi|393222054|gb|EJD07538.1| GDP-mannose transporter [Fomitiporia...   377   e-102   Fomitiporia mediterranea MF3/22
gi|255729500|ref|XP_002549675.1| GDP-mannose transporter [Candid...   376   e-102   Candida tropicalis MYA-3404
gi|126138426|ref|XP_001385736.1| GDP-mannose transporter into th...   375   e-101   Scheffersomyces stipitis CBS 6054
gi|119182733|ref|XP_001242483.1| hypothetical protein CIMG_06379...   374   e-101   
gi|303319387|ref|XP_003069693.1| GDP-mannose transporter, putati...   374   e-101   Coccidioides posadasii C735 delta SOWgp
gi|442570188|sp|Q1DTI4.2|GMT_COCIM RecName: Full=GDP-mannose tra...   374   e-101   Coccidioides immitis RS
gi|501751312|emb|CCG84418.1| protein of unknown function [Taphri...   373   e-101   Taphrina deformans PYCC 5710
gi|344304936|gb|EGW35168.1| GDP-mannose transporter into the lum...   373   e-101   Spathaspora passalidarum NRRL Y-27907
gi|169612213|ref|XP_001799524.1| hypothetical protein SNOG_09225...   372   e-101   Parastagonospora nodorum SN15
gi|392589849|gb|EIW79179.1| GDP-mannose transporter [Coniophora ...   372   e-101   Coniophora puteana RWD-64-598 SS2
gi|213401707|ref|XP_002171626.1| nucleotide sugar transporter [S...   371   e-100   Schizosaccharomyces japonicus yFS275
gi|19115591|ref|NP_594679.1| Golgi GDP-mannose transporter Vrg4 ...   371   e-100   Schizosaccharomyces pombe 972h-
gi|294659154|ref|XP_002770907.1| DEHA2F26532p [Debaryomyces hans...   371   e-100   Debaryomyces hansenii CBS767
gi|345560686|gb|EGX43811.1| hypothetical protein AOL_s00215g547 ...   370   e-100   Arthrobotrys oligospora ATCC 24927
gi|485920438|gb|EOD46460.1| putative golgi gdp-mannose transport...   369   e-100   Neofusicoccum parvum UCRNP2
gi|449547892|gb|EMD38859.1| hypothetical protein CERSUDRAFT_1125...   369   e-100   Gelatoporia subvermispora B
gi|83764960|dbj|BAE55104.1| unnamed protein product [Aspergillus...   369   e-100   Aspergillus oryzae RIB40
gi|238503434|ref|XP_002382950.1| Golgi GDP-mannose transporter [...   369   e-100   Aspergillus flavus NRRL3357
gi|494829213|gb|EON65904.1| GDP-mannose transporter [Coniosporiu...   369   e-100   Coniosporium apollinis CBS 100218
gi|409040882|gb|EKM50368.1| hypothetical protein PHACADRAFT_2003...   369   e-100   Phanerochaete carnosa HHB-10118-sp
gi|325091767|gb|EGC45077.1| golgi GDP-mannose transporter [Ajell...   369   1e-99   Histoplasma capsulatum H88
gi|261190871|ref|XP_002621844.1| GDP-mannose transporter [Ajello...   368   1e-99   Blastomyces gilchristii SLH14081
gi|70998672|ref|XP_754058.1| Golgi GDP-mannose transporter [Aspe...   368   1e-99   Aspergillus fumigatus Af293
gi|395331810|gb|EJF64190.1| UDP-galactose transporter, partial [...   368   2e-99   Dichomitus squalens LYAD-421 SS1
gi|295660563|ref|XP_002790838.1| GDP-mannose transporter [Paraco...   368   2e-99   Paracoccidioides lutzii Pb01
gi|225562232|gb|EEH10512.1| golgi GDP-mannose transporter [Ajell...   367   4e-99   Histoplasma capsulatum G186AR
gi|225685062|gb|EEH23346.1| golgi GDP-mannose transporter [Parac...   367   4e-99   Paracoccidioides brasiliensis Pb03
gi|226294373|gb|EEH49793.1| GDP-mannose transporter [Paracoccidi...   367   4e-99   Paracoccidioides brasiliensis Pb18
gi|336363835|gb|EGN92206.1| hypothetical protein SERLA73DRAFT_99...   366   5e-99   Serpula lacrymans var. lacrymans S7.3
gi|407916525|gb|EKG09893.1| UDP-galactose transporter [Macrophom...   366   6e-99   Macrophomina phaseolina MS6
gi|331243713|ref|XP_003334499.1| hypothetical protein PGTG_15928...   366   6e-99   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|241949311|ref|XP_002417378.1| Golgi apparatus GDP-mannose tra...   366   6e-99   Candida dubliniensis CD36
gi|121712594|ref|XP_001273908.1| Golgi GDP-mannose transporter [...   366   7e-99   Aspergillus clavatus NRRL 1
gi|385302445|gb|EIF46576.1| gdp-mannose transporter [Dekkera bru...   366   8e-99   Brettanomyces bruxellensis AWRI1499
gi|119498605|ref|XP_001266060.1| Golgi GDP-mannose transporter [...   365   1e-98   Aspergillus fischeri NRRL 181
gi|390596780|gb|EIN06181.1| UDP-galactose transporter [Punctular...   365   1e-98   Punctularia strigosozonata HHB-11173 SS5
gi|344228537|gb|EGV60423.1| UDP-galactose transporter [Candida t...   364   2e-98   Candida tenuis ATCC 10573
gi|68478756|ref|XP_716540.1| hypothetical protein CaO19.1232 [Ca...   364   2e-98   Candida albicans SC5314
gi|238878798|gb|EEQ42436.1| GDP-mannose transporter [Candida alb...   364   2e-98   Candida albicans WO-1
gi|392565536|gb|EIW58713.1| UDP-galactose transporter [Trametes ...   364   2e-98   Trametes versicolor FP-101664 SS1
gi|448084751|ref|XP_004195682.1| Piso0_005084 [Millerozyma farin...   363   6e-98   Millerozyma farinosa CBS 7064
gi|145253861|ref|XP_001398443.1| GDP-mannose transporter 1 [Aspe...   363   6e-98   Aspergillus niger CBS 513.88
gi|302685884|ref|XP_003032622.1| hypothetical protein SCHCODRAFT...   362   7e-98   Schizophyllum commune H4-8
gi|396495906|ref|XP_003844659.1| similar to golgi GDP-mannose tr...   362   9e-98   Leptosphaeria maculans JN3
gi|451854420|gb|EMD67713.1| hypothetical protein COCSADRAFT_1117...   362   1e-97   Bipolaris sorokiniana ND90Pr
gi|472587269|gb|EMS24768.1| GDP-mannose transporter [Rhodosporid...   362   1e-97   Rhodotorula toruloides NP11
gi|170105052|ref|XP_001883739.1| predicted protein [Laccaria bic...   362   1e-97   Laccaria bicolor S238N-H82
gi|358373314|dbj|GAA89913.1| golgi GDP-mannose transporter [Aspe...   362   1e-97   Aspergillus kawachii IFO 4308
gi|296417330|ref|XP_002838311.1| hypothetical protein [Tuber mel...   361   2e-97   Tuber melanosporum Mel28
gi|115438488|ref|XP_001218079.1| GDP-mannose transporter [Asperg...   361   2e-97   Aspergillus terreus NIH2624
gi|212536064|ref|XP_002148188.1| Golgi GDP-mannose transporter [...   361   2e-97   Talaromyces marneffei ATCC 18224
gi|448080268|ref|XP_004194583.1| Piso0_005084 [Millerozyma farin...   361   2e-97   Millerozyma farinosa CBS 7064
gi|482812641|gb|EOA89360.1| hypothetical protein SETTUDRAFT_1678...   360   3e-97   Setosphaeria turcica Et28A
gi|320581626|gb|EFW95846.1| GDP-mannose transporter [Ogataea par...   360   3e-97   
gi|449301339|gb|EMC97350.1| hypothetical protein BAUCODRAFT_4487...   360   3e-97   Baudoinia panamericana UAMH 10762
gi|189190012|ref|XP_001931345.1| GDP-mannose transporter [Pyreno...   360   3e-97   Pyrenophora tritici-repentis Pt-1C-BFP
gi|451999497|gb|EMD91959.1| hypothetical protein COCHEDRAFT_1223...   360   3e-97   Bipolaris maydis C5
gi|50556628|ref|XP_505722.1| YALI0F21791p [Yarrowia lipolytica] ...   360   4e-97   Yarrowia lipolytica CLIB122
gi|330944221|ref|XP_003306333.1| hypothetical protein PTT_19463 ...   359   6e-97   Pyrenophora teres f. teres 0-1
gi|321261227|ref|XP_003195333.1| GDP-mannose transporter [Crypto...   359   7e-97   Cryptococcus gattii WM276
gi|378730381|gb|EHY56840.1| GDP-mannose transporter [Exophiala d...   359   8e-97   Exophiala dermatitidis NIH/UT8656
gi|389739315|gb|EIM80509.1| UDP-galactose transporter [Stereum h...   359   8e-97   Stereum hirsutum FP-91666 SS1
gi|401881014|gb|EJT45320.1| nucleotide-sugar transporter [Tricho...   358   1e-96   Trichosporon asahii var. asahii CBS 2479
gi|296817385|ref|XP_002849029.1| GDP-mannose transporter [Arthro...   358   1e-96   Arthroderma otae CBS 113480
gi|459366145|gb|EMG45590.1| GDP-mannose transporter [Candida mal...   358   1e-96   Candida maltosa Xu316
gi|58269436|ref|XP_571874.1| GDP-mannose transporter [Cryptococc...   358   1e-96   Cryptococcus neoformans var. neoformans JEC21
gi|405121882|gb|AFR96650.1| GDP-mannose transporter [Cryptococcu...   358   2e-96   Cryptococcus neoformans var. grubii H99
gi|328860009|gb|EGG09116.1| hypothetical protein MELLADRAFT_1158...   358   2e-96   Melampsora larici-populina 98AG31
gi|67903722|ref|XP_682117.1| hypothetical protein AN8848.2 [Aspe...   357   4e-96   Aspergillus nidulans FGSC A4
gi|242794757|ref|XP_002482441.1| Golgi GDP-mannose transporter [...   357   4e-96   Talaromyces stipitatus ATCC 10500
gi|189041383|sp|Q5AS82.2|GMT1_EMENI RecName: Full=GDP-mannose tr...   357   4e-96   Aspergillus nidulans FGSC A4
gi|402223777|gb|EJU03841.1| UDP-galactose transporter [Dacryopin...   355   1e-95   Dacryopinax primogenitus
gi|258571405|ref|XP_002544506.1| nucleolar protein NOP2 [Uncinoc...   355   1e-95   Uncinocarpus reesii 1704
gi|393240472|gb|EJD47998.1| UDP-galactose transporter [Auricular...   355   2e-95   Auricularia subglabra TFB-10046 SS5
gi|321260246|ref|XP_003194843.1| golgi GDP-mannose transporter; ...   353   4e-95   Cryptococcus gattii WM276
gi|511000295|gb|EPB81845.1| hypothetical protein HMPREF1544_1142...   353   4e-95   Mucor circinelloides f. circinelloides 1006PhL
gi|354546452|emb|CCE43182.1| hypothetical protein CPAR2_208270 [...   353   4e-95   Candida parapsilosis
gi|260940210|ref|XP_002614405.1| hypothetical protein CLUG_05891...   353   4e-95   Clavispora lusitaniae ATCC 42720
gi|58268680|ref|XP_571496.1| nucleotide-sugar transporter [Crypt...   352   1e-94   Cryptococcus neoformans var. neoformans JEC21
gi|448511662|ref|XP_003866581.1| Vrg4 GDP-mannose transporter [C...   352   1e-94   Candida orthopsilosis Co 90-125
gi|388581799|gb|EIM22106.1| UDP-galactose transporter [Wallemia ...   351   2e-94   Wallemia mellicola CBS 633.66
gi|291510236|gb|ADE10074.1| DUF6 [Tremella fuciformis]                351   2e-94   Tremella fuciformis
gi|340515369|gb|EGR45624.1| predicted protein [Trichoderma reese...   350   3e-94   Trichoderma reesei QM6a
gi|146418890|ref|XP_001485410.1| hypothetical protein PGUG_03139...   349   6e-94   Meyerozyma guilliermondii ATCC 6260
gi|358387876|gb|EHK25470.1| hypothetical protein TRIVIDRAFT_7258...   349   7e-94   Trichoderma virens Gv29-8
gi|452982507|gb|EME82266.1| hypothetical protein MYCFIDRAFT_1974...   348   2e-93   Cercospora fijiensis CIRAD86
gi|255943747|ref|XP_002562641.1| Pc20g00790 [Penicillium chrysog...   347   2e-93   Penicillium rubens Wisconsin 54-1255
gi|405121367|gb|AFR96136.1| nucleotide-sugar transporter [Crypto...   347   3e-93   Cryptococcus neoformans var. grubii H99
gi|189041377|sp|A8N9T6.2|GMT_COPC7 RecName: Full=GDP-mannose tra...   347   3e-93   Coprinopsis cinerea okayama7#130
gi|452841152|gb|EME43089.1| hypothetical protein DOTSEDRAFT_1315...   345   1e-92   Dothistroma septosporum NZE10
gi|392575244|gb|EIW68378.1| hypothetical protein TREMEDRAFT_6933...   344   2e-92   Tremella mesenterica DSM 1558
gi|453083879|gb|EMF11924.1| Golgi GDP-mannose transporter [Mycos...   343   4e-92   Sphaerulina musiva SO2202
gi|398393832|ref|XP_003850375.1| hypothetical protein MYCGRDRAFT...   342   9e-92   Zymoseptoria tritici IPO323
gi|408400394|gb|EKJ79476.1| hypothetical protein FPSE_00407 [Fus...   341   2e-91   Fusarium pseudograminearum CS3096
gi|46111635|ref|XP_382875.1| hypothetical protein FG02699.1 [Fus...   340   3e-91   
gi|358058600|dbj|GAA95563.1| hypothetical protein E5Q_02218 [Mix...   340   3e-91   Mixia osmundae IAM 14324
gi|358390314|gb|EHK39720.1| hypothetical protein TRIATDRAFT_3030...   340   4e-91   Trichoderma atroviride IMI 206040
gi|342888195|gb|EGU87561.1| hypothetical protein FOXB_01943 [Fus...   339   8e-91   Fusarium oxysporum Fo5176
gi|477513770|gb|ENH66234.1| GDP-mannose transporter [Fusarium ox...   338   1e-90   Fusarium oxysporum f. sp. cubense race 1
gi|406604393|emb|CCH44158.1| GDP-mannose transporter 1 [Wickerha...   338   1e-90   Wickerhamomyces ciferrii
gi|471568413|gb|EMR68084.1| putative gdp-mannose transporter pro...   338   1e-90   Eutypa lata UCREL1
gi|320588105|gb|EFX00580.1| golgi GDP-mannose transporter [Grosm...   338   1e-90   Grosmannia clavigera kw1407
gi|392572678|gb|EIW65823.1| hypothetical protein TREMEDRAFT_4126...   338   2e-90   Tremella mesenterica DSM 1558
gi|384496172|gb|EIE86663.1| hypothetical protein RO3G_11374 [Rhi...   337   4e-90   Rhizopus delemar RA 99-880
gi|353239464|emb|CCA71375.1| probable Golgi GDP-mannose transpor...   336   7e-90   Serendipita indica DSM 11827
gi|367002099|ref|XP_003685784.1| hypothetical protein TPHA_0E025...   332   8e-89   Tetrapisispora phaffii CBS 4417
gi|322712359|gb|EFZ03932.1| GDP-mannose transporter [Metarhizium...   332   1e-88   Metarhizium robertsii ARSEF 23
gi|50302251|ref|XP_451059.1| hypothetical protein [Kluyveromyces...   332   1e-88   Kluyveromyces lactis NRRL Y-1140
gi|302891757|ref|XP_003044760.1| predicted protein [Nectria haem...   331   3e-88   Nectria haematococca mpVI 77-13-4
gi|471907854|emb|CCO28451.1| GDP-mannose transporter Short=GMT [...   329   6e-88   Rhizoctonia solani AG-1 IB
gi|406864956|gb|EKD17999.1| GDP-mannose transporter [Marssonina ...   328   1e-87   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|342884383|gb|EGU84599.1| hypothetical protein FOXB_04894 [Fus...   328   1e-87   Fusarium oxysporum Fo5176
gi|425766605|gb|EKV05209.1| GDP-mannose transporter 1 [Penicilli...   328   1e-87   Penicillium digitatum PHI26
gi|512191513|gb|EPE07274.1| gdp-mannose transporter [Ophiostoma ...   328   1e-87   Ophiostoma piceae UAMH 11346
gi|475673606|gb|EMT70717.1| GDP-mannose transporter [Fusarium ox...   328   1e-87   Fusarium oxysporum f. sp. cubense race 4
gi|302892837|ref|XP_003045300.1| hypothetical protein NECHADRAFT...   328   1e-87   Nectria haematococca mpVI 77-13-4
gi|384489790|gb|EIE81012.1| hypothetical protein RO3G_05717 [Rhi...   328   2e-87   Rhizopus delemar RA 99-880
gi|429848238|gb|ELA23746.1| gdp-mannose transporter [Colletotric...   328   2e-87   Colletotrichum gloeosporioides Nara gc5
gi|340959378|gb|EGS20559.1| putative GDP-mannose protein [Chaeto...   328   2e-87   Chaetomium thermophilum var. thermophilum DSM 1495
gi|310793211|gb|EFQ28672.1| UDP-galactose transporter [Glomerell...   328   2e-87   Colletotrichum graminicola M1.001
gi|367013802|ref|XP_003681401.1| hypothetical protein TDEL_0D060...   327   2e-87   Torulaspora delbrueckii
gi|322711936|gb|EFZ03509.1| GDP-mannose transporter [Metarhizium...   327   3e-87   Metarhizium robertsii ARSEF 23
gi|477533719|gb|ENH85297.1| gdp-mannose transporter [Colletotric...   327   3e-87   Colletotrichum orbiculare MAFF 240422
gi|477522584|gb|ENH74651.1| GDP-mannose transporter [Fusarium ox...   327   3e-87   Fusarium oxysporum f. sp. cubense race 1
gi|408388234|gb|EKJ67921.1| hypothetical protein FPSE_11930 [Fus...   326   5e-87   Fusarium pseudograminearum CS3096
gi|444319929|ref|XP_004180621.1| hypothetical protein TBLA_0E004...   326   6e-87   Tetrapisispora blattae CBS 6284
gi|322692876|gb|EFY84761.1| GDP-mannose transporter [Metarhizium...   326   7e-87   Metarhizium acridum CQMa 102
gi|365990579|ref|XP_003672119.1| hypothetical protein NDAI_0I030...   325   9e-87   Naumovozyma dairenensis CBS 421
gi|403413690|emb|CCM00390.1| predicted protein [Fibroporia radic...   325   1e-86   Fibroporia radiculosa
gi|156838743|ref|XP_001643071.1| hypothetical protein Kpol_423p1...   325   2e-86   Vanderwaltozyma polyspora DSM 70294
gi|401625844|gb|EJS43832.1| vrg4p [Saccharomyces arboricola H-6]      324   2e-86   Saccharomyces arboricola H-6
gi|500260084|gb|EOO02787.1| putative gdp-mannose transporter pro...   324   2e-86   Phaeoacremonium minimum UCRPA7
gi|336263390|ref|XP_003346475.1| hypothetical protein SMAC_05370...   323   3e-86   Sordaria macrospora k-hell
gi|363748074|ref|XP_003644255.1| hypothetical protein Ecym_1190 ...   323   6e-86   Eremothecium cymbalariae DBVPG#7215
gi|6321213|ref|NP_011290.1| Vrg4p [Saccharomyces cerevisiae S288...   323   6e-86   Saccharomyces cerevisiae S288c
gi|440638851|gb|ELR08770.1| hypothetical protein GMDG_03448 [Geo...   322   8e-86   Pseudogymnoascus destructans 20631-21
gi|299745257|ref|XP_001831592.2| nucleotide-sugar transporter [C...   322   1e-85   Coprinopsis cinerea okayama7#130
gi|302405992|ref|XP_003000832.1| GDP-mannose transporter [Vertic...   322   1e-85   Verticillium alfalfae VaMs.102
gi|346971346|gb|EGY14798.1| GDP-mannose transporter [Verticilliu...   321   2e-85   Verticillium dahliae VdLs.17
gi|189041379|sp|Q2HA88.2|GMT_CHAGB RecName: Full=GDP-mannose tra...   321   2e-85   Chaetomium globosum CBS 148.51
gi|366993417|ref|XP_003676473.1| hypothetical protein NCAS_0E004...   320   3e-85   Naumovozyma castellii CBS 4309
gi|410083789|ref|XP_003959472.1| hypothetical protein KAFR_0J027...   320   5e-85   Kazachstania africana CBS 2517
gi|401839091|gb|EJT42445.1| VRG4-like protein [Saccharomyces kud...   320   6e-85   Saccharomyces kudriavzevii IFO 1802
gi|389632457|ref|XP_003713881.1| GDP-mannose transporter [Magnap...   320   6e-85   Magnaporthe oryzae 70-15
gi|346325906|gb|EGX95502.1| GDP-mannose transporter [Cordyceps m...   319   7e-85   Cordyceps militaris CM01
gi|85109433|ref|XP_962914.1| GDP-mannose transporter [Neurospora...   319   9e-85   Neurospora crassa OR74A
gi|156064845|ref|XP_001598344.1| GDP-mannose transporter [Sclero...   318   2e-84   Sclerotinia sclerotiorum 1980 UF-70
gi|154322673|ref|XP_001560651.1| golgi GDP-mannose transporter [...   317   4e-84   Botrytis cinerea B05.10
gi|402086886|gb|EJT81784.1| GDP-mannose transporter [Gaeumannomy...   316   5e-84   Gaeumannomyces graminis var. tritici R3-111a-1
gi|500257163|gb|EOO00354.1| putative gdp-mannose transporter pro...   316   6e-84   Phaeoacremonium minimum UCRPA7
gi|367027284|ref|XP_003662926.1| hypothetical protein MYCTH_2304...   315   1e-83   Myceliophthora thermophila ATCC 42464
gi|399164798|emb|CCE34291.1| probable Golgi GDP-mannose transpor...   315   1e-83   Claviceps purpurea 20.1
gi|347837164|emb|CCD51736.1| similar to GDP-mannose transporter ...   313   7e-83   Botrytis cinerea T4
gi|349577697|dbj|GAA22865.1| K7_01966p [Saccharomyces cerevisiae...   311   2e-82   Saccharomyces cerevisiae Kyokai no. 7
gi|116207146|ref|XP_001229382.1| hypothetical protein CHGG_02866...   307   3e-81   Chaetomium globosum CBS 148.51
gi|323348972|gb|EGA83208.1| Hvg1p [Saccharomyces cerevisiae Lalv...   306   5e-81   Saccharomyces cerevisiae Lalvin QA23
gi|400599762|gb|EJP67453.1| GDP-mannose transporter [Beauveria b...   306   6e-81   Beauveria bassiana ARSEF 2860
gi|365766064|gb|EHN07565.1| Vrg4p [Saccharomyces cerevisiae x Sa...   306   7e-81   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gi|290463236|sp|C8Z742.1|GMT2_YEAS8 RecName: Full=Probable GDP-m...   306   7e-81   Saccharomyces cerevisiae EC1118
gi|400602080|gb|EJP69705.1| UDP-galactose transporter [Beauveria...   305   2e-80   Beauveria bassiana ARSEF 2860
gi|255717637|ref|XP_002555099.1| KLTH0G01342p [Lachancea thermot...   304   3e-80   Lachancea thermotolerans CBS 6340
gi|323309383|gb|EGA62600.1| Hvg1p [Saccharomyces cerevisiae Fost...   303   6e-80   Saccharomyces cerevisiae FostersO
gi|323305058|gb|EGA58811.1| Vrg4p [Saccharomyces cerevisiae Fost...   300   5e-79   Saccharomyces cerevisiae FostersB
gi|401838618|gb|EJT42141.1| hypothetical protein SKUD_122702 [Sa...   300   6e-79   Saccharomyces kudriavzevii IFO 1802
gi|322700180|gb|EFY91936.1| GDP-mannose transporter [Metarhizium...   299   8e-79   Metarhizium acridum CQMa 102
gi|346326199|gb|EGX95795.1| GDP-mannose transporter [Cordyceps m...   299   9e-79   Cordyceps militaris CM01
gi|302308751|ref|NP_985783.2| AFR236Cp [Ashbya gossypii ATCC 108...   298   2e-78   Eremothecium gossypii ATCC 10895
gi|119487698|ref|XP_001262580.1| hypothetical protein NFIA_03116...   297   3e-78   Aspergillus fischeri NRRL 181
gi|451993077|gb|EMD85552.1| hypothetical protein COCHEDRAFT_1118...   296   6e-78   Bipolaris maydis C5
gi|403213992|emb|CCK68493.1| hypothetical protein KNAG_0B00440 [...   296   6e-78   Kazachstania naganishii CBS 8797
gi|189041381|sp|Q5AQY2.2|GMT2_EMENI RecName: Full=GDP-mannose tr...   296   9e-78   Aspergillus nidulans FGSC A4
gi|512205257|gb|EPE34079.1| Multidrug resistance efflux transpor...   295   1e-77   Glarea lozoyensis ATCC 20868
gi|451846228|gb|EMD59538.1| hypothetical protein COCSADRAFT_7250...   295   1e-77   Bipolaris sorokiniana ND90Pr
gi|477582891|gb|ENH99994.1| hypothetical protein COCC4DRAFT_1113...   295   1e-77   Bipolaris maydis ATCC 48331
gi|240277314|gb|EER40823.1| golgi GDP-mannose transporter [Ajell...   295   2e-77   Histoplasma capsulatum H143
gi|149247926|ref|XP_001528350.1| GDP-mannose transporter [Lodder...   295   2e-77   Lodderomyces elongisporus NRRL YB-4239
gi|471570065|gb|EMR69288.1| putative gdp-mannose transporter pro...   294   3e-77   Eutypa lata UCREL1
gi|482814538|gb|EOA91213.1| hypothetical protein SETTUDRAFT_1326...   294   3e-77   Setosphaeria turcica Et28A
gi|156848294|ref|XP_001647029.1| hypothetical protein Kpol_1050p...   294   3e-77   Vanderwaltozyma polyspora DSM 70294
gi|14010202|gb|AAK51897.1|AF360395_1 GDP-mannose transporter [Ca...   293   5e-77   [Candida] glabrata
gi|315054153|ref|XP_003176451.1| GDP-mannose transporter [Arthro...   293   7e-77   Microsporum gypseum CBS 118893
gi|50289535|ref|XP_447199.1| hypothetical protein [Candida glabr...   291   3e-76   Candida glabrata CBS 138
gi|327308646|ref|XP_003239014.1| GDP-mannose transporter [Tricho...   290   4e-76   Trichophyton rubrum CBS 118892
gi|365984104|ref|XP_003668885.1| hypothetical protein NDAI_0B061...   289   9e-76   Naumovozyma dairenensis CBS 421
gi|326477831|gb|EGE01841.1| GDP-mannose transporter [Trichophyto...   288   2e-75   Trichophyton equinum CBS 127.97
gi|513033402|gb|AGO13374.1| AaceriAFR236Cp [Saccharomycetaceae s...   287   4e-75   Saccharomycetaceae sp. 'Ashbya aceri'
gi|365761037|gb|EHN02713.1| Vrg4p [Saccharomyces cerevisiae x Sa...   286   6e-75   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gi|326474841|gb|EGD98850.1| GDP-mannose transporter [Trichophyto...   285   1e-74   Trichophyton tonsurans CBS 112818
gi|366994912|ref|XP_003677220.1| hypothetical protein NCAS_0F038...   281   2e-73   Naumovozyma castellii CBS 4309
gi|171685696|ref|XP_001907789.1| hypothetical protein [Podospora...   277   3e-72   Podospora anserina S mat+
gi|328770349|gb|EGF80391.1| hypothetical protein BATDEDRAFT_1957...   271   2e-70   Batrachochytrium dendrobatidis JAM81
gi|367050542|ref|XP_003655650.1| hypothetical protein THITE_2119...   263   8e-68   Thielavia terrestris NRRL 8126
gi|67904622|ref|XP_682567.1| hypothetical protein AN9298.2 [Aspe...   258   3e-66   Aspergillus nidulans FGSC A4
gi|46111433|ref|XP_382774.1| hypothetical protein FG02598.1 [Fus...   255   2e-65   
gi|380473296|emb|CCF46359.1| GDP-mannose transporter [Colletotri...   254   2e-65   Colletotrichum higginsianum
gi|429858012|gb|ELA32848.1| gdp-mannose transporter [Colletotric...   251   3e-64   Colletotrichum gloeosporioides Nara gc5
gi|154284155|ref|XP_001542873.1| predicted protein [Ajellomyces ...   248   2e-63   Histoplasma capsulatum NAm1
gi|323333923|gb|EGA75312.1| Hvg1p [Saccharomyces cerevisiae AWRI...   242   2e-61   Saccharomyces cerevisiae AWRI796
gi|470318961|gb|EMR10602.1| hypothetical protein PNEG_01306 [Pne...   237   4e-60   Pneumocystis murina B123
gi|6320877|ref|NP_010956.1| Hvg1p [Saccharomyces cerevisiae S288...   235   1e-59   Saccharomyces cerevisiae S288c
gi|302497451|ref|XP_003010726.1| hypothetical protein ARB_03428 ...   233   5e-59   Arthroderma benhamiae CBS 112371
gi|443924622|gb|ELU43618.1| GDP-mannose transporter [Rhizoctonia...   230   6e-58   Rhizoctonia solani AG-1 IA
gi|401626088|gb|EJS44053.1| hvg1p [Saccharomyces arboricola H-6]      218   2e-54   Saccharomyces arboricola H-6
gi|443895389|dbj|GAC72735.1| nucleotide-sugar transporter VRG4/S...   213   6e-53   Moesziomyces antarcticus T-34
gi|470318962|gb|EMR10603.1| hypothetical protein, variant [Pneum...   208   2e-51   
gi|380485001|emb|CCF39638.1| UDP-galactose transporter [Colletot...   208   2e-51   Colletotrichum higginsianum
gi|501308296|dbj|GAC97209.1| GDP-mannose transporter [Pseudozyma...   208   2e-51   Pseudozyma hubeiensis SY62
gi|388851616|emb|CCF54806.1| probable VRG4-Golgi GDP-mannose tra...   207   3e-51   Ustilago hordei
gi|71005086|ref|XP_757209.1| hypothetical protein UM01062.1 [Ust...   207   4e-51   
gi|343426886|emb|CBQ70414.1| probable VRG4-Golgi GDP-mannose tra...   203   7e-50   Sporisorium reilianum SRZ2
gi|167523407|ref|XP_001746040.1| hypothetical protein [Monosiga ...   202   1e-49   Monosiga brevicollis MX1
gi|164663177|ref|XP_001732710.1| hypothetical protein MGL_0485 [...   201   2e-49   Malassezia globosa CBS 7966
gi|209570354|emb|CAQ16243.1| hypothetical protein [Glomerella gr...   201   3e-49   Colletotrichum graminicola
gi|505758704|gb|EOR02805.1| GDP-mannose transporter [Wallemia ic...   199   1e-48   Wallemia ichthyophaga EXF-994
gi|361129783|gb|EHL01665.1| putative GDP-mannose transporter [Gl...   198   2e-48   Glarea lozoyensis 74030
gi|302661930|ref|XP_003022626.1| hypothetical protein TRV_03283 ...   192   2e-46   Trichophyton verrucosum HKI 0517
gi|380487443|emb|CCF38035.1| GDP-mannose transporter [Colletotri...   189   1e-45   Colletotrichum higginsianum
gi|365765737|gb|EHN07243.1| Vrg4p [Saccharomyces cerevisiae x Sa...   187   4e-45   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gi|323337741|gb|EGA78985.1| Vrg4p [Saccharomyces cerevisiae Vin13]    187   6e-45   Saccharomyces cerevisiae Vin13
gi|254583163|ref|XP_002499313.1| ZYRO0E08888p [Zygosaccharomyces...   184   4e-44   Zygosaccharomyces rouxii CBS 732
gi|238578657|ref|XP_002388791.1| hypothetical protein MPER_12148...   179   1e-42   
gi|326431646|gb|EGD77216.1| hypothetical protein PTSG_08308 [Sal...   179   1e-42   Salpingoeca rosetta
gi|380476963|emb|CCF44414.1| GDP-mannose transporter, partial [C...   178   2e-42   Colletotrichum higginsianum
gi|402468553|gb|EJW03697.1| hypothetical protein EDEG_00185 [Edh...   168   2e-39   Edhazardia aedis USNM 41457
gi|323309197|gb|EGA62422.1| Vrg4p [Saccharomyces cerevisiae Fost...   166   1e-38   Saccharomyces cerevisiae FostersO
gi|430812320|emb|CCJ30260.1| unnamed protein product [Pneumocyst...   164   5e-38   Pneumocystis jirovecii
gi|299117408|emb|CBN73911.1| conserved unknown protein [Ectocarp...   162   2e-37   Ectocarpus siliculosus
gi|357114889|ref|XP_003559226.1| PREDICTED: GDP-mannose transpor...   159   9e-37   Brachypodium distachyon [annual false brome]
gi|301100880|ref|XP_002899529.1| GDP-mannose transporter, putati...   159   2e-36   Phytophthora infestans T30-4
gi|449330303|gb|AGE96561.1| membrane protein [Encephalitozoon cu...   157   5e-36   Encephalitozoon cuniculi
gi|384551571|dbj|BAM11305.1| unnamed protein product [Oryza sati...   157   5e-36   Oryza sativa Japonica Group [Japonica rice]
gi|19172975|ref|NP_597526.1| GOLGI MEMBRANE PROTEIN [Encephalito...   155   1e-35   Encephalitozoon cuniculi GB-M1
gi|357464677|ref|XP_003602620.1| GDP-mannose transporter [Medica...   155   1e-35   Medicago truncatula
gi|475583174|gb|EMT19388.1| hypothetical protein F775_20322 [Aeg...   155   2e-35   Aegilops tauschii
gi|473879420|gb|EMS47956.1| hypothetical protein TRIUR3_24467 [T...   153   9e-35   Triticum urartu
gi|238569369|ref|XP_002386641.1| hypothetical protein MPER_15036...   152   1e-34   
gi|366998725|ref|XP_003684099.1| hypothetical protein TPHA_0A059...   152   2e-34   Tetrapisispora phaffii CBS 4417
gi|449518507|ref|XP_004166283.1| PREDICTED: LOW QUALITY PROTEIN:...   152   2e-34   
gi|502137377|ref|XP_004503064.1| PREDICTED: GDP-mannose transpor...   152   2e-34   
gi|392299730|gb|EIW10822.1| Vrg4p [Saccharomyces cerevisiae CEN....   152   2e-34   Saccharomyces cerevisiae CEN.PK113-7D
gi|401825577|ref|XP_003886883.1| nucleotide sugar transporter [E...   152   2e-34   Encephalitozoon hellem ATCC 50504
gi|462402377|gb|EMJ07934.1| hypothetical protein PRUPE_ppa024735...   151   2e-34   Prunus persica
gi|508700654|gb|EOX92550.1| Golgi nucleotide sugar transporter 1...   151   3e-34   Theobroma cacao [chocolate]
gi|224080961|ref|XP_002306245.1| predicted protein [Populus tric...   150   5e-34   
gi|326516288|dbj|BAJ92299.1| predicted protein [Hordeum vulgare ...   150   5e-34   Hordeum vulgare subsp. vulgare [barley]
gi|449459266|ref|XP_004147367.1| PREDICTED: GDP-mannose transpor...   150   5e-34   
gi|296088545|emb|CBI37536.3| unnamed protein product [Vitis vini...   150   7e-34   Vitis vinifera
gi|303388553|ref|XP_003072510.1| nucleotide-sugar transporter [E...   150   8e-34   Encephalitozoon intestinalis ATCC 50506
gi|449513327|ref|XP_004164296.1| PREDICTED: GDP-mannose transpor...   149   1e-33   
gi|384253114|gb|EIE26589.1| GDP-mannose transporter, golgi appar...   148   3e-33   Coccomyxa subellipsoidea C-169
gi|224106291|ref|XP_002314115.1| predicted protein [Populus tric...   146   9e-33   
gi|298713766|emb|CBJ33733.1| GDP-mannose transporter [Ectocarpus...   145   1e-32   Ectocarpus siliculosus
gi|240254028|ref|NP_172209.4| GDP-mannose transporter [Arabidops...   145   2e-32   Arabidopsis thaliana [mouse-ear cress]
gi|356569556|ref|XP_003552965.1| PREDICTED: GDP-mannose transpor...   145   2e-32   
gi|356507466|ref|XP_003522487.1| PREDICTED: GDP-mannose transpor...   145   3e-32   
gi|357115399|ref|XP_003559476.1| PREDICTED: GDP-mannose transpor...   145   3e-32   
gi|224093398|ref|XP_002309911.1| predicted protein [Populus tric...   144   3e-32   
gi|462395769|gb|EMJ01568.1| hypothetical protein PRUPE_ppa008285...   144   3e-32   Prunus persica
gi|502129255|ref|XP_004500240.1| PREDICTED: GDP-mannose transpor...   144   3e-32   
gi|482573825|gb|EOA38012.1| hypothetical protein CARUB_v10009481...   144   3e-32   Capsella rubella
gi|470119281|ref|XP_004295743.1| PREDICTED: GDP-mannose transpor...   144   4e-32   
gi|108711849|gb|ABF99644.1| GONST2 Golgi Nucleotide sugar transp...   143   7e-32   Oryza sativa Japonica Group [Japonica rice]
gi|15042812|gb|AAK82435.1|AC091247_2 putative lipophosphoglycan ...   143   7e-32   Oryza sativa Japonica Group [Japonica rice]
gi|212722412|ref|NP_001131586.1| hypothetical protein [Zea mays]...   142   1e-31   Zea mays [maize]
gi|297836010|ref|XP_002885887.1| GONST1 [Arabidopsis lyrata subs...   142   2e-31   Arabidopsis lyrata subsp. lyrata
gi|397567941|gb|EJK45870.1| hypothetical protein THAOC_35494, pa...   141   3e-31   Thalassiosira oceanica
gi|396081005|gb|AFN82624.1| nucleotide-sugar transporter [Enceph...   141   3e-31   Encephalitozoon romaleae SJ-2008
gi|218200355|gb|EEC82782.1| hypothetical protein OsI_27528 [Oryz...   141   3e-31   Oryza sativa Indica Group [Indian rice]
gi|15487237|emb|CAC69066.1| GDP-Mannose transporter [Arabidopsis...   141   4e-31   Arabidopsis thaliana [mouse-ear cress]
gi|18397301|ref|NP_565357.1| GDP-mannose transporter [Arabidopsi...   140   4e-31   Arabidopsis thaliana [mouse-ear cress]
gi|482566827|gb|EOA31016.1| hypothetical protein CARUB_v10014164...   140   4e-31   
gi|307103835|gb|EFN52092.1| hypothetical protein CHLNCDRAFT_3270...   140   6e-31   
gi|508786512|gb|EOY33768.1| Golgi nucleotide sugar transporter 2...   140   7e-31   
gi|226494181|ref|NP_001146151.1| uncharacterized protein LOC1002...   140   8e-31   
gi|414873726|tpg|DAA52283.1| TPA: putative DUF250 domain family ...   140   8e-31   
gi|218194021|gb|EEC76448.1| hypothetical protein OsI_14146 [Oryz...   139   1e-30   
gi|222626090|gb|EEE60222.1| hypothetical protein OsJ_13195 [Oryz...   139   1e-30   
gi|460392931|ref|XP_004242065.1| PREDICTED: GDP-mannose transpor...   139   2e-30   
gi|348677902|gb|EGZ17719.1| hypothetical protein PHYSODRAFT_5602...   137   3e-30   
gi|302785279|ref|XP_002974411.1| hypothetical protein SELMODRAFT...   137   4e-30   
gi|302808031|ref|XP_002985710.1| hypothetical protein SELMODRAFT...   137   6e-30   
gi|302839446|ref|XP_002951280.1| hypothetical protein VOLCADRAFT...   137   6e-30   
gi|297745928|emb|CBI15984.3| unnamed protein product [Vitis vini...   136   8e-30   
gi|359478564|ref|XP_002279549.2| PREDICTED: GDP-mannose transpor...   136   9e-30   
gi|460410997|ref|XP_004250901.1| PREDICTED: GDP-mannose transpor...   136   1e-29   
gi|460365231|ref|XP_004228507.1| PREDICTED: GDP-mannose transpor...   135   2e-29   
gi|470103368|ref|XP_004288111.1| PREDICTED: GDP-mannose transpor...   135   2e-29   
gi|302849432|ref|XP_002956246.1| hypothetical protein VOLCADRAFT...   135   3e-29   
gi|413921529|gb|AFW61461.1| hypothetical protein ZEAMMB73_893206...   134   4e-29   
gi|429963180|gb|ELA42724.1| hypothetical protein VICG_00039 [Vit...   132   1e-28   
gi|159465443|ref|XP_001690932.1| GDP-Mannose transporter, golgi ...   132   2e-28   
gi|465793792|emb|CCU98769.1| unnamed protein product [Malassezia...   132   2e-28   
gi|159465441|ref|XP_001690931.1| GDP-Mannose transporter, golgi ...   131   2e-28   
gi|242032419|ref|XP_002463604.1| hypothetical protein SORBIDRAFT...   130   5e-28   
gi|325194144|emb|CCA28187.1| GDPmannose transporter putative [Al...   127   4e-27   
gi|223998108|ref|XP_002288727.1| predicted protein [Thalassiosir...   127   7e-27   
gi|157876111|ref|XP_001686416.1| lipophosphoglycan biosynthetic ...   125   1e-26   
gi|219109917|ref|XP_002176711.1| predicted protein [Phaeodactylu...   125   2e-26   
gi|168023262|ref|XP_001764157.1| predicted protein [Physcomitrel...   125   2e-26   
gi|342180561|emb|CCC90037.1| putative lipophosphoglycan biosynth...   125   2e-26   
gi|302834387|ref|XP_002948756.1| hypothetical protein VOLCADRAFT...   124   4e-26   
gi|9998817|emb|CAC07406.1| LPG2 protein [Leishmania mexicana]         124   4e-26   
gi|392299728|gb|EIW10820.1| Hvg1p [Saccharomyces cerevisiae CEN....   124   5e-26   
gi|146099491|ref|XP_001468657.1| lipophosphoglycan biosynthetic ...   124   6e-26   
gi|398022854|ref|XP_003864589.1| unnamed protein product [Leishm...   123   9e-26   
gi|401428771|ref|XP_003878868.1| lipophosphoglycan biosynthetic ...   123   9e-26   
gi|347837451|emb|CCD52023.1| hypothetical protein BofuT4_P081820...   122   2e-25   
gi|407404415|gb|EKF29878.1| GDP-mannose transporter, putative [T...   122   2e-25   
gi|71657564|ref|XP_817296.1| lipophosphoglycan biosynthetic prot...   122   2e-25   
gi|1041825|gb|AAC46914.1| LPG2 [Leishmania donovani] >gi|1583457...   122   2e-25   
gi|397607270|gb|EJK59623.1| hypothetical protein THAOC_20121 [Th...   122   2e-25   
gi|407850985|gb|EKG05127.1| GDP-mannose transporter, putative [T...   121   3e-25   
gi|340053179|emb|CCC47467.1| putative lipophosphoglycan biosynth...   117   4e-24   
gi|452819959|gb|EME27008.1| nucleotide-sugar transporter, DMT fa...   116   1e-23   
gi|72387780|ref|XP_844314.1| lipophosphoglycan biosynthetic prot...   115   2e-23   
gi|255569289|ref|XP_002525612.1| GDP-mannose transporter, putati...   115   2e-23   
gi|449467359|ref|XP_004151391.1| PREDICTED: GDP-mannose transpor...   115   3e-23   
gi|154336631|ref|XP_001564551.1| lipophosphoglycan biosynthetic ...   114   4e-23   
gi|387593213|gb|EIJ88237.1| hypothetical protein NEQG_01681 [Nem...   111   3e-22   
gi|115474401|ref|NP_001060797.1| Os08g0107400 [Oryza sativa Japo...   108   3e-21   
gi|378755771|gb|EHY65797.1| hypothetical protein NERG_01404 [Nem...   107   5e-21   
gi|484857717|gb|EOB15450.1| GDP-mannose transporter [Nosema bomb...   104   4e-20   
gi|159483261|ref|XP_001699679.1| hypothetical protein CHLREDRAFT...   103   1e-19   
gi|300708818|ref|XP_002996581.1| hypothetical protein NCER_10030...   102   1e-19   
gi|147842396|emb|CAN76204.1| hypothetical protein VITISV_020305 ...   102   2e-19   
gi|307109207|gb|EFN57445.1| hypothetical protein CHLNCDRAFT_2083...   101   3e-19   
gi|30678967|ref|NP_849952.1| GDP-mannose transporter [Arabidopsi...    99   2e-18   
gi|255563681|ref|XP_002522842.1| GDP-mannose transporter, putati...    97   8e-18   
gi|62132939|gb|AAH92185.1| Slc35d1a protein [Danio rerio]              96   1e-17   
gi|356518767|ref|XP_003528049.1| PREDICTED: GDP-mannose transpor...    96   2e-17   
gi|242077901|ref|XP_002443719.1| hypothetical protein SORBIDRAFT...    95   3e-17   
gi|51468006|ref|NP_001003877.1| solute carrier family 35 (UDP-gl...    95   3e-17   
gi|359477017|ref|XP_002274276.2| PREDICTED: GDP-mannose transpor...    95   3e-17   
gi|432914301|ref|XP_004079048.1| PREDICTED: UDP-N-acetylglucosam...    92   3e-16   
gi|440492173|gb|ELQ74764.1| GDP-Mannose:GMP Antiporter (GMA) Fam...    89   2e-15   
gi|508786513|gb|EOY33769.1| Golgi nucleotide sugar transporter 2...    89   2e-15   
gi|198429407|ref|XP_002127350.1| PREDICTED: UDP-N-acetylglucosam...    89   2e-15   
gi|429963985|gb|ELA45983.1| hypothetical protein VCUG_02516 [Vav...    87   6e-15   
gi|41054129|ref|NP_956769.1| solute carrier family 35 (UDP-glucu...    87   7e-15   
gi|340368825|ref|XP_003382951.1| PREDICTED: UDP-N-acetylglucosam...    87   9e-15   
gi|348504492|ref|XP_003439795.1| PREDICTED: UDP-N-acetylglucosam...    86   1e-14   
gi|410922892|ref|XP_003974916.1| PREDICTED: UDP-N-acetylglucosam...    86   1e-14   
gi|470466360|ref|XP_004341709.1| DMT family transporter: UDPgluc...    86   2e-14   
gi|393911726|gb|EFO27257.2| hypothetical protein LOAG_01225 [Loa...    86   2e-14   
gi|313226529|emb|CBY21675.1| unnamed protein product [Oikopleura...    86   2e-14   
gi|229366448|gb|ACQ58204.1| UDP-N-acetylglucosamine/UDP-glucose/...    86   2e-14   
gi|313221499|emb|CBY32247.1| unnamed protein product [Oikopleura...    84   5e-14   
gi|348517221|ref|XP_003446133.1| PREDICTED: UDP-N-acetylglucosam...    84   6e-14   
gi|499010513|ref|XP_004557242.1| PREDICTED: UDP-N-acetylglucosam...    84   7e-14   
gi|498969633|ref|XP_004547205.1| PREDICTED: UDP-N-acetylglucosam...    83   1e-13   
gi|507556051|ref|XP_004661791.1| PREDICTED: UDP-N-acetylglucosam...    83   2e-13   
gi|499032985|ref|XP_004567185.1| PREDICTED: UDP-N-acetylglucosam...    82   3e-13   
gi|122144575|sp|Q15B89.1|S35D2_PIG RecName: Full=UDP-N-acetylglu...    81   5e-13   
gi|363736687|ref|XP_422532.3| PREDICTED: UDP-N-acetylglucosamine...    81   5e-13   
gi|507545224|ref|XP_004656578.1| PREDICTED: UDP-N-acetylglucosam...    81   6e-13   
gi|321459201|gb|EFX70257.1| hypothetical protein DAPPUDRAFT_6152...    81   6e-13   
gi|449513860|ref|XP_002191483.2| PREDICTED: UDP-N-acetylglucosam...    80   7e-13   
gi|307104125|gb|EFN52380.1| hypothetical protein CHLNCDRAFT_1388...    80   7e-13   
gi|440906051|gb|ELR56358.1| UDP-N-acetylglucosamine/UDP-glucose/...    80   8e-13   
gi|60360040|dbj|BAD90239.1| mKIAA0260 protein [Mus musculus]           80   8e-13   
gi|126722865|ref|NP_001075928.1| UDP-N-acetylglucosamine/UDP-glu...    80   8e-13   
gi|209364596|ref|NP_001125094.1| UDP-N-acetylglucosamine/UDP-glu...    80   8e-13   
gi|296208196|ref|XP_002750979.1| PREDICTED: UDP-N-acetylglucosam...    80   9e-13   
gi|74146757|dbj|BAE41358.1| unnamed protein product [Mus musculus]     80   1e-12   
gi|332232128|ref|XP_003265254.1| PREDICTED: UDP-N-acetylglucosam...    80   1e-12   
gi|355745357|gb|EHH49982.1| hypothetical protein EGM_00733, part...    80   1e-12   
gi|384475706|ref|NP_001244999.1| solute carrier family 35 (UDP-g...    80   1e-12   
gi|512958494|ref|XP_004841549.1| PREDICTED: UDP-N-acetylglucosam...    80   1e-12   
gi|26340190|dbj|BAC33758.1| unnamed protein product [Mus musculus]     80   1e-12   
gi|1665787|dbj|BAA13390.1| KIAA0260 [Homo sapiens]                     80   1e-12   
gi|355558088|gb|EHH14868.1| hypothetical protein EGK_00860 [Maca...    80   1e-12   
gi|504153622|ref|XP_004588808.1| PREDICTED: UDP-N-acetylglucosam...    80   1e-12   
gi|14028875|ref|NP_055954.1| UDP-glucuronic acid/UDP-N-acetylgal...    80   1e-12   
gi|426329931|ref|XP_004025984.1| PREDICTED: UDP-glucuronic acid/...    79   2e-12   
gi|291242213|ref|XP_002741002.1| PREDICTED: solute carrier famil...    79   2e-12   
gi|466063256|ref|XP_004280813.1| PREDICTED: UDP-N-acetylglucosam...    79   2e-12   
gi|344279032|ref|XP_003411295.1| PREDICTED: UDP-N-acetylglucosam...    79   2e-12   
gi|488597136|ref|XP_004483737.1| PREDICTED: UDP-N-acetylglucosam...    79   2e-12   
gi|403257828|ref|XP_003921494.1| PREDICTED: UDP-N-acetylglucosam...    79   2e-12   
gi|66818795|ref|XP_643057.1| hypothetical protein DDB_G0276625 [...    79   2e-12   
gi|256065038|ref|XP_002570446.1| solute carrier family 35 member...    79   2e-12   
gi|405977579|gb|EKC42022.1| UDP-sugar transporter UST74c [Crasso...    79   3e-12   
gi|472385121|ref|XP_004411926.1| PREDICTED: UDP-N-acetylglucosam...    78   3e-12   
gi|157817576|ref|NP_001100138.1| solute carrier family 35, membe...    78   3e-12   
gi|226489961|emb|CAX75131.1| UDP-glucuronic acid/UDP-N-acetylgal...    78   3e-12   
gi|473869641|gb|EMS47706.1| hypothetical protein TRIUR3_10661 [T...    78   3e-12   
gi|260813444|ref|XP_002601428.1| hypothetical protein BRAFLDRAFT...    78   4e-12   
gi|507936252|ref|XP_004679150.1| PREDICTED: UDP-N-acetylglucosam...    78   4e-12   
gi|301773150|ref|XP_002921993.1| PREDICTED: UDP-N-acetylglucosam...    77   6e-12   
gi|471356996|ref|XP_004369091.1| PREDICTED: UDP-N-acetylglucosam...    77   6e-12   
gi|511886472|ref|XP_004763024.1| PREDICTED: UDP-N-acetylglucosam...    77   6e-12   
gi|410921058|ref|XP_003974000.1| PREDICTED: UDP-N-acetylglucosam...    77   6e-12   
gi|395821938|ref|XP_003784286.1| PREDICTED: UDP-N-acetylglucosam...    77   8e-12   
gi|431896975|gb|ELK06239.1| UDP-N-acetylglucosamine/UDP-glucose/...    77   8e-12   
gi|475610763|gb|EMT27845.1| hypothetical protein F775_08993 [Aeg...    77   9e-12   
gi|470269768|ref|XP_004362571.1| hypothetical protein DFA_02964 ...    77   9e-12   
gi|156553106|ref|XP_001599500.1| PREDICTED: UDP-sugar transporte...    77   9e-12   
gi|17535737|ref|NP_495436.1| Protein SQV-7 [Caenorhabditis elega...    77   1e-11   
gi|268530686|ref|XP_002630469.1| C. briggsae CBR-SQV-7 protein [...    77   1e-11   
gi|345800382|ref|XP_003434691.1| PREDICTED: UDP-N-acetylglucosam...    76   1e-11   
gi|170582760|ref|XP_001896274.1| UDP-sugar transporter-like prot...    76   1e-11   
gi|328721175|ref|XP_001946251.2| PREDICTED: UDP-sugar transporte...    76   2e-11   
gi|428170047|gb|EKX38975.1| hypothetical protein GUITHDRAFT_1437...    76   2e-11   
gi|512933685|ref|XP_004932852.1| PREDICTED: UDP-sugar transporte...    75   2e-11   
gi|308502836|ref|XP_003113602.1| CRE-SQV-7 protein [Caenorhabdit...    75   3e-11   
gi|226489963|emb|CAX75132.1| UDP-glucuronic acid/UDP-N-acetylgal...    75   4e-11   
gi|313234157|emb|CBY10226.1| unnamed protein product [Oikopleura...    75   4e-11   
gi|53236929|gb|AAH83039.1| LOC494867 protein, partial [Xenopus l...    75   4e-11   
gi|297849022|ref|XP_002892392.1| nucleotide-sugar transporter fa...    75   4e-11   
gi|313221430|emb|CBY32181.1| unnamed protein product [Oikopleura...    74   5e-11   
gi|443721889|gb|ELU11014.1| hypothetical protein CAPTEDRAFT_1205...    74   6e-11   
gi|410924784|ref|XP_003975861.1| PREDICTED: UDP-glucuronic acid/...    74   6e-11   
gi|327284163|ref|XP_003226808.1| PREDICTED: UDP-N-acetylglucosam...    74   1e-10   


>gi|511007002|gb|EPB88304.1| hypothetical protein HMPREF1544_04888 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 375

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 201/337 (59%), Positives = 250/337 (74%), Gaps = 8/337 (2%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDL 76
           LPI +YC ASILMTVTNKYVLSGYDFNMNFLLL IQ++V V+LL++FK LNL+ FR+FD 
Sbjct: 42  LPIASYCFASILMTVTNKYVLSGYDFNMNFLLLTIQNLVTVLLLQSFKFLNLIKFRDFDK 101

Query: 77  ALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTM 136
             +RKW PIA  LVAMIYTGSK+LQ+L IP+YTIFKNLTIILIAYGEV+WF  S++ L +
Sbjct: 102 DEARKWMPIAASLVAMIYTGSKALQFLRIPIYTIFKNLTIILIAYGEVLWFGGSVTHLML 161

Query: 137 TSFLLMVFXXXXXX-XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRIRSTN 195
            SF LMV                      T   GY WMA NC++SAAFVL MR+RI+ TN
Sbjct: 162 VSFGLMVLSSVIAGWADISDTLTQIAELDTTLAGYFWMATNCLASAAFVLYMRKRIKLTN 221

Query: 196 FKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFGIS 255
           FKDFDTVYYNNLLSIPLL+  S + EDWS ++  KN P D+R  ++ A++FSG SAF +S
Sbjct: 222 FKDFDTVYYNNLLSIPLLIIPSFIFEDWSAESLTKNFPADVRQAMLIAMVFSGASAFAMS 281

Query: 256 YTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSIAK 315
           Y SAWCVR TSSTTYSMVGALNKLP+AASG++FFGDP T GNV+AI VGF+AG++YS+AK
Sbjct: 282 YASAWCVRTTSSTTYSMVGALNKLPIAASGIMFFGDPATFGNVTAIIVGFIAGLVYSVAK 341

Query: 316 TEQQKPIKPSVYIPISNKE-LPQTTTNDNNTTEIQSN 351
           T   K          +NK+ +P ++++ +N   ++ +
Sbjct: 342 TVANKSTSN------NNKDIIPMSSSSQSNADAVKDH 372



>gi|254572089|ref|XP_002493154.1| Golgi GDP-mannose transporter [Komagataella pastoris GS115]
 gi|121775237|sp|Q2AAF6.1|GMT_PICPA RecName: Full=GDP-mannose transporter; Short=GMT
 gi|89241880|dbj|BAE80635.1| Vig4 [Komagataella pastoris]
 gi|238032952|emb|CAY70975.1| Golgi GDP-mannose transporter [Komagataella pastoris GS115]
 gi|328352830|emb|CCA39228.1| GDP-mannose transporter [Komagataella pastoris CBS 7435]
          Length = 329

 Score =  388 bits (997), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 188/310 (60%), Positives = 234/310 (75%), Gaps = 3/310 (0%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS 70
           L+ +  L I +YCAASILMTVTNKY +SG DFN NF LL +Q IVC+ L+ + K LN+++
Sbjct: 12  LTNSAPLSIFSYCAASILMTVTNKYAVSGVDFNFNFFLLAVQGIVCITLISSLKQLNVIT 71

Query: 71  FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCS 130
           FREF+   ++KWFPIA+LLV MIYT SK+LQYLSIP+YTIFKNLTIILIAYGEVIWF   
Sbjct: 72  FREFNKVEAKKWFPIAVLLVVMIYTSSKALQYLSIPIYTIFKNLTIILIAYGEVIWFGGR 131

Query: 131 ISRLTMTSFLLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRR 190
           ++ L + SF+LMV                      F+IGY WM  NC SSAAFVL MR+R
Sbjct: 132 VTNLALGSFVLMVLSSAVASYGDSNVDTGKL---NFNIGYFWMFTNCFSSAAFVLFMRKR 188

Query: 191 IRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGIS 250
           I+ TNFKDFDT+YYNNLLSIP+L+  SL  EDWS KN  +N PED +  +I +++ SG+S
Sbjct: 189 IKLTNFKDFDTMYYNNLLSIPILLFASLTTEDWSAKNIAQNFPEDTKYAVIASMIISGMS 248

Query: 251 AFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGIL 310
           A GISYTSAWCVRVTSSTTYSMVGALNKLP+A SG++FF  PI   ++S+IF+GF AG++
Sbjct: 249 AVGISYTSAWCVRVTSSTTYSMVGALNKLPIALSGLLFFKAPINFYSISSIFIGFAAGLV 308

Query: 311 YSIAKTEQQK 320
           Y+IAK +Q+K
Sbjct: 309 YAIAKQKQKK 318



>gi|384484594|gb|EIE76774.1| hypothetical protein RO3G_01478 [Rhizopus delemar RA 99-880]
          Length = 1385

 Score =  386 bits (991), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 200/350 (57%), Positives = 251/350 (71%), Gaps = 8/350 (2%)

Query: 12  SATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSF 71
           +A   LPI +YC ASILMTVTNKYVLSGYDFNMNFLLL IQ++V V LL  FK LNL+ F
Sbjct: 36  AARAILPIASYCFASILMTVTNKYVLSGYDFNMNFLLLTIQNLVTVFLLVIFKFLNLIKF 95

Query: 72  REFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSI 131
           R+FD   +RKW P+A  LV MIYTGSK+LQ+L IP+YTIFKNLTIILIAYGEV+WF  ++
Sbjct: 96  RDFDNDEARKWLPVAGSLVGMIYTGSKALQFLRIPIYTIFKNLTIILIAYGEVLWFGGNV 155

Query: 132 SRLTMTSFLLMVFXXXXXXXXXXXXXXXXXXXXTFDI-GYLWMAFNCISSAAFVLTMRRR 190
           +RL + SF LMVF                       I GY WMA NCI+SAAFVL MR+R
Sbjct: 156 TRLMLVSFGLMVFSSVIAGWADINDTLTEIVQLDTTIAGYFWMATNCITSAAFVLYMRKR 215

Query: 191 IRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGIS 250
           I+ TNFKDFDTV+YNN++SIPLL+  S + EDWS +N   N P D+R  ++ A++FSG S
Sbjct: 216 IKLTNFKDFDTVFYNNIISIPLLIIPSFIFEDWSAENLSNNFPSDVRQQVVMAMIFSGAS 275

Query: 251 AFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGIL 310
           AF +SY SAWCVR TSSTTYSMVGALNKLP+AASG++FFGDP T GN++AI VGF+AGI+
Sbjct: 276 AFAMSYASAWCVRTTSSTTYSMVGALNKLPIAASGILFFGDPATFGNITAIIVGFIAGIV 335

Query: 311 YSIAKTEQQKPIKPSVYIPISNKELPQTTTNDNNTTEIQSNLLNNDDDHR 360
           YS++KT   KP +       SNK++   +++  +  +  +N+    +  R
Sbjct: 336 YSLSKTVYNKPSQ-------SNKDIIPMSSSSQSNADAYTNMKKKKERLR 378



>gi|344304934|gb|EGW35166.1| GDP-mannose transporter into the lumen of the Golgi [Spathaspora
           passalidarum NRRL Y-27907]
          Length = 334

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 185/319 (57%), Positives = 240/319 (75%), Gaps = 1/319 (0%)

Query: 3   QPPTILAF-LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLR 61
           QP   LA  +S +G + IL YC +SILMTVTNKYVLSG+ FN+NF LL +QSIVC+V + 
Sbjct: 8   QPGQSLASSISNSGPISILAYCLSSILMTVTNKYVLSGFSFNLNFFLLAVQSIVCIVTIG 67

Query: 62  AFKMLNLVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAY 121
           + K + ++++R+F+   ++KW PIA LLVAMIYTGSK++QYLSIPVYTIFKNLTIILIAY
Sbjct: 68  SLKSVGIITYRQFNKDEAKKWSPIAFLLVAMIYTGSKAIQYLSIPVYTIFKNLTIILIAY 127

Query: 122 GEVIWFDCSISRLTMTSFLLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSA 181
           GEV+WF   ++ + ++SFLLMVF                    T  +GY WM  NC +SA
Sbjct: 128 GEVLWFGGKVTSMALSSFLLMVFSSMIAYYGDNAAVRSQDDEFTLYLGYFWMLVNCFASA 187

Query: 182 AFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLI 241
           +FVL MR+RI+ TNFKDFDT+YYNNLL+IP+L+  SL+ EDWS +N   N P D R T I
Sbjct: 188 SFVLIMRKRIKLTNFKDFDTMYYNNLLAIPILLISSLVFEDWSSENIAVNFPSDNRVTTI 247

Query: 242 TAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAI 301
           +A++ SG+S+ GISY SAWCVRVTSSTTYSMVGALNKLP+A +G+IFF   +   +VS+I
Sbjct: 248 SAMILSGVSSVGISYCSAWCVRVTSSTTYSMVGALNKLPIALTGLIFFDAVVNFWSVSSI 307

Query: 302 FVGFVAGILYSIAKTEQQK 320
           FVGF+AG++Y+IAK +QQ+
Sbjct: 308 FVGFIAGLVYAIAKQKQQR 326



>gi|326468871|gb|EGD92880.1| GDP-mannose transporter [Trichophyton tonsurans CBS 112818]
 gi|326480149|gb|EGE04159.1| golgi GDP-mannose transporter [Trichophyton equinum CBS 127.97]
          Length = 381

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 187/322 (58%), Positives = 239/322 (74%), Gaps = 5/322 (1%)

Query: 15  GTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREF 74
            TL I++YCA+SILMTVTNKYVLSG DFN+NF LL IQSI+C++ +++ K L  +++R+F
Sbjct: 45  ATLAIISYCASSILMTVTNKYVLSGVDFNLNFFLLCIQSIICIIAVQSCKTLGFINYRDF 104

Query: 75  DLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRL 134
               ++KWFPI++LL+ MIYTGSK+L++LSIPVYTIFKNLTIILIAYGEV+WF  S+S L
Sbjct: 105 SSDEAKKWFPISLLLIGMIYTGSKALKFLSIPVYTIFKNLTIILIAYGEVLWFGGSVSGL 164

Query: 135 TMTSFLLMVFXXXXXX----XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRR 190
           T+ SF LMV                         T + GYLWM  NC  +A++VL MR+R
Sbjct: 165 TLFSFGLMVLSSVVAAWADITHAVSTSAGAGAVSTLNSGYLWMLINCACTASYVLGMRKR 224

Query: 191 IRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGIS 250
           I+ TNFKDFDT++YNNLLSIP+LM  SL+VEDWS  N  KN P D R  L  A+LFSG+S
Sbjct: 225 IKLTNFKDFDTMFYNNLLSIPILMVSSLLVEDWSSANVAKNFPVDTRNRLYVAMLFSGLS 284

Query: 251 AFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGIL 310
              ISY SAWCVRVT+STTYSMVGALNKLP+A SG++FFGDP+T  +VSAI +GF++GI+
Sbjct: 285 TVFISYASAWCVRVTTSTTYSMVGALNKLPIALSGLMFFGDPVTFPSVSAIAIGFISGIV 344

Query: 311 YSIAKTEQQKPIKPSVYIPISN 332
           Y++AK +Q    K  + +P SN
Sbjct: 345 YALAKIKQNAKPKTGI-LPTSN 365



>gi|315049129|ref|XP_003173939.1| GDP-mannose transporter [Arthroderma gypseum CBS 118893]
 gi|311341906|gb|EFR01109.1| GDP-mannose transporter [Arthroderma gypseum CBS 118893]
          Length = 381

 Score =  380 bits (976), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 187/322 (58%), Positives = 240/322 (74%), Gaps = 5/322 (1%)

Query: 15  GTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREF 74
            TL I++YCA+SILMTVTNKYVLSG DFN+NF LL +QSI+C++ +++ K L  +++R+F
Sbjct: 45  ATLAIISYCASSILMTVTNKYVLSGVDFNLNFFLLCVQSIICIIAVQSCKTLGFINYRDF 104

Query: 75  DLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRL 134
           +   ++KWFPI++LL+ MIYTGSK+L++LSIPVYTIFKNLTIILIAYGEV+WF  S+S L
Sbjct: 105 NADEAKKWFPISLLLIGMIYTGSKALKFLSIPVYTIFKNLTIILIAYGEVLWFGGSVSGL 164

Query: 135 TMTSFLLMVFXXXXXX----XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRR 190
           T+ SF LMV                         T + GYLWM  NC  +A++VL MR+R
Sbjct: 165 TLFSFGLMVLSSVVAAWADITHAVGTSAGVGAVSTLNSGYLWMLVNCACTASYVLGMRKR 224

Query: 191 IRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGIS 250
           I+ TNFKDFDT++YNNLLSIP+LM  SL+VEDWS  N  KN P D R  L  A+LFSG+S
Sbjct: 225 IKLTNFKDFDTMFYNNLLSIPILMVSSLLVEDWSATNVAKNFPVDTRNRLYLAMLFSGLS 284

Query: 251 AFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGIL 310
              ISY SAWCVRVT+STTYSMVGALNKLP+A SG++FFGDP+T  +VSAI +GFV+GI+
Sbjct: 285 TVFISYASAWCVRVTTSTTYSMVGALNKLPIALSGLMFFGDPVTFPSVSAITIGFVSGIV 344

Query: 311 YSIAKTEQQKPIKPSVYIPISN 332
           Y++AK +Q    K  + +P SN
Sbjct: 345 YALAKIKQNAKPKTGI-LPTSN 365



>gi|327301381|ref|XP_003235383.1| GDP-mannose transporter [Trichophyton rubrum CBS 118892]
 gi|326462735|gb|EGD88188.1| GDP-mannose transporter [Trichophyton rubrum CBS 118892]
          Length = 381

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 187/321 (58%), Positives = 239/321 (74%), Gaps = 5/321 (1%)

Query: 16  TLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFD 75
           TL I++YCA+SILMTVTNKYVLSG DFN+NF LL IQSI+C++ +++ K L  +++R+F 
Sbjct: 46  TLAIISYCASSILMTVTNKYVLSGVDFNLNFFLLCIQSIICIIAVQSCKTLGFINYRDFS 105

Query: 76  LALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLT 135
              ++KWFPI++LL+ MIYTGSK+L++LSIPVYTIFKNLTIILIAYGEV+WF  S+S LT
Sbjct: 106 SDEAKKWFPISLLLIGMIYTGSKALKFLSIPVYTIFKNLTIILIAYGEVLWFGGSVSGLT 165

Query: 136 MTSFLLMVFXXXXXX----XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRI 191
           + SF LMV                         T + GYLWM  NC  +A++VL MR+RI
Sbjct: 166 LFSFGLMVLSSVVAAWADITHAVSTSAGAGAVSTLNSGYLWMLINCACTASYVLGMRKRI 225

Query: 192 RSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISA 251
           + TNFKDFDT++YNNLLSIP+LM  SL+VEDWS  N  KN P D R  L  A+LFSG+S 
Sbjct: 226 KLTNFKDFDTMFYNNLLSIPILMVSSLLVEDWSSANVAKNFPVDTRNRLYVAMLFSGLST 285

Query: 252 FGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILY 311
             ISY SAWCVRVT+STTYSMVGALNKLP+A SG++FFGDP+T  +VSAI +GF++GI+Y
Sbjct: 286 VFISYASAWCVRVTTSTTYSMVGALNKLPIALSGLMFFGDPVTFPSVSAIAIGFISGIVY 345

Query: 312 SIAKTEQQKPIKPSVYIPISN 332
           ++AK +Q    K  + +P SN
Sbjct: 346 ALAKIKQNAKPKTGI-LPTSN 365



>gi|302652448|ref|XP_003018074.1| hypothetical protein TRV_07910 [Trichophyton verrucosum HKI 0517]
 gi|291181679|gb|EFE37429.1| hypothetical protein TRV_07910 [Trichophyton verrucosum HKI 0517]
          Length = 380

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 187/321 (58%), Positives = 239/321 (74%), Gaps = 5/321 (1%)

Query: 16  TLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFD 75
           TL I++YCA+SILMTVTNKYVLSG DFN+NF LL IQSI+C++ +++ K L  +++R+F 
Sbjct: 45  TLAIISYCASSILMTVTNKYVLSGVDFNLNFFLLCIQSIICIIAVQSCKTLGFINYRDFS 104

Query: 76  LALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLT 135
              ++KWFPI++LL+ MIYTGSK+L++LSIPVYTIFKNLTIILIAYGEV+WF  S+S LT
Sbjct: 105 SDEAKKWFPISLLLIGMIYTGSKALKFLSIPVYTIFKNLTIILIAYGEVLWFGGSVSGLT 164

Query: 136 MTSFLLMVFXXXXXX----XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRI 191
           + SF LMV                         T + GYLWM  NC  +A++VL MR+RI
Sbjct: 165 LFSFGLMVLSSVVAAWADITHAVSTSADTGAVSTLNSGYLWMLINCACTASYVLGMRKRI 224

Query: 192 RSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISA 251
           + TNFKDFDT++YNNLLSIP+LM  SL+VEDWS  N  KN P D R  L  A+LFSG+S 
Sbjct: 225 KLTNFKDFDTMFYNNLLSIPILMVSSLLVEDWSSANVAKNFPVDTRNRLYVAMLFSGLST 284

Query: 252 FGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILY 311
             ISY SAWCVRVT+STTYSMVGALNKLP+A SG++FFGDP+T  +VSAI +GF++GI+Y
Sbjct: 285 VFISYASAWCVRVTTSTTYSMVGALNKLPIALSGLMFFGDPVTFPSVSAIAIGFISGIVY 344

Query: 312 SIAKTEQQKPIKPSVYIPISN 332
           ++AK +Q    K  + +P SN
Sbjct: 345 ALAKIKQNAKPKTGI-LPTSN 364



>gi|302501987|ref|XP_003012985.1| hypothetical protein ARB_00868 [Arthroderma benhamiae CBS 112371]
 gi|291176546|gb|EFE32345.1| hypothetical protein ARB_00868 [Arthroderma benhamiae CBS 112371]
          Length = 380

 Score =  379 bits (972), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 187/321 (58%), Positives = 239/321 (74%), Gaps = 5/321 (1%)

Query: 16  TLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFD 75
           TL I++YCA+SILMTVTNKYVLSG DFN+NF LL IQSI+C++ +++ K L  +++R+F 
Sbjct: 45  TLAIISYCASSILMTVTNKYVLSGVDFNLNFFLLCIQSIICIIAVQSCKTLGFINYRDFS 104

Query: 76  LALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLT 135
              ++KWFPI++LL+ MIYTGSK+L++LSIPVYTIFKNLTIILIAYGEV+WF  S+S LT
Sbjct: 105 SDEAKKWFPISLLLIGMIYTGSKALKFLSIPVYTIFKNLTIILIAYGEVLWFGGSVSGLT 164

Query: 136 MTSFLLMVFXXXXXX----XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRI 191
           + SF LMV                         T + GYLWM  NC  +A++VL MR+RI
Sbjct: 165 LFSFGLMVLSSVVAAWADITHAVSTSAGTGAVSTLNSGYLWMLINCACTASYVLGMRKRI 224

Query: 192 RSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISA 251
           + TNFKDFDT++YNNLLSIP+LM  SL+VEDWS  N  KN P D R  L  A+LFSG+S 
Sbjct: 225 KLTNFKDFDTMFYNNLLSIPILMVSSLLVEDWSSANVAKNFPVDTRNRLYVAMLFSGLST 284

Query: 252 FGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILY 311
             ISY SAWCVRVT+STTYSMVGALNKLP+A SG++FFGDP+T  +VSAI +GF++GI+Y
Sbjct: 285 VFISYASAWCVRVTTSTTYSMVGALNKLPIALSGLMFFGDPVTFPSVSAIAIGFISGIVY 344

Query: 312 SIAKTEQQKPIKPSVYIPISN 332
           ++AK +Q    K  + +P SN
Sbjct: 345 ALAKIKQNAKPKTGI-LPTSN 364



>gi|393222054|gb|EJD07538.1| GDP-mannose transporter [Fomitiporia mediterranea MF3/22]
          Length = 389

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 184/326 (56%), Positives = 237/326 (72%), Gaps = 18/326 (5%)

Query: 13  ATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFR 72
           +T  LPI++YC ASILMTV NK+V+SG DF+MNFLLL IQS VCV  +   K   ++SFR
Sbjct: 45  STAVLPIVSYCCASILMTVVNKFVVSGRDFSMNFLLLTIQSTVCVACVMVVKKAGIISFR 104

Query: 73  EFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSIS 132
           +FD+  ++KW PI++LLV++IYTGSKS+QYLSIPVYTIFKNLTIILIAYGEVIWF   ++
Sbjct: 105 DFDMEDAKKWSPISLLLVSVIYTGSKSIQYLSIPVYTIFKNLTIILIAYGEVIWFGGRVT 164

Query: 133 RLTMTSFLLMV------------------FXXXXXXXXXXXXXXXXXXXXTFDIGYLWMA 174
            LT  SF++MV                  +                      +IGY WM 
Sbjct: 165 GLTFLSFIIMVISSIIAAWSDIANALDTTWSSQDPAAAIGGLHAVQSALTKLNIGYFWMF 224

Query: 175 FNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPE 234
           FNCI+SAAFVL+MR+RI+  NF D++T++YNNLLSIP+L+  S +VEDWS +N  K+ P 
Sbjct: 225 FNCITSAAFVLSMRKRIKVMNFGDWETMFYNNLLSIPVLIVFSFLVEDWSSENLTKSFPP 284

Query: 235 DIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPIT 294
           + RT L+ AI FSG +A GIS+T+AWC+R TSSTTYSMVGALNKLPVAASGM+FFGD +T
Sbjct: 285 ETRTFLLFAIAFSGAAAVGISFTTAWCIRATSSTTYSMVGALNKLPVAASGMLFFGDLVT 344

Query: 295 TGNVSAIFVGFVAGILYSIAKTEQQK 320
            G+VSA+ VGF+AG++Y++AK  Q+K
Sbjct: 345 LGSVSAVLVGFLAGVVYAVAKNNQKK 370



>gi|255729500|ref|XP_002549675.1| GDP-mannose transporter [Candida tropicalis MYA-3404]
 gi|240132744|gb|EER32301.1| GDP-mannose transporter [Candida tropicalis MYA-3404]
          Length = 361

 Score =  376 bits (965), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 183/312 (58%), Positives = 228/312 (73%)

Query: 15  GTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREF 74
           G + I  YC +SILMTVTNKYVLSG+ FN+NF LL +QSIVC+V + + K   ++++R+F
Sbjct: 46  GPISIFAYCLSSILMTVTNKYVLSGFSFNLNFFLLAVQSIVCIVTIGSLKSFGVITYRQF 105

Query: 75  DLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRL 134
           +   ++KW PIA LLVAMIYT SK+LQYLSIPVYTIFKNLTIILIAYGEVIWF   ++ +
Sbjct: 106 NKDEAKKWSPIAFLLVAMIYTSSKALQYLSIPVYTIFKNLTIILIAYGEVIWFGGQVTAM 165

Query: 135 TMTSFLLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRIRST 194
            ++SFLLMVF                       +GY WM  NC +SA+FVL MR+RI+ T
Sbjct: 166 ALSSFLLMVFSSVIAYYGDNAAAKSSDDTLAMYLGYFWMFTNCFASASFVLIMRKRIKLT 225

Query: 195 NFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFGI 254
           NFKDFDT+YYNNLLSIP+L+  S + EDWS  N   N P D R T ITA++ SG S+ GI
Sbjct: 226 NFKDFDTMYYNNLLSIPILLVCSFVFEDWSAANVALNFPADNRVTTITAMILSGASSVGI 285

Query: 255 SYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSIA 314
           SY SAWCVRVTSSTTYSMVGALNKLP+A SG+IFF   +   +VS+IFVGFVAG++Y++A
Sbjct: 286 SYCSAWCVRVTSSTTYSMVGALNKLPIALSGLIFFNAAVNFWSVSSIFVGFVAGLVYAVA 345

Query: 315 KTEQQKPIKPSV 326
           K +QQK   P +
Sbjct: 346 KQKQQKQSAPQL 357



>gi|126138426|ref|XP_001385736.1| GDP-mannose transporter into the lumen of the Golgi
           [Scheffersomyces stipitis CBS 6054]
 gi|189041722|sp|A3LWX1.1|GMT_PICST RecName: Full=GDP-mannose transporter; Short=GMT
 gi|126093014|gb|ABN67707.1| GDP-mannose transporter into the lumen of the Golgi
           [Scheffersomyces stipitis CBS 6054]
          Length = 327

 Score =  375 bits (963), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 183/314 (58%), Positives = 233/314 (74%), Gaps = 1/314 (0%)

Query: 8   LAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLN 67
           LA ++ +G + I +YC +SILMTVTNKYVLSG+ FNMNFLLL +QSIVC+V + + K   
Sbjct: 5   LAAIANSGPISIFSYCVSSILMTVTNKYVLSGFSFNMNFLLLAVQSIVCIVTIGSLKSFG 64

Query: 68  LVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWF 127
           ++++R+F+   +RKW PIA+LLV MIYT SK+LQYLSIPVYTIFKNLTIILIAYGEV+WF
Sbjct: 65  VITYRQFNKEEARKWSPIAVLLVIMIYTSSKALQYLSIPVYTIFKNLTIILIAYGEVLWF 124

Query: 128 DCSISRLTMTSFLLMVFXXXXX-XXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLT 186
              ++ + ++SFLLMVF                        +GY WMA NC +SAAFVL 
Sbjct: 125 GGKVTTMALSSFLLMVFSSVVAWYGDEAVSGSGNESFIALYLGYFWMATNCFASAAFVLI 184

Query: 187 MRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILF 246
           MR+RI+ TNFKDFDT+YYNNLLSIP+L+  S++ EDWS +N   N P D RT  I A++ 
Sbjct: 185 MRKRIKLTNFKDFDTMYYNNLLSIPILLASSIIFEDWSAENLAVNFPSDNRTATIAAMVL 244

Query: 247 SGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFV 306
           SG S+ GISY SAWCVRVTSSTTYSMVGALNKLP+A SG++FF   +   +V++IFVGF 
Sbjct: 245 SGASSVGISYCSAWCVRVTSSTTYSMVGALNKLPIALSGLVFFPAAVNFWSVASIFVGFA 304

Query: 307 AGILYSIAKTEQQK 320
           AG++Y++AK  QQK
Sbjct: 305 AGLVYAVAKQRQQK 318



>gi|119182733|ref|XP_001242483.1| hypothetical protein CIMG_06379 [Coccidioides immitis RS]
          Length = 408

 Score =  374 bits (961), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 190/365 (52%), Positives = 257/365 (70%), Gaps = 18/365 (4%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDL 76
           LPIL+YCA+SILMTVTNKYVLSG  FN+NF LL +QS+VC++ ++  K + L+++R+F+ 
Sbjct: 49  LPILSYCASSILMTVTNKYVLSGVQFNLNFFLLCVQSVVCIIAIQTCKSMGLINYRDFNS 108

Query: 77  ALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTM 136
             ++KWFPI++LL+ MIYTG+K+L++LSIPVYTIFKNLTIILIAYGEV+WF  S++ + +
Sbjct: 109 DEAKKWFPISLLLIGMIYTGTKALKFLSIPVYTIFKNLTIILIAYGEVLWFGGSVTGMAL 168

Query: 137 TSFLLMVFXXXXXX---------XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTM 187
            SF LMV                              T + GY+WM  NC+ ++ ++L M
Sbjct: 169 FSFGLMVLSSVIAAWADIKHALDTSGFSGAEATSKISTLNAGYIWMLINCLCTSTYILGM 228

Query: 188 RRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFS 247
           R+RI+ TNFKDFDT++YNNLLSIP+LM  S +VEDWS +N  KN P + R +LI A++FS
Sbjct: 229 RKRIKLTNFKDFDTMFYNNLLSIPILMIGSFIVEDWSSENINKNFPIETRNSLIFAMIFS 288

Query: 248 GISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVA 307
           G+S+  ISYTSAWCVRVTSSTTYSMVGALNKLP+A SG+IFFGDP+T  +VSAI VGF++
Sbjct: 289 GLSSVFISYTSAWCVRVTSSTTYSMVGALNKLPIALSGLIFFGDPVTVPSVSAIVVGFIS 348

Query: 308 GILYSIAKTEQQKPIKPSVYIPISNKELPQTTTNDNNTTEIQSNLLNNDDDHRVIKIEDN 367
           GI+YS+AK +Q    +  V +P +N   P T     N   +++   N D D+   KI+ +
Sbjct: 349 GIVYSLAKVKQNAKPRTGV-LPTTN---PATAGPAPN---VRTFFFNRDIDY--FKIDSH 399

Query: 368 NLSEK 372
               K
Sbjct: 400 FSGHK 404



>gi|303319387|ref|XP_003069693.1| GDP-mannose transporter, putative [Coccidioides posadasii C735
           delta SOWgp]
 gi|240109379|gb|EER27548.1| GDP-mannose transporter, putative [Coccidioides posadasii C735
           delta SOWgp]
 gi|320040864|gb|EFW22797.1| GDP-mannose transporter [Coccidioides posadasii str. Silveira]
          Length = 387

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 181/325 (55%), Positives = 242/325 (74%), Gaps = 10/325 (3%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDL 76
           LPIL+YCA+SILMTVTNKYVLSG  FN+NF LL +QS+VC++ ++  K + L+++R+F+ 
Sbjct: 49  LPILSYCASSILMTVTNKYVLSGVQFNLNFFLLCVQSVVCIIAIQTCKSMGLINYRDFNS 108

Query: 77  ALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTM 136
             ++KWFPI++LL+ MIYTG+K+L++LSIPVYTIFKNLTIILIAYGEV+WF  S++ + +
Sbjct: 109 DEAKKWFPISLLLIGMIYTGTKALKFLSIPVYTIFKNLTIILIAYGEVLWFGGSVTGMAL 168

Query: 137 TSFLLMVFXXXXXX---------XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTM 187
            SF LMV                              T + GY+WM  NC+ ++ ++L M
Sbjct: 169 FSFGLMVLSSVIAAWADIKHALDTSGFSGAEATSKISTLNAGYIWMLINCLCTSTYILGM 228

Query: 188 RRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFS 247
           R+RI+ TNFKDFDT++YNNLLSIP+LM  S +VEDWS +N  KN P + R +LI A++FS
Sbjct: 229 RKRIKLTNFKDFDTMFYNNLLSIPILMIGSFIVEDWSSENINKNFPIETRNSLIFAMIFS 288

Query: 248 GISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVA 307
           G+S+  ISYTSAWCVRVTSSTTYSMVGALNKLP+A SG+IFFGDP+T  +VSAI VGF++
Sbjct: 289 GLSSVFISYTSAWCVRVTSSTTYSMVGALNKLPIALSGLIFFGDPVTVPSVSAIVVGFIS 348

Query: 308 GILYSIAKTEQQKPIKPSVYIPISN 332
           GI+YS+AK +Q    +  V +P +N
Sbjct: 349 GIVYSLAKVKQNAKPRTGV-LPTTN 372



>gi|442570188|sp|Q1DTI4.2|GMT_COCIM RecName: Full=GDP-mannose transporter; Short=GMT
 gi|392865381|gb|EAS31162.2| GDP-mannose transporter [Coccidioides immitis RS]
          Length = 387

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 181/325 (55%), Positives = 242/325 (74%), Gaps = 10/325 (3%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDL 76
           LPIL+YCA+SILMTVTNKYVLSG  FN+NF LL +QS+VC++ ++  K + L+++R+F+ 
Sbjct: 49  LPILSYCASSILMTVTNKYVLSGVQFNLNFFLLCVQSVVCIIAIQTCKSMGLINYRDFNS 108

Query: 77  ALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTM 136
             ++KWFPI++LL+ MIYTG+K+L++LSIPVYTIFKNLTIILIAYGEV+WF  S++ + +
Sbjct: 109 DEAKKWFPISLLLIGMIYTGTKALKFLSIPVYTIFKNLTIILIAYGEVLWFGGSVTGMAL 168

Query: 137 TSFLLMVFXXXXXX---------XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTM 187
            SF LMV                              T + GY+WM  NC+ ++ ++L M
Sbjct: 169 FSFGLMVLSSVIAAWADIKHALDTSGFSGAEATSKISTLNAGYIWMLINCLCTSTYILGM 228

Query: 188 RRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFS 247
           R+RI+ TNFKDFDT++YNNLLSIP+LM  S +VEDWS +N  KN P + R +LI A++FS
Sbjct: 229 RKRIKLTNFKDFDTMFYNNLLSIPILMIGSFIVEDWSSENINKNFPIETRNSLIFAMIFS 288

Query: 248 GISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVA 307
           G+S+  ISYTSAWCVRVTSSTTYSMVGALNKLP+A SG+IFFGDP+T  +VSAI VGF++
Sbjct: 289 GLSSVFISYTSAWCVRVTSSTTYSMVGALNKLPIALSGLIFFGDPVTVPSVSAIVVGFIS 348

Query: 308 GILYSIAKTEQQKPIKPSVYIPISN 332
           GI+YS+AK +Q    +  V +P +N
Sbjct: 349 GIVYSLAKVKQNAKPRTGV-LPTTN 372



>gi|501751312|emb|CCG84418.1| protein of unknown function [Taphrina deformans PYCC 5710]
          Length = 388

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 180/322 (55%), Positives = 235/322 (72%), Gaps = 13/322 (4%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDL 76
           LP+L+YC ASI MT +NKYVLSG+ FN+NF LL +QS+VC++ +   K   ++++R+F+ 
Sbjct: 45  LPVLSYCLASISMTASNKYVLSGFQFNLNFFLLMVQSVVCILAIAICKQFKVITYRDFNA 104

Query: 77  ALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTM 136
             ++KWFPI+ LLV MIYTGSK+LQ+LSIPVYTIFKNLTII+IAYGEVIWF  +++ LT+
Sbjct: 105 DEAKKWFPISFLLVLMIYTGSKALQFLSIPVYTIFKNLTIIVIAYGEVIWFGGTVTPLTL 164

Query: 137 TSFLLMVFXXXXXX-------------XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAF 183
            SF LMV                                  T + GYLWMA NC++SAA+
Sbjct: 165 GSFGLMVVSSVVAAWSDISRVVANYGSTASSVGTEASAQLATLNSGYLWMAINCLASAAY 224

Query: 184 VLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITA 243
           VL MR+RI+ TNFKDFDT++YNNLLSIP+L   SL++EDWS  N E+N P   R T+  +
Sbjct: 225 VLGMRKRIKLTNFKDFDTMFYNNLLSIPILFVCSLLLEDWSSANIERNFPPANRNTVAFS 284

Query: 244 ILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFV 303
           ++FSG++  GISYTSAWCVR TSSTTYSMVGALNKLP+A SG++FFGDP+T  +V+AI +
Sbjct: 285 MVFSGLTTVGISYTSAWCVRTTSSTTYSMVGALNKLPIALSGLVFFGDPVTFFSVTAIAL 344

Query: 304 GFVAGILYSIAKTEQQKPIKPS 325
           GFVAGI+Y++AK +Q K   PS
Sbjct: 345 GFVAGIVYAVAKMQQNKAKSPS 366



>gi|344304936|gb|EGW35168.1| GDP-mannose transporter into the lumen of the Golgi [Spathaspora
           passalidarum NRRL Y-27907]
          Length = 335

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 180/310 (58%), Positives = 230/310 (74%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS 70
           +S +G + IL YC +SILMTVTNKYVLSG+ FN+NF LL +Q  VC+V +   K+  +++
Sbjct: 15  ISNSGPISILAYCLSSILMTVTNKYVLSGFSFNLNFFLLAVQCFVCIVTIGTLKVSGIIT 74

Query: 71  FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCS 130
           +R F+L  +RKW PIA+LLVAMIYTGSK++QYLSIPVYTIFKNLTIILIAYGEV+WF   
Sbjct: 75  YRNFNLDEARKWSPIAVLLVAMIYTGSKAIQYLSIPVYTIFKNLTIILIAYGEVLWFGGK 134

Query: 131 ISRLTMTSFLLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRR 190
           ++ + ++SFLLMVF                    T   GY+WM  NC +SA+FVL MR+R
Sbjct: 135 VTAMALSSFLLMVFSSVIAYYGDNVEVQTETDAFTLYRGYIWMFVNCFASASFVLIMRKR 194

Query: 191 IRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGIS 250
           I+ TNFKDFDT+YYNNLL+IP+L+  SL++EDWS  N E N P D R T + A++ SG+S
Sbjct: 195 IKLTNFKDFDTMYYNNLLAIPILLVASLLLEDWSPANLEVNFPSDNRATTVAAMVLSGVS 254

Query: 251 AFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGIL 310
           + GISY SAWCVRVTSSTTYSMVGALNKLP+A +G++FF   I   +VS+IFVGF AG++
Sbjct: 255 SVGISYCSAWCVRVTSSTTYSMVGALNKLPIALTGLVFFDAAINFWSVSSIFVGFAAGLV 314

Query: 311 YSIAKTEQQK 320
           Y+ AK  Q K
Sbjct: 315 YATAKQRQIK 324



>gi|169612213|ref|XP_001799524.1| hypothetical protein SNOG_09225 [Phaeosphaeria nodorum SN15]
 gi|121920160|sp|Q0UG89.1|GMT_PHANO RecName: Full=GDP-mannose transporter; Short=GMT
 gi|111062297|gb|EAT83417.1| hypothetical protein SNOG_09225 [Phaeosphaeria nodorum SN15]
          Length = 381

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 182/330 (55%), Positives = 238/330 (72%), Gaps = 11/330 (3%)

Query: 19  ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLAL 78
           +L YCA+SILMTVTNKYVLSG DFN+NF LL +QS+VCV  +   K   L+++R+F+   
Sbjct: 45  VLAYCASSILMTVTNKYVLSGVDFNLNFFLLCVQSVVCVTAISICKAAGLITYRDFNTDE 104

Query: 79  SRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTS 138
           ++KWFPI++LL+ MIYTG+ +L+YLSIPVYTIFKNLTIILIAYGEV+WF  S++ +T+ S
Sbjct: 105 AKKWFPISLLLIGMIYTGTWALKYLSIPVYTIFKNLTIILIAYGEVLWFGGSVTPMTLFS 164

Query: 139 FLLMVFXXXXXX---------XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRR 189
           F LMV                              T   GYLWMAFNC+ SA ++L+MR+
Sbjct: 165 FGLMVLSSIIAAWADIQHALNSFGQQSEAANEALSTMHAGYLWMAFNCVCSATYLLSMRK 224

Query: 190 RIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGI 249
           RI+ TNFKD+DT+YYNNLL+IP+L+  S++VEDWS  N +KN P + R T+I  ++ SG+
Sbjct: 225 RIKLTNFKDYDTMYYNNLLTIPILLVASILVEDWSSANIQKNFPPEQRNTVIMVMVISGM 284

Query: 250 SAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGI 309
           S   ISYTSAW VRVTSSTTYSMVGALNKLP+A SG++FF  P+T G+VSAIFVGFV+GI
Sbjct: 285 STVFISYTSAWAVRVTSSTTYSMVGALNKLPIAISGLVFFDAPVTFGSVSAIFVGFVSGI 344

Query: 310 LYSIAKTEQQKPIKPSVYIPISNKELPQTT 339
           +Y++AK  Q    KP   +P +N  L  ++
Sbjct: 345 VYAVAKVRQNS--KPKTVLPTTNIPLSASS 372



>gi|392589849|gb|EIW79179.1| GDP-mannose transporter [Coniophora puteana RWD-64-598 SS2]
          Length = 375

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 185/334 (55%), Positives = 231/334 (69%), Gaps = 19/334 (5%)

Query: 19  ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLAL 78
           IL YC ASI+MT+ NK+V+SG  FNM FLLL +QS VCV  + + K + ++SFR FD   
Sbjct: 39  ILCYCVASIMMTLVNKFVVSGSQFNMTFLLLTLQSTVCVGAVWSVKKIGIISFRNFDTHD 98

Query: 79  SRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTS 138
           ++ WFPI+ LLV +IYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWF+  ISRLTM S
Sbjct: 99  AKAWFPISFLLVWVIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFNGRISRLTMVS 158

Query: 139 FLLMVFXXXXXX----------------XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAA 182
           F  MVF                                      DIGY WM  NC++SA 
Sbjct: 159 FGFMVFSSVVAAWADVNGAETAVAAIPVSASAGLEIMTNMVQRLDIGYFWMLLNCLASAG 218

Query: 183 FVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLIT 242
           +VL MR+RI+ T F D+D+++YNNLLSIP+L   S++ EDW   N  +N P + RT L++
Sbjct: 219 YVLLMRKRIKVTGFSDWDSMFYNNLLSIPVLAVFSIIAEDWGTANLTRNFPPETRTVLLS 278

Query: 243 AILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIF 302
           AI FSG +A GISYT+AWCVR TSSTTYSMVGALNKLPVAASGMIFFGDP+T G+VSAI 
Sbjct: 279 AIAFSGAAAVGISYTTAWCVRTTSSTTYSMVGALNKLPVAASGMIFFGDPVTVGSVSAIT 338

Query: 303 VGFVAGILYSIAKTEQQKP---IKPSVYIPISNK 333
           +GF AG++Y++AK  Q+K     +    +P++N+
Sbjct: 339 MGFFAGVIYAVAKNNQKKQEMRAQTGGVLPMTNR 372



>gi|213401707|ref|XP_002171626.1| nucleotide sugar transporter [Schizosaccharomyces japonicus yFS275]
 gi|211999673|gb|EEB05333.1| nucleotide sugar transporter [Schizosaccharomyces japonicus yFS275]
          Length = 343

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 178/304 (58%), Positives = 234/304 (76%), Gaps = 2/304 (0%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDL 76
           LP+L YC+ASILMTV+NKYVL+  DFNMNFLLL IQS VC + +   K LN++ FR+F+ 
Sbjct: 15  LPVLAYCSASILMTVSNKYVLNLKDFNMNFLLLAIQSTVCTLAITGLKRLNIIKFRDFNF 74

Query: 77  ALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTM 136
             +R WFPI+ LLV+MIYTGSK+LQYL++PVYTIFKNLTII+IAYGEV+WF  S+S LT+
Sbjct: 75  KEARFWFPISFLLVSMIYTGSKALQYLTVPVYTIFKNLTIIVIAYGEVLWFGGSVSSLTL 134

Query: 137 TSFLLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRIRSTNF 196
            SF LMV                     +F+ GY WM  NC+++A+FVL MR+RI+ TNF
Sbjct: 135 FSFGLMVLSSVVAAWADIKSPASEGA--SFNAGYFWMFANCLTNASFVLAMRKRIKLTNF 192

Query: 197 KDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFGISY 256
           +DFDT++YNNLLSIP+L+ ++++ EDWS +N  +  P     +++T +  SG+SA GISY
Sbjct: 193 RDFDTMFYNNLLSIPVLLILTVLTEDWSAENLTRIFPPGSGLSVMTVMAISGLSAVGISY 252

Query: 257 TSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSIAKT 316
           TSAWCVRVTSSTTYSMVGALNKLP+A SG++FFG P+T G+V+AI +GF+AGI+Y++AK 
Sbjct: 253 TSAWCVRVTSSTTYSMVGALNKLPLAISGILFFGAPVTFGSVTAIALGFIAGIVYALAKV 312

Query: 317 EQQK 320
           +QQK
Sbjct: 313 QQQK 316



>gi|19115591|ref|NP_594679.1| Golgi GDP-mannose transporter Vrg4 (predicted) [Schizosaccharomyces
           pombe 972h-]
 gi|74625965|sp|Q9UTK8.1|GMT_SCHPO RecName: Full=GDP-mannose transporter; Short=GMT
 gi|6138909|emb|CAB59698.1| Golgi GDP-mannose transporter Vrg4 (predicted) [Schizosaccharomyces
           pombe]
          Length = 345

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 175/329 (53%), Positives = 244/329 (74%), Gaps = 2/329 (0%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS 70
           +S +  LP+++YC ASILMT+TNKYVLS   +NMNFLLL +QS VCV  +   K L +++
Sbjct: 9   ISKSPILPVVSYCMASILMTLTNKYVLSSPGYNMNFLLLTVQSTVCVAAIGILKRLKVIN 68

Query: 71  FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCS 130
           +R+FD   ++ WFPI+ LLVAMIYT SK+LQ+LS+PVYTIFKNLTII+IAYGEV+WF   
Sbjct: 69  YRDFDFREAKFWFPISFLLVAMIYTASKALQFLSVPVYTIFKNLTIIIIAYGEVLWFGGH 128

Query: 131 ISRLTMTSFLLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRR 190
           ++ LT+ SF LMV                     T + GYLWM  NC+++AAFVL MR+R
Sbjct: 129 VTALTLFSFGLMVLSSIVAAWADIQSSSFASQ--TLNSGYLWMVLNCLTNAAFVLAMRKR 186

Query: 191 IRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGIS 250
           I+ TNF+DFDT++YNNLLSIP+L+  +L  EDWS +N  +N P D +  ++ A+  SG+S
Sbjct: 187 IKLTNFRDFDTMFYNNLLSIPVLVICTLFTEDWSAENIAQNFPPDAKFGVLMAMAISGVS 246

Query: 251 AFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGIL 310
           + GISYTSAWCVRVTSSTTYSMVGALNKLP+A +G++FF  PIT G+V+AI +GF++G++
Sbjct: 247 SVGISYTSAWCVRVTSSTTYSMVGALNKLPLAIAGLVFFDAPITFGSVTAILLGFISGVV 306

Query: 311 YSIAKTEQQKPIKPSVYIPISNKELPQTT 339
           Y++AK++QQ+   P+  +P+++  +  ++
Sbjct: 307 YAVAKSQQQRQKDPATILPMTHNPVSASS 335



>gi|294659154|ref|XP_002770907.1| DEHA2F26532p [Debaryomyces hansenii CBS767]
 gi|202953659|emb|CAG89918.2| DEHA2F26532p [Debaryomyces hansenii CBS767]
          Length = 357

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 180/304 (59%), Positives = 228/304 (75%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDL 76
           + I +YCA+SILMTVTNKYVLSGYDFN+NF +L  QSI+C+  +   K L ++++R+F+ 
Sbjct: 45  VSIFSYCASSILMTVTNKYVLSGYDFNLNFFMLACQSIICIATIGTLKALGVITYRQFNK 104

Query: 77  ALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTM 136
             ++KW PIA+LLVAMIYT SK+LQ+LSIPVYTIFKNLTIILIAYGEV+WF   ++ + +
Sbjct: 105 DEAKKWSPIAVLLVAMIYTSSKALQFLSIPVYTIFKNLTIILIAYGEVLWFGGKVTTMAL 164

Query: 137 TSFLLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRIRSTNF 196
            SF+LMV                     +   GY WM  NC +SAAFVL MR+RI+ TNF
Sbjct: 165 GSFILMVLSSVIACYGDSSGAKSPSDTISLYAGYFWMFTNCFASAAFVLIMRKRIKLTNF 224

Query: 197 KDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFGISY 256
           KDFDT+YYNNLLSIP+L+T+S++ EDWS  N   N P D RT  I AI+FSG S+ GISY
Sbjct: 225 KDFDTMYYNNLLSIPILLTLSIVFEDWSVTNINLNFPVDNRTPTIMAIIFSGASSVGISY 284

Query: 257 TSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSIAKT 316
            SAWCVRVTSSTTYSMVGALNKLP+A SG++FF   +   +VS+IFVGFVAG++Y++AK 
Sbjct: 285 CSAWCVRVTSSTTYSMVGALNKLPIALSGLVFFDAAVNFWSVSSIFVGFVAGLVYAVAKQ 344

Query: 317 EQQK 320
           +QQK
Sbjct: 345 KQQK 348



>gi|345560686|gb|EGX43811.1| hypothetical protein AOL_s00215g547 [Arthrobotrys oligospora ATCC
           24927]
          Length = 371

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 177/315 (56%), Positives = 235/315 (74%), Gaps = 6/315 (1%)

Query: 12  SATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSF 71
           S +GT+ I +YC ASILMTVTNKYVLSGY FN+NF LL +QS+VCVV +   K + ++++
Sbjct: 36  SNSGTVAIASYCGASILMTVTNKYVLSGYAFNLNFFLLIVQSVVCVVAIEVCKRMKIITY 95

Query: 72  REFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSI 131
           R+F++  +RKW P+++LL+ MIYTGSK+LQ+LSIPVYTIFKNLTII+IAYGEV+WF  S+
Sbjct: 96  RDFNMDEARKWLPVSLLLIGMIYTGSKALQFLSIPVYTIFKNLTIIMIAYGEVLWFGGSV 155

Query: 132 SRLTMTSFLLMVFXXXXXX------XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVL 185
           + + + SF L+V                           T + GYLWM  NC+S+ A+VL
Sbjct: 156 TPMALLSFGLIVLSSIIAAWADIQAALSASSVQAASQISTLNSGYLWMFINCLSTTAYVL 215

Query: 186 TMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAIL 245
            MR+RI+ T FKDFDT++YNNLLSIP+L+  + ++EDWS +N  KN PE+ R  ++ A+ 
Sbjct: 216 GMRKRIKVTQFKDFDTMFYNNLLSIPILLACTFLLEDWSTENVNKNFPEETRNNVMIAMF 275

Query: 246 FSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGF 305
            SG+S+  ISYTSAWCVRVTSSTTYSMVGALNKLP+A SG+IFF  P+T  +V+AI VGF
Sbjct: 276 ISGLSSVFISYTSAWCVRVTSSTTYSMVGALNKLPIAISGLIFFDAPVTFFSVTAIAVGF 335

Query: 306 VAGILYSIAKTEQQK 320
           V+GI+YS+AK +QQK
Sbjct: 336 VSGIVYSMAKIQQQK 350



>gi|485920438|gb|EOD46460.1| putative golgi gdp-mannose transporter protein [Neofusicoccum
           parvum UCRNP2]
          Length = 350

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 179/335 (53%), Positives = 238/335 (71%), Gaps = 12/335 (3%)

Query: 9   AFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNL 68
           A +S    LP+L YC +SILMTVTNKYVLSG  FN+NF LL +QS+VC++ +++ K   +
Sbjct: 4   AGISGNPVLPVLAYCGSSILMTVTNKYVLSGSGFNLNFFLLCVQSVVCIIAIQSLKTFKV 63

Query: 69  VSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFD 128
           +S+R+F    ++KW PI +LL+ MIYT +K+L++LSIPVYTIFKNLTIILIAYGEV+WF 
Sbjct: 64  ISYRDFKTEEAKKWLPITILLIGMIYTSTKALKFLSIPVYTIFKNLTIILIAYGEVLWFG 123

Query: 129 CSISRLTMTSFLLMVFXXXXXX---------XXXXXXXXXXXXXXTFDIGYLWMAFNCIS 179
            +++ + + SF LMV                              T + GY+WM FNC  
Sbjct: 124 GTVTPMALLSFGLMVLSSVVAAWADIQHALASYGGGSSEASDKISTLNAGYMWMLFNCFC 183

Query: 180 SAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTT 239
           SA +VL MR+RI+ TNFKDFDT++YNN LSIP+L+  SL VEDWS  N +KN P + RT+
Sbjct: 184 SATYVLGMRKRIKLTNFKDFDTMFYNNFLSIPILLVSSLFVEDWSNANLDKNFPSENRTS 243

Query: 240 LITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVS 299
           +I +++FSG+S   ISYTSAWCVRVTSSTTYSMVGALNKLP+A SG++FF  P+T G+VS
Sbjct: 244 IILSMVFSGLSTIFISYTSAWCVRVTSSTTYSMVGALNKLPIAVSGLVFFDAPVTFGSVS 303

Query: 300 AIFVGFVAGILYSIAKTEQ---QKPIKPSVYIPIS 331
           AIF+GFV+GI+Y+IAK  Q   +    P+  +P+S
Sbjct: 304 AIFIGFVSGIVYAIAKVRQNASKTEALPTTSVPMS 338



>gi|449547892|gb|EMD38859.1| hypothetical protein CERSUDRAFT_112581 [Ceriporiopsis subvermispora
           B]
          Length = 374

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 190/334 (56%), Positives = 238/334 (71%), Gaps = 18/334 (5%)

Query: 18  PILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLA 77
           PI+ YC ASILMTV NK+V+SG  FNMNFLLLGIQS VCV  +   K L ++SFR+F   
Sbjct: 41  PIVCYCIASILMTVVNKFVVSGQGFNMNFLLLGIQSTVCVACVFVVKKLGIISFRDFSTD 100

Query: 78  LSRKWFPIAMLLVAMIYTGSKSLQ-YLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTM 136
            ++ WFPI+ LLV++IYTGSKSLQ YLSIPVYTIFKNLTIILIAYGEVIWF   ++ LT+
Sbjct: 101 DAKAWFPISFLLVSVIYTGSKSLQQYLSIPVYTIFKNLTIILIAYGEVIWFGGRVTGLTL 160

Query: 137 TSFLLMVFXXXXXX-------------XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAF 183
            SF  MV                                  + +IGYLWM  NCI+SAA+
Sbjct: 161 VSFFFMVLSSVIAAWADISDALTAGDPAVSEGLSAVRGVVSSLNIGYLWMLVNCITSAAY 220

Query: 184 VLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITA 243
           VLTMR+RI+ST F D+D+++YNNLLSIP+L+  SL+ E+W  +N  KN P + R  L+ A
Sbjct: 221 VLTMRKRIKSTGFSDWDSMFYNNLLSIPVLVVASLVFENWGTENLIKNFPPETRNFLLFA 280

Query: 244 ILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFV 303
           I FSG +A GISYT+AWCVRVTSSTTYSMVGALNKLPVAASGMIFFGD +T G+VSA+ V
Sbjct: 281 IAFSGSAAVGISYTTAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDAVTFGSVSAVSV 340

Query: 304 GFVAGILYSIAKTEQQKPI---KPSVYIPISNKE 334
           GF AG++Y+ AK  Q+K     +P + IP+++++
Sbjct: 341 GFFAGLVYAFAKNNQKKAESANQPGI-IPMTSRK 373



>gi|83764960|dbj|BAE55104.1| unnamed protein product [Aspergillus oryzae RIB40]
          Length = 368

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 181/327 (55%), Positives = 241/327 (73%), Gaps = 6/327 (1%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS 70
           LS    LP+L YC +SILMTV NKYVLSG DFN+NF LL +QSIVC++ ++  K   L++
Sbjct: 27  LSGNPVLPVLAYCGSSILMTVMNKYVLSGLDFNLNFFLLCVQSIVCIIAIQTCKFCGLIT 86

Query: 71  FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCS 130
           +R+F    ++KWFPI++LL+ MIYTGSK+LQ+LSIPVYTIFKNLTIILIAYGEV+WF  S
Sbjct: 87  YRDFSADEAKKWFPISLLLIGMIYTGSKALQFLSIPVYTIFKNLTIILIAYGEVLWFGGS 146

Query: 131 ISRLTMTSFLLMVFXXXXXX-----XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVL 185
           ++ LT+ SF LMV                          T + GY+WM  NC+ ++++VL
Sbjct: 147 VTGLTLFSFGLMVLSSIIAAWADIKHAVESSGDTSAQVSTLNAGYIWMLINCLCTSSYVL 206

Query: 186 TMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAIL 245
            MR+RI+ TNFKDFDT++YNNLLSIP+L+ ++ ++EDWS  N ++N P+  R++++ A++
Sbjct: 207 GMRKRIKLTNFKDFDTMFYNNLLSIPVLVVLTGLMEDWSSANIDRNFPQADRSSIMFAMI 266

Query: 246 FSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGF 305
            SG+S+  ISYTSAWCVRVTSSTTYSMVGALNKLP+A SG+IFF  P+T  +VSAI VGF
Sbjct: 267 LSGLSSVFISYTSAWCVRVTSSTTYSMVGALNKLPIALSGLIFFDAPVTFPSVSAIAVGF 326

Query: 306 VAGILYSIAKTEQQKPIKPSVYIPISN 332
           V+GI+Y+IAK +Q    K  V +P SN
Sbjct: 327 VSGIVYAIAKIKQNAKPKTGV-LPTSN 352



>gi|238503434|ref|XP_002382950.1| Golgi GDP-mannose transporter [Aspergillus flavus NRRL3357]
 gi|317138734|ref|XP_001817106.2| GDP-mannose transporter 1 [Aspergillus oryzae RIB40]
 gi|189041380|sp|Q2UTL1.2|GMT_ASPOR RecName: Full=GDP-mannose transporter; Short=GMT
 gi|220690421|gb|EED46770.1| Golgi GDP-mannose transporter [Aspergillus flavus NRRL3357]
 gi|391863452|gb|EIT72763.1| nucleotide-sugar transporter VRG4/SQV-7 [Aspergillus oryzae 3.042]
          Length = 381

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 181/327 (55%), Positives = 241/327 (73%), Gaps = 6/327 (1%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS 70
           LS    LP+L YC +SILMTV NKYVLSG DFN+NF LL +QSIVC++ ++  K   L++
Sbjct: 40  LSGNPVLPVLAYCGSSILMTVMNKYVLSGLDFNLNFFLLCVQSIVCIIAIQTCKFCGLIT 99

Query: 71  FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCS 130
           +R+F    ++KWFPI++LL+ MIYTGSK+LQ+LSIPVYTIFKNLTIILIAYGEV+WF  S
Sbjct: 100 YRDFSADEAKKWFPISLLLIGMIYTGSKALQFLSIPVYTIFKNLTIILIAYGEVLWFGGS 159

Query: 131 ISRLTMTSFLLMVFXXXXXX-----XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVL 185
           ++ LT+ SF LMV                          T + GY+WM  NC+ ++++VL
Sbjct: 160 VTGLTLFSFGLMVLSSIIAAWADIKHAVESSGDTSAQVSTLNAGYIWMLINCLCTSSYVL 219

Query: 186 TMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAIL 245
            MR+RI+ TNFKDFDT++YNNLLSIP+L+ ++ ++EDWS  N ++N P+  R++++ A++
Sbjct: 220 GMRKRIKLTNFKDFDTMFYNNLLSIPVLVVLTGLMEDWSSANIDRNFPQADRSSIMFAMI 279

Query: 246 FSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGF 305
            SG+S+  ISYTSAWCVRVTSSTTYSMVGALNKLP+A SG+IFF  P+T  +VSAI VGF
Sbjct: 280 LSGLSSVFISYTSAWCVRVTSSTTYSMVGALNKLPIALSGLIFFDAPVTFPSVSAIAVGF 339

Query: 306 VAGILYSIAKTEQQKPIKPSVYIPISN 332
           V+GI+Y+IAK +Q    K  V +P SN
Sbjct: 340 VSGIVYAIAKIKQNAKPKTGV-LPTSN 365



>gi|494829213|gb|EON65904.1| GDP-mannose transporter [Coniosporium apollinis CBS 100218]
          Length = 384

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 184/336 (54%), Positives = 241/336 (71%), Gaps = 15/336 (4%)

Query: 3   QPP---TILAFLSATGT--LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCV 57
           QPP   +  A +S +    +P+L YC +SILMTVTNKYVLSG DFN+NF LL +QS+VCV
Sbjct: 26  QPPRMPSAPAHISVSNNPIVPVLAYCGSSILMTVTNKYVLSGRDFNLNFFLLCVQSVVCV 85

Query: 58  VLLRAFKMLNLVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTII 117
             ++  K   ++++R+F+   +RKWFP+++LL+ MIYT +K+L++LSIPVYTIFKNLTII
Sbjct: 86  AAIQTCKTAGVITYRDFNTEEARKWFPVSLLLIGMIYTSTKALRFLSIPVYTIFKNLTII 145

Query: 118 LIAYGEVIWFDCSISRLTMTSFLLMVFXXXXXX----------XXXXXXXXXXXXXXTFD 167
           +IAYGEV+WF  +++ + + SF LMVF                              T +
Sbjct: 146 IIAYGEVLWFGGTVTGMALFSFGLMVFSSLIAAWADIQHALANYGGSASNEASDKISTLN 205

Query: 168 IGYLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKN 227
            GY+WM  NC  SAA+VL MR+RI+ TNFKDFDT+YYNNLLSIP+L+  SL +EDWS KN
Sbjct: 206 SGYIWMMLNCFCSAAYVLGMRKRIKLTNFKDFDTMYYNNLLSIPILLVCSLFLEDWSSKN 265

Query: 228 FEKNLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMI 287
              N P   R ++ITA++FSG+S+  ISYTSAWCVRVTSSTTYSMVGALNKLP+A SG++
Sbjct: 266 ISLNFPPVERNSIITAMVFSGLSSVFISYTSAWCVRVTSSTTYSMVGALNKLPIALSGLV 325

Query: 288 FFGDPITTGNVSAIFVGFVAGILYSIAKTEQQKPIK 323
           FF  P T G+VSAIFVGFV+GI+Y++AK +Q K  K
Sbjct: 326 FFDAPRTFGSVSAIFVGFVSGIVYALAKIKQNKEKK 361



>gi|409040882|gb|EKM50368.1| hypothetical protein PHACADRAFT_200317 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 370

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 188/338 (55%), Positives = 232/338 (68%), Gaps = 22/338 (6%)

Query: 18  PILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLA 77
           PI+ YC ASILMTV NK+V+SG  FNMNFLLL IQS VCV  +   K L ++SFR +D  
Sbjct: 35  PIVCYCFASILMTVVNKFVVSGRQFNMNFLLLCIQSTVCVSCVYLVKKLGIISFRNWDSK 94

Query: 78  LSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMT 137
            ++ WFPI+ LLV++IYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWF   ++ LT+ 
Sbjct: 95  DAKAWFPISFLLVSVIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFGGRVTGLTLV 154

Query: 138 SFLLMVFXXXXXXXXXXXXXXXXXXXXTFD-----------------IGYLWMAFNCISS 180
           SF  MV                       +                 +GY WM  NC++S
Sbjct: 155 SFFFMVLSSLIAAWADISDALTAGDPAVLESEGWGFQHLSGIVSKINVGYFWMLINCLTS 214

Query: 181 AAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTL 240
           AA+VLTMR+RI+ T F D+D+++YNNLLSIP+L   S++ EDWS  N  ++ PE+ R  L
Sbjct: 215 AAYVLTMRKRIKITGFSDWDSMFYNNLLSIPVLAFFSIVAEDWSATNLTRSFPEETRNVL 274

Query: 241 ITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSA 300
             AI FSG +A GISYT+AWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDP+T G+VSA
Sbjct: 275 FFAIAFSGAAAVGISYTTAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPVTLGSVSA 334

Query: 301 IFVGFVAGILYSIAKTEQQKPIKPSVYIPISNKELPQT 338
           + VGF AG++Y++AK  Q+K     V + + N  LP T
Sbjct: 335 VSVGFFAGVVYAVAKNNQRK-----VEMAVQNNVLPMT 367



>gi|325091767|gb|EGC45077.1| golgi GDP-mannose transporter [Ajellomyces capsulatus H88]
          Length = 382

 Score =  369 bits (946), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 180/333 (54%), Positives = 244/333 (73%), Gaps = 9/333 (2%)

Query: 14  TGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFRE 73
           +  LP+  YC +SILMTVTNKYVLSG  FN+NFLLL +QS+VCV  ++  K L ++++R+
Sbjct: 43  SSALPVFCYCCSSILMTVTNKYVLSGTSFNLNFLLLCVQSLVCVAAIQTCKSLKIITYRD 102

Query: 74  FDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISR 133
           F++  ++KWFPI++LL+ MIYTG+K+LQ+LSIPVYTIFKNLTIILIAYGEV+WF  S++ 
Sbjct: 103 FNIDEAKKWFPISLLLIGMIYTGTKALQFLSIPVYTIFKNLTIILIAYGEVLWFGGSVTG 162

Query: 134 LTMTSFLLMVFXXXXXX------XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTM 187
           + + SF LMV                           T + GY+WM  NC+ +A++VL M
Sbjct: 163 MVLFSFGLMVLSSIIAAWADINHALSQVGMDATSKISTLNAGYVWMLINCLCTASYVLGM 222

Query: 188 RRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFS 247
           R+RI+ TNFKDFDT++YNNLLSIP+++  SL+VEDWS +N   N P + R+ +I A++FS
Sbjct: 223 RKRIKLTNFKDFDTMFYNNLLSIPIILVASLVVEDWSSENINLNFPPETRSRIIMAMVFS 282

Query: 248 GISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVA 307
           G+S+  ISYTSAWCVRVTSSTTYSMVGALNKLP+A SG+IFF  P+T  +VSAIFVGFV+
Sbjct: 283 GLSSVFISYTSAWCVRVTSSTTYSMVGALNKLPIALSGLIFFDAPVTFPSVSAIFVGFVS 342

Query: 308 GILYSIAKTEQQKPIKPSVYI-PISNKELPQTT 339
           G++Y++AK  Q    KP + + P SN  +  ++
Sbjct: 343 GLVYAMAKVRQNS--KPRIGVLPTSNPPMSASS 373



>gi|261190871|ref|XP_002621844.1| GDP-mannose transporter [Ajellomyces dermatitidis SLH14081]
 gi|239590888|gb|EEQ73469.1| GDP-mannose transporter [Ajellomyces dermatitidis SLH14081]
 gi|239613206|gb|EEQ90193.1| golgi GDP-mannose transporter [Ajellomyces dermatitidis ER-3]
 gi|327354721|gb|EGE83578.1| golgi GDP-mannose transporter [Ajellomyces dermatitidis ATCC 18188]
          Length = 383

 Score =  368 bits (945), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 182/347 (52%), Positives = 250/347 (72%), Gaps = 11/347 (3%)

Query: 2   AQP--PTILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVL 59
           +QP  P   +  + +  LP+ +YC +SILMTVTNKYVLSG  FN+NF LL +QS+VCV  
Sbjct: 30  SQPRLPASRSSYAQSSALPVFSYCCSSILMTVTNKYVLSGTSFNLNFFLLCVQSLVCVAA 89

Query: 60  LRAFKMLNLVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILI 119
           ++  K L +++FR+F++  ++KWFPI++LL+ MIYTG+K+LQ+LSIPVYTIFKNLTIILI
Sbjct: 90  IQTAKSLKIITFRDFNIDEAKKWFPISLLLIGMIYTGTKALQFLSIPVYTIFKNLTIILI 149

Query: 120 AYGEVIWFDCSISRLTMTSFLLMVFXXXXXX------XXXXXXXXXXXXXXTFDIGYLWM 173
           AYGEV+WF  S++ + + SF LMV                           T + GY+WM
Sbjct: 150 AYGEVLWFGGSVTGMVLFSFGLMVLSSIIAAWADINYALSAVGVDATSKISTLNAGYVWM 209

Query: 174 AFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLP 233
             NC+ +A +VL MR+RI+ TNFKDFDT++YNNLLSIP+++  SL+VEDWS +N   N P
Sbjct: 210 LINCLCTATYVLGMRKRIKLTNFKDFDTMFYNNLLSIPIILVASLVVEDWSSENVNLNFP 269

Query: 234 EDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPI 293
            + R+ +I A++FSG+S+  ISYTSAWCVRVTSSTTYSMVGALNKLP+A SG+IFF  P+
Sbjct: 270 TETRSRIIMAMIFSGLSSVFISYTSAWCVRVTSSTTYSMVGALNKLPIALSGLIFFDAPV 329

Query: 294 TTGNVSAIFVGFVAGILYSIAKTEQQKPIKPSVYI-PISNKELPQTT 339
           T  +VSAIFVGFV+G++Y++AK +Q    +P + + P SN  +  ++
Sbjct: 330 TFPSVSAIFVGFVSGLVYAMAKVKQNS--RPRIGVLPTSNPPISASS 374



>gi|70998672|ref|XP_754058.1| Golgi GDP-mannose transporter [Aspergillus fumigatus Af293]
 gi|74672900|sp|Q4WTQ6.1|GMT_ASPFU RecName: Full=GDP-mannose transporter; Short=GMT
 gi|189041361|sp|B0Y384.1|GMT_ASPFC RecName: Full=GDP-mannose transporter; Short=GMT
 gi|66851694|gb|EAL92020.1| Golgi GDP-mannose transporter [Aspergillus fumigatus Af293]
 gi|159126209|gb|EDP51325.1| Golgi GDP-mannose transporter [Aspergillus fumigatus A1163]
          Length = 382

 Score =  368 bits (945), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 183/341 (53%), Positives = 246/341 (72%), Gaps = 8/341 (2%)

Query: 4   PPTILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAF 63
           PP  +A L+    LP+L YC +SILMTV NKYVLSG DFN+NF LL +QSIVC+V ++  
Sbjct: 36  PP--VAQLANNPILPVLAYCGSSILMTVMNKYVLSGRDFNLNFFLLCVQSIVCIVAIQTC 93

Query: 64  KMLNLVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGE 123
           K+  L+++R+F+   ++KWFPI +LL+ MIYTGSK+LQYLSIPVYTIFKNLTIILIAYGE
Sbjct: 94  KVSKLITYRDFNSDEAKKWFPITLLLIGMIYTGSKALQYLSIPVYTIFKNLTIILIAYGE 153

Query: 124 VIWFDCSISRLTMTSFLLMVFXXXXXX-----XXXXXXXXXXXXXXTFDIGYLWMAFNCI 178
           V+WF  S++ LT+ SF LMV                          T + GY+WM  NC+
Sbjct: 154 VLWFGGSVTGLTLFSFGLMVLSSIIAAWADIKHAVESSGDATAKVSTLNAGYIWMLINCL 213

Query: 179 SSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRT 238
            ++++VL MR+RI+ TNFKDFDT++YNNLLSIP+L+ ++ ++EDWS  N  +N P   R 
Sbjct: 214 CTSSYVLGMRKRIKLTNFKDFDTMFYNNLLSIPVLLVLTFLMEDWSSANIARNFPSTDRN 273

Query: 239 TLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNV 298
            ++ A++ SG+S+  ISYTSAWCVRVTSSTTYSMVGALNKLP+A SG+IFF  P+T  +V
Sbjct: 274 GILFAMILSGLSSVFISYTSAWCVRVTSSTTYSMVGALNKLPIALSGLIFFDAPVTFPSV 333

Query: 299 SAIFVGFVAGILYSIAKTEQQKPIKPSVYIPISNKELPQTT 339
           SAI VGF++GI+Y++AK +Q    K  V +P+SN  +  ++
Sbjct: 334 SAIVVGFISGIVYAVAKIKQSAKPKTGV-LPMSNPPVSASS 373



>gi|395331810|gb|EJF64190.1| UDP-galactose transporter, partial [Dichomitus squalens LYAD-421
           SS1]
          Length = 339

 Score =  368 bits (944), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 183/320 (57%), Positives = 225/320 (70%), Gaps = 17/320 (5%)

Query: 18  PILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLA 77
           PI+ YC ASILMTV NK+V+SG  FNMNFLLL IQS VCV  +   K L ++SFR+FD  
Sbjct: 3   PIVCYCMASILMTVVNKFVVSGSQFNMNFLLLCIQSSVCVGCVYTVKKLGVISFRDFDTK 62

Query: 78  LSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMT 137
            ++ WFPI+++LV +IYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWF   ++ LT+ 
Sbjct: 63  DAKMWFPISVMLVGVIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFGGRVTGLTLV 122

Query: 138 SFLLMVFXX-----------------XXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISS 180
           SF+LMV                                        ++GY WM  NC +S
Sbjct: 123 SFILMVISSVIAAWADINNALTASDPASTAGAIAGLSSVGGIVRQLNVGYFWMFLNCGTS 182

Query: 181 AAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTL 240
           AA+VLTMR+RI+ T F D+DT+YYNNLLSIP+L   S++ EDW  +N  +N P D R  L
Sbjct: 183 AAYVLTMRKRIKGTGFSDWDTMYYNNLLSIPVLAVASIIAEDWGYENLNRNFPPDTRNFL 242

Query: 241 ITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSA 300
           + AI FSG +A GISYT+AWC+R TSSTTYSMVGALNKLPVAASGMIFFGDP+T G+V+A
Sbjct: 243 LFAIAFSGGAAVGISYTTAWCIRATSSTTYSMVGALNKLPVAASGMIFFGDPVTFGSVTA 302

Query: 301 IFVGFVAGILYSIAKTEQQK 320
           + VGF AG++Y+ AK  Q+K
Sbjct: 303 VSVGFFAGLVYAFAKNNQKK 322



>gi|295660563|ref|XP_002790838.1| GDP-mannose transporter [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226281391|gb|EEH36957.1| GDP-mannose transporter [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 388

 Score =  368 bits (944), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 183/336 (54%), Positives = 243/336 (72%), Gaps = 8/336 (2%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS 70
           L+ + TLPIL YC +SILMTVTNKYVLSG  FN+NF LL +QSIVCV  ++A K L +++
Sbjct: 45  LAHSSTLPILCYCLSSILMTVTNKYVLSGISFNLNFFLLCVQSIVCVAAIQACKSLKIIT 104

Query: 71  FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCS 130
           +R+F+   ++KWFPI+ LL+ MIYTG+K+LQYLSIPVYTIFKNLTIILIAYGEV+WF  S
Sbjct: 105 YRDFNADEAKKWFPISFLLIGMIYTGTKALQYLSIPVYTIFKNLTIILIAYGEVLWFGGS 164

Query: 131 ISRLTMTSFLLMV-------FXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAF 183
           ++ + + SF LMV       +                    T + GY+WM  NC+ +A++
Sbjct: 165 VTGMVLFSFGLMVLSSIIAAWADISHALSTVSGVDATAKISTLNAGYIWMLINCLCTASY 224

Query: 184 VLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITA 243
           VL MR+RI+ TNFKDFDT++YNNLLSIP+++  SL++EDWS  N   N P   R ++I A
Sbjct: 225 VLGMRKRIKLTNFKDFDTMFYNNLLSIPIILVASLLLEDWSSANVNLNFPPATRNSVILA 284

Query: 244 ILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFV 303
           ++FSG+S   ISYTSAWCVRVTSSTTYSMVGALNKLP+A SG++FF  P+T  +VSAI V
Sbjct: 285 MIFSGLSTVFISYTSAWCVRVTSSTTYSMVGALNKLPIALSGLVFFDAPVTFPSVSAIIV 344

Query: 304 GFVAGILYSIAKTEQQKPIKPSVYIPISNKELPQTT 339
           GFV+GI+Y++AK +Q    +  V +P SN  +  ++
Sbjct: 345 GFVSGIVYAMAKVKQNMNNRTGV-LPSSNPTISASS 379



>gi|225562232|gb|EEH10512.1| golgi GDP-mannose transporter [Ajellomyces capsulatus G186AR]
          Length = 382

 Score =  367 bits (941), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 179/333 (53%), Positives = 243/333 (72%), Gaps = 9/333 (2%)

Query: 14  TGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFRE 73
           +  LP+  YC +SILMTV NKYVLSG  FN+NFLLL +QS+VCV  ++  K L ++++R+
Sbjct: 43  SSALPVFCYCCSSILMTVANKYVLSGTSFNLNFLLLCVQSLVCVAAIQTCKSLKIITYRD 102

Query: 74  FDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISR 133
           F++  ++KWFPI++LL+ MIYTG+K+LQ+LSIPVYTIFKNLTIILIAYGEV+WF  S++ 
Sbjct: 103 FNIDEAKKWFPISLLLIGMIYTGTKALQFLSIPVYTIFKNLTIILIAYGEVLWFGGSVTG 162

Query: 134 LTMTSFLLMVFXXXXXX------XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTM 187
           + + SF LMV                           T + GY+WM  NC+ +A++VL M
Sbjct: 163 MVLFSFGLMVLSSIIAAWADINHALSQVGMDATSKISTLNTGYVWMLINCLCTASYVLGM 222

Query: 188 RRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFS 247
           R+RI+ TNFKDFDT++YNNLLSIP+++  SL+VEDWS +N   N P + R+ +I A++FS
Sbjct: 223 RKRIKLTNFKDFDTMFYNNLLSIPIILVASLVVEDWSSENINLNFPPETRSRIIMAMVFS 282

Query: 248 GISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVA 307
           G+S+  ISYTSAWCVRVTSSTTYSMVGALNKLP+A SG+IFF  P+T  +VSAIFVGFV+
Sbjct: 283 GLSSVFISYTSAWCVRVTSSTTYSMVGALNKLPIALSGLIFFDAPVTFPSVSAIFVGFVS 342

Query: 308 GILYSIAKTEQQKPIKPSVYI-PISNKELPQTT 339
           G++Y++AK  Q    KP + + P SN  +  ++
Sbjct: 343 GLVYAMAKVRQNS--KPRIGVLPTSNPPMSASS 373



>gi|225685062|gb|EEH23346.1| golgi GDP-mannose transporter [Paracoccidioides brasiliensis Pb03]
          Length = 388

 Score =  367 bits (941), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 182/336 (54%), Positives = 242/336 (72%), Gaps = 8/336 (2%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS 70
           L+ + TLPIL YC +SILMTVTNKYVLSG  FN+NF LL +QSIVCV  ++  K L +++
Sbjct: 45  LAHSSTLPILCYCLSSILMTVTNKYVLSGISFNLNFFLLCVQSIVCVAAIQTCKSLKIIT 104

Query: 71  FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCS 130
           +R+F+   ++KWFPI+ LL+ MIYTG+K+LQYLSIPVYTIFKNLTIILIAYGEV+WF  S
Sbjct: 105 YRDFNADEAKKWFPISFLLIGMIYTGTKALQYLSIPVYTIFKNLTIILIAYGEVLWFGGS 164

Query: 131 ISRLTMTSFLLMV-------FXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAF 183
           ++ + + SF LMV       +                    T + GY+WM  NC+ +A++
Sbjct: 165 VTGMVLFSFGLMVLSSIIAAWADISHALSTVSGVDATAKISTLNAGYIWMLINCLCTASY 224

Query: 184 VLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITA 243
           VL MR+RI+ TNFKDFDT++YNNLLSIP+++  SL++EDWS  N   N P   R ++I A
Sbjct: 225 VLGMRKRIKLTNFKDFDTMFYNNLLSIPIILVASLLLEDWSSANVHLNFPPATRNSVILA 284

Query: 244 ILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFV 303
           ++FSG+S   ISYTSAWCVRVTSSTTYSMVGALNKLP+A SG++FF  P+T  +VSAI V
Sbjct: 285 MIFSGLSTVFISYTSAWCVRVTSSTTYSMVGALNKLPIALSGLVFFDAPVTFPSVSAIIV 344

Query: 304 GFVAGILYSIAKTEQQKPIKPSVYIPISNKELPQTT 339
           GFV+GI+Y++AK +Q    +  V +P SN  +  ++
Sbjct: 345 GFVSGIVYAMAKVKQNMNNRTGV-LPSSNPTISASS 379



>gi|226294373|gb|EEH49793.1| GDP-mannose transporter [Paracoccidioides brasiliensis Pb18]
          Length = 389

 Score =  367 bits (941), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 182/336 (54%), Positives = 242/336 (72%), Gaps = 8/336 (2%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS 70
           L+ + TLPIL YC +SILMTVTNKYVLSG  FN+NF LL +QSIVCV  ++  K L +++
Sbjct: 46  LAHSSTLPILCYCLSSILMTVTNKYVLSGISFNLNFFLLCVQSIVCVAAIQTCKSLKIIT 105

Query: 71  FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCS 130
           +R+F+   ++KWFPI+ LL+ MIYTG+K+LQYLSIPVYTIFKNLTIILIAYGEV+WF  S
Sbjct: 106 YRDFNADEAKKWFPISFLLIGMIYTGTKALQYLSIPVYTIFKNLTIILIAYGEVLWFGGS 165

Query: 131 ISRLTMTSFLLMV-------FXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAF 183
           ++ + + SF LMV       +                    T + GY+WM  NC+ +A++
Sbjct: 166 VTGMVLFSFGLMVLSSIIAAWADISHALSTVSGVDATAKISTLNAGYIWMLINCLCTASY 225

Query: 184 VLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITA 243
           VL MR+RI+ TNFKDFDT++YNNLLSIP+++  SL++EDWS  N   N P   R ++I A
Sbjct: 226 VLGMRKRIKLTNFKDFDTMFYNNLLSIPIILIASLLLEDWSSANVHLNFPPATRNSVILA 285

Query: 244 ILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFV 303
           ++FSG+S   ISYTSAWCVRVTSSTTYSMVGALNKLP+A SG++FF  P+T  +VSAI V
Sbjct: 286 MIFSGLSTVFISYTSAWCVRVTSSTTYSMVGALNKLPIALSGLVFFDAPVTFPSVSAIIV 345

Query: 304 GFVAGILYSIAKTEQQKPIKPSVYIPISNKELPQTT 339
           GFV+GI+Y++AK +Q    +  V +P SN  +  ++
Sbjct: 346 GFVSGIVYAMAKVKQNMNNRTGV-LPSSNPTISASS 380



>gi|336363835|gb|EGN92206.1| hypothetical protein SERLA73DRAFT_99599 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336380955|gb|EGO22107.1| hypothetical protein SERLADRAFT_450998 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 377

 Score =  366 bits (940), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 182/339 (53%), Positives = 234/339 (69%), Gaps = 22/339 (6%)

Query: 18  PILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLA 77
           PI+ YC ASILMT+ NK+V+SG  FNM FLLL IQSIVCV  + A K   ++SFR FD+ 
Sbjct: 38  PIVCYCVASILMTLVNKFVVSGSQFNMTFLLLSIQSIVCVTCVAAVKRAGIISFRNFDIQ 97

Query: 78  LSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMT 137
            ++ WFPI+ +LV++IYTGSKSLQYL+IPVYTIFKNLTIILIAYGEVIWF   ++ LT+ 
Sbjct: 98  DAKAWFPISFMLVSVIYTGSKSLQYLTIPVYTIFKNLTIILIAYGEVIWFGARVTGLTIV 157

Query: 138 SFLLMVFXXXXXXXXXXXXXX-------------------XXXXXXTFDIGYLWMAFNCI 178
           +F+ MV                                          +IGY WM  NC+
Sbjct: 158 AFIFMVLSSIIAAWADIHSTTNIVDALPPASAGMGIGLDMISDVAQKLNIGYFWMLVNCL 217

Query: 179 SSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRT 238
           +SAA+VLTMR+RI+ T F D+D+++Y+NLL IP+L   S++VEDW  +N  +N PE+ R 
Sbjct: 218 TSAAYVLTMRKRIKITGFSDWDSMFYSNLLCIPVLSVFSVIVEDWGTENLARNFPEETRN 277

Query: 239 TLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNV 298
            L+ AI FSG +A GISYT+AWCVR TSSTTYSMVGALNKLPVAASGM+FFGDP+T G+V
Sbjct: 278 FLLFAIAFSGAAAVGISYTTAWCVRTTSSTTYSMVGALNKLPVAASGMLFFGDPVTFGSV 337

Query: 299 SAIFVGFVAGILYSIAKTEQQK---PIKPSVYIPISNKE 334
           SAI VGF AG++Y++AK  Q+K          IP++N++
Sbjct: 338 SAIGVGFFAGLVYAVAKNNQKKVENRATTDAIIPLANRK 376



>gi|407916525|gb|EKG09893.1| UDP-galactose transporter [Macrophomina phaseolina MS6]
          Length = 372

 Score =  366 bits (940), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 178/325 (54%), Positives = 230/325 (70%), Gaps = 9/325 (2%)

Query: 4   PPTILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAF 63
           PP   + LS    LP+L+YC +SILMTVTNKYVLSG  FN+NF LL +QS+VC+  ++  
Sbjct: 21  PPMSSSGLSNNPILPVLSYCGSSILMTVTNKYVLSGTGFNLNFFLLCVQSLVCIFAIQTL 80

Query: 64  KMLNLVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGE 123
           K   ++S+R+F    ++KW PI +LL+ MIYT +K+L++LSIPVYTIFKNLTIILIAYGE
Sbjct: 81  KTTKVISYRDFKTEEAKKWLPITILLIGMIYTSTKALKFLSIPVYTIFKNLTIILIAYGE 140

Query: 124 VIWFDCSISRLTMTSFLLMVFXXXXXXXXXXXXX---------XXXXXXXTFDIGYLWMA 174
           V+WF  +++ + + SF LMV                              T + GY+WM 
Sbjct: 141 VLWFGGTVTPMALLSFGLMVLSSVVAAWADIQHALTNYGGGSSEASEKISTLNAGYMWML 200

Query: 175 FNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPE 234
            NC  SA +VL MR+RI+ TNFKDFDT++YNNLLSIP+L+  SL VEDWS  N EKN P 
Sbjct: 201 LNCFCSATYVLGMRKRIKLTNFKDFDTMFYNNLLSIPILLVSSLFVEDWSSANLEKNFPA 260

Query: 235 DIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPIT 294
           + R  +I +++FSG+S   ISYTSAWCVRVTSSTTYSMVGALNKLP+A SG++FF  P+T
Sbjct: 261 ENRNAIILSMIFSGLSTIFISYTSAWCVRVTSSTTYSMVGALNKLPIAVSGLVFFDAPVT 320

Query: 295 TGNVSAIFVGFVAGILYSIAKTEQQ 319
            G+VSAIF+GFV+GI+Y+IAK  Q 
Sbjct: 321 FGSVSAIFIGFVSGIVYAIAKVRQN 345



>gi|331243713|ref|XP_003334499.1| hypothetical protein PGTG_15928 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309313489|gb|EFP90080.1| hypothetical protein PGTG_15928 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 379

 Score =  366 bits (939), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 186/331 (56%), Positives = 234/331 (70%), Gaps = 14/331 (4%)

Query: 4   PPTILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAF 63
           P + +  LS    LP+ +YCAASILMTV NK+V+SG  F+MNFLLL IQS+VCV  +   
Sbjct: 20  PGSKIDRLSNNPVLPVFSYCAASILMTVINKFVVSGRHFSMNFLLLTIQSVVCVGCVATS 79

Query: 64  KMLNLVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGE 123
           K L L+ +R+ D   +++WFPI+ LLV +IYTGSK+LQ+L+IPVYTIFKNLTIILIAYGE
Sbjct: 80  KSLRLIKYRDLDKNDAKRWFPISFLLVVVIYTGSKALQFLTIPVYTIFKNLTIILIAYGE 139

Query: 124 VIWFDCSISRLTMTSFLLMVFXXX--------------XXXXXXXXXXXXXXXXXTFDIG 169
           VIWF+ S+S LT+ SF LMV                                     ++G
Sbjct: 140 VIWFNGSVSSLTLVSFGLMVLSSLIAAWSDISPFLSINSAKEEAFQEPLIYGEIVKKNMG 199

Query: 170 YLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFE 229
           Y WM  NC +SAA+VL MR++I+ TNFKD+DT++YNNLLSIP+L+  SL  EDWS+ +  
Sbjct: 200 YFWMLINCFASAAYVLAMRKKIKLTNFKDWDTMFYNNLLSIPILIVFSLAFEDWSQSSLS 259

Query: 230 KNLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFF 289
            N P + R  L+ A+ FSG +A  ISYT+AWCVR TSSTTYSMVGALNKLPVAASGMIFF
Sbjct: 260 LNFPSEGRNFLLAAMSFSGAAAVFISYTTAWCVRTTSSTTYSMVGALNKLPVAASGMIFF 319

Query: 290 GDPITTGNVSAIFVGFVAGILYSIAKTEQQK 320
           GDP+T GNV+A+  GFVAG++Y+IAKT QQK
Sbjct: 320 GDPVTFGNVTAVSTGFVAGLVYAIAKTNQQK 350



>gi|241949311|ref|XP_002417378.1| Golgi apparatus GDP-mannose tramsporter, putative [Candida
           dubliniensis CD36]
 gi|223640716|emb|CAX45027.1| Golgi apparatus GDP-mannose tramsporter, putative [Candida
           dubliniensis CD36]
          Length = 380

 Score =  366 bits (939), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 181/305 (59%), Positives = 226/305 (74%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS 70
           +S +G + I  YC +SILMTVTNKYVLSG+ FN+NF LL IQSIVC++ + + K LN+++
Sbjct: 61  ISNSGPISIAAYCLSSILMTVTNKYVLSGFSFNLNFFLLAIQSIVCIITIGSLKSLNIIT 120

Query: 71  FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCS 130
           +R+F+   ++KW PIA LLVAMIYT SK+LQYLSIPVYTIFKNLTIILIAYGEVIWF   
Sbjct: 121 YRQFNKDEAKKWSPIAFLLVAMIYTSSKALQYLSIPVYTIFKNLTIILIAYGEVIWFGGK 180

Query: 131 ISRLTMTSFLLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRR 190
           ++ + ++SFLLMV                        +GY WM  NC +SAAFVL MR+R
Sbjct: 181 VTTMALSSFLLMVLSSIIAYYGDNAAIKSNDDIFALYLGYFWMLTNCFASAAFVLIMRKR 240

Query: 191 IRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGIS 250
           I+ TNFKDFDT+YYNNLLSIP+L+  S + EDWS  N   N P + R T ITA++ SGIS
Sbjct: 241 IKLTNFKDFDTMYYNNLLSIPILLICSFIFEDWSSNNVSLNFPANNRFTTITAMILSGIS 300

Query: 251 AFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGIL 310
           + GISY SAWCVRVTSSTTYSMVGALNKLP+A SG+IFF   +   +VS+IFVGF AG++
Sbjct: 301 SVGISYCSAWCVRVTSSTTYSMVGALNKLPIALSGLIFFDAAVNFWSVSSIFVGFAAGLV 360

Query: 311 YSIAK 315
           Y++AK
Sbjct: 361 YAVAK 365



>gi|121712594|ref|XP_001273908.1| Golgi GDP-mannose transporter [Aspergillus clavatus NRRL 1]
 gi|189041360|sp|A1C9R4.1|GMT_ASPCL RecName: Full=GDP-mannose transporter; Short=GMT
 gi|119402061|gb|EAW12482.1| Golgi GDP-mannose transporter [Aspergillus clavatus NRRL 1]
          Length = 381

 Score =  366 bits (939), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 181/329 (55%), Positives = 239/329 (72%), Gaps = 6/329 (1%)

Query: 9   AFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNL 68
           A L+    LP+L YC +SI+MTV NKYVLSG DFN+NFLLL +QSIVC+V ++  K   L
Sbjct: 39  AQLANNPILPVLAYCGSSIMMTVMNKYVLSGTDFNLNFLLLCVQSIVCIVAIQTCKASKL 98

Query: 69  VSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFD 128
           +++R+F+   ++KWFPI +LL+ MIYTGSK+LQ+LSIPVYTIFKNLTIILIAYGEV+WF 
Sbjct: 99  ITYRDFNADEAKKWFPITLLLIGMIYTGSKALQFLSIPVYTIFKNLTIILIAYGEVLWFG 158

Query: 129 CSISRLTMTSFLLMVFXXXXXX-----XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAF 183
            S++ LT+ SF LMV                          T + GY+WM  NC+ ++++
Sbjct: 159 GSVTGLTLFSFGLMVLSSIIAAWADIKHAVESSGDATAKVSTLNAGYIWMLINCLCTSSY 218

Query: 184 VLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITA 243
           VL MR+RI+ TNFKDFDT++YNNLLSIP+L+ ++ ++EDWS  N  +N P   R  ++ A
Sbjct: 219 VLGMRKRIKLTNFKDFDTMFYNNLLSIPVLLVLTFLMEDWSSANITRNFPPADRNGIMFA 278

Query: 244 ILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFV 303
           ++ SG+S+  ISYTSAWCVRVTSSTTYSMVGALNKLP+A SG+IFF  P+T  +VSAI V
Sbjct: 279 MILSGLSSVFISYTSAWCVRVTSSTTYSMVGALNKLPIAVSGLIFFDAPVTFPSVSAIVV 338

Query: 304 GFVAGILYSIAKTEQQKPIKPSVYIPISN 332
           GFV+GI+Y++AK +Q    K  V +P SN
Sbjct: 339 GFVSGIVYAVAKIKQNAKPKTGV-LPTSN 366



>gi|385302445|gb|EIF46576.1| gdp-mannose transporter [Dekkera bruxellensis AWRI1499]
          Length = 349

 Score =  366 bits (939), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 174/310 (56%), Positives = 234/310 (75%), Gaps = 4/310 (1%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS 70
           ++ +G + IL+YC +SILMT TNKYV+SGY FN+NF+LL +QSIVC++++   K   +++
Sbjct: 34  IANSGPISILSYCLSSILMTTTNKYVVSGYHFNLNFVLLAVQSIVCILVISTLKFFGVIT 93

Query: 71  FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCS 130
           +R+F+   ++KW PIA LLV MIYT SK+L+YLSIPVYTIFKNLTIILIAYGEVIWF   
Sbjct: 94  YRKFNKNEAKKWSPIAFLLVLMIYTSSKALRYLSIPVYTIFKNLTIILIAYGEVIWFGGE 153

Query: 131 ISRLTMTSFLLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRR 190
           ++ + + SF LMVF                      +IGY+WM  NC +SA+FVL MR+R
Sbjct: 154 VTPMALGSFFLMVFSSVVACFGDKNSEGAL----NLNIGYVWMFTNCFASASFVLFMRKR 209

Query: 191 IRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGIS 250
           I+ TNFKDFDT+YYNN+LSIP+L+  S+++EDWS +N  +N P D R  +I+A++FSG S
Sbjct: 210 IKLTNFKDFDTMYYNNILSIPILLVASILLEDWSPENLNRNFPPDNRLAVISAMIFSGAS 269

Query: 251 AFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGIL 310
           + GISY S WC+RVTSSTTYSMVGALNKLP+A SG+IFF  PI   +VS+IF+GF AG+L
Sbjct: 270 SVGISYCSGWCIRVTSSTTYSMVGALNKLPIALSGLIFFDAPINFFSVSSIFIGFAAGVL 329

Query: 311 YSIAKTEQQK 320
           Y++AK +Q++
Sbjct: 330 YAVAKQKQKE 339



>gi|119498605|ref|XP_001266060.1| Golgi GDP-mannose transporter [Neosartorya fischeri NRRL 181]
 gi|189041355|sp|A1CZJ3.1|GMT1_NEOFI RecName: Full=GDP-mannose transporter 1; Short=GMT 1
 gi|119414224|gb|EAW24163.1| Golgi GDP-mannose transporter [Neosartorya fischeri NRRL 181]
          Length = 382

 Score =  365 bits (937), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 182/341 (53%), Positives = 244/341 (71%), Gaps = 8/341 (2%)

Query: 4   PPTILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAF 63
           PP   A L+    LP+L YC +SILMTV NKYVLSG DFN+NF LL +QSIVC+V ++  
Sbjct: 36  PPA--AQLANNPILPVLAYCGSSILMTVMNKYVLSGTDFNLNFFLLCVQSIVCIVAIQTC 93

Query: 64  KMLNLVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGE 123
           K   L+++R+F+   ++KWFPI +LL+ MIYTGSK+LQYLSIPVYTIFKNLTIILIAYGE
Sbjct: 94  KSSKLITYRDFNSDEAKKWFPITLLLIGMIYTGSKALQYLSIPVYTIFKNLTIILIAYGE 153

Query: 124 VIWFDCSISRLTMTSFLLMVFXXXXXX-----XXXXXXXXXXXXXXTFDIGYLWMAFNCI 178
           V+WF  S++ +T+ SF LMV                          T + GY+WM  NC+
Sbjct: 154 VLWFGGSVTGMTLFSFGLMVLSSIIAAWADIKHAVESSGDATAKVSTLNAGYIWMLINCL 213

Query: 179 SSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRT 238
            ++++VL MR+RI+ TNFKDFDT++YNNLLSIP+L+ ++ ++EDWS  N  +N P   R 
Sbjct: 214 CTSSYVLGMRKRIKLTNFKDFDTMFYNNLLSIPVLLVLTFLMEDWSSANIARNFPPADRN 273

Query: 239 TLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNV 298
            ++ A++ SG+S+  ISYTSAWCVRVTSSTTYSMVGALNKLP+A SG+IFF  P+T  +V
Sbjct: 274 GILFAMILSGLSSVFISYTSAWCVRVTSSTTYSMVGALNKLPIALSGLIFFDAPVTFPSV 333

Query: 299 SAIFVGFVAGILYSIAKTEQQKPIKPSVYIPISNKELPQTT 339
           SAI VGF++GI+Y++AK +Q    K  V +P+SN  +  ++
Sbjct: 334 SAIVVGFISGIVYAVAKIKQSAKPKTGV-LPMSNPPVSASS 373



>gi|390596780|gb|EIN06181.1| UDP-galactose transporter [Punctularia strigosozonata HHB-11173
           SS5]
          Length = 386

 Score =  365 bits (937), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 184/346 (53%), Positives = 231/346 (66%), Gaps = 23/346 (6%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS 70
           ++ TG   I  YC ASILMTV NKYV+SG  FNMNFLLL IQS VC   + A K   ++S
Sbjct: 38  IAPTGIASIACYCVASILMTVVNKYVVSGRQFNMNFLLLAIQSSVCCACVFAVKRAGIIS 97

Query: 71  FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCS 130
           FR+F    ++ WFP++ LLV++IYTGSKSLQYL+IPVYTIFKNLTIILIAYGEV+WF   
Sbjct: 98  FRDFSTQDAKAWFPVSFLLVSVIYTGSKSLQYLNIPVYTIFKNLTIILIAYGEVLWFGGR 157

Query: 131 ISRLTMTSFLLMVFXXXXXXXXXXXXXXXXXXXXTF-------------------DIGYL 171
           ++ LT  SF+ MVF                                         ++GY 
Sbjct: 158 VTALTFVSFIFMVFSSVIAAWSDVTTASADSASEALLESEKLFQGATYASVIRNLNVGYF 217

Query: 172 WMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKN 231
           WM  NCISSA +VL MR+RI++T F D+D+++YNNLLSIP+L   S++ EDW  +N  +N
Sbjct: 218 WMLLNCISSAGYVLIMRKRIKATGFSDWDSMFYNNLLSIPVLAVFSIIAEDWGTENLIRN 277

Query: 232 LPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGD 291
            P + R  L+ AI FSG +A GISYT+AWC+R TSSTTYSMVGALNKLPVAASGMIFFGD
Sbjct: 278 FPPESRNILLFAIAFSGAAAVGISYTTAWCIRETSSTTYSMVGALNKLPVAASGMIFFGD 337

Query: 292 PITTGNVSAIFVGFVAGILYSIAKTEQQKPI----KPSVYIPISNK 333
            +T G+VSAI VGF AG+LY++AK  Q+K      +    IP+SN+
Sbjct: 338 AVTLGSVSAIGVGFFAGLLYAVAKNNQKKAESAAGRDKGIIPLSNR 383



>gi|344228537|gb|EGV60423.1| UDP-galactose transporter [Candida tenuis ATCC 10573]
 gi|344228538|gb|EGV60424.1| hypothetical protein CANTEDRAFT_116466 [Candida tenuis ATCC 10573]
          Length = 328

 Score =  364 bits (935), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 175/307 (57%), Positives = 230/307 (74%), Gaps = 2/307 (0%)

Query: 14  TGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFRE 73
           +  + I +YCA+SILMT+TNK+VLSG DFN+NF LL IQS+ C+V +   K LN++++R+
Sbjct: 15  SAPVSIFSYCASSILMTLTNKFVLSG-DFNLNFFLLAIQSVTCIVAISTLKSLNIITYRQ 73

Query: 74  FDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISR 133
           F+   ++KWFPIA LLVAMIYTGSK++QYLS+PVYTIFKNLTIILIAYGEV+WF   ++ 
Sbjct: 74  FNKDEAKKWFPIAALLVAMIYTGSKAIQYLSVPVYTIFKNLTIILIAYGEVLWFGAKVTP 133

Query: 134 LTMTSFLLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRIRS 193
           +T+ SF LMV                      + +GY WM  NC ++AAFVL M++RI+ 
Sbjct: 134 MTLGSFFLMVLSSVIAYYGDAKGVPAGDLFELY-LGYFWMFVNCFAAAAFVLIMKKRIKL 192

Query: 194 TNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFG 253
           TNFKDFDT +YNNLLSIP+L+  S + EDWS +N  KN P + RT  + A+LFSG+++ G
Sbjct: 193 TNFKDFDTTFYNNLLSIPILLVCSFLFEDWSAENVSKNFPAENRTATVMAMLFSGLTSVG 252

Query: 254 ISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSI 313
           ISY SAWCVRVTSSTTYSMVGALNKLP+A SG+IFF   +   +VS+IF+GFVAG++Y++
Sbjct: 253 ISYCSAWCVRVTSSTTYSMVGALNKLPIALSGLIFFEAAVNFFSVSSIFLGFVAGLVYAV 312

Query: 314 AKTEQQK 320
           AK +Q K
Sbjct: 313 AKQKQAK 319



>gi|68478756|ref|XP_716540.1| hypothetical protein CaO19.1232 [Candida albicans SC5314]
 gi|68478861|ref|XP_716485.1| hypothetical protein CaO19.8817 [Candida albicans SC5314]
 gi|74585870|sp|Q5A477.1|GMT_CANAL RecName: Full=GDP-mannose transporter; Short=GMT
 gi|14971021|gb|AAK74075.1|AF164627_1 Golgi GDP-mannose transporter [Candida albicans]
 gi|46438155|gb|EAK97490.1| hypothetical protein CaO19.8817 [Candida albicans SC5314]
 gi|46438211|gb|EAK97545.1| hypothetical protein CaO19.1232 [Candida albicans SC5314]
          Length = 371

 Score =  364 bits (935), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 180/304 (59%), Positives = 224/304 (73%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS 70
           +S +G + I  YC +SILMTVTNKYVLSG+ FN+NF LL +QSIVC+V + + K LN+++
Sbjct: 52  ISNSGPISIAAYCLSSILMTVTNKYVLSGFSFNLNFFLLAVQSIVCIVTIGSLKSLNIIT 111

Query: 71  FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCS 130
           +R+F+   ++KW PIA LLVAMIYT SK+LQYLSIPVYTIFKNLTIILIAYGEVIWF   
Sbjct: 112 YRQFNKDEAKKWSPIAFLLVAMIYTSSKALQYLSIPVYTIFKNLTIILIAYGEVIWFGGK 171

Query: 131 ISRLTMTSFLLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRR 190
           ++ + ++SFLLMV                        +GY WM  NC +SAAFVL MR+R
Sbjct: 172 VTTMALSSFLLMVLSSVIAYYGDNAAVKSHDDAFALYLGYFWMLTNCFASAAFVLIMRKR 231

Query: 191 IRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGIS 250
           I+ TNFKDFDT+YYNNLLSIP+L+  S + EDWS  N   N P D R T ITA++ SG S
Sbjct: 232 IKLTNFKDFDTMYYNNLLSIPILLICSFIFEDWSSANVSLNFPADNRVTTITAMILSGAS 291

Query: 251 AFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGIL 310
           + GISY SAWCVRVTSSTTYSMVGALNKLP+A SG+IFF   +   +VS+IFVGF AG++
Sbjct: 292 SVGISYCSAWCVRVTSSTTYSMVGALNKLPIALSGLIFFEAAVNFWSVSSIFVGFGAGLV 351

Query: 311 YSIA 314
           Y++A
Sbjct: 352 YAVA 355



>gi|238878798|gb|EEQ42436.1| GDP-mannose transporter [Candida albicans WO-1]
          Length = 338

 Score =  364 bits (934), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 180/304 (59%), Positives = 224/304 (73%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS 70
           +S +G + I  YC +SILMTVTNKYVLSG+ FN+NF LL +QSIVC+V + + K LN+++
Sbjct: 19  ISNSGPISIAAYCLSSILMTVTNKYVLSGFSFNLNFFLLAVQSIVCIVTIGSLKSLNIIT 78

Query: 71  FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCS 130
           +R+F+   ++KW PIA LLVAMIYT SK+LQYLSIPVYTIFKNLTIILIAYGEVIWF   
Sbjct: 79  YRQFNKDEAKKWSPIAFLLVAMIYTSSKALQYLSIPVYTIFKNLTIILIAYGEVIWFGGK 138

Query: 131 ISRLTMTSFLLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRR 190
           ++ + ++SFLLMV                        +GY WM  NC +SAAFVL MR+R
Sbjct: 139 VTTMALSSFLLMVLSSVIAYYGDNAAVKSHDDAFALYLGYFWMLTNCFASAAFVLIMRKR 198

Query: 191 IRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGIS 250
           I+ TNFKDFDT+YYNNLLSIP+L+  S + EDWS  N   N P D R T ITA++ SG S
Sbjct: 199 IKLTNFKDFDTMYYNNLLSIPILLICSFIFEDWSSANVSLNFPADNRVTTITAMILSGAS 258

Query: 251 AFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGIL 310
           + GISY SAWCVRVTSSTTYSMVGALNKLP+A SG+IFF   +   +VS+IFVGF AG++
Sbjct: 259 SVGISYCSAWCVRVTSSTTYSMVGALNKLPIALSGLIFFEAAVNFWSVSSIFVGFGAGLV 318

Query: 311 YSIA 314
           Y++A
Sbjct: 319 YAVA 322



>gi|392565536|gb|EIW58713.1| UDP-galactose transporter [Trametes versicolor FP-101664 SS1]
          Length = 375

 Score =  364 bits (934), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 183/341 (53%), Positives = 237/341 (69%), Gaps = 18/341 (5%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS 70
           ++A+   PI+ YC ASILMTV NK+V+SG  FNMNFLLL +QS VCV  +   K L ++S
Sbjct: 33  VAASSVAPIICYCIASILMTVVNKFVVSGTHFNMNFLLLCMQSSVCVACVFTVKRLGIIS 92

Query: 71  FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCS 130
           FR+FD+  ++ W+PI+++LV +IYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWF   
Sbjct: 93  FRDFDMKDAKVWWPISVMLVGVIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFGGR 152

Query: 131 ISRLTMTSFLLMVFXXX----------------XXXXXXXXXXXXXXXXXTFDIGYLWMA 174
           ++ LT+ SF+LMV                                       +IGY WM 
Sbjct: 153 VTGLTLVSFILMVASSIIAAWADISDALAIGDPAVAEAAYGLASVTGVVSKMNIGYFWMF 212

Query: 175 FNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPE 234
            NC +SAA+VLTMR+RI+ T F D+DT++YNNLLSIP+L   S++ E+W  +N  +N P 
Sbjct: 213 LNCATSAAYVLTMRKRIKLTGFSDWDTMFYNNLLSIPVLAVASIVAENWGYENLVRNFPP 272

Query: 235 DIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPIT 294
           + R  L+ AI FSG +A GISYT+AWC+R TSSTTYSMVGALNKLPVAASGMIFFGD +T
Sbjct: 273 ETRDFLLFAIAFSGAAAVGISYTTAWCIRATSSTTYSMVGALNKLPVAASGMIFFGDRVT 332

Query: 295 TGNVSAIFVGFVAGILYSIAKTEQQKPIKPSVY--IPISNK 333
            G+V+A+ VGF AG++Y++AK  Q+K    S    IP++N+
Sbjct: 333 FGSVTAVSVGFFAGLVYAVAKNNQKKAETASQQGVIPLTNR 373



>gi|448084751|ref|XP_004195682.1| Piso0_005084 [Millerozyma farinosa CBS 7064]
 gi|359377104|emb|CCE85487.1| Piso0_005084 [Millerozyma farinosa CBS 7064]
          Length = 356

 Score =  363 bits (931), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 170/304 (55%), Positives = 226/304 (74%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDL 76
           L +++YCA+SILMT+TNKYV+S YDFN+ F LL +Q IVC++ +   K L L+++R+F+ 
Sbjct: 43  LSVVSYCASSILMTITNKYVVSAYDFNLYFFLLAVQCIVCLMTIAVLKSLGLITYRQFNK 102

Query: 77  ALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTM 136
             + KW PIA LLV  +YT SK+L+YLSIPVYTIFKNLTII+IAYGEV+WF   ++ + +
Sbjct: 103 DEATKWSPIAFLLVVTLYTSSKALKYLSIPVYTIFKNLTIIVIAYGEVLWFGGKVTSMAL 162

Query: 137 TSFLLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRIRSTNF 196
           +SF LMVF                    +  +GY WM  NC +SAAFVL MR+RI+ TNF
Sbjct: 163 SSFFLMVFSSVIAYYGDTSSAKTASDTLSLYLGYFWMFTNCFASAAFVLIMRKRIKLTNF 222

Query: 197 KDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFGISY 256
           KDFDT++YNNLL +P+ +  S + EDWS +N  +N PE  RT+ I A++FSG+S+ GISY
Sbjct: 223 KDFDTMFYNNLLGVPMFLVSSFVFEDWSAENLVRNFPEANRTSTIMAMIFSGMSSVGISY 282

Query: 257 TSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSIAKT 316
            SAWCVRVTSSTTYSMVGALNKLP+A SG+IFFG  +   +VS+IFVGF+AG++Y++AK 
Sbjct: 283 CSAWCVRVTSSTTYSMVGALNKLPIALSGLIFFGGAVNFFSVSSIFVGFIAGLVYAVAKQ 342

Query: 317 EQQK 320
           +QQK
Sbjct: 343 KQQK 346



>gi|145253861|ref|XP_001398443.1| GDP-mannose transporter 1 [Aspergillus niger CBS 513.88]
 gi|189041362|sp|A2R9P4.1|GMT_ASPNC RecName: Full=GDP-mannose transporter; Short=GMT
 gi|134084019|emb|CAL00557.1| unnamed protein product [Aspergillus niger]
 gi|350634092|gb|EHA22456.1| hypothetical protein ASPNIDRAFT_214109 [Aspergillus niger ATCC
           1015]
          Length = 381

 Score =  363 bits (931), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 182/330 (55%), Positives = 238/330 (72%), Gaps = 9/330 (2%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS 70
           LS    LP+L YC +SILMTV NKYVLSG DFN+NF LL IQS+VC++ ++  K   L++
Sbjct: 40  LSNNPILPVLAYCGSSILMTVMNKYVLSGTDFNLNFFLLCIQSLVCIIAIQTCKSCGLIT 99

Query: 71  FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCS 130
           +R+F    +RKWFPI +LL+ MIYTGSK+LQ+LSIPVYTIFKNLTIILIAYGEV+WF  S
Sbjct: 100 YRDFSADEARKWFPITLLLIGMIYTGSKALQFLSIPVYTIFKNLTIILIAYGEVLWFGGS 159

Query: 131 ISRLTMTSFLLMVFXXXXXX-----XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVL 185
           ++ LT+ SF LMV                          T + GY+WM  NC+ ++++VL
Sbjct: 160 VTGLTLFSFGLMVLSSIIAAWADIKHAVESNGDATAKVSTLNAGYIWMLVNCLCTSSYVL 219

Query: 186 TMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAIL 245
            MR+RI+ TNFKDFDT++YNNLLSIP+L+ +S  +EDWS  N  +N P   R +++ A++
Sbjct: 220 GMRKRIKLTNFKDFDTMFYNNLLSIPVLIVLSAFLEDWSSTNVNRNFPPMDRNSIVFAMI 279

Query: 246 FSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGF 305
            SG+S+  ISYTSAWCVRVTSSTTYSMVGALNKLP+A SG+IFF  P+T  +VSAI VGF
Sbjct: 280 LSGLSSVFISYTSAWCVRVTSSTTYSMVGALNKLPIAISGLIFFDAPVTFPSVSAIVVGF 339

Query: 306 VAGILYSIAKTEQQ-KP---IKPSVYIPIS 331
           V+GI+Y++AK +Q  KP   + P+   P+S
Sbjct: 340 VSGIVYAVAKIKQNAKPRTGVLPTANPPVS 369



>gi|302685884|ref|XP_003032622.1| hypothetical protein SCHCODRAFT_81942 [Schizophyllum commune H4-8]
 gi|300106316|gb|EFI97719.1| hypothetical protein SCHCODRAFT_81942 [Schizophyllum commune H4-8]
          Length = 383

 Score =  362 bits (930), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 181/342 (52%), Positives = 235/342 (68%), Gaps = 16/342 (4%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS 70
           +++  TL +L YC ASILMT+ NKYV+SG  F+M FLLL IQS VC  ++   K   L+S
Sbjct: 42  IASQATLSVLCYCVASILMTLVNKYVVSGTHFSMTFLLLCIQSSVCSAVVYGCKAAGLIS 101

Query: 71  FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCS 130
           FR+FD+  ++ WFPI+ LLV +IYTGSKSLQ+LSIP+YTIFKNLTIILIAYGE IWF   
Sbjct: 102 FRDFDMKDAKAWFPISFLLVWVIYTGSKSLQFLSIPIYTIFKNLTIILIAYGEKIWFGGR 161

Query: 131 ISRLTMTSFLLMVFXXXXXXXXXXXXXX--------------XXXXXXTFDIGYLWMAFN 176
           I+ LT  SF+ MVF                                    ++GY WM  N
Sbjct: 162 ITTLTFISFIFMVFSSLIAASSDLSFSIPTTLSTGTPLNLDGMGSAVRNLNVGYFWMLIN 221

Query: 177 CISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDI 236
           C++SAA+VL MR+RI++T F D+D+++YNN+LSIP+L   S ++EDW  +N  +N P + 
Sbjct: 222 CLASAAYVLFMRKRIKATGFSDWDSMFYNNMLSIPVLALFSFIIEDWGSENLTRNFPPET 281

Query: 237 RTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTG 296
           R TL+ AI FSG +A GISYT+AWCVRVTSSTTYSM GALNKLPVA SGM+FFGDP+T G
Sbjct: 282 RGTLLFAIAFSGAAAVGISYTTAWCVRVTSSTTYSMTGALNKLPVALSGMLFFGDPVTFG 341

Query: 297 NVSAIFVGFVAGILYSIAKTEQQK--PIKPSVYIPISNKELP 336
           +VSAI +GF AG+LY+IAK  Q+K    +    +P++ +E P
Sbjct: 342 SVSAIAMGFFAGVLYAIAKNNQKKEEARQAPPALPLARRESP 383



>gi|396495906|ref|XP_003844659.1| similar to golgi GDP-mannose transporter [Leptosphaeria maculans
           JN3]
 gi|312221239|emb|CBY01180.1| similar to golgi GDP-mannose transporter [Leptosphaeria maculans
           JN3]
          Length = 383

 Score =  362 bits (929), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 180/330 (54%), Positives = 234/330 (70%), Gaps = 11/330 (3%)

Query: 19  ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLAL 78
           IL YC +SILMTVTNKYVLSG DFN+NF LL +QSIVCV  +   K   L+++R+F+   
Sbjct: 47  ILGYCGSSILMTVTNKYVLSGVDFNLNFFLLCVQSIVCVAAIAICKAAGLITYRDFNTDE 106

Query: 79  SRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTS 138
           ++KWFPI++LL+ MIYT + +L+YLSIPVYTIFKNLTIILIAYGEV+WF  +++ + + S
Sbjct: 107 AKKWFPISLLLIGMIYTSTWALKYLSIPVYTIFKNLTIILIAYGEVLWFGGAVTPMALFS 166

Query: 139 FLLMVFXXXXXXXXXXXXXXXXX---------XXXTFDIGYLWMAFNCISSAAFVLTMRR 189
           F LMV                              T   GYLWM FNC+ +A +VL M++
Sbjct: 167 FGLMVLSSIIAAWADIQHALSSMGQSGGGNTDAITTLHAGYLWMMFNCLCTATYVLGMKK 226

Query: 190 RIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGI 249
           RI+ TNFKDFDT+YYNNLL+IP+L   S+++EDWS  N EKN P D R T+I+ ++ SG+
Sbjct: 227 RIKLTNFKDFDTMYYNNLLTIPVLFVASILMEDWSPANIEKNFPTDRRNTVISVMIISGL 286

Query: 250 SAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGI 309
           S   ISY+SAW VRVTSSTTYSMVGALNKLP+A SG+IFF  P+T G+VSAIFVGFV+G+
Sbjct: 287 STVFISYSSAWAVRVTSSTTYSMVGALNKLPIALSGLIFFDAPVTFGSVSAIFVGFVSGL 346

Query: 310 LYSIAKTEQQKPIKPSVYIPISNKELPQTT 339
           +Y++AK  Q    KP   +P+SN  L  ++
Sbjct: 347 VYALAKVRQNA--KPKHVLPVSNVPLSASS 374



>gi|451854420|gb|EMD67713.1| hypothetical protein COCSADRAFT_111755 [Bipolaris sorokiniana
           ND90Pr]
          Length = 384

 Score =  362 bits (928), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 179/330 (54%), Positives = 234/330 (70%), Gaps = 11/330 (3%)

Query: 19  ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLAL 78
           IL YC +SILMTVTNKYVLSG DFN+ F LL IQS+VCV  +   K   ++++R+F+   
Sbjct: 48  ILAYCGSSILMTVTNKYVLSGVDFNLPFFLLCIQSVVCVAAISICKSAGIITYRDFNSDE 107

Query: 79  SRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTS 138
           ++KWFPI++LL+ MIYT + +L++LSIPVYTIFKNLTIILIAYGEV+WF  +++ + + S
Sbjct: 108 AKKWFPISLLLIGMIYTSTWALKFLSIPVYTIFKNLTIILIAYGEVLWFGGAVTPMALFS 167

Query: 139 FLLMVFXXXXXX---------XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRR 189
           F LMVF                             T   GYLWM FNC+ +A +VL MR+
Sbjct: 168 FGLMVFSSVIAAWADIQHALSSMGQSTSASTDAMSTLHAGYLWMMFNCLCTATYVLGMRK 227

Query: 190 RIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGI 249
           RI+ TNFKDFDT+YYNNLL+IP+L+  S++VEDWS  N +KN P D R T+IT ++ SG+
Sbjct: 228 RIKLTNFKDFDTMYYNNLLTIPILLVASILVEDWSSANIQKNFPPDQRNTVITVMVVSGL 287

Query: 250 SAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGI 309
           S   ISYTSAW VRVTSSTTYSMVGALNKLP+A SG+IFF  P+T G+VSAIF+GFV+G+
Sbjct: 288 STVFISYTSAWAVRVTSSTTYSMVGALNKLPIALSGLIFFDAPVTFGSVSAIFIGFVSGL 347

Query: 310 LYSIAKTEQQKPIKPSVYIPISNKELPQTT 339
           +Y++AK  Q    +P   +P SN  L  ++
Sbjct: 348 VYALAKIRQNS--QPKTVLPTSNIPLSASS 375



>gi|472587269|gb|EMS24768.1| GDP-mannose transporter [Rhodosporidium toruloides NP11]
          Length = 380

 Score =  362 bits (928), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 180/322 (55%), Positives = 230/322 (71%), Gaps = 5/322 (1%)

Query: 16  TLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFD 75
            LP++ YCA+SILMTV NK+V+SG  FNMNFLLL IQS+VCV  +   K L +++FR++D
Sbjct: 56  ALPVMCYCASSILMTVVNKFVVSGKGFNMNFLLLTIQSVVCVGCVITAKRLGVITFRDWD 115

Query: 76  LALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLT 135
              +RKWFPI+ LLV++IYTGSKSLQYLS+PVYTIFKNLTIILIAYGEV+WF  S++ LT
Sbjct: 116 REDARKWFPISFLLVSVIYTGSKSLQYLSVPVYTIFKNLTIILIAYGEVLWFGGSVTPLT 175

Query: 136 MTSFLLMVFXXXXXXXX-----XXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRR 190
           + SF LMV                              GY WM  NC  SA +VL MR+R
Sbjct: 176 LVSFFLMVLSSMMAASPDILNWLNGVQAAPKPGGQSSAGYAWMMVNCFVSAGYVLAMRKR 235

Query: 191 IRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGIS 250
           I+ TNFKD+D+++YNNLLSIP+L+  SL+ E+W+  N  KN PE+ R++L++ + FSG +
Sbjct: 236 IKVTNFKDWDSMFYNNLLSIPVLVFFSLIFENWTGANLAKNFPEETRSSLLSLMAFSGAA 295

Query: 251 AFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGIL 310
           A  ISY +AW VR TSSTT+SMVGALNKLPVAASG++FFGDP T  NVS+I VGF AG++
Sbjct: 296 AVFISYCTAWTVRTTSSTTFSMVGALNKLPVAASGILFFGDPATFANVSSILVGFFAGLV 355

Query: 311 YSIAKTEQQKPIKPSVYIPISN 332
           YS AKT Q    KP+V + +  
Sbjct: 356 YSAAKTAQSSAAKPNVPVELGK 377



>gi|170105052|ref|XP_001883739.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|189041718|sp|B0DI84.1|GMT_LACBS RecName: Full=GDP-mannose transporter; Short=GMT
 gi|164641374|gb|EDR05635.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 340

 Score =  362 bits (928), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 184/327 (56%), Positives = 235/327 (71%), Gaps = 10/327 (3%)

Query: 18  PILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLA 77
           PIL YC ASILMTV NK+V+SG  F+MNFLLL IQS VCVV +   K   ++SFR FD+ 
Sbjct: 13  PILCYCCASILMTVVNKFVVSGAHFSMNFLLLCIQSTVCVVCVATVKKFGIISFRSFDMQ 72

Query: 78  LSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMT 137
            ++ WFPI+ LLV +IYTGSKSLQ+LSIPVYTIFKNLTIILIAYGEVIWF   ++ LT  
Sbjct: 73  DAKAWFPISFLLVTVIYTGSKSLQFLSIPVYTIFKNLTIILIAYGEVIWFGGRVTALTFV 132

Query: 138 SFLLMVFXXXXXXXXXXXXXXXXXXXXT-------FDIGYLWMAFNCISSAAFVLTMRRR 190
           SF+ MV                     T        ++GY WM  NC++SAA+VL MR+R
Sbjct: 133 SFIFMVISSMIAAWSDVSSGLSGSVPATIAGAVRGLNVGYFWMLVNCLTSAAYVLAMRKR 192

Query: 191 IRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGIS 250
           I+ T F D+D+++YNNLLSIP+L   S++VEDW  +N  +N P + R+ L+TAI FSG +
Sbjct: 193 IKVTGFSDWDSMFYNNLLSIPVLAIFSIVVEDWGLENLGRNFPAETRSFLLTAIAFSGAA 252

Query: 251 AFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGIL 310
           A GISYT+AWCVR TSSTTYSMVGALNKLPVAASGM+FFGD +T G+VSA+ VGF AGI+
Sbjct: 253 AVGISYTTAWCVRTTSSTTYSMVGALNKLPVAASGMLFFGDAVTFGSVSAVGVGFFAGIV 312

Query: 311 YSIAKTEQQKP---IKPSVYIPISNKE 334
           Y++AK  Q+K    ++    IP+++++
Sbjct: 313 YAVAKNNQKKTEGRLQADAIIPLASRK 339



>gi|358373314|dbj|GAA89913.1| golgi GDP-mannose transporter [Aspergillus kawachii IFO 4308]
          Length = 381

 Score =  362 bits (928), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 182/330 (55%), Positives = 237/330 (71%), Gaps = 9/330 (2%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS 70
           LS    LP+L YC +SILMTV NKYVLSG DFN+NF LL IQS+VC++ ++  K   L++
Sbjct: 40  LSNNPILPVLAYCGSSILMTVMNKYVLSGTDFNLNFFLLCIQSLVCIIAIQTCKSCGLIT 99

Query: 71  FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCS 130
           +R+F    +RKWFPI +LL+ MIYTGSK+LQ+LSIPVYTIFKNLTIILIAYGEV+WF  S
Sbjct: 100 YRDFSADEARKWFPITLLLIGMIYTGSKALQFLSIPVYTIFKNLTIILIAYGEVLWFGGS 159

Query: 131 ISRLTMTSFLLMVFXXXXXX-----XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVL 185
           ++ LT+ SF LMV                          T + GY+WM  NC+ ++++VL
Sbjct: 160 VTGLTLFSFGLMVLSSIIAAWADIKHAVESNGDATAKMSTLNAGYVWMLVNCLCTSSYVL 219

Query: 186 TMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAIL 245
            MR+RI+ TNFKDFDT++YNNLLSIP+L+ +S  +EDWS  N  +N P   R +++ A++
Sbjct: 220 GMRKRIKLTNFKDFDTMFYNNLLSIPVLIVLSAFLEDWSSTNVNRNFPPVDRNSIVFAMI 279

Query: 246 FSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGF 305
            SG+S   ISYTSAWCVRVTSSTTYSMVGALNKLP+A SG+IFF  P+T  +VSAI VGF
Sbjct: 280 LSGLSTVFISYTSAWCVRVTSSTTYSMVGALNKLPIAISGLIFFDAPVTFPSVSAIVVGF 339

Query: 306 VAGILYSIAKTEQQ-KP---IKPSVYIPIS 331
           V+GI+Y++AK +Q  KP   + P+   P+S
Sbjct: 340 VSGIVYAVAKIKQNAKPRTGVLPTANPPVS 369



>gi|296417330|ref|XP_002838311.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295634239|emb|CAZ82502.1| unnamed protein product [Tuber melanosporum]
          Length = 380

 Score =  361 bits (927), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 183/332 (55%), Positives = 236/332 (71%), Gaps = 11/332 (3%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDL 76
            PIL+YC ASILMTVTNKYVLSGYDFN+NF L  +QSIVCVV +   K +  + +R+F +
Sbjct: 40  FPILSYCGASILMTVTNKYVLSGYDFNLNFFLCMVQSIVCVVAIAIGKSMGYIKYRDFSM 99

Query: 77  ALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTM 136
             +RKWFPI++LL+ MIYT SK+LQ+LSIPVYTIFKNLTIILIAYGEV+WF  S++ + +
Sbjct: 100 DEARKWFPISVLLILMIYTSSKALQFLSIPVYTIFKNLTIILIAYGEVLWFGGSVTGMAL 159

Query: 137 TSFLLMVFXXXXXXXX---------XXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTM 187
            SF LMV                              T + GY+WM  NC+SSA++VL M
Sbjct: 160 FSFGLMVLSSVVAAWADISAAIDNYGHSSTETAAALSTLNAGYIWMLINCLSSASYVLGM 219

Query: 188 RRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFS 247
           R+RI+ TNFKDFDT++YNNLLSIP+L   SL+ EDWS  N   N PE+ R  +I A++FS
Sbjct: 220 RKRIKLTNFKDFDTMFYNNLLSIPVLFFSSLLFEDWSSTNINLNFPEERRNNIIIAMIFS 279

Query: 248 GISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVA 307
           G+S+  ISYTSAWCVR TSSTTYSMVGALNKLP+A SG+IFF  P+T  +V+AI +GF +
Sbjct: 280 GLSSIFISYTSAWCVRTTSSTTYSMVGALNKLPLAISGLIFFDAPVTFFSVTAIGIGFFS 339

Query: 308 GILYSIAKTEQQKPIKPSVYIPISNKELPQTT 339
           GI+Y++AK +Q +  K  V +P SN  +  ++
Sbjct: 340 GIVYALAKVKQSQS-KTGV-LPTSNPTMSASS 369



>gi|115438488|ref|XP_001218079.1| GDP-mannose transporter [Aspergillus terreus NIH2624]
 gi|121733937|sp|Q0CA27.1|GMT_ASPTN RecName: Full=GDP-mannose transporter; Short=GMT
 gi|114188894|gb|EAU30594.1| GDP-mannose transporter [Aspergillus terreus NIH2624]
          Length = 384

 Score =  361 bits (927), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 181/330 (54%), Positives = 238/330 (72%), Gaps = 8/330 (2%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDL 76
           LP+L YC +SILMTV NKYVLSG DFN+NF LL +QSIVC+V ++  K   L+++R+F  
Sbjct: 47  LPVLAYCGSSILMTVMNKYVLSGLDFNLNFFLLCVQSIVCIVAIQTCKSCGLITYRDFSA 106

Query: 77  ALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTM 136
             +RKWFPI +LL+ MIYTGSK+LQ+LSIPVYTIFKNLTIILIAYGEV+WF  S++ LT+
Sbjct: 107 DEARKWFPITLLLIGMIYTGSKALQFLSIPVYTIFKNLTIILIAYGEVLWFGGSVTGLTL 166

Query: 137 TSFLLMVFXXXXXX-----XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRI 191
            SF LMV                          T + GY+WM  NC+ ++++VL MR+RI
Sbjct: 167 FSFGLMVLSSIIAAWADIKHAVESTGDATAKVSTLNAGYIWMLVNCLCTSSYVLGMRKRI 226

Query: 192 RSTNFKDFDTV--YYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGI 249
           + TNFKDFDT+  +YNNLLSIP+L+ ++ ++EDWS  N  +N P   R  +I A++ SG+
Sbjct: 227 KLTNFKDFDTLAMFYNNLLSIPVLIVLTGLMEDWSSANITRNFPPADRNNIIFAMILSGL 286

Query: 250 SAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGI 309
           S+  ISYTSAWCVRVTSSTTYSMVGALNKLP+A SG+IFF  P+T  +VSAI VGFV+GI
Sbjct: 287 SSVFISYTSAWCVRVTSSTTYSMVGALNKLPIALSGLIFFDAPVTFPSVSAIVVGFVSGI 346

Query: 310 LYSIAKTEQQKPIKPSVYIPISNKELPQTT 339
           +Y++AK +Q    K  V +P+SN  +  ++
Sbjct: 347 VYAVAKIKQNAKPKTGV-LPMSNPPVSASS 375



>gi|212536064|ref|XP_002148188.1| Golgi GDP-mannose transporter [Talaromyces marneffei ATCC 18224]
 gi|210070587|gb|EEA24677.1| Golgi GDP-mannose transporter [Talaromyces marneffei ATCC 18224]
          Length = 375

 Score =  361 bits (926), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 184/331 (55%), Positives = 240/331 (72%), Gaps = 10/331 (3%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS 70
           LS    LP+L YC +SI+MTV NKYVLSG DFN+NF LL +QSIVC+V ++A K    ++
Sbjct: 33  LSNNPILPVLAYCGSSIMMTVMNKYVLSGLDFNLNFFLLLVQSIVCIVAIQACKTGGFIT 92

Query: 71  FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCS 130
           FR F+   ++KWFPI +LL+ MI+TGSK+LQ+LSIPVYTIFKNLTIILIAYGEV+WF  S
Sbjct: 93  FRNFNTDEAKKWFPITLLLIGMIFTGSKALQFLSIPVYTIFKNLTIILIAYGEVLWFGGS 152

Query: 131 -ISRLTMTSFLLMVFXXXXXX-----XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFV 184
            ++ LT+ SF LMV                          T + GY+WM  NC+ +A + 
Sbjct: 153 AVTGLTLFSFGLMVASSIIAAWADVQHALTSTTNASTQISTLNAGYVWMMANCLCTAFYS 212

Query: 185 LTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAI 244
           L MR+RI+ TNFKDFDT++YNNLLSIP+L+  +L++EDWS +N  +N P   RT ++ A+
Sbjct: 213 LYMRKRIKLTNFKDFDTMFYNNLLSIPVLIVATLLIEDWSAENIARNFPIASRTNILIAM 272

Query: 245 LFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVG 304
           + SG+S+  ISYTSAWC+RVTSSTTYSMVGALNKLP+A SG+IFF  P+T G+VSAI +G
Sbjct: 273 VLSGLSSVFISYTSAWCMRVTSSTTYSMVGALNKLPIAVSGLIFFDAPVTLGSVSAIAIG 332

Query: 305 FVAGILYSIAKTEQQ-KP---IKPSVYIPIS 331
           FV+GI+YS+AK +Q  KP   I P+  IP+S
Sbjct: 333 FVSGIVYSVAKFKQNAKPRTGILPTTNIPLS 363



>gi|448080268|ref|XP_004194583.1| Piso0_005084 [Millerozyma farinosa CBS 7064]
 gi|359376005|emb|CCE86587.1| Piso0_005084 [Millerozyma farinosa CBS 7064]
          Length = 356

 Score =  361 bits (926), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 169/304 (55%), Positives = 226/304 (74%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDL 76
           L +++YCA+SILMT+TNKYV+S Y+FN+ F LL +Q IVC++ +   K L L++FR+F+ 
Sbjct: 43  LSVISYCASSILMTITNKYVVSAYEFNLYFFLLAVQCIVCLLTIYVLKSLGLITFRQFNK 102

Query: 77  ALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTM 136
             + KW PIA LLV  +YT SK+L+YLSIPVYTIFKNLTII+IAYGEV+WF   ++ + +
Sbjct: 103 DEATKWSPIAFLLVVTLYTSSKALKYLSIPVYTIFKNLTIIVIAYGEVLWFGGKVTSMAL 162

Query: 137 TSFLLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRIRSTNF 196
           +SF LMVF                    +  +GY WM  NC +SAAFVL MR+RI+ TNF
Sbjct: 163 SSFFLMVFSSVIAYYGDTSSAKTASDTLSLYLGYFWMFSNCFASAAFVLIMRKRIKLTNF 222

Query: 197 KDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFGISY 256
           KDFDT++YNNLL +P+ +  S + EDWS +N  +N PE  RT+ I A++FSG+S+ GISY
Sbjct: 223 KDFDTMFYNNLLGVPMFLVSSFVFEDWSAENLARNFPEANRTSTIMAMVFSGMSSVGISY 282

Query: 257 TSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSIAKT 316
            SAWCVRVTSSTTYSMVGALNKLP+A SG+IFFG  +   +VS+IF+GF+AG++Y++AK 
Sbjct: 283 CSAWCVRVTSSTTYSMVGALNKLPIALSGLIFFGGAVNFFSVSSIFLGFLAGLVYAVAKQ 342

Query: 317 EQQK 320
           +QQK
Sbjct: 343 KQQK 346



>gi|482812641|gb|EOA89360.1| hypothetical protein SETTUDRAFT_167862 [Setosphaeria turcica Et28A]
          Length = 383

 Score =  360 bits (925), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 176/330 (53%), Positives = 233/330 (70%), Gaps = 11/330 (3%)

Query: 19  ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLAL 78
           IL YC +SILMTVTNKYVLSG DFN+NF LL +QS+VCV  +   K   ++++R+F+   
Sbjct: 47  ILAYCGSSILMTVTNKYVLSGVDFNLNFFLLCVQSVVCVAAISICKAAGIITYRDFNSDE 106

Query: 79  SRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTS 138
           ++KWFPI++LL+ MIYT + +L++LSIPVYTIFKNLTIILIAYGEV+WF  +++ + + S
Sbjct: 107 AKKWFPISLLLIGMIYTSTWALKFLSIPVYTIFKNLTIILIAYGEVLWFGGAVTPMALFS 166

Query: 139 FLLMVFXX---------XXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRR 189
           F LMVF                             T   GYLWM FNC+ +A +VL MR+
Sbjct: 167 FGLMVFSSVIAAWADIQHALASMNNSSAASTDAMSTLHAGYLWMMFNCLCTATYVLGMRK 226

Query: 190 RIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGI 249
           RI+ TNFKDFDT+YYNNLL+IP+L+  S++VEDWS  N +KN P D R T++  ++ SG+
Sbjct: 227 RIKLTNFKDFDTMYYNNLLTIPILLVASILVEDWSSANIQKNFPPDQRNTVMIVMIVSGL 286

Query: 250 SAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGI 309
           S   ISYTSAW VRVTSSTTYSMVGALNKLP+A SG++FF  P+T G+VSAI VGF++G+
Sbjct: 287 STVFISYTSAWAVRVTSSTTYSMVGALNKLPIALSGLVFFDAPVTFGSVSAIIVGFISGL 346

Query: 310 LYSIAKTEQQKPIKPSVYIPISNKELPQTT 339
           +Y++AK  Q    KP   +P SN  L  ++
Sbjct: 347 VYALAKIRQNS--KPKTILPTSNMPLSASS 374



>gi|320581626|gb|EFW95846.1| GDP-mannose transporter [Ogataea parapolymorpha DL-1]
          Length = 339

 Score =  360 bits (925), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 179/316 (56%), Positives = 233/316 (73%), Gaps = 8/316 (2%)

Query: 3   QPP----TILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVV 58
           QPP    ++L+ L+ +G + I  YCA+SILMTVTNKYV+SG DFN+NF LL +QSIVC++
Sbjct: 14  QPPPQSSSLLSQLANSGPVSIFAYCASSILMTVTNKYVVSG-DFNLNFFLLAVQSIVCLI 72

Query: 59  LLRAFKMLNLVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIIL 118
            +   K L ++++REF+   ++KW PIA LLV MIYT SK+LQ+L+IPVYTIFKNLTIIL
Sbjct: 73  TISILKFLGIITYREFNYIEAKKWSPIAFLLVGMIYTSSKALQFLTIPVYTIFKNLTIIL 132

Query: 119 IAYGEVIWFDCSISRLTMTSFLLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCI 178
           IAYGEV+WF  S++ + + SF+LMV                      F +GY WM  NC 
Sbjct: 133 IAYGEVLWFGGSVTSMALGSFILMVLSSVVACYGDKDSSTGNM---VFGVGYFWMFLNCF 189

Query: 179 SSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRT 238
           SSA FVL MR+RI+ TNFKDFDT++YNNLLSIP+L+  S ++EDWS +N   N PE  R 
Sbjct: 190 SSATFVLCMRKRIKLTNFKDFDTMFYNNLLSIPILLIASFVLEDWSPENVAVNFPEANRN 249

Query: 239 TLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNV 298
           ++I A++FSG S+ GISY S WC+RVTSSTTYSMVGALNKLP+A SG+IFF  PI   ++
Sbjct: 250 SVIFAMIFSGASSVGISYCSGWCIRVTSSTTYSMVGALNKLPIALSGLIFFDAPINFFSI 309

Query: 299 SAIFVGFVAGILYSIA 314
           S+IF+GFVAGI+Y++A
Sbjct: 310 SSIFIGFVAGIVYAVA 325



>gi|449301339|gb|EMC97350.1| hypothetical protein BAUCODRAFT_448796 [Baudoinia compniacensis
           UAMH 10762]
          Length = 391

 Score =  360 bits (925), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 179/338 (52%), Positives = 235/338 (69%), Gaps = 18/338 (5%)

Query: 2   AQPPTILAFLSATG-------TLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSI 54
           AQP  I+  + A         T+ IL YC +SILMTVTNKYVLSG +FN+NFLLL +QSI
Sbjct: 23  AQPKPIIPSMPAAASSLNNNPTISILAYCGSSILMTVTNKYVLSGTNFNLNFLLLAVQSI 82

Query: 55  VCVVLLRAFKMLNLVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNL 114
           VC++ +++ K   ++++R+F+   +RKWFPI++LL+ MI+T +K+LQ+LSIPVYTIFKNL
Sbjct: 83  VCIIAIQSCKSAGVITYRDFNTDEARKWFPISLLLIGMIWTSTKALQFLSIPVYTIFKNL 142

Query: 115 TIILIAYGEVIWFDCSISRLTMTSFLLMVFXXXXXX-----------XXXXXXXXXXXXX 163
           TIILIAYGEV+WF  S++ + + SF LMV                               
Sbjct: 143 TIILIAYGEVLWFGGSVTPMALLSFGLMVLSSVIAAWADIQHALTAYSGDAVTGEAAAKL 202

Query: 164 XTFDIGYLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDW 223
            T + GY+WM  NC  SAA+VL MR+RI+ TNFKDFDT+YYNNLLSIP+L+  SL +E+W
Sbjct: 203 STLNAGYIWMMLNCFCSAAYVLGMRKRIKLTNFKDFDTMYYNNLLSIPILVLCSLFLENW 262

Query: 224 SEKNFEKNLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAA 283
           S  N   N P + R  +I  ++ SG+S+  ISYTSAWCVR+TSSTTYSMVGALNKLP+A 
Sbjct: 263 SSANLNLNFPPETRNWMIATMIISGLSSVFISYTSAWCVRITSSTTYSMVGALNKLPIAL 322

Query: 284 SGMIFFGDPITTGNVSAIFVGFVAGILYSIAKTEQQKP 321
           SG+IFF  P T  +VSAI VGFV+G++Y++AK  Q KP
Sbjct: 323 SGLIFFDAPFTLASVSAIMVGFVSGLVYAVAKMRQPKP 360



>gi|189190012|ref|XP_001931345.1| GDP-mannose transporter [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|187972951|gb|EDU40450.1| GDP-mannose transporter [Pyrenophora tritici-repentis Pt-1C-BFP]
          Length = 382

 Score =  360 bits (925), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 176/330 (53%), Positives = 233/330 (70%), Gaps = 11/330 (3%)

Query: 19  ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLAL 78
           IL YC +SILMTVTNKYVLSG DFN+NF LL +QS+VCV  +   K   ++++R+F+   
Sbjct: 46  ILAYCGSSILMTVTNKYVLSGVDFNLNFFLLCVQSVVCVAAISICKAAGIITYRDFNSDE 105

Query: 79  SRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTS 138
           ++KWFPI++LL+ MIYT + +L++LSIPVYTIFKNLTIILIAYGEV+WF  +++ + + S
Sbjct: 106 AKKWFPISLLLIGMIYTSTWALKFLSIPVYTIFKNLTIILIAYGEVLWFGGAVTPMALFS 165

Query: 139 FLLMVFXXXXXX---------XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRR 189
           F LMV                              T   GYLWM FNC+ +A +VL MR+
Sbjct: 166 FGLMVLSSVIAAWADIQHALSSMSQATSATTDAMSTLHAGYLWMMFNCLCTATYVLGMRK 225

Query: 190 RIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGI 249
           RI+ TNFKDFDT+YYNNLL+IP+L+  S++VEDWS  N +KN P + R T+I  ++ SG+
Sbjct: 226 RIKLTNFKDFDTMYYNNLLTIPILLIASILVEDWSSANIQKNFPTEQRNTVIVVMIVSGL 285

Query: 250 SAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGI 309
           S   ISYTSAW VRVTSSTTYSMVGALNKLP+A SG++FF  P+T G+VSAIFVGFV+G+
Sbjct: 286 STVFISYTSAWAVRVTSSTTYSMVGALNKLPIALSGLVFFDAPVTFGSVSAIFVGFVSGL 345

Query: 310 LYSIAKTEQQKPIKPSVYIPISNKELPQTT 339
           +Y++AK  Q    KP   +P +N  L  ++
Sbjct: 346 VYALAKVRQNS--KPKTVLPTTNIPLSASS 373



>gi|451999497|gb|EMD91959.1| hypothetical protein COCHEDRAFT_1223913 [Bipolaris maydis C5]
 gi|477585469|gb|ENI02557.1| hypothetical protein COCC4DRAFT_201619 [Bipolaris maydis ATCC
           48331]
          Length = 384

 Score =  360 bits (924), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 179/330 (54%), Positives = 234/330 (70%), Gaps = 11/330 (3%)

Query: 19  ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLAL 78
           IL YC +SILMTVTNKYVLSG DFN+ F LL +QSIVCV  +   K   ++++R+F+   
Sbjct: 48  ILAYCGSSILMTVTNKYVLSGVDFNLPFFLLCVQSIVCVAAISICKSAGIITYRDFNSDE 107

Query: 79  SRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTS 138
           ++KWFPI++LL+ MIYT + +L++LSIPVYTIFKNLTIILIAYGEV+WF  +++ + + S
Sbjct: 108 AKKWFPISLLLIGMIYTSTWALKFLSIPVYTIFKNLTIILIAYGEVLWFGGAVTPMALFS 167

Query: 139 FLLMVFXXXXXX---------XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRR 189
           F LMVF                             T   GYLWM FNC+ +A +VL MR+
Sbjct: 168 FGLMVFSSVIAAWADIQHALSSMGQSTSASTDAMSTLHAGYLWMMFNCLCTATYVLGMRK 227

Query: 190 RIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGI 249
           RI+ TNFKDFDT+YYNNLL+IP+L+  S++VEDWS  N +KN P + R T+IT ++ SG+
Sbjct: 228 RIKLTNFKDFDTMYYNNLLTIPILLVASILVEDWSSANIQKNFPPNQRNTVITVMVVSGL 287

Query: 250 SAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGI 309
           S   ISYTSAW VRVTSSTTYSMVGALNKLP+A SG+IFF  P+T G+VSAIFVGFV+G+
Sbjct: 288 STVFISYTSAWAVRVTSSTTYSMVGALNKLPIALSGLIFFDAPVTFGSVSAIFVGFVSGL 347

Query: 310 LYSIAKTEQQKPIKPSVYIPISNKELPQTT 339
           +Y++AK  Q    +P   +P SN  L  ++
Sbjct: 348 VYALAKIRQNS--QPKTVLPTSNIPLSASS 375



>gi|50556628|ref|XP_505722.1| YALI0F21791p [Yarrowia lipolytica]
 gi|74632370|sp|Q6C0U0.1|GMT_YARLI RecName: Full=GDP-mannose transporter; Short=GMT
 gi|49651592|emb|CAG78533.1| YALI0F21791p [Yarrowia lipolytica CLIB122]
          Length = 326

 Score =  360 bits (924), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 179/309 (57%), Positives = 222/309 (71%), Gaps = 5/309 (1%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDL 76
           L IL+YCAASILMTVTNKYVLSG  FN+N  LL +QSIVC+  +   K   L  FR F+ 
Sbjct: 11  LSILSYCAASILMTVTNKYVLSGTSFNLNLALLAVQSIVCLTAISIGKSFGLCKFRSFNA 70

Query: 77  ALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTM 136
             ++KWFPIA+LLV MIYT SK+LQ+LSIPVYTIFKNLTIILIAYGEV+WF  S++ + +
Sbjct: 71  DEAKKWFPIALLLVVMIYTSSKALQFLSIPVYTIFKNLTIILIAYGEVLWFGGSVTSMAL 130

Query: 137 TSFLLMVFXXXXXXXXXXXXXXXXXXXXT-----FDIGYLWMAFNCISSAAFVLTMRRRI 191
            SF+LMV                     T      +IGY WM  NC +SAAFVL MR+RI
Sbjct: 131 ASFVLMVLSSVIAAWSDISGAIAVSGSATTTVTALNIGYFWMMSNCFASAAFVLYMRKRI 190

Query: 192 RSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISA 251
           + TNF DFDT +YNNLLSIP+L+  SL+ EDWS  N   N P + R  +  +++ SG+ +
Sbjct: 191 KLTNFGDFDTTFYNNLLSIPVLLIASLLFEDWSPANLAVNFPPESRNLIFFSMVVSGLMS 250

Query: 252 FGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILY 311
            GISY SAWCVRVTSSTTYSMVGALNKLP+A SG++FFG P T  +VSAIFVGFVAGI+Y
Sbjct: 251 IGISYCSAWCVRVTSSTTYSMVGALNKLPLALSGIVFFGTPATFSSVSAIFVGFVAGIVY 310

Query: 312 SIAKTEQQK 320
           ++A+ +++K
Sbjct: 311 AVAQIQKKK 319



>gi|330944221|ref|XP_003306333.1| hypothetical protein PTT_19463 [Pyrenophora teres f. teres 0-1]
 gi|311316183|gb|EFQ85566.1| hypothetical protein PTT_19463 [Pyrenophora teres f. teres 0-1]
          Length = 382

 Score =  359 bits (922), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 176/325 (54%), Positives = 232/325 (71%), Gaps = 12/325 (3%)

Query: 19  ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLAL 78
           IL YC +SILMTVTNKYVLSG DFN+NF LL +QS+VCV  +   K   ++++R+F+   
Sbjct: 46  ILAYCGSSILMTVTNKYVLSGVDFNLNFFLLCVQSVVCVAAISICKAAGIITYRDFNSDE 105

Query: 79  SRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTS 138
           ++KWFPI++LL+ MIYT + +L++LSIPVYTIFKNLTIILIAYGEV+WF  +++ + + S
Sbjct: 106 AKKWFPISLLLIGMIYTSTWALKFLSIPVYTIFKNLTIILIAYGEVLWFGGAVTPMALFS 165

Query: 139 FLLMVFXXXXXX---------XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRR 189
           F LMV                              T   GYLWM FNC+ +A +VL MR+
Sbjct: 166 FGLMVLSSVIAAWADIQHALSSMGQAASATTDAMSTLHAGYLWMMFNCLCTATYVLGMRK 225

Query: 190 RIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGI 249
           RI+ TNFKDFDT+YYNNLL+IP+L+  S++VEDWS  N +KN P + R T+I  ++ SG+
Sbjct: 226 RIKLTNFKDFDTMYYNNLLTIPILLIASILVEDWSSANIQKNFPTEQRNTVIVVMIISGL 285

Query: 250 SAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGI 309
           S   ISYTSAW VRVTSSTTYSMVGALNKLP+A SG++FF  P+T G+VSAIFVGFV+G+
Sbjct: 286 STVFISYTSAWAVRVTSSTTYSMVGALNKLPIALSGLVFFDAPVTFGSVSAIFVGFVSGL 345

Query: 310 LYSIAKTEQQ---KPIKPSVYIPIS 331
           +Y++AK  Q    K + P+  IP+S
Sbjct: 346 VYALAKVRQNSKPKNVLPTANIPLS 370



>gi|321261227|ref|XP_003195333.1| GDP-mannose transporter [Cryptococcus gattii WM276]
 gi|317461806|gb|ADV23546.1| GDP-mannose transporter, putative [Cryptococcus gattii WM276]
          Length = 420

 Score =  359 bits (921), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 179/330 (54%), Positives = 232/330 (70%), Gaps = 21/330 (6%)

Query: 12  SATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSF 71
           S+T  LPIL+YC ASI+MTV NK+V+SG  F M FLLL IQS VCV  +   K + +++F
Sbjct: 77  SSTVVLPILSYCVASIMMTVVNKFVVSGRQFTMTFLLLAIQSFVCVACVWFAKRIGVINF 136

Query: 72  REFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSI 131
           R++DL  ++ WFP++ LLVA+IYTGSKSLQ+LSIPVYTIFKNLTIILIAYGEVIWF   +
Sbjct: 137 RDWDLNDAKAWFPVSSLLVAVIYTGSKSLQFLSIPVYTIFKNLTIILIAYGEVIWFGGHV 196

Query: 132 SRLTMTSFLLMVFXXXXXXXXXXXXXXXXXXXX---------------------TFDIGY 170
           + LT+ SF LMV                                          T ++GY
Sbjct: 197 TPLTLCSFFLMVGSSVIAAWADISTTLARLSAGVAVVDPISGADVPLSSSRVMDTMNMGY 256

Query: 171 LWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEK 230
           LWM  NC++SA +VL MR+RI+ T FKD+D+++YNNLLSIP+L   SL++EDW   +F +
Sbjct: 257 LWMFVNCLASAGYVLFMRKRIKVTGFKDWDSMFYNNLLSIPVLFVFSLIIEDWGAASFSR 316

Query: 231 NLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFG 290
           N PE+ RT L++AI FSG +A  ISY++AWCVR+  +TTYS+VGALNKLPVAASG++FFG
Sbjct: 317 NFPEEGRTFLLSAIAFSGAAAVFISYSTAWCVRICGATTYSLVGALNKLPVAASGILFFG 376

Query: 291 DPITTGNVSAIFVGFVAGILYSIAKTEQQK 320
           DP+  GNVSAI VG V+GI+Y++AKT Q K
Sbjct: 377 DPMNFGNVSAILVGGVSGIVYAVAKTNQAK 406



>gi|378730381|gb|EHY56840.1| GDP-mannose transporter [Exophiala dermatitidis NIH/UT8656]
          Length = 388

 Score =  359 bits (921), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 179/326 (54%), Positives = 231/326 (70%), Gaps = 11/326 (3%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDL 76
           LP++ YC +SILMTV NKY+LS  D+N+NFLLL +QS VCV+ +   K L L+S+R+F  
Sbjct: 49  LPVICYCGSSILMTVANKYILSFPDYNLNFLLLAVQSTVCVLAISTCKSLGLISYRDFKA 108

Query: 77  ALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTM 136
             ++KWFPI++LL+AMIYTG+K+L+YLSIPVYTIFKNLTIILIAYGEV+WF   IS +T+
Sbjct: 109 DEAKKWFPISLLLIAMIYTGTKALRYLSIPVYTIFKNLTIILIAYGEVLWFGGYISSMTL 168

Query: 137 TSFLLMVFXXXXXXXXXXXXXXX----------XXXXXTFDIGYLWMAFNCISSAAFVLT 186
            SF LMV                               T + GYLWM  NC+S+AA+VL 
Sbjct: 169 FSFGLMVLSSVVAAWADIKHALESHSSSNSAAATQQLATLNAGYLWMLVNCLSNAAYVLC 228

Query: 187 MRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILF 246
           MR+RI+ TNFKDFDT +YNNLL+IP+L+  S + EDWS  N  KN P + R  +  A++F
Sbjct: 229 MRKRIKLTNFKDFDTTFYNNLLTIPVLLLASFLAEDWSSANLTKNFPPNSRNGIFAAMIF 288

Query: 247 SGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFV 306
           +G S+  ISYTSAWCVR TSSTTYSMVGALNKLP+A SG+IFF  P+T  +VSAIF+GFV
Sbjct: 289 TGASSIFISYTSAWCVRATSSTTYSMVGALNKLPLAISGLIFFDAPVTIPSVSAIFLGFV 348

Query: 307 AGILYSIAKTEQQKPIKPSVYIPISN 332
           +GI+Y++AK    +  K  + +P SN
Sbjct: 349 SGIVYALAKLRGSQKPKTGI-LPTSN 373



>gi|389739315|gb|EIM80509.1| UDP-galactose transporter [Stereum hirsutum FP-91666 SS1]
          Length = 387

 Score =  359 bits (921), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 180/339 (53%), Positives = 229/339 (67%), Gaps = 22/339 (6%)

Query: 18  PILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLA 77
           PI  YCAASILMTV NKYV+SG +F+MNFLLL IQS VCV  +   K   ++S R FD+ 
Sbjct: 48  PIACYCAASILMTVVNKYVVSGRNFSMNFLLLCIQSSVCVACVLTVKKFGIISIRAFDVQ 107

Query: 78  LSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMT 137
            ++ WFPI+ LLV +IYTGSKSLQ+L+IPVYTIFKNLTIILIAYGEV+WF   ++ LT+ 
Sbjct: 108 DAKAWFPISFLLVTVIYTGSKSLQFLTIPVYTIFKNLTIILIAYGEVLWFGGRVTALTLV 167

Query: 138 SFLLMVFXXXXXX------------------XXXXXXXXXXXXXXTFDIGYLWMAFNCIS 179
           SFL MV                                       T ++GY WM  NC +
Sbjct: 168 SFLFMVVSSVIAAWSDISSAMNDALVVGQPAAVAGGLTSVTNVVSTLNVGYFWMFANCFT 227

Query: 180 SAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTT 239
           SAA+VL MR+RI+ T F D+D+++YNNLLSIP+L+  S + EDW  ++  +N P + R  
Sbjct: 228 SAAYVLGMRKRIKVTGFSDWDSMFYNNLLSIPVLLLFSFIAEDWGSESLNRNFPPETRNL 287

Query: 240 LITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVS 299
           L+ AI FSG +A GIS+T+AWC+RVTSSTTYSMVGALNKLPVAASGMIFFGDP++ G+VS
Sbjct: 288 LLFAIAFSGAAAVGISFTTAWCIRVTSSTTYSMVGALNKLPVAASGMIFFGDPVSFGSVS 347

Query: 300 AIFVGFVAGILYSIAKTEQ----QKPIKPSVYIPISNKE 334
           A+ VGF AGI+Y++AK  Q         P   IP+S ++
Sbjct: 348 AVSVGFFAGIVYAVAKNNQKKAEAAAKAPESIIPLSTRK 386



>gi|401881014|gb|EJT45320.1| nucleotide-sugar transporter [Trichosporon asahii var. asahii CBS
           2479]
 gi|406697118|gb|EKD00386.1| nucleotide-sugar transporter [Trichosporon asahii var. asahii CBS
           8904]
          Length = 406

 Score =  358 bits (920), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 183/319 (57%), Positives = 224/319 (70%), Gaps = 15/319 (4%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDL 76
           LPIL YCAASI+MTV NKYV+SG +F M FLLL IQS VCV+ +   K L L++FR+FD+
Sbjct: 73  LPILNYCAASIMMTVVNKYVVSGANFTMTFLLLCIQSAVCVLAVGTVKRLGLITFRDFDM 132

Query: 77  ALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTM 136
             ++ WFPI+ LLVA+IYTGSKSLQ+LSIPVYTIFKNLTIILIAYGEV  F   ++ LT+
Sbjct: 133 KDAKAWFPISCLLVAVIYTGSKSLQFLSIPVYTIFKNLTIILIAYGEVFMFSGHVTPLTL 192

Query: 137 TSFLLMVFXXXXXX---------------XXXXXXXXXXXXXXTFDIGYLWMAFNCISSA 181
            SF LMV                                       +GY WMA NC+ SA
Sbjct: 193 VSFALMVGSSVIAAWADISSAISNLGVDSNTGAEIANTAHKIGGVSVGYFWMALNCLCSA 252

Query: 182 AFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLI 241
           A+VL MR+RI+ T FKD+D+++YNNLLSIP+L   SL+ EDW  ++   N P   RT L+
Sbjct: 253 AYVLFMRKRIKVTGFKDWDSMFYNNLLSIPVLALFSLIFEDWGAESLALNFPSSNRTILL 312

Query: 242 TAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAI 301
           +AI+FSG +A  ISY++AWCVRV  STTYSMVGALNKLPVAASGM+FFGDP + GNVSAI
Sbjct: 313 SAIVFSGAAAVFISYSTAWCVRVCGSTTYSMVGALNKLPVAASGMLFFGDPASFGNVSAI 372

Query: 302 FVGFVAGILYSIAKTEQQK 320
            VG +AGI+Y+IAKT Q K
Sbjct: 373 GVGGLAGIVYAIAKTNQAK 391



>gi|296817385|ref|XP_002849029.1| GDP-mannose transporter [Arthroderma otae CBS 113480]
 gi|238839482|gb|EEQ29144.1| GDP-mannose transporter [Arthroderma otae CBS 113480]
          Length = 383

 Score =  358 bits (920), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 192/342 (56%), Positives = 245/342 (71%), Gaps = 13/342 (3%)

Query: 3   QPPTILAFLSA------TGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVC 56
           QPP      SA        TL I+ YCA+SILMTVTNKYVLSG DFN+NF LL IQSI+C
Sbjct: 27  QPPPQPRHSSAVSSAANNATLAIIAYCASSILMTVTNKYVLSGVDFNLNFFLLCIQSIIC 86

Query: 57  VVLLRAFKMLNLVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTI 116
           ++ +++ K + L+++R+F+   ++KWFPI++LL+ MIYTGSK+L++LSIPVYTIFKNLTI
Sbjct: 87  IIAIQSCKTMGLINYRDFNSDEAKKWFPISLLLIGMIYTGSKALKFLSIPVYTIFKNLTI 146

Query: 117 ILIAYGEVIWFDCSISRLTMTSFLLMVFXXXXXX------XXXXXXXXXXXXXXTFDIGY 170
           ILIAYGEV+WF  S+S LT+ SF LMV                           T + GY
Sbjct: 147 ILIAYGEVLWFGGSVSGLTLFSFGLMVLSSVVAAWADITHAVSSSAGSGSAAVSTLNSGY 206

Query: 171 LWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEK 230
           LWM  NC  +A++VL MR+RI+ TNFKDFDT++YNNLLSIP+LM  SL+VEDWS  N  K
Sbjct: 207 LWMLINCACTASYVLGMRKRIKLTNFKDFDTMFYNNLLSIPILMISSLLVEDWSAANVAK 266

Query: 231 NLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFG 290
           N P + R  L  A+LFSG+S   ISY SAWCVRVT+STTYSMVGALNKLP+A SG++FFG
Sbjct: 267 NFPVETRNRLYLAMLFSGLSTVFISYASAWCVRVTTSTTYSMVGALNKLPIALSGLMFFG 326

Query: 291 DPITTGNVSAIFVGFVAGILYSIAKTEQQKPIKPSVYIPISN 332
           DP+T  +VSAI +GFV+GI+Y++AK +Q    K  + +P SN
Sbjct: 327 DPVTFPSVSAIAIGFVSGIVYALAKIKQNAKPKTGI-LPTSN 367



>gi|459366145|gb|EMG45590.1| GDP-mannose transporter [Candida maltosa Xu316]
          Length = 334

 Score =  358 bits (920), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 176/300 (58%), Positives = 220/300 (73%)

Query: 14  TGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFRE 73
           +G + I  YC +SILMTVTNKYVLSG+ FN+NF LL +QSIVC+V + + K   ++++R+
Sbjct: 18  SGPISIAAYCLSSILMTVTNKYVLSGFSFNLNFFLLAVQSIVCIVTIGSLKSFGVITYRQ 77

Query: 74  FDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISR 133
           F+   ++KW PIA LLVAMIYT SK+LQYLSIPVYTIFKNLTIILIAYGEVIWF   ++ 
Sbjct: 78  FNKDEAKKWSPIAFLLVAMIYTSSKALQYLSIPVYTIFKNLTIILIAYGEVIWFGGQVTA 137

Query: 134 LTMTSFLLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRIRS 193
           + ++SFLLMV                        +GY WM  NC +SAAFVL MR+RI+ 
Sbjct: 138 MALSSFLLMVLSSVIAYYGDNAASKSSDDAFALYLGYFWMFTNCFASAAFVLIMRKRIKL 197

Query: 194 TNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFG 253
           TNFKDFDT+YYNNLLSIP+L+  S + E+WS  N   N P D R T ITA++ SG S+ G
Sbjct: 198 TNFKDFDTMYYNNLLSIPILLICSFLFENWSADNVALNFPADNRVTTITAMILSGASSVG 257

Query: 254 ISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSI 313
           ISY SAWCVRVTSSTTYSMVGALNKLP+A SG+IFF   +   +VS+IFVGFVAG++Y++
Sbjct: 258 ISYCSAWCVRVTSSTTYSMVGALNKLPIALSGLIFFDAAVNFWSVSSIFVGFVAGLVYAV 317



>gi|58269436|ref|XP_571874.1| GDP-mannose transporter [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|134114181|ref|XP_774338.1| hypothetical protein CNBG3190 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|338818174|sp|P0CS05.1|GMT2_CRYNB RecName: Full=GDP-mannose transporter 2; Short=GMT 2
 gi|338818175|sp|P0CS04.1|GMT2_CRYNJ RecName: Full=GDP-mannose transporter 2; Short=GMT 2
 gi|40886754|gb|AAR96298.1| GDP-mannose transporter [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|50256973|gb|EAL19691.1| hypothetical protein CNBG3190 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57228110|gb|AAW44567.1| GDP-mannose transporter, putative [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 420

 Score =  358 bits (919), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 176/330 (53%), Positives = 231/330 (70%), Gaps = 21/330 (6%)

Query: 12  SATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSF 71
           ++T  LPIL+YC ASI+MTV NK+V+SG  F M FLLL IQS VCV  +   K + +++F
Sbjct: 77  ASTTVLPILSYCVASIMMTVVNKFVVSGRQFTMTFLLLAIQSFVCVACVWLAKRIGVINF 136

Query: 72  REFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSI 131
           R++D+  ++ WFP++ LLVA+IYTGSKSLQ+LSIPVYTIFKNLTIILIAYGEVIWF   +
Sbjct: 137 RDWDMNDAKAWFPVSSLLVAVIYTGSKSLQFLSIPVYTIFKNLTIILIAYGEVIWFGGHV 196

Query: 132 SRLTMTSFLLMVFXXXXXXXXXXXXXXXXXXXX---------------------TFDIGY 170
           + LT+ SF LMV                                          T ++GY
Sbjct: 197 TPLTLCSFFLMVGSSVIAAWADISTTLSKLSAGVAVVDPISGADVPLSSISVMDTMNVGY 256

Query: 171 LWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEK 230
           LWM  NC++SA +VL MR+RI+ T FKD+D+++YNNLLSIP+L   SL++EDW   +F +
Sbjct: 257 LWMFINCLASAGYVLFMRKRIKVTGFKDWDSMFYNNLLSIPVLFVFSLIIEDWGAASFSR 316

Query: 231 NLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFG 290
           N PE+ R  L++AI FSG +A  ISY++AWCVR+  +TTYS+VGALNKLPVAASG++FFG
Sbjct: 317 NFPEEGRAFLLSAIAFSGAAAVFISYSTAWCVRICGATTYSLVGALNKLPVAASGILFFG 376

Query: 291 DPITTGNVSAIFVGFVAGILYSIAKTEQQK 320
           DP+  GNVSAI VG V+GI+Y++AKT Q K
Sbjct: 377 DPVNFGNVSAILVGGVSGIVYAVAKTNQAK 406



>gi|405121882|gb|AFR96650.1| GDP-mannose transporter [Cryptococcus neoformans var. grubii H99]
          Length = 421

 Score =  358 bits (919), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 176/330 (53%), Positives = 232/330 (70%), Gaps = 21/330 (6%)

Query: 12  SATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSF 71
           ++T  LPIL+YC ASI+MTV NK+V+SG  F M FLLL IQS VCV  + + K + +++F
Sbjct: 78  ASTTVLPILSYCVASIMMTVVNKFVVSGRQFTMTFLLLAIQSFVCVACVWSAKRIGIINF 137

Query: 72  REFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSI 131
           R++D+  ++ WFP++ LLVA+IYTGSKSLQ+LSIPVYTIFKNLTIILIAYGEVIWF   +
Sbjct: 138 RDWDMNDAKAWFPVSSLLVAVIYTGSKSLQFLSIPVYTIFKNLTIILIAYGEVIWFGGHV 197

Query: 132 SRLTMTSFLLMVFXXXXXXXXXXXXXXXXXXXX---------------------TFDIGY 170
           + LT+ SF LMV                                          T ++GY
Sbjct: 198 TPLTLCSFFLMVGSSVIAAWADISTTLSKLSAGVAVVDPISGADVPLSSISVLDTMNVGY 257

Query: 171 LWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEK 230
           LWM  NC++SA +VL MR+RI+ T FKD+D+++YNNLLSIP+L   SL++EDW   +F +
Sbjct: 258 LWMFINCLASAGYVLFMRKRIKVTGFKDWDSMFYNNLLSIPVLFIFSLVIEDWGAASFSR 317

Query: 231 NLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFG 290
           N PE+ R  L++AI FSG +A  ISY++AWCVR+  +TTYS+VGALNKLPVAASG++FFG
Sbjct: 318 NFPEEGRVFLLSAIAFSGAAAVFISYSTAWCVRICGATTYSLVGALNKLPVAASGILFFG 377

Query: 291 DPITTGNVSAIFVGFVAGILYSIAKTEQQK 320
           DP+  GNVSAI VG V+GI+Y++AKT Q K
Sbjct: 378 DPMNFGNVSAILVGGVSGIVYAVAKTNQAK 407



>gi|328860009|gb|EGG09116.1| hypothetical protein MELLADRAFT_115827 [Melampsora larici-populina
           98AG31]
          Length = 416

 Score =  358 bits (918), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 184/332 (55%), Positives = 229/332 (68%), Gaps = 29/332 (8%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDL 76
           LP+L+YCAASILMTV NK+V+SG+ F MNFLLL IQS VCV  +   K L L+++R+FD 
Sbjct: 77  LPVLSYCAASILMTVVNKFVVSGHHFTMNFLLLTIQSAVCVTCVAISKSLKLINYRDFDF 136

Query: 77  ALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTM 136
           + +++WFPI+ LLV +IYTGSK+LQ+LSIPVYTIFKNLTIILIAYGEVIWF   +S LT+
Sbjct: 137 SDAKRWFPISFLLVIVIYTGSKALQFLSIPVYTIFKNLTIILIAYGEVIWFGGHVSGLTL 196

Query: 137 TSFLLMVFXXXXXXXXXXXXXXXXXXXXTF-----------------------DIGYLWM 173
            SF LMV                                                GY WM
Sbjct: 197 ISFGLMVLSSLVAAWSDISSALFLSPVTATALAAASVASDPIGQGNYSELVQKHAGYFWM 256

Query: 174 AFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLP 233
             NC++SA +VL MR+RI+ T+FKD+DT++YNNLLSIP+L+  S + EDWSE +   N P
Sbjct: 257 LINCLASAGYVLAMRKRIKLTSFKDWDTMFYNNLLSIPVLVIFSFLFEDWSESSLTANFP 316

Query: 234 EDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPI 293
            + RT L++A+ FSG +A  ISYT+AWCVR TSSTTYSMVGALNKLPVAASGMIFFGDP+
Sbjct: 317 IEGRTFLLSAMAFSGAAAVFISYTTAWCVRTTSSTTYSMVGALNKLPVAASGMIFFGDPV 376

Query: 294 TTGNVSAIFVGFVAGILYSIAKTEQQKPIKPS 325
           + GNVSAI +GF AG++Y+ AK      IKPS
Sbjct: 377 SIGNVSAISIGFFAGLVYTFAK------IKPS 402



>gi|67903722|ref|XP_682117.1| hypothetical protein AN8848.2 [Aspergillus nidulans FGSC A4]
 gi|40740946|gb|EAA60136.1| hypothetical protein AN8848.2 [Aspergillus nidulans FGSC A4]
          Length = 428

 Score =  357 bits (915), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 181/328 (55%), Positives = 236/328 (71%), Gaps = 9/328 (2%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS 70
           +S    L +L YC +SILMTV NKYVLS  DFN+NF LL +QS+VC++ ++  K   L++
Sbjct: 89  ISNNAALSVLAYCGSSILMTVMNKYVLSS-DFNLNFFLLCVQSLVCIIAIQLCKACGLIT 147

Query: 71  FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCS 130
           +R+F+L  +RKWFPI +LL+ MIYTGSK+LQ+LSIPVYTIFKNLTIILIAYGEV+WF  S
Sbjct: 148 YRDFNLDEARKWFPITLLLIGMIYTGSKALQFLSIPVYTIFKNLTIILIAYGEVLWFGGS 207

Query: 131 ISRLTMTSFLLMVFXXXXXX-----XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVL 185
           ++ LT+ SF LMVF                         T + GY+WM  NC+ ++++VL
Sbjct: 208 VTNLTLFSFGLMVFSSIIAAWADIKHAIESSGDATSKVSTLNAGYIWMLINCLCTSSYVL 267

Query: 186 TMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAIL 245
            MR+RI+ TNFKDFDT++YNNLLSIP+L+  S ++EDWS  N  +N P   R  ++ A++
Sbjct: 268 GMRKRIKLTNFKDFDTMFYNNLLSIPVLIVCSGILEDWSPANVARNFPSADRNGIMFAMI 327

Query: 246 FSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGF 305
            SG+S   ISYTSAWCVRVTSSTTYSMVGALNKLP+A SG+IFF  P+T  +VSAI VGF
Sbjct: 328 LSGLSTVFISYTSAWCVRVTSSTTYSMVGALNKLPIALSGLIFFDAPVTFPSVSAIMVGF 387

Query: 306 VAGILYSIAKTEQQKPIKPSVYI-PISN 332
           V+GI+Y++AK +Q    KP V I P +N
Sbjct: 388 VSGIVYAVAKIKQNA--KPKVGILPTTN 413



>gi|242794757|ref|XP_002482441.1| Golgi GDP-mannose transporter [Talaromyces stipitatus ATCC 10500]
 gi|218719029|gb|EED18449.1| Golgi GDP-mannose transporter [Talaromyces stipitatus ATCC 10500]
          Length = 375

 Score =  357 bits (915), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 182/331 (54%), Positives = 239/331 (72%), Gaps = 10/331 (3%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS 70
           LS    LP+L YC +SILMTV NKYVLSG DFN+NF LL +QS+VC++ ++  K   L++
Sbjct: 33  LSNNPVLPVLAYCGSSILMTVMNKYVLSGLDFNLNFFLLLVQSVVCIIAIQTCKAGGLIT 92

Query: 71  FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCS 130
           FR F+   ++KWFPI +LL+ MI+TGSK+LQ+LSIPVYTIFKNLTIILIAYGEV+WF  S
Sbjct: 93  FRNFNTDEAKKWFPITLLLIGMIFTGSKALQFLSIPVYTIFKNLTIILIAYGEVLWFGGS 152

Query: 131 -ISRLTMTSFLLMVFXXXXXX-----XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFV 184
            ++ LT+ SF LMV                          T + GY+WM  NC+ +A + 
Sbjct: 153 AVTGLTLFSFGLMVASSIIAAWADVQHALTSTTNASTKISTLNAGYIWMTANCLCTAFYN 212

Query: 185 LTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAI 244
           L MR+RI+ TNFKDFDT++YNNLLSIP+L+  +L++EDWS +N  +N P   R+ +  A+
Sbjct: 213 LYMRKRIKLTNFKDFDTMFYNNLLSIPVLILATLLIEDWSAENVARNFPIVSRSNIAIAM 272

Query: 245 LFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVG 304
           + SG+S+  ISYTSAWC+RVTSSTTYSMVGALNKLP+A SG+IFF  P+T G+VSAI +G
Sbjct: 273 VLSGLSSVFISYTSAWCMRVTSSTTYSMVGALNKLPIALSGLIFFDAPVTLGSVSAIAIG 332

Query: 305 FVAGILYSIAKTEQQ-KP---IKPSVYIPIS 331
           FV+GI+YS+AK +Q  KP   I P+  IP+S
Sbjct: 333 FVSGIVYSVAKFKQNAKPKTGILPTTNIPLS 363



>gi|189041383|sp|Q5AS82.2|GMT1_EMENI RecName: Full=GDP-mannose transporter 1; Short=GMT 1
 gi|259482937|tpe|CBF77888.1| TPA: GDP-mannose transporter 1 (GMT 1)
           [Source:UniProtKB/Swiss-Prot;Acc:Q5AS82] [Aspergillus
           nidulans FGSC A4]
          Length = 379

 Score =  357 bits (915), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 181/328 (55%), Positives = 236/328 (71%), Gaps = 9/328 (2%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS 70
           +S    L +L YC +SILMTV NKYVLS  DFN+NF LL +QS+VC++ ++  K   L++
Sbjct: 40  ISNNAALSVLAYCGSSILMTVMNKYVLSS-DFNLNFFLLCVQSLVCIIAIQLCKACGLIT 98

Query: 71  FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCS 130
           +R+F+L  +RKWFPI +LL+ MIYTGSK+LQ+LSIPVYTIFKNLTIILIAYGEV+WF  S
Sbjct: 99  YRDFNLDEARKWFPITLLLIGMIYTGSKALQFLSIPVYTIFKNLTIILIAYGEVLWFGGS 158

Query: 131 ISRLTMTSFLLMVFXXXXXX-----XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVL 185
           ++ LT+ SF LMVF                         T + GY+WM  NC+ ++++VL
Sbjct: 159 VTNLTLFSFGLMVFSSIIAAWADIKHAIESSGDATSKVSTLNAGYIWMLINCLCTSSYVL 218

Query: 186 TMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAIL 245
            MR+RI+ TNFKDFDT++YNNLLSIP+L+  S ++EDWS  N  +N P   R  ++ A++
Sbjct: 219 GMRKRIKLTNFKDFDTMFYNNLLSIPVLIVCSGILEDWSPANVARNFPSADRNGIMFAMI 278

Query: 246 FSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGF 305
            SG+S   ISYTSAWCVRVTSSTTYSMVGALNKLP+A SG+IFF  P+T  +VSAI VGF
Sbjct: 279 LSGLSTVFISYTSAWCVRVTSSTTYSMVGALNKLPIALSGLIFFDAPVTFPSVSAIMVGF 338

Query: 306 VAGILYSIAKTEQQKPIKPSVYI-PISN 332
           V+GI+Y++AK +Q    KP V I P +N
Sbjct: 339 VSGIVYAVAKIKQNA--KPKVGILPTTN 364



>gi|402223777|gb|EJU03841.1| UDP-galactose transporter [Dacryopinax sp. DJM-731 SS1]
          Length = 378

 Score =  355 bits (911), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 179/328 (54%), Positives = 227/328 (69%), Gaps = 22/328 (6%)

Query: 18  PILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLA 77
           PIL+YC +SILMTV NKYVLSG  F+MNFLLL IQSIVCV ++   K   ++SFR+FD+ 
Sbjct: 36  PILSYCCSSILMTVVNKYVLSGRHFSMNFLLLAIQSIVCVSVVATLKRTGVISFRDFDMK 95

Query: 78  LSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMT 137
            ++ WFPI+  LV +IYTGSKSLQ+L+IPVYTIFKNLTIILIAYGEV+WF   ++ LT+ 
Sbjct: 96  DAKNWFPISFALVVVIYTGSKSLQFLTIPVYTIFKNLTIILIAYGEVLWFGGHVTGLTLV 155

Query: 138 SFLLMVFXXXXXX----------------------XXXXXXXXXXXXXXTFDIGYLWMAF 175
           SF LMV                                             ++GYLWM  
Sbjct: 156 SFFLMVLSSIIAAWSDITNTINALTGVWSPIDQTSGTPLPEGIAAVGSVPVNLGYLWMFL 215

Query: 176 NCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPED 235
           NC++SAA+VL MR+RI++T FKD+D+++YNNLLSIP+L+  SL+VE W+ +N   N P +
Sbjct: 216 NCLASAAYVLGMRKRIKATGFKDWDSMFYNNLLSIPVLIVFSLLVERWTSENLTLNFPPE 275

Query: 236 IRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITT 295
            R  L+ A++ SG  A  ISYT+AWCVRVTSSTTYSMVGALNKLPVAASGMIFFGD +T 
Sbjct: 276 SRNFLLFAMVLSGGVAVLISYTTAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDAVTL 335

Query: 296 GNVSAIFVGFVAGILYSIAKTEQQKPIK 323
           G+VS +  GF+AG++Y+IAK  Q K  K
Sbjct: 336 GSVSGVTTGFLAGVVYAIAKQNQSKTEK 363



>gi|258571405|ref|XP_002544506.1| nucleolar protein NOP2 [Uncinocarpus reesii 1704]
 gi|237904776|gb|EEP79177.1| nucleolar protein NOP2 [Uncinocarpus reesii 1704]
          Length = 1027

 Score =  355 bits (910), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 182/341 (53%), Positives = 240/341 (70%), Gaps = 25/341 (7%)

Query: 2    AQPPTILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLR 61
            +  P+IL+  +    +PIL+YCA+SILMTVTNKYVLSG +FN+NF LL +Q+        
Sbjct: 687  SHSPSILSGPA----VPILSYCASSILMTVTNKYVLSGVEFNLNFFLLCVQTC------- 735

Query: 62   AFKMLNLVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAY 121
              K + L++FR+F+   ++KWFPI++LL+ MIYTG+K+L++LSIPVYTIFKNLT ILIAY
Sbjct: 736  --KSMGLINFRDFNSDEAKKWFPISLLLIGMIYTGAKALKFLSIPVYTIFKNLTTILIAY 793

Query: 122  GEVIWFDCSISRLTMTSFLLMVFX---------XXXXXXXXXXXXXXXXXXXTFDIGYLW 172
            GEV+WF  S++ + + SF LMV                              T + GYLW
Sbjct: 794  GEVLWFGGSVTGMALFSFGLMVMSSVIAAWADIKHALDSSSLSGLETTSKISTLNSGYLW 853

Query: 173  MAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNL 232
            M  NC+ ++ ++L MR+RI+ TNFKDFDT++YNNLLSIP+L+  S +VEDWS  N  KN 
Sbjct: 854  MLMNCLCTSMYLLGMRKRIKLTNFKDFDTMFYNNLLSIPILLIGSFIVEDWSSTNISKNF 913

Query: 233  PEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDP 292
            P + R +LI A++FSG+S+  ISYTSAWCVRVTSSTTYSMVGALNKLPVA SG++FFGDP
Sbjct: 914  PIETRNSLIFAMIFSGLSSVFISYTSAWCVRVTSSTTYSMVGALNKLPVALSGLVFFGDP 973

Query: 293  ITTGNVSAIFVGFVAGILYSIAKTEQQKPIKPSVYI-PISN 332
            +T   VSAI VGFV+G++YS+AK +Q    KP   I P +N
Sbjct: 974  VTIPGVSAIVVGFVSGLVYSLAKVKQN--AKPRTGILPTAN 1012



>gi|393240472|gb|EJD47998.1| UDP-galactose transporter [Auricularia delicata TFB-10046 SS5]
          Length = 363

 Score =  355 bits (910), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 179/323 (55%), Positives = 231/323 (71%), Gaps = 2/323 (0%)

Query: 1   MAQPPTILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLL 60
           ++Q    +  L  +   PI  YC ASI MTV NK+V+SG  F+MNFLLL IQS VCV  +
Sbjct: 23  LSQSAHAVDSLGQSSLFPIAAYCLASIFMTVLNKFVVSGTGFSMNFLLLCIQSTVCVGCV 82

Query: 61  RAFKMLNLVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIA 120
              K   L+++R+FD   +++WFPI++LLVA+IYTGSKSLQ+LSIPVYTIFKNLTIILIA
Sbjct: 83  WVSKSAGLITYRDFDHTDAKRWFPISVLLVAVIYTGSKSLQFLSIPVYTIFKNLTIILIA 142

Query: 121 YGEVIWFDCSISRLTMTSFLLMVFXX--XXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCI 178
           YGE+     +++ LT+ SF LMV                       +F+IGY+WM  NCI
Sbjct: 143 YGEMFMTGATVTGLTLVSFGLMVVSSIIAAATDTKPPPTTPWGTTASFNIGYIWMFSNCI 202

Query: 179 SSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRT 238
            +AA+ L MR R+++  FKD+DT++YNNLLSIP+L   SL+VEDWS  N ++N PE+ R+
Sbjct: 203 FTAAYALLMRGRMKALQFKDWDTMFYNNLLSIPVLGIASLLVEDWSSVNLQRNFPEETRS 262

Query: 239 TLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNV 298
            L+ AI  SG +A  ISYT+AWC+R TSSTTYSMVGALNKLPVAASGMIFFGDP+T G+V
Sbjct: 263 FLLFAIAVSGAAAVFISYTTAWCMRATSSTTYSMVGALNKLPVAASGMIFFGDPVTVGSV 322

Query: 299 SAIFVGFVAGILYSIAKTEQQKP 321
           SAI  GF AG++Y++AKT+  KP
Sbjct: 323 SAISAGFAAGLVYTVAKTKAPKP 345



>gi|321260246|ref|XP_003194843.1| golgi GDP-mannose transporter; Vrg4p [Cryptococcus gattii WM276]
 gi|317461315|gb|ADV23056.1| Golgi GDP-mannose transporter, putative; Vrg4p [Cryptococcus gattii
           WM276]
          Length = 397

 Score =  353 bits (907), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 178/321 (55%), Positives = 227/321 (70%), Gaps = 17/321 (5%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDL 76
           LPIL+YCAASI+MTV NKYV+SG +F M FLLL IQS VCV+ + + K L  ++FR+FD 
Sbjct: 63  LPILSYCAASIMMTVVNKYVVSGANFTMTFLLLAIQSSVCVLAVTSVKKLGFITFRDFDK 122

Query: 77  ALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTM 136
             ++ W+PI+ LLVA+IYTGSK+LQ+LSIPVYTIFKNLTIILIAYGEV  F+ S++ LT+
Sbjct: 123 NDAKAWWPISTLLVAVIYTGSKALQFLSIPVYTIFKNLTIILIAYGEVFMFNGSVTGLTL 182

Query: 137 TSFLLMVFXXXXXX-----------------XXXXXXXXXXXXXXTFDIGYLWMAFNCIS 179
            SF LMV                                        + GY+WMA NCI 
Sbjct: 183 CSFALMVGSSVIAAWSDITSVWNKEPELDPTTGVEIAAGPVSTIGGLNAGYVWMALNCIV 242

Query: 180 SAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTT 239
           SAA+VL MR+RI+ T FKD+D++YYNNLLSIP+L+  SL++EDW  ++   N P   R  
Sbjct: 243 SAAYVLFMRKRIKITGFKDWDSMYYNNLLSIPILVVFSLVIEDWGSESLALNFPASNRVL 302

Query: 240 LITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVS 299
           L++A+ FSG +A  ISY++AWCVR+T STTYSMVGALNKLPVAASG++FFGDP   GNVS
Sbjct: 303 LLSAMAFSGAAAVFISYSTAWCVRITGSTTYSMVGALNKLPVAASGILFFGDPANFGNVS 362

Query: 300 AIFVGFVAGILYSIAKTEQQK 320
           AI VG VAG++Y++AKT Q +
Sbjct: 363 AIAVGGVAGVVYAVAKTNQAR 383



>gi|511000295|gb|EPB81845.1| hypothetical protein HMPREF1544_11429 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 393

 Score =  353 bits (907), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 191/324 (58%), Positives = 231/324 (71%), Gaps = 10/324 (3%)

Query: 14  TGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFRE 73
           T  LPI TYC ASI+MTVTNK+V+SG DFNM F LL IQS+V V  L+AFK LNL+ +RE
Sbjct: 46  TAGLPIFTYCVASIVMTVTNKFVVSG-DFNMVFFLLTIQSLVTVFFLQAFKFLNLIKYRE 104

Query: 74  FDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISR 133
           FD   ++KW+PI + LVAMIYTGSK+LQYL IPVYTIFKNLTIILIAYGEV+WF  +++ 
Sbjct: 105 FDSETAKKWYPIVVFLVAMIYTGSKALQYLPIPVYTIFKNLTIILIAYGEVLWFGGNVTS 164

Query: 134 LTMTSFLLMVFXX---------XXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFV 184
           + + SF LM                               T  +GY WMA NC+SSA+FV
Sbjct: 165 MMIMSFGLMTLSSVIAGWNDVSAAIQSMLDVTTVLTSVNGTTMLGYFWMAVNCLSSASFV 224

Query: 185 LTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAI 244
           L MR+RI+ TNFKDFDTVYYNNLLSIPLL+  SL++EDWS +N   N P + R   I A+
Sbjct: 225 LYMRKRIKLTNFKDFDTVYYNNLLSIPLLIIPSLLLEDWSHENLMMNFPPEQRQARIWAM 284

Query: 245 LFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVG 304
           +FSG+SAFG+SY SAWCVR TSSTTYSMVG+LNKLP+A SG++FFGD  T  NVSAI +G
Sbjct: 285 IFSGVSAFGMSYASAWCVRTTSSTTYSMVGSLNKLPIAISGIVFFGDVATFSNVSAILMG 344

Query: 305 FVAGILYSIAKTEQQKPIKPSVYI 328
           FVAG++YS AK    K  K +  I
Sbjct: 345 FVAGMVYSYAKAFPSKKTKDTTTI 368



>gi|354546452|emb|CCE43182.1| hypothetical protein CPAR2_208270 [Candida parapsilosis]
          Length = 335

 Score =  353 bits (906), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 179/310 (57%), Positives = 231/310 (74%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS 70
           ++ +G + IL YC +SILMTVTNK+V+SG++FN+NFLLL +QSIVC+V +   K   +++
Sbjct: 17  ITNSGPISILAYCLSSILMTVTNKFVVSGFNFNLNFLLLAVQSIVCIVTIGTLKTFGIIT 76

Query: 71  FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCS 130
           +R+F+   ++KW PIA LLV MIYT SK+LQYLSIPVYTIFKNLTIILIAYGEVIWF   
Sbjct: 77  YRQFNKDEAKKWSPIAFLLVGMIYTSSKALQYLSIPVYTIFKNLTIILIAYGEVIWFGGK 136

Query: 131 ISRLTMTSFLLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRR 190
           ++ + ++SFLLMVF                       +GY WM  NC +SAAFVL MR+R
Sbjct: 137 VTTMALSSFLLMVFSSVIAYYGDKGEVKTVDDQFALYLGYFWMFTNCFASAAFVLIMRKR 196

Query: 191 IRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGIS 250
           I+ TNFKDFDT+YYNNLLSIP+L+  + + E+W+ +N EKN P D R   I A++ SG S
Sbjct: 197 IKLTNFKDFDTMYYNNLLSIPILLVFTFLFENWTPENLEKNFPADNRVATIVAMVLSGAS 256

Query: 251 AFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGIL 310
           + GISY SAWCVRVTSSTTYSMVGALNKLP+A SG+IFF   +   +VS+IFVGFVAG++
Sbjct: 257 SVGISYCSAWCVRVTSSTTYSMVGALNKLPIALSGLIFFNAAVNFWSVSSIFVGFVAGLV 316

Query: 311 YSIAKTEQQK 320
           Y++AK +QQK
Sbjct: 317 YAVAKQKQQK 326



>gi|260940210|ref|XP_002614405.1| hypothetical protein CLUG_05891 [Clavispora lusitaniae ATCC 42720]
 gi|238852299|gb|EEQ41763.1| hypothetical protein CLUG_05891 [Clavispora lusitaniae ATCC 42720]
          Length = 354

 Score =  353 bits (906), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 172/298 (57%), Positives = 217/298 (72%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDL 76
           L I  YC +SILMTVTNKYVLSGY FN+NF LL +Q IVC+  + + K   ++++R+F+ 
Sbjct: 43  LSIFCYCLSSILMTVTNKYVLSGYSFNLNFFLLAVQGIVCIFTIGSLKQFGVITYRQFNQ 102

Query: 77  ALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTM 136
             ++KWFPIA+LLVAMIYT SK+L YLSIPVYTIFKNLTIILIAYGEV+WF   ++ + +
Sbjct: 103 DEAKKWFPIALLLVAMIYTSSKALVYLSIPVYTIFKNLTIILIAYGEVLWFGGKVTTMAL 162

Query: 137 TSFLLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRIRSTNF 196
            SFLLMVF                    +  +GY WM  NC +SAAFVL MR RI+ TNF
Sbjct: 163 GSFLLMVFSSVLATYGDSASVKTQDDMYSLYLGYFWMFTNCFASAAFVLYMRIRIKLTNF 222

Query: 197 KDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFGISY 256
           KDFDT+YYNNLLSIP+L+  S + EDWS  N   N P + R   I A++FSG S+ GISY
Sbjct: 223 KDFDTMYYNNLLSIPVLLICSFIFEDWSAANLAVNFPAENRAATIFAMIFSGASSVGISY 282

Query: 257 TSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSIA 314
            SAWCVRVTSSTTYSMVGALNKLP+A SG++FF   +   +VS+IFVGF++G++Y++A
Sbjct: 283 CSAWCVRVTSSTTYSMVGALNKLPIALSGLVFFDAAVNFWSVSSIFVGFISGLVYAVA 340



>gi|58268680|ref|XP_571496.1| nucleotide-sugar transporter [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|134113208|ref|XP_774629.1| hypothetical protein CNBF3090 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|338818172|sp|P0CS03.1|GMT1_CRYNB RecName: Full=GDP-mannose transporter 1; Short=GMT 1
 gi|338818173|sp|P0CS02.1|GMT1_CRYNJ RecName: Full=GDP-mannose transporter 1; Short=GMT 1
 gi|50257273|gb|EAL19982.1| hypothetical protein CNBF3090 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57227731|gb|AAW44189.1| nucleotide-sugar transporter, putative [Cryptococcus neoformans
           var. neoformans JEC21]
 gi|68137387|gb|AAY85624.1| GDP-mannose transporter [Cryptococcus neoformans var. neoformans
           JEC21]
          Length = 397

 Score =  352 bits (902), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 178/321 (55%), Positives = 225/321 (70%), Gaps = 17/321 (5%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDL 76
           LPIL+YCAASI+MTV NKYV+SG +F M FLLL IQS VCV+ +   K L  +SFR+FD 
Sbjct: 63  LPILSYCAASIMMTVVNKYVVSGANFTMTFLLLAIQSSVCVLAVTTVKKLGFISFRDFDK 122

Query: 77  ALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTM 136
             ++ W+PI+ LLVA+IYTGSK+LQ+LSIPVYTIFKNLTIILIAYGEV  F+ ++S LT+
Sbjct: 123 NDAKAWWPISTLLVAVIYTGSKALQFLSIPVYTIFKNLTIILIAYGEVFMFNGAVSGLTL 182

Query: 137 TSFLLMVFXXXXXX-----------------XXXXXXXXXXXXXXTFDIGYLWMAFNCIS 179
            SF LMV                                        + GY+WMA NC  
Sbjct: 183 CSFALMVGSSIIAAWSDITSVWNKEPELDPITGLEITVGPVSTIGGLNAGYIWMALNCFV 242

Query: 180 SAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTT 239
           SAA+VL MR+RI+ T FKD+D++YYNNLLSIP+L+  SL++EDW  ++   N P   R  
Sbjct: 243 SAAYVLFMRKRIKVTGFKDWDSMYYNNLLSIPILVVFSLVIEDWGSESLALNFPASNRVL 302

Query: 240 LITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVS 299
           L++A+ FSG +A  ISY++AWCVR+T STTYSMVGALNKLPVAASG++FFGDP   GN+S
Sbjct: 303 LLSAMAFSGAAAVFISYSTAWCVRITGSTTYSMVGALNKLPVAASGILFFGDPANFGNIS 362

Query: 300 AIFVGFVAGILYSIAKTEQQK 320
           AI VG VAG++Y++AKT Q K
Sbjct: 363 AIAVGGVAGVVYAVAKTNQAK 383



>gi|448511662|ref|XP_003866581.1| Vrg4 GDP-mannose transporter [Candida orthopsilosis Co 90-125]
 gi|380350919|emb|CCG21142.1| Vrg4 GDP-mannose transporter [Candida orthopsilosis Co 90-125]
          Length = 364

 Score =  352 bits (902), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 178/313 (56%), Positives = 230/313 (73%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS 70
           ++ +G + I  YC +SILMTVTNK+V+SG++FN+NFLLL +QSIVC+  +   K   +++
Sbjct: 46  ITNSGPISIFAYCLSSILMTVTNKFVVSGFNFNLNFLLLAVQSIVCIFTIGTLKTFGIIT 105

Query: 71  FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCS 130
           +R+F+   ++KW PIA LLV MIYT SK+LQYLSIPVYTIFKNLTIILIAYGEVIWF   
Sbjct: 106 YRQFNKDEAKKWSPIAFLLVGMIYTSSKALQYLSIPVYTIFKNLTIILIAYGEVIWFGGK 165

Query: 131 ISRLTMTSFLLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRR 190
           ++ + ++SFLLMVF                       +GY WM  NC +SAAFVL MR+R
Sbjct: 166 VTTMALSSFLLMVFSSVIAYYGDKGEAKTVDDQFQLYLGYFWMFTNCFASAAFVLIMRKR 225

Query: 191 IRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGIS 250
           I+ TNFKDFDT+YYNNLLSIP+L+  + + E+WS +N EKN P D R   I A++ SG S
Sbjct: 226 IKLTNFKDFDTMYYNNLLSIPILLVFTFLFENWSPENLEKNFPADNRVATIVAMILSGAS 285

Query: 251 AFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGIL 310
           + GISY SAWCVRVTSSTTYSMVGALNKLP+A SG+IFF   +   +VS+IFVGFVAG++
Sbjct: 286 SVGISYCSAWCVRVTSSTTYSMVGALNKLPIALSGLIFFNAAVNFWSVSSIFVGFVAGLV 345

Query: 311 YSIAKTEQQKPIK 323
           Y++AK +QQK  +
Sbjct: 346 YAVAKQKQQKEAQ 358



>gi|388581799|gb|EIM22106.1| UDP-galactose transporter [Wallemia sebi CBS 633.66]
          Length = 329

 Score =  351 bits (900), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 174/304 (57%), Positives = 224/304 (73%), Gaps = 3/304 (0%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDL 76
           L I++YC ASI MT+ NKY++SG  FNMN LLL IQSIVC++ +   K+   +++++F+L
Sbjct: 11  LSIISYCFASISMTIINKYIVSGEHFNMNLLLLSIQSIVCILTVYILKLSGFINYKDFNL 70

Query: 77  ALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTM 136
              + WFP++  LV +IYTGSK+LQ+LSIP+YTIFKNLTIILIAYGE++WF+  I+RLT 
Sbjct: 71  VDIKNWFPVSFSLVLVIYTGSKALQFLSIPIYTIFKNLTIILIAYGELLWFNNKITRLTS 130

Query: 137 TSFLLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRIRSTNF 196
            +FLLMV                        IGY WMA NC+SSAA+VL MR+RI+ T F
Sbjct: 131 FAFLLMVLSSVVAAYDDFDLNDLFNKSM---IGYFWMALNCLSSAAYVLLMRKRIKLTGF 187

Query: 197 KDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFGISY 256
           KD+D++ +NN LSIPLL+  SL++EDWS  + EKN P   R  L++ I FSG +A GISY
Sbjct: 188 KDWDSMAFNNALSIPLLIVSSLIIEDWSFDSLEKNFPPSNRYLLLSTIAFSGAAAVGISY 247

Query: 257 TSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSIAKT 316
           T+AWCVR TSSTTYSMVGALNKLPVAASG+IFF DP T  +VSAI +GF+AGI+Y+IAK 
Sbjct: 248 TTAWCVRTTSSTTYSMVGALNKLPVAASGLIFFNDPATVKSVSAIILGFIAGIIYAIAKQ 307

Query: 317 EQQK 320
           +Q K
Sbjct: 308 KQSK 311



>gi|291510236|gb|ADE10074.1| DUF6 [Tremella fuciformis]
          Length = 401

 Score =  351 bits (900), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 179/321 (55%), Positives = 223/321 (69%), Gaps = 16/321 (4%)

Query: 16  TLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFD 75
            LPIL+YC ASILMTV NKYV+SG  F M FLLL IQS VCV+ + + K   +++FR+FD
Sbjct: 67  ALPILSYCCASILMTVVNKYVVSGRHFTMTFLLLAIQSAVCVLAVWSVKRAGVITFRDFD 126

Query: 76  LALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLT 135
              ++ W+PI+ LLVA+IYTGSK+LQYLSIPVYTIFKNLTIILIAYGEV  F+ +++ LT
Sbjct: 127 KNDAKAWWPISSLLVAVIYTGSKALQYLSIPVYTIFKNLTIILIAYGEVFMFNGTVTGLT 186

Query: 136 MTSFLLMV--------------FXXXXXXXXXXXXXXXXXXXXTFDI--GYLWMAFNCIS 179
           + SF LMV              F                     F    GY+WM  NC++
Sbjct: 187 LVSFALMVGSSIIAAWADISSAFSAAAPTLDPTTGLEVGGVTSAFGASGGYVWMGMNCLA 246

Query: 180 SAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTT 239
           SAA+VL MR+RI+ T FKD+D+++YNNLLSIP+L+  S++VEDW  ++   N P   R  
Sbjct: 247 SAAYVLFMRKRIKVTGFKDWDSMFYNNLLSIPVLVVFSILVEDWGSESLSLNFPASNRVV 306

Query: 240 LITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVS 299
           L+TAI  SG  A  ISY++AWCVRV  STTYSMVGALNKLPVAASGM+FFGDP + GNVS
Sbjct: 307 LLTAIAISGAGAVFISYSTAWCVRVCGSTTYSMVGALNKLPVAASGMLFFGDPASFGNVS 366

Query: 300 AIFVGFVAGILYSIAKTEQQK 320
           AI VG +AGI+Y +AKT Q K
Sbjct: 367 AIGVGGLAGIVYGVAKTNQAK 387



>gi|340515369|gb|EGR45624.1| predicted protein [Trichoderma reesei QM6a]
          Length = 390

 Score =  350 bits (898), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 173/331 (52%), Positives = 230/331 (69%), Gaps = 7/331 (2%)

Query: 19  ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS-FREFDLA 77
           +L YC +SI MTV NKYV+SG  +NMNFL L IQSIVCV  ++A K   L++    FD  
Sbjct: 57  VLGYCLSSISMTVVNKYVVSGSSWNMNFLYLAIQSIVCVAAIQACKQAGLITNLSPFDPE 116

Query: 78  LSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMT 137
             +KWFP+++LLV MIYTG+K+LQY+S+PVYTIFKNLTII+IAYGEV+WF  S++   + 
Sbjct: 117 KGKKWFPVSVLLVGMIYTGAKALQYISVPVYTIFKNLTIIVIAYGEVLWFGGSVTPTILL 176

Query: 138 SFLLMVFXX----XXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRIRS 193
           SF LM+F                        T  +GY WMA N I  AAFVL MR+ I+ 
Sbjct: 177 SFGLMIFSSIVAAWADADAAGRSSKASQEFSTLQVGYTWMALNVICQAAFVLGMRKVIKK 236

Query: 194 TNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFG 253
             FKD+DT++YNN L+IP+L+  SL+VEDWS +N  +N PE+ RT LI  +++SG+ A  
Sbjct: 237 MGFKDWDTMFYNNFLTIPVLIVGSLLVEDWSAENLARNFPEETRTKLIIGMVYSGLCAIF 296

Query: 254 ISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSI 313
           ISY+SAWC+RVTSSTTYSMVGALNKLP+A SG+IFF  P+T G+VSAI +GFV+G++Y+ 
Sbjct: 297 ISYSSAWCIRVTSSTTYSMVGALNKLPIAVSGLIFFDAPVTFGSVSAILIGFVSGLVYAW 356

Query: 314 AKTEQQKPIKPSVYIPISNKELPQTTTNDNN 344
            K  Q +  K S  +P++NK +   ++  NN
Sbjct: 357 GKVRQGEKAKMS--LPVTNKPVMSASSQSNN 385



>gi|146418890|ref|XP_001485410.1| hypothetical protein PGUG_03139 [Meyerozyma guilliermondii ATCC
           6260]
 gi|189041721|sp|A5DIN8.1|GMT_PICGU RecName: Full=GDP-mannose transporter; Short=GMT
 gi|146390883|gb|EDK39041.1| hypothetical protein PGUG_03139 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 353

 Score =  349 bits (896), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 179/320 (55%), Positives = 229/320 (71%), Gaps = 3/320 (0%)

Query: 15  GTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREF 74
           G + I  YCA+SILMTVTNK+V+  Y+FN+NF LL +Q+ VC+V +   K L ++++R+F
Sbjct: 36  GPVSIFAYCASSILMTVTNKFVVGAYEFNLNFFLLAVQAAVCLVTIATLKGLGIITYRQF 95

Query: 75  DLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRL 134
           +   ++KWFPIA LLV MIYT SK+LQYLSIPVYTIFKNLTIILIAYGEVIWF   ++ +
Sbjct: 96  NKDEAKKWFPIAFLLVLMIYTSSKALQYLSIPVYTIFKNLTIILIAYGEVIWFGGKVTTM 155

Query: 135 TMTSFLLMVFXXXXXXXX-XXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRIRS 193
            + SF+LMV                         +GY WM  NC SSAAFVL MR+RI+ 
Sbjct: 156 ALGSFILMVLSSVIAYYGDTAETGEKTAEMHLLYLGYAWMFTNCFSSAAFVLIMRKRIKL 215

Query: 194 TNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFG 253
           TNFKDFDT+YYNNLLS+PLL+  S + EDWS  N  KN P D R T I  ++ SG S+ G
Sbjct: 216 TNFKDFDTMYYNNLLSLPLLLVFSFLFEDWSSVNLNKNFPPDNRNTTIFVMILSGASSVG 275

Query: 254 ISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSI 313
           ISY SAWCVRVTSSTTYSMVGALNKLP+A SG++FF   +   +VS+IFVGF+AG+ Y++
Sbjct: 276 ISYCSAWCVRVTSSTTYSMVGALNKLPIALSGLVFFNAAVNFWSVSSIFVGFLAGVFYAV 335

Query: 314 AKTEQQKPIKPSVYIPISNK 333
           AK +QQK  + +  +P++NK
Sbjct: 336 AKQKQQK--ENAQQLPVANK 353



>gi|358387876|gb|EHK25470.1| hypothetical protein TRIVIDRAFT_72586 [Trichoderma virens Gv29-8]
          Length = 385

 Score =  349 bits (896), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 173/331 (52%), Positives = 230/331 (69%), Gaps = 7/331 (2%)

Query: 19  ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS-FREFDLA 77
           +L YC ASI MTV NKYV+SG  +NMNFL L IQSIVCVV ++A K   L++    FD  
Sbjct: 52  VLGYCLASISMTVVNKYVVSGSSWNMNFLYLAIQSIVCVVAIQACKQAGLITNLSPFDPE 111

Query: 78  LSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMT 137
             ++WFP+++LLV MIYTG+K+LQY+S+PVYTIFKNLTII+IAYGEV+WF  S++   + 
Sbjct: 112 KGKRWFPVSVLLVGMIYTGAKALQYISVPVYTIFKNLTIIVIAYGEVLWFGGSVTPTILL 171

Query: 138 SFLLMVFXXXXXXXXX----XXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRIRS 193
           SF L++F                        T  +GY WM  N I  AAFVL MR+ I+ 
Sbjct: 172 SFGLIIFSSMVAAWADADAAGRSAKASQSFSTLQVGYTWMGLNVICQAAFVLGMRKVIKK 231

Query: 194 TNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFG 253
             FKD+DT++YNN L+IP+L+  SL+VEDWS  N  +N PE+ RT LI  +++SG+ A  
Sbjct: 232 MGFKDWDTMFYNNFLTIPVLIIGSLLVEDWSADNLARNFPEETRTNLILGMVYSGLCAIF 291

Query: 254 ISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSI 313
           ISY+SAWC+RVTSSTTYSMVGALNKLP+A SG+IFF  P+T G+VSAIF+GFV+G++Y+ 
Sbjct: 292 ISYSSAWCIRVTSSTTYSMVGALNKLPIAVSGLIFFDAPVTFGSVSAIFIGFVSGLVYAW 351

Query: 314 AKTEQQKPIKPSVYIPISNKELPQTTTNDNN 344
            K  Q +  K S  +P++NK +   ++  NN
Sbjct: 352 GKIRQGEKAKMS--LPVTNKPVMSASSQSNN 380



>gi|452982507|gb|EME82266.1| hypothetical protein MYCFIDRAFT_197434 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 349

 Score =  348 bits (892), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 167/333 (50%), Positives = 233/333 (69%), Gaps = 11/333 (3%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDL 76
           L I  YCA+SILMTV+NKY ++G  +N++F LL +Q++VC+  +   K   ++++R+F+ 
Sbjct: 15  LSIFAYCASSILMTVSNKYCVNGTGWNLSFFLLAVQALVCIAAISTCKAFGIITYRDFNT 74

Query: 77  ALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTM 136
             +RKWFP+++LL+ MIYT  K+LQ+LSIPVYTIFKNLTIILIAYGEV+WF  S+  + +
Sbjct: 75  DEARKWFPVSLLLIGMIYTSIKALQFLSIPVYTIFKNLTIILIAYGEVLWFGGSVGGMAL 134

Query: 137 TSFLLMVFXXXXXX-----------XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVL 185
            SF LMV                                T + GY+WMA NC+SSA +VL
Sbjct: 135 LSFGLMVLSSIIAAWADISHALASYSGDAVTGEAAEKISTLNAGYIWMALNCLSSAGYVL 194

Query: 186 TMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAIL 245
            MR+RI+ TNFKDFDT++YNNLLSIP+L+  +L++EDWS  N   N P   +  +I A++
Sbjct: 195 GMRKRIKLTNFKDFDTMFYNNLLSIPILLICTLLLEDWSSANIAINFPPGRQQLMIAAMI 254

Query: 246 FSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGF 305
           F+G+S+  ISYTSAWCVRVTSSTTYSMVGALNKLP+A SG++FF  P+T  +VSAIFVGF
Sbjct: 255 FTGLSSIFISYTSAWCVRVTSSTTYSMVGALNKLPIAISGLVFFDAPVTLASVSAIFVGF 314

Query: 306 VAGILYSIAKTEQQKPIKPSVYIPISNKELPQT 338
           V+G++Y++AK  Q+K  K  + +  S++ +  +
Sbjct: 315 VSGVVYALAKVWQKKDDKNVLPVSASSQSMKDS 347



>gi|255943747|ref|XP_002562641.1| Pc20g00790 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211587376|emb|CAP85408.1| Pc20g00790 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 378

 Score =  347 bits (891), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 185/340 (54%), Positives = 242/340 (71%), Gaps = 10/340 (2%)

Query: 2   AQPPTILAFLSAT----GTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCV 57
           A PPT     S+T       P+L YC +SI+MTV NKYVLSG DFN+NFLLL +QS+VC+
Sbjct: 27  APPPTPSPRASSTVSNNPAFPVLAYCGSSIMMTVMNKYVLSGLDFNLNFLLLCVQSLVCI 86

Query: 58  VLLRAFKMLNLVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTII 117
             ++  K + L++FR+F+   +RKWFPI +LL+ MIYTGSK+LQ+LSIPVYTIFKNLTII
Sbjct: 87  AAIQTCKSMGLITFRDFNTDEARKWFPITLLLIGMIYTGSKALQFLSIPVYTIFKNLTII 146

Query: 118 LIAYGEVIWFDCSISRLTMTSFLLMVFXXXXXX-----XXXXXXXXXXXXXXTFDIGYLW 172
           LIAYGEV+WF  S++ LT+ SF LMVF                         T + GY+W
Sbjct: 147 LIAYGEVLWFGGSVTNLTLFSFGLMVFSSLIAAWADIKHAVESTGDTSSKVSTLNAGYVW 206

Query: 173 MAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNL 232
           M  NC+ ++++VL MR+RI+ TNFKDFDT++YNNLLSIP+L+ ++L+VEDWS  N  +N 
Sbjct: 207 MLINCLCTSSYVLGMRKRIKLTNFKDFDTMFYNNLLSIPVLIVLTLLVEDWSSANLARNF 266

Query: 233 PEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDP 292
           PE  R  +  A++ SG S+  ISYTSAWCVR TSSTTYSMVGALNKLP+A SG+IFF  P
Sbjct: 267 PEANRDGIFFAMVLSGASSVFISYTSAWCVRTTSSTTYSMVGALNKLPIALSGLIFFDAP 326

Query: 293 ITTGNVSAIFVGFVAGILYSIAKTEQQ-KPIKPSVYIPIS 331
           +T  +VSAI +GFV+GI+Y++AK +Q  KP    +  P+S
Sbjct: 327 VTFPSVSAIAIGFVSGIVYAVAKIKQNSKPRTGVLPTPVS 366



>gi|405121367|gb|AFR96136.1| nucleotide-sugar transporter [Cryptococcus neoformans var. grubii
           H99]
          Length = 397

 Score =  347 bits (890), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 175/321 (54%), Positives = 224/321 (69%), Gaps = 17/321 (5%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDL 76
           LPIL+YCAASI+MTV NKYV+SG +F M FLLL IQS VCV+ +   K L  ++FR+FD 
Sbjct: 63  LPILSYCAASIMMTVVNKYVVSGANFTMTFLLLAIQSSVCVLAVTTVKKLGFITFRDFDK 122

Query: 77  ALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTM 136
             ++ W+PI+ LLVA+IYTGSK+LQ+LSIPVYTIFKNLTIILIAYGEV  F+ +++ LT+
Sbjct: 123 NDAKAWWPISTLLVAVIYTGSKALQFLSIPVYTIFKNLTIILIAYGEVFMFNGAVTGLTL 182

Query: 137 TSFLLMVFXXXXXX-----------------XXXXXXXXXXXXXXTFDIGYLWMAFNCIS 179
            SF LMV                                        + GY+WMA NC  
Sbjct: 183 CSFALMVGSSIIAAWSDITSVWNKEPELDPTTGLEIAVGPVSTIGGLNAGYVWMALNCFV 242

Query: 180 SAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTT 239
           SAA+VL MR+RI+ T FKD+D++YYNNLLSIP+L+  S++ EDW  ++   N P   R  
Sbjct: 243 SAAYVLFMRKRIKITGFKDWDSMYYNNLLSIPILVVFSVVTEDWGSESLALNFPASNRVL 302

Query: 240 LITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVS 299
           L++A+ FSG +A  ISY++AWCVR+T STTYSMVGALNKLPVAASG++FFGDP   GN+S
Sbjct: 303 LLSAMAFSGAAAVFISYSTAWCVRITGSTTYSMVGALNKLPVAASGILFFGDPANFGNIS 362

Query: 300 AIFVGFVAGILYSIAKTEQQK 320
           AI VG VAG++Y++AKT Q K
Sbjct: 363 AIAVGGVAGVVYAVAKTNQAK 383



>gi|189041377|sp|A8N9T6.2|GMT_COPC7 RecName: Full=GDP-mannose transporter; Short=GMT
          Length = 360

 Score =  347 bits (890), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 170/304 (55%), Positives = 215/304 (70%), Gaps = 18/304 (5%)

Query: 35  YVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLALSRKWFPIAMLLVAMIY 94
           +V+SG +F+MNFLLL IQS VC   + A K L ++SFR+FD+  ++ WFPI+ LLV++IY
Sbjct: 39  FVVSGANFSMNFLLLCIQSSVCCACVFAVKKLGIISFRDFDMKDAKMWFPISFLLVSVIY 98

Query: 95  TGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTSFLLMVFXX-------- 146
           TGSKSLQYLSIPVYTIFKNLTIILIAYGEV+WF   ++ LT  SF+ MV           
Sbjct: 99  TGSKSLQYLSIPVYTIFKNLTIILIAYGEVLWFGGRVTALTFVSFIFMVISSIIAAWSDV 158

Query: 147 ----------XXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRIRSTNF 196
                                         ++GY WM  NC++SAA+VL+MR+RI+ST F
Sbjct: 159 QSALASSIPGASSGVSVGAMQSLFGALRGLNVGYFWMLVNCLTSAAYVLSMRKRIKSTGF 218

Query: 197 KDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFGISY 256
            D+DT++YNNLLSIP+L   SL+ EDW  +N  +N P + R  L+ AI FSG +A GISY
Sbjct: 219 SDWDTMFYNNLLSIPVLAVFSLIAEDWGRENLNRNFPAETRNFLLFAIAFSGAAAVGISY 278

Query: 257 TSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSIAKT 316
           T+AWCVRVTSSTTYSMVGALNKLPVAASGM+FFGDP+T G+VSA+ VGF AGI+Y++AK 
Sbjct: 279 TTAWCVRVTSSTTYSMVGALNKLPVAASGMLFFGDPVTVGSVSAVGVGFFAGIVYAVAKN 338

Query: 317 EQQK 320
            Q+K
Sbjct: 339 NQKK 342



>gi|452841152|gb|EME43089.1| hypothetical protein DOTSEDRAFT_131590 [Dothistroma septosporum
           NZE10]
          Length = 353

 Score =  345 bits (885), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 164/316 (51%), Positives = 225/316 (71%), Gaps = 11/316 (3%)

Query: 19  ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLAL 78
           I  YC +SILMTV+NKY ++G  +N++F LL +QSIVC++ +   K +NL+++R+F+   
Sbjct: 15  IFAYCGSSILMTVSNKYCVNGTGWNLSFFLLAVQSIVCIIAISTGKAMNLITYRDFNTDE 74

Query: 79  SRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTS 138
           +RKWFP+++LL+ MIYT  K+LQ+LSIPVYTIFKNLTIILIAYGEV+WF   +  + + S
Sbjct: 75  ARKWFPVSLLLIGMIYTSIKALQFLSIPVYTIFKNLTIILIAYGEVLWFGGHVGGMALLS 134

Query: 139 FLLMVFXXXXXXXXXXXXX-----------XXXXXXXTFDIGYLWMAFNCISSAAFVLTM 187
           F LMV                                T + GY+WMA NC  SA +VL M
Sbjct: 135 FGLMVLSSVIAAWADITHALGSHGGDVLDPAAAEKIATLNSGYIWMALNCFCSAGYVLGM 194

Query: 188 RRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFS 247
           R+RI+ TNFKDFDT++YNNLLS+P+L+  SL++EDWS  N   N P   +TT++ A++F+
Sbjct: 195 RKRIKLTNFKDFDTMFYNNLLSVPILLIASLLLEDWSSANLAVNFPPGRQTTMLAAMIFT 254

Query: 248 GISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVA 307
           G+S+  ISYTSAWCVRVT STTYSMVGALNKLP+A SG++FF  P+T  +VSAIF+GFV+
Sbjct: 255 GLSSIFISYTSAWCVRVTCSTTYSMVGALNKLPIAISGLVFFDAPVTFPSVSAIFLGFVS 314

Query: 308 GILYSIAKTEQQKPIK 323
           G++Y++AK  Q++  K
Sbjct: 315 GLVYAVAKIWQKEADK 330



>gi|392575244|gb|EIW68378.1| hypothetical protein TREMEDRAFT_69337 [Tremella mesenterica DSM
           1558]
          Length = 409

 Score =  344 bits (883), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 177/329 (53%), Positives = 221/329 (67%), Gaps = 20/329 (6%)

Query: 18  PILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLA 77
           PIL+YC ASI+MTVTNK+V+SG  F M FLLL +QS VCV  +   K   L++FR+FD+ 
Sbjct: 73  PILSYCVASIMMTVTNKFVVSGSQFTMTFLLLTVQSAVCVACVYTAKRTGLIAFRDFDMT 132

Query: 78  LSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMT 137
            ++ WFP++ LLVA+IYTGSKSLQ+LSIPVYTIFKN+TIILIA GE + F  SI+ LT+ 
Sbjct: 133 DAKAWFPVSFLLVAVIYTGSKSLQFLSIPVYTIFKNMTIILIAAGETVLFGGSITGLTIV 192

Query: 138 SFLLMVFXXXXXXXXXXXXXXXXXXX--------------------XTFDIGYLWMAFNC 177
           SFLLM+                                             GYLWM  NC
Sbjct: 193 SFLLMIGSSIIAAWSDISTTLTRLSAGMAVVDPTSGADVPLPSGVMSKLGAGYLWMLINC 252

Query: 178 ISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIR 237
           ++SAA+VL MR+RI+ T FKD+D+++YNNLLSIP+L+  SL+VEDW   +F +N PE  R
Sbjct: 253 LASAAYVLFMRKRIKVTGFKDWDSMFYNNLLSIPVLLICSLLVEDWGAASFARNFPETGR 312

Query: 238 TTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGN 297
           T L+ AI  SG  A  ISY++AWCVR   STTYSMVGALNKLPVAASG++FFGDP   GN
Sbjct: 313 TFLLFAIACSGAVAVFISYSTAWCVRTCGSTTYSMVGALNKLPVAASGILFFGDPANLGN 372

Query: 298 VSAIFVGFVAGILYSIAKTEQQKPIKPSV 326
           VSAI VG  AGI+Y++AKT Q +  K  V
Sbjct: 373 VSAIAVGGFAGIVYAVAKTNQARVEKARV 401



>gi|453083879|gb|EMF11924.1| Golgi GDP-mannose transporter [Mycosphaerella populorum SO2202]
          Length = 381

 Score =  343 bits (880), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 168/335 (50%), Positives = 231/335 (68%), Gaps = 16/335 (4%)

Query: 2   AQPPTILAFLSATGTL-----PILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVC 56
           A P  I+  +SA   +      IL YC +SILMTV+NKY ++G  +N++F LL +Q+IVC
Sbjct: 25  AAPRPIVPTMSAPAVVNNPLFSILAYCGSSILMTVSNKYCVNGTGWNLSFFLLAVQAIVC 84

Query: 57  VVLLRAFKMLNLVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTI 116
           ++ + + K +  +S+R F++  +RKWFP+++LL+ MIYT  K+LQ+LSIPVYTIFKNLTI
Sbjct: 85  IIAISSGKAMGFISYRGFNVDEARKWFPVSLLLIGMIYTSIKALQFLSIPVYTIFKNLTI 144

Query: 117 ILIAYGEVIWFDCSISRLTMTSFLLMVFXXXXXXXXXXXXX-----------XXXXXXXT 165
           ILIAYGEV+WF  S++ + + SF LMV                                T
Sbjct: 145 ILIAYGEVLWFGGSVTGMALLSFGLMVLSSIIAAWADISHALASYGGNAVTGEAAEKIAT 204

Query: 166 FDIGYLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSE 225
            + GY+WMA NC+ SA +VL MR+RI+ TNFKDFDT+YYNNLLSIP+L+  SL++EDWS 
Sbjct: 205 LNSGYIWMALNCVCSAGYVLGMRKRIKLTNFKDFDTMYYNNLLSIPILLIASLLLEDWSA 264

Query: 226 KNFEKNLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASG 285
            N   N P   +  +I A++F+G+S+  ISYTSAWCVRVTSSTTYSMVGALNKLP+A SG
Sbjct: 265 ANLAINFPPGRQQLMIAAMIFTGLSSIFISYTSAWCVRVTSSTTYSMVGALNKLPIAISG 324

Query: 286 MIFFGDPITTGNVSAIFVGFVAGILYSIAKTEQQK 320
           ++FF  P+T  + SAIFVGFV+G++++++K    K
Sbjct: 325 LVFFNAPVTLASCSAIFVGFVSGLVFALSKVWSSK 359



>gi|398393832|ref|XP_003850375.1| hypothetical protein MYCGRDRAFT_74783 [Zymoseptoria tritici IPO323]
 gi|339470253|gb|EGP85351.1| hypothetical protein MYCGRDRAFT_74783 [Zymoseptoria tritici IPO323]
          Length = 355

 Score =  342 bits (878), Expect = 9e-92,   Method: Compositional matrix adjust.
 Identities = 165/325 (50%), Positives = 227/325 (69%), Gaps = 11/325 (3%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDL 76
           L I  YC +SILMTV+NK+ ++G  +N++F LL +QSIVC++ +   K + ++++R+++ 
Sbjct: 13  LSIFAYCGSSILMTVSNKFCVNGTGWNLSFFLLAVQSIVCIIAISTGKAMGVINYRDYNT 72

Query: 77  ALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTM 136
             ++KWFP+++LLV MIYT  ++LQ+LSIPVYTIFKNLTIILIAYGEV+WF  S+S + +
Sbjct: 73  DEAKKWFPVSLLLVGMIYTSLQALQFLSIPVYTIFKNLTIILIAYGEVLWFGGSVSGMAL 132

Query: 137 TSFLLMVFXXXXXXXXXXXXXXX-----------XXXXXTFDIGYLWMAFNCISSAAFVL 185
            SF LMV                                T + GY+WMA NC  SA +VL
Sbjct: 133 LSFGLMVASSIIAAWADISHALASYGGDALVGEAAEKVATLNKGYVWMAMNCFCSAGYVL 192

Query: 186 TMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAIL 245
            MR+RI+ TNFKDFDT+YYNNLLSIP+L+  S+ +EDWS  N   N P+D +  ++ A++
Sbjct: 193 GMRKRIKLTNFKDFDTMYYNNLLSIPVLLICSICLEDWSAANLAVNFPQDRQGWMVAAMI 252

Query: 246 FSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGF 305
           F+G+S+  ISYTSAWCVRVTSSTTYSMVGALNKLP+A SG++FF  P+T  +VSAIFVGF
Sbjct: 253 FTGLSSIFISYTSAWCVRVTSSTTYSMVGALNKLPIAISGLVFFDAPVTLASVSAIFVGF 312

Query: 306 VAGILYSIAKTEQQKPIKPSVYIPI 330
           V+GI+Y++AK    K       +P+
Sbjct: 313 VSGIVYALAKVWSSKDKDAKTSLPM 337



>gi|408400394|gb|EKJ79476.1| hypothetical protein FPSE_00407 [Fusarium pseudograminearum CS3096]
          Length = 390

 Score =  341 bits (874), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 169/332 (50%), Positives = 223/332 (67%), Gaps = 10/332 (3%)

Query: 2   AQPPTILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLR 61
           AQP   +A +  +G   IL YC +SI MTV NKYV+SG  +N+ F  L +QSIVC+  + 
Sbjct: 46  AQPGGFMATVENSGPFSILAYCLSSISMTVVNKYVVSGSSWNLTFFYLAVQSIVCIAAIT 105

Query: 62  AFKMLNLV-SFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIA 120
           A K L ++ S    ++   +KW+PI+++LV MIYT +K+LQYLS+PVYTIFKNLTII IA
Sbjct: 106 ACKQLGMIKSLAPLEMDRIKKWYPISLVLVGMIYTSTKALQYLSVPVYTIFKNLTIIAIA 165

Query: 121 YGEVIWFDCSISRLTMTSFLLMVFXXXXXXXX---------XXXXXXXXXXXXTFDIGYL 171
           YGEV+WF  S++   + SF LMV                              T + GY 
Sbjct: 166 YGEVLWFGGSVTSTALASFSLMVLSSVVAAWADIKSAISGDYSATTGDADALATLNAGYF 225

Query: 172 WMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKN 231
           WMA N I SA++VL MR+ I   NFKD+DT+YYNNLL+IP+L+  SL+ EDWS  N  KN
Sbjct: 226 WMAMNVICSASYVLGMRKVIHKMNFKDWDTMYYNNLLTIPVLVFFSLVTEDWSSANLAKN 285

Query: 232 LPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGD 291
            PED R  ++  I++SG++A  ISY SAWC+RVTSSTTYSMVGALNKLP+A SG+IFF  
Sbjct: 286 FPEDTRNRMMIGIIYSGLAAIFISYCSAWCIRVTSSTTYSMVGALNKLPIAVSGLIFFAA 345

Query: 292 PITTGNVSAIFVGFVAGILYSIAKTEQQKPIK 323
           P+T G+VSAIF+GFV+GI+Y+ AK ++ +  K
Sbjct: 346 PVTFGSVSAIFIGFVSGIVYAWAKVKENEAKK 377



>gi|46111635|ref|XP_382875.1| hypothetical protein FG02699.1 [Fusarium graminearum PH-1]
          Length = 390

 Score =  340 bits (873), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 169/332 (50%), Positives = 223/332 (67%), Gaps = 10/332 (3%)

Query: 2   AQPPTILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLR 61
           AQP   +A +  +G   IL YC +SI MTV NKYV+SG  +N+ F  L +QSIVC+  + 
Sbjct: 46  AQPGGFMATVENSGPFSILAYCLSSISMTVVNKYVVSGSSWNLTFFYLAVQSIVCIAAIT 105

Query: 62  AFKMLNLV-SFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIA 120
           A K L ++ S    ++   +KW+PI+++LV MIYT +K+LQYLS+PVYTIFKNLTII IA
Sbjct: 106 ACKQLGMIKSLAPLEMDRIKKWYPISLVLVGMIYTSTKALQYLSVPVYTIFKNLTIIAIA 165

Query: 121 YGEVIWFDCSISRLTMTSFLLMVFXXXXXXXX---------XXXXXXXXXXXXTFDIGYL 171
           YGEV+WF  S++   + SF LMV                              T + GY 
Sbjct: 166 YGEVLWFGGSVTSTALASFSLMVLSSVVAAWADIKSAISGDYSATTGDADALATLNAGYF 225

Query: 172 WMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKN 231
           WMA N I SA++VL MR+ I   NFKD+DT+YYNNLL+IP+L+  SL+ EDWS  N  KN
Sbjct: 226 WMAMNVICSASYVLGMRKVIHKMNFKDWDTMYYNNLLTIPVLVFFSLVTEDWSSANLAKN 285

Query: 232 LPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGD 291
            PED R  ++  I++SG++A  ISY SAWC+RVTSSTTYSMVGALNKLP+A SG+IFF  
Sbjct: 286 FPEDSRNRMMIGIIYSGLAAIFISYCSAWCIRVTSSTTYSMVGALNKLPIAVSGLIFFAA 345

Query: 292 PITTGNVSAIFVGFVAGILYSIAKTEQQKPIK 323
           P+T G+VSAIF+GFV+GI+Y+ AK ++ +  K
Sbjct: 346 PVTFGSVSAIFIGFVSGIVYAWAKVKENEAKK 377



>gi|358058600|dbj|GAA95563.1| hypothetical protein E5Q_02218 [Mixia osmundae IAM 14324]
          Length = 517

 Score =  340 bits (873), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 174/324 (53%), Positives = 216/324 (66%), Gaps = 29/324 (8%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDL 76
           LP+  YC +SILMTV NK+VLSG  F+MNFLLL IQS VC+  +   K L L++FR+FD 
Sbjct: 177 LPVACYCLSSILMTVVNKFVLSGAHFSMNFLLLTIQSTVCIACVTVCKRLRLITFRDFDR 236

Query: 77  ALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTM 136
             +R WFPI+ +LV +IYTGSK+LQYL IPV ++ KNLTIILIAYGEV+WF  S++ L M
Sbjct: 237 QDARAWFPISFMLVMVIYTGSKALQYLPIPVVSVCKNLTIILIAYGEVLWFSGSVTGLIM 296

Query: 137 TSFLLMVFXXXXXX----XXXXXXXXXXXXXXTFD------------------------- 167
            SF LM+                         T D                         
Sbjct: 297 CSFGLMILSSLIAGWADISHALQSLSEVSAQTTLDPVTGAEIPAMPTSIPDITAAVGQLN 356

Query: 168 IGYLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKN 227
            GYLWMA N   SA +VL MR+RI+ TNFKD+D++YYNNLLSIP+L+  SL++EDWS K+
Sbjct: 357 AGYLWMAINVFVSAGYVLAMRKRIKVTNFKDWDSMYYNNLLSIPVLVFFSLLIEDWSAKS 416

Query: 228 FEKNLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMI 287
            E N P + R  L+ A++FSG +A  ISYT+AWCVR TSSTTYSMVGALNKLPVAASGM+
Sbjct: 417 LEANFPAEGRYFLLFAMVFSGAAAVFISYTTAWCVRTTSSTTYSMVGALNKLPVAASGMV 476

Query: 288 FFGDPITTGNVSAIFVGFVAGILY 311
           FFGDPITTG+V  +  GFVAG++Y
Sbjct: 477 FFGDPITTGSVGGVLTGFVAGLVY 500



>gi|358390314|gb|EHK39720.1| hypothetical protein TRIATDRAFT_303026 [Trichoderma atroviride IMI
           206040]
          Length = 385

 Score =  340 bits (872), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 168/334 (50%), Positives = 229/334 (68%), Gaps = 7/334 (2%)

Query: 19  ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS-FREFDLA 77
           +L YC ASI MTV NK+V+SG  +NMNFL L IQSIVC V ++A K   L++    FD+ 
Sbjct: 53  VLGYCLASISMTVVNKFVVSGSSWNMNFLYLAIQSIVCCVAIQACKQAGLITNLSAFDVE 112

Query: 78  LSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMT 137
             +KWFPI++LLV MIYTG+K+LQYLS+PVYTIFKNLTII+IAYGEV+WF  S+S   + 
Sbjct: 113 KGKKWFPISVLLVGMIYTGAKALQYLSVPVYTIFKNLTIIVIAYGEVLWFGGSVSPTILL 172

Query: 138 SFLLMVFXXXXXXXXXX----XXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRIRS 193
           SF L+VF                        T  +GY WMA N    AAFVL MR+ I+ 
Sbjct: 173 SFGLIVFSSIVAAWADADAARGSSKASQSLATLQVGYTWMALNVFCQAAFVLGMRKVIKK 232

Query: 194 TNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFG 253
             FKD+DT++YNN L+IP+L+  SL++EDWS +N  +N P + R +LI  +++SG+ A  
Sbjct: 233 MGFKDWDTMFYNNFLTIPVLIVGSLLLEDWSAENLARNFPAETRNSLIIGMIYSGLCAIF 292

Query: 254 ISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSI 313
           ISY+SAWC+RVTSSTTYSMVGALNKLP+A SG+IFF  P+T G+VSAI +GF +G++Y+ 
Sbjct: 293 ISYSSAWCIRVTSSTTYSMVGALNKLPIAVSGLIFFDAPVTFGSVSAIIIGFFSGLVYAW 352

Query: 314 AKTEQQKPIKPSVYIPISNKELPQTTTNDNNTTE 347
            K  Q +  K S  +P++   +  ++ ++N+ + 
Sbjct: 353 GKVRQTEKAKMS--LPVTKPVMSASSQSNNDASN 384



>gi|342888195|gb|EGU87561.1| hypothetical protein FOXB_01943 [Fusarium oxysporum Fo5176]
          Length = 390

 Score =  339 bits (869), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 169/346 (48%), Positives = 228/346 (65%), Gaps = 12/346 (3%)

Query: 2   AQPPTILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLR 61
           AQP   +  +  +G   IL YC +SI MTV NKYV+SG  +N+ F  L +QSIVC+V + 
Sbjct: 46  AQPSGFMNKIENSGPFSILAYCLSSISMTVVNKYVVSGTSWNLTFFYLAVQSIVCIVAIT 105

Query: 62  AFKMLNLV-SFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIA 120
           A K   ++ S    ++   +KW+PI+++LV MIYT +K+LQYLS+PVYTIFKNLTII IA
Sbjct: 106 ACKQFGMIKSLAPLEMDRIKKWYPISLVLVGMIYTSTKALQYLSVPVYTIFKNLTIIAIA 165

Query: 121 YGEVIWFDCSISRLTMTSFLLMVFXXXXXXXX---------XXXXXXXXXXXXTFDIGYL 171
           YGEV+WF  S++ + ++SF LMV                              T + GY 
Sbjct: 166 YGEVLWFGGSVTPIALSSFGLMVLSSVVAAWADIKSAISGDYSATTGDADALATLNAGYF 225

Query: 172 WMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKN 231
           WMA N   SA++VL MR+ I   NFKD+DT+YYNNLL+IP+L+  SL+ EDWS  NF KN
Sbjct: 226 WMAMNVFCSASYVLGMRKVIHKMNFKDWDTMYYNNLLTIPVLVFFSLVTEDWSSANFAKN 285

Query: 232 LPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGD 291
            PED R  +   I++SG++A  ISY SAWC+RVTSSTTYSMVGALNKLP+A SG++FF  
Sbjct: 286 FPEDSRNRIFIGIIYSGLAAIFISYCSAWCIRVTSSTTYSMVGALNKLPIAVSGLVFFAA 345

Query: 292 PITTGNVSAIFVGFVAGILYSIAKTEQQKPIKPSVYIPISNKELPQ 337
           P+T G+VSAIF+GFV+GI+Y+ AK ++ +  K +  +P +    P 
Sbjct: 346 PVTVGSVSAIFIGFVSGIVYAWAKVKENEAKKNA--LPTAESREPS 389



>gi|477513770|gb|ENH66234.1| GDP-mannose transporter [Fusarium oxysporum f. sp. cubense race 1]
          Length = 380

 Score =  338 bits (868), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 167/332 (50%), Positives = 223/332 (67%), Gaps = 10/332 (3%)

Query: 2   AQPPTILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLR 61
           AQP   +  +  +G   IL YC +SI MTV NKYV+SG  +N+ F  L +QSIVC+V + 
Sbjct: 46  AQPSGFMNKIENSGPFSILAYCLSSISMTVVNKYVVSGTSWNLTFFYLAVQSIVCIVAIT 105

Query: 62  AFKMLNLV-SFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIA 120
           A K   ++ S    ++   +KW+PI+++LV MIYT +K+LQYLS+PVYTIFKNLTII IA
Sbjct: 106 ACKQFGMIKSLAPLEMDRIKKWYPISLVLVGMIYTSTKALQYLSVPVYTIFKNLTIIAIA 165

Query: 121 YGEVIWFDCSISRLTMTSFLLMVFXXXXXXXX---------XXXXXXXXXXXXTFDIGYL 171
           YGEV+WF  S++ + ++SF LMV                              T + GY 
Sbjct: 166 YGEVLWFGGSVTPIALSSFGLMVLSSVVAAWADIKSAISGDYSATTGDADALATLNAGYF 225

Query: 172 WMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKN 231
           WMA N   SA++VL MR+ I   NFKD+DT+YYNNLL+IP+L+  SL+ EDWS  NF KN
Sbjct: 226 WMAMNVFCSASYVLGMRKVIHKMNFKDWDTMYYNNLLTIPVLVFFSLVTEDWSSANFAKN 285

Query: 232 LPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGD 291
            PED R  +   I++SG++A  ISY SAWC+RVTSSTTYSMVGALNKLP+A SG++FF  
Sbjct: 286 FPEDSRNRIFIGIIYSGLAAIFISYCSAWCIRVTSSTTYSMVGALNKLPIAVSGLVFFAA 345

Query: 292 PITTGNVSAIFVGFVAGILYSIAKTEQQKPIK 323
           P+T G+VSAIF+GFV+GI+Y+ AK ++ +  K
Sbjct: 346 PVTVGSVSAIFIGFVSGIVYAWAKVKENEAKK 377



>gi|406604393|emb|CCH44158.1| GDP-mannose transporter 1 [Wickerhamomyces ciferrii]
          Length = 314

 Score =  338 bits (867), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 168/322 (52%), Positives = 227/322 (70%), Gaps = 11/322 (3%)

Query: 1   MAQPPTI---LAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCV 57
           M+QPP     LA +   G + I  YCA+SILMTVTNKYV++G+ FNMNF+LL +QS+VCV
Sbjct: 1   MSQPPQAQGGLASIVNNGPVSIFAYCASSILMTVTNKYVVNGFQFNMNFVLLLVQSVVCV 60

Query: 58  VLLRAFKMLNLVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTII 117
             +   K   ++++R  +   ++ W PI++LLV MIYT SK+LQ+LSIPVYTIFKNLTII
Sbjct: 61  AAIATLKAFGVITYRPLNKTDAKNWAPISVLLVVMIYTSSKALQFLSIPVYTIFKNLTII 120

Query: 118 LIAYGEVIWFDCSISRLTMTSFLLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNC 177
           LIAYGEV++F   ++ + + SFLLMV                        +GY WMA NC
Sbjct: 121 LIAYGEVLFFGGEVTSMALGSFLLMVL----SSVIACLGDQKDSEAFGLSVGYFWMALNC 176

Query: 178 ISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIR 237
            SSAAFVL MR+RI+ TNFKDFDT+YYNN+LSIP+L+  S ++EDWS +N   N  +   
Sbjct: 177 FSSAAFVLVMRKRIKLTNFKDFDTMYYNNVLSIPILLVSSFILEDWSPENLNANFSQPS- 235

Query: 238 TTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGN 297
              + A++ SG+++ GISY S WCVRVTSSTTYSMVGALNKLP+A SG++FF   +   +
Sbjct: 236 ---VIAMVVSGLASVGISYCSGWCVRVTSSTTYSMVGALNKLPIALSGLVFFDAAVNFLS 292

Query: 298 VSAIFVGFVAGILYSIAKTEQQ 319
           VS+IF+GF+AGI+Y++AK +++
Sbjct: 293 VSSIFIGFLAGIVYAVAKQQKK 314



>gi|471568413|gb|EMR68084.1| putative gdp-mannose transporter protein [Eutypa lata UCREL1]
          Length = 386

 Score =  338 bits (867), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 170/350 (48%), Positives = 238/350 (68%), Gaps = 9/350 (2%)

Query: 2   AQPPTILAFLSATGTLPI--LTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVL 59
           +Q P   +F     + PI  L YC +SI MTV NKYV+SG+++NMNF  L +QS+VC+V 
Sbjct: 35  SQQPLAASFTQIENSPPISILAYCLSSISMTVVNKYVVSGHEWNMNFFYLAVQSVVCIVT 94

Query: 60  LRAFKMLNLVS-FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIIL 118
           +   K + L++    FD+   ++WFPI++LLV MIYT +KSLQ+LS+PVYTIFKNLTII+
Sbjct: 95  IEVCKQVGLITNLAPFDVNKGKRWFPISLLLVGMIYTSTKSLQFLSVPVYTIFKNLTIIV 154

Query: 119 IAYGEVIWFDCSISRLTMTSFLLMVFXXXXXX----XXXXXXXXXXXXXXTFDIGYLWMA 174
           IAYGEV+WF  S++ L + SF LMV                         T + GY WM 
Sbjct: 155 IAYGEVLWFGGSVTPLALLSFGLMVLSSVVAAWADTRSAASTPEAAAALATLNAGYAWMG 214

Query: 175 FNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPE 234
            N   +A++VL MR+ I++ NFKD+DT++YNNLL+IP+L+  SL+ EDWS  NF KN P 
Sbjct: 215 MNVFCTASYVLGMRKVIKNMNFKDWDTMFYNNLLTIPVLIVFSLLAEDWSSTNFAKNFPP 274

Query: 235 DIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPIT 294
           + R +L+  +++SG++A  ISY SAWC+RVTSSTTYSMVGALNKLP+A SG+IFF  P+T
Sbjct: 275 ESRNSLMIGMIYSGMAAIFISYCSAWCIRVTSSTTYSMVGALNKLPIAISGLIFFSAPVT 334

Query: 295 TGNVSAIFVGFVAGILYSIAKTEQQKPIKPSVYIPISNKELPQTTTNDNN 344
            G+VSAIF+GFV+GI+Y+ AK  Q +  K S  +P +   +  ++ ++ +
Sbjct: 335 VGSVSAIFIGFVSGIVYAWAKVRQSQVAKNS--LPTTQPTMSASSASNRD 382



>gi|320588105|gb|EFX00580.1| golgi GDP-mannose transporter [Grosmannia clavigera kw1407]
          Length = 392

 Score =  338 bits (867), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 170/339 (50%), Positives = 229/339 (67%), Gaps = 11/339 (3%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS-FREFD 75
           L IL YC ASI MTV NKYV+SG  +N+NFL L IQS VC++ +   K + L+     FD
Sbjct: 54  LSILAYCLASISMTVVNKYVVSGSAWNLNFLYLAIQSTVCILAILFGKQVGLIKHLSPFD 113

Query: 76  LALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLT 135
               ++WFPI++LLV MIYTG+K+LQ+LS+PVYTIFKNLTII+IAYGEV+WF   +S +T
Sbjct: 114 PEKGKRWFPISLLLVGMIYTGAKALQFLSVPVYTIFKNLTIIVIAYGEVLWFGGQVSPIT 173

Query: 136 MTSFLLMVFXX--------XXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTM 187
           + SF LMV                             T + GY WM  N   SA+FVL M
Sbjct: 174 LLSFGLMVLSSIIAAWADIQAALNSVGHTAAATEAISTLNAGYAWMGLNVFCSASFVLGM 233

Query: 188 RRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFS 247
           R+ I+  NFKD DT++YNNLLSIP+L+  SL++EDWS +N E+N P + RT L+  +++S
Sbjct: 234 RKVIKKMNFKDKDTMFYNNLLSIPILVVCSLLLEDWSSENLERNFPVETRTKLLIGMVYS 293

Query: 248 GISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVA 307
           G++A  ISY SAWCVRVTSSTTYSMVGALNKLP+A SG++FF  PIT G+V+AI +GFV+
Sbjct: 294 GLAAIFISYCSAWCVRVTSSTTYSMVGALNKLPIAVSGLVFFDAPITFGSVAAIALGFVS 353

Query: 308 GILYSIAKTEQQKPIKPSVYIPISNKELPQTTTNDNNTT 346
           G++Y+ AK  Q   +KPS  +P+    +  ++ +  + +
Sbjct: 354 GLVYAWAKVRQS--VKPSESLPMQQPVMSASSQSSKDAS 390



>gi|392572678|gb|EIW65823.1| hypothetical protein TREMEDRAFT_41263 [Tremella mesenterica DSM
           1558]
          Length = 401

 Score =  338 bits (867), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 173/321 (53%), Positives = 218/321 (67%), Gaps = 16/321 (4%)

Query: 16  TLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFD 75
             PI++YC ASILMTV NKYV+SG  F M FLLL IQS VCV+ +   K    ++FR+FD
Sbjct: 66  AFPIISYCCASILMTVVNKYVVSGRHFTMTFLLLAIQSAVCVLAVWGAKRAGFITFRDFD 125

Query: 76  LALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLT 135
              ++ W+PI+ LLVA+IYTGSKSLQ+LSIPVYTIFKNLTIILIAYGEV  F+  ++ LT
Sbjct: 126 KNDAKAWWPISSLLVAVIYTGSKSLQFLSIPVYTIFKNLTIILIAYGEVFMFNGIVTGLT 185

Query: 136 MTSFLLMVFXXXXXXXXXXXXX----------------XXXXXXXTFDIGYLWMAFNCIS 179
             +F LMV                                       + GYLWMA NC++
Sbjct: 186 FAAFSLMVGSSVIAAWADISAAWNTPPTLDPTTGLELVATEYTIGGVNAGYLWMALNCLA 245

Query: 180 SAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTT 239
           SAA+VL MR+RI+ T FKD+D+++YNNLLSIP+L+  S+++EDW  ++   N P   R  
Sbjct: 246 SAAYVLFMRKRIKITGFKDWDSMFYNNLLSIPILVVFSVLIEDWGAESISLNFPASNRVA 305

Query: 240 LITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVS 299
           L++AI  SG  A  ISY++AWCVRV  STTYSMVGALNKLPVAASGMIFF DP+  GNVS
Sbjct: 306 LLSAIALSGAGAVFISYSTAWCVRVCGSTTYSMVGALNKLPVAASGMIFFRDPVNFGNVS 365

Query: 300 AIFVGFVAGILYSIAKTEQQK 320
           AI VG +AGI++++AKT Q K
Sbjct: 366 AIGVGGLAGIVFAVAKTNQAK 386



>gi|384496172|gb|EIE86663.1| hypothetical protein RO3G_11374 [Rhizopus delemar RA 99-880]
          Length = 333

 Score =  337 bits (863), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 176/311 (56%), Positives = 212/311 (68%), Gaps = 24/311 (7%)

Query: 12  SATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSF 71
           +A   LPI +YC ASILMTVTNKYVLSGY+FNMNFLLL IQ                  F
Sbjct: 38  AARAILPIASYCFASILMTVTNKYVLSGYEFNMNFLLLTIQ------------------F 79

Query: 72  REFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSI 131
           R+FD   ++KW P+A+ LV MIYTGSK+LQ+L IP+YTIFKNLTIILIAYGEV+WF  S+
Sbjct: 80  RDFDKEEAQKWLPVAISLVGMIYTGSKALQFLRIPIYTIFKNLTIILIAYGEVLWFGGSV 139

Query: 132 SRLTMTSFLLMVFXXXXXXXXXXXXXXXXXXXXTFDI-GYLWMAFNCISSAAFVLTMRRR 190
           +RL + SF LMV                        I GY WMA NCISSAAFVL MR+R
Sbjct: 140 TRLMLVSFSLMVLSSIIAGWADISDSLTEIVQLDTTIAGYFWMATNCISSAAFVLYMRKR 199

Query: 191 IRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGIS 250
           I+ TNFKDFDTV+YNN++SIP L+  S + EDWS +N   N    IR  +I A++FSG S
Sbjct: 200 IKLTNFKDFDTVFYNNIISIPFLIIPSFIFEDWSTENLSNNF--HIRQQVIVAMVFSGAS 257

Query: 251 AFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGIL 310
           AF +SY SAWCVR TSSTTYSMVGALNKLP+AASG++FFGDP T GN++AI V +V    
Sbjct: 258 AFTMSYASAWCVRTTSSTTYSMVGALNKLPIAASGILFFGDPATFGNITAIIVDYVQQ-- 315

Query: 311 YSIAKTEQQKP 321
            + A  ++  P
Sbjct: 316 -TFANEQRSHP 325



>gi|353239464|emb|CCA71375.1| probable Golgi GDP-mannose transporter [Piriformospora indica DSM
           11827]
          Length = 387

 Score =  336 bits (861), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 175/340 (51%), Positives = 222/340 (65%), Gaps = 16/340 (4%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS 70
           +S++   PI +YC +SILMTV NK  +SG  FNM  +LL IQ  VC  L+   K L +++
Sbjct: 48  ISSSPLWPIASYCVSSILMTVINKLAVSGSKFNMTCVLLFIQCTVCAFLVILCKRLRIIT 107

Query: 71  FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCS 130
            R+FD  ++RKWFPI+  LV +IYTGSKSLQYLSIPVYTIFKNLTIILIAYGE+I+F   
Sbjct: 108 VRDFDFDVARKWFPISSFLVTLIYTGSKSLQYLSIPVYTIFKNLTIILIAYGELIFFGGR 167

Query: 131 ISRLTMTSFLLMVFXXXXX---------------XXXXXXXXXXXXXXXTFDIGYLWMAF 175
           ++ L M SF LMV                                      +IGY WM  
Sbjct: 168 VTGLMMVSFALMVLSSVMASWTDIAGMFTPTNGAADSAIISDAPVTKLLGLNIGYFWMFA 227

Query: 176 NCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPED 235
           NC +SAA++LTMR++I+   FKD+DT++YNN L IPLL  MS +VEDWS  N + N PED
Sbjct: 228 NCFASAAYLLTMRKKIKQMGFKDWDTMFYNNALPIPLLAVMSFLVEDWSPSNLKANFPED 287

Query: 236 IRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITT 295
            R  L+  +  SG +   ISY++AWC+R TSSTTYSMVGALNKLPVAASGMIF GD +T 
Sbjct: 288 TRVLLLFTMALSGAATVWISYSTAWCMRTTSSTTYSMVGALNKLPVAASGMIFLGDAVTL 347

Query: 296 GNVSAIFVGFVAGILYSIAKTEQQKPIKPSV-YIPISNKE 334
           G+VSA+  GF AGI+Y++AK E QK  K  +  IP+S + 
Sbjct: 348 GSVSAVLTGFFAGIVYAVAKNELQKSEKIRMGEIPLSARR 387



>gi|367002099|ref|XP_003685784.1| hypothetical protein TPHA_0E02580 [Tetrapisispora phaffii CBS 4417]
 gi|357524083|emb|CCE63350.1| hypothetical protein TPHA_0E02580 [Tetrapisispora phaffii CBS 4417]
          Length = 339

 Score =  332 bits (852), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 166/325 (51%), Positives = 227/325 (69%), Gaps = 20/325 (6%)

Query: 15  GTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREF 74
           G + I +YC +SILMTVTNK+V++G +FNMNF++L +QS VC +LL   K L    FR F
Sbjct: 20  GPVSIFSYCLSSILMTVTNKFVVNGANFNMNFVMLFVQSAVCTLLLIVLKTLGYAKFRAF 79

Query: 75  DLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRL 134
           +   ++ W PI+ LLV MIYT SK+LQ+L+IP+YTIFKNLTIILIAYGEV++F  ++S +
Sbjct: 80  NKTDAKNWLPISFLLVLMIYTSSKALQFLAIPIYTIFKNLTIILIAYGEVLFFGGNVSSM 139

Query: 135 TMTSFLLMVFXXXXXX--------------XXXXXXXXXXXXXXTFDIGYLWMAFNCISS 180
            +++FLLMVF                                  TF+IGY+WM  NC+SS
Sbjct: 140 ELSAFLLMVFSSVVAAWGDSQAVAVKNAALVAEDVTVGSADLISTFNIGYVWMLTNCLSS 199

Query: 181 AAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTL 240
           AAFVL MR+RI+ TNFKDFDT++YNN+L++P+L+  S +VEDWS +N  +N   D  T  
Sbjct: 200 AAFVLIMRKRIKLTNFKDFDTMFYNNVLALPILIIFSFIVEDWSSENLAQNFSSDTAT-- 257

Query: 241 ITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSA 300
             A++ SG+++ GISY S WCVRVTSSTTYSMVGALNKLP+A SG++FF  P    ++S+
Sbjct: 258 --AMIISGMASVGISYCSGWCVRVTSSTTYSMVGALNKLPIALSGLVFFDAPKNFLSISS 315

Query: 301 IFVGFVAGILYSIAKTEQQKPIKPS 325
           IF+GF++G++Y++AK  Q+K   PS
Sbjct: 316 IFIGFLSGLVYAVAK--QKKSQSPS 338



>gi|322712359|gb|EFZ03932.1| GDP-mannose transporter [Metarhizium anisopliae ARSEF 23]
          Length = 381

 Score =  332 bits (851), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 163/331 (49%), Positives = 228/331 (68%), Gaps = 3/331 (0%)

Query: 5   PTILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFK 64
           P++ +  S+ G   I  YC +S+ MT+ NKYV+SG ++NMN L L +QSIV  + +   K
Sbjct: 53  PSMASLESSRGA-SIFAYCLSSMSMTIVNKYVVSGSNWNMNLLYLAVQSIVGTLAIIMCK 111

Query: 65  MLNLVS-FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGE 123
              +V     FD   ++ WFPIA+LLVAMIYTG+K+LQYLS+PVYTIFKNLTII+IAYGE
Sbjct: 112 QAGMVKDLGPFDSQKAKTWFPIALLLVAMIYTGNKALQYLSVPVYTIFKNLTIIVIAYGE 171

Query: 124 VIWFDCSISRLTMTSFLLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAF 183
           V+WF  S++ LT+ SF++MVF                    T ++GY WM  N   +A +
Sbjct: 172 VLWFGSSLTPLTLVSFIMMVFSSVVAAWADARSASTAAAVTTLNLGYGWMGINVFCAAMY 231

Query: 184 VLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITA 243
            L+MR+ I+ T F +++ +YYNNLL+IP+L+  SL+VEDWS  N   N P D R ++ T 
Sbjct: 232 ALSMRKVIKKTGFNNWEVMYYNNLLTIPVLIISSLLVEDWSSANLNSNFPADSRYSMCTG 291

Query: 244 ILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFV 303
           +++SG+ A  ISY++AWC+R TSSTTY+MVGALNKLPVA  G+IFF  P+T G+VSAI +
Sbjct: 292 MVYSGLGAIFISYSTAWCIRATSSTTYAMVGALNKLPVAILGIIFFAAPVTFGSVSAIVL 351

Query: 304 GFVAGILYSIAKTEQQKPIKPSVYIPISNKE 334
           GFV+GI+Y++AK ++ K  KP   +P++NK 
Sbjct: 352 GFVSGIVYTVAKLQKGKE-KPQPALPLTNKR 381



>gi|50302251|ref|XP_451059.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|74607885|sp|Q6CYD0.1|GMT_KLULA RecName: Full=GDP-mannose transporter; Short=GMT
 gi|49640190|emb|CAH02647.1| KLLA0A01364p [Kluyveromyces lactis]
          Length = 330

 Score =  332 bits (850), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 166/323 (51%), Positives = 231/323 (71%), Gaps = 6/323 (1%)

Query: 8   LAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLN 67
           L+ ++ +G + I  YC +SI+MTVTNK+V++   FNMNF++L +Q+ VCV LL   ++L 
Sbjct: 11  LSHVANSGPISIGAYCFSSIMMTVTNKFVVNLKGFNMNFVMLFVQAAVCVNLLFFLRLLG 70

Query: 68  LVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWF 127
              FR  +   ++ WFPI + LV MIYT SKSLQYL++P+YTIFKNLTIILIAYGEV++F
Sbjct: 71  YAKFRPLNRTDAKNWFPITIFLVLMIYTSSKSLQYLAVPIYTIFKNLTIILIAYGEVLFF 130

Query: 128 DCSISRLTMTSFLLMVFXXXXXXX--XXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVL 185
             S++ + ++SFLLMV                        F+IGY+WM  NC+SSAAFVL
Sbjct: 131 GGSVTAMELSSFLLMVLSSVVATLGDQQALKKTADAGASLFNIGYMWMFINCLSSAAFVL 190

Query: 186 TMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAIL 245
            MR+RI+ TNFKDFDT++YNN+LS+P+L+ +S ++EDWS +N  KNL  D     +TA++
Sbjct: 191 VMRKRIKLTNFKDFDTMFYNNILSMPVLLALSFLMEDWSTENLTKNLSRDS----VTAMI 246

Query: 246 FSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGF 305
            SG++A  ISY S WCVRVTSSTTYSMVGALNKLP+A SG+IFF  P    ++ +IF+GF
Sbjct: 247 ISGMTAVCISYCSGWCVRVTSSTTYSMVGALNKLPIALSGLIFFDAPKNFLSIFSIFLGF 306

Query: 306 VAGILYSIAKTEQQKPIKPSVYI 328
           ++GI+Y++AK ++Q+  +PS  I
Sbjct: 307 LSGIVYAVAKQKKQQNPQPSAPI 329



>gi|302891757|ref|XP_003044760.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256725685|gb|EEU39047.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 385

 Score =  331 bits (848), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 165/334 (49%), Positives = 225/334 (67%), Gaps = 11/334 (3%)

Query: 4   PPT-ILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRA 62
           PPT  LA +  +G   I+ YC +SI MTV NKYV+SG  +N+ F  L IQSIVC++ + A
Sbjct: 42  PPTGFLAKIENSGPFSIMAYCVSSISMTVVNKYVVSGTSWNLTFFYLAIQSIVCIITITA 101

Query: 63  FKMLNLV-SFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAY 121
            K   L+ S    D    +KW+PI+++LV MIYT +++LQYLS+PVYTIFKNLTII IAY
Sbjct: 102 CKYFGLIKSLAPLDPERIKKWYPISLVLVGMIYTSTRALQYLSVPVYTIFKNLTIIAIAY 161

Query: 122 GEVIWFDCSISRLTMTSFLLMVFXX---------XXXXXXXXXXXXXXXXXXTFDIGYLW 172
           GEV+WF  ++S   +++F LMV                              T + GY W
Sbjct: 162 GEVLWFGGAVSPTALSAFGLMVLSSIVAAWADIKSAMSGDYSATAGDKDALATLNAGYFW 221

Query: 173 MAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNL 232
           MA N   SA++VL MR+ I+  NFKD+D++YYNNLL+IP+L+  SL+ EDWS  NF KN 
Sbjct: 222 MAMNVFCSASYVLGMRKVIKKMNFKDWDSMYYNNLLTIPVLVICSLLTEDWSSANFAKNF 281

Query: 233 PEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDP 292
           PE+ R  +   I++SG++A  ISY +AWC+RVTSSTTYSMVGALNKLP+A SG+IFF  P
Sbjct: 282 PEEYRNRITIGIIYSGVAAIFISYCTAWCIRVTSSTTYSMVGALNKLPIAISGLIFFAAP 341

Query: 293 ITTGNVSAIFVGFVAGILYSIAKTEQQKPIKPSV 326
           +T G+VSAIF+GFV+G++Y+ +K ++ +  K S+
Sbjct: 342 VTVGSVSAIFLGFVSGLVYTWSKVKESEAKKNSL 375



>gi|471907854|emb|CCO28451.1| GDP-mannose transporter Short=GMT [Rhizoctonia solani AG-1 IB]
          Length = 385

 Score =  329 bits (844), Expect = 6e-88,   Method: Compositional matrix adjust.
 Identities = 176/338 (52%), Positives = 221/338 (65%), Gaps = 23/338 (6%)

Query: 18  PILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLA 77
           PIL YC ASILMTVTNK+VLSG +FNMNF  L IQSI  V  +   K L L++FR+FD  
Sbjct: 47  PILCYCLASILMTVTNKFVLSGANFNMNFAFLAIQSITGVSCVVLAKKLGLINFRDFDKQ 106

Query: 78  LSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMT 137
            ++ WFPI+  LV +IYTGSKSLQYLSIPVYTIFKNLTIILIAYGEV+WF   ++ LT+ 
Sbjct: 107 DAKTWFPISFALVLVIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVLWFGGRVTALTLA 166

Query: 138 SFLLMVFXXXXXX-------------------XXXXXXXXXXXXXXTFDIGYLWMAFNCI 178
           SF LMV                                            GYLWM FNC+
Sbjct: 167 SFGLMVMSSVVAAWSDITTAFQNSFPEYAASPVFQADPSQAHKNLANTGAGYLWMGFNCL 226

Query: 179 SSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRT 238
           ++A +VLTMR+RI+ST FKD+DT++YNNLLSIP+L+  SL+ E+W+ KN + N P   R 
Sbjct: 227 TTATYVLTMRKRIKSTGFKDWDTMFYNNLLSIPVLVIFSLLFEEWNHKNLDINFPPPTRN 286

Query: 239 TLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNV 298
            L++ +  SG +A  ISYT+A   ++  +  YSMVGALNKLPVAASGMIFFGDP+   +V
Sbjct: 287 LLLSLMAMSGAAAVFISYTTA--CQLIEAAHYSMVGALNKLPVAASGMIFFGDPVNFSSV 344

Query: 299 SAIFVGFVAGILYSIAKTEQQKPIKPSVYIPISNKELP 336
           SA+ +GFVAGI+Y+ AK  Q K  K +   P S + LP
Sbjct: 345 SAVTIGFVAGIVYAFAKNNQAKAEKKAG--PGSAESLP 380



>gi|406864956|gb|EKD17999.1| GDP-mannose transporter [Marssonina brunnea f. sp. 'multigermtubi'
           MB_m1]
          Length = 389

 Score =  328 bits (842), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 167/351 (47%), Positives = 232/351 (66%), Gaps = 13/351 (3%)

Query: 4   PPTILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAF 63
           PP  L+ ++ +  L IL YC ASI MTVTNKY +SG ++N+NF  L IQS+VC++ +   
Sbjct: 35  PPAPLSNITNSPPLSILAYCLASISMTVTNKYCVSGANWNLNFFYLAIQSLVCIIAIILC 94

Query: 64  KMLNLVS-FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYG 122
           K   +++    FD   ++ WFPI++LLV MIYT +K+LQYLS+PVYTIFKNLTII+IAYG
Sbjct: 95  KQAGMITNLAPFDPKKAKTWFPISLLLVGMIYTSTKALQYLSVPVYTIFKNLTIIVIAYG 154

Query: 123 EVIWFDCSISRLTMTSFLLMVFXXXXXX----------XXXXXXXXXXXXXXTFDIGYLW 172
           EV+WF  S++   + SF LMV                               T + GY W
Sbjct: 155 EVLWFGGSVTASALFSFGLMVLSSVVAAWADIQHALYGNAEIESAEAALALSTLNAGYAW 214

Query: 173 MAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNL 232
           M  N   +AA+VL+MR+ I+  NFKD+DT++YNNLL+IP+L   S + E+W+  N EKN 
Sbjct: 215 MGMNVFCTAAYVLSMRKVIKKMNFKDWDTMFYNNLLTIPVLFVCSFLFENWTSVNIEKNF 274

Query: 233 PEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDP 292
           P + R +LI  +++SG++   ISY SAWC+RVTSSTTYSMVGALNKLP+A SG+IFF  P
Sbjct: 275 PLESRNSLILGMIYSGLATIFISYCSAWCIRVTSSTTYSMVGALNKLPIAVSGLIFFAAP 334

Query: 293 ITTGNVSAIFVGFVAGILYSIAKTEQQKPIKPSVYIPISNKELPQTTTNDN 343
           +T G+VSAI +GFV+GI+Y+ AK  Q +  K S  +P +N+++   ++  N
Sbjct: 335 VTLGSVSAIIIGFVSGIVYAWAKVRQTQMNKMS--LPTTNQQVMSASSQSN 383



>gi|342884383|gb|EGU84599.1| hypothetical protein FOXB_04894 [Fusarium oxysporum Fo5176]
          Length = 390

 Score =  328 bits (842), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 165/327 (50%), Positives = 220/327 (67%), Gaps = 9/327 (2%)

Query: 2   AQPPTILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLR 61
           + P   L  L  +  L IL YC +SI MTV NKYV+SG  +N+NF  L +Q++VC+  + 
Sbjct: 38  SSPVGGLEQLEKSPPLSILAYCLSSISMTVVNKYVVSGSFWNLNFFYLTVQAVVCIGAIT 97

Query: 62  AFKMLNLVS-FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIA 120
             K L L+     FD   +RKWFPI++LLV MIYT +KSLQ+LS+PVYTIFKNLTII+IA
Sbjct: 98  LCKQLGLIKVLAPFDSDRARKWFPISLLLVGMIYTSTKSLQFLSVPVYTIFKNLTIIVIA 157

Query: 121 YGEVIWFDCSISRLTMTSFLLMVFXXXXXXXXXXXXXX--------XXXXXXTFDIGYLW 172
           YGEV+WF  S++ L + SF LMV                             T + GY W
Sbjct: 158 YGEVLWFGGSVTPLALLSFGLMVLSSIVAAWADIQSAINGDFGTTDSAAAVSTLNAGYAW 217

Query: 173 MAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNL 232
           M  N   SAA+VL MR+ I+  NFKD+DT+YYNNLL+IP+L+  SL+ EDWS  NF +N 
Sbjct: 218 MGMNVFCSAAYVLGMRKVIKKMNFKDWDTMYYNNLLTIPVLVVCSLLTEDWSAYNFSRNF 277

Query: 233 PEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDP 292
           P+D R  +I  +++SG++A  ISY SAWC+RVTSSTTYSMVGALNKLP+A SG++FF  P
Sbjct: 278 PDDTRNKIIIGMIYSGLAAIFISYCSAWCIRVTSSTTYSMVGALNKLPIAISGLVFFSAP 337

Query: 293 ITTGNVSAIFVGFVAGILYSIAKTEQQ 319
           +T G+VSAIF+GF++G++Y+ ++  Q 
Sbjct: 338 VTFGSVSAIFLGFISGLVYAWSRVRQS 364



>gi|425766605|gb|EKV05209.1| GDP-mannose transporter 1 [Penicillium digitatum PHI26]
 gi|425781699|gb|EKV19646.1| GDP-mannose transporter 1 [Penicillium digitatum Pd1]
          Length = 398

 Score =  328 bits (842), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 182/362 (50%), Positives = 241/362 (66%), Gaps = 34/362 (9%)

Query: 2   AQPPT----ILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCV 57
           A PPT        +S    LP+L YC +SI+MTV NKYVLSG DFN+NFLLL +QS+VC+
Sbjct: 27  APPPTPSPRASTAISNNPALPVLAYCGSSIMMTVMNKYVLSGLDFNLNFLLLCVQSLVCI 86

Query: 58  VLLRAFKMLNLVSFREFDLALSRK--------------------WFPIAMLLVAMIYTGS 97
             ++  K + L+++R+F+   ++K                     FPI +LL+ MIYTGS
Sbjct: 87  AAIQTCKSMGLITYRDFNADEAKKCMDSDYNKLRDIAADKFSISGFPITLLLIGMIYTGS 146

Query: 98  KSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTSFLLMVFXXXXXX-----XX 152
           K+LQ+LSIPVYTIFKNLTIILIAYGEV+WF  S++ LT+ SF LMVF             
Sbjct: 147 KALQFLSIPVYTIFKNLTIILIAYGEVLWFGGSVTNLTLFSFGLMVFSSLIAAWADIKHA 206

Query: 153 XXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPL 212
                       T + GY+WM  NC+ ++++VL MR+RI+ TNFKDFDT++YNNLLS+P+
Sbjct: 207 VESTGDTSSKVSTLNAGYVWMLINCLCTSSYVLGMRKRIKLTNFKDFDTMFYNNLLSVPI 266

Query: 213 LMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSM 272
           L+  +L+VEDWS  N  +N PE  R  +  A++ SG S+  ISYTSAWCVR TSSTTYSM
Sbjct: 267 LIVFTLLVEDWSSANLARNFPESNRHGIFFAMILSGASSVFISYTSAWCVRTTSSTTYSM 326

Query: 273 VGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSIAKTEQQKPIKPSVYI---P 329
           VGALNKLP+A SG+IFF  P+T  +VSAI VGFV+GI+Y++AK +Q    KP + +   P
Sbjct: 327 VGALNKLPIAISGLIFFDAPVTFPSVSAIGVGFVSGIVYAVAKIKQNS--KPRIGVLPTP 384

Query: 330 IS 331
           +S
Sbjct: 385 VS 386



>gi|512191513|gb|EPE07274.1| gdp-mannose transporter [Ophiostoma piceae UAMH 11346]
          Length = 378

 Score =  328 bits (842), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 163/308 (52%), Positives = 209/308 (67%), Gaps = 8/308 (2%)

Query: 19  ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLV-SFREFDLA 77
           +L YC ASI MT+ NKY++SG  +NMNFL L IQS VCVV + A K    +    +FD  
Sbjct: 44  VLAYCMASISMTIVNKYIVSGSQWNMNFLYLAIQSAVCVVTVLAGKYSGFIKELGDFDWQ 103

Query: 78  LSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMT 137
             ++WFPI+ LLV MIYTG+K+LQ+LS+PVYTIFKNLTII+IAYGEV+WF   ++ LT+ 
Sbjct: 104 KGKRWFPISALLVGMIYTGAKALQFLSVPVYTIFKNLTIIVIAYGEVLWFGGQVTPLTLA 163

Query: 138 SFLLMVFXXX-------XXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRR 190
           SF LMV                            T + GY WM  N I SA FVL MR+ 
Sbjct: 164 SFGLMVLSSVIAAWSDIRAAVTGVHPAVATDAVSTLNAGYAWMGMNVICSACFVLGMRKV 223

Query: 191 IRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGIS 250
           I+  NFKD DT+ YNNLLSIP+L+  SL++EDWS +N  +N P + R +L+  I++SG+ 
Sbjct: 224 IKKMNFKDKDTMLYNNLLSIPILVVCSLLLEDWSSENLARNFPPETRKSLMIGIIYSGVI 283

Query: 251 AFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGIL 310
           A  ISY SAWCVR TSSTTYSMVGALNKLP+A +G++FF  P+T G VSAI +GFV+G++
Sbjct: 284 AIFISYCSAWCVRCTSSTTYSMVGALNKLPIAVAGLVFFDAPVTFGGVSAIGIGFVSGLV 343

Query: 311 YSIAKTEQ 318
           Y+ AK  Q
Sbjct: 344 YAWAKVRQ 351



>gi|475673606|gb|EMT70717.1| GDP-mannose transporter [Fusarium oxysporum f. sp. cubense race 4]
          Length = 390

 Score =  328 bits (841), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 165/327 (50%), Positives = 220/327 (67%), Gaps = 9/327 (2%)

Query: 2   AQPPTILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLR 61
           + P   L  L  +  L IL YC +SI MTV NKYV+SG  +N+NF  L +Q++VC+  + 
Sbjct: 38  SSPVGGLEQLEKSPPLSILAYCLSSISMTVVNKYVVSGTFWNLNFFYLTVQAVVCIGAIT 97

Query: 62  AFKMLNLVS-FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIA 120
             K L L+     FD   +RKWFPI++LLV MIYT +KSLQ+LS+PVYTIFKNLTII+IA
Sbjct: 98  LCKQLGLIKVLAPFDSDRARKWFPISLLLVGMIYTSTKSLQFLSVPVYTIFKNLTIIVIA 157

Query: 121 YGEVIWFDCSISRLTMTSFLLMVFXXXXXXXXXXXXXX--------XXXXXXTFDIGYLW 172
           YGEV+WF  S++ L + SF LMV                             T + GY W
Sbjct: 158 YGEVLWFGGSVTPLALLSFGLMVLSSIVAAWADIQSAINGDFGTTDSAAAVSTLNAGYAW 217

Query: 173 MAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNL 232
           M  N   SAA+VL MR+ I+  NFKD+DT+YYNNLL+IP+L+  SL+ EDWS  NF +N 
Sbjct: 218 MGMNVFCSAAYVLGMRKVIKKMNFKDWDTMYYNNLLTIPVLVVCSLLTEDWSAYNFSRNF 277

Query: 233 PEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDP 292
           P+D R  +I  +++SG++A  ISY SAWC+RVTSSTTYSMVGALNKLP+A SG++FF  P
Sbjct: 278 PDDTRNKIIIGMIYSGLAAIFISYCSAWCIRVTSSTTYSMVGALNKLPIAISGLVFFSAP 337

Query: 293 ITTGNVSAIFVGFVAGILYSIAKTEQQ 319
           +T G+VSAIF+GF++G++Y+ ++  Q 
Sbjct: 338 VTFGSVSAIFLGFISGLVYAWSRVRQS 364



>gi|302892837|ref|XP_003045300.1| hypothetical protein NECHADRAFT_43433 [Nectria haematococca mpVI
           77-13-4]
 gi|256726225|gb|EEU39587.1| hypothetical protein NECHADRAFT_43433 [Nectria haematococca mpVI
           77-13-4]
          Length = 390

 Score =  328 bits (841), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 164/318 (51%), Positives = 217/318 (68%), Gaps = 9/318 (2%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS 70
           L  +  L I+ YC +SI MTV NKYV+SG  +N+NF  L +Q+IVC+  +   K L L+ 
Sbjct: 47  LEKSPPLSIVAYCFSSISMTVVNKYVVSGSFWNLNFFYLTVQAIVCIATITLCKQLGLIK 106

Query: 71  -FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDC 129
               FD   ++KWFPI++LLV MIYT +KSLQ+LS+PVYTIFKNLTII+IAYGEV+WF  
Sbjct: 107 VLAPFDPDRAKKWFPISLLLVGMIYTSTKSLQFLSVPVYTIFKNLTIIVIAYGEVLWFGG 166

Query: 130 SISRLTMTSFLLMVFXXXXXXXXXXXXXXX--------XXXXXTFDIGYLWMAFNCISSA 181
           S++ + + SF LMV                             T + GY WM  N   SA
Sbjct: 167 SVTPMALLSFGLMVLSSVVAAWADIQSAIAGDFGTSNSADAMSTLNAGYAWMGMNVFCSA 226

Query: 182 AFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLI 241
           A+VL MR+ I+  NFKD+DT+YYNNLL+IP+L+  SL+ EDWS  NF +N PE+ R  +I
Sbjct: 227 AYVLGMRKVIKKMNFKDWDTMYYNNLLTIPVLVVCSLISEDWSAFNFARNFPEETRNKII 286

Query: 242 TAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAI 301
             +++SG++A  ISY SAWC+RVTSSTTYSMVGALNKLP+A SG++FF  P+T G+VSAI
Sbjct: 287 IGMIYSGLAAIFISYCSAWCIRVTSSTTYSMVGALNKLPIAISGLVFFSAPVTVGSVSAI 346

Query: 302 FVGFVAGILYSIAKTEQQ 319
           F+GFV+GI+Y+ A+  Q 
Sbjct: 347 FIGFVSGIVYAWARVRQS 364



>gi|384489790|gb|EIE81012.1| hypothetical protein RO3G_05717 [Rhizopus delemar RA 99-880]
          Length = 307

 Score =  328 bits (841), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 173/306 (56%), Positives = 214/306 (69%), Gaps = 8/306 (2%)

Query: 44  MNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYL 103
           M F LL +QSIV V+ L+ FK LNL+ +RE+    ++KW+PI + LVAMIYTGSK+LQYL
Sbjct: 1   MVFFLLTVQSIVTVLFLQLFKFLNLIKYREYSNEEAKKWYPIVIFLVAMIYTGSKALQYL 60

Query: 104 SIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTSFLLMVFXXXXXXXXXXXXXXXXXXX 163
            IPVYTIFKNLTII+IAYGEV+WF  +++ L M SFLLM                     
Sbjct: 61  PIPVYTIFKNLTIIMIAYGEVLWFGGNVTSLMMISFLLMTLSSMIAGWNDVFDALGSVMN 120

Query: 164 XTFD-----IGYLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSL 218
            +       IGY WM FNC+SSAAFVL MR+RI+ TNFKDFDTVYYNNLLSIPLL+  SL
Sbjct: 121 VSIAETRIMIGYFWMIFNCLSSAAFVLYMRKRIKLTNFKDFDTVYYNNLLSIPLLLAPSL 180

Query: 219 MVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNK 278
           ++EDWS KN   N P + R  +I A++FSGISAFG+SY SAWCVR TSSTTYSMVG+LNK
Sbjct: 181 LLEDWSTKNLAINFPPEQRQAIICAMIFSGISAFGMSYASAWCVRTTSSTTYSMVGSLNK 240

Query: 279 LPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSIAKTEQQKPIKPSVYIPISNKELPQT 338
           LP+A SG++FFGD  T GN+SAIF+GF+AGI+YS AK     P   +     S++     
Sbjct: 241 LPIAISGIVFFGDQATFGNISAIFIGFIAGIVYSYAKAF---PKSVNAITSASSQSYSDA 297

Query: 339 TTNDNN 344
           + +DN 
Sbjct: 298 SKDDNE 303



>gi|429848238|gb|ELA23746.1| gdp-mannose transporter [Colletotrichum gloeosporioides Nara gc5]
          Length = 386

 Score =  328 bits (840), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 163/317 (51%), Positives = 219/317 (69%), Gaps = 9/317 (2%)

Query: 19  ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS-FREFDLA 77
           IL YC +SI MTV NKYV+SG  +N+NFL L +QSIVC++ +   K L +++    FD  
Sbjct: 52  ILAYCFSSISMTVVNKYVVSGQFWNLNFLYLAVQSIVCILTIVVCKNLGMITNLAPFDTG 111

Query: 78  LSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMT 137
            ++KWFPIA+LLV MIYTG+K+LQ+LS+PVYTIFKNLTII+IAYGEV+WF  S+S L++ 
Sbjct: 112 KAKKWFPIALLLVGMIYTGTKALQFLSVPVYTIFKNLTIIVIAYGEVLWFGGSVSPLSLL 171

Query: 138 SFLLMVFXXXXXX--------XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRR 189
           SF LMV                             T + GY WM  N   +AA+VL MR+
Sbjct: 172 SFGLMVLSSVVAAWADVQHALGGGSHTAEASAAVSTLNAGYAWMGMNVCCTAAYVLGMRK 231

Query: 190 RIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGI 249
            I+  NFKD+DT++YNNLL+IP+L+  +L+ EDWS  N  KN P + R +L   +++SG+
Sbjct: 232 VIKKMNFKDWDTMFYNNLLTIPVLIVCTLLTEDWSSANIAKNFPIETRNSLFVGMIYSGL 291

Query: 250 SAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGI 309
            A  ISY SAWC+RVTSSTTYS+VGALNKLP+A SG++FF  P+T G+VSAI +GFV+GI
Sbjct: 292 CAIFISYCSAWCIRVTSSTTYSVVGALNKLPIAISGLVFFDAPVTFGSVSAIIIGFVSGI 351

Query: 310 LYSIAKTEQQKPIKPSV 326
           +Y+ A+  Q +  K S+
Sbjct: 352 VYAWARIRQSEAAKMSL 368



>gi|340959378|gb|EGS20559.1| putative GDP-mannose protein [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 385

 Score =  328 bits (840), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 160/309 (51%), Positives = 217/309 (70%), Gaps = 8/309 (2%)

Query: 19  ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLV-SFREFDLA 77
           IL YC +SI MTV NKYV+SG  +N+NF  L +QS+VC + +  FK   L  +   FD  
Sbjct: 51  ILAYCLSSISMTVVNKYVVSGSYWNLNFFYLAVQSLVCTLTILVFKHAGLFKNLAPFDPV 110

Query: 78  LSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMT 137
            ++KWFPI++LLV MIYTG+K+LQYLS+PVYTIFKNLTII+IAYGEV+WF  S++ LT+ 
Sbjct: 111 KAKKWFPISLLLVGMIYTGAKALQYLSVPVYTIFKNLTIIVIAYGEVLWFGGSVTPLTLL 170

Query: 138 SFLLMVFXXXXXXXXXXXXXX-------XXXXXXTFDIGYLWMAFNCISSAAFVLTMRRR 190
           SF LMV                              + GY WM  N + ++++VL MR+ 
Sbjct: 171 SFGLMVLSSVIAAWADIQAALDGMHSLDTSSALSALNAGYAWMGMNVVCTSSYVLGMRKV 230

Query: 191 IRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGIS 250
           I+  NFKD+DT++YNNLL+IP+L+  SL+VEDWS +N  +N PE+ R  L+  +++SG++
Sbjct: 231 IKKMNFKDYDTMFYNNLLTIPVLIVCSLLVEDWSAENLARNFPEETRNKLMIGMIYSGLA 290

Query: 251 AFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGIL 310
           A  ISY SAWC+RVTSSTTYSMVGALNKLP+A SG+IFF  PIT G+V+AI VGF++G++
Sbjct: 291 AIFISYCSAWCIRVTSSTTYSMVGALNKLPIAISGLIFFDAPITFGSVTAIIVGFISGLV 350

Query: 311 YSIAKTEQQ 319
           ++ AK  Q+
Sbjct: 351 FTWAKVRQK 359



>gi|310793211|gb|EFQ28672.1| UDP-galactose transporter [Glomerella graminicola M1.001]
          Length = 384

 Score =  328 bits (840), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 163/319 (51%), Positives = 221/319 (69%), Gaps = 9/319 (2%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS-FREFD 75
           + IL YC +SI MTV NKYV+SG  +N+NFL L +QSIVC++ +   K L +++    FD
Sbjct: 48  IAILAYCFSSISMTVVNKYVVSGQFWNLNFLYLAVQSIVCILTIVVCKNLGMITNLAPFD 107

Query: 76  LALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLT 135
              ++KWFPIA+LLV MIYTG+K+LQ+LS+PVYTIFKNLTII+IAYGEV+WF  S+S L+
Sbjct: 108 TDKAKKWFPIALLLVGMIYTGTKALQFLSVPVYTIFKNLTIIVIAYGEVLWFGGSVSPLS 167

Query: 136 MTSFLLMVFXXXXXX--------XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTM 187
           + SF LMV                             T + GY WM  N   +AA+VL M
Sbjct: 168 LLSFGLMVLSSVVAAWADVAHALGGSSHTAEASAAVSTLNAGYAWMGMNVCCTAAYVLGM 227

Query: 188 RRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFS 247
           R+ I+  NFKD+DT++YNNLL+IP+L+  +L+ EDWS  N +KN P + R +L   +++S
Sbjct: 228 RKVIKKMNFKDWDTMFYNNLLTIPVLIVCTLLTEDWSSANVQKNFPVETRNSLFVGMVYS 287

Query: 248 GISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVA 307
           G+ A  ISY SAWC+RVTSSTTYS+VGALNKLP+A SG++FF  P+T G+VSAI +GFV+
Sbjct: 288 GLCAIFISYCSAWCIRVTSSTTYSVVGALNKLPIAISGLVFFDAPVTFGSVSAIIIGFVS 347

Query: 308 GILYSIAKTEQQKPIKPSV 326
           GI+Y+ A+  Q +  K S+
Sbjct: 348 GIVYAWARIRQTEASKMSL 366



>gi|367013802|ref|XP_003681401.1| hypothetical protein TDEL_0D06060 [Torulaspora delbrueckii]
 gi|359749061|emb|CCE92190.1| hypothetical protein TDEL_0D06060 [Torulaspora delbrueckii]
          Length = 333

 Score =  327 bits (839), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 164/326 (50%), Positives = 228/326 (69%), Gaps = 10/326 (3%)

Query: 1   MAQPPTILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLL 60
           +A   + LA +  +G + IL+YC +SILMTVTNK+V++  DFNMN ++L +QS+VC + L
Sbjct: 6   VAGAESALARVVNSGPISILSYCGSSILMTVTNKFVVNLQDFNMNLVMLFVQSLVCTLAL 65

Query: 61  RAFKMLNLVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIA 120
              K L    FR  +   ++ W PI++LLV MIYT SK+LQYL++P+YTIFKNLTIILIA
Sbjct: 66  VVLKFLGYAKFRPINKTDTKNWLPISVLLVLMIYTSSKALQYLAVPIYTIFKNLTIILIA 125

Query: 121 YGEVIWFDCSISRLTMTSFLLMVFXXXXX------XXXXXXXXXXXXXXXTFDIGYLWMA 174
           YGEV++F  SI+ + M+SFLLMV                            F++GY+WM 
Sbjct: 126 YGEVLFFGGSITSMEMSSFLLMVLSSVIATWGDQQALAKKAAESVGESALPFNVGYVWMF 185

Query: 175 FNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPE 234
            NCISSA FVL MR+RI+ TNFKDFDT++YNN+L++P+L+  S +VEDWS+ N   NL +
Sbjct: 186 TNCISSALFVLIMRKRIKLTNFKDFDTMFYNNVLAMPILLGASFLVEDWSQANLAINLSQ 245

Query: 235 DIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPIT 294
           D     + A++ SG+++ GISY S WCVRVTSSTTYSMVGALNKLP+A SG+IFF  P  
Sbjct: 246 DS----VIAMIISGLASVGISYCSGWCVRVTSSTTYSMVGALNKLPIALSGLIFFDAPRN 301

Query: 295 TGNVSAIFVGFVAGILYSIAKTEQQK 320
             ++ +IF+GF++GI+Y++AK ++ +
Sbjct: 302 FLSILSIFIGFLSGIVYAVAKQKKMQ 327



>gi|322711936|gb|EFZ03509.1| GDP-mannose transporter [Metarhizium anisopliae ARSEF 23]
          Length = 392

 Score =  327 bits (839), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 164/340 (48%), Positives = 224/340 (65%), Gaps = 11/340 (3%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLV-SFREFD 75
           L ++ YC +SI MTV NKYV+SG  +N+NF  L IQ++VC+  + A K   L+ +   FD
Sbjct: 54  LSVVAYCFSSISMTVVNKYVVSGTFWNLNFFYLAIQAVVCIAAISACKSFGLIQNLAPFD 113

Query: 76  LALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLT 135
              +RKWFPI++LLV MIYT +K+LQ+LS+PVYTIFKNLTII+IAYGEV+WF  S++ L 
Sbjct: 114 RNKARKWFPISLLLVGMIYTSTKALQFLSVPVYTIFKNLTIIVIAYGEVLWFGGSVTPLA 173

Query: 136 MTSFLLMVFXXXXXXXXXXXXXXX--------XXXXXTFDIGYLWMAFNCISSAAFVLTM 187
           + SF LMV                             T + GY WM  N   +A++VL M
Sbjct: 174 LLSFGLMVLSSVVAAWADIQSAIAGDFGHADSSAAMSTLNAGYAWMGLNVFCTASYVLGM 233

Query: 188 RRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFS 247
           R+ I+  NFKD+DT+YYNNLL+IP+L   SL+ EDWS  NF KN P++ R  +I  +++S
Sbjct: 234 RKVIKKMNFKDWDTMYYNNLLTIPVLFICSLLAEDWSGTNFAKNFPDESRNRIIIGMVYS 293

Query: 248 GISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVA 307
           G++A  ISY SAWC+RVTSSTTYSMVGALNKLP+A SG++FF  P+T G+VSAI +GFV+
Sbjct: 294 GLAAIFISYCSAWCIRVTSSTTYSMVGALNKLPIAISGLVFFAAPVTFGSVSAIVIGFVS 353

Query: 308 GILYSIAKTEQQKPIKPSVYIPISNKELPQTTTNDNNTTE 347
           GI+Y+ A+  Q    K S  +P S   +  ++ +  +   
Sbjct: 354 GIVYAWARVRQSSGSKDS--LPTSRPPMSASSQSSRDAAN 391



>gi|477533719|gb|ENH85297.1| gdp-mannose transporter [Colletotrichum orbiculare MAFF 240422]
          Length = 387

 Score =  327 bits (838), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 163/317 (51%), Positives = 218/317 (68%), Gaps = 9/317 (2%)

Query: 19  ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS-FREFDLA 77
           IL YC +SI MTV NKYV+SG  +N+NFL L +Q+IVC+V +   K L ++S    FD  
Sbjct: 53  ILAYCFSSISMTVVNKYVVSGQFWNLNFLYLAVQAIVCIVTILVCKNLGMISNLAPFDTE 112

Query: 78  LSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMT 137
            ++KWFPI++LLV MIYTG+K+LQ+LS+PVYTIFKNLTII+IAYGEV+WF   +S L++ 
Sbjct: 113 KAKKWFPISLLLVGMIYTGTKALQFLSVPVYTIFKNLTIIVIAYGEVLWFGGGVSPLSLL 172

Query: 138 SFLLMVFXXXXXX--------XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRR 189
           SF LMV                             T + GY WM  N   +AA+VL MR+
Sbjct: 173 SFGLMVLSSVVAAWADVQHALGGNSHTAETSAAVSTLNAGYAWMGMNVCCTAAYVLGMRK 232

Query: 190 RIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGI 249
            I+  NFKD+DT++YNNLL+IP+L+  +L+ EDWS  N +KN P + R +L   +++SG+
Sbjct: 233 VIKKMNFKDWDTMFYNNLLTIPVLIICTLLTEDWSSANIQKNFPTESRNSLFIGMVYSGL 292

Query: 250 SAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGI 309
            A  ISY SAWC+RVTSSTTYS+VGALNKLP+A SG+IFF  P+T G+VSAI +GFV+GI
Sbjct: 293 CAIFISYCSAWCIRVTSSTTYSVVGALNKLPIAISGLIFFDAPVTAGSVSAIIIGFVSGI 352

Query: 310 LYSIAKTEQQKPIKPSV 326
           +Y+ A+  Q    K S+
Sbjct: 353 IYAWARIRQTAASKMSL 369



>gi|477522584|gb|ENH74651.1| GDP-mannose transporter [Fusarium oxysporum f. sp. cubense race 1]
          Length = 390

 Score =  327 bits (838), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 164/327 (50%), Positives = 220/327 (67%), Gaps = 9/327 (2%)

Query: 2   AQPPTILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLR 61
           + P   L  L  +  L IL YC +SI MTV NKYV+SG  +N+NF  L +Q++VC+  + 
Sbjct: 38  SSPVGGLEQLEKSPPLSILAYCLSSISMTVVNKYVVSGSFWNLNFFYLTVQAVVCIGAIT 97

Query: 62  AFKMLNLVS-FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIA 120
             K L L+     FD   +RKWFPI++LLV MIYT +KSLQ+LS+PVYTIFKNLTII+IA
Sbjct: 98  LCKQLGLIKVLAPFDSDRARKWFPISLLLVGMIYTSTKSLQFLSVPVYTIFKNLTIIVIA 157

Query: 121 YGEVIWFDCSISRLTMTSFLLMVFXXXXXXXXXXXXXX--------XXXXXXTFDIGYLW 172
           YGEV+WF  S++ L + SF LMV                             T + GY W
Sbjct: 158 YGEVLWFGGSVTPLALLSFGLMVLSSIVAAWADIQSAINGDFGTTDSAAAVSTLNAGYAW 217

Query: 173 MAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNL 232
           M  N   SAA+VL MR+ I+  NFKD+DT+YYNNLL+IP+L+  SL+ EDWS  NF +N 
Sbjct: 218 MGMNVFCSAAYVLGMRKVIKKMNFKDWDTMYYNNLLTIPVLVVCSLLTEDWSAYNFSRNF 277

Query: 233 PEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDP 292
           P++ R  +I  +++SG++A  ISY SAWC+RVTSSTTYSMVGALNKLP+A SG++FF  P
Sbjct: 278 PDETRNKIIIGMIYSGLAAIFISYCSAWCIRVTSSTTYSMVGALNKLPIAISGLVFFSAP 337

Query: 293 ITTGNVSAIFVGFVAGILYSIAKTEQQ 319
           +T G+VSAIF+GF++G++Y+ ++  Q 
Sbjct: 338 VTFGSVSAIFLGFISGLVYAWSRVRQS 364



>gi|408388234|gb|EKJ67921.1| hypothetical protein FPSE_11930 [Fusarium pseudograminearum CS3096]
          Length = 390

 Score =  326 bits (836), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 162/318 (50%), Positives = 216/318 (67%), Gaps = 9/318 (2%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS 70
           L  +  L I  YC +SI MTV NKYV+SG  +N+NF  L +Q++VC+  +   K L ++ 
Sbjct: 47  LEKSPPLSIAAYCLSSISMTVVNKYVVSGSFWNLNFFYLTVQAVVCIGTITLCKQLGMIK 106

Query: 71  -FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDC 129
               FD   +RKWFPI++LLV MIYT +KSLQ+LS+PVYTIFKNLTII+IAYGEV+WF  
Sbjct: 107 VLAPFDADRARKWFPISLLLVGMIYTSTKSLQFLSVPVYTIFKNLTIIVIAYGEVLWFGG 166

Query: 130 SISRLTMTSFLLMVFXXXXXXXXXXXXXX--------XXXXXXTFDIGYLWMAFNCISSA 181
           S++ L + SF LMV                             T + GY WM  N   SA
Sbjct: 167 SVTPLALLSFGLMVLSSIVAAWADIQSAINGDFGTGDSAAAVSTLNAGYAWMGMNVFCSA 226

Query: 182 AFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLI 241
           A+VL MR+ I+  NFKD+DT+YYNNLL+IP+L+  SL+ EDWS  NF +N P+D R  +I
Sbjct: 227 AYVLGMRKVIKKMNFKDWDTMYYNNLLTIPVLVICSLLTEDWSAYNFSRNFPDDTRNKII 286

Query: 242 TAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAI 301
             +++SG++A  ISY SAWC+RVTSSTTYSMVGALNKLP+A SG+IFF  P+T G+VSAI
Sbjct: 287 IGMIYSGLAAIFISYCSAWCIRVTSSTTYSMVGALNKLPIAISGLIFFSAPVTFGSVSAI 346

Query: 302 FVGFVAGILYSIAKTEQQ 319
           F+GF++G++Y+ ++  Q 
Sbjct: 347 FIGFISGLVYAWSRVRQS 364



>gi|444319929|ref|XP_004180621.1| hypothetical protein TBLA_0E00410 [Tetrapisispora blattae CBS 6284]
 gi|387513664|emb|CCH61102.1| hypothetical protein TBLA_0E00410 [Tetrapisispora blattae CBS 6284]
          Length = 333

 Score =  326 bits (836), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 165/325 (50%), Positives = 228/325 (70%), Gaps = 10/325 (3%)

Query: 2   AQPPTILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLR 61
           A+    L  ++ +G + IL+YC +SILMTVTNK+V++  +FNMNF++L +QS+VC V L 
Sbjct: 7   AEHAGALTGIANSGPISILSYCFSSILMTVTNKFVVNLENFNMNFVMLFVQSLVCTVALI 66

Query: 62  AFKMLNLVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAY 121
             K L    FR F+   ++ W PI+ LLV MIYT SK+LQ+L++P+YTIFKNLTIILIAY
Sbjct: 67  ILKSLGYAKFRPFNKTDAKNWLPISFLLVLMIYTSSKALQFLAVPIYTIFKNLTIILIAY 126

Query: 122 GEVIWFDCSISRLTMTSFLLMVFXXXXX------XXXXXXXXXXXXXXXTFDIGYLWMAF 175
           GEV++F  S+S + ++SFLLMVF                           F++GY+WM  
Sbjct: 127 GEVLFFGGSVSTMELSSFLLMVFSSVVATWGDQQAIAAKAAETLTESGSFFNMGYIWMFT 186

Query: 176 NCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPED 235
           NCISSA FVL MR+RI+ TNFKDFDT++YNN+L++P+L+  S  VEDWS  N   NL  D
Sbjct: 187 NCISSALFVLIMRKRIKLTNFKDFDTMFYNNVLALPILLLSSFCVEDWSSSNVATNLSGD 246

Query: 236 IRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITT 295
                +TA++ SG+++ GISY S WCVRVTSSTTYSMVGALNKLP+A SG++FF  P   
Sbjct: 247 S----LTAMVISGLASVGISYCSGWCVRVTSSTTYSMVGALNKLPIALSGLVFFDAPRNF 302

Query: 296 GNVSAIFVGFVAGILYSIAKTEQQK 320
            ++S+IF+GF++GI+Y++AK ++ +
Sbjct: 303 LSISSIFLGFLSGIVYAVAKQKKMR 327



>gi|322692876|gb|EFY84761.1| GDP-mannose transporter [Metarhizium acridum CQMa 102]
          Length = 379

 Score =  326 bits (835), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 157/317 (49%), Positives = 220/317 (69%), Gaps = 2/317 (0%)

Query: 19  ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS-FREFDLA 77
           +  YC +S+ MT+ NKYV+SG ++NMN L L +QSIV  + +   K   +V     FD  
Sbjct: 64  VFAYCLSSMSMTIVNKYVVSGSNWNMNLLYLAVQSIVGTLAIIMCKQAGMVKDLGPFDSQ 123

Query: 78  LSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMT 137
            ++ WFPIA+LLVAMIYTG+K+LQYLS+PVYTIFKNLTII+IAYGEV+WF  S++ LT+ 
Sbjct: 124 KAKTWFPIALLLVAMIYTGNKALQYLSVPVYTIFKNLTIIVIAYGEVLWFGSSLTPLTLV 183

Query: 138 SFLLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRIRSTNFK 197
           SF++MVF                    T ++GY WM  N   +A + L+MR+ I+ T F 
Sbjct: 184 SFIMMVFSSVVAAWADAKSASTAAAITTMNLGYGWMGINVFCAAMYALSMRKIIKKTGFN 243

Query: 198 DFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFGISYT 257
           +++ +YYNNLL+IP+L+  SL+VEDWS  N   N P + R ++   +++SG+ A  ISY+
Sbjct: 244 NWEVMYYNNLLTIPVLIVSSLLVEDWSSTNLNSNFPANSRYSMCMGMVYSGLGAIFISYS 303

Query: 258 SAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSIAKTE 317
           +AWC+R TSSTTY+MVGALNKLPVA  G+IFF  P+T G+VSAI +GFV+GI+Y++AK +
Sbjct: 304 TAWCIRATSSTTYAMVGALNKLPVAILGIIFFAAPVTFGSVSAIILGFVSGIVYTVAKLQ 363

Query: 318 QQKPIKPSVYIPISNKE 334
           + K  KP   +P++NK 
Sbjct: 364 KGKE-KPQSALPLTNKR 379



>gi|365990579|ref|XP_003672119.1| hypothetical protein NDAI_0I03080 [Naumovozyma dairenensis CBS 421]
 gi|343770893|emb|CCD26876.1| hypothetical protein NDAI_0I03080 [Naumovozyma dairenensis CBS 421]
          Length = 333

 Score =  325 bits (834), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 164/325 (50%), Positives = 227/325 (69%), Gaps = 12/325 (3%)

Query: 4   PPTILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAF 63
           P    A ++ +G + IL+YC +SILMTVTNK+V++  +FNMNF++L +QS+VC + L   
Sbjct: 9   PHNPWAGVANSGPISILSYCGSSILMTVTNKFVVNLENFNMNFVMLFVQSLVCTLTLIVL 68

Query: 64  KMLNLVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGE 123
           K L    FR  + A ++ WFPI++LLV MIYT SK+LQ+L++P+YTIFKNLTIILIAYGE
Sbjct: 69  KTLGYAKFRPLNKADAKNWFPISVLLVLMIYTSSKALQFLAVPIYTIFKNLTIILIAYGE 128

Query: 124 VIWFDCSISRLTMTSFLLMVFXXXXX--------XXXXXXXXXXXXXXXTFDIGYLWMAF 175
           V++F  S++ + ++SFLLMVF                              + GY WM  
Sbjct: 129 VLFFGGSVTSMELSSFLLMVFSSVVATWGDQQALAAKNLAEETVSQTSALLNPGYFWMFT 188

Query: 176 NCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPED 235
           NCISSA FVL MR+RI+ TNFKDFDT++YNN+L++P+L+  S +VEDWS  N   NL  D
Sbjct: 189 NCISSALFVLIMRKRIKLTNFKDFDTMFYNNILALPILLIFSFIVEDWSSANLATNLSGD 248

Query: 236 IRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITT 295
                +TA++ SG+++ GISY S WCVRVTSSTTYSMVGALNKLP+A SG+IFF  P   
Sbjct: 249 S----LTAMIISGMASVGISYCSGWCVRVTSSTTYSMVGALNKLPIALSGLIFFDAPRNF 304

Query: 296 GNVSAIFVGFVAGILYSIAKTEQQK 320
            ++ +IF+GF++GI+Y++AK ++Q+
Sbjct: 305 LSILSIFIGFLSGIVYAVAKQKKQQ 329



>gi|403413690|emb|CCM00390.1| predicted protein [Fibroporia radiculosa]
          Length = 354

 Score =  325 bits (834), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 164/318 (51%), Positives = 212/318 (66%), Gaps = 27/318 (8%)

Query: 18  PILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLA 77
           PI+ YC ASILMTV NK+V+SG +F+MNFLLLGIQS V V+ +   K    +SFR FD  
Sbjct: 29  PIVCYCIASILMTVINKFVVSGPEFSMNFLLLGIQSSVSVLCVLIVKRSGWISFRSFDSR 88

Query: 78  LSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMT 137
            ++ WFP++ LL           Q+LSIP+YTIFKNLTIILIAYGEVIWF   ++ LT+ 
Sbjct: 89  DAKAWFPVSFLL-----------QHLSIPMYTIFKNLTIILIAYGEVIWFGGRVTGLTLI 137

Query: 138 SFLLMVFXXXXXX----------------XXXXXXXXXXXXXXTFDIGYLWMAFNCISSA 181
           SF+ MVF                                      ++GY WM  NC ++A
Sbjct: 138 SFVFMVFSSVIAAWADISEAFTAGDPAVVEGLGMLATMKGVVTNLNVGYFWMFLNCATNA 197

Query: 182 AFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLI 241
            +VL+MR+RI+ T F D+DT++YNNLLSIP+L T S++ E+W   N  +N P + R  L+
Sbjct: 198 TYVLSMRKRIKVTGFSDWDTMFYNNLLSIPVLATFSVIAENWGHDNLVRNFPAERRNVLL 257

Query: 242 TAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAI 301
            AI FSG +A GISYT+AWC+R TSSTTYSMVGALNKLPVAASGMIFF DP+T G+VSA+
Sbjct: 258 FAIAFSGAAAVGISYTTAWCIRATSSTTYSMVGALNKLPVAASGMIFFEDPVTPGSVSAV 317

Query: 302 FVGFVAGILYSIAKTEQQ 319
            VGF+AG++Y++AK  Q+
Sbjct: 318 GVGFLAGLVYAVAKNNQK 335



>gi|156838743|ref|XP_001643071.1| hypothetical protein Kpol_423p1 [Vanderwaltozyma polyspora DSM
           70294]
 gi|189041356|sp|A7TR80.1|GMT1_VANPO RecName: Full=GDP-mannose transporter 1; Short=GMT 1
 gi|156113663|gb|EDO15213.1| hypothetical protein Kpol_423p1 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 332

 Score =  325 bits (832), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 165/319 (51%), Positives = 223/319 (69%), Gaps = 13/319 (4%)

Query: 14  TGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFRE 73
           +G + I +YCA+SILMTVTNK+V++  DFNMNF++L +QS VC +LL   K L    FR 
Sbjct: 18  SGPISIFSYCASSILMTVTNKFVVNLKDFNMNFVMLFVQSFVCTLLLVILKTLGYAKFRP 77

Query: 74  FDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISR 133
           F+   ++ WFPI++LLV MIYT SK+LQ+L++P+YTIFKNLTIILIAYGEVI+F   ++ 
Sbjct: 78  FNKTDAKNWFPISVLLVIMIYTSSKALQFLAVPIYTIFKNLTIILIAYGEVIYFGGKVTS 137

Query: 134 LTMTSFLLMVFXXXXXXXXXXXXXXXXXXXXT--------FDIGYLWMAFNCISSAAFVL 185
           + ++SF+LMV                     +        F++GYLWM  NCISSAAFVL
Sbjct: 138 MELSSFILMVLSSVVATWGDKQAMQAKSLVESDVTVPVVPFNVGYLWMFANCISSAAFVL 197

Query: 186 TMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAIL 245
            MR+RI+ TNFKDFDT++YNN+L++P+L+  S  +EDWS      NL         TA++
Sbjct: 198 IMRKRIKLTNFKDFDTMFYNNVLALPILLLFSFCIEDWS----STNLSTSFTANSFTAMI 253

Query: 246 FSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGF 305
            SG+++ GISY S WCVRVTSSTTYSMVGALNKLP+A SG+IFF  P    ++ +IF+GF
Sbjct: 254 ISGMASVGISYCSGWCVRVTSSTTYSMVGALNKLPIALSGLIFFDAPKNFLSIFSIFLGF 313

Query: 306 VAGILYSIAKTEQ-QKPIK 323
           +AGI+Y++AK ++ Q P K
Sbjct: 314 LAGIVYAVAKQKKNQNPEK 332



>gi|401625844|gb|EJS43832.1| vrg4p [Saccharomyces arboricola H-6]
          Length = 337

 Score =  324 bits (831), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 161/321 (50%), Positives = 225/321 (70%), Gaps = 13/321 (4%)

Query: 9   AFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNL 68
           A ++ +G + IL+YC +SILMTVTNK+V++  +FNMNF++L +QS+VC + L   ++L  
Sbjct: 15  ASVANSGPISILSYCGSSILMTVTNKFVVNLENFNMNFVMLFVQSLVCTMTLVILRLLGY 74

Query: 69  VSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFD 128
             FR  +   ++ WFPI+ LLV MIYT SK+LQYL++P+YTIFKNLTIILIAYGEV++F 
Sbjct: 75  AKFRSLNKTDAKNWFPISFLLVLMIYTSSKALQYLAVPIYTIFKNLTIILIAYGEVLFFG 134

Query: 129 CSISRLTMTSFLLMVFXXXXXXXXXXXXXXXXXXXXT---------FDIGYLWMAFNCIS 179
            S++ + ++SFLLMV                     T         F+ GY WM  NCI+
Sbjct: 135 GSVTSMELSSFLLMVLSSVVATLGDQQAVAAKAASLTDGAASAVAAFNPGYFWMFTNCIT 194

Query: 180 SAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTT 239
           SA FVL MR+RI+ TNFKDFDT++YNN+L++P+L+  S  VE+WS  N   NL  D    
Sbjct: 195 SALFVLIMRKRIKLTNFKDFDTMFYNNILALPILLLFSFCVENWSSANLATNLSNDS--- 251

Query: 240 LITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVS 299
            +TA++ SG+++ GISY S WCVRVTSSTTYSMVGALNKLP+A SG+IFF  P    ++ 
Sbjct: 252 -LTAMIISGVASVGISYCSGWCVRVTSSTTYSMVGALNKLPIALSGLIFFDAPRNFLSIV 310

Query: 300 AIFVGFVAGILYSIAKTEQQK 320
           +IF+GF++GI+Y++AK ++Q+
Sbjct: 311 SIFIGFLSGIIYAVAKQKKQQ 331



>gi|500260084|gb|EOO02787.1| putative gdp-mannose transporter protein [Togninia minima UCRPA7]
          Length = 389

 Score =  324 bits (831), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 162/315 (51%), Positives = 216/315 (68%), Gaps = 5/315 (1%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS-FREFD 75
           + IL YC ASI MTV NKY +SG D+N+N   L IQSIVC+  +   K L L++    FD
Sbjct: 55  ISILAYCMASISMTVVNKYCVSGPDWNLNLFYLAIQSIVCIGAIMICKSLGLITNLAPFD 114

Query: 76  LALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLT 135
               ++WFPI++LLV MIYTG K+LQYLS+PVYTIFKNLTII+IAYGEV+WF  S++ +T
Sbjct: 115 PEKGKRWFPISLLLVGMIYTGLKALQYLSVPVYTIFKNLTIIVIAYGEVLWFGGSVTPMT 174

Query: 136 MTSFLLMVFXXXXXX----XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRI 191
           + SF L+V                         T + GY WM  N   SA+FVL MR+ I
Sbjct: 175 LVSFGLIVLSSIVAAWADIQIALSGSAGATDVSTLNAGYAWMGMNVFCSASFVLGMRKVI 234

Query: 192 RSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISA 251
           +  NFKD+D+++YNN L+IP+L+  SL+ EDWS +N  +N P + R +L+  +++SG+ A
Sbjct: 235 KKMNFKDWDSMFYNNFLTIPVLIIASLLFEDWSSENLARNFPIESRNSLLIGMIYSGLGA 294

Query: 252 FGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILY 311
             ISY SAWC+RVTSSTTYSMVGALNKLP+A SG+IFF  PIT G+VSAI +GF++G++Y
Sbjct: 295 IFISYCSAWCIRVTSSTTYSMVGALNKLPIAISGLIFFSVPITVGSVSAIILGFISGLVY 354

Query: 312 SIAKTEQQKPIKPSV 326
           + AK  Q +  K S+
Sbjct: 355 AWAKVRQSEQSKMSL 369



>gi|336263390|ref|XP_003346475.1| hypothetical protein SMAC_05370 [Sordaria macrospora k-hell]
 gi|380089987|emb|CCC12298.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 392

 Score =  323 bits (829), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 162/335 (48%), Positives = 223/335 (66%), Gaps = 13/335 (3%)

Query: 19  ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLV-SFREFDLA 77
           IL YC +SI MTV NKYV+SG ++N+NF  L +QS+VC   +   K L +  +   FD  
Sbjct: 58  ILAYCLSSISMTVVNKYVVSGSEWNLNFFYLAVQSLVCTAAILICKQLGMFQNLAAFDST 117

Query: 78  LSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMT 137
            ++KWFPI++LLV MIYT +K+LQ+LS+PVYTIFKNLTII+IAYGEV+WF  S++ + + 
Sbjct: 118 KAKKWFPISLLLVGMIYTSTKALQFLSVPVYTIFKNLTIIVIAYGEVLWFGGSVTPMALL 177

Query: 138 SFLLMVFXX--------XXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRR 189
           SF LMVF                            T + GY WM  N   +AA+VL MR+
Sbjct: 178 SFGLMVFSSVIAAWADIQAAVEGVGHTAEATDAISTLNAGYAWMGMNVFCTAAYVLGMRK 237

Query: 190 RIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGI 249
            I+  NFKD+DT++YNNLL+IP+L+  SL+ EDWS  N  KN P + R  L   +++SG+
Sbjct: 238 VIKKMNFKDYDTMFYNNLLTIPVLIVFSLLFEDWSNDNLIKNFPVETRNALFIGMIYSGL 297

Query: 250 SAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGI 309
           +A  ISY SAWC+RVTSSTTYSMVGALNKLP+A SG+IFF  P+T G+V+AIFVGFV+G+
Sbjct: 298 AAIFISYCSAWCIRVTSSTTYSMVGALNKLPIAVSGLIFFDAPVTFGSVTAIFVGFVSGL 357

Query: 310 LYSIAKTEQQKPIKPSVYIPISNKELPQTTTNDNN 344
           +++ +KT Q    K S  +P +   +  +  ++ +
Sbjct: 358 VFAWSKTRQ----KVSAILPTAQPTMSASAASNRD 388



>gi|363748074|ref|XP_003644255.1| hypothetical protein Ecym_1190 [Eremothecium cymbalariae
           DBVPG#7215]
 gi|356887887|gb|AET37438.1| hypothetical protein Ecym_1190 [Eremothecium cymbalariae
           DBVPG#7215]
          Length = 328

 Score =  323 bits (828), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 163/320 (50%), Positives = 224/320 (70%), Gaps = 9/320 (2%)

Query: 9   AFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNL 68
           + ++ +G + IL+YC +SILMTVTNK+V++  DFNMN ++L +QS VC + L   + L  
Sbjct: 12  SHIANSGPISILSYCGSSILMTVTNKFVVNLKDFNMNCVMLLVQSTVCTLALLVLRTLGY 71

Query: 69  VSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFD 128
             FR  +   +R WFPI++LLV M+YT SK+LQYL++P+YTIFKNLTIILIAYGEV++F 
Sbjct: 72  AKFRPLNKTDARNWFPISILLVLMMYTSSKALQYLAVPIYTIFKNLTIILIAYGEVLFFG 131

Query: 129 CSISRLTMTSFLLMVFXXXXXX----XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFV 184
             ++ + ++SFLLMV                          F  GY WM  NCI SA FV
Sbjct: 132 GRVTSMELSSFLLMVLSSIVATWGDQQALALKVTNGASSSPFSAGYFWMFTNCICSALFV 191

Query: 185 LTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAI 244
           L MR+RI  TNFKDFDT++YNN+LS+PLL   S++VEDWS +N   NL +D     +TA+
Sbjct: 192 LIMRKRITLTNFKDFDTMFYNNILSLPLLFLTSVLVEDWSPENLATNLSQDS----VTAM 247

Query: 245 LFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVG 304
           + SG+++ GISY S WCVRVTSSTTYSMVGALNKLP+A SG+IFF  P    ++ +IF+G
Sbjct: 248 VISGLASVGISYCSGWCVRVTSSTTYSMVGALNKLPIALSGLIFFDAPKNFLSIFSIFLG 307

Query: 305 FVAGILYSIAKTEQQ-KPIK 323
           F+AG++Y++AK ++Q +P+K
Sbjct: 308 FLAGVVYAVAKQKKQSQPVK 327



>gi|6321213|ref|NP_011290.1| Vrg4p [Saccharomyces cerevisiae S288c]
 gi|729611|sp|P40107.1|GMT1_YEAST RecName: Full=GDP-mannose transporter 1; Short=GMT 1; AltName:
           Full=Low dye-binding protein 3; AltName:
           Full=Morphogenesis checkpoint-dependent protein 3;
           AltName: Full=Vanadate resistance glycosylation protein
           4
 gi|189041357|sp|A6ZTW6.1|GMT1_YEAS7 RecName: Full=GDP-mannose transporter 1; Short=GMT 1; AltName:
           Full=Low dye-binding protein 3; AltName:
           Full=Morphogenesis checkpoint-dependent protein 3;
           AltName: Full=Vanadate resistance glycosylation protein
           4
 gi|290463230|sp|B3LHR7.1|GMT1_YEAS1 RecName: Full=GDP-mannose transporter 1; Short=GMT 1; AltName:
           Full=Low dye-binding protein 3; AltName:
           Full=Morphogenesis checkpoint-dependent protein 3;
           AltName: Full=Vanadate resistance glycosylation protein
           4
 gi|290463231|sp|C7GUZ7.1|GMT1_YEAS2 RecName: Full=GDP-mannose transporter 1; Short=GMT 1; AltName:
           Full=Low dye-binding protein 3; AltName:
           Full=Morphogenesis checkpoint-dependent protein 3;
           AltName: Full=Vanadate resistance glycosylation protein
           4
 gi|290463232|sp|C8Z830.1|GMT1_YEAS8 RecName: Full=GDP-mannose transporter 1; Short=GMT 1; AltName:
           Full=Low dye-binding protein 3; AltName:
           Full=Morphogenesis checkpoint-dependent protein 3;
           AltName: Full=Vanadate resistance glycosylation protein
           4
 gi|499894|gb|AAC37468.1| vanadate resistant protein [Saccharomyces cerevisiae]
 gi|603046|gb|AAA81537.1| Van2p [Saccharomyces cerevisiae]
 gi|1322877|emb|CAA96941.1| GOG5 [Saccharomyces cerevisiae]
 gi|151943594|gb|EDN61904.1| vandate resistance glycosylation [Saccharomyces cerevisiae YJM789]
 gi|190407158|gb|EDV10425.1| GDP-mannose transporter [Saccharomyces cerevisiae RM11-1a]
 gi|256270145|gb|EEU05374.1| Vrg4p [Saccharomyces cerevisiae JAY291]
 gi|259146289|emb|CAY79546.1| Vrg4p [Saccharomyces cerevisiae EC1118]
 gi|285811994|tpg|DAA07894.1| TPA: Vrg4p [Saccharomyces cerevisiae S288c]
 gi|323333601|gb|EGA74994.1| Vrg4p [Saccharomyces cerevisiae AWRI796]
 gi|323355127|gb|EGA86956.1| Vrg4p [Saccharomyces cerevisiae VL3]
 gi|349578013|dbj|GAA23179.1| K7_Vrg4p [Saccharomyces cerevisiae Kyokai no. 7]
 gi|392299400|gb|EIW10494.1| Vrg4p [Saccharomyces cerevisiae CEN.PK113-7D]
 gi|1588364|prf||2208367A VRG4 gene
          Length = 337

 Score =  323 bits (828), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 161/321 (50%), Positives = 224/321 (69%), Gaps = 13/321 (4%)

Query: 9   AFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNL 68
           A ++ +G + IL+YC +SILMTVTNK+V++  DFNMNF++L +QS+VC + L   ++L  
Sbjct: 15  ASVANSGPISILSYCGSSILMTVTNKFVVNLKDFNMNFVMLFVQSLVCTITLIILRILGY 74

Query: 69  VSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFD 128
             FR  +   ++ WFPI+ LLV MIYT SK+LQYL++P+YTIFKNLTIILIAYGEV++F 
Sbjct: 75  AKFRSLNKTDAKNWFPISFLLVLMIYTSSKALQYLAVPIYTIFKNLTIILIAYGEVLFFG 134

Query: 129 CSISRLTMTSFLLMVFXXXXXX---------XXXXXXXXXXXXXXTFDIGYLWMAFNCIS 179
            S++ + ++SFLLMV                              +F+ GY WM  NCI+
Sbjct: 135 GSVTSMELSSFLLMVLSSVVATWGDQQAVAAKAASLAEGAAGAVASFNPGYFWMFTNCIT 194

Query: 180 SAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTT 239
           SA FVL MR+RI+ TNFKDFDT++YNN+L++P+L+  S  VEDWS  N   N   D    
Sbjct: 195 SALFVLIMRKRIKLTNFKDFDTMFYNNVLALPILLLFSFCVEDWSSVNLTNNFSNDS--- 251

Query: 240 LITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVS 299
            +TA++ SG+++ GISY S WCVRVTSSTTYSMVGALNKLP+A SG+IFF  P    ++ 
Sbjct: 252 -LTAMIISGVASVGISYCSGWCVRVTSSTTYSMVGALNKLPIALSGLIFFDAPRNFLSIL 310

Query: 300 AIFVGFVAGILYSIAKTEQQK 320
           +IF+GF++GI+Y++AK ++Q+
Sbjct: 311 SIFIGFLSGIIYAVAKQKKQQ 331



>gi|440638851|gb|ELR08770.1| hypothetical protein GMDG_03448 [Geomyces destructans 20631-21]
          Length = 394

 Score =  322 bits (826), Expect = 8e-86,   Method: Compositional matrix adjust.
 Identities = 164/350 (46%), Positives = 229/350 (65%), Gaps = 22/350 (6%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS-FREFD 75
           L +L YC ASI MTV NK+ +SG  +NM+F  LG QSIVC++ ++A K + L+    +FD
Sbjct: 47  LSVLAYCLASISMTVINKFCVSGDKWNMSFFFLGFQSIVCIIAIQACKSMGLIKDLAKFD 106

Query: 76  LALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLT 135
              +++WFPI++LLV MIYT +K+LQ+LS+PVYTIFKNLTII+IAYGEV+WF  S+S  +
Sbjct: 107 NEKAKRWFPISILLVGMIYTSTKALQFLSVPVYTIFKNLTIIVIAYGEVLWFGGSVSPSS 166

Query: 136 MTSFLLMVFXXXXXXXXXXXXX---------------XXXXXXXTFDIGYLWMAFNCISS 180
           + +F LMV                                    T + GY WM  N   +
Sbjct: 167 LFAFGLMVLSSVIAAWADVQHALAASAGTSTLSGQNIEAAAQLSTLNAGYAWMGLNVFFT 226

Query: 181 AAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTL 240
           A++VL MR+ I+  NFKD+DT++YNNLL+IP+L+ +S+++EDWS  NF  N P + R + 
Sbjct: 227 ASYVLGMRKTIKKMNFKDWDTMFYNNLLTIPVLIVLSILIEDWSSVNFNANFPVESRNSQ 286

Query: 241 ITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSA 300
           I A+++SG++   ISY SAWC+RVTSSTTYSMVGALNKLP+A SG++FF  PIT G+VSA
Sbjct: 287 ILAMIYSGLATIFISYASAWCIRVTSSTTYSMVGALNKLPIAVSGLVFFDAPITFGSVSA 346

Query: 301 IFVGFVAGILYSIAKTEQQKPIK---PSVYIPISNKELPQTTTNDNNTTE 347
           I +GFV+G++Y+ AK  Q    K   P+  IP+S       +  D N ++
Sbjct: 347 ILLGFVSGMVYAWAKVRQTAASKMSLPTTNIPMSASS---QSARDANASK 393



>gi|299745257|ref|XP_001831592.2| nucleotide-sugar transporter [Coprinopsis cinerea okayama7#130]
 gi|298406505|gb|EAU90125.2| nucleotide-sugar transporter [Coprinopsis cinerea okayama7#130]
          Length = 379

 Score =  322 bits (825), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 170/332 (51%), Positives = 217/332 (65%), Gaps = 36/332 (10%)

Query: 18  PILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAF-----------KML 66
           PI+ YC ASILMTV NK  L     +++ L   I +IV  +  + F           ++L
Sbjct: 37  PIVCYCLASILMTVVNKARLWSMKEDVDML---ISTIVRRIRSQLFDELPPAMHPIIRLL 93

Query: 67  NLVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIW 126
            L    +FD+  ++ WFPI+ LLV++IYTGSKSLQYLSIPVYTIFKNLTIILIAYGEV+W
Sbjct: 94  RL----DFDMKDAKMWFPISFLLVSVIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVLW 149

Query: 127 FDCSISRLTMTSFLLMVFXXXXXXXXXXXXXXXXX------------------XXXTFDI 168
           F   ++ LT  SF+ MV                                         ++
Sbjct: 150 FGGRVTALTFVSFIFMVISSIIAAWSDVQSALASSIPGASSGVSVGAMQSLFGALRGLNV 209

Query: 169 GYLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNF 228
           GY WM  NC++SAA+VL+MR+RI+ST F D+DT++YNNLLSIP+L   SL+ EDW  +N 
Sbjct: 210 GYFWMLVNCLTSAAYVLSMRKRIKSTGFSDWDTMFYNNLLSIPVLAVFSLIAEDWGRENL 269

Query: 229 EKNLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIF 288
            +N P + R  L+ AI FSG +A GISYT+AWCVRVTSSTTYSMVGALNKLPVAASGM+F
Sbjct: 270 NRNFPAETRNFLLFAIAFSGAAAVGISYTTAWCVRVTSSTTYSMVGALNKLPVAASGMLF 329

Query: 289 FGDPITTGNVSAIFVGFVAGILYSIAKTEQQK 320
           FGDP+T G+VSA+ VGF AGI+Y++AK  Q+K
Sbjct: 330 FGDPVTVGSVSAVGVGFFAGIVYAVAKNNQKK 361



>gi|302405992|ref|XP_003000832.1| GDP-mannose transporter [Verticillium albo-atrum VaMs.102]
 gi|261360090|gb|EEY22518.1| GDP-mannose transporter [Verticillium albo-atrum VaMs.102]
          Length = 394

 Score =  322 bits (824), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 162/334 (48%), Positives = 223/334 (66%), Gaps = 11/334 (3%)

Query: 19  ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS-FREFDLA 77
           IL YC +SI MTV NK+V+SG  +N+NF  L +Q+IVCV  ++  K + ++     FD  
Sbjct: 59  ILAYCFSSISMTVVNKFVVSGKFWNLNFFYLAVQAIVCVTTIQICKNVGMIRVLAPFDQE 118

Query: 78  LSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMT 137
            ++KWFPI++LLV MIYT +K+LQ+LS+PVYTIFKNLTII+IAYGEV+WF  S++ L + 
Sbjct: 119 KAKKWFPISLLLVGMIYTSTKALQFLSVPVYTIFKNLTIIVIAYGEVLWFGGSVTPLALL 178

Query: 138 SFLLMVFXXXXXXXXXXXXXX--------XXXXXXTFDIGYLWMAFNCISSAAFVLTMRR 189
           SF LMV                             T + GY WM FN   +AA+VL MR+
Sbjct: 179 SFGLMVLSSVVAAWADIQHAIYGSVGEHDASAAMSTLNAGYAWMGFNVFCTAAYVLGMRK 238

Query: 190 RIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGI 249
            I+  NFKD+DT++YNNLL+IP+L+  SL++EDWS +N  KN P   R  L   +++SG+
Sbjct: 239 VIKKMNFKDWDTMFYNNLLTIPVLIVCSLLLEDWSSENLTKNFPPATRNGLFVGMIYSGL 298

Query: 250 SAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGI 309
            A  ISY SAWC+RVTSSTTYSMVGALNKLP+A SG++FF  P+T G+V+AIF+GFV+GI
Sbjct: 299 CAIFISYCSAWCIRVTSSTTYSMVGALNKLPIAVSGLVFFAAPVTFGSVTAIFLGFVSGI 358

Query: 310 LYSIAKTEQQKPIKPSVYIPISNKELPQTTTNDN 343
           +Y+ A+  Q    K S  +P +      + +N++
Sbjct: 359 VYAWARVRQTATSKMS--LPTTQPMSASSRSNND 390



>gi|346971346|gb|EGY14798.1| GDP-mannose transporter [Verticillium dahliae VdLs.17]
          Length = 394

 Score =  321 bits (823), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 162/334 (48%), Positives = 223/334 (66%), Gaps = 11/334 (3%)

Query: 19  ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS-FREFDLA 77
           IL YC +SI MTV NK+V+SG  +N+NF  L +Q+IVCV  ++  K + ++     FD  
Sbjct: 59  ILAYCFSSISMTVVNKFVVSGKFWNLNFFYLAVQAIVCVTTIQICKNVGMIRVLAPFDQE 118

Query: 78  LSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMT 137
            ++KWFPI++LLV MIYT +K+LQ+LS+PVYTIFKNLTII+IAYGEV+WF  S++ L + 
Sbjct: 119 KAKKWFPISLLLVGMIYTSTKALQFLSVPVYTIFKNLTIIVIAYGEVLWFGGSVTPLALL 178

Query: 138 SFLLMVFXXXXXXXXXXXXXX--------XXXXXXTFDIGYLWMAFNCISSAAFVLTMRR 189
           SF LMV                             T + GY WM FN   +AA+VL MR+
Sbjct: 179 SFGLMVLSSVVAAWADIQHAIYGSVGEHDASAAMSTLNAGYAWMGFNVFCTAAYVLGMRK 238

Query: 190 RIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGI 249
            I+  NFKD+DT++YNNLL+IP+L+  SL++EDWS +N  KN P   R  L   +++SG+
Sbjct: 239 VIKKMNFKDWDTMFYNNLLTIPVLIVCSLLLEDWSSENLTKNFPPATRNGLFIGMIYSGL 298

Query: 250 SAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGI 309
            A  ISY SAWC+RVTSSTTYSMVGALNKLP+A SG++FF  P+T G+V+AIF+GFV+GI
Sbjct: 299 CAIFISYCSAWCIRVTSSTTYSMVGALNKLPIAVSGLVFFSAPVTFGSVTAIFLGFVSGI 358

Query: 310 LYSIAKTEQQKPIKPSVYIPISNKELPQTTTNDN 343
           +Y+ A+  Q    K S  +P +      + +N++
Sbjct: 359 VYAWARVRQTAASKMS--LPTTQPMSASSRSNND 390



>gi|189041379|sp|Q2HA88.2|GMT_CHAGB RecName: Full=GDP-mannose transporter; Short=GMT
          Length = 394

 Score =  321 bits (822), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 157/330 (47%), Positives = 223/330 (67%), Gaps = 12/330 (3%)

Query: 2   AQPPTILAFLSATGTLP---ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVV 58
            + PT  A+       P   I+ YC +SI MTV NKYV+SG  +N+NF  LG+QS+VC +
Sbjct: 39  GREPTASAYFGKLDNSPGASIIAYCLSSISMTVVNKYVVSGESWNLNFFYLGVQSLVCTI 98

Query: 59  LLRAFKMLNLV-SFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTII 117
            +   +   L+ +   FD   +++WFP+++LLV+MIYTG+ +LQYLS+PVYTIFKNLTII
Sbjct: 99  AILLSRQTGLIKNLAPFDSNKAKRWFPVSLLLVSMIYTGANALQYLSVPVYTIFKNLTII 158

Query: 118 LIAYGEVIWFDCSISRLTMTSFLLMVFXXXXXXXX--------XXXXXXXXXXXXTFDIG 169
           +IAYGEV+WF  S++ L + SF LMV                             T + G
Sbjct: 159 VIAYGEVLWFGGSVTPLMLLSFGLMVLSSVVAAWADIQAAIDGVGHSAETSAALATLNAG 218

Query: 170 YLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFE 229
           Y WM  N + +++++L MR+ I+  NFKD+D+++YNNLL+IP+L+  SL+VEDWS +N  
Sbjct: 219 YAWMGLNVVCTSSYLLGMRKVIKKMNFKDYDSMFYNNLLTIPVLVVCSLLVEDWSSENLA 278

Query: 230 KNLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFF 289
           KN P + R  L+  +++SG++A  ISY SAWC+RVTSSTTYSMVGALNKLP+A SG+IFF
Sbjct: 279 KNFPIETRNKLMVGMIYSGLAAIFISYCSAWCIRVTSSTTYSMVGALNKLPIAISGLIFF 338

Query: 290 GDPITTGNVSAIFVGFVAGILYSIAKTEQQ 319
             PIT G+++AI VGFV+G++++ AK  Q+
Sbjct: 339 DAPITFGSITAIAVGFVSGLVFAWAKVRQK 368



>gi|366993417|ref|XP_003676473.1| hypothetical protein NCAS_0E00420 [Naumovozyma castellii CBS 4309]
 gi|342302340|emb|CCC70112.1| hypothetical protein NCAS_0E00420 [Naumovozyma castellii CBS 4309]
          Length = 333

 Score =  320 bits (821), Expect = 3e-85,   Method: Compositional matrix adjust.
 Identities = 162/320 (50%), Positives = 224/320 (70%), Gaps = 12/320 (3%)

Query: 9   AFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNL 68
           A ++ +G + IL+YC +SILMTVTNK+V++  +FNMNF++L +QS+VC + L   K+L  
Sbjct: 15  AGIANSGPISILSYCGSSILMTVTNKFVVNLENFNMNFVMLFVQSLVCTLTLIVLKVLGY 74

Query: 69  VSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFD 128
             FR  +   ++ WFPI++LLV MIYT SK+LQ+L++P+YTIFKNLTIILIAYGEV++F 
Sbjct: 75  AKFRPLNKTDAKNWFPISVLLVVMIYTSSKALQFLAVPIYTIFKNLTIILIAYGEVLFFG 134

Query: 129 CSISRLTMTSFLLMVFXXXXX--------XXXXXXXXXXXXXXXTFDIGYLWMAFNCISS 180
            S++ + ++SFLLMV                              F+ GY WM  NCISS
Sbjct: 135 GSVTSMELSSFLLMVLSSIVATWGDQQALAAKNLADEVTGASVALFNPGYFWMFTNCISS 194

Query: 181 AAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTL 240
           A FVL MR+RI+ TNFKDFDT++YNN+L++P+L+  S  VEDWS  N   NL  D     
Sbjct: 195 ALFVLIMRKRIKLTNFKDFDTMFYNNILALPILLFFSFCVEDWSSANLATNLSNDS---- 250

Query: 241 ITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSA 300
           +TA++ SG+++ GISY S WCVRVTSSTTYSMVGALNKLP+A SG+IFF  P    ++ +
Sbjct: 251 LTAMIISGMASVGISYCSGWCVRVTSSTTYSMVGALNKLPIALSGLIFFDAPRNFLSIFS 310

Query: 301 IFVGFVAGILYSIAKTEQQK 320
           IF+GF++GI+Y+ AK ++Q+
Sbjct: 311 IFLGFLSGIVYAFAKQKKQQ 330



>gi|410083789|ref|XP_003959472.1| hypothetical protein KAFR_0J02730 [Kazachstania africana CBS 2517]
 gi|372466063|emb|CCF60337.1| hypothetical protein KAFR_0J02730 [Kazachstania africana CBS 2517]
          Length = 337

 Score =  320 bits (819), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 162/330 (49%), Positives = 224/330 (67%), Gaps = 15/330 (4%)

Query: 1   MAQPPTILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLL 60
           +A     LA ++ +G + IL+YC +SILMTVTNK+V++  DFNMNF++L +QS+VC + L
Sbjct: 6   IANNHNALASIANSGPISILSYCGSSILMTVTNKFVVNLKDFNMNFVMLFVQSLVCCLTL 65

Query: 61  RAFKMLNLVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIA 120
              K L    FR  +   ++ WFPI++LLV MIYT SK+LQ+L++P+YTIFKNLTIILIA
Sbjct: 66  VVLKFLGYAKFRPLNKTDAKNWFPISILLVLMIYTSSKALQFLAVPIYTIFKNLTIILIA 125

Query: 121 YGEVIWFDCSISRLTMTSFLLMVFXXXXXX-----------XXXXXXXXXXXXXXTFDIG 169
           YGEV++F  +++ + ++SFLLMV                                 F+ G
Sbjct: 126 YGEVLFFGGNVTAMELSSFLLMVLSSVVATLGDQQAIAQKNAEMALANEVGASVALFNPG 185

Query: 170 YLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFE 229
           Y WM  NCISSA FVL MR+RI+ TNFKDFDT++YNN+L +P+L+  S   EDWS  N  
Sbjct: 186 YFWMFTNCISSALFVLIMRKRIKLTNFKDFDTMFYNNVLGLPILLVASFCFEDWSPTNLA 245

Query: 230 KNLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFF 289
            NL  D     +TA++ SG+++ GISY S WCVRVTSSTTYSMVGALNKLP+A SG++FF
Sbjct: 246 TNLSGDS----LTAMIISGVASVGISYCSGWCVRVTSSTTYSMVGALNKLPIALSGLLFF 301

Query: 290 GDPITTGNVSAIFVGFVAGILYSIAKTEQQ 319
             P    ++ +IF+GF++GI+Y++AK ++Q
Sbjct: 302 DAPRNFLSIFSIFLGFLSGIVYALAKQKKQ 331



>gi|401839091|gb|EJT42445.1| VRG4-like protein [Saccharomyces kudriavzevii IFO 1802]
          Length = 336

 Score =  320 bits (819), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 160/320 (50%), Positives = 225/320 (70%), Gaps = 12/320 (3%)

Query: 9   AFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNL 68
           A ++ +G + IL+YC +SILMTVTNK+V++  +FNMNF++L +Q++VC + L   ++L  
Sbjct: 15  ASVANSGPISILSYCGSSILMTVTNKFVVNLDNFNMNFVMLFVQTLVCTMTLIVLRILGY 74

Query: 69  VSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFD 128
             FR  +   ++ WFPI++LLV M YT SK+LQYL++P+YTIFKNLTIILIAYGEVI+F 
Sbjct: 75  AKFRSLNKTDAKNWFPISLLLVLMTYTSSKALQYLAVPIYTIFKNLTIILIAYGEVIFFG 134

Query: 129 CSISRLTMTSFLLMVFXXXXXX--------XXXXXXXXXXXXXXTFDIGYLWMAFNCISS 180
            S++ + ++SFLLMV                              F+ GY WM  NCISS
Sbjct: 135 GSVTSMELSSFLLMVLSSIVATWGDQQAVAAKAASLADAAADVAGFNPGYFWMFTNCISS 194

Query: 181 AAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTL 240
           A FVL MR+RI+ TNFKDFDT++YNN+L++P+L+  S  +E+WS  N  KNL  D     
Sbjct: 195 ALFVLIMRKRIKLTNFKDFDTMFYNNVLALPILLLFSFCLENWSSSNLTKNLSNDS---- 250

Query: 241 ITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSA 300
           +TA++ SG+++ GISY S WCVRVTSSTTYSMVGALNKLP+A SG+IFF  P    ++ +
Sbjct: 251 LTAMIISGVASVGISYCSGWCVRVTSSTTYSMVGALNKLPIALSGLIFFDAPRNFLSILS 310

Query: 301 IFVGFVAGILYSIAKTEQQK 320
           IF+GF++GI+Y++AK ++Q+
Sbjct: 311 IFIGFLSGIIYAVAKQKKQQ 330



>gi|389632457|ref|XP_003713881.1| GDP-mannose transporter [Magnaporthe oryzae 70-15]
 gi|189041719|sp|A4RM13.1|GMT_MAGO7 RecName: Full=GDP-mannose transporter; Short=GMT
 gi|351646214|gb|EHA54074.1| GDP-mannose transporter [Magnaporthe oryzae 70-15]
 gi|440473325|gb|ELQ42128.1| GDP-mannose transporter [Magnaporthe oryzae Y34]
 gi|440486519|gb|ELQ66379.1| GDP-mannose transporter [Magnaporthe oryzae P131]
          Length = 394

 Score =  320 bits (819), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 155/314 (49%), Positives = 211/314 (67%), Gaps = 9/314 (2%)

Query: 19  ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS-FREFDLA 77
           IL YC +SI MTV NKYV+SG ++N+NF  L +Q+IVC++ +   K + +++    FD  
Sbjct: 58  ILAYCLSSISMTVVNKYVVSGSEWNLNFFYLAVQAIVCIIAILFCKQIGIITNLAPFDNV 117

Query: 78  LSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMT 137
            ++KWFP+++LLV MIYT +K+LQ+LS+PVYTIFKNLTII IAYGEV+WF  S+S L + 
Sbjct: 118 KAKKWFPVSLLLVGMIYTSTKALQFLSVPVYTIFKNLTIIAIAYGEVLWFGGSVSPLALV 177

Query: 138 SFLLMVFXXXXXX--------XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRR 189
           SF LMV                             T + GY WM  N   SAA++L MR+
Sbjct: 178 SFGLMVLSSVVAAWADIQSAIHGGSHPSEASTAISTLNAGYAWMGMNVFCSAAYLLGMRK 237

Query: 190 RIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGI 249
            I   NFKD+D+++YNNLL+IP+L+  SL+ EDWS  N  +N P + R  L   +++SG+
Sbjct: 238 VIHKMNFKDWDSMFYNNLLTIPVLIVCSLIAEDWSAANLARNFPIESRNALFIGMIYSGL 297

Query: 250 SAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGI 309
            A  ISY SAWC+RVT+STTYSMVGALNKLP+A SG++FF  P+T G+VSAI +GF++GI
Sbjct: 298 GAIFISYCSAWCIRVTTSTTYSMVGALNKLPIAISGLVFFSAPVTFGSVSAIVIGFISGI 357

Query: 310 LYSIAKTEQQKPIK 323
           +Y+ AK  Q    K
Sbjct: 358 VYAWAKARQSSQAK 371



>gi|346325906|gb|EGX95502.1| GDP-mannose transporter [Cordyceps militaris CM01]
          Length = 382

 Score =  319 bits (818), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 161/337 (47%), Positives = 227/337 (67%), Gaps = 5/337 (1%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS 70
           +S +  L +L YC +SI MTV NKYV+SG  FNM  + LGIQ+ V V  + A K L L++
Sbjct: 44  ISQSPGLSVLAYCLSSISMTVVNKYVVSGSKFNMPLMYLGIQNGVGVAAIMACKQLGLIT 103

Query: 71  -FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDC 129
               FD   ++KW PI+ LL+ MI+TG+K+LQ+LS+PVYTIFKNLTII+IAYGEV+WF  
Sbjct: 104 TLAPFDTEKAKKWMPISFLLLGMIFTGTKALQFLSVPVYTIFKNLTIIVIAYGEVLWFGG 163

Query: 130 SISRLTMTSFLLMVFXXXXX--XXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTM 187
            ++ + + SF +MV                       T + GY WM  N I S+AFVL M
Sbjct: 164 KVTSMILLSFGMMVISSIIAGWSDVQYAASASSDALSTLNAGYAWMFLNVICSSAFVLGM 223

Query: 188 RRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFS 247
           R+ IR  NF D+DT++YNN L+IP+++ ++L+VEDWS +N  +N P + R  L+  +++S
Sbjct: 224 RKVIRKMNFSDWDTMFYNNFLTIPVIIVLTLLVEDWSSENLARNFPVESRNNLMLGMVYS 283

Query: 248 GISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVA 307
           G+ A  ISY SAWC+RVTSSTTYSMVGALNKLP+A SG++FF  P+T G+VSAI +GFV+
Sbjct: 284 GLCAIFISYCSAWCIRVTSSTTYSMVGALNKLPIAVSGLVFFDAPVTFGSVSAIILGFVS 343

Query: 308 GILYSIAKTEQQKPIKPSVYIPISNKELPQTTTNDNN 344
           GI+Y+  K + ++  K S  +P +N+ +   ++  NN
Sbjct: 344 GIVYTWGKVQMKEQSKMS--LPTTNRPVMSASSKSNN 378



>gi|85109433|ref|XP_962914.1| GDP-mannose transporter [Neurospora crassa OR74A]
 gi|74617386|sp|Q7SBC5.1|GMT_NEUCR RecName: Full=GDP-mannose transporter; Short=GMT
 gi|28924558|gb|EAA33678.1| GDP-mannose transporter [Neurospora crassa OR74A]
 gi|336469439|gb|EGO57601.1| GDP-mannose transporter [Neurospora tetrasperma FGSC 2508]
 gi|350290920|gb|EGZ72134.1| GDP-mannose transporter [Neurospora tetrasperma FGSC 2509]
          Length = 392

 Score =  319 bits (817), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 156/310 (50%), Positives = 214/310 (69%), Gaps = 9/310 (2%)

Query: 19  ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLV-SFREFDLA 77
           I+ YC +SI MTV NKYV+SG ++N+NF  L +QS+VC   +   K L +  +   FD  
Sbjct: 58  IIAYCLSSISMTVVNKYVVSGSEWNLNFFYLAVQSLVCTAAILICKQLGMFQNLAAFDST 117

Query: 78  LSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMT 137
            ++KWFPI++LLV MIYT +K+LQ+LS+PVYTIFKNLTII++AYGEV+WF  S++ + + 
Sbjct: 118 KAKKWFPISLLLVGMIYTSTKALQFLSVPVYTIFKNLTIIVVAYGEVLWFGGSVTPMALL 177

Query: 138 SFLLMVFXX--------XXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRR 189
           SF LMV                             T + GY WM  N   +AA++L MR+
Sbjct: 178 SFGLMVLSSVIAAWADIQAAVEGVGHTAEATDAISTLNAGYAWMGMNVFCTAAYLLGMRK 237

Query: 190 RIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGI 249
            I+  NFKD+DT++YNNLL+IP+L+  SL+ EDWS  N  KN P + R +L   +++SG+
Sbjct: 238 VIKKMNFKDYDTMFYNNLLTIPVLIVFSLLFEDWSNDNLIKNFPVETRNSLFIGMIYSGL 297

Query: 250 SAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGI 309
           +A  ISY SAWC+RVTSSTTYSMVGALNKLP+A SG+IFF  P+T G+V+AIFVGFV+G+
Sbjct: 298 AAIFISYCSAWCIRVTSSTTYSMVGALNKLPLAISGLIFFDAPVTFGSVTAIFVGFVSGL 357

Query: 310 LYSIAKTEQQ 319
           +Y+ +KT Q+
Sbjct: 358 VYTWSKTRQK 367



>gi|156064845|ref|XP_001598344.1| GDP-mannose transporter [Sclerotinia sclerotiorum 1980]
 gi|189041723|sp|A7E558.1|GMT_SCLS1 RecName: Full=GDP-mannose transporter; Short=GMT
 gi|154691292|gb|EDN91030.1| GDP-mannose transporter [Sclerotinia sclerotiorum 1980 UF-70]
          Length = 391

 Score =  318 bits (815), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 158/315 (50%), Positives = 213/315 (67%), Gaps = 11/315 (3%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS-FREFD 75
           + IL YC ASI MTVTNKY +SG ++N+NF  L IQS+VC++ +   K   L++    FD
Sbjct: 51  ISILAYCLASISMTVTNKYCVSGSNWNLNFFYLAIQSVVCIIAIIICKQAGLITNLAPFD 110

Query: 76  LALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLT 135
              ++ WFPI++LLV MIYT +K+LQ+LS+PVYTIFKNLTII+IAYGEV+WF  S++   
Sbjct: 111 TKKAKTWFPISLLLVGMIYTSTKALQFLSVPVYTIFKNLTIIVIAYGEVLWFGGSVTPSA 170

Query: 136 MTSFLLMVFXXXXXX----------XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVL 185
           + SF LMV                               T + GY WM  N   +AA+VL
Sbjct: 171 LFSFGLMVLSSVVAAWADIQHALYGGGATQTKEAADALSTLNAGYAWMGMNVFCTAAYVL 230

Query: 186 TMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAIL 245
           +MR+ I+  NFKD+DT++YNNLL+IP+L   S + E+WS +N  KN P + R  LI  ++
Sbjct: 231 SMRKVIKKMNFKDWDTMFYNNLLTIPVLFVCSFVFENWSSENLTKNFPLETRNNLILGMI 290

Query: 246 FSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGF 305
           +SG++   ISY SAWC+RVTSSTTYSMVGALNKLP+A SG++FF  P+T G+VSAIF+GF
Sbjct: 291 YSGLATIFISYCSAWCIRVTSSTTYSMVGALNKLPIAVSGLVFFAAPVTFGSVSAIFIGF 350

Query: 306 VAGILYSIAKTEQQK 320
           V+GI+Y+ AK  Q +
Sbjct: 351 VSGIVYAWAKVRQNQ 365



>gi|154322673|ref|XP_001560651.1| golgi GDP-mannose transporter [Botryotinia fuckeliana B05.10]
 gi|189041363|sp|A6RJQ8.1|GMT_BOTFB RecName: Full=GDP-mannose transporter; Short=GMT
 gi|472238324|gb|EMR83193.1| putative gdp-mannose transporter protein [Botryotinia fuckeliana
           BcDW1]
          Length = 392

 Score =  317 bits (812), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 158/315 (50%), Positives = 213/315 (67%), Gaps = 11/315 (3%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS-FREFD 75
           + IL YC ASI MTVTNKY +SG ++N+NF  L IQS+VC++ +   K   L++    FD
Sbjct: 52  ISILAYCLASISMTVTNKYCVSGSNWNLNFFYLAIQSVVCIIAIIICKQAGLITNLAPFD 111

Query: 76  LALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLT 135
              ++ WFPI++LLV MIYT +K+LQ+LS+PVYTIFKNLTII+IAYGEV+WF  S++   
Sbjct: 112 TKKAKTWFPISLLLVGMIYTSTKALQFLSVPVYTIFKNLTIIVIAYGEVLWFGGSVTPSA 171

Query: 136 MTSFLLMVFXXXXXXXXXXXXX----------XXXXXXXTFDIGYLWMAFNCISSAAFVL 185
           + SF LMV                               T + GY WM  N   +AA+VL
Sbjct: 172 LFSFGLMVLSSVVAAWADIQHALYGGGAAQSAEAAAALSTLNAGYAWMGMNVFCTAAYVL 231

Query: 186 TMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAIL 245
           +MR+ I+  NFKD+DT++YNNLL+IP+L   S + E+WS +N  KN P + R  LI  ++
Sbjct: 232 SMRKVIKKMNFKDWDTMFYNNLLTIPVLFVCSFIFENWSSENLTKNFPLETRNNLILGMI 291

Query: 246 FSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGF 305
           +SG++   ISY SAWC+RVTSSTTYSMVGALNKLP+A SG++FF  P+T G+VSAIF+GF
Sbjct: 292 YSGLATIFISYCSAWCIRVTSSTTYSMVGALNKLPIAVSGLVFFAAPVTFGSVSAIFIGF 351

Query: 306 VAGILYSIAKTEQQK 320
           V+GI+Y+ AK  Q +
Sbjct: 352 VSGIVYAWAKVRQNQ 366



>gi|402086886|gb|EJT81784.1| GDP-mannose transporter [Gaeumannomyces graminis var. tritici
           R3-111a-1]
          Length = 393

 Score =  316 bits (810), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 154/314 (49%), Positives = 211/314 (67%), Gaps = 9/314 (2%)

Query: 19  ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS-FREFDLA 77
           IL YC +SI MTV NKYV+SG  +N+NF  L +Q+IVC+  +   K   L++    +D  
Sbjct: 58  ILAYCLSSISMTVVNKYVVSGSSWNLNFFYLAVQAIVCIAAIMVCKQAGLITNLAPYDQT 117

Query: 78  LSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMT 137
            +++WFPI++LLV MIYT +K+LQ+LS+PVYTIFKNLTII IAYGEV+WF   ++ L + 
Sbjct: 118 KAKRWFPISILLVGMIYTSTKALQFLSVPVYTIFKNLTIIAIAYGEVLWFGGRVTPLALL 177

Query: 138 SFLLMVFXXXXXXXXXXXXX--------XXXXXXXTFDIGYLWMAFNCISSAAFVLTMRR 189
           SF L+V                             T + GY WM  N   SAA++LTMR+
Sbjct: 178 SFGLIVLSSVVAAWADIQSAISGAPHPGHASAAISTLNAGYAWMGMNVFCSAAYLLTMRK 237

Query: 190 RIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGI 249
            I   NFKD+D+++YNNLL+IP+L+  SL+ EDWS  N  +N P + R TL   +++SG+
Sbjct: 238 VIHKMNFKDWDSMFYNNLLTIPVLVVCSLIAEDWSGANLARNFPIETRNTLFIGMIYSGL 297

Query: 250 SAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGI 309
           +A  ISY SAWC+RVT+STTYSMVGALNKLP+A SG++FF  P+T G+VSAI +GF++GI
Sbjct: 298 AAIFISYCSAWCIRVTTSTTYSMVGALNKLPIAISGLVFFDAPVTFGSVSAIVLGFISGI 357

Query: 310 LYSIAKTEQQKPIK 323
           +Y+ AK  Q +  K
Sbjct: 358 VYAWAKARQSQQAK 371



>gi|500257163|gb|EOO00354.1| putative gdp-mannose transporter protein [Togninia minima UCRPA7]
          Length = 313

 Score =  316 bits (810), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 158/313 (50%), Positives = 218/313 (69%), Gaps = 10/313 (3%)

Query: 29  MTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS-FREFDLALSRKWFPIAM 87
           MTV NKYV+SG  +N+NFL L IQS VCV  + A K + L++    FD   +++WFPI++
Sbjct: 1   MTVVNKYVVSGSYWNLNFLYLAIQSTVCVAAIMACKSVGLITNLAAFDSTRAKRWFPISV 60

Query: 88  LLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTSFLLMV---- 143
           LLV  IYTG+K+LQ+LS+PVYTIFKNL+II+ AYGEV+WF   ++ + + SF +MV    
Sbjct: 61  LLVGYIYTGAKALQFLSVPVYTIFKNLSIIVTAYGEVLWFGGRVTPMILLSFGIMVLSSI 120

Query: 144 ---FXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRIRSTNFKDFD 200
              +                    T + GY+WM  N   SA F+L+MR+ I++ NFKD+D
Sbjct: 121 VAAWADIQAAVNGQHSQESSEAISTLNAGYMWMGLNVFCSAFFLLSMRKVIKTMNFKDWD 180

Query: 201 TVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFGISYTSAW 260
           T++YNNLLSIP+L+  SL++EDWS +N  +N PED R +LI  +++SG+ A  ISY SAW
Sbjct: 181 TMFYNNLLSIPVLIAGSLLLEDWSGENLARNFPEDTRNSLIIGMIYSGLGAIFISYCSAW 240

Query: 261 CVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSIAKTEQQK 320
           C+RVTSSTTYSMVGALNKLP+A SG+IFF  PIT G+VSAI +GF++G++Y+ AK  Q +
Sbjct: 241 CLRVTSSTTYSMVGALNKLPMAVSGLIFFDAPITFGSVSAIIIGFISGLVYAWAKIRQTE 300

Query: 321 PIKPSVYIPISNK 333
             K S  +P +N+
Sbjct: 301 KAKMS--LPTTNQ 311



>gi|367027284|ref|XP_003662926.1| hypothetical protein MYCTH_2304127 [Myceliophthora thermophila ATCC
           42464]
 gi|347010195|gb|AEO57681.1| hypothetical protein MYCTH_2304127 [Myceliophthora thermophila ATCC
           42464]
          Length = 418

 Score =  315 bits (808), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 165/376 (43%), Positives = 231/376 (61%), Gaps = 36/376 (9%)

Query: 2   AQPPTILAFLSATGTLP---ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVV 58
            + P   AFL      P   IL YC +SI MTV NKYV+SG ++N+NF  L +QS+VC +
Sbjct: 39  GREPGFSAFLDKLNHSPGASILAYCLSSISMTVVNKYVVSGSEWNLNFFYLAVQSLVCTL 98

Query: 59  LLRAFKMLNLV-SFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTII 117
            +   +   L+ +   FD   +RKWFP+++LLV MIYTG+K+LQYLS+PVYTIFKNLTII
Sbjct: 99  AILVSRQTGLIKNLAPFDTNKARKWFPVSLLLVGMIYTGAKALQYLSVPVYTIFKNLTII 158

Query: 118 LIAYGEVIWFDCSISRLTMTSFLLMVFXX--------XXXXXXXXXXXXXXXXXXTFDIG 169
           +IAYGEV+WF  S++ LT+ SF LMV                             T + G
Sbjct: 159 VIAYGEVLWFGGSVTPLTLLSFGLMVLSSVIAAWADIQAAIDGVGHSGETSAALATLNAG 218

Query: 170 YLWMAFNCISSAAFVLTMRRRIRSTNFKDFDT----------------------VYYNNL 207
           Y WM  N + ++++VL  R+ I+  NFKD+D+                      ++YNNL
Sbjct: 219 YAWMGMNVVCTSSYVLGTRKAIKKMNFKDYDSKFSEPASDGDALPGADPSGRLAMFYNNL 278

Query: 208 LSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSS 267
           L+IP+L+  SL+VEDWS +N  +N P + R  L+  +++SG+ A  ISY SAWC+RVTSS
Sbjct: 279 LTIPVLIVCSLLVEDWSSENLARNFPAESRNKLMVGMVYSGLGAIFISYCSAWCIRVTSS 338

Query: 268 TTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSIAKTEQQKPIKPSVY 327
           TTYSMVG+LNKLP+A SG+IFF  PIT G+V+AIFVGF++G++Y+ AK   +   + +  
Sbjct: 339 TTYSMVGSLNKLPIAISGLIFFDAPITFGSVTAIFVGFISGLVYAWAKIRAKA--QDAGI 396

Query: 328 IPISNKELPQTTTNDN 343
           +P +NK     +   N
Sbjct: 397 LPTTNKPTMSASAQSN 412



>gi|399164798|emb|CCE34291.1| probable Golgi GDP-mannose transporter [Claviceps purpurea 20.1]
          Length = 371

 Score =  315 bits (807), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 158/317 (49%), Positives = 216/317 (68%), Gaps = 2/317 (0%)

Query: 19  ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS-FREFDLA 77
           +L YC +S+ MT+ NKYV+SG D+NMN L L +QSIV    +   K   L+     FD  
Sbjct: 56  VLAYCLSSMSMTIVNKYVISGSDWNMNLLYLAVQSIVGTAAIVICKQAGLIKDLGSFDSQ 115

Query: 78  LSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMT 137
            ++ WFP+A+LLVAMIYTG+K+LQ+LS+PVYTIFKNLTII+IAYGEV+ F  S+S LT+ 
Sbjct: 116 KAKGWFPVALLLVAMIYTGNKALQFLSVPVYTIFKNLTIIVIAYGEVMLFGSSVSPLTLV 175

Query: 138 SFLLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRIRSTNFK 197
           SF +MVF                    T + GY WM  N   +A + L++R+ I+ T F 
Sbjct: 176 SFAMMVFSSVIAAWADAKSAASAAALATLNAGYAWMGVNVFCAAMYALSVRKVIKKTGFN 235

Query: 198 DFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFGISYT 257
           +++ +YYNNLL+IP+L+  SL+VEDWS  N  KN P   R ++ T +++SG+ A  ISY+
Sbjct: 236 NWEVMYYNNLLTIPVLILSSLLVEDWSAANLNKNFPVASRGSMATGMVYSGLGAIFISYS 295

Query: 258 SAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSIAKTE 317
           +AWC+R TSSTTY+MVGALNKLPVA  G+IFF  P+T G+VSAI +GFV+GI+Y++AK  
Sbjct: 296 TAWCIRATSSTTYAMVGALNKLPVAILGIIFFAAPVTFGSVSAILLGFVSGIVYTVAKL- 354

Query: 318 QQKPIKPSVYIPISNKE 334
           Q KP      +P++NK 
Sbjct: 355 QNKPSPQPPALPLTNKR 371



>gi|347837164|emb|CCD51736.1| similar to GDP-mannose transporter [Botryotinia fuckeliana T4]
          Length = 393

 Score =  313 bits (801), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 158/316 (50%), Positives = 213/316 (67%), Gaps = 12/316 (3%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQ-SIVCVVLLRAFKMLNLVS-FREF 74
           + IL YC ASI MTVTNKY +SG ++N+NF  L IQ S+VC++ +   K   L++    F
Sbjct: 52  ISILAYCLASISMTVTNKYCVSGSNWNLNFFYLAIQQSVVCIIAIIICKQAGLITNLAPF 111

Query: 75  DLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRL 134
           D   ++ WFPI++LLV MIYT +K+LQ+LS+PVYTIFKNLTII+IAYGEV+WF  S++  
Sbjct: 112 DTKKAKTWFPISLLLVGMIYTSTKALQFLSVPVYTIFKNLTIIVIAYGEVLWFGGSVTPS 171

Query: 135 TMTSFLLMVFXXXXXXXXXXXXX----------XXXXXXXTFDIGYLWMAFNCISSAAFV 184
            + SF LMV                               T + GY WM  N   +AA+V
Sbjct: 172 ALFSFGLMVLSSVVAAWADIQHALYGGGAAQSAEAAAALSTLNAGYAWMGMNVFCTAAYV 231

Query: 185 LTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAI 244
           L+MR+ I+  NFKD+DT++YNNLL+IP+L   S + E+WS +N  KN P + R  LI  +
Sbjct: 232 LSMRKVIKKMNFKDWDTMFYNNLLTIPVLFVCSFIFENWSSENLTKNFPLETRNNLILGM 291

Query: 245 LFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVG 304
           ++SG++   ISY SAWC+RVTSSTTYSMVGALNKLP+A SG++FF  P+T G+VSAIF+G
Sbjct: 292 IYSGLATIFISYCSAWCIRVTSSTTYSMVGALNKLPIAVSGLVFFAAPVTFGSVSAIFIG 351

Query: 305 FVAGILYSIAKTEQQK 320
           FV+GI+Y+ AK  Q +
Sbjct: 352 FVSGIVYAWAKVRQNQ 367



>gi|349577697|dbj|GAA22865.1| K7_01966p [Saccharomyces cerevisiae Kyokai no. 7]
          Length = 341

 Score =  311 bits (796), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 158/314 (50%), Positives = 216/314 (68%), Gaps = 17/314 (5%)

Query: 14  TGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFRE 73
           +G   IL+YCA+SILMTVTNK+V++  +FNMNF++L +QS+VC V L   +++ + +FR 
Sbjct: 15  SGPASILSYCASSILMTVTNKFVVNLDNFNMNFVMLFVQSLVCTVTLCILRIVGVANFRS 74

Query: 74  FDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISR 133
            D    + WFPI++LLV MIYT SKSLQYL++P+YTIFKNLTIILIAYGEV++F   ++ 
Sbjct: 75  LDRTDVKNWFPISLLLVLMIYTSSKSLQYLAVPIYTIFKNLTIILIAYGEVLFFGGKVTS 134

Query: 134 LTMTSFLLMVFXXXXXXXXXXXXXXXXXXXX-------------TFDIGYLWMAFNCISS 180
           + +TSF++MV                                    + GYLWM  NCISS
Sbjct: 135 MELTSFIMMVLSSVVATWGDQQAIAIKASSLEDLDQELVESTIFVLNPGYLWMFTNCISS 194

Query: 181 AAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTL 240
           A FVL MR+RIR TNFKD+DT++YNN+L++PLL+  S ++EDWS KN   NL  D     
Sbjct: 195 ALFVLIMRKRIRLTNFKDYDTMFYNNVLALPLLLVFSFIMEDWSTKNLSVNLSADS---- 250

Query: 241 ITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSA 300
           + A++ SG+ + GISY S WCVRVTSSTTYSMVGALNKLP+A +G++FF  P    +  +
Sbjct: 251 LAAMVISGLMSVGISYCSGWCVRVTSSTTYSMVGALNKLPIALAGLVFFDAPKNFLSFFS 310

Query: 301 IFVGFVAGILYSIA 314
           IF+GF++G+LY++A
Sbjct: 311 IFLGFLSGLLYAVA 324



>gi|116207146|ref|XP_001229382.1| hypothetical protein CHGG_02866 [Chaetomium globosum CBS 148.51]
 gi|88183463|gb|EAQ90931.1| hypothetical protein CHGG_02866 [Chaetomium globosum CBS 148.51]
          Length = 381

 Score =  307 bits (786), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 153/329 (46%), Positives = 217/329 (65%), Gaps = 23/329 (6%)

Query: 2   AQPPTILAFLSATGTLP---ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVV 58
            + PT  A+       P   I+ YC +SI MTV NKYV+SG  +N+NF  LG+Q+ +   
Sbjct: 39  GREPTASAYFGKLDNSPGASIIAYCLSSISMTVVNKYVVSGESWNLNFFYLGVQTGL--- 95

Query: 59  LLRAFKMLNLVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIIL 118
                    + +   FD   +++WFP+++LLV+MIYTG+ +LQYLS+PVYTIFKNLTII+
Sbjct: 96  ---------IKNLAPFDSNKAKRWFPVSLLLVSMIYTGANALQYLSVPVYTIFKNLTIIV 146

Query: 119 IAYGEVIWFDCSISRLTMTSFLLMVFXXXXXXXX--------XXXXXXXXXXXXTFDIGY 170
           IAYGEV+WF  S++ L + SF LMV                             T + GY
Sbjct: 147 IAYGEVLWFGGSVTPLMLLSFGLMVLSSVVAAWADIQAAIDGVGHSAETSAALATLNAGY 206

Query: 171 LWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEK 230
            WM  N + +++++L MR+ I+  NFKD+D+++YNNLL+IP+L+  SL+VEDWS +N  K
Sbjct: 207 AWMGLNVVCTSSYLLGMRKVIKKMNFKDYDSMFYNNLLTIPVLVVCSLLVEDWSSENLAK 266

Query: 231 NLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFG 290
           N P + R  L+  +++SG++A  ISY SAWC+RVTSSTTYSMVGALNKLP+A SG+IFF 
Sbjct: 267 NFPIETRNKLMVGMIYSGLAAIFISYCSAWCIRVTSSTTYSMVGALNKLPIAISGLIFFD 326

Query: 291 DPITTGNVSAIFVGFVAGILYSIAKTEQQ 319
            PIT G+++AI VGFV+G++++ AK  Q+
Sbjct: 327 APITFGSITAIAVGFVSGLVFAWAKVRQK 355



>gi|323348972|gb|EGA83208.1| Hvg1p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 341

 Score =  306 bits (785), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 156/314 (49%), Positives = 215/314 (68%), Gaps = 17/314 (5%)

Query: 14  TGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFRE 73
           +G   IL+YCA+SILMTVTNK+V++  +FNMNF++L +QS+VC V L   +++ + +FR 
Sbjct: 15  SGPASILSYCASSILMTVTNKFVVNLDNFNMNFVMLFVQSLVCTVTLCILRIVGVANFRS 74

Query: 74  FDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISR 133
            +    + WFPI++LLV MIYT  KSLQYL++P+YTIFKNLTIILIAYGEV++F   ++ 
Sbjct: 75  LNRTDVKNWFPISLLLVLMIYTSXKSLQYLAVPIYTIFKNLTIILIAYGEVLFFGGKVTS 134

Query: 134 LTMTSFLLMVFXXXXXXXXXXXXXXXXXXXX-------------TFDIGYLWMAFNCISS 180
           + +TSF++MV                                    + GYLWM  NCISS
Sbjct: 135 MELTSFIMMVLSSVVATWGDQQAIAIKASSLEDLDQELVESTIFVLNPGYLWMFTNCISS 194

Query: 181 AAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTL 240
           A FVL MR+RIR TNFKD+DT++YNN+L++PLL+  S ++EDWS KN   NL  D     
Sbjct: 195 ALFVLIMRKRIRLTNFKDYDTMFYNNVLALPLLLVFSFIMEDWSTKNLSVNLSADS---- 250

Query: 241 ITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSA 300
           + A++ SG+ + GISY S WCVRVTSSTTYSMVGALNKLP+A +G++FF  P    +  +
Sbjct: 251 LAAMVISGLMSAGISYCSGWCVRVTSSTTYSMVGALNKLPIALAGLVFFDAPKNFLSFFS 310

Query: 301 IFVGFVAGILYSIA 314
           IF+GF++G+LY++A
Sbjct: 311 IFLGFLSGLLYAVA 324



>gi|400599762|gb|EJP67453.1| GDP-mannose transporter [Beauveria bassiana ARSEF 2860]
          Length = 353

 Score =  306 bits (784), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 154/322 (47%), Positives = 212/322 (65%), Gaps = 10/322 (3%)

Query: 19  ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS-FREFDLA 77
           IL YC ASI MT  NKY+ SG  +N+ F  L +QS+VC+  +   K   +V+    +D  
Sbjct: 25  ILAYCVASISMTAVNKYIFSGGSWNLTFFCLTVQSVVCLAAVLIGKRFGVVTTLGAYDSL 84

Query: 78  LSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMT 137
            +RKW P+++LLV MIY+G+KSLQYLS+PVYTIFKNLTII+IAYGE I+F   +SRL + 
Sbjct: 85  KARKWLPLSVLLVGMIYSGAKSLQYLSVPVYTIFKNLTIIVIAYGENIFFGTKVSRLILV 144

Query: 138 SFLLMVFXXXXXXXXXXXXXX-------XXXXXXTFDIGYLWMAFNCISSAAFVLTMRRR 190
           SF LMV                                GY WM  N   ++AF++  R+ 
Sbjct: 145 SFGLMVLSSVIAAWADIQAAINGLHSVDTSAATAQLAAGYTWMGINVFCTSAFLIGSRKV 204

Query: 191 IRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGIS 250
           +++ NF D DT++YNNLLSIP+L+  SL +EDWS +N  +N P + RT LI ++++SG+ 
Sbjct: 205 MKAFNFSDVDTMFYNNLLSIPVLVLASLFLEDWSSENVTRNFPPETRTVLIISMIYSGLG 264

Query: 251 AFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGIL 310
              ISYT+AWC+RVTSSTTYSMVGALNKLP+A +G +FFG P+T G+VSA+F+ FV+GI+
Sbjct: 265 TIFISYTTAWCIRVTSSTTYSMVGALNKLPLAVTGFLFFGAPVTLGSVSAVFIAFVSGIV 324

Query: 311 YSIAKTEQQKPIKPSVYIPISN 332
           Y+ AK  Q +  K  + +P +N
Sbjct: 325 YAWAKVVQSE--KAKLALPTTN 344



>gi|365766064|gb|EHN07565.1| Vrg4p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 344

 Score =  306 bits (783), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 156/314 (49%), Positives = 215/314 (68%), Gaps = 17/314 (5%)

Query: 14  TGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFRE 73
           +G   IL+YCA+SILMTVTNK+V++  +FNMNF++L +QS+VC V L   +++ + +FR 
Sbjct: 18  SGPASILSYCASSILMTVTNKFVVNLDNFNMNFVMLFVQSLVCTVTLCILRIVGVANFRS 77

Query: 74  FDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISR 133
            +    + WFPI++LLV MIYT  KSLQYL++P+YTIFKNLTIILIAYGEV++F   ++ 
Sbjct: 78  LNRTDVKNWFPISLLLVLMIYTSLKSLQYLAVPIYTIFKNLTIILIAYGEVLFFGGKVTS 137

Query: 134 LTMTSFLLMVFXXXXXXXXXXXXXXXXXXXX-------------TFDIGYLWMAFNCISS 180
           + +TSF++MV                                    + GYLWM  NCISS
Sbjct: 138 MELTSFIMMVLSSVVATWGDQQAIAIKASSLEDLDQELVESTIFVLNPGYLWMFTNCISS 197

Query: 181 AAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTL 240
           A FVL MR+RIR TNFKD+DT++YNN+L++PLL+  S ++EDWS KN   NL  D     
Sbjct: 198 ALFVLIMRKRIRLTNFKDYDTMFYNNVLALPLLLVFSFIMEDWSTKNLSVNLSADS---- 253

Query: 241 ITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSA 300
           + A++ SG+ + GISY S WCVRVTSSTTYSMVGALNKLP+A +G++FF  P    +  +
Sbjct: 254 LAAMVISGLMSAGISYCSGWCVRVTSSTTYSMVGALNKLPIALAGLVFFDAPKNFLSFFS 313

Query: 301 IFVGFVAGILYSIA 314
           IF+GF++G+LY++A
Sbjct: 314 IFLGFLSGLLYAVA 327



>gi|290463236|sp|C8Z742.1|GMT2_YEAS8 RecName: Full=Probable GDP-mannose transporter 2; Short=GMT 2
 gi|259145948|emb|CAY79208.1| EC1118_1E8_1420p [Saccharomyces cerevisiae EC1118]
          Length = 341

 Score =  306 bits (783), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 156/314 (49%), Positives = 215/314 (68%), Gaps = 17/314 (5%)

Query: 14  TGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFRE 73
           +G   IL+YCA+SILMTVTNK+V++  +FNMNF++L +QS+VC V L   +++ + +FR 
Sbjct: 15  SGPASILSYCASSILMTVTNKFVVNLDNFNMNFVMLFVQSLVCTVTLCILRIVGVANFRS 74

Query: 74  FDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISR 133
            +    + WFPI++LLV MIYT  KSLQYL++P+YTIFKNLTIILIAYGEV++F   ++ 
Sbjct: 75  LNRTDVKNWFPISLLLVLMIYTSLKSLQYLAVPIYTIFKNLTIILIAYGEVLFFGGKVTS 134

Query: 134 LTMTSFLLMVFXXXXXXXXXXXXXXXXXXXX-------------TFDIGYLWMAFNCISS 180
           + +TSF++MV                                    + GYLWM  NCISS
Sbjct: 135 MELTSFIMMVLSSVVATWGDQQAIAIKASSLEDLDQELVESTIFVLNPGYLWMFTNCISS 194

Query: 181 AAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTL 240
           A FVL MR+RIR TNFKD+DT++YNN+L++PLL+  S ++EDWS KN   NL  D     
Sbjct: 195 ALFVLIMRKRIRLTNFKDYDTMFYNNVLALPLLLVFSFIMEDWSTKNLSVNLSADS---- 250

Query: 241 ITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSA 300
           + A++ SG+ + GISY S WCVRVTSSTTYSMVGALNKLP+A +G++FF  P    +  +
Sbjct: 251 LAAMVISGLMSVGISYCSGWCVRVTSSTTYSMVGALNKLPIALAGLVFFDAPKNFLSFFS 310

Query: 301 IFVGFVAGILYSIA 314
           IF+GF++G+LY++A
Sbjct: 311 IFLGFLSGLLYAVA 324



>gi|400602080|gb|EJP69705.1| UDP-galactose transporter [Beauveria bassiana ARSEF 2860]
          Length = 383

 Score =  305 bits (780), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 158/331 (47%), Positives = 222/331 (67%), Gaps = 5/331 (1%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS-FREFD 75
           L +L YC +SI MTV NKYV+SG  FNM  + LGIQ+ V V  + A K L L++    FD
Sbjct: 50  LSVLAYCLSSISMTVVNKYVVSGSQFNMPLMYLGIQNGVGVAAILACKQLGLITTLAPFD 109

Query: 76  LALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLT 135
              ++KW PI+ LL+ MI+TG+K+LQ+LS+PVYTIFKNLTII+IAYGEV+WF   ++ L 
Sbjct: 110 TEKAKKWLPISFLLLGMIFTGTKALQFLSVPVYTIFKNLTIIVIAYGEVLWFGGQVTSLI 169

Query: 136 MTSFLLMVFXXXXXX--XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRIRS 193
           + SF +MV                       T + GY WM  N + S+ FVL MR+ IR 
Sbjct: 170 LLSFGMMVLSSIIAAWSDVQSAATASADAMSTLNAGYAWMFLNVLCSSTFVLGMRKVIRK 229

Query: 194 TNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFG 253
            NF D+DT++YNN L+IP+++ ++ ++EDWS +N  +N P + R  L+  +++SG+ A  
Sbjct: 230 MNFSDWDTMFYNNFLTIPIIIILTFLIEDWSSENLARNFPVETRNNLLLGMVYSGLCAIF 289

Query: 254 ISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSI 313
           ISY SAWC+RVTSSTTYSMVGALNKLP+A SG++FF  P+T G+VSAIF+GFV+GI+Y+ 
Sbjct: 290 ISYCSAWCIRVTSSTTYSMVGALNKLPIAVSGLVFFDAPVTFGSVSAIFLGFVSGIVYTW 349

Query: 314 AKTEQQKPIKPSVYIPISNKELPQTTTNDNN 344
            K + ++  K S  +P +N+ +   +   NN
Sbjct: 350 GKVQLKEQSKMS--LPTTNRPVMSASAKSNN 378



>gi|255717637|ref|XP_002555099.1| KLTH0G01342p [Lachancea thermotolerans]
 gi|238936483|emb|CAR24662.1| KLTH0G01342p [Lachancea thermotolerans CBS 6340]
          Length = 335

 Score =  304 bits (779), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 157/322 (48%), Positives = 219/322 (68%), Gaps = 15/322 (4%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS 70
           ++ +G L IL YC +SILMTVTNK+V++  +FNMNF++L +QS VC + L   + L    
Sbjct: 14  MANSGPLSILAYCGSSILMTVTNKFVVNVENFNMNFVMLFVQSFVCSLALVVLRALGYAK 73

Query: 71  FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCS 130
           FR  +    + WFPI++LLVAMIYT SK+LQ+L++P+YTIFKNLTIILIAYGEV++F   
Sbjct: 74  FRPLNKTDVKNWFPISVLLVAMIYTSSKALQFLAVPIYTIFKNLTIILIAYGEVLFFGGR 133

Query: 131 ISRLTMTSFLLMVFXXXXX--------XXXXXXXXXXXXXXXTFD--IGYLWMAFNCISS 180
           ++ + +++FLLMV                               D   GY+WM  NCISS
Sbjct: 134 VTAMELSAFLLMVLSSVVATMGDRQALAKKASELAAAATSEEAMDPTAGYIWMFANCISS 193

Query: 181 AAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTL 240
           A FVL MR+RI+ TNFKD+DT++YNN L++P+L+  S ++EDWS +N    L  +     
Sbjct: 194 ALFVLIMRKRIKLTNFKDYDTMFYNNALAMPILLISSFVLEDWSPEN----LTTNFTRNT 249

Query: 241 ITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSA 300
            TA++ SG+++ GISY S WCVRVTSSTTYSMVGALNKLP+A SG++FF  P    ++ +
Sbjct: 250 FTALIISGLASVGISYCSGWCVRVTSSTTYSMVGALNKLPIALSGLVFFDAPKNFLSIFS 309

Query: 301 IFVGFVAGILYSIAKT-EQQKP 321
           IF+GF+AG++Y +AK  +QQ+P
Sbjct: 310 IFLGFLAGLVYVVAKQKKQQQP 331



>gi|323309383|gb|EGA62600.1| Hvg1p [Saccharomyces cerevisiae FostersO]
          Length = 341

 Score =  303 bits (775), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 155/314 (49%), Positives = 214/314 (68%), Gaps = 17/314 (5%)

Query: 14  TGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFRE 73
           +G   IL+YCA+SILMTVTNK+V++  +FNMNF++L +QS+VC V L   +++ + +F  
Sbjct: 15  SGPASILSYCASSILMTVTNKFVVNLDNFNMNFVMLFVQSLVCTVTLCILRIVGVANFXS 74

Query: 74  FDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISR 133
            +    + WFPI++LLV MIYT SKSLQYL++P+YTIFKNLTIILIAYGEV++F   ++ 
Sbjct: 75  LNRTDVKNWFPISLLLVLMIYTSSKSLQYLAVPIYTIFKNLTIILIAYGEVLFFGGKVTS 134

Query: 134 LTMTSFLLMVFXXXXXXXXXXXXXXXXXXXX-------------TFDIGYLWMAFNCISS 180
           + +TSF++MV                                    + GYLWM  NCISS
Sbjct: 135 MELTSFIMMVLSSVVATWGDQQAIAIKASSLEDLDQELVESTIFVLNPGYLWMFTNCISS 194

Query: 181 AAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTL 240
           A FVL MR+RIR TNFKD+DT++YNN+L++PLL+  S ++EDWS K    NL  D     
Sbjct: 195 ALFVLIMRKRIRLTNFKDYDTMFYNNVLALPLLLVFSFIMEDWSTKXLSVNLSADS---- 250

Query: 241 ITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSA 300
           + A++ SG+ + GISY S WCVRVTSSTTYSMVGALNKLP+A +G++FF  P    +  +
Sbjct: 251 LAAMVISGLMSVGISYCSGWCVRVTSSTTYSMVGALNKLPIALAGLVFFDAPKNFLSFFS 310

Query: 301 IFVGFVAGILYSIA 314
           IF+GF++G+LY++A
Sbjct: 311 IFLGFLSGLLYAVA 324



>gi|323305058|gb|EGA58811.1| Vrg4p [Saccharomyces cerevisiae FostersB]
 gi|323348743|gb|EGA82984.1| Vrg4p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 336

 Score =  300 bits (767), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 157/326 (48%), Positives = 216/326 (66%), Gaps = 15/326 (4%)

Query: 9   AFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNL 68
           A ++ +G + IL+YC +SILMTVTNK+V++  DFNMNF++L +QS+VC + L   ++L  
Sbjct: 15  ASVANSGPISILSYCGSSILMTVTNKFVVNLKDFNMNFVMLFVQSLVCTITLIILRILGY 74

Query: 69  VSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFD 128
             FR  +   ++ WFPI+ LLV MIYT SK+LQYL++P+YTIFKNLTIILIAYGEV++F 
Sbjct: 75  AKFRSLNKTDAKNWFPISFLLVLMIYTSSKALQYLAVPIYTIFKNLTIILIAYGEVLFFG 134

Query: 129 CSISRLTMTSFLLMVFXXXXXX---------XXXXXXXXXXXXXXTFDIGYLWMAFNCIS 179
            S++ + ++SFLLMV                              +F+ GY WM  NCI+
Sbjct: 135 GSVTSMELSSFLLMVLSSVVATWGDQQAVAAKAASLAEGAAGAVASFNPGYFWMFTNCIT 194

Query: 180 SAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTT 239
           SA FVL MR+RI+ TNFKDFDT++YNN+L++P+L+  S  VEDWS  N   N   D    
Sbjct: 195 SALFVLIMRKRIKLTNFKDFDTMFYNNVLALPILLLFSFCVEDWSSVNLTNNFSNDS--- 251

Query: 240 LITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVS 299
            +TA++ SG+++ GISY S WCVRVTSSTTYSMVGALNKLP+A SG+IFF  P    ++ 
Sbjct: 252 -LTAMIISGVASVGISYCSGWCVRVTSSTTYSMVGALNKLPIALSGLIFFDAPRNFLSIL 310

Query: 300 AIFVGFVAGILYSIAKTEQQKPIKPS 325
           +IF  F   I Y +   + ++   P+
Sbjct: 311 SIFYWF--PIRYYLCCCQTKEATSPT 334



>gi|401838618|gb|EJT42141.1| hypothetical protein SKUD_122702 [Saccharomyces kudriavzevii IFO
           1802]
          Length = 341

 Score =  300 bits (767), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 154/314 (49%), Positives = 213/314 (67%), Gaps = 17/314 (5%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS 70
           L+ +G + IL+YCA+SILMTVTNK+V++  +FNMNF++L +QS+VC + L   +++ +  
Sbjct: 12  LANSGPISILSYCASSILMTVTNKFVVNLKNFNMNFVMLFVQSLVCTLALCVLRVVKVAK 71

Query: 71  FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCS 130
           FR  +    + WFPI++LLV M YT SKSLQYL++P+YTIFKNLTIILIAYGEV++F   
Sbjct: 72  FRSLNKTDVKNWFPISLLLVLMTYTSSKSLQYLAVPIYTIFKNLTIILIAYGEVLFFGGC 131

Query: 131 ISRLTMTSFLLMVFXXXXXXXXXXXXXXXX-------------XXXXTFDIGYLWMAFNC 177
           ++ + ++SF++MV                                    + GYLWM  NC
Sbjct: 132 VTSMELSSFIMMVLSSVVATWGDQRAIATKISPLGDLDQDLVESTIFLLNPGYLWMFTNC 191

Query: 178 ISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIR 237
           ISSA FVL MR+RIR TNFKD+DT++YNN+L++PLL+  S+++EDWS  N   NL  D  
Sbjct: 192 ISSALFVLIMRKRIRLTNFKDYDTMFYNNVLALPLLLVFSVIMEDWSANNLSVNLSPDS- 250

Query: 238 TTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGN 297
              +TA++ SG+ + GISY S WCVRVTSSTTYSMVGALNKLP+A  G+ FF  P    +
Sbjct: 251 ---LTAMIISGLMSVGISYCSGWCVRVTSSTTYSMVGALNKLPIALVGLAFFDAPKNFLS 307

Query: 298 VSAIFVGFVAGILY 311
             +IF+GF++G+LY
Sbjct: 308 FFSIFLGFMSGVLY 321



>gi|322700180|gb|EFY91936.1| GDP-mannose transporter [Metarhizium acridum CQMa 102]
          Length = 381

 Score =  299 bits (766), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 154/340 (45%), Positives = 213/340 (62%), Gaps = 22/340 (6%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLV-SFREFD 75
           L ++ YC +SI MTV NKYV+SG  +N+NF  L +Q++VC+  + A K   L+ +   FD
Sbjct: 54  LSVVAYCFSSISMTVVNKYVVSGTFWNLNFFYLAVQAVVCIAAISACKSFGLIRNLAPFD 113

Query: 76  LALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLT 135
              +RKWFPI++LLV MIYT +K+LQ+LS+PVYTIFKNLTII+IAYGEV+WF  S++ L 
Sbjct: 114 QNKARKWFPISLLLVGMIYTSTKALQFLSVPVYTIFKNLTIIVIAYGEVLWFGGSVTPLA 173

Query: 136 MTSFLLMVFXXXXXXXXXXXXXXX--------XXXXXTFDIGYLWMAFNCISSAAFVLTM 187
           + SF LMV                             T + GY WM  N   +A++VL M
Sbjct: 174 LLSFGLMVLSSVVAAWADIQSAIAGDFGHADSSVAMSTLNAGYAWMGLNVFCTASYVLGM 233

Query: 188 RRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFS 247
           R+ I+  NFKD+D           +L   SL+ EDWS  NF KN P++ R  +I  +++S
Sbjct: 234 RKVIKKMNFKDWD-----------ILFICSLLAEDWSGTNFAKNFPDESRNRIIIGMVYS 282

Query: 248 GISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVA 307
           G++A  ISY SAWC+RVTSSTTYSMVGALNKLP+A SG++FF  P+T G+VSAI +GFV+
Sbjct: 283 GLAAIFISYCSAWCIRVTSSTTYSMVGALNKLPIAISGLVFFAAPVTFGSVSAIVIGFVS 342

Query: 308 GILYSIAKTEQQKPIKPSVYIPISNKELPQTTTNDNNTTE 347
           GI+Y+ A+  Q    K S  +P S   +  ++ +  +   
Sbjct: 343 GIVYAWARVRQSNGSKDS--LPTSRPPMSASSQSSRDAAN 380



>gi|346326199|gb|EGX95795.1| GDP-mannose transporter [Cordyceps militaris CM01]
          Length = 352

 Score =  299 bits (765), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 152/323 (47%), Positives = 211/323 (65%), Gaps = 10/323 (3%)

Query: 19  ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLAL 78
           IL YC ASI MT  NKY+ SG  +N+ F  L +QS+VC+  +   K L +      D A 
Sbjct: 26  ILAYCVASISMTAVNKYIFSGGSWNLTFFCLTVQSVVCLAAVVLGKHLGMHEPARADQA- 84

Query: 79  SRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTS 138
               FP+++LLV MIY+G+KSLQYLS+PVYTIFKNLTI++IAYGE ++F  S+SRL ++S
Sbjct: 85  PHAGFPLSILLVGMIYSGAKSLQYLSVPVYTIFKNLTIVVIAYGENVFFGTSVSRLILSS 144

Query: 139 FLLMVFXXXXXXXXXXXXXXXXXXXX-------TFDIGYLWMAFNCISSAAFVLTMRRRI 191
           F LMV                                GY+WMA N   ++AF++  R+ +
Sbjct: 145 FGLMVLSSVIAAWADIQAALGGLHSVDAAAATAQLTAGYIWMAINVFCTSAFLIGSRKVM 204

Query: 192 RSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISA 251
           ++ NF D DT++YNNLLSIP+L+  S+ +EDWS +N  +N P + RT LI ++L+SG+  
Sbjct: 205 KAYNFSDVDTMFYNNLLSIPVLILASVFLEDWSRENVARNFPPETRTVLIISMLYSGLGT 264

Query: 252 FGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILY 311
             ISYT+AWC+RVTSSTTYSMVGALNKLP+A +G +FFG P+T G+VSA+ + FV+GI+Y
Sbjct: 265 IFISYTTAWCIRVTSSTTYSMVGALNKLPLAVTGFLFFGAPVTLGSVSAVLIAFVSGIVY 324

Query: 312 SIAKTEQQKPIKPSVYIPISNKE 334
           + AK  Q +  K  + +P +N  
Sbjct: 325 AWAKVVQSE--KAKLTLPTANSA 345



>gi|302308751|ref|NP_985783.2| AFR236Cp [Ashbya gossypii ATCC 10895]
 gi|442570187|sp|Q753T9.2|GMT_ASHGO RecName: Full=GDP-mannose transporter; Short=GMT
 gi|299790777|gb|AAS53607.2| AFR236Cp [Ashbya gossypii ATCC 10895]
 gi|374109014|gb|AEY97920.1| FAFR236Cp [Ashbya gossypii FDAG1]
          Length = 329

 Score =  298 bits (763), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 154/318 (48%), Positives = 211/318 (66%), Gaps = 10/318 (3%)

Query: 8   LAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLN 67
           L+ ++ +G + IL YCA+SILMTVTNK V+    FNM F++L  QS+VCV  L   K L 
Sbjct: 11  LSHIANSGPMSILAYCASSILMTVTNKCVVGSDKFNMLFVMLFAQSLVCVTALVLLKALG 70

Query: 68  LVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWF 127
            V +R  +    + W  I++LLV M YT S++L+YL++P+YTIFKNLTIILIAYGEV++F
Sbjct: 71  YVQYRPLNKVDVKNWLLISVLLVLMTYTSSRALKYLAVPIYTIFKNLTIILIAYGEVLFF 130

Query: 128 DCSISRLTMTSFLLMVFXXXXXXX------XXXXXXXXXXXXXTFDIGYLWMAFNCISSA 181
              ++ + ++SFLL+V                             ++GY WM  NCI SA
Sbjct: 131 GGRVTAMELSSFLLIVLSSVVATLGDQQALAKKPLAAAVESILGLNVGYFWMFTNCICSA 190

Query: 182 AFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLI 241
            FVL MR+RI  T FKDFDT++YNN+LS+PLLM  S M EDW   N  +NL +D     I
Sbjct: 191 LFVLIMRKRIALTKFKDFDTMFYNNILSLPLLMLASFMFEDWGAANIARNLTKD----YI 246

Query: 242 TAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAI 301
             ++ SG+++ GISY S WCVRVTSSTTYSMVGALNKLP+A SG++FF  P    ++ +I
Sbjct: 247 IIMIISGLASVGISYCSGWCVRVTSSTTYSMVGALNKLPIALSGLLFFDAPKNFLSIFSI 306

Query: 302 FVGFVAGILYSIAKTEQQ 319
           F+GF++GI+Y++AK ++Q
Sbjct: 307 FLGFLSGIVYAVAKQKKQ 324



>gi|119487698|ref|XP_001262580.1| hypothetical protein NFIA_031160 [Neosartorya fischeri NRRL 181]
 gi|189041358|sp|A1DA52.1|GMT2_NEOFI RecName: Full=GDP-mannose transporter 2; Short=GMT 2
 gi|119410737|gb|EAW20683.1| conserved hypothetical protein [Neosartorya fischeri NRRL 181]
          Length = 357

 Score =  297 bits (761), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 148/314 (47%), Positives = 210/314 (66%), Gaps = 11/314 (3%)

Query: 14  TGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLV-SFR 72
           + +  +L YC +SI MT+ NKYV+SG  +N++FL L +QS +  V + A K   L+ +  
Sbjct: 41  SASAAVLAYCLSSISMTLVNKYVVSGASWNLSFLYLAMQSFIGTVAILACKKTGLIQNLA 100

Query: 73  EFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSIS 132
            FDL  ++ W PI++LLV MIYTG+K+LQ+LS+PVYTIFKNLTII+IAYGEV+     + 
Sbjct: 101 LFDLKKAQTWLPISLLLVGMIYTGNKALQFLSVPVYTIFKNLTIIVIAYGEVLMVGGGVK 160

Query: 133 RLTMTSFLLMVFXXXXXXXXXXXXXXXXXXXXTFD----------IGYLWMAFNCISSAA 182
            L + SF LMV                     + D           GY WM  N I SA+
Sbjct: 161 PLALLSFGLMVLSSVVAAWADIQNATTATVGASSDSTAAALSALNAGYAWMGTNVIFSAS 220

Query: 183 FVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLIT 242
           + L MRR I+ TNF ++D ++YNNLLSIP+L+  S++ EDWS +N ++N P ++R +L  
Sbjct: 221 YALGMRRVIKKTNFDNWDVMFYNNLLSIPILLLASVLAEDWSSENLQRNFPAELRQSLFI 280

Query: 243 AILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIF 302
            IL+SG++A  ISY +AWCVR TSSTTY+MVGALNKLP+A +G++FF  P+T G+VSAI 
Sbjct: 281 GILYSGVAAVFISYCTAWCVRATSSTTYAMVGALNKLPLAVAGIVFFAAPVTFGSVSAIV 340

Query: 303 VGFVAGILYSIAKT 316
           +GF++G++Y+ AK+
Sbjct: 341 LGFISGLVYARAKS 354



>gi|451993077|gb|EMD85552.1| hypothetical protein COCHEDRAFT_1118569 [Bipolaris maydis C5]
          Length = 364

 Score =  296 bits (758), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 153/329 (46%), Positives = 217/329 (65%), Gaps = 20/329 (6%)

Query: 19  ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVC---VVLLRAFKML-NLVSFREF 74
           +L YC +SI MTV NKYV+SG  +N+NFL L IQ+++C   +++L+   M+ NLV+  E 
Sbjct: 42  VLAYCFSSISMTVVNKYVVSGSSWNLNFLYLAIQAVICTAAILVLKQMGMIPNLVAV-ES 100

Query: 75  DLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRL 134
           D A  +KW P+++  V MIYT +K+LQ+LS+PVYTIFKNLTI++IAYGEV+WF   ++ L
Sbjct: 101 DKA--KKWLPVSLFFVGMIYTSTKALQFLSVPVYTIFKNLTIVVIAYGEVLWFGGKVTPL 158

Query: 135 TMTSFLLMVFXXXXXX----------XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFV 184
            + SF LMV                               T + GY+WM  N I SA++V
Sbjct: 159 LLLSFGLMVLSSIIAAWADIQVVLHGGAGDKTQTADDAMSTLNAGYIWMGLNIICSASYV 218

Query: 185 LTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAI 244
           L  R+ I S  FKD+DT+YYNNLLS+P+L+  S + ED+S  N  +N P + RT L+  +
Sbjct: 219 LGTRKYITSLQFKDWDTMYYNNLLSLPILLACSFITEDYSSANLSRNFPVETRTNLVIGM 278

Query: 245 LFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVG 304
           ++SG+ A  ISY+SAWC+R TSSTTYS VG LNKLP+A SG++FFG P+T G+V+AI +G
Sbjct: 279 IYSGLGAIFISYSSAWCIRKTSSTTYSFVGYLNKLPLAISGIVFFGAPVTFGSVTAILLG 338

Query: 305 FVAGILYSIAKTEQQKPIKPSVYIPISNK 333
           F +G++Y   K + +K  +P+  +P S K
Sbjct: 339 FFSGLVYGYGKVQMKKE-QPT--LPTSQK 364



>gi|403213992|emb|CCK68493.1| hypothetical protein KNAG_0B00440 [Kazachstania naganishii CBS
           8797]
          Length = 336

 Score =  296 bits (758), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 156/314 (49%), Positives = 220/314 (70%), Gaps = 13/314 (4%)

Query: 9   AFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNL 68
           A ++ +G + IL+YC +SILMTVTNK+V++  +FNMNF++L +QS+VC +LL   ++L  
Sbjct: 14  ASVANSGPISILSYCGSSILMTVTNKFVVNLENFNMNFVMLFVQSLVCTLLLVVLRLLGY 73

Query: 69  VSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFD 128
             FR  +   ++ WFPI++LLV MIYT SK+LQ+L++P+YTIFKNLTIILIAYGEV++F 
Sbjct: 74  AKFRSLNKTDAKNWFPISVLLVLMIYTSSKALQFLAVPIYTIFKNLTIILIAYGEVLYFG 133

Query: 129 CSISRLTMTSFLLMVFXXXXXX---------XXXXXXXXXXXXXXTFDIGYLWMAFNCIS 179
            S++ + ++SFLLMV                                + GY WM  NCIS
Sbjct: 134 GSVTSMELSSFLLMVLSSVVATWGDQQAIASKAASSAVGSTAGESMLNPGYFWMFTNCIS 193

Query: 180 SAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTT 239
           SA FVL MR+RI+ TNFKDFDT++YNN+L++P+L+  S  VEDWS  N   NL +D    
Sbjct: 194 SAMFVLIMRKRIKLTNFKDFDTMFYNNVLALPILLVASFCVEDWSSANLATNLAKDS--- 250

Query: 240 LITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVS 299
            +TA++ SG+++ GISY S WCVRVTSSTTYSMVGALNKLP+A SG++FF  P    ++ 
Sbjct: 251 -VTAMVISGMASVGISYCSGWCVRVTSSTTYSMVGALNKLPIALSGLVFFDAPRNFLSIF 309

Query: 300 AIFVGFVAGILYSI 313
           +IF+GF++G++Y++
Sbjct: 310 SIFLGFLSGLIYAV 323



>gi|189041381|sp|Q5AQY2.2|GMT2_EMENI RecName: Full=GDP-mannose transporter 2; Short=GMT 2
          Length = 357

 Score =  296 bits (757), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 149/317 (47%), Positives = 209/317 (65%), Gaps = 11/317 (3%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLV- 69
           +S      +L YC +SI MT+ NKYV+SG  +N++FL L IQS +  V +   K   L+ 
Sbjct: 38  ISNNAAAAVLAYCLSSISMTLVNKYVVSGASWNLSFLYLAIQSFIGTVAIMVCKKAGLIQ 97

Query: 70  SFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDC 129
           +   FDL  ++ W PI++LLV MIYTG+K+LQ+LS+PVYTIFKNLTII+IAYGEV     
Sbjct: 98  NLGLFDLKKAQTWLPISLLLVGMIYTGNKALQFLSVPVYTIFKNLTIIVIAYGEVFMVGG 157

Query: 130 SISRLTMTSFLLMVFXXXXXXXXXXXXXXXXXXXXTFD----------IGYLWMAFNCIS 179
           S+  L + SF LMV                     + D           GY WM  N + 
Sbjct: 158 SVKPLALLSFGLMVLSSVVAAWADIQIATAATAKASSDSAVATLSALNAGYAWMGTNVVF 217

Query: 180 SAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTT 239
           SA++ L MRR I+ TNF ++D ++YNNLLS+P+L+  SL+VEDWS +N ++N P + R +
Sbjct: 218 SASYALGMRRVIKKTNFDNWDVMFYNNLLSVPILLLSSLLVEDWSSENLQRNFPAESRQS 277

Query: 240 LITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVS 299
           L+  I +SG++A  ISY +AWCVR TSSTTY+MVGALNKLP+A +G++FF  P+T G+VS
Sbjct: 278 LVIGIFYSGVAAIFISYCTAWCVRATSSTTYAMVGALNKLPLAVAGIVFFAAPVTFGSVS 337

Query: 300 AIFVGFVAGILYSIAKT 316
           AI +GF++G++Y+ AK+
Sbjct: 338 AIVLGFISGLVYTWAKS 354



>gi|512205257|gb|EPE34079.1| Multidrug resistance efflux transporter EmrE [Glarea lozoyensis
           ATCC 20868]
          Length = 371

 Score =  295 bits (756), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 155/325 (47%), Positives = 209/325 (64%), Gaps = 29/325 (8%)

Query: 5   PTILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFK 64
           P  ++ ++ +  L IL YC ASI MTVTNKY +SG ++N+NF  LGIQ  V   L    +
Sbjct: 41  PPAMSNIANSPPLSILAYCLASISMTVTNKYCVSGANWNLNFFYLGIQ--VGPPLQAPLR 98

Query: 65  MLNLVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEV 124
                             FPI++LLV MIYT +K+LQ+LS+PVYTIFKNLTII+ AYGEV
Sbjct: 99  ------------------FPISLLLVGMIYTSTKALQFLSVPVYTIFKNLTIIVTAYGEV 140

Query: 125 IWFDCSISRLTMTSFLLMVFXXXXXX---------XXXXXXXXXXXXXXTFDIGYLWMAF 175
           +WF  S++   + SF LMV                              T + GY+WM  
Sbjct: 141 LWFGGSVTPSALFSFGLMVLSSVVAAWADIQHALYGGGAKSVDAADALSTLNAGYMWMGM 200

Query: 176 NCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPED 235
           N   +A ++L+MR+ I+  NFKD+DT++YNNLL+IP+L   SL+ E+WS KN EKN P +
Sbjct: 201 NVFCTATYLLSMRKVIKKMNFKDWDTMFYNNLLTIPVLFLCSLIFENWSSKNIEKNFPLE 260

Query: 236 IRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITT 295
            R TLI+ +++SG++   ISY SAWC+RVTSSTTYSMVGALNKLP+A SG++FF  P+T 
Sbjct: 261 TRNTLISGMIYSGLATIFISYCSAWCIRVTSSTTYSMVGALNKLPLAVSGLVFFAAPVTF 320

Query: 296 GNVSAIFVGFVAGILYSIAKTEQQK 320
           G+VSAI +GFV+GI+Y+ AK  Q +
Sbjct: 321 GSVSAIIIGFVSGIVYTWAKVRQSQ 345



>gi|451846228|gb|EMD59538.1| hypothetical protein COCSADRAFT_72504, partial [Bipolaris
           sorokiniana ND90Pr]
          Length = 336

 Score =  295 bits (755), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 149/323 (46%), Positives = 207/323 (64%), Gaps = 19/323 (5%)

Query: 19  ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKML----NLVSFREF 74
           +L YC +SI MTV NKYV+SG  +N+NFL L IQ+I+C   +   K +    NLV+    
Sbjct: 15  VLAYCFSSISMTVVNKYVVSGSSWNLNFLYLAIQAIICTAAILILKQMGTIPNLVAVES- 73

Query: 75  DLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRL 134
               ++KW P+++  V MIYT +K+LQ+LS+PVYTIFKNLTI++IAYGEV+WF   ++ L
Sbjct: 74  --GKAKKWLPVSLFFVGMIYTSTKALQFLSVPVYTIFKNLTIVVIAYGEVLWFGGKVTPL 131

Query: 135 TMTSFLLMVFXXXXXXXXXXXXXXXXX----------XXXTFDIGYLWMAFNCISSAAFV 184
            + SF LMV                               T + GY+WM  N I SA++V
Sbjct: 132 LLLSFGLMVLSSIIAAWADIQVVLHGGVGDKTQTADDAMSTLNAGYIWMGLNIICSASYV 191

Query: 185 LTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAI 244
           L  R+ I S  FKD+DT+YYNNLLS+P+L+  S + ED+S  N  +N P + RT LI  +
Sbjct: 192 LGTRKYITSLQFKDWDTMYYNNLLSLPILLACSFITEDYSSANLSRNFPVETRTNLIVGM 251

Query: 245 LFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVG 304
           ++SG+ A  ISY+SAWC+R TSSTTYS VG LNKLP+A SG++FFG P+T G+V+AI +G
Sbjct: 252 IYSGLGAIFISYSSAWCIRKTSSTTYSFVGYLNKLPLAISGIVFFGAPVTFGSVTAILLG 311

Query: 305 FVAGILYSIAKTEQQK--PIKPS 325
           F +G++Y   K + +K  P  P+
Sbjct: 312 FFSGLVYGYGKVQMKKEQPTLPT 334



>gi|477582891|gb|ENH99994.1| hypothetical protein COCC4DRAFT_111302, partial [Bipolaris maydis
           ATCC 48331]
          Length = 336

 Score =  295 bits (755), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 151/323 (46%), Positives = 213/323 (65%), Gaps = 19/323 (5%)

Query: 19  ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVC---VVLLRAFKML-NLVSFREF 74
           +L YC +SI MTV NKYV+SG  +N+NFL L IQ+++C   +++L+   M+ NLV+  E 
Sbjct: 15  VLAYCFSSISMTVVNKYVVSGSSWNLNFLYLAIQAVICTAAILVLKQMGMIPNLVAV-ES 73

Query: 75  DLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRL 134
           D A  +KW P+++  V MIYT +K+LQ+LS+PVYTIFKNLTI++IAYGEV+WF   ++ L
Sbjct: 74  DKA--KKWLPVSLFFVGMIYTSTKALQFLSVPVYTIFKNLTIVVIAYGEVLWFGGKVTPL 131

Query: 135 TMTSFLLMVFXXXXXXXXXXXXXXXXXX----------XXTFDIGYLWMAFNCISSAAFV 184
            + SF LMV                               T + GY+WM  N I SA++V
Sbjct: 132 LLLSFGLMVLSSIIAAWADIQVVLHGGAGDKTQTADDAMSTLNAGYIWMGLNIICSASYV 191

Query: 185 LTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAI 244
           L  R+ I S  FKD+DT+YYNNLLS+P+L+  S + ED+S  N  +N P + RT L+  +
Sbjct: 192 LGTRKYITSLQFKDWDTMYYNNLLSLPILLACSFITEDYSSANLSRNFPVETRTNLVIGM 251

Query: 245 LFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVG 304
           ++SG+ A  ISY+SAWC+R TSSTTYS VG LNKLP+A SG++FFG P+T G+V+AI +G
Sbjct: 252 IYSGLGAIFISYSSAWCIRKTSSTTYSFVGYLNKLPLAISGIVFFGAPVTFGSVTAILLG 311

Query: 305 FVAGILYSIAKTEQQK--PIKPS 325
           F +G++Y   K + +K  P  P+
Sbjct: 312 FFSGLVYGYGKVQMKKEQPTLPT 334



>gi|240277314|gb|EER40823.1| golgi GDP-mannose transporter [Ajellomyces capsulatus H143]
          Length = 329

 Score =  295 bits (754), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 146/270 (54%), Positives = 196/270 (72%), Gaps = 9/270 (3%)

Query: 79  SRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTS 138
           ++KWFPI++LL+ MIYTG+K+LQ+LSIPVYTIFKNLTIILIAYGEV+WF  S++ + + S
Sbjct: 55  AKKWFPISLLLIGMIYTGTKALQFLSIPVYTIFKNLTIILIAYGEVLWFGGSVTGMVLFS 114

Query: 139 FLLMVFXXXXXX------XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRIR 192
           F LMV                           T + GY+WM  NC+ +A++VL MR+RI+
Sbjct: 115 FGLMVLSSIIAAWADINHALSQVGMDATSKISTLNAGYVWMLINCLCTASYVLGMRKRIK 174

Query: 193 STNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAF 252
            TNFKDFDT++YNNLLSIP+++  SL+VEDWS +N   N P + R+ +I A++FSG+S+ 
Sbjct: 175 LTNFKDFDTMFYNNLLSIPIILVASLVVEDWSSENINLNFPPETRSRIIMAMVFSGLSSV 234

Query: 253 GISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYS 312
            ISYTSAWCVRVTSSTTYSMVGALNKLP+A SG+IFF  P+T  +VSAIFVGFV+G++Y+
Sbjct: 235 FISYTSAWCVRVTSSTTYSMVGALNKLPIALSGLIFFDAPVTFPSVSAIFVGFVSGLVYA 294

Query: 313 IAKTEQQKPIKPSVYI-PISNKELPQTTTN 341
           +AK  Q    KP + + P SN  +  ++ +
Sbjct: 295 MAKVRQNS--KPRIGVLPTSNPPMSASSQS 322



>gi|149247926|ref|XP_001528350.1| GDP-mannose transporter [Lodderomyces elongisporus NRRL YB-4239]
 gi|146448304|gb|EDK42692.1| GDP-mannose transporter [Lodderomyces elongisporus NRRL YB-4239]
          Length = 247

 Score =  295 bits (754), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 144/237 (60%), Positives = 176/237 (74%)

Query: 84  PIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTSFLLMV 143
           PI +LLV MIYTGSK+LQYLSIPVYTIFKNLTIILIAYGEV+WF   ++ +T++SFLLMV
Sbjct: 2   PIVILLVGMIYTGSKALQYLSIPVYTIFKNLTIILIAYGEVLWFGGKVTPMTLSSFLLMV 61

Query: 144 FXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVY 203
           F                    T  +GY WM  NC SSA+FVL MR+RI+ TNFKDFDTV+
Sbjct: 62  FSSIIAYWGDNAEVKTSDDQFTMYLGYFWMIINCFSSASFVLIMRKRIKLTNFKDFDTVF 121

Query: 204 YNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFGISYTSAWCVR 263
           YNNLLS+P+L+ ++   EDWS  N E+N P + RT +I A++ SG S   ISY SAWCVR
Sbjct: 122 YNNLLSVPILLILTFGFEDWSAANLERNFPPESRTAVIVAMVLSGASTIAISYCSAWCVR 181

Query: 264 VTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSIAKTEQQK 320
           VTSSTTYSMVGALNKLP+A SG+IFF   +   +VS+IFVGFVAG++YS+AK +Q K
Sbjct: 182 VTSSTTYSMVGALNKLPIALSGLIFFEAAVNFWSVSSIFVGFVAGLVYSVAKQKQAK 238



>gi|471570065|gb|EMR69288.1| putative gdp-mannose transporter protein [Eutypa lata UCREL1]
          Length = 392

 Score =  294 bits (752), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 146/350 (41%), Positives = 217/350 (62%), Gaps = 11/350 (3%)

Query: 6   TILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKM 65
           ++L+ L       +L YC +SI MTV NKYV+SG  +N+NFL L IQ+++C   +   K 
Sbjct: 43  SVLSQLENNPGASVLAYCFSSISMTVVNKYVVSGSSWNLNFLYLAIQAVICTAAILVLKQ 102

Query: 66  LNLV-SFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEV 124
           +  + +    +   ++KW P+++  V MIYT +KSLQ+LS+PVYTIFKNLTII+IAYGEV
Sbjct: 103 MGFIPNLAALESRKAKKWLPVSVFFVGMIYTSTKSLQFLSVPVYTIFKNLTIIVIAYGEV 162

Query: 125 IWFDCSISRLTMTSFLLMVFXXXXXXXX--------XXXXXXXXXXXXTFDIGYLWMAFN 176
           +WF  +++ L + SF  M                              T + GY WM  N
Sbjct: 163 LWFGGNVTPLLLLSFGCMALSSVVAAWADIQAALNGVGHSVETATAISTLNAGYAWMGLN 222

Query: 177 CISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDI 236
            + +A++VL  R+ I S +FKD+DT+YYNNL+S+P+++  SL+ EDWS  N  KN P + 
Sbjct: 223 VVCTASYVLGTRKFITSLHFKDWDTMYYNNLISLPIMIICSLVTEDWSSANLAKNFPAES 282

Query: 237 RTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTG 296
           R  L+  +L+SG+ A  ISY+SAWC+R TSSTTYS VG LNKLP+A SG+IFF  P+T G
Sbjct: 283 RNNLMIGMLYSGLGAIFISYSSAWCIRKTSSTTYSFVGYLNKLPLAVSGIIFFDAPVTFG 342

Query: 297 NVSAIFVGFVAGILYSIAKTEQQKPIKPSVYIPISNKELPQTTTNDNNTT 346
           +V+AI +GF +G++Y   K +Q++  K    +P S   +  ++ +  + +
Sbjct: 343 SVTAILLGFFSGLVYGYGKMKQREQSKQ--VLPFSQPAMSASSQSQKDAS 390



>gi|482814538|gb|EOA91213.1| hypothetical protein SETTUDRAFT_132654 [Setosphaeria turcica Et28A]
          Length = 382

 Score =  294 bits (752), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 149/346 (43%), Positives = 213/346 (61%), Gaps = 17/346 (4%)

Query: 1   MAQPPTILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVC---- 56
           +A    + A L  +    +L YC +SI MTV NKYV+SG  +N+NF  L IQ+ +C    
Sbjct: 37  IADGGGLFAQLENSSGAAVLAYCFSSISMTVVNKYVVSGSSWNLNFFYLAIQAAICTAAI 96

Query: 57  VVLLRAFKMLNLVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTI 116
           +VL R   + NL +        ++KW P+++  V MIYT +K+LQ+LS+PVYTIFKNLTI
Sbjct: 97  LVLQRTGTISNLAALES---GKAKKWLPVSIFFVGMIYTSTKALQFLSVPVYTIFKNLTI 153

Query: 117 ILIAYGEVIWFDCSISRLTMTSFLLMVFXX--------XXXXXXXXXXXXXXXXXXTFDI 168
           ++IAYGEV+WF   ++ L + SF LMV                             T + 
Sbjct: 154 VVIAYGEVLWFGGKVTPLLLLSFGLMVLSSIVAAWADIQAAMGGGSQTSEKAAAISTLNA 213

Query: 169 GYLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNF 228
           GY WM  N + +A++VL  R  I S  FKD+DT+YYNNLLS+P+++  SL+ EDWS  N 
Sbjct: 214 GYAWMGLNIVCTASYVLGTRNFITSLKFKDWDTMYYNNLLSLPIMLLCSLVTEDWSSTNL 273

Query: 229 EKNLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIF 288
            KN P++ RT L   +++SG+ A  ISY+SAWC+R TSSTTYS VG LNKLP+A SG++F
Sbjct: 274 AKNFPKETRTNLFIGMIYSGLGAIFISYSSAWCIRKTSSTTYSFVGYLNKLPLAISGIVF 333

Query: 289 FGDPITTGNVSAIFVGFVAGILYSIAKTEQQKPI--KPSVYIPISN 332
           FG P+T G+++AIF+GF +G++Y   K   ++    K    +P++ 
Sbjct: 334 FGAPVTFGSITAIFLGFFSGLVYGYGKVRMKEAATKKEGGLLPVAQ 379



>gi|156848294|ref|XP_001647029.1| hypothetical protein Kpol_1050p28 [Vanderwaltozyma polyspora DSM
           70294]
 gi|189041359|sp|A7TES5.1|GMT2_VANPO RecName: Full=GDP-mannose transporter 2; Short=GMT 2
 gi|156117712|gb|EDO19171.1| hypothetical protein Kpol_1050p28 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 332

 Score =  294 bits (752), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 161/321 (50%), Positives = 217/321 (67%), Gaps = 16/321 (4%)

Query: 14  TGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFRE 73
           +G++ IL YCA+SILMT+TNK V+S   FNMNFLLL IQS+VCV+ L   K+L  V+FR 
Sbjct: 16  SGSVAILAYCASSILMTITNKVVMSDRTFNMNFLLLFIQSLVCVITLLVLKVLGSVNFRS 75

Query: 74  FDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISR 133
           F+   +R WFPI++ LV MI+T SKSLQYLS+PVYTIFKNLTII+IAYGEV++F  S+  
Sbjct: 76  FNKTDARNWFPISICLVLMIFTSSKSLQYLSVPVYTIFKNLTIIVIAYGEVLFFGSSVGN 135

Query: 134 LTMTSFLLMVFXXXXXXXXXXXXXXXXXXXX---------TFDIGYLWMAFNCISSAAFV 184
           + + SF LM+                                +IGY W+A NC +SA FV
Sbjct: 136 MELGSFALMIVSSLIAAHGDYLHSVERLKKMLGPNVSFSFIVNIGYFWIAANCFASALFV 195

Query: 185 LTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAI 244
           L MR+RI+ TNFKDFDT++YNN+LS+PLL+  S + EDWS++N   ++  D  +T+I   
Sbjct: 196 LLMRKRIQVTNFKDFDTMFYNNVLSLPLLLLGSYLFEDWSQENLLPHVDIDNLSTMI--- 252

Query: 245 LFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVG 304
             SG+++  ISY S WCVRVTSSTTYSMVGALNKLP+A +G +F        + ++I +G
Sbjct: 253 -ISGLASVAISYCSGWCVRVTSSTTYSMVGALNKLPIALTGFLFNDAARNLSSAASILLG 311

Query: 305 FVAGILYSIAKTEQQKPIKPS 325
           F +GI+Y++AK   QK ++ S
Sbjct: 312 FASGIIYAVAK---QKKLQNS 329



>gi|14010202|gb|AAK51897.1|AF360395_1 GDP-mannose transporter [Candida glabrata]
          Length = 324

 Score =  293 bits (750), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 146/311 (46%), Positives = 211/311 (67%), Gaps = 7/311 (2%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS 70
           ++ +G + IL YCA+SILMTVTNK+V++   FNM F++L  QS+VC + L   KM     
Sbjct: 14  IANSGPVSILCYCASSILMTVTNKFVVNTDGFNMFFVMLFAQSLVCTMCLMVLKMFGYAK 73

Query: 71  FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCS 130
           +R  +L   + W PI+ LLV MI+T +K+L+Y+ +P+YTIFKNLTIILIAYGEV++F  S
Sbjct: 74  YRPLNLIDVKNWLPISFLLVFMIFTSAKALKYMPVPIYTIFKNLTIILIAYGEVLFFGGS 133

Query: 131 ISRLTMTSFLLMVFXXXXXXXXXXXXXXXXXXXXTFDI---GYLWMAFNCISSAAFVLTM 187
           ++ + ++SF+LMV                        I    Y WM  NCI SA+FVL M
Sbjct: 134 VTPMELSSFILMVLSSVVASLGDQQAAKIAQPLANNSILSPEYYWMFLNCICSASFVLIM 193

Query: 188 RRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFS 247
           R+RI+ TNFKD+DT++YNN L++P+L+  S + EDWS +N  +N   +     ++A++ S
Sbjct: 194 RKRIKLTNFKDYDTMFYNNALALPILLGFSFLSEDWSSENLAQNFSGES----LSAMIIS 249

Query: 248 GISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVA 307
           G+++ GISY S WCVR TSSTTYSMVGALNKLP+A +G+IFF  P    ++ +IF+GF +
Sbjct: 250 GMTSVGISYCSGWCVRATSSTTYSMVGALNKLPIALAGLIFFDAPRNFLSIMSIFIGFAS 309

Query: 308 GILYSIAKTEQ 318
           G+LY++AK ++
Sbjct: 310 GLLYAVAKQKK 320



>gi|315054153|ref|XP_003176451.1| GDP-mannose transporter [Arthroderma gypseum CBS 118893]
 gi|311338297|gb|EFQ97499.1| GDP-mannose transporter [Arthroderma gypseum CBS 118893]
          Length = 383

 Score =  293 bits (749), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 155/360 (43%), Positives = 222/360 (61%), Gaps = 24/360 (6%)

Query: 7   ILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVC----VVLLRA 62
           +LA L       +L YC +SI MTV NKYV+SG  +N+NFL L IQS++C    +VL ++
Sbjct: 36  VLAQLENNPGAAVLAYCFSSISMTVVNKYVVSGSSWNLNFLYLAIQSVLCTAAILVLKQS 95

Query: 63  FKMLNLVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYG 122
             + NLV+     +   +KW P+++  V+MIYT +KSLQ+LS+PVYTIFKNLTII+IAYG
Sbjct: 96  GFIPNLVALESTKV---KKWLPVSVFFVSMIYTSTKSLQFLSVPVYTIFKNLTIIVIAYG 152

Query: 123 EVIWFDCSISRLTMTSFLLMVFXXXXXXXXXXXXXX--------XXXXXXTFDIGYLWMA 174
           EV+WF  +++ + M SF  MV                             T + GY WM 
Sbjct: 153 EVLWFGGTVTPMIMLSFGCMVLSSVVAAWADIQAAVNGIGHSGEAAAAISTLNAGYAWMG 212

Query: 175 FNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPE 234
            N I +A +VL  R+ I S NFKD+DT+ YNNL+S+P+++  SL+ EDWS  N  KN P 
Sbjct: 213 LNVICTALYVLGTRKFITSLNFKDWDTMLYNNLISLPIMVICSLVAEDWSSANLAKNFPA 272

Query: 235 DIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPIT 294
           + R  ++  + +SG+ A  ISY+SAWC+R TSSTTYS VG LNKLP+A SG++FFG P+T
Sbjct: 273 ESRNNILIGMFYSGLGAIFISYSSAWCIRKTSSTTYSFVGYLNKLPLAISGIVFFGAPVT 332

Query: 295 TGNVSAIFVGFVAGILYSIAKTEQQKPIKPSVYIPISNKELPQTTTNDNNTTEIQSNLLN 354
            G VSAI +GF +G++Y   K +Q++ +         ++ LP T    + +++ Q +  N
Sbjct: 333 FGGVSAILLGFFSGLIYGYGKMKQKEQM---------SQVLPTTRPTMSASSQSQKDASN 383



>gi|50289535|ref|XP_447199.1| hypothetical protein [Candida glabrata CBS 138]
 gi|74609726|sp|Q6FRE5.1|GMT_CANGA RecName: Full=GDP-mannose transporter; Short=GMT
 gi|49526508|emb|CAG60132.1| unnamed protein product [Candida glabrata]
          Length = 324

 Score =  291 bits (744), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 145/311 (46%), Positives = 210/311 (67%), Gaps = 7/311 (2%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS 70
           ++ +G + IL YCA+SILMTVTNK+V++   FNM F++L  QS+VC + L   KM     
Sbjct: 14  IANSGPVSILCYCASSILMTVTNKFVVNTDGFNMFFVMLFAQSLVCTMCLMVLKMFGYAK 73

Query: 71  FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCS 130
           +R  +L   + W PI+ LLV MI+T +K+L+Y+ +P+YTIFKNLTIILIAYGEV++F  S
Sbjct: 74  YRPLNLIDVKNWLPISFLLVFMIFTSAKALKYMPVPIYTIFKNLTIILIAYGEVLFFGGS 133

Query: 131 ISRLTMTSFLLMVFXXXXXXXXXXXXXXXXXXXXTFDI---GYLWMAFNCISSAAFVLTM 187
           ++ + ++SF+LMV                        I    Y WM  NCI SA+FVL M
Sbjct: 134 VTPMELSSFILMVLSSVVASLGDQQAAKIAQPLANNSILSPEYYWMFLNCICSASFVLIM 193

Query: 188 RRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFS 247
           R+RI+ TNFKD+DT++YNN L++P+L+  S + EDWS +N  +N   +     ++A++ S
Sbjct: 194 RKRIKLTNFKDYDTMFYNNALALPILLGFSFLSEDWSSENLAQNFSGES----LSAMIIS 249

Query: 248 GISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVA 307
           G+++ GISY S WCVR TSSTTYSMVGALNKLP+A +G+IFF  P    ++ +IF+GF +
Sbjct: 250 GMTSVGISYCSGWCVRATSSTTYSMVGALNKLPIALAGLIFFDAPRNFLSIMSIFIGFAS 309

Query: 308 GILYSIAKTEQ 318
           G+ Y++AK ++
Sbjct: 310 GLSYAVAKQKK 320



>gi|327308646|ref|XP_003239014.1| GDP-mannose transporter [Trichophyton rubrum CBS 118892]
 gi|326459270|gb|EGD84723.1| GDP-mannose transporter [Trichophyton rubrum CBS 118892]
          Length = 383

 Score =  290 bits (743), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 153/351 (43%), Positives = 218/351 (62%), Gaps = 18/351 (5%)

Query: 7   ILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVC----VVLLRA 62
           IL+ L  +    +L YC +SI MTV NKYV+SG  +N+NFL L IQS++C    +VL +A
Sbjct: 36  ILSRLENSPGAAVLAYCFSSISMTVVNKYVVSGSSWNLNFLYLAIQSVLCTAAILVLKQA 95

Query: 63  FKMLNLVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYG 122
             + NLV+     +   +KW P+++  V+MIYT  K+LQ+LS+PVYTIFKNLTI++IAYG
Sbjct: 96  GFVPNLVALESTKV---KKWLPVSVFFVSMIYTSIKALQFLSVPVYTIFKNLTIVVIAYG 152

Query: 123 EVIWFDCSISRLTMTSFLLMVFXXXXXXXXXXXXXX--------XXXXXXTFDIGYLWMA 174
           EV+WF  +++ L M SF  MV                             T + GY WM 
Sbjct: 153 EVLWFGGNVTPLIMLSFGCMVLSSIVAAWADIQAAVNGFGHSGETAAAISTLNAGYAWMG 212

Query: 175 FNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPE 234
            N + +A +VL  R+ I S NFKD+DT+ YNNL+S+P+++  SL+ EDWS  N  KN P 
Sbjct: 213 LNVVCTALYVLGTRKFITSLNFKDWDTMLYNNLISLPIMVICSLVTEDWSSANLAKNFPA 272

Query: 235 DIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPIT 294
           + R  ++  +L+SG+ A  ISY+SAWC+R TSSTTYS VG LNKLP+A SG++FF  P+T
Sbjct: 273 ESRNNILIGMLYSGLGAIFISYSSAWCIRKTSSTTYSFVGYLNKLPLAISGLVFFDTPVT 332

Query: 295 TGNVSAIFVGFVAGILYSIAKTEQQK---PIKPSVYIPISNKELPQTTTND 342
            G VSAI +GF +G++Y   K +Q++    + P+   P+S     Q   ++
Sbjct: 333 FGGVSAILLGFFSGLIYGYGKMKQKEMTSQVLPTTRPPMSASSQSQKDASN 383



>gi|365984104|ref|XP_003668885.1| hypothetical protein NDAI_0B06100 [Naumovozyma dairenensis CBS 421]
 gi|343767652|emb|CCD23642.1| hypothetical protein NDAI_0B06100 [Naumovozyma dairenensis CBS 421]
          Length = 390

 Score =  289 bits (740), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 156/347 (44%), Positives = 219/347 (63%), Gaps = 38/347 (10%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS 70
           ++ +G + IL+YCA+SILMT+TNK+V++  +FNMNF++L +QS VC + L   K  N+ +
Sbjct: 21  IANSGPISILSYCASSILMTMTNKFVVNLPNFNMNFIMLLVQSFVCTLTLIILKKFNITN 80

Query: 71  FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCS 130
           FR  +   +  W PI+ LLV MI+T SKSLQ+L +P+YTIFKNLTIILIAYGEV++F   
Sbjct: 81  FRPLNKKDTLNWLPISFLLVIMIFTSSKSLQFLPVPIYTIFKNLTIILIAYGEVLFFGGK 140

Query: 131 ISRLTMTSFLLMVFXXXXXX-----------------XXXXXXXXXXXXXXTFDI----- 168
           ++   ++SF+LMV                                      T +I     
Sbjct: 141 VTLWELSSFILMVLSSIVATMGDNQALKQATALSIANSTAQLNHQGNKKTTTEEIELSNI 200

Query: 169 ----------GYLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSL 218
                     GYLWM  NCISSA FVL MR++I+ T FKD+DT++YNN+L++P+L+  S 
Sbjct: 201 TIWTTIMGNPGYLWMFINCISSALFVLIMRKKIKQTKFKDYDTMFYNNILALPILLIFSY 260

Query: 219 MVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNK 278
           +VEDWS  N + NL  D     +  ++ SG+++ GISY S WCVRVTSSTTYSMVGALNK
Sbjct: 261 IVEDWSHDNLKLNLNNDS----VIPMIISGLASVGISYCSGWCVRVTSSTTYSMVGALNK 316

Query: 279 LPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSIAKTEQQKPIKPS 325
           LP+A  G++FF  P    ++ +IF+GF++G+LY+ AK  Q+K I  S
Sbjct: 317 LPIALFGLLFFDAPRNFLSIFSIFLGFLSGLLYAFAK--QRKNISTS 361



>gi|326477831|gb|EGE01841.1| GDP-mannose transporter [Trichophyton equinum CBS 127.97]
          Length = 383

 Score =  288 bits (737), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 153/360 (42%), Positives = 223/360 (61%), Gaps = 24/360 (6%)

Query: 7   ILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVC----VVLLRA 62
           IL+ L  +    +L YC +SI MTV NKYV+SG  +N+NFL L IQS++C    +VL +A
Sbjct: 36  ILSQLENSPGAAVLAYCFSSISMTVVNKYVVSGSSWNLNFLYLAIQSVLCTAAILVLKQA 95

Query: 63  FKMLNLVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYG 122
             + NL +     +   +KW P+++  V+MIYT +K+LQ+LS+PVYTIFKNLTI++IAYG
Sbjct: 96  GFIPNLAALESTKV---KKWLPVSVFFVSMIYTSTKALQFLSVPVYTIFKNLTIVVIAYG 152

Query: 123 EVIWFDCSISRLTMTSFLLMVFXXXXXXXXXXXXXX--------XXXXXXTFDIGYLWMA 174
           EV+WF  +++ L M SF  MV                             T + GY WM 
Sbjct: 153 EVLWFGGNVTPLIMLSFGCMVLSSIVAAWADIQAAVNGFGHSGETAAAISTLNAGYAWMG 212

Query: 175 FNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPE 234
            N I +A +VL  R+ I S +FKD+DT+ YNNL+S+P+++  SL+ EDWS  N  KN P 
Sbjct: 213 LNVICTALYVLGTRKFITSLSFKDWDTMLYNNLISLPIMVICSLVTEDWSSANLAKNFPA 272

Query: 235 DIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPIT 294
           + R  ++  +L+SG+ A  ISY+SAWC+R TSSTTYS VG LNKLP+A SG++FF  P+T
Sbjct: 273 ESRNNILIGMLYSGLGAIFISYSSAWCIRKTSSTTYSFVGYLNKLPLAISGLVFFDTPVT 332

Query: 295 TGNVSAIFVGFVAGILYSIAKTEQQKPIKPSVYIPISNKELPQTTTNDNNTTEIQSNLLN 354
            G VSAI +GF +G++Y   K +Q++         ++++ LP T    + +++ Q +  N
Sbjct: 333 FGGVSAILLGFFSGLIYGYGKMKQKE---------MASQVLPTTRPTMSASSQSQKDASN 383



>gi|513033402|gb|AGO13374.1| AaceriAFR236Cp [Saccharomycetaceae sp. 'Ashbya aceri']
          Length = 329

 Score =  287 bits (734), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 156/318 (49%), Positives = 215/318 (67%), Gaps = 10/318 (3%)

Query: 8   LAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLN 67
           L+ ++ +G + IL YCA+SILMTVTNK+V+    FNM F++L  QS+VCV  L   K L 
Sbjct: 11  LSHIANSGPVSILAYCASSILMTVTNKFVVGSDGFNMLFVMLFAQSLVCVTALVLLKALG 70

Query: 68  LVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWF 127
            V +R  +    + W PI++LLV M YT S++L+YL++P+YTIFKNLTIILIAYGEV++F
Sbjct: 71  YVRYRPLNKVDVKNWLPISVLLVLMTYTSSRALKYLAVPIYTIFKNLTIILIAYGEVLFF 130

Query: 128 DCSISRLTMTSFLLMVFXXXXXXX------XXXXXXXXXXXXXTFDIGYLWMAFNCISSA 181
              ++ + ++SFLL+V                             ++GY WM  NCI SA
Sbjct: 131 GGRVTAMELSSFLLIVLSSVVATLGDQQALAKKPLAAAAESILGLNVGYFWMFTNCICSA 190

Query: 182 AFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLI 241
            FVL MR+RI  T FKDFDT++YNN+LS+PLLM  SL+ EDW  +N  +NL +D     I
Sbjct: 191 LFVLIMRKRIALTKFKDFDTMFYNNILSLPLLMLASLLFEDWGAENVGRNLTKD----YI 246

Query: 242 TAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAI 301
             ++ SG+++ GISY S WCVRVTSSTTYSMVGALNKLP+A SG+IFF  P    ++ +I
Sbjct: 247 VVMIISGLASVGISYCSGWCVRVTSSTTYSMVGALNKLPIALSGLIFFDAPKNFLSIFSI 306

Query: 302 FVGFVAGILYSIAKTEQQ 319
           F+GF++GI+Y++AK ++Q
Sbjct: 307 FLGFLSGIVYAVAKQKKQ 324



>gi|365761037|gb|EHN02713.1| Vrg4p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 352

 Score =  286 bits (732), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 147/295 (49%), Positives = 200/295 (67%), Gaps = 17/295 (5%)

Query: 11  LSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS 70
           L+ +G + IL+YCA+SILMTVTNK+V++  +FNMNF++L +QS+VC + L   +++ +  
Sbjct: 12  LANSGPISILSYCASSILMTVTNKFVVNLKNFNMNFVMLFVQSLVCTLALCVLRVVKVAK 71

Query: 71  FREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCS 130
           FR  +    + WFPI++LLV M YT SKSLQYL++P+YTIFKNLTIILIAYGEV++F   
Sbjct: 72  FRSLNKTDVKNWFPISLLLVLMTYTSSKSLQYLAVPIYTIFKNLTIILIAYGEVLFFGGC 131

Query: 131 ISRLTMTSFLLMVFXXXXXXXXXXXXXXXX-------------XXXXTFDIGYLWMAFNC 177
           ++ + ++SF++MV                                    + GYLWM  NC
Sbjct: 132 VTSMELSSFIMMVLSSVVATWGDQRAIATKISPLGDLDQDLVESTIFLLNPGYLWMFTNC 191

Query: 178 ISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIR 237
           ISSA FVL MR+RIR TNFKD+DT++YNN+L++PLL+  S+++EDWS  N   NL  D  
Sbjct: 192 ISSALFVLIMRKRIRLTNFKDYDTMFYNNVLALPLLLVFSVIMEDWSANNLSVNLSPDS- 250

Query: 238 TTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDP 292
              +TA++ SG+ + GISY S WCVRVTSSTTYSMVGALNKLP+A  G+ FF  P
Sbjct: 251 ---LTAMIISGLMSVGISYCSGWCVRVTSSTTYSMVGALNKLPIALVGLAFFDAP 302



>gi|326474841|gb|EGD98850.1| GDP-mannose transporter [Trichophyton tonsurans CBS 112818]
          Length = 383

 Score =  285 bits (729), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 149/357 (41%), Positives = 217/357 (60%), Gaps = 18/357 (5%)

Query: 7   ILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKML 66
           IL+ L  +    +L YC +SI MTV NKYV+SG  +N+NFL L IQS++C   +   K  
Sbjct: 36  ILSQLENSPGAAVLAYCFSSISMTVVNKYVVSGSSWNLNFLYLAIQSVLCTAAILVLKQA 95

Query: 67  NLV-SFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVI 125
             + +    +    +KW P+++  V+MIYT  K+LQ+LS+PVYTIFKNLTI++IAYGEV+
Sbjct: 96  GFIPNLAALESTKVKKWLPVSVFFVSMIYTSIKALQFLSVPVYTIFKNLTIVVIAYGEVL 155

Query: 126 WFDCSISRLTMTSFLLMVFXXXXXXXXXXXXXX--------XXXXXXTFDIGYLWMAFNC 177
           WF  +++ L M SF  MV                             T + GY WM  N 
Sbjct: 156 WFGGNVTPLIMLSFGCMVLSSIVAAWADIQAAVNGFGHSGETAAAISTLNAGYAWMGLNV 215

Query: 178 ISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIR 237
           I +A +VL  R+ I S +FKD+DT+ YNNL+S+P+++  SL+ EDWS  N  KN P + R
Sbjct: 216 ICTALYVLGTRKFITSLSFKDWDTMLYNNLISLPIMVICSLVTEDWSSANLAKNFPAESR 275

Query: 238 TTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGN 297
             ++  +L+SG+ A  ISY+SAWC+R TSSTTYS VG LNKLP+A SG++FF  P+T G 
Sbjct: 276 NNILIGMLYSGLGAIFISYSSAWCIRKTSSTTYSFVGYLNKLPLAISGLVFFDTPVTFGV 335

Query: 298 VSAIFVGFVAGILYSIAKTEQQKPIKPSVYIPISNKELPQTTTNDNNTTEIQSNLLN 354
           VSAI +GF +G++Y   K +Q++         ++++ LP T    + +++ Q +  N
Sbjct: 336 VSAILLGFFSGLIYGYGKMKQKE---------MASQVLPTTRPTMSASSQSQKDASN 383



>gi|366994912|ref|XP_003677220.1| hypothetical protein NCAS_0F03830 [Naumovozyma castellii CBS 4309]
 gi|342303088|emb|CCC70867.1| hypothetical protein NCAS_0F03830 [Naumovozyma castellii CBS 4309]
          Length = 357

 Score =  281 bits (719), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 151/341 (44%), Positives = 212/341 (62%), Gaps = 28/341 (8%)

Query: 3   QPPTILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRA 62
           QP +    +  +    IL+YCA+SILMT+TNK+V++   FNM F++L +QS+VC + L  
Sbjct: 9   QPWSFQTHMVNSAPASILSYCASSILMTMTNKFVVNLPYFNMTFVMLFVQSMVCTLTLVI 68

Query: 63  FKMLNLVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYG 122
            K   +  FR  +   +  W PI+ LLV MIYT SK+LQ+L++P+YTIFKNLTIILIAYG
Sbjct: 69  LKFFGVAKFRNLNKKDTLNWLPISFLLVLMIYTSSKALQFLAVPIYTIFKNLTIILIAYG 128

Query: 123 EVIWFDCSISRLTMTSFLLMVFXXXXX---------XXXXXXXXXXXXXXXTFDI----- 168
           EV++F  S++ + ++SF LMV                              T D      
Sbjct: 129 EVLFFGGSVTLMELSSFFLMVLSSVVATLGDNQALRAKAITMAELAASTNSTDDTIPTEL 188

Query: 169 ----------GYLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSL 218
                     GYLWM  NCI+ A FVL MR+RI+ST+FKD+DT++YNN+L+ P+L+  S 
Sbjct: 189 GVISGIIGNPGYLWMFTNCITCALFVLIMRKRIKSTSFKDYDTMFYNNVLASPILLIFSF 248

Query: 219 MVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNK 278
           ++EDWS  N   NL  +     ++A++ SG+++ GISY S WCVRVTSSTTYSMVGALNK
Sbjct: 249 LMEDWSRSNVHINLGGNS----LSAMIISGLASVGISYCSGWCVRVTSSTTYSMVGALNK 304

Query: 279 LPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSIAKTEQQ 319
           LP+A  G+IFF  P    ++ +I +GF +G+LY+ AK  + 
Sbjct: 305 LPIAVFGLIFFDAPRNFLSIFSILLGFASGLLYAFAKQRKS 345



>gi|171685696|ref|XP_001907789.1| hypothetical protein [Podospora anserina S mat+]
 gi|170942809|emb|CAP68462.1| unnamed protein product [Podospora anserina S mat+]
          Length = 389

 Score =  277 bits (709), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 152/351 (43%), Positives = 215/351 (61%), Gaps = 13/351 (3%)

Query: 3   QPPTILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRA 62
           Q P +L  L  +    IL YC ASI MTV NKYV+SG ++N+NF  L IQS VC + + A
Sbjct: 37  QEPGLLDKLDHSPGASILAYCLASISMTVVNKYVVSGSEWNLNFFYLAIQSAVCTLAILA 96

Query: 63  FKMLN-LVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAY 121
           FK    L +   FD   ++KWFPI++LLV MIYTG+K+LQ+LS+PVYTIFKNLTII+IAY
Sbjct: 97  FKQTGILKNLAPFDSTKAKKWFPISLLLVGMIYTGAKALQFLSVPVYTIFKNLTIIVIAY 156

Query: 122 GEVIWFDCSISRLTMTSFLLMVFXXXXXXXXXXXXXX--------XXXXXXTFDIGYLWM 173
           GEV+WF  S++ +T+ SF LMV                             T + GY WM
Sbjct: 157 GEVLWFGGSVTPITLLSFGLMVLSSVVAAWADIQAAIDGVGISPDKQDALSTLNAGYAWM 216

Query: 174 AFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLL--SIPLLMTMSLMVEDWSEKNFEKN 231
             N I ++A+VL MR+ I+  NFKD+D+ +   L       L   S +++          
Sbjct: 217 GINVICTSAYVLGMRKVIKKMNFKDYDSKFLARLRRSKYSRLTPNSHVLQQPPYHPRLGC 276

Query: 232 LPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGD 291
           L    +  L+  +++SG++A  ISY S+WC+R+TSSTTYSMVGALNKLP+A SG+IFF  
Sbjct: 277 LLPATKNKLMIGMVYSGLAAIFISYCSSWCIRITSSTTYSMVGALNKLPIAVSGLIFFDA 336

Query: 292 PITTGNVSAIFVGFVAGILYSIAKTEQQKPIKPSVYIPISNKELPQTTTND 342
           P+T G+V+AIF+GFV+G++++ AK  Q+   + ++ +P +N      +  D
Sbjct: 337 PVTFGSVTAIFLGFVSGLVFAWAKVRQKA--QEALSLPTTNMSASAKSNRD 385



>gi|328770349|gb|EGF80391.1| hypothetical protein BATDEDRAFT_19571 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 355

 Score =  271 bits (694), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 161/373 (43%), Positives = 218/373 (58%), Gaps = 45/373 (12%)

Query: 7   ILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKML 66
           IL+    T  L IL+YC ASILMTVTNK VLS YDF +NFLLL IQSI+ V LL     L
Sbjct: 3   ILSGTHHTAPLAILSYCFASILMTVTNKLVLSSYDFKLNFLLLAIQSIITVALLEISVGL 62

Query: 67  NLVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGE-VI 125
            L++ R F  + ++ WF +++ LV MIYTGSKSLQ+LSIPV+TIFKNLTII+ AY E +I
Sbjct: 63  GLLTHRPFRTSEAKNWFIVSLSLVLMIYTGSKSLQFLSIPVFTIFKNLTIIITAYAERII 122

Query: 126 WFDCSISRLTMTSFLLMVFXXXXXX-XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFV 184
               +++ L + SF L+V                         + Y WM  NCI++ +F 
Sbjct: 123 LKGAAVTHLMLVSFSLIVASSIIAGWADITAGHLLKDNQANIVVAYGWMFSNCIATCSFT 182

Query: 185 LTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRT------ 238
           L M+ +++++ FKDFDTV+YNNLLSIP L+ MS++ E          +PE +R       
Sbjct: 183 LFMKGKLKASGFKDFDTVFYNNLLSIPTLLIMSIINE----------MPEALRLYDRYYG 232

Query: 239 -----------TLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMI 287
                       L   IL S +SAFGISY+++WCVRVTSSTTYSM GALNKLP+A +GMI
Sbjct: 233 STSDLYSSEFYGLSIGILVSSVSAFGISYSTSWCVRVTSSTTYSMAGALNKLPIAVAGMI 292

Query: 288 FFGDPITTGNVSAIFVGFVAGILYSIAKTEQQKPIKPSVYIPISNKELPQTTTNDNNTTE 347
           FF   +   ++  +   F  GI+YS+AK +Q             + EL  T  + + T  
Sbjct: 293 FFDAVVNFASIMGVLFAFTGGIVYSLAKMQQ-------------SAELSSTLKDTSVTLP 339

Query: 348 IQSNLLNNDDDHR 360
           +  +L   D+D+R
Sbjct: 340 LHKSL---DEDYR 349



>gi|367050542|ref|XP_003655650.1| hypothetical protein THITE_2119575 [Thielavia terrestris NRRL 8126]
 gi|347002914|gb|AEO69314.1| hypothetical protein THITE_2119575 [Thielavia terrestris NRRL 8126]
          Length = 264

 Score =  263 bits (671), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 126/260 (48%), Positives = 178/260 (68%), Gaps = 10/260 (3%)

Query: 92  MIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTSFLLMVFXXXXXXX 151
           MIYTG+K+LQ+LS+PVYTIFKNLTII+IAYGEV+WF  S++ LT+ SF L+V        
Sbjct: 1   MIYTGTKALQFLSVPVYTIFKNLTIIVIAYGEVLWFGGSVTPLTLLSFGLIVLSSVVAAW 60

Query: 152 X--------XXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVY 203
                                T + GY WM  N + ++ ++L MR+ I+  NFKD+DT++
Sbjct: 61  ADIQAAIDGVGHSLETSAALSTLNAGYAWMGLNVVCTSTYLLGMRKVIKKMNFKDYDTMF 120

Query: 204 YNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFGISYTSAWCVR 263
           YNNLLSIP+L+  SL+VEDWS +N  +N PE+ R  L+  +++SG++A  ISY+ AWC+R
Sbjct: 121 YNNLLSIPILVVCSLLVEDWSGENLARNFPEESRNKLVIGMIYSGLAAIFISYSQAWCIR 180

Query: 264 VTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSIAKTEQQKPIK 323
           VTSSTTYSMVGALNKLP+A SG+IFF  PIT G+VSAI +GF++G++++ AK  Q+   +
Sbjct: 181 VTSSTTYSMVGALNKLPIAVSGLIFFDAPITFGSVSAILLGFISGLVFAWAKVRQKA--Q 238

Query: 324 PSVYIPISNKELPQTTTNDN 343
            +  +P +NK +   +   N
Sbjct: 239 AANVLPTTNKPMMSASAQSN 258



>gi|67904622|ref|XP_682567.1| hypothetical protein AN9298.2 [Aspergillus nidulans FGSC A4]
 gi|40747209|gb|EAA66365.1| hypothetical protein AN9298.2 [Aspergillus nidulans FGSC A4]
 gi|259488132|tpe|CBF87355.1| TPA: GDP-mannose transporter 2 (GMT 2)
           [Source:UniProtKB/Swiss-Prot;Acc:Q5AQY2] [Aspergillus
           nidulans FGSC A4]
          Length = 270

 Score =  258 bits (658), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 125/253 (49%), Positives = 173/253 (68%), Gaps = 10/253 (3%)

Query: 74  FDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISR 133
           FDL  ++ W PI++LLV MIYTG+K+LQ+LS+PVYTIFKNLTII+IAYGEV     S+  
Sbjct: 15  FDLKKAQTWLPISLLLVGMIYTGNKALQFLSVPVYTIFKNLTIIVIAYGEVFMVGGSVKP 74

Query: 134 LTMTSFLLMVFXXXXXXXXXXXXXXXXXXXXTFD----------IGYLWMAFNCISSAAF 183
           L + SF LMV                     + D           GY WM  N + SA++
Sbjct: 75  LALLSFGLMVLSSVVAAWADIQIATAATAKASSDSAVATLSALNAGYAWMGTNVVFSASY 134

Query: 184 VLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITA 243
            L MRR I+ TNF ++D ++YNNLLS+P+L+  SL+VEDWS +N ++N P + R +L+  
Sbjct: 135 ALGMRRVIKKTNFDNWDVMFYNNLLSVPILLLSSLLVEDWSSENLQRNFPAESRQSLVIG 194

Query: 244 ILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFV 303
           I +SG++A  ISY +AWCVR TSSTTY+MVGALNKLP+A +G++FF  P+T G+VSAI +
Sbjct: 195 IFYSGVAAIFISYCTAWCVRATSSTTYAMVGALNKLPLAVAGIVFFAAPVTFGSVSAIVL 254

Query: 304 GFVAGILYSIAKT 316
           GF++G++Y+ AK+
Sbjct: 255 GFISGLVYTWAKS 267



>gi|46111433|ref|XP_382774.1| hypothetical protein FG02598.1 [Fusarium graminearum PH-1]
          Length = 367

 Score =  255 bits (651), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 143/320 (44%), Positives = 190/320 (59%), Gaps = 30/320 (9%)

Query: 8   LAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLN 67
           L  L  +  L I  YC +SI MTV NKY   G+   +        SI C +        +
Sbjct: 44  LEQLEKSPPLSIAAYCLSSISMTVVNKY---GHWRKL--------SIGCCLYWHN----H 88

Query: 68  LVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWF 127
           LV     D          +  +       +KSLQ+LS+PVYTIFKNLTII+IAYGEV+WF
Sbjct: 89  LVQAAGHDQGSRSFRRRSSKEI-------TKSLQFLSVPVYTIFKNLTIIVIAYGEVLWF 141

Query: 128 DCSISRLTMTSFLLMVFXXXXXXXXXXXXXX--------XXXXXXTFDIGYLWMAFNCIS 179
             S++ L + SF LMV                             T + GY WM  N   
Sbjct: 142 GGSVTPLALLSFGLMVLSSIVAAWADIQSAINGDFGTGDSAAAVSTLNAGYAWMGMNVFC 201

Query: 180 SAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTT 239
           SAA+VL MR+ I+  NFKD+DT+YYNNLL+IP+L+  SL+ EDWS  NF +N P+D R  
Sbjct: 202 SAAYVLGMRKVIKKMNFKDWDTMYYNNLLTIPVLVICSLLTEDWSAYNFSRNFPDDTRNK 261

Query: 240 LITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVS 299
           +I  +++SG++A  ISY SAWC+RVTSSTTYSMVGALNKLP+A SG+IFF  P+T G+VS
Sbjct: 262 IIIGMIYSGLAAIFISYCSAWCIRVTSSTTYSMVGALNKLPIAISGLIFFSAPVTFGSVS 321

Query: 300 AIFVGFVAGILYSIAKTEQQ 319
           AIF+GF++G++Y+ ++  Q 
Sbjct: 322 AIFIGFISGLVYAWSRVRQS 341



>gi|380473296|emb|CCF46359.1| GDP-mannose transporter [Colletotrichum higginsianum]
          Length = 261

 Score =  254 bits (650), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 124/243 (51%), Positives = 168/243 (69%), Gaps = 8/243 (3%)

Query: 92  MIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTSFLLMVFXXXXXXX 151
           MIYTG+K+LQ+LS+PVYTIFKNLTII+IAYGEV+WF  ++S L + SF LMV        
Sbjct: 1   MIYTGTKALQFLSVPVYTIFKNLTIIVIAYGEVLWFGGNVSPLALLSFGLMVLSSVVAAW 60

Query: 152 XXXXXX--------XXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVY 203
                                T + GY WM  N   +AA++L+MR+ I+  NFKD+DT++
Sbjct: 61  ADVAHALGGGFQTAEASAAVSTLNAGYAWMGMNVCCTAAYLLSMRKVIKKMNFKDWDTMF 120

Query: 204 YNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFGISYTSAWCVR 263
           YNNLL+IP+L+  +L+ EDWS  N +KN P + R +L   +++SG+ A  ISY SAWC+R
Sbjct: 121 YNNLLTIPVLIVCTLVAEDWSSANIQKNFPVETRNSLFIGMIYSGLCAVFISYCSAWCIR 180

Query: 264 VTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSIAKTEQQKPIK 323
           VTSSTTYS+VGALNKLP+A SG++FF  P+T G+VSAI +GFV+GI+Y+ AK  Q +  K
Sbjct: 181 VTSSTTYSVVGALNKLPIALSGLVFFDAPVTFGSVSAIVIGFVSGIVYAWAKIRQTEASK 240

Query: 324 PSV 326
            S+
Sbjct: 241 MSL 243



>gi|429858012|gb|ELA32848.1| gdp-mannose transporter [Colletotrichum gloeosporioides Nara gc5]
          Length = 319

 Score =  251 bits (640), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 125/264 (47%), Positives = 174/264 (65%), Gaps = 8/264 (3%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLV-SFREFD 75
           L I+ YC +SI MTV NKYV+SG  +N+ F  L +Q+IV    +   K L ++ +    +
Sbjct: 54  LSIVAYCLSSISMTVVNKYVVSGSSWNLTFFYLAVQAIVSTTAIIFAKRLRMIRNLAPIN 113

Query: 76  LALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLT 135
              +++WFPI++LLV+MIYTG+K+LQ+LS+PVYTIFKNLT I+IAYGEV+ F   ++ L 
Sbjct: 114 YTKAKQWFPISLLLVSMIYTGNKALQFLSVPVYTIFKNLTTIVIAYGEVLLFGGKVTPLA 173

Query: 136 MTSFLLMV-------FXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMR 188
             SF LMV       +                      D+GY WM  N + SAA++L+MR
Sbjct: 174 FLSFCLMVLSSIVAAWADIQSAANASLSKGVSSLSSNLDVGYTWMGINIVCSAAYLLSMR 233

Query: 189 RRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSG 248
           R I+  NF D+DT++YNNLL+IP+L++ SLMVEDWS  N  KN P+  R ++I  +++SG
Sbjct: 234 RIIKKMNFSDWDTMFYNNLLTIPVLLSCSLMVEDWSAANLAKNFPDSSRHSIIAGMIYSG 293

Query: 249 ISAFGISYTSAWCVRVTSSTTYSM 272
           + A  ISY+SAWC+RVTSSTTYSM
Sbjct: 294 LGAITISYSSAWCIRVTSSTTYSM 317



>gi|154284155|ref|XP_001542873.1| predicted protein [Ajellomyces capsulatus NAm1]
 gi|150411053|gb|EDN06441.1| predicted protein [Ajellomyces capsulatus NAm1]
          Length = 289

 Score =  248 bits (632), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 118/224 (52%), Positives = 161/224 (71%), Gaps = 6/224 (2%)

Query: 14  TGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFRE 73
           +  LP+  YC +SILMTVTNKYVLSG  FN+NFLLL +QS+VCV  ++  K L ++++R+
Sbjct: 43  SSALPVFCYCCSSILMTVTNKYVLSGTSFNLNFLLLCVQSLVCVAAIQTCKSLKIITYRD 102

Query: 74  FDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISR 133
           F++  ++KWFPI++LL+ MIYTG+K+LQ+LSIPVYTIFKNLTIILIAYGEV+WF  S++ 
Sbjct: 103 FNIDEAKKWFPISLLLIGMIYTGTKALQFLSIPVYTIFKNLTIILIAYGEVLWFGGSVTG 162

Query: 134 LTMTSFLLMVFXXXXXX------XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTM 187
           + + SF LMV                           T + GY+WM  NC+ +A++VL M
Sbjct: 163 MVLFSFGLMVLSSIIAAWADINHALSQVGMDATSKISTLNAGYVWMLINCLCTASYVLGM 222

Query: 188 RRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKN 231
           R+RI+ TNFKDFDT++YNNLLSIP+++  SL+VEDWS +N   N
Sbjct: 223 RKRIKLTNFKDFDTMFYNNLLSIPIILVASLVVEDWSSENINLN 266



>gi|323333923|gb|EGA75312.1| Hvg1p [Saccharomyces cerevisiae AWRI796]
          Length = 247

 Score =  242 bits (617), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 124/251 (49%), Positives = 166/251 (66%), Gaps = 17/251 (6%)

Query: 92  MIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTSFLLMVFXXXXXXX 151
           MIYT SKSLQYL++P+YTIFKNLTIILIAYGEV++F   ++ + +TSF++MV        
Sbjct: 1   MIYTSSKSLQYLAVPIYTIFKNLTIILIAYGEVLFFGGKVTSMELTSFIMMVLSSVVATW 60

Query: 152 XXXXXXXXXXXXX-------------TFDIGYLWMAFNCISSAAFVLTMRRRIRSTNFKD 198
                                       + GYLWM  NCISSA FVL MR+RIR TNFKD
Sbjct: 61  GDQQAIAIKASSLEDLDQELVESTIFVLNPGYLWMFTNCISSALFVLIMRKRIRLTNFKD 120

Query: 199 FDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFGISYTS 258
           +DT++YNN+L++PLL+  S ++EDWS KN   NL  D     + A++ SG+ + GISY S
Sbjct: 121 YDTMFYNNVLALPLLLVFSFIMEDWSTKNLSVNLSADS----LAAMVISGLMSVGISYCS 176

Query: 259 AWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSIAKTEQ 318
            WCVRVTSSTTYSMVGALNKLP+A +G++FF  P    +  +IF+GF++G+LY++AK ++
Sbjct: 177 GWCVRVTSSTTYSMVGALNKLPIALAGLVFFDAPKNFLSFFSIFLGFLSGLLYAVAKQKK 236

Query: 319 QKPIKPSVYIP 329
            +  K S   P
Sbjct: 237 IQQAKSSSSYP 247



>gi|470318961|gb|EMR10602.1| hypothetical protein PNEG_01306 [Pneumocystis murina B123]
          Length = 304

 Score =  237 bits (604), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 127/284 (44%), Positives = 185/284 (65%), Gaps = 13/284 (4%)

Query: 48  LLGIQSIVCVVLLRAFKMLNLVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPV 107
           +L IQ ++ + +L  F++  ++S  +F  ++ ++W PI+ L ++MIYT SK+LQ+LSIP+
Sbjct: 1   MLIIQLLISLAILHVFEIFKIISLPKFTFSIVKQWLPISFLFISMIYTSSKALQFLSIPI 60

Query: 108 YTIFKNLTIILIAYGEVIWFDCSISRLTMTSFLLMV---FXXXXXXXXXXXXXXXXXXXX 164
           YTIFKNLTIIL AYGEV +   S+S++T+ SF +M+   F                    
Sbjct: 61  YTIFKNLTIILTAYGEVFFMGGSVSKVTLLSFCMMILSSFMIAWEDLYSLLSRLWFRQSF 120

Query: 165 TFD-----IGYLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLM 219
             D      GYLW+  NCI S+A+VL  R++I+S +F DFD+++Y+NLL IP+L+  +L+
Sbjct: 121 LLDHSFLYYGYLWIIINCICSSAYVLETRKKIKSGHFTDFDSMFYSNLLGIPILIICTLI 180

Query: 220 VEDWSEKNFEKNLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKL 279
           ++DWS +N  +     I    I AIL SGI + G+ YTS WC+RVTSSTTYSM+GALNKL
Sbjct: 181 MDDWSSENIAR---NRINIIPIIAILLSGIFSAGLGYTSLWCIRVTSSTTYSMIGALNKL 237

Query: 280 PVAASGMIFFGDPITTGNVSAIFVGFVAGILYSIAKTEQ--QKP 321
           PV+ +G+IFF  P+T   +SAI +GF +G LY I K+    Q P
Sbjct: 238 PVSITGLIFFHTPVTFSTISAIILGFFSGFLYVIEKSHDIYQYP 281



>gi|6320877|ref|NP_010956.1| Hvg1p [Saccharomyces cerevisiae S288c]
 gi|290463233|sp|B3LS51.1|GMT2_YEAS1 RecName: Full=Probable GDP-mannose transporter 2; Short=GMT 2
 gi|290463234|sp|C7GSI5.1|GMT2_YEAS2 RecName: Full=Probable GDP-mannose transporter 2; Short=GMT 2
 gi|290463235|sp|B5VHH5.1|GMT2_YEAS6 RecName: Full=Probable GDP-mannose transporter 2; Short=GMT 2
 gi|290463237|sp|P0CE11.1|GMT2_YEAST RecName: Full=Probable GDP-mannose transporter 2; Short=GMT 2
 gi|603272|gb|AAB64574.1| Yer039cp [Saccharomyces cerevisiae]
 gi|45270794|gb|AAS56778.1| YER039C [Saccharomyces cerevisiae]
 gi|190405600|gb|EDV08867.1| nucleotide sugar transporter [Saccharomyces cerevisiae RM11-1a]
 gi|207345987|gb|EDZ72621.1| YER039Cp-like protein [Saccharomyces cerevisiae AWRI1631]
 gi|256271128|gb|EEU06221.1| Hvg1p [Saccharomyces cerevisiae JAY291]
 gi|285811664|tpg|DAA07692.1| TPA: Hvg1p [Saccharomyces cerevisiae S288c]
 gi|323337939|gb|EGA79178.1| Hvg1p [Saccharomyces cerevisiae Vin13]
 gi|323355247|gb|EGA87072.1| Hvg1p [Saccharomyces cerevisiae VL3]
          Length = 249

 Score =  235 bits (600), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 120/236 (50%), Positives = 159/236 (67%), Gaps = 17/236 (7%)

Query: 92  MIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTSFLLMVFXXXXXXX 151
           MIYT SKSLQYL++P+YTIFKNLTIILIAYGEV++F   ++ + +TSF++MV        
Sbjct: 1   MIYTSSKSLQYLAVPIYTIFKNLTIILIAYGEVLFFGGKVTSMELTSFIMMVLSSVVATW 60

Query: 152 XXXXXXXXXXXXX-------------TFDIGYLWMAFNCISSAAFVLTMRRRIRSTNFKD 198
                                       + GYLWM  NCISSA FVL MR+RIR TNFKD
Sbjct: 61  GDQQAIAIKASSLEDLDQELVESTIFVLNPGYLWMFTNCISSALFVLIMRKRIRLTNFKD 120

Query: 199 FDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFGISYTS 258
           +DT++YNN+L++PLL+  S ++EDWS KN   NL  D     + A++ SG+ + GISY S
Sbjct: 121 YDTMFYNNVLALPLLLVFSFIMEDWSTKNLSVNLSADS----LAAMVISGLMSVGISYCS 176

Query: 259 AWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSIA 314
            WCVRVTSSTTYSMVGALNKLP+A +G++FF  P    +  +IF+GF++G+LY++A
Sbjct: 177 GWCVRVTSSTTYSMVGALNKLPIALAGLVFFDAPKNFLSFFSIFLGFLSGLLYAVA 232



>gi|302497451|ref|XP_003010726.1| hypothetical protein ARB_03428 [Arthroderma benhamiae CBS 112371]
 gi|291174269|gb|EFE30086.1| hypothetical protein ARB_03428 [Arthroderma benhamiae CBS 112371]
          Length = 262

 Score =  233 bits (595), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 120/271 (44%), Positives = 168/271 (61%), Gaps = 17/271 (6%)

Query: 92  MIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTSFLLMVFXXXXXXX 151
           MIYT  K+LQ+LS+PVYTIFKNLTI++IAYGEV+WF  S++ L M SF  MV        
Sbjct: 1   MIYTSIKALQFLSVPVYTIFKNLTIVVIAYGEVLWFGGSVTPLIMLSFGCMVLSSVVAAW 60

Query: 152 XXXXXXX--------XXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVY 203
                                T + GY WM  N I +A +VL  R+ I S NFKD+DT+ 
Sbjct: 61  ADIQAAVNGFGHSGETAAAISTLNAGYAWMGLNVICTALYVLGTRKFITSLNFKDWDTML 120

Query: 204 YNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFGISYTSAWCVR 263
           YNNL+S+P+++  SL+ EDWS  N  KN P + R  ++  +L+SG+ A  ISY+SAWC+R
Sbjct: 121 YNNLISLPIMIICSLVTEDWSSANLAKNFPAESRNNILIGMLYSGLGAIFISYSSAWCIR 180

Query: 264 VTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSIAKTEQQKPIK 323
            TSSTTYS VG LNKLP+A SG++FF  P+T G VSAI +GF +G++Y   K +Q++   
Sbjct: 181 KTSSTTYSFVGYLNKLPLAISGLVFFDTPVTFGGVSAILLGFFSGLIYGYGKMKQKE--- 237

Query: 324 PSVYIPISNKELPQTTTNDNNTTEIQSNLLN 354
                 ++++ LP T    + +++ Q +  N
Sbjct: 238 ------MASQVLPTTRPTMSASSQSQKDASN 262



>gi|443924622|gb|ELU43618.1| GDP-mannose transporter [Rhizoctonia solani AG-1 IA]
          Length = 589

 Score =  230 bits (586), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 151/357 (42%), Positives = 191/357 (53%), Gaps = 51/357 (14%)

Query: 18  PILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIV---CVVLLRAFKMLNLVSFREF 74
           PIL YC ASILMTVTNK+VLSG  FNMNF  L IQSI    CVVL    K L L++FR+F
Sbjct: 260 PILCYCVASILMTVTNKFVLSGASFNMNFAFLAIQSITGVSCVVLA---KKLGLINFRDF 316

Query: 75  DLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRL 134
           D   ++ WFPI+  LV +IYTGSKSL        +    L  I+ A+ ++          
Sbjct: 317 DKQDAKTWFPISFALVLVIYTGSKSL-------VSSGPQLDAIIAAWSDIT--------- 360

Query: 135 TMTSFLLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVL--------- 185
             T+F                             GYLWM FNCI++A +V          
Sbjct: 361 --TAFQNSFPEYAASPIFQIDPSKAHKNLANTGTGYLWMGFNCITTATYVSMDLDVKLWW 418

Query: 186 -TMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAI 244
            T+ R +   N ++ D VY+   L                 KN + N P   R  L++ +
Sbjct: 419 STVLRYLLGINDEEEDQVYWIQGLGY--------------NKNMDANFPPATRNVLLSLM 464

Query: 245 LFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVG 304
             SG +A  ISYT+AWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDP+   +VSAI +G
Sbjct: 465 AMSGAAAVFISYTTAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPVNFSSVSAITIG 524

Query: 305 FVAGILYSIAKTEQQKPIKPSVYIPISNKELPQTTT-NDNNTTEIQSNLLNNDDDHR 360
           FVAG++Y+IAK  Q K  K +   P S + LP T    D +  EI+   LN ++  R
Sbjct: 525 FVAGVVYAIAKNNQAKAEKKAG--PGSVESLPITNDLADFSLGEIRGAFLNQNNAQR 579



>gi|401626088|gb|EJS44053.1| hvg1p [Saccharomyces arboricola H-6]
          Length = 249

 Score =  218 bits (555), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 121/236 (51%), Positives = 160/236 (67%), Gaps = 17/236 (7%)

Query: 92  MIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTSFLLMVFXXXXXXX 151
           MIYT SKSLQYL++P+YTIFKNLTIILIAYGEV++F   ++ + ++SF++MV        
Sbjct: 1   MIYTSSKSLQYLAVPIYTIFKNLTIILIAYGEVLFFGGKVTSMELSSFVMMVLSSVVATW 60

Query: 152 XXXXXXXXXXX-----------XXTFDI--GYLWMAFNCISSAAFVLTMRRRIRSTNFKD 198
                                   TF +  GYLWM  NCISSA FVL MR+RIR TNFKD
Sbjct: 61  GDQQAIATKTSPLGDLDKELVESTTFILNPGYLWMLANCISSALFVLIMRKRIRLTNFKD 120

Query: 199 FDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFGISYTS 258
           +DT++YNN+L++PLL+  S ++EDWS  N   NL  +     +TA++ SG+ + GISY S
Sbjct: 121 YDTMFYNNILALPLLLLFSFIMEDWSTNNLSVNLCANS----LTAMIISGLMSVGISYCS 176

Query: 259 AWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSIA 314
            WCVRVTSSTTYSMVGALNKLP+A  G++FF  P    +  +IF+GF++GILY++A
Sbjct: 177 GWCVRVTSSTTYSMVGALNKLPIALVGLVFFDAPRNFLSFFSIFLGFLSGILYTVA 232



>gi|443895389|dbj|GAC72735.1| nucleotide-sugar transporter VRG4/SQV-7 [Pseudozyma antarctica
           T-34]
          Length = 469

 Score =  213 bits (542), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 123/156 (78%), Gaps = 1/156 (0%)

Query: 169 GYLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNF 228
           GYLWMA NCI SA +VL MR+RI+ T FKD+DT++YNN LSIP+L+ MS +VEDWS  N 
Sbjct: 283 GYLWMALNCICSATYVLLMRKRIKVTGFKDWDTMFYNNFLSIPVLLVMSFLVEDWSAANL 342

Query: 229 EKNLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIF 288
            KN P+D RT LI+AI+FSG  A  ISYT+AWC+R TSSTTYSMVGALNKLPVA SGM+F
Sbjct: 343 HKNFPDDKRTKLISAIVFSGACAILISYTTAWCIRATSSTTYSMVGALNKLPVALSGMVF 402

Query: 289 FGD-PITTGNVSAIFVGFVAGILYSIAKTEQQKPIK 323
           F D P+T  +VSAI VGF AG++Y++ K +Q +  K
Sbjct: 403 FHDPPVTFSSVSAISVGFFAGLVYAVGKNKQAEAAK 438



 Score =  139 bits (349), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 91/127 (71%)

Query: 18  PILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLA 77
           PIL+YCAASI MTV NK+ +SG  FNMN L+L IQS V V  +   +   L+  R  +  
Sbjct: 77  PILSYCAASITMTVVNKFTVSGAGFNMNLLVLLIQSTVGVTCVMIAERAGLIQLRGLNSR 136

Query: 78  LSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMT 137
               W P++ +LV +I+TGSK+LQYL+I VYTIFKNLTIILIAYGEV+WF   ++R+ ++
Sbjct: 137 DVWNWMPLSTMLVFVIWTGSKALQYLNISVYTIFKNLTIILIAYGEVLWFGGRVTRIVLS 196

Query: 138 SFLLMVF 144
           SFLLMV 
Sbjct: 197 SFLLMVL 203



>gi|470318962|gb|EMR10603.1| hypothetical protein, variant [Pneumocystis murina B123]
          Length = 260

 Score =  208 bits (530), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 116/240 (48%), Positives = 157/240 (65%), Gaps = 13/240 (5%)

Query: 92  MIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTSFLLMV---FXXXX 148
           MIYT SK+LQ+LSIP+YTIFKNLTIIL AYGEV +   S+S++T+ SF +M+   F    
Sbjct: 1   MIYTSSKALQFLSIPIYTIFKNLTIILTAYGEVFFMGGSVSKVTLLSFCMMILSSFMIAW 60

Query: 149 XXXXXXXXXXXXXXXXTFD-----IGYLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVY 203
                             D      GYLW+  NCI S+A+VL  R++I+S +F DFD+++
Sbjct: 61  EDLYSLLSRLWFRQSFLLDHSFLYYGYLWIIINCICSSAYVLETRKKIKSGHFTDFDSMF 120

Query: 204 YNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFGISYTSAWCVR 263
           Y+NLL IP+L+  +L+++DWS +N  +N         I AIL SGI + G+ YTS WC+R
Sbjct: 121 YSNLLGIPILIICTLIMDDWSSENIARNRIN---IIPIIAILLSGIFSAGLGYTSLWCIR 177

Query: 264 VTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSIAKTEQ--QKP 321
           VTSSTTYSM+GALNKLPV+ +G+IFF  P+T   +SAI +GF +G LY I K+    Q P
Sbjct: 178 VTSSTTYSMIGALNKLPVSITGLIFFHTPVTFSTISAIILGFFSGFLYVIEKSHDIYQYP 237



>gi|380485001|emb|CCF39638.1| UDP-galactose transporter [Colletotrichum higginsianum]
          Length = 271

 Score =  208 bits (530), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 103/223 (46%), Positives = 146/223 (65%), Gaps = 9/223 (4%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS-FREFD 75
           + IL YC +SI MTV NKYV+SG  +N+NFL L +QS+VC++ +   K L +++    FD
Sbjct: 48  IAILAYCLSSISMTVVNKYVVSGQFWNLNFLYLAVQSVVCILTITVCKNLGMITNLAPFD 107

Query: 76  LALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLT 135
              ++KWFP+++LLV MIYTG+K+LQ+LS+PVYTIFKNLTII+IAYGEV+WF  ++S L 
Sbjct: 108 TDKAKKWFPVSLLLVGMIYTGTKALQFLSVPVYTIFKNLTIIVIAYGEVLWFGGNVSPLA 167

Query: 136 MTSFLLMVFXXXXXXXXXXXXX--------XXXXXXXTFDIGYLWMAFNCISSAAFVLTM 187
           + SF LMV                             T + GY WM  N   +AA++L+M
Sbjct: 168 LLSFGLMVLSSVVAAWADVAHALGGGFQTAEASAAVSTLNAGYAWMGMNVCCTAAYLLSM 227

Query: 188 RRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEK 230
           R+ I+  NFKD+DT++YNNLL+IP+L+  +L+ E WS  N  +
Sbjct: 228 RKVIKKMNFKDWDTMFYNNLLTIPVLIVCTLVAEXWSSANTHQ 270



>gi|501308296|dbj|GAC97209.1| GDP-mannose transporter [Pseudozyma hubeiensis SY62]
          Length = 471

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 98/151 (64%), Positives = 120/151 (79%), Gaps = 1/151 (0%)

Query: 169 GYLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNF 228
           GYLWMA NCI SA++VL MR+RI+ T FKD+DT++YNN LSIP+L  MS +VEDWS  N 
Sbjct: 284 GYLWMALNCICSASYVLLMRKRIKVTGFKDWDTMFYNNFLSIPVLFLMSFLVEDWSAANL 343

Query: 229 EKNLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIF 288
            KN P+D +T LI+AI+FSG  A  ISYT+AWC+R TSSTTYSMVGALNKLPVA SGM+F
Sbjct: 344 HKNFPDDKQTKLISAIVFSGTCAIMISYTTAWCIRATSSTTYSMVGALNKLPVALSGMVF 403

Query: 289 FGD-PITTGNVSAIFVGFVAGILYSIAKTEQ 318
           F D P+T  +VSAI VGF AG++Y+  K +Q
Sbjct: 404 FHDPPVTLSSVSAISVGFFAGLVYAFGKNKQ 434



 Score =  137 bits (345), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 91/127 (71%)

Query: 18  PILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLA 77
           PIL+YCAASI MTV NK+ +SG  FNMN L+L IQS V V  +   +   L+  R  +  
Sbjct: 78  PILSYCAASITMTVVNKFTVSGAGFNMNLLVLLIQSTVGVACVWIAERAGLIQLRGLNSK 137

Query: 78  LSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMT 137
            +  W P++ +LV +I+TGSK+LQ+L+I VYTIFKNLTIILIAYGEV+WF   ++R+ + 
Sbjct: 138 DAWNWMPLSTMLVFVIWTGSKALQHLNISVYTIFKNLTIILIAYGEVMWFGGRVTRVILC 197

Query: 138 SFLLMVF 144
           SFLLMV 
Sbjct: 198 SFLLMVL 204



>gi|388851616|emb|CCF54806.1| probable VRG4-Golgi GDP-mannose transporter [Ustilago hordei]
          Length = 471

 Score =  207 bits (528), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 121/156 (77%), Gaps = 1/156 (0%)

Query: 169 GYLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNF 228
           GYLWMA NCI SA +VL MR+RI+ T FKD+DT++YNN LSIP+L+ MS +VEDWS  N 
Sbjct: 284 GYLWMALNCICSATYVLLMRKRIKVTGFKDWDTMFYNNFLSIPVLLIMSFLVEDWSSANL 343

Query: 229 EKNLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIF 288
            KN P+D +  L++AI+FSG  A  ISYT+AWC+R TSSTTYSMVGALNKLPVA SGM+F
Sbjct: 344 HKNFPDDRQAKLVSAIVFSGACAILISYTTAWCIRATSSTTYSMVGALNKLPVALSGMVF 403

Query: 289 FGD-PITTGNVSAIFVGFVAGILYSIAKTEQQKPIK 323
           F D P+T  +VSAI VGF AG++Y+  K +Q +  K
Sbjct: 404 FHDPPVTFSSVSAITVGFFAGLVYAFGKNKQAEQAK 439



 Score =  139 bits (351), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 92/131 (70%)

Query: 14  TGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFRE 73
           T   PIL+YCAASI MTV NK+ +SG  FNMN L+L IQS V V  +   +   L+  R 
Sbjct: 74  TALAPILSYCAASITMTVVNKFTVSGAGFNMNLLVLLIQSTVGVTCVVIAERAGLIQLRG 133

Query: 74  FDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISR 133
            +      W P++ +LV +I+TGSK+LQYL+I VYTIFKNLTIILIAYGEV+WF   ++R
Sbjct: 134 LNSRDVWNWMPLSTMLVFVIWTGSKALQYLNISVYTIFKNLTIILIAYGEVMWFGGRVTR 193

Query: 134 LTMTSFLLMVF 144
           + ++SFLLMV 
Sbjct: 194 IVLSSFLLMVL 204



>gi|71005086|ref|XP_757209.1| hypothetical protein UM01062.1 [Ustilago maydis 521]
 gi|74704070|sp|Q4PFQ1.1|GMT_USTMA RecName: Full=GDP-mannose transporter; Short=GMT
 gi|46096571|gb|EAK81804.1| hypothetical protein UM01062.1 [Ustilago maydis 521]
          Length = 471

 Score =  207 bits (527), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 98/156 (62%), Positives = 122/156 (78%), Gaps = 1/156 (0%)

Query: 169 GYLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNF 228
           GY+WMA NCI SA +VL MR+RI+ T FKD+DT++YNN LSIP+L+ MS +VEDWS  N 
Sbjct: 284 GYVWMALNCICSATYVLLMRKRIKVTGFKDWDTMFYNNFLSIPVLLLMSFLVEDWSYANL 343

Query: 229 EKNLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIF 288
            KN P+D +T LI+AI+FSG  A  ISYT+AWC+R TSSTTYSMVGALNKLPVA SGM+F
Sbjct: 344 HKNFPDDKQTKLISAIVFSGACAILISYTTAWCIRATSSTTYSMVGALNKLPVALSGMVF 403

Query: 289 FGD-PITTGNVSAIFVGFVAGILYSIAKTEQQKPIK 323
           F D P+T  +VSAI VGF AG++Y+  K +Q +  K
Sbjct: 404 FHDPPVTFSSVSAIAVGFFAGLVYAFGKNKQAEAAK 439



 Score =  138 bits (347), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 90/127 (70%)

Query: 18  PILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLA 77
           PIL YCAASI MTV NK+ +SG  FNMN L+L IQS V V  +   +   L+  R  +  
Sbjct: 78  PILCYCAASITMTVVNKFTVSGRGFNMNLLVLLIQSTVGVTCVWIAERAGLIQLRGLNAK 137

Query: 78  LSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMT 137
            +  W P++++LV +I+TGSK+LQYL+I VYTIFKNLTIILIAYGEV+WF   ++R+ + 
Sbjct: 138 DAWNWMPLSIMLVFVIWTGSKALQYLNISVYTIFKNLTIILIAYGEVMWFGGRVTRIVLC 197

Query: 138 SFLLMVF 144
           SFL MV 
Sbjct: 198 SFLFMVL 204



>gi|343426886|emb|CBQ70414.1| probable VRG4-Golgi GDP-mannose transporter [Sporisorium reilianum
           SRZ2]
          Length = 467

 Score =  203 bits (516), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 96/156 (61%), Positives = 120/156 (76%), Gaps = 1/156 (0%)

Query: 169 GYLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNF 228
           GYLWMA NCI SA +VL MR+RI+ T FKD+DT++YNNLLSIP+L+ MS +VEDWS  N 
Sbjct: 284 GYLWMALNCICSATYVLLMRKRIKVTGFKDWDTMFYNNLLSIPVLLVMSFLVEDWSAANL 343

Query: 229 EKNLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIF 288
            KN P+D +T LI AI+FSG  A  ISYT+AWC+R TSSTTYSMVGALNK P++ SGM+F
Sbjct: 344 HKNFPDDKQTKLIFAIVFSGTCAILISYTTAWCIRATSSTTYSMVGALNKAPLSLSGMVF 403

Query: 289 FGD-PITTGNVSAIFVGFVAGILYSIAKTEQQKPIK 323
           F D P+   NVSAI + FVAG++Y+  K +Q +  K
Sbjct: 404 FHDPPVNFPNVSAIMLSFVAGLVYAFGKNKQAEADK 439



 Score =  139 bits (351), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 92/127 (72%)

Query: 18  PILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLA 77
           PIL+YCAASI MTV NK+ +SG  FNMN L+L IQS V V  +   +   L+  R  +  
Sbjct: 78  PILSYCAASITMTVVNKFTVSGAGFNMNLLVLLIQSTVGVTCVVIAERAGLIQLRGLNSR 137

Query: 78  LSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMT 137
            +  W P++ +LV +I+TGSK+LQYL+I VYTIFKNLTIILIAYGEV+WF   ++R+ ++
Sbjct: 138 DAWNWMPLSAMLVFVIWTGSKALQYLNISVYTIFKNLTIILIAYGEVMWFGGRVTRIVLS 197

Query: 138 SFLLMVF 144
           SFLLMV 
Sbjct: 198 SFLLMVL 204



>gi|167523407|ref|XP_001746040.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163775311|gb|EDQ88935.1| predicted protein [Monosiga brevicollis MX1]
          Length = 326

 Score =  202 bits (515), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 118/322 (36%), Positives = 184/322 (57%), Gaps = 16/322 (4%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDL 76
           LPIL YCA S+ M  TNK VLS YDF+    LL  QS+V V+ L     +  +    F +
Sbjct: 13  LPILAYCACSMSMIYTNKLVLSVYDFHYAACLLIFQSVVAVLCLWGLSAMKYIDLEPFSM 72

Query: 77  ALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTM 136
             ++KW P+ +    M+YTGSK++  LSIPV T+FKN+T ++IA+G+  +F  +++   +
Sbjct: 73  ETAKKWSPVTIFFGLMLYTGSKTITLLSIPVLTVFKNMTNLVIAFGDWYFFGQTVTPGII 132

Query: 137 TSFLLMVFXXXXXXXXXXXXXXXXXXXXTFDI-GYLWMAFNCISSAAFVLTMRRRIRSTN 195
            SF++M                       F++ GY+WM+FNC+S AA+VL MRR  ++T 
Sbjct: 133 GSFVMMT----------VGSVLVSLYDLEFNLAGYVWMSFNCLSQAAYVLYMRRAKQTTK 182

Query: 196 FKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEK-NLPEDIRTTLITAILFSGISAFGI 254
             ++   +YNNLL   L++  ++     S + FE  N P    T  ++A++FSG+   G+
Sbjct: 183 LSEWGMSFYNNLLCAGLMVLSAVG----SGEIFEAVNYPSLSDTGFLSAMIFSGVIGTGL 238

Query: 255 SYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSIA 314
           S +  WCV  TS TTYSMVGALNK+P+    ++FF   + +    ++ VG +AG++Y+ A
Sbjct: 239 SLSVFWCVNATSPTTYSMVGALNKIPITFISIVFFNTEMDSKLAFSVCVGLLAGLVYTYA 298

Query: 315 KTEQQKPIKPSVYIPISNKELP 336
           K + +K  +P       N+ LP
Sbjct: 299 KLQLRKSPQPVNEKSAENERLP 320



>gi|164663177|ref|XP_001732710.1| hypothetical protein MGL_0485 [Malassezia globosa CBS 7966]
 gi|189041720|sp|A8PTV6.1|GMT_MALGO RecName: Full=GDP-mannose transporter; Short=GMT
 gi|159106613|gb|EDP45496.1| hypothetical protein MGL_0485 [Malassezia globosa CBS 7966]
          Length = 484

 Score =  201 bits (512), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 120/150 (80%)

Query: 169 GYLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNF 228
           GY+WM  NC+ SA +VL MR+RI+ T FKD+DT++YNNLLSIP+L+ MSL+VE+WS + F
Sbjct: 290 GYVWMLANCMISATYVLVMRKRIKLTGFKDWDTMFYNNLLSIPVLLFMSLLVENWSVETF 349

Query: 229 EKNLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIF 288
           E N P + R+TL+ AIL SG     ISYT+AWC+RVTSSTTYSMVGALNKLP+A SGM+F
Sbjct: 350 EHNFPREKRSTLVFAILLSGTGGVFISYTTAWCIRVTSSTTYSMVGALNKLPLALSGMLF 409

Query: 289 FGDPITTGNVSAIFVGFVAGILYSIAKTEQ 318
           FG+P+T  N   + VGF+AGI+Y++ K +Q
Sbjct: 410 FGNPVTPYNSIGVAVGFIAGIVYAVGKYKQ 439



 Score =  132 bits (331), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 64/126 (50%), Positives = 89/126 (70%)

Query: 19  ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLAL 78
           +L+YC ASI MTV NK+ +SG  F MN L+L  Q  V V ++ A K +  +  R  ++  
Sbjct: 68  VLSYCIASISMTVINKFTVSGEKFTMNLLVLLCQCSVGVAMVYAAKCMGWIQIRTLNMRD 127

Query: 79  SRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTS 138
            + WFPI+ +LV +IYTGSK+LQ++ IP+YTIFKNLTIILIAYGE++WF+  I+ +   S
Sbjct: 128 VKTWFPISTMLVFVIYTGSKALQHMDIPIYTIFKNLTIILIAYGELLWFNGRITPMVFLS 187

Query: 139 FLLMVF 144
           F+LMV 
Sbjct: 188 FILMVL 193



>gi|209570354|emb|CAQ16243.1| hypothetical protein [Glomerella graminicola]
          Length = 257

 Score =  201 bits (511), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 103/208 (49%), Positives = 138/208 (66%), Gaps = 9/208 (4%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVS-FREFD 75
           + IL YC +SI MTV NKYV+SG  +N+NFL L +QSIVC++ +   K L +++    FD
Sbjct: 48  IAILAYCFSSISMTVVNKYVVSGQFWNLNFLYLAVQSIVCILTIVVCKNLGMITNLAPFD 107

Query: 76  LALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLT 135
              ++KWFPIA+LLV MIYTG+K+LQ+LS+PVYTIFKNLTII+IAYGEV+WF  S+S L+
Sbjct: 108 TDKAKKWFPIALLLVGMIYTGTKALQFLSVPVYTIFKNLTIIVIAYGEVLWFGGSVSPLS 167

Query: 136 MTSFLLMVFXXXXXX--------XXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTM 187
           + SF LMV                             T + GY WM  N   +AA+VL M
Sbjct: 168 LLSFGLMVLSSVVAAWADVAHALGGSSHTAEASAAVSTLNAGYAWMGMNVCCTAAYVLGM 227

Query: 188 RRRIRSTNFKDFDTVYYNNLLSIPLLMT 215
           R+ I+  NFKD+DT++YNNLL+IP+L+ 
Sbjct: 228 RKVIKKMNFKDWDTMFYNNLLTIPVLIA 255



>gi|505758704|gb|EOR02805.1| GDP-mannose transporter [Wallemia ichthyophaga EXF-994]
          Length = 212

 Score =  199 bits (505), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 129/181 (71%), Gaps = 17/181 (9%)

Query: 169 GYLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNF 228
           GY WM  NC+SSAA+VL MR+RI+ T FKD+D++ YNN LS+PLL+  SL+ EDWS ++ 
Sbjct: 28  GYCWMLTNCLSSAAYVLLMRKRIKVTAFKDWDSMAYNNALSVPLLVFASLVKEDWSLESL 87

Query: 229 EKNLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTT---------------YSMV 273
           EKN P   R  L++ I+FSG +A GISYT+AWCVR TSSTT               YSMV
Sbjct: 88  EKNFPPSNRHLLLSTIVFSGAAAVGISYTTAWCVRTTSSTTYSFVKLLTFNFSDKLYSMV 147

Query: 274 GALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSIAKTEQQK--PIKPSVYIPIS 331
           GALNKLPVAASG+IFF DP T  ++SAI +GFVAG++Y+IAK  Q +    K + YIP++
Sbjct: 148 GALNKLPVAASGLIFFNDPATPKSISAIAIGFVAGVMYTIAKQNQTRIGAQKQNSYIPLT 207

Query: 332 N 332
           +
Sbjct: 208 S 208



>gi|361129783|gb|EHL01665.1| putative GDP-mannose transporter [Glarea lozoyensis 74030]
          Length = 214

 Score =  198 bits (503), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 91/183 (49%), Positives = 133/183 (72%), Gaps = 2/183 (1%)

Query: 165 TFDIGYLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWS 224
           T + GY+WM  N   +A ++L+MR+ I+  NFKD+DT++YNNLL+IP+L   SL+ E+WS
Sbjct: 33  TLNAGYMWMGMNVFCTATYLLSMRKVIKKMNFKDWDTMFYNNLLTIPVLFLCSLIFENWS 92

Query: 225 EKNFEKNLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAAS 284
            KN EKN P + R TLI+ +++SG++   ISY SAWC+RVTSSTTYSMVGALNKLP+A S
Sbjct: 93  SKNIEKNFPLETRNTLISGMIYSGLATIFISYCSAWCIRVTSSTTYSMVGALNKLPLAVS 152

Query: 285 GMIFFGDPITTGNVSAIFVGFVAGILYSIAKTEQQKPIKPSVYIPISNKELPQTTTNDNN 344
           G++FF  P+T G+VSAI +GFV+GI+Y+ AK  Q +  K  + +P S   +  ++ ++ +
Sbjct: 153 GLVFFAAPVTFGSVSAIIIGFVSGIVYTWAKVRQSQMNK--MALPTSQPVMSASSQSNRD 210

Query: 345 TTE 347
            + 
Sbjct: 211 ASS 213



>gi|302661930|ref|XP_003022626.1| hypothetical protein TRV_03283 [Trichophyton verrucosum HKI 0517]
 gi|291186582|gb|EFE42008.1| hypothetical protein TRV_03283 [Trichophyton verrucosum HKI 0517]
          Length = 237

 Score =  192 bits (487), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 108/271 (39%), Positives = 149/271 (54%), Gaps = 42/271 (15%)

Query: 92  MIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTSFLLMVFXXXXXXX 151
           MIYT  K+LQ+LS+PVYTIFKNLTI++IAYGEV+WF  S++ L M SF  MV        
Sbjct: 1   MIYTSIKALQFLSVPVYTIFKNLTIVVIAYGEVLWFGGSVTPLIMLSFGCMVLSSVVAAW 60

Query: 152 XXXXXXX--------XXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVY 203
                                T + GY WM  N I +A +VL  R+ I S NFKD+DT  
Sbjct: 61  ADIQAAVNGFGHSGETAAAISTLNAGYAWMGLNVICTALYVLGTRKFITSLNFKDWDT-- 118

Query: 204 YNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFGISYTSAWCVR 263
                                  N  KN P + R  ++  +L+SG+ A  ISY+SAWC+R
Sbjct: 119 -----------------------NLAKNFPAESRNNILIGMLYSGLGAIFISYSSAWCIR 155

Query: 264 VTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSIAKTEQQKPIK 323
            TSSTTYS VG LNKLP+A SG++FF  P+T G VSAI +GF +G++Y   K +Q++   
Sbjct: 156 KTSSTTYSFVGYLNKLPLAISGLVFFDTPVTFGGVSAILLGFFSGLIYGYGKMKQKE--- 212

Query: 324 PSVYIPISNKELPQTTTNDNNTTEIQSNLLN 354
                 ++++ LP T    + +++ Q +  N
Sbjct: 213 ------MASQVLPTTRPTMSASSQSQKDASN 237



>gi|380487443|emb|CCF38035.1| GDP-mannose transporter [Colletotrichum higginsianum]
          Length = 174

 Score =  189 bits (480), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 87/159 (54%), Positives = 119/159 (74%), Gaps = 6/159 (3%)

Query: 171 LWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEK 230
           +WMA N + +A + L++R+ I+  +FKD+DT+YYNNLL+IP+L+  SL+VEDW  +N  +
Sbjct: 1   MWMALNVVCTATYTLSLRKVIKRMDFKDWDTMYYNNLLTIPILIVASLLVEDWGHENLVR 60

Query: 231 NLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFG 290
           N PED R  +   I++SG++   ISY SAWC+RVTSSTTYSMVGALNKLP+A SG+IFF 
Sbjct: 61  NFPEDQRNRICVGIVYSGLATIFISYCSAWCIRVTSSTTYSMVGALNKLPIAISGLIFFS 120

Query: 291 DPITTGNVSAIFVGFVAGILYSIAK------TEQQKPIK 323
            P+T G+VSAI +GFV+GI+Y+ AK       +Q  PIK
Sbjct: 121 APVTLGSVSAIALGFVSGIVYAFAKKWEADEKKQTLPIK 159



>gi|365765737|gb|EHN07243.1| Vrg4p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 211

 Score =  187 bits (475), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 87/156 (55%), Positives = 119/156 (76%), Gaps = 4/156 (2%)

Query: 165 TFDIGYLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWS 224
           +F+ GY WM  NCI+SA FVL MR+RI+ TNFKDFDT++YNN+L++P+L+  S  VEDWS
Sbjct: 54  SFNPGYFWMFTNCITSALFVLIMRKRIKLTNFKDFDTMFYNNVLALPILLLFSFCVEDWS 113

Query: 225 EKNFEKNLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAAS 284
             N   N   D     +TA++ SG+++ GISY S WCVRVTSSTTYSMVGALNKLP+A S
Sbjct: 114 SVNLTNNFSNDS----LTAMIISGVASVGISYCSGWCVRVTSSTTYSMVGALNKLPIALS 169

Query: 285 GMIFFGDPITTGNVSAIFVGFVAGILYSIAKTEQQK 320
           G+IFF  P    ++ +IF+GF++GI+Y++AK ++Q+
Sbjct: 170 GLIFFDAPRNFLSILSIFIGFLSGIIYAVAKQKKQQ 205



>gi|323337741|gb|EGA78985.1| Vrg4p [Saccharomyces cerevisiae Vin13]
          Length = 211

 Score =  187 bits (474), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 87/156 (55%), Positives = 119/156 (76%), Gaps = 4/156 (2%)

Query: 165 TFDIGYLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWS 224
           +F+ GY WM  NCI+SA FVL MR+RI+ TNFKDFDT++YNN+L++P+L+  S  VEDWS
Sbjct: 54  SFNPGYFWMFTNCITSALFVLIMRKRIKLTNFKDFDTMFYNNVLALPILLLFSFCVEDWS 113

Query: 225 EKNFEKNLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAAS 284
             N   N   D     +TA++ SG+++ GISY S WCVRVTSSTTYSMVGALNKLP+A S
Sbjct: 114 SVNLTNNFSNDS----LTAMIISGVASVGISYCSGWCVRVTSSTTYSMVGALNKLPIALS 169

Query: 285 GMIFFGDPITTGNVSAIFVGFVAGILYSIAKTEQQK 320
           G+IFF  P    ++ +IF+GF++GI+Y++AK ++Q+
Sbjct: 170 GLIFFDAPRNFLSILSIFIGFLSGIIYAVAKQKKQQ 205



>gi|254583163|ref|XP_002499313.1| ZYRO0E08888p [Zygosaccharomyces rouxii]
 gi|238942887|emb|CAR31058.1| ZYRO0E08888p [Zygosaccharomyces rouxii]
          Length = 364

 Score =  184 bits (467), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 85/160 (53%), Positives = 117/160 (73%), Gaps = 4/160 (2%)

Query: 165 TFDIGYLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWS 224
           + ++GY+WM FNC+SSA FVL MR+RI+ TNFKDFDT++YNN L++P+L+  S + EDWS
Sbjct: 208 SLNVGYVWMLFNCVSSALFVLIMRKRIKLTNFKDFDTMFYNNALAMPILLIASFLFEDWS 267

Query: 225 EKNFEKNLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAAS 284
             N   N   +     +TA++ SG ++ GISY S WCVRVTSSTTYSMVGALNKLP+A S
Sbjct: 268 SANLRVNFSNES----MTALVISGAASVGISYCSGWCVRVTSSTTYSMVGALNKLPIALS 323

Query: 285 GMIFFGDPITTGNVSAIFVGFVAGILYSIAKTEQQKPIKP 324
           G++FF  P    ++ +IF+GF++GI+Y  AK ++ K   P
Sbjct: 324 GLLFFDAPKNFLSILSIFIGFLSGIVYVAAKQKKMKQQPP 363



 Score =  131 bits (330), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 72/137 (52%), Positives = 98/137 (71%)

Query: 8   LAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLN 67
           LA ++  G + IL YC +SILMTVTNK+V++  DFNM F++L +Q +VC ++L   K L 
Sbjct: 12  LARITNNGPISILAYCCSSILMTVTNKFVVNKDDFNMFFVMLVVQCLVCTLVLVVLKGLG 71

Query: 68  LVSFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWF 127
              FR  +    + W PI+ LLV MIYT SK+L  L +P+YTIFKNLTIILIAYGEV++F
Sbjct: 72  YAKFRPLNKTDIKNWMPISFLLVLMIYTSSKALNLLPVPIYTIFKNLTIILIAYGEVLFF 131

Query: 128 DCSISRLTMTSFLLMVF 144
             S++ + ++SFLLMVF
Sbjct: 132 GGSVTSMELSSFLLMVF 148



>gi|238578657|ref|XP_002388791.1| hypothetical protein MPER_12148 [Moniliophthora perniciosa FA553]
 gi|215450399|gb|EEB89721.1| hypothetical protein MPER_12148 [Moniliophthora perniciosa FA553]
          Length = 148

 Score =  179 bits (453), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 83/144 (57%), Positives = 111/144 (77%), Gaps = 3/144 (2%)

Query: 194 TNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFG 253
           T F D+D+++Y+NLLSIP+L   S ++EDW  +N  +N PE+ R  L  AI FSG +A G
Sbjct: 4   TGFSDWDSMFYSNLLSIPVLALFSFILEDWGTENLNRNFPEETRNFLFMAIAFSGAAAVG 63

Query: 254 ISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSI 313
           ISYT+AWC+RVTSSTTYSMVGALNKLPVAASGM+FFGDP+T G+VSA+ VGF AG+LY++
Sbjct: 64  ISYTTAWCIRVTSSTTYSMVGALNKLPVAASGMMFFGDPVTLGSVSAVAVGFFAGLLYAV 123

Query: 314 AKTEQQKP---IKPSVYIPISNKE 334
           AK  Q+K    ++    IP++ ++
Sbjct: 124 AKNNQKKAESRMQADSIIPLTARK 147



>gi|326431646|gb|EGD77216.1| hypothetical protein PTSG_08308 [Salpingoeca sp. ATCC 50818]
          Length = 354

 Score =  179 bits (453), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 109/305 (35%), Positives = 176/305 (57%), Gaps = 14/305 (4%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDL 76
           L ILTYC  S+ M  TNK VL+ +DF+   +LL  QS V VV+L+   +  ++    F +
Sbjct: 54  LAILTYCLCSMTMIFTNKLVLAEHDFSYPSVLLLFQSAVAVVILKLLSVGQVIELERFSM 113

Query: 77  ALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTM 136
           A  R+W P+ +    M+YTGSK+L +LSIP+ T+FKN+T +LIAYG+  +F  +++R  +
Sbjct: 114 ATVRRWAPVTVFFGLMLYTGSKTLVFLSIPIVTVFKNMTNLLIAYGDWHFFGQTVTRGVI 173

Query: 137 TSFLLMVFXXXXXXXXXXXXXXXXXXXXTFDI-GYLWMAFNCISSAAFVLTMRRRIRSTN 195
            SF+LMV                      F++ GY+WM+ NC+S A++VL  R    +T 
Sbjct: 174 VSFMLMV----------VGSILTGFTDLEFNLQGYVWMSLNCLSQASYVLYARYAKTTTQ 223

Query: 196 FKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFGIS 255
             ++   +YNNLL + L+   S+   +  +    KNL      + + +++ SG+   G+S
Sbjct: 224 LSEWGMSFYNNLLCVVLMSASSVFTGELFQAMEFKNLTAP---SFVVSVVLSGVVGTGLS 280

Query: 256 YTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSIAK 315
           +   W +  TS TTYSMVG+LNK+P+  + ++FF   +T   + +I VG  AGI+Y+ AK
Sbjct: 281 FAVFWVMSTTSPTTYSMVGSLNKIPITFASVLFFHMNMTWKTMVSIAVGLGAGIVYTHAK 340

Query: 316 TEQQK 320
            + ++
Sbjct: 341 IQMKR 345



>gi|380476963|emb|CCF44414.1| GDP-mannose transporter, partial [Colletotrichum higginsianum]
          Length = 275

 Score =  178 bits (451), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 97/230 (42%), Positives = 134/230 (58%), Gaps = 16/230 (6%)

Query: 4   PPTILAFLSATGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAF 63
           PP  LA +     + +L YC ASI MTV NKYV+SG  +N+ F  L  Q+I+C+ ++ A 
Sbjct: 44  PPLSLADMDNNAPVSVLAYCMASISMTVVNKYVVSGASWNLTFFYLAAQAIICIAVITAC 103

Query: 64  KMLNLV-SFREFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYG 122
           K + ++ S     L  S+KWFPI+ LLV MIYT +K+LQYLS+PVYTIFKNLTII IAYG
Sbjct: 104 KRVGMIKSLTPVTLDKSKKWFPISFLLVGMIYTSTKALQYLSVPVYTIFKNLTIIAIAYG 163

Query: 123 EVIWFDCSISRLTMTSFLLMVFXXXXXX--------------XXXXXXXXXXXXXXTFDI 168
           EV  +   ++R+   +F LMV                                     + 
Sbjct: 164 EVFLWGGEVTRMATVAFSLMVLSSVVAAWADIRNALAGDMGGGGGGGGDSSKDALAILNA 223

Query: 169 GYLWMAFNCISSAAFVLTMRRRI-RSTNFKDFDTVYYNNLLSIPLLMTMS 217
           GY+WMA N + +A + L++R+ I R   FKD+DT+YYNNLL+IP+L+  S
Sbjct: 224 GYMWMALNVVCTATYTLSLRKVIKRMMYFKDWDTMYYNNLLTIPILIVAS 273



>gi|402468553|gb|EJW03697.1| hypothetical protein EDEG_00185 [Edhazardia aedis USNM 41457]
          Length = 301

 Score =  168 bits (426), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 108/294 (36%), Positives = 166/294 (56%), Gaps = 17/294 (5%)

Query: 22  YCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLALSRK 81
           Y  +SI  TV NKYV+S   FNM F+ L IQSI    +L       L+  R  + +   K
Sbjct: 16  YLLSSIATTVINKYVISILKFNMLFVYLMIQSIFIAAILSILHWYRLIYIRRINSSFVFK 75

Query: 82  WFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTSFLL 141
           W P ++LL  MI+TG+KS++YL + ++T+FKN +IIL+A  E   +   I   T+ SF L
Sbjct: 76  WAPCSLLLSLMIFTGAKSMEYLPVSLFTLFKNFSIILVACSEYFIYARRIGLRTIISFSL 135

Query: 142 MVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRIRSTNFKDFDT 201
           ++                     T  +GY W   N +S+A +V+ ++  I +    +F++
Sbjct: 136 IIL---------SSIVGEYTDFTTSKLGYAWSVLNALSTATYVIMLKFNIDTEYVSNFES 186

Query: 202 VYYNNLLSIPLLMTMSLMVE--DWSEKNFEKNLPEDIRTTLITAILFSGISAFGISYTSA 259
           V+Y N LSIP L+  SL ++  D+    F+  L +     ++T I+ S I AF +SY++A
Sbjct: 187 VFYTNFLSIPFLLFGSLSIDKIDYRITKFDATLAK-----ILTIIIVSSIFAFFVSYSTA 241

Query: 260 WCVRVTSSTTYSMVGALNKLPVAASGMIFFGDP-ITTGNVSAIFVGFVAGILYS 312
           W +R  SSTT SM+GA NKL V+ SGMIF G+  I+    +++ +G +AG+LYS
Sbjct: 242 WTLRALSSTTLSMMGAFNKLFVSFSGMIFLGEKNISLLKGASLIIGSLAGLLYS 295



>gi|323309197|gb|EGA62422.1| Vrg4p [Saccharomyces cerevisiae FostersO]
          Length = 210

 Score =  166 bits (419), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 83/161 (51%), Positives = 111/161 (68%), Gaps = 6/161 (3%)

Query: 165 TFDIGYLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWS 224
           +F+ GY WM  NCI+SA FVL MR+RI+ TNFKDFDT++YNN+L++P+L+  S  VEDWS
Sbjct: 54  SFNPGYFWMFTNCITSALFVLIMRKRIKLTNFKDFDTMFYNNVLALPILLLFSFCVEDWS 113

Query: 225 EKNFEKNLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAAS 284
             N   N   D     +TA++ SG+++ GISY S WCVRVTSSTTYSMVGALNKLP+A S
Sbjct: 114 SVNLTNNFSNDS----LTAMIISGVASVGISYCSGWCVRVTSSTTYSMVGALNKLPIALS 169

Query: 285 GMIFFGDPITTGNVSAIFVGFVAGILYSIAKTEQQKPIKPS 325
           G+IFF  P    ++ +IF  F   I Y +   + ++   P+
Sbjct: 170 GLIFFDAPRNFLSILSIFYWF--PIRYYLCCCQTKEATSPT 208



>gi|430812320|emb|CCJ30260.1| unnamed protein product [Pneumocystis jirovecii]
 gi|430812580|emb|CCJ29986.1| unnamed protein product [Pneumocystis jirovecii]
          Length = 183

 Score =  164 bits (414), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 76/147 (51%), Positives = 108/147 (73%), Gaps = 1/147 (0%)

Query: 169 GYLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNF 228
           GY+WM  NC  S+A+VL  R+RI+S +F DFD ++YN+LL IP L+  +L+++DWS++N 
Sbjct: 37  GYIWMITNCFCSSAYVLGTRKRIKSGHFTDFDAMFYNDLLGIPFLIICTLIIDDWSKENI 96

Query: 229 EKNLPEDIRTTLITAILFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIF 288
            +N    I   ++ AIL SG+ + GI+YTS WC+R TSSTTYSM+GALNKLPV+  G++F
Sbjct: 97  LRNTYGKIFEPVV-AILLSGVFSAGIAYTSLWCIRATSSTTYSMIGALNKLPVSIFGLVF 155

Query: 289 FGDPITTGNVSAIFVGFVAGILYSIAK 315
           F  P T   +SAI +GF +G+LY+I K
Sbjct: 156 FKTPTTFLTISAIIIGFFSGVLYTIGK 182



>gi|299117408|emb|CBN73911.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 364

 Score =  162 bits (409), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/299 (31%), Positives = 160/299 (53%), Gaps = 20/299 (6%)

Query: 29  MTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLALSRKWFPIAML 88
           M ++NK +   Y  +M FL++  Q +V  +L+ A + +   S+  F+ + +R+W P+++ 
Sbjct: 40  MVMSNKLLAFTYKSDMAFLVVVGQCLVATILVEAVRRMGYASYDPFNFSTARRWLPVSIC 99

Query: 89  LVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTSFLLMVFXXXX 148
             AM++T  K+L+ +++P+ T+FKNLT I+I  G+  +F  + S L M S  +MVF    
Sbjct: 100 FSAMLFTSFKALEVMNVPMVTVFKNLTNIVIVTGDWWFFQQAASWLVMFSMAVMVFGALF 159

Query: 149 XXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRIRSTNFKDFDTVYYNNLL 208
                               GY WM  NC ++A +VL M+   +S     F  V+YNNLL
Sbjct: 160 ASYNDLDFN---------PWGYFWMVANCCTTAGYVLYMKHATKSIKLPRFGMVFYNNLL 210

Query: 209 SIPLLMTMSLMVED----WSEKNFEKNLPEDIRTTLITAILFSGISAFGISYTSAWCVRV 264
           +  LL   + M+ D    W+        P+    T +TA+LFSG+    +++ S WCV  
Sbjct: 211 TTCLLTPAAFMMGDFTIFWTT-------PQLRTVTYMTALLFSGVVGVLLNFASLWCVGA 263

Query: 265 TSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSIAKTEQQKPIK 323
           TS+TTY++VG++N +P A  G   F   I+T     + V  + G +YS AK ++++ ++
Sbjct: 264 TSATTYAVVGSVNVIPTALLGYQLFDSAISTQMGEFMLVSMIGGFMYSFAKLQEKRSLE 322



>gi|357114889|ref|XP_003559226.1| PREDICTED: GDP-mannose transporter GONST2-like [Brachypodium
           distachyon]
          Length = 395

 Score =  159 bits (403), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 95/306 (31%), Positives = 163/306 (53%), Gaps = 19/306 (6%)

Query: 20  LTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLALS 79
           ++YC AS  M + NK VLS Y+FN    L+  Q+++ VV+L A ++ +++S  E    L 
Sbjct: 101 ISYCIASCSMILLNKVVLSSYNFNAGISLMLYQNLISVVILLALELFSVISTEELTWKLI 160

Query: 80  RKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTSF 139
           + W P+ ++ + M+ TG  SL+Y+++ + TI KN+T IL A GE+  F    ++    + 
Sbjct: 161 KVWIPVNIIFIGMLVTGMYSLKYINVAMVTILKNMTNILTAMGEIYVFKKGQNKQVWAAL 220

Query: 140 LLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRI-------R 192
           L+M+                        +GY W   NC  +AA+ LT+RR +       +
Sbjct: 221 LMMIVSAVCGGMTDLSFHL---------VGYTWQILNCFLTAAYSLTLRRLMDTAKQSTK 271

Query: 193 STNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAF 252
           S +  +   V  NN LSIP  + + ++  +W      + + E +     TA   SG+   
Sbjct: 272 SGSLNEVSMVLLNNALSIPFAVILIIVFSEWEYVYQAEVIREPMFWFFATA---SGLLGL 328

Query: 253 GISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYS 312
            IS++S W ++ TS TTYS+VG+LNK+P++ +G++ F  P++  N+ +I  G  AGI ++
Sbjct: 329 AISFSSVWFLQETSPTTYSLVGSLNKIPISVAGILLFKVPVSVENLFSIVFGLFAGIFFA 388

Query: 313 IAKTEQ 318
            AK  +
Sbjct: 389 KAKMSK 394



>gi|301100880|ref|XP_002899529.1| GDP-mannose transporter, putative [Phytophthora infestans T30-4]
 gi|262103837|gb|EEY61889.1| GDP-mannose transporter, putative [Phytophthora infestans T30-4]
          Length = 339

 Score =  159 bits (401), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 107/332 (32%), Positives = 169/332 (50%), Gaps = 21/332 (6%)

Query: 20  LTYCAASILMTVTNKYVLSG--YDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLA 77
           L Y   S +M +TN+Y+L    Y F+  F ++ +Q+ V +++L   KM  L+S+  +D A
Sbjct: 20  LVYSVMSNVMVLTNRYLLGKKYYGFDEKFFVVAVQAGVAILVLELAKMQKLISYDPYDSA 79

Query: 78  LSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMT 137
           ++RKW P+    VAM+YT  ++   L I + T+FKN+T I+I +GE  +F   +  L + 
Sbjct: 80  IARKWAPVTFFFVAMLYTSMQATAGLPIHIVTVFKNVTNIIIVFGEWRFFGERVGGLVLV 139

Query: 138 SFLLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRIRSTNFK 197
           S  +M+                     +   GY WM  NC S+A +VL MR     ++ K
Sbjct: 140 SLGVMLMGAVMSSYSDVGGGKATPSTIS---GYFWMVLNCASTAGYVLYMRYATSRSSLK 196

Query: 198 --DFDTVYYNNLLSIPLLMTMSLMVED----WSEKNFEKNLPEDIRTTLITAILFSGISA 251
              F   +YNNL+S+PLL    ++  +    WS       L  +   TL+  +  SG+  
Sbjct: 197 ISKFGMAFYNNLISLPLLAPPLVLNGEAFTVWSNP-----LLGNFNFTLL--LFISGVLG 249

Query: 252 FGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILY 311
            G++  S WCV VTS+TTY+ VG LNK+P    G++  G+P+       +  G V GILY
Sbjct: 250 VGLNLASFWCVSVTSATTYATVGGLNKIPTTFIGVLLLGEPLKPDTAIYVTFGMVGGILY 309

Query: 312 SIAKTEQQKPIKPSVYIPISNKELPQTTTNDN 343
             AK ++ +  K       + + LPQTT +  
Sbjct: 310 GYAKFKEGEAAKKH---KAAQEALPQTTHDSK 338



>gi|449330303|gb|AGE96561.1| membrane protein [Encephalitozoon cuniculi]
          Length = 292

 Score =  157 bits (397), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 100/301 (33%), Positives = 168/301 (55%), Gaps = 21/301 (6%)

Query: 20  LTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLALS 79
           L Y  +SI+ T+ NKY+LS   F M +LL+ +QS+  VV L   K+  LV FR   L   
Sbjct: 12  LIYLFSSIITTLANKYILSNLGFKMQYLLVALQSLTIVVGLLTLKLARLVEFR---LTKF 68

Query: 80  RKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTSF 139
           +KW   ++LL  MI++GSKSL YL I +YT+FKN +II++A  E   F   I  L+  SF
Sbjct: 69  KKWMVPSLLLTVMIFSGSKSLYYLPISLYTLFKNSSIIVVALLEQHLFKKRIGSLSCLSF 128

Query: 140 LLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRIRSTNFKDF 199
           +LM+                       ++GY+W++ N +S+ A+VL+++  +   N    
Sbjct: 129 ILMIISSYAGNSSDVI----------LNVGYVWISVNVLSTTAYVLSLKIVVDMNNKAKT 178

Query: 200 DTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFGISYTSA 259
           + VYY+NL+S+P+L+++S++        F++  P      +   I  S + AF  S+++A
Sbjct: 179 EAVYYSNLISLPILISLSML--------FDEKDPGANGLKVFVWIFISSLCAFFTSFSTA 230

Query: 260 WCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSIAKTEQQ 319
           W + V SST  SM+GALNK   + +G++  G+ +    + ++ +G +A  +YS   + ++
Sbjct: 231 WTLNVLSSTALSMLGALNKSLGSLAGILGLGESVNRQKIFSLLLGSLACAIYSYDISFKK 290

Query: 320 K 320
           K
Sbjct: 291 K 291



>gi|384551571|dbj|BAM11305.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 387

 Score =  157 bits (397), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 98/311 (31%), Positives = 165/311 (53%), Gaps = 24/311 (7%)

Query: 16  TLPILT---YCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFR 72
           T P+L+   YC AS  M + NK VLS Y+FN    L+  Q+++ V++L   ++  ++S  
Sbjct: 88  TGPLLSGICYCIASCSMILLNKVVLSNYNFNAGISLMLYQNLISVIILLVLELFGVISTE 147

Query: 73  EFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSIS 132
           +    L + W P+ ++ V M+ TG  SL+Y+++ + TI KN+T IL A GE+  F    +
Sbjct: 148 KLTWKLIKVWIPVNLIFVGMLVTGMYSLKYINVAMVTILKNMTNILTAVGEIYIFRKGQN 207

Query: 133 RLTMTSFLLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRI- 191
           +    +  LMV                        +GY+W  FNC  +A + LT+RR + 
Sbjct: 208 KKVWAALCLMVISAVCGGITDLSF---------HPVGYMWQLFNCFLTAGYSLTLRRVMD 258

Query: 192 ------RSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPED-IRTTLITAI 244
                 +S +  +   V  NN LSIPL + + ++ ++W +  +E  +  D +     TA 
Sbjct: 259 VAKQSTKSGSLNEVSMVLLNNALSIPLALILIVIFDEW-QYVYEVEVTRDPMFWAFATA- 316

Query: 245 LFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVG 304
             SG+    IS++S W +  T  TTYS+VG+LNK+P++ +G++ F  P++  N+ +I  G
Sbjct: 317 --SGLLGLAISFSSVWFLHRTGPTTYSLVGSLNKIPISVAGILLFNVPVSVENLFSIIFG 374

Query: 305 FVAGILYSIAK 315
             AGI ++ AK
Sbjct: 375 LFAGIFFAKAK 385



>gi|19172975|ref|NP_597526.1| GOLGI MEMBRANE PROTEIN [Encephalitozoon cuniculi GB-M1]
 gi|19168642|emb|CAD26161.1| GOLGI MEMBRANE PROTEIN [Encephalitozoon cuniculi GB-M1]
          Length = 292

 Score =  155 bits (393), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 100/301 (33%), Positives = 167/301 (55%), Gaps = 21/301 (6%)

Query: 20  LTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLALS 79
           L Y  +SI+ T+ NKY+LS   F M +LL+ +QS+  VV L   K   LV FR   L   
Sbjct: 12  LIYLFSSIITTLANKYILSNLGFKMQYLLVALQSLTIVVGLLTLKFARLVEFR---LTKF 68

Query: 80  RKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTSF 139
           +KW   ++LL  MI++GSKSL YL I +YT+FKN +II++A  E   F   I  L+  SF
Sbjct: 69  KKWMIPSLLLTVMIFSGSKSLYYLPISLYTLFKNSSIIVVALLEQHLFKKRIGSLSCLSF 128

Query: 140 LLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRIRSTNFKDF 199
           +LM+                       ++GY+W++ N +S+ A+VL+++  +   N    
Sbjct: 129 ILMIISSYAGNSSDVI----------LNVGYVWISVNVLSTTAYVLSLKIVVDMNNKAKT 178

Query: 200 DTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFGISYTSA 259
           + VYY+NL+S+P+L+++S++        F++  P      +   I  S + AF  S+++A
Sbjct: 179 EAVYYSNLISLPILISLSML--------FDEKDPGANGLKVFVWIFISSLCAFFTSFSTA 230

Query: 260 WCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYSIAKTEQQ 319
           W + V SST  SM+GALNK   + +G++  G+ +    + ++ +G +A  +YS   + ++
Sbjct: 231 WTLNVLSSTALSMLGALNKSLGSLAGILGLGESVNRQKIFSLLLGSLACAIYSYDISFKK 290

Query: 320 K 320
           K
Sbjct: 291 K 291



>gi|357464677|ref|XP_003602620.1| GDP-mannose transporter [Medicago truncatula]
 gi|355491668|gb|AES72871.1| GDP-mannose transporter [Medicago truncatula]
          Length = 342

 Score =  155 bits (393), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 96/311 (30%), Positives = 164/311 (52%), Gaps = 21/311 (6%)

Query: 17  LPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDL 76
           L  L YC +S  M + NK+VLS YDFN    L+  Q+ + V+++    +L LVS      
Sbjct: 42  LSGLAYCLSSCGMILVNKFVLSSYDFNAGISLMVYQNFISVIIVSVLSLLGLVSTEPLTW 101

Query: 77  ALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTM 136
            L + WFP+ ++ V M+ T   SL+Y+++ + T+ KN+T ++ A GE+  F         
Sbjct: 102 RLIKVWFPVNVIFVGMLITSMFSLKYINVAMVTVLKNVTNVITAVGEMYLFSKHHEGRVW 161

Query: 137 TSFLLMVFXXXXXXXXXXXXXXXXXXXXTFD-IGYLWMAFNCISSAAFVLTMRRRI---- 191
            +  LM+                     +F+  GY+W   NC  +A++ LT+RR +    
Sbjct: 162 AALFLMII----------SAITGGITDLSFNATGYVWQTLNCFLTASYSLTLRRVMDTAK 211

Query: 192 ---RSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSG 248
              +S N  +F  V  NN LS+PL + + L+   ++E ++    P     +    + FSG
Sbjct: 212 QYTKSGNLNEFTMVLLNNTLSLPLGIFLMLV---FNEVDYLLRTPLLRLPSFWLVMTFSG 268

Query: 249 ISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAG 308
           +    IS+TS W +  T +TTYS+VG+LNK+P++ +G++ F  P +  N ++I  G +AG
Sbjct: 269 VLGLAISFTSMWFLHQTGATTYSLVGSLNKIPLSVAGILLFKVPTSLENSASILFGLLAG 328

Query: 309 ILYSIAKTEQQ 319
           +L++ AK  ++
Sbjct: 329 VLFARAKIRER 339



>gi|475583174|gb|EMT19388.1| hypothetical protein F775_20322 [Aegilops tauschii]
          Length = 395

 Score =  155 bits (392), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 94/306 (30%), Positives = 160/306 (52%), Gaps = 19/306 (6%)

Query: 20  LTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLALS 79
           ++YC AS  M + NK VLS Y+FN    L+  Q+++ VV+L A +  +++S  E    L 
Sbjct: 101 ISYCIASCSMILLNKVVLSSYNFNAGISLMLYQNLISVVILVALEFFSVISTEELTWKLI 160

Query: 80  RKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTSF 139
           + W P+ ++ V M+ TG  SL+Y+++ + TI KN+T IL A GE+  F    ++    + 
Sbjct: 161 KVWIPVNLIFVGMLVTGMYSLKYINVAMVTILKNMTNILTAIGEIYVFRKCQNKQVWAAL 220

Query: 140 LLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRI-------R 192
            +M+                        +GY W   NC  +AA+ LT+RR +       +
Sbjct: 221 CMMIISAVSGGMTDLSFHL---------VGYTWQILNCFLTAAYSLTLRRLMDTAKQSTK 271

Query: 193 STNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAF 252
           S +  +   V  NN LSIP  + + ++  +W      + + E +     TA   SG+   
Sbjct: 272 SGSLNEVSMVLLNNALSIPFAVILIIVFNEWEYVYQTEVIREPMFWFFATA---SGLLGL 328

Query: 253 GISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYS 312
            IS++S W ++ T  TTYS+VG+LNK+P++ +G++ F  P++  N+ +I  G  AGI ++
Sbjct: 329 AISFSSVWFLQETGPTTYSLVGSLNKIPISVAGVLLFNVPVSVENLFSIVFGLFAGIFFA 388

Query: 313 IAKTEQ 318
            AK  +
Sbjct: 389 KAKMSK 394



>gi|473879420|gb|EMS47956.1| hypothetical protein TRIUR3_24467 [Triticum urartu]
          Length = 395

 Score =  153 bits (386), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 94/306 (30%), Positives = 159/306 (51%), Gaps = 19/306 (6%)

Query: 20  LTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLALS 79
           ++YC AS  M + NK VLS Y+F+    L+  Q+++ VV+L A +   ++S  E    L 
Sbjct: 101 ISYCIASCSMILLNKVVLSSYNFSAGISLMLYQNLISVVILVALEFFAVISTEELTWKLI 160

Query: 80  RKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTSF 139
           + W P+ ++ V M+ TG  SL+Y+++ + TI KN+T IL A GE+  F    ++    + 
Sbjct: 161 KVWIPVNLIFVGMLVTGMYSLKYINVAMVTILKNMTNILTAVGEIYVFRKCQNKQVWAAL 220

Query: 140 LLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRI-------R 192
            +M+                        IGY W   NC  +AA+ LT+RR +       +
Sbjct: 221 CMMIISAVSGGMTDLSFHL---------IGYAWQILNCFLTAAYSLTLRRLMDTAKQSTK 271

Query: 193 STNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAF 252
           S +  +   V  NN LSIP  + + ++  +W      + + E +     TA   SG+   
Sbjct: 272 SGSLNEVSMVLLNNALSIPFAVILIIVFNEWEYVYQTEVIREPMFWFFATA---SGLLGL 328

Query: 253 GISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYS 312
            IS++S W ++ T  TTYS+VG+LNK+P++ +G++ F  P++  N+ +I  G  AGI ++
Sbjct: 329 AISFSSVWFLQETGPTTYSLVGSLNKIPISVAGVLLFNVPVSVENLFSIVFGLFAGIFFA 388

Query: 313 IAKTEQ 318
            AK  +
Sbjct: 389 KAKMSK 394



>gi|238569369|ref|XP_002386641.1| hypothetical protein MPER_15036 [Moniliophthora perniciosa FA553]
 gi|215439107|gb|EEB87571.1| hypothetical protein MPER_15036 [Moniliophthora perniciosa FA553]
          Length = 125

 Score =  152 bits (384), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 74/118 (62%), Positives = 94/118 (79%)

Query: 18  PILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLA 77
           P++ YC ASILMTV NK+V+SG +F+MNFLLL IQS VC+V +   K + +++FR FD  
Sbjct: 8   PVVCYCLASILMTVVNKFVVSGANFSMNFLLLCIQSTVCIVCVLLVKKMGIITFRTFDWQ 67

Query: 78  LSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLT 135
            ++ W PI+ +LV +IYTGSKSLQ+LSIPVYTIFKNLTIILIAYGEVIWF   ++ LT
Sbjct: 68  DAKTWSPISFMLVLVIYTGSKSLQFLSIPVYTIFKNLTIILIAYGEVIWFGGRVTGLT 125



>gi|366998725|ref|XP_003684099.1| hypothetical protein TPHA_0A05910 [Tetrapisispora phaffii CBS 4417]
 gi|357522394|emb|CCE61665.1| hypothetical protein TPHA_0A05910 [Tetrapisispora phaffii CBS 4417]
          Length = 336

 Score =  152 bits (384), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 91/310 (29%), Positives = 164/310 (52%), Gaps = 19/310 (6%)

Query: 19  ILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFR---EFD 75
           ++ +  +SILM   NK ++    FNM+ L +GIQ+ V  + L   K  + +S R   +FD
Sbjct: 20  VIAFAGSSILMLALNKSLVQDRSFNMHLLFMGIQTGVATLSLLLLKYTDFISVRPLNKFD 79

Query: 76  LALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCS-ISRL 134
           L   + W P+  ++   +YT SK+L+YL++PVY + KNL++I I + E ++F    I+ L
Sbjct: 80  L---KYWLPVGFMMAVALYTASKALKYLTVPVYVLVKNLSLIFITFSEALFFGTGGITSL 136

Query: 135 TMTSFLLMVFXXXXX---------XXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVL 185
              SF++ +                                ++GY W+    ISS  FVL
Sbjct: 137 EALSFVMFIAGAASLCLGDYEQSIALMKKKLGSDISFSYLVNVGYFWIVGAVISSTLFVL 196

Query: 186 TMRRRIRSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAIL 245
            +R+ I+ T F D DT+ YNN ++ P+L   S  +++W     E N+     + ++  ++
Sbjct: 197 LLRKMIQYTKFTDVDTILYNNFIACPILFAASYFLDNWES---EFNVDNHFDSNVMAMMI 253

Query: 246 FSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGF 305
            +G  +  ++Y SA C+  TS+++Y+MVGA+N++ +  +G+IF   P  + +   +    
Sbjct: 254 ITGFVSLALAYFSALCLSSTSTSSYAMVGAVNRIALCMTGLIFPNFPSNSYSYLGMATAL 313

Query: 306 VAGILYSIAK 315
           V G+L+++AK
Sbjct: 314 VGGLLFALAK 323



>gi|449518507|ref|XP_004166283.1| PREDICTED: LOW QUALITY PROTEIN: GDP-mannose transporter GONST2-like
           [Cucumis sativus]
          Length = 413

 Score =  152 bits (384), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 99/315 (31%), Positives = 164/315 (52%), Gaps = 24/315 (7%)

Query: 16  TLPILT---YCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFR 72
           T PIL+   YC +S  M + NK VLSGY+FN    L+  Q+++  +++    +   VS  
Sbjct: 109 TGPILSGTAYCISSCSMIILNKVVLSGYNFNAGISLMFYQNLISSIVIILLGLCRTVSIE 168

Query: 73  EFDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSIS 132
           + +  L R W P+ ++ + M+ +G  SL+Y++I + TI KN+T IL A GEV  F    +
Sbjct: 169 KLNWKLIRLWIPVNLIFIGMLVSGMYSLKYINIAMVTILKNVTNILTAIGEVYIFRKRQN 228

Query: 133 RLTMTSFLLMVFXXXXXXXXXXXXXXXXXXXXTFD-IGYLWMAFNCISSAAFVLTMRRRI 191
           +   T+  LM+                     TFD +GY W   NC+ +A++ LT+RR +
Sbjct: 229 QKVWTAMFLMII----------SAISGGVTDLTFDTLGYGWQITNCVLTASYSLTLRRIM 278

Query: 192 -------RSTNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAI 244
                  RS +  +   V  NNLLS+P  + + ++  +W+   +  N       T     
Sbjct: 279 DEAKKLTRSGSLNEASMVLLNNLLSLPFGVVLIILFGEWA---YVMNADVIKLPTFWVIA 335

Query: 245 LFSGISAFGISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVG 304
             SG+    IS+TS W +  T  TTYS+VG+LNK+P++ +G++ F  P++  N+ +I  G
Sbjct: 336 TASGLLGLAISFTSMWFLHQTGPTTYSLVGSLNKIPISIAGILLFKVPLSPPNLFSILFG 395

Query: 305 FVAGILYSIAKTEQQ 319
             AG+ ++ AK   +
Sbjct: 396 LFAGVFFARAKMSSK 410



>gi|502137377|ref|XP_004503064.1| PREDICTED: GDP-mannose transporter GONST1-like [Cicer arietinum]
          Length = 483

 Score =  152 bits (384), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 96/318 (30%), Positives = 161/318 (50%), Gaps = 23/318 (7%)

Query: 20  LTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLALS 79
           L YC +S  M + NK+VLS YDFN    L+  Q+ + V ++ A  +L LVS       L 
Sbjct: 43  LAYCLSSCGMILVNKFVLSSYDFNAGISLMVYQNFISVTIVSALSLLGLVSTEPLTWKLI 102

Query: 80  RKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTSF 139
           + W P+ ++ V M+ T   SL+Y+++ + T+ KN+T ++ A GE+  F          + 
Sbjct: 103 KVWLPVNVIFVGMLITSMFSLKYINVAMVTVLKNVTNVITAVGEMYLFKKQHEGRVWAAL 162

Query: 140 LLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRI-------R 192
            LM+                         GY+W   NC  +A++ LT+RR +       +
Sbjct: 163 FLMIISAITGGITDLAFNAT---------GYVWQTLNCFLTASYSLTLRRVMDTAKQYTK 213

Query: 193 STNFKDFDTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAF 252
           S N   F  V  NN LS+PL +    ++  ++E ++    P     +    + FSG+   
Sbjct: 214 SGNLNVFSMVLLNNTLSLPLGI---FLIVVFNEVDYLLRTPLLRLPSFWLVMTFSGVLGL 270

Query: 253 GISYTSAWCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYS 312
            IS+TS W +  T +TTYS+VG+LNK+P++ +G+  F  P +  N ++I  G +AG+L++
Sbjct: 271 AISFTSMWFLHQTGATTYSLVGSLNKIPLSVAGIFLFNVPTSLENSASILFGLLAGVLFA 330

Query: 313 IAK----TEQQKPIKPSV 326
            AK    ++QQ+  +  V
Sbjct: 331 RAKIRERSQQQQHHRSEV 348



>gi|392299730|gb|EIW10822.1| Vrg4p [Saccharomyces cerevisiae CEN.PK113-7D]
          Length = 179

 Score =  152 bits (383), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 72/131 (54%), Positives = 103/131 (78%)

Query: 14  TGTLPILTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFRE 73
           +G   IL+YCA+SILMTVTNK+V++  +FNMNF++L +QS+VC V L   +++ + +FR 
Sbjct: 15  SGPASILSYCASSILMTVTNKFVVNLDNFNMNFVMLFVQSLVCTVTLCILRIVGVANFRS 74

Query: 74  FDLALSRKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISR 133
            +    + WFPI++LLV MIYT SKSLQYL++P+YTIFKNLTIILIAYGEV++F   ++ 
Sbjct: 75  LNRTDVKNWFPISLLLVLMIYTSSKSLQYLAVPIYTIFKNLTIILIAYGEVLFFGGKVTS 134

Query: 134 LTMTSFLLMVF 144
           + +TSF++MV 
Sbjct: 135 MELTSFIMMVL 145



>gi|401825577|ref|XP_003886883.1| nucleotide sugar transporter [Encephalitozoon hellem ATCC 50504]
 gi|392998040|gb|AFM97902.1| nucleotide sugar transporter [Encephalitozoon hellem ATCC 50504]
          Length = 293

 Score =  152 bits (383), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 98/293 (33%), Positives = 164/293 (55%), Gaps = 21/293 (7%)

Query: 20  LTYCAASILMTVTNKYVLSGYDFNMNFLLLGIQSIVCVVLLRAFKMLNLVSFREFDLALS 79
           L Y  +SIL T++NKY+LS   F M +LL+G QS+  V+ L   + + L+ FR  +    
Sbjct: 12  LVYLFSSILTTLSNKYILSNLGFKMQYLLVGAQSLTIVMGLLILRGVGLIEFRLTNF--- 68

Query: 80  RKWFPIAMLLVAMIYTGSKSLQYLSIPVYTIFKNLTIILIAYGEVIWFDCSISRLTMTSF 139
           RKW   ++LL  MI++GSKSL YL I +YT+FKN +I+++A  E   F   I  L+  SF
Sbjct: 69  RKWMVPSLLLTVMIFSGSKSLYYLPISLYTLFKNSSIVVVALLEQYLFKKRIGGLSYISF 128

Query: 140 LLMVFXXXXXXXXXXXXXXXXXXXXTFDIGYLWMAFNCISSAAFVLTMRRRIRSTNFKDF 199
           +LM+                       +IGY+W+  N +S+ A+VL+++  +   +    
Sbjct: 129 ILMI----------ISSYTGNSSDVILNIGYVWILTNVLSTTAYVLSLKAVVDMNSKAKA 178

Query: 200 DTVYYNNLLSIPLLMTMSLMVEDWSEKNFEKNLPEDIRTTLITAILFSGISAFGISYTSA 259
           ++VYY+NL+S+P+L+ +S++ ++     F           ++  IL S + AF  S+++A
Sbjct: 179 ESVYYSNLISLPVLIFLSMLFDEKDVSVFSFK--------VLMWILISSLCAFFTSFSTA 230

Query: 260 WCVRVTSSTTYSMVGALNKLPVAASGMIFFGDPITTGNVSAIFVGFVAGILYS 312
           W + V SST  SM+GALNK   + +G+   G+ I    + ++ +G +A  +YS
Sbjct: 231 WTLNVLSSTALSMIGALNKSLGSFAGIFALGEVINGQKIFSLLLGSLASAIYS 283