BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10132_c0_seq4-m.53 5prime_partial 67-1014(-) 316 (-)
         (315 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|511007562|gb|EPB88848.1| hypothetical protein HMPREF1544_0435...    87   5e-15   Mucor circinelloides f. circinelloides 1006PhL


>gi|511007562|gb|EPB88848.1| hypothetical protein HMPREF1544_04357 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 962

 Score = 87.0 bits (214), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 70/144 (48%), Gaps = 17/144 (11%)

Query: 1   CIYFTVKTTTRL-PPYFFLGILNSTTIQHFLSHHCKYDQQGRMRLFRENMAKIPYAAPAH 59
           CIYFT+K       P ++ G+LNST    F+  HC YDQQGRMR F   MA +P+A P  
Sbjct: 731 CIYFTIKPDCPWQDPDYYCGLLNSTLAMFFIKLHCSYDQQGRMRFFGRLMAHVPFAPPPS 790

Query: 60  SDGVEWFIRCVQRMILARQMLYEGIRICGDEDKVASTIVEKLRRGAWQLTGREWQEKESN 119
           ++ ++     VQ + LAR  LY  +R C    K    ++E++R   W LT          
Sbjct: 791 TEFMQQVATFVQGVTLARSCLYPFLRYC----KGGQRLLERVRNFEWHLTAM-------- 838

Query: 120 AYNDETSVILREEQEGNWVMVKQC 143
               E+ ++ + E   NW     C
Sbjct: 839 ----ESDIVRQFEPPANWTEAISC 858