BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10144_c0_seq1-m.56 complete 79-741(+) 221 (+)
         (220 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|358056716|dbj|GAA97379.1| hypothetical protein E5Q_04057 [Mix...    74   2e-11   Mixia osmundae IAM 14324
gi|343426956|emb|CBQ70484.1| conserved hypothetical protein [Spo...    72   8e-11   Sporisorium reilianum SRZ2


>gi|358056716|dbj|GAA97379.1| hypothetical protein E5Q_04057 [Mixia osmundae IAM 14324]
          Length = 248

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 63/137 (45%), Gaps = 6/137 (4%)

Query: 28  NLPDFQFLLTQKSEPERDNICKTNMGFCETN-CGGPN-KAPMNFCNVTTMGWGCGC---S 82
           +LP F + LT +S   R  IC   M  C  + C   N     NFCN  TMG+ C C   S
Sbjct: 73  SLPAFTYNLTSESATLRAAICTQMMNVCSVSGCINSNATVSTNFCNNVTMGYDCECTSSS 132

Query: 83  DKIPDLSAFQWPINREHCIGSGEACKLACQDPKVPNEKKPDCNLACIDTYTSKCGTAAQP 142
           +    +  +  PIN   C     AC  AC  P + +    DC  AC   Y   CGT++Q 
Sbjct: 133 ESREFMQEYLLPINLVDCQFRSRACLDACLKPGMTSSTN-DCQTACNSIYADTCGTSSQQ 191

Query: 143 PAYYNVSDPAIVPTYAP 159
              Y VS+P+  P+Y P
Sbjct: 192 IPEYRVSNPSATPSYYP 208



>gi|343426956|emb|CBQ70484.1| conserved hypothetical protein [Sporisorium reilianum SRZ2]
          Length = 340

 Score = 72.4 bits (176), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 42/132 (31%), Positives = 56/132 (42%), Gaps = 3/132 (2%)

Query: 29  LPDFQFLLTQKSEPE--RDNICKTNMGFCET-NCGGPNKAPMNFCNVTTMGWGCGCSDKI 85
           LP + F L Q S  +  +  +C + M FC+T  C   +    NFC    MG  C CS   
Sbjct: 171 LPVYNFNLAQNSSSDQVKTALCASQMQFCQTAGCNQTDAKLTNFCETKYMGVACSCSKGA 230

Query: 86  PDLSAFQWPINREHCIGSGEACKLACQDPKVPNEKKPDCNLACIDTYTSKCGTAAQPPAY 145
             L  +QWP+    C G   AC+ AC  P    + +  C   C   + S CG   Q  A 
Sbjct: 231 SRLEQYQWPVMLADCQGRNTACRDACIKPGQSVQDQTKCLGVCTQNFGSTCGKPGQYAAN 290

Query: 146 YNVSDPAIVPTY 157
           Y V      P+Y
Sbjct: 291 YAVKKEGDKPSY 302