BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10145_c0_seq1-m.57 complete 290-973(-) 228 (-)
         (227 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|511007387|gb|EPB88679.1| casein kinase II subunit beta [Mucor...   330   2e-88   Mucor circinelloides f. circinelloides 1006PhL
gi|384490754|gb|EIE81976.1| hypothetical protein RO3G_06681 [Rhi...   329   3e-88   Rhizopus delemar RA 99-880
gi|384498876|gb|EIE89367.1| hypothetical protein RO3G_14078 [Rhi...   329   4e-88   Rhizopus delemar RA 99-880
gi|358057626|dbj|GAA96624.1| hypothetical protein E5Q_03294 [Mix...   326   2e-87   Mixia osmundae IAM 14324
gi|340992777|gb|EGS23332.1| enzyme regulator-like protein [Chaet...   324   1e-86   Chaetomium thermophilum var. thermophilum DSM 1495
gi|358057627|dbj|GAA96625.1| hypothetical protein E5Q_03295 [Mix...   324   1e-86   Mixia osmundae IAM 14324
gi|296424881|ref|XP_002841974.1| hypothetical protein [Tuber mel...   323   1e-86   Tuber melanosporum Mel28
gi|429856611|gb|ELA31511.1| duf1339 domain protein [Colletotrich...   323   2e-86   Colletotrichum gloeosporioides Nara gc5
gi|511002542|gb|EPB83973.1| casein kinase II subunit beta [Mucor...   322   4e-86   Mucor circinelloides f. circinelloides 1006PhL
gi|328859101|gb|EGG08211.1| hypothetical protein MELLADRAFT_4785...   321   1e-85   Melampsora larici-populina 98AG31
gi|380488485|emb|CCF37345.1| casein kinase II subunit beta-2 [Co...   320   1e-85   Colletotrichum higginsianum
gi|342890448|gb|EGU89266.1| hypothetical protein FOXB_00219 [Fus...   320   2e-85   Fusarium oxysporum Fo5176
gi|46108812|ref|XP_381464.1| hypothetical protein FG01288.1 [Fus...   319   4e-85   
gi|408388545|gb|EKJ68228.1| hypothetical protein FPSE_11599 [Fus...   318   5e-85   Fusarium pseudograminearum CS3096
gi|403178469|ref|XP_003336905.2| casein kinase 2, beta polypepti...   318   6e-85   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|367020430|ref|XP_003659500.1| hypothetical protein MYCTH_2296...   318   6e-85   Myceliophthora thermophila ATCC 42464
gi|485921544|gb|EOD47236.1| putative casein kinase ii beta subun...   318   6e-85   Neofusicoccum parvum UCRNP2
gi|367043420|ref|XP_003652090.1| hypothetical protein THITE_2113...   318   7e-85   Thielavia terrestris NRRL 8126
gi|393231426|gb|EJD39018.1| hypothetical protein AURDEDRAFT_1162...   318   9e-85   Auricularia subglabra TFB-10046 SS5
gi|430813180|emb|CCJ29438.1| unnamed protein product [Pneumocyst...   317   1e-84   Pneumocystis jirovecii
gi|407924548|gb|EKG17584.1| Casein kinase II regulatory subunit ...   317   2e-84   Macrophomina phaseolina MS6
gi|449542404|gb|EMD33383.1| hypothetical protein CERSUDRAFT_1179...   316   2e-84   Gelatoporia subvermispora B
gi|477525204|gb|ENH77119.1| casein kinase subunit ii beta [Colle...   315   5e-84   Colletotrichum orbiculare MAFF 240422
gi|512188913|gb|EPE04682.1| casein kinase ii beta subunit [Ophio...   315   5e-84   Ophiostoma piceae UAMH 11346
gi|406858971|gb|EKD12049.1| casein kinase II beta subunit [Marss...   315   6e-84   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|500254332|gb|EON97940.1| putative glutathione transferase pro...   314   9e-84   Phaeoacremonium minimum UCRPA7
gi|388857380|emb|CCF49054.1| related to casein kinase II beta su...   314   9e-84   Ustilago hordei
gi|345570844|gb|EGX53663.1| hypothetical protein AOL_s00006g53 [...   314   1e-83   Arthrobotrys oligospora ATCC 24927
gi|302925441|ref|XP_003054096.1| hypothetical protein NECHADRAFT...   314   1e-83   Nectria haematococca mpVI 77-13-4
gi|470317866|gb|EMR09556.1| hypothetical protein PNEG_02143 [Pne...   313   2e-83   Pneumocystis murina B123
gi|475668915|gb|EMT66701.1| Casein kinase II subunit beta-2 [Fus...   313   2e-83   Fusarium oxysporum f. sp. cubense race 4
gi|320588545|gb|EFX01013.1| casein kinase 2 beta subunit [Grosma...   313   3e-83   Grosmannia clavigera kw1407
gi|399164710|emb|CCE34404.1| Ckb-2 casein kinase II subunit beta...   312   3e-83   Claviceps purpurea 20.1
gi|471575361|gb|EMR72930.1| putative casein kinase ii beta subun...   311   6e-83   Eutypa lata UCREL1
gi|393221340|gb|EJD06825.1| hypothetical protein FOMMEDRAFT_1027...   311   1e-82   Fomitiporia mediterranea MF3/22
gi|154318245|ref|XP_001558441.1| casein kinase II beta subunit [...   310   1e-82   Botrytis cinerea B05.10
gi|400595246|gb|EJP63053.1| casein kinase II beta subunit [Beauv...   310   2e-82   Beauveria bassiana ARSEF 2860
gi|501305036|dbj|GAC94305.1| casein kinase II beta subunit [Pseu...   309   3e-82   Pseudozyma hubeiensis SY62
gi|343427855|emb|CBQ71381.1| related to casein kinase II beta su...   309   4e-82   Sporisorium reilianum SRZ2
gi|242205786|ref|XP_002468750.1| predicted protein [Postia place...   308   7e-82   Postia placenta Mad-698-R
gi|346326889|gb|EGX96485.1| casein kinase II beta subunit [Cordy...   308   1e-81   Cordyceps militaris CM01
gi|322694992|gb|EFY86808.1| casein kinase II beta subunit [Metar...   307   1e-81   Metarhizium acridum CQMa 102
gi|402086431|gb|EJT81329.1| casein kinase II subunit beta-2 [Gae...   307   1e-81   Gaeumannomyces graminis var. tritici R3-111a-1
gi|171680291|ref|XP_001905091.1| hypothetical protein [Podospora...   307   1e-81   Podospora anserina S mat+
gi|396462894|ref|XP_003836058.1| similar to casein kinase subuni...   306   2e-81   Leptosphaeria maculans JN3
gi|71024049|ref|XP_762254.1| hypothetical protein UM06107.1 [Ust...   306   3e-81   
gi|261194727|ref|XP_002623768.1| casein kinase subunit II beta [...   306   3e-81   Blastomyces gilchristii SLH14081
gi|482805151|gb|EOA82250.1| hypothetical protein SETTUDRAFT_1423...   306   3e-81   Setosphaeria turcica Et28A
gi|327351919|gb|EGE80776.1| casein kinase subunit II beta [Ajell...   305   4e-81   Blastomyces dermatitidis ATCC 18188
gi|405120747|gb|AFR95517.1| casein kinase II beta chain [Cryptoc...   305   5e-81   Cryptococcus neoformans var. grubii H99
gi|336464655|gb|EGO52895.1| hypothetical protein NEUTE1DRAFT_916...   305   5e-81   Neurospora tetrasperma FGSC 2508
gi|321259199|ref|XP_003194320.1| casein kinase II beta chain [Cr...   305   5e-81   Cryptococcus gattii WM276
gi|164427743|ref|XP_001728406.1| casein kinase II beta subunit [...   305   6e-81   Neurospora crassa OR74A
gi|189189698|ref|XP_001931188.1| casein kinase II subunit beta [...   305   6e-81   Pyrenophora tritici-repentis Pt-1C-BFP
gi|134111973|ref|XP_775522.1| hypothetical protein CNBE2360 [Cry...   305   6e-81   Cryptococcus neoformans var. neoformans B-3501A
gi|451848081|gb|EMD61387.1| hypothetical protein COCSADRAFT_2307...   305   7e-81   Bipolaris sorokiniana ND90Pr
gi|336272403|ref|XP_003350958.1| hypothetical protein SMAC_04262...   304   1e-80   Sordaria macrospora k-hell
gi|358378734|gb|EHK16415.1| hypothetical protein TRIVIDRAFT_2321...   303   2e-80   Trichoderma virens Gv29-8
gi|336371028|gb|EGN99368.1| hypothetical protein SERLA73DRAFT_16...   303   2e-80   Serpula lacrymans var. lacrymans S7.3
gi|403417520|emb|CCM04220.1| predicted protein [Fibroporia radic...   302   5e-80   Fibroporia radiculosa
gi|388581534|gb|EIM21842.1| hypothetical protein WALSEDRAFT_5439...   301   6e-80   Wallemia mellicola CBS 633.66
gi|116206920|ref|XP_001229269.1| conserved hypothetical protein ...   301   7e-80   Chaetomium globosum CBS 148.51
gi|226290226|gb|EEH45710.1| casein kinase II subunit beta [Parac...   301   8e-80   
gi|378729739|gb|EHY56198.1| casein kinase II subunit beta-2 [Exo...   301   8e-80   Exophiala dermatitidis NIH/UT8656
gi|295669614|ref|XP_002795355.1| casein kinase II subunit beta-2...   301   9e-80   
gi|302682390|ref|XP_003030876.1| hypothetical protein SCHCODRAFT...   301   1e-79   Schizophyllum commune H4-8
gi|19115518|ref|NP_594606.1| CK2 family regulatory subunit Ckb1 ...   300   1e-79   Schizosaccharomyces pombe 972h-
gi|225682779|gb|EEH21063.1| casein kinase II subunit beta [Parac...   300   1e-79   
gi|392594477|gb|EIW83801.1| hypothetical protein CONPUDRAFT_8037...   300   2e-79   Coniophora puteana RWD-64-598 SS2
gi|340520333|gb|EGR50569.1| casein kinase II, regulatory subunit...   300   2e-79   Trichoderma reesei QM6a
gi|398411450|ref|XP_003857063.1| hypothetical protein MYCGRDRAFT...   299   3e-79   Zymoseptoria tritici IPO323
gi|358391190|gb|EHK40594.1| hypothetical protein TRIATDRAFT_2912...   299   4e-79   Trichoderma atroviride IMI 206040
gi|212542893|ref|XP_002151601.1| casein kinase 2 beta' regulator...   299   4e-79   Talaromyces marneffei ATCC 18224
gi|452290|emb|CAA52330.1| casein kinase II beta subunit [Schizos...   299   4e-79   Schizosaccharomyces pombe
gi|452988495|gb|EME88250.1| casein kinase II, beta subunit [Pseu...   298   5e-79   Cercospora fijiensis CIRAD86
gi|453088818|gb|EMF16858.1| casein kinase II subunit beta [Mycos...   298   5e-79   Sphaerulina musiva SO2202
gi|242767776|ref|XP_002341435.1| casein kinase 2 beta' regulator...   298   6e-79   Talaromyces stipitatus ATCC 10500
gi|325089728|gb|EGC43038.1| casein kinase II [Ajellomyces capsul...   298   6e-79   Histoplasma capsulatum H88
gi|225559719|gb|EEH08001.1| casein kinase subunit II beta [Ajell...   298   6e-79   Histoplasma capsulatum G186AR
gi|240276410|gb|EER39922.1| casein kinase subunit II beta [Ajell...   298   7e-79   Histoplasma capsulatum H143
gi|154280871|ref|XP_001541248.1| casein kinase II beta 2 subunit...   298   7e-79   Histoplasma capsulatum NAm1
gi|452847906|gb|EME49838.1| hypothetical protein DOTSEDRAFT_6858...   298   8e-79   Dothistroma septosporum NZE10
gi|303324425|ref|XP_003072200.1| Casein kinase II beta chain 2, ...   297   1e-78   Coccidioides posadasii C735 delta SOWgp
gi|119173743|ref|XP_001239268.1| casein kinase II beta chain [Co...   297   2e-78   Coccidioides immitis RS
gi|389625781|ref|XP_003710544.1| casein kinase II subunit beta-2...   297   2e-78   Magnaporthe oryzae 70-15
gi|326475405|gb|EGD99414.1| casein kinase subunit II beta [Trich...   296   3e-78   Trichophyton tonsurans CBS 112818
gi|302502658|ref|XP_003013290.1| hypothetical protein ARB_00475 ...   296   3e-78   Arthroderma benhamiae CBS 112371
gi|327292857|ref|XP_003231126.1| casein kinase subunit II beta [...   296   3e-78   Trichophyton rubrum CBS 118892
gi|317155760|ref|XP_001825358.2| casein kinase II subunit beta-2...   296   3e-78   Aspergillus oryzae RIB40
gi|391867655|gb|EIT76898.1| casein kinase II, beta subunit [Aspe...   296   4e-78   Aspergillus oryzae 3.042
gi|83774100|dbj|BAE64225.1| unnamed protein product [Aspergillus...   295   4e-78   Aspergillus oryzae RIB40
gi|472588537|gb|EMS26009.1| casein kinase II subunit beta [Rhodo...   295   6e-78   Rhodotorula toruloides NP11
gi|389749564|gb|EIM90735.1| hypothetical protein STEHIDRAFT_9058...   294   1e-77   Stereum hirsutum FP-91666 SS1
gi|296807843|ref|XP_002844260.1| casein kinase II subunit beta-2...   293   1e-77   Arthroderma otae CBS 113480
gi|443898915|dbj|GAC76248.1| casein kinase II, beta subunit, par...   293   2e-77   Moesziomyces antarcticus T-34
gi|392564754|gb|EIW57932.1| hypothetical protein TRAVEDRAFT_1262...   293   2e-77   Trametes versicolor FP-101664 SS1
gi|409039294|gb|EKM48934.1| hypothetical protein PHACADRAFT_1079...   293   2e-77   Phanerochaete carnosa HHB-10118-sp
gi|471901770|emb|CCO29864.1| Casein kinase II subunit beta-2 Sho...   293   2e-77   Rhizoctonia solani AG-1 IB
gi|310793251|gb|EFQ28712.1| casein kinase II regulatory subunit ...   293   3e-77   Colletotrichum graminicola M1.001
gi|67521630|ref|XP_658876.1| hypothetical protein AN1272.2 [Aspe...   292   6e-77   Aspergillus nidulans FGSC A4
gi|505755226|gb|EOQ99450.1| Casein kinase II subunit beta [Walle...   291   6e-77   Wallemia ichthyophaga EXF-994
gi|350629476|gb|EHA17849.1| hypothetical protein ASPNIDRAFT_2083...   291   6e-77   Aspergillus niger ATCC 1015
gi|145239299|ref|XP_001392296.1| casein kinase II subunit beta-2...   291   7e-77   Aspergillus niger CBS 513.88
gi|336383780|gb|EGO24929.1| hypothetical protein SERLADRAFT_3493...   291   7e-77   Serpula lacrymans var. lacrymans S7.9
gi|402222662|gb|EJU02728.1| hypothetical protein DACRYDRAFT_2171...   291   1e-76   Dacryopinax primogenitus
gi|449304708|gb|EMD00715.1| hypothetical protein BAUCODRAFT_1184...   291   1e-76   Baudoinia panamericana UAMH 10762
gi|169607477|ref|XP_001797158.1| hypothetical protein SNOG_06796...   290   2e-76   Parastagonospora nodorum SN15
gi|58267552|ref|XP_570932.1| casein kinase ii beta chain (ck ii)...   290   2e-76   Cryptococcus neoformans var. neoformans JEC21
gi|328773712|gb|EGF83749.1| hypothetical protein BATDEDRAFT_1522...   289   5e-76   Batrachochytrium dendrobatidis JAM81
gi|302665292|ref|XP_003024258.1| hypothetical protein TRV_01609 ...   288   5e-76   Trichophyton verrucosum HKI 0517
gi|299750280|ref|XP_001836649.2| casein kinase subunit II beta [...   288   5e-76   Coprinopsis cinerea okayama7#130
gi|322711522|gb|EFZ03095.1| DUF1339 domain protein [Metarhizium ...   287   1e-75   
gi|315042580|ref|XP_003170666.1| casein kinase II subunit beta-2...   287   1e-75   Microsporum gypseum CBS 118893
gi|512202746|gb|EPE31572.1| Casein kinase II beta subunit [Glare...   286   3e-75   Glarea lozoyensis ATCC 20868
gi|115491301|ref|XP_001210278.1| casein kinase II beta 2 subunit...   285   6e-75   Aspergillus terreus NIH2624
gi|395326764|gb|EJF59170.1| hypothetical protein DICSQDRAFT_1723...   284   1e-74   Dichomitus squalens LYAD-421 SS1
gi|390594580|gb|EIN03990.1| casein kinase subunit II beta [Punct...   283   2e-74   Punctularia strigosozonata HHB-11173 SS5
gi|472243050|gb|EMR87718.1| putative casein kinase ii beta subun...   282   4e-74   Botrytis cinerea BcDW1
gi|353235510|emb|CCA67522.1| related to casein kinase II beta su...   281   1e-73   Serendipita indica DSM 11827
gi|330927665|ref|XP_003301953.1| hypothetical protein PTT_13604 ...   279   4e-73   Pyrenophora teres f. teres 0-1
gi|392578538|gb|EIW71666.1| hypothetical protein TREMEDRAFT_2775...   278   6e-73   Tremella mesenterica DSM 1558
gi|440631837|gb|ELR01756.1| casein kinase 2, beta polypeptide [G...   275   5e-72   Pseudogymnoascus destructans 20631-21
gi|156053165|ref|XP_001592509.1| hypothetical protein SS1G_06750...   275   8e-72   Sclerotinia sclerotiorum 1980 UF-70
gi|238498606|ref|XP_002380538.1| casein kinase 2 beta' regulator...   274   1e-71   Aspergillus flavus NRRL3357
gi|406604755|emb|CCH43815.1| Casein kinase II subunit beta [Wick...   273   2e-71   Wickerhamomyces ciferrii
gi|242767771|ref|XP_002341434.1| casein kinase 2 beta' regulator...   270   2e-70   Talaromyces stipitatus ATCC 10500
gi|50553598|ref|XP_504210.1| YALI0E20955p [Yarrowia lipolytica] ...   267   2e-69   Yarrowia lipolytica CLIB122
gi|358372969|dbj|GAA89570.1| casein kinase II beta 2 subunit [As...   264   1e-68   Aspergillus kawachii IFO 4308
gi|258570259|ref|XP_002543933.1| casein kinase II beta subunit [...   264   2e-68   Uncinocarpus reesii 1704
gi|425774404|gb|EKV12711.1| Casein kinase 2 beta' regulatory sub...   264   2e-68   Penicillium digitatum PHI26
gi|320581875|gb|EFW96094.1| casein kinase II beta 2 subunit [Oga...   262   5e-68   
gi|50426617|ref|XP_461905.1| DEHA2G08206p [Debaryomyces hansenii...   261   1e-67   Debaryomyces hansenii CBS767
gi|344234111|gb|EGV65981.1| hypothetical protein CANTEDRAFT_1128...   258   8e-67   Candida tenuis ATCC 10573
gi|119495995|ref|XP_001264771.1| casein kinase II beta subunit C...   258   9e-67   Aspergillus fischeri NRRL 181
gi|70995195|ref|XP_752362.1| casein kinase 2 beta' regulatory su...   258   9e-67   Aspergillus fumigatus Af293
gi|150865565|ref|XP_001384834.2| hypothetical protein PICST_8385...   257   1e-66   Scheffersomyces stipitis CBS 6054
gi|494824111|gb|EON61430.1| hypothetical protein W97_00645 [Coni...   256   2e-66   Coniosporium apollinis CBS 100218
gi|459369657|gb|EMG47998.1| Casein kinase 2 beta' subunit [Candi...   256   3e-66   Candida maltosa Xu316
gi|121701997|ref|XP_001269263.1| casein kinase II beta subunit C...   255   6e-66   Aspergillus clavatus NRRL 1
gi|361130679|gb|EHL02429.1| putative Casein kinase II subunit be...   255   7e-66   Glarea lozoyensis 74030
gi|344301935|gb|EGW32240.1| hypothetical protein SPAPADRAFT_6132...   254   1e-65   Spathaspora passalidarum NRRL Y-27907
gi|340372967|ref|XP_003385015.1| PREDICTED: casein kinase II sub...   253   3e-65   Amphimedon queenslandica
gi|146417981|ref|XP_001484957.1| hypothetical protein PGUG_02686...   252   5e-65   Meyerozyma guilliermondii ATCC 6260
gi|190346490|gb|EDK38588.2| hypothetical protein PGUG_02686 [Mey...   251   1e-64   Meyerozyma guilliermondii ATCC 6260
gi|301789295|ref|XP_002930069.1| PREDICTED: casein kinase II sub...   248   7e-64   
gi|478500191|ref|XP_004424419.1| PREDICTED: casein kinase II sub...   248   8e-64   
gi|466089368|ref|XP_004286643.1| PREDICTED: casein kinase II sub...   248   8e-64   
gi|395537127|ref|XP_003770556.1| PREDICTED: casein kinase II sub...   248   8e-64   
gi|472392017|ref|XP_004415292.1| PREDICTED: casein kinase II sub...   248   8e-64   Odobenus rosmarus divergens
gi|444721101|gb|ELW61854.1| Casein kinase II subunit beta [Tupai...   248   8e-64   Tupaia chinensis
gi|512925596|ref|XP_004905498.1| PREDICTED: casein kinase II sub...   248   8e-64   
gi|511923747|ref|XP_004781035.1| PREDICTED: casein kinase II sub...   248   8e-64   Mustela putorius furo [black ferret]
gi|471418618|ref|XP_004390805.1| PREDICTED: casein kinase II sub...   248   8e-64   
gi|426352425|ref|XP_004043713.1| PREDICTED: casein kinase II sub...   248   8e-64   Gorilla gorilla gorilla [lowland gorilla]
gi|440898775|gb|ELR50200.1| Casein kinase II subunit beta [Bos g...   248   8e-64   Bos mutus
gi|148694713|gb|EDL26660.1| casein kinase II, beta subunit, isof...   248   9e-64   Mus musculus [mouse]
gi|149028072|gb|EDL83523.1| casein kinase 2, beta subunit, isofo...   248   1e-63   Rattus norvegicus [brown rat]
gi|479274680|emb|CCI79673.1| Csnk2b splicing isoform 670 [Mus mu...   248   1e-63   Mus musculus [mouse]
gi|452824770|gb|EME31771.1| casein kinase 2, beta polypeptide [G...   248   1e-63   Galdieria sulphuraria
gi|89269873|emb|CAJ83806.1| casein kinase 2, beta subunit [Xenop...   247   1e-63   Xenopus tropicalis [western clawed frog]
gi|281342582|gb|EFB18166.1| hypothetical protein PANDA_020408 [A...   247   1e-63   Ailuropoda melanoleuca
gi|181155|gb|AAA52123.1| casein kinase II beta subunit [Homo sap...   247   1e-63   Homo sapiens [man]
gi|18858421|ref|NP_571262.1| casein kinase II subunit beta [Dani...   247   1e-63   Danio rerio [leopard danio]
gi|512969761|ref|XP_004847035.1| PREDICTED: casein kinase II sub...   247   1e-63   
gi|30059126|gb|AAO38844.1| casein kinase 2 beta' subunit [Candid...   247   1e-63   Candida albicans
gi|52346076|ref|NP_001005081.1| casein kinase 2, beta polypeptid...   247   1e-63   Xenopus tropicalis [western clawed frog]
gi|60834087|gb|AAX37079.1| casein kinase 2 beta polypeptide [syn...   247   1e-63   synthetic construct
gi|348533844|ref|XP_003454414.1| PREDICTED: casein kinase II sub...   247   1e-63   Oreochromis niloticus
gi|7106277|ref|NP_034105.1| casein kinase II subunit beta [Mus m...   247   2e-63   Mus musculus [mouse]
gi|432908434|ref|XP_004077859.1| PREDICTED: casein kinase II sub...   247   2e-63   Oryzias latipes [Japanese rice fish]
gi|470501653|ref|XP_004347173.1| casein kinase ii subunit beta, ...   247   2e-63   Acanthamoeba castellanii str. Neff
gi|498977118|ref|XP_004549035.1| PREDICTED: casein kinase II sub...   246   2e-63   Maylandia zebra
gi|255723141|ref|XP_002546504.1| casein kinase II beta' subunit ...   245   5e-63   Candida tropicalis MYA-3404
gi|68470456|ref|XP_720732.1| hypothetical protein CaO19.11773 [C...   245   5e-63   Candida albicans SC5314
gi|50289727|ref|XP_447295.1| hypothetical protein [Candida glabr...   245   8e-63   Candida glabrata CBS 138
gi|203282561|pdb|3EED|A Chain A, Crystal Structure Of Human Prot...   244   1e-62   Homo sapiens [man]
gi|195999064|ref|XP_002109400.1| protein kinase Ck2-beta [Tricho...   244   1e-62   Trichoplax adhaerens
gi|291231545|ref|XP_002735719.1| PREDICTED: casein kinase 2, bet...   244   1e-62   Saccoglossus kowalevskii
gi|255717274|ref|XP_002554918.1| KLTH0F16852p [Lachancea thermot...   244   1e-62   Lachancea thermotolerans CBS 6340
gi|354547231|emb|CCE43965.1| hypothetical protein CPAR2_501900 [...   244   2e-62   Candida parapsilosis
gi|238882675|gb|EEQ46313.1| casein kinase II beta' subunit [Cand...   243   2e-62   Candida albicans WO-1
gi|313573614|emb|CBK38916.1| protein kinase CK2beta regulatory s...   243   2e-62   Mytilus galloprovincialis
gi|448515532|ref|XP_003867362.1| Ckb2 regulatory subunit of prot...   243   2e-62   Candida orthopsilosis Co 90-125
gi|390349651|ref|XP_003727253.1| PREDICTED: casein kinase II sub...   243   3e-62   Strongylocentrotus purpuratus [purple urchin]
gi|444315205|ref|XP_004178260.1| hypothetical protein TBLA_0A095...   243   3e-62   Tetrapisispora blattae CBS 6284
gi|156373129|ref|XP_001629386.1| predicted protein [Nematostella...   243   3e-62   Nematostella vectensis
gi|449686740|ref|XP_002161949.2| PREDICTED: casein kinase II sub...   242   4e-62   
gi|260944470|ref|XP_002616533.1| hypothetical protein CLUG_03774...   242   5e-62   Clavispora lusitaniae ATCC 42720
gi|241955675|ref|XP_002420558.1| beta' regulatory subunit of cas...   242   6e-62   Candida dubliniensis CD36
gi|328351558|emb|CCA37957.1| Casein kinase II subunit beta [Koma...   241   7e-62   Komagataella phaffii CBS 7435
gi|149237983|ref|XP_001524868.1| casein kinase II beta 2 subunit...   241   8e-62   Lodderomyces elongisporus NRRL YB-4239
gi|281204801|gb|EFA78996.1| putative casein kinase II beta chain...   241   1e-61   Polysphondylium pallidum PN500
gi|323449556|gb|EGB05443.1| hypothetical protein AURANDRAFT_5464...   241   1e-61   Aureococcus anophagefferens
gi|318087154|gb|ADV40169.1| casein kinase 2 beta subunit isoform...   241   1e-61   Latrodectus hesperus [black widow]
gi|50309855|ref|XP_454941.1| hypothetical protein [Kluyveromyces...   241   1e-61   Kluyveromyces lactis NRRL Y-1140
gi|72110360|ref|XP_780696.1| PREDICTED: casein kinase II subunit...   241   1e-61   Strongylocentrotus purpuratus [purple urchin]
gi|350416270|ref|XP_003490894.1| PREDICTED: casein kinase II sub...   241   1e-61   Bombus impatiens
gi|410925180|ref|XP_003976059.1| PREDICTED: casein kinase II sub...   240   2e-61   Takifugu rubripes [tiger puffer]
gi|328777239|ref|XP_624048.2| PREDICTED: casein kinase II subuni...   240   2e-61   Apis mellifera [European honey bee]
gi|365987614|ref|XP_003670638.1| hypothetical protein NDAI_0F007...   240   2e-61   Naumovozyma dairenensis CBS 421
gi|340711481|ref|XP_003394304.1| PREDICTED: casein kinase II sub...   239   3e-61   Bombus terrestris [large earth bumblebee]
gi|66809541|ref|XP_638493.1| hypothetical protein DDB_G0284601 [...   239   3e-61   Dictyostelium discoideum AX4
gi|391341916|ref|XP_003745272.1| PREDICTED: casein kinase II sub...   239   4e-61   Metaseiulus occidentalis
gi|340711479|ref|XP_003394303.1| PREDICTED: casein kinase II sub...   239   4e-61   
gi|508776888|gb|EOY24144.1| Casein kinase II beta chain 1 isofor...   239   4e-61   Theobroma cacao [chocolate]
gi|148909061|gb|ABR17633.1| unknown [Picea sitchensis]                239   4e-61   Picea sitchensis
gi|448120059|ref|XP_004203879.1| Piso0_000902 [Millerozyma farin...   239   5e-61   Millerozyma farinosa CBS 7064
gi|448117601|ref|XP_004203296.1| Piso0_000902 [Millerozyma farin...   239   5e-61   Millerozyma farinosa CBS 7064
gi|449017504|dbj|BAM80906.1| probable protein kinase CK2 regulat...   239   5e-61   Cyanidioschyzon merolae strain 10D
gi|260793664|ref|XP_002591831.1| hypothetical protein BRAFLDRAFT...   239   5e-61   Branchiostoma floridae
gi|147801660|emb|CAN72327.1| hypothetical protein VITISV_022015 ...   238   6e-61   Vitis vinifera
gi|508776886|gb|EOY24142.1| Casein kinase II beta chain 1 isofor...   238   6e-61   Theobroma cacao [chocolate]
gi|242020270|ref|XP_002430578.1| Casein kinase II subunit beta, ...   238   6e-61   Pediculus humanus corporis [human body lice]
gi|391341918|ref|XP_003745273.1| PREDICTED: casein kinase II sub...   238   6e-61   Metaseiulus occidentalis
gi|482549616|gb|EOA13810.1| hypothetical protein CARUB_v10026904...   238   7e-61   Capsella rubella
gi|357482235|ref|XP_003611403.1| Casein kinase II subunit beta-4...   238   7e-61   Medicago truncatula
gi|225453309|ref|XP_002269020.1| PREDICTED: putative casein kina...   238   7e-61   Vitis vinifera
gi|21261784|emb|CAD32500.1| protein kinase Ck2 regulatory subuni...   238   8e-61   Nicotiana tabacum [American tobacco]
gi|330840241|ref|XP_003292127.1| hypothetical protein DICPUDRAFT...   238   8e-61   Dictyostelium purpureum
gi|482549615|gb|EOA13809.1| hypothetical protein CARUB_v10026904...   238   9e-61   Capsella rubella
gi|195355288|ref|XP_002044124.1| GM13109 [Drosophila sechellia] ...   238   9e-61   Drosophila sechellia
gi|321466375|gb|EFX77371.1| hypothetical protein DAPPUDRAFT_3058...   238   1e-60   Daphnia pulex
gi|195131885|ref|XP_002010375.1| GI15890 [Drosophila mojavensis]...   238   1e-60   
gi|194889399|ref|XP_001977076.1| GG18445 [Drosophila erecta] >gi...   238   1e-60   
gi|470143175|ref|XP_004307257.1| PREDICTED: putative casein kina...   238   1e-60   Fragaria vesca subsp. vesca
gi|442616024|ref|NP_001259462.1| casein kinase II beta subunit, ...   238   1e-60   Drosophila melanogaster
gi|367009086|ref|XP_003679044.1| hypothetical protein TDEL_0A050...   238   1e-60   Torulaspora delbrueckii
gi|45554910|ref|NP_996415.1| casein kinase II beta subunit, isof...   238   1e-60   Drosophila melanogaster
gi|290562888|gb|ADD38838.1| Casein kinase II subunit beta [Lepeo...   238   1e-60   Lepeophtheirus salmonis
gi|261259993|gb|ACX54931.1| MIP14664p [Drosophila melanogaster]       238   1e-60   Drosophila melanogaster
gi|187121192|ref|NP_001119697.1| casein kinase II beta subunit [...   238   1e-60   Acyrthosiphon pisum
gi|225710276|gb|ACO10984.1| Casein kinase II subunit beta [Calig...   238   1e-60   Caligus rogercresseyi
gi|195396573|ref|XP_002056905.1| GJ16637 [Drosophila virilis] >g...   238   1e-60   Drosophila virilis
gi|386764249|ref|NP_001245630.1| casein kinase II beta subunit, ...   238   1e-60   Drosophila melanogaster
gi|195457224|ref|XP_002075481.1| GK14838 [Drosophila willistoni]...   238   1e-60   Drosophila willistoni
gi|386764247|ref|NP_001245629.1| casein kinase II beta subunit, ...   237   1e-60   Drosophila melanogaster
gi|225717930|gb|ACO14811.1| Casein kinase II subunit beta [Calig...   237   1e-60   Caligus clemensi
gi|195043323|ref|XP_001991596.1| GH12745 [Drosophila grimshawi] ...   237   1e-60   Drosophila grimshawi
gi|18158427|ref|NP_542940.1| casein kinase II beta subunit, isof...   237   1e-60   Drosophila melanogaster
gi|194762780|ref|XP_001963512.1| GF20435 [Drosophila ananassae] ...   237   1e-60   Drosophila ananassae
gi|356541308|ref|XP_003539120.1| PREDICTED: casein kinase II sub...   237   2e-60   Glycine max [soybeans]
gi|383848595|ref|XP_003699934.1| PREDICTED: casein kinase II sub...   237   2e-60   Megachile rotundata
gi|462416991|gb|EMJ21728.1| hypothetical protein PRUPE_ppa009433...   237   2e-60   Prunus persica
gi|502160448|ref|XP_004511748.1| PREDICTED: casein kinase II sub...   237   2e-60   Cicer arietinum [garbanzo]
gi|356497080|ref|XP_003517392.1| PREDICTED: casein kinase II sub...   237   2e-60   Glycine max [soybeans]
gi|460388830|ref|XP_004240067.1| PREDICTED: putative casein kina...   237   2e-60   Solanum lycopersicum
gi|341877475|gb|EGT33410.1| CBN-KIN-10 protein [Caenorhabditis b...   237   2e-60   Caenorhabditis brenneri
gi|17508231|ref|NP_492255.1| Protein KIN-10, isoform a [Caenorha...   237   2e-60   Caenorhabditis elegans [roundworm]
gi|224063639|ref|XP_002301241.1| predicted protein [Populus tric...   236   2e-60   Populus trichocarpa [western balsam poplar]
gi|224137102|ref|XP_002327022.1| predicted protein [Populus tric...   236   2e-60   
gi|502160451|ref|XP_004511749.1| PREDICTED: casein kinase II sub...   236   2e-60   Cicer arietinum [garbanzo]
gi|268565583|ref|XP_002639489.1| C. briggsae CBR-KIN-10 protein ...   236   3e-60   Caenorhabditis briggsae
gi|460388828|ref|XP_004240066.1| PREDICTED: putative casein kina...   236   3e-60   Solanum lycopersicum
gi|470128773|ref|XP_004300309.1| PREDICTED: casein kinase II sub...   236   3e-60   Fragaria vesca subsp. vesca
gi|156839663|ref|XP_001643520.1| hypothetical protein Kpol_473p2...   236   3e-60   Vanderwaltozyma polyspora DSM 70294
gi|45238341|emb|CAD27343.1| protein kinase 2 beta chain [Nicotia...   236   3e-60   Nicotiana tabacum [American tobacco]
gi|460367725|ref|XP_004229721.1| PREDICTED: casein kinase II sub...   236   3e-60   Solanum lycopersicum
gi|254580301|ref|XP_002496136.1| ZYRO0C11330p [Zygosaccharomyces...   236   4e-60   Zygosaccharomyces rouxii CBS 732
gi|297742197|emb|CBI33984.3| unnamed protein product [Vitis vini...   236   4e-60   Vitis vinifera
gi|296197701|ref|XP_002806733.1| PREDICTED: LOW QUALITY PROTEIN:...   236   5e-60   
gi|112983394|ref|NP_001036989.1| casein kinase 2 beta subunit [B...   235   5e-60   Bombyx mori [silk moth]
gi|307168550|gb|EFN61608.1| Casein kinase II subunit beta [Campo...   235   5e-60   Camponotus floridanus
gi|17508229|ref|NP_492254.1| Protein KIN-10, isoform b [Caenorha...   235   5e-60   Caenorhabditis elegans [roundworm]
gi|449442327|ref|XP_004138933.1| PREDICTED: putative casein kina...   235   5e-60   Cucumis sativus [cucumbers]
gi|332030518|gb|EGI70206.1| Casein kinase II subunit beta [Acrom...   235   5e-60   Acromyrmex echinatior
gi|308497959|ref|XP_003111166.1| CRE-KIN-10 protein [Caenorhabdi...   235   6e-60   Caenorhabditis remanei
gi|508776887|gb|EOY24143.1| Casein kinase II beta chain 1 isofor...   235   6e-60   Theobroma cacao [chocolate]
gi|357165059|ref|XP_003580256.1| PREDICTED: casein kinase II sub...   235   6e-60   Brachypodium distachyon [annual false brome]
gi|359474439|ref|XP_003631466.1| PREDICTED: casein kinase II sub...   235   6e-60   
gi|159463382|ref|XP_001689921.1| casein kinase 2 beta chain, CK2...   235   7e-60   Chlamydomonas reinhardtii
gi|359474435|ref|XP_002279768.2| PREDICTED: casein kinase II sub...   235   7e-60   
gi|460407074|ref|XP_004248982.1| PREDICTED: putative casein kina...   235   8e-60   Solanum lycopersicum
gi|33386536|emb|CAD45007.1| casein kinase 2 beta subunit [Takifu...   235   8e-60   Takifugu rubripes [tiger puffer]
gi|168042863|ref|XP_001773906.1| predicted protein [Physcomitrel...   235   8e-60   Physcomitrella patens
gi|410905365|ref|XP_003966162.1| PREDICTED: casein kinase II sub...   234   8e-60   Takifugu rubripes [tiger puffer]
gi|162463224|ref|NP_001104974.1| CK2 regulatory subunit B1 [Zea ...   234   9e-60   Zea mays [maize]
gi|508704653|gb|EOX96549.1| Casein kinase II beta subunit 4 isof...   234   1e-59   Theobroma cacao [chocolate]
gi|195624186|gb|ACG33923.1| casein kinase II subunit beta-4 [Zea...   234   1e-59   Zea mays [maize]
gi|15238013|ref|NP_199519.1| casein kinase 2 subunit beta [Arabi...   234   1e-59   Arabidopsis thaliana [mouse-ear cress]
gi|297790971|ref|XP_002863370.1| hypothetical protein ARALYDRAFT...   234   1e-59   
gi|356511072|ref|XP_003524255.1| PREDICTED: putative casein kina...   234   1e-59   
gi|388491214|gb|AFK33673.1| unknown [Lotus japonicus]                 234   1e-59   
gi|29367573|gb|AAO72648.1| possible protein kinase CK2 regulator...   234   1e-59   
gi|334188238|ref|NP_001190483.1| casein kinase 2 subunit beta [A...   234   1e-59   
gi|195628750|gb|ACG36205.1| casein kinase II subunit beta-4 [Zea...   234   1e-59   
gi|218199655|gb|EEC82082.1| hypothetical protein OsI_26078 [Oryz...   234   1e-59   
gi|115472189|ref|NP_001059693.1| Os07g0495100 [Oryza sativa Japo...   234   1e-59   
gi|74096135|ref|NP_001027591.1| protein kinase Ck2-beta [Ciona i...   234   2e-59   
gi|410078293|ref|XP_003956728.1| hypothetical protein KAFR_0C060...   234   2e-59   
gi|222637075|gb|EEE67207.1| hypothetical protein OsJ_24322 [Oryz...   234   2e-59   
gi|156246|gb|AAA27983.1| casein kinase II beta subunit [Caenorha...   233   2e-59   
gi|513031318|gb|AGO11342.1| AaceriACR087Cp [Saccharomycetaceae s...   233   2e-59   
gi|162463349|ref|NP_001104975.1| LOC541824 [Zea mays] >gi|115270...   233   2e-59   
gi|302850333|ref|XP_002956694.1| hypothetical protein VOLCADRAFT...   233   2e-59   
gi|356497082|ref|XP_003517393.1| PREDICTED: casein kinase II sub...   233   2e-59   
gi|115483490|ref|NP_001065415.1| Os10g0564900 [Oryza sativa Japo...   233   3e-59   
gi|470128769|ref|XP_004300307.1| PREDICTED: casein kinase II sub...   233   3e-59   
gi|12597893|gb|AAG60201.1|AC084763_21 putative casein kinase II ...   233   3e-59   
gi|357114526|ref|XP_003559051.1| PREDICTED: putative casein kina...   233   3e-59   
gi|511923743|ref|XP_004781033.1| PREDICTED: casein kinase II sub...   233   3e-59   
gi|357122751|ref|XP_003563078.1| PREDICTED: putative casein kina...   233   3e-59   
gi|217073057|gb|ACJ84888.1| unknown [Medicago truncatula]             233   3e-59   
gi|168043961|ref|XP_001774451.1| predicted protein [Physcomitrel...   233   3e-59   
gi|482553014|gb|EOA17207.1| hypothetical protein CARUB_v10005479...   233   3e-59   
gi|45185773|ref|NP_983489.1| ACR087Cp [Ashbya gossypii ATCC 1089...   233   3e-59   
gi|113374086|dbj|BAF03602.1| casein kinase II beta [Hordeum vulg...   233   3e-59   
gi|502152540|ref|XP_004508973.1| PREDICTED: casein kinase II sub...   233   3e-59   
gi|15236597|ref|NP_193499.1| casein kinase II  beta chain 2 [Ara...   233   4e-59   
gi|462405170|gb|EMJ10634.1| hypothetical protein PRUPE_ppa009594...   233   4e-59   
gi|357147461|ref|XP_003574352.1| PREDICTED: casein kinase II sub...   233   4e-59   
gi|403214248|emb|CCK68749.1| hypothetical protein KNAG_0B03070 [...   232   4e-59   
gi|359807361|ref|NP_001241381.1| uncharacterized protein LOC1007...   232   4e-59   
gi|91078036|ref|XP_966313.1| PREDICTED: similar to casein kinase...   232   4e-59   
gi|482553013|gb|EOA17206.1| hypothetical protein CARUB_v10005479...   232   5e-59   
gi|222613281|gb|EEE51413.1| hypothetical protein OsJ_32490 [Oryz...   232   5e-59   
gi|502152538|ref|XP_004508972.1| PREDICTED: casein kinase II sub...   232   5e-59   
gi|462405171|gb|EMJ10635.1| hypothetical protein PRUPE_ppa009594...   232   5e-59   
gi|479274748|emb|CCI79707.1| chimera Csnk2b-Ly6g5b splicing isof...   232   5e-59   
gi|313228994|emb|CBY18146.1| unnamed protein product [Oikopleura...   232   6e-59   
gi|511923749|ref|XP_004781036.1| PREDICTED: casein kinase II sub...   232   6e-59   
gi|224011944|ref|XP_002294625.1| predicted protein [Thalassiosir...   232   6e-59   
gi|443697104|gb|ELT97659.1| hypothetical protein CAPTEDRAFT_2235...   232   7e-59   
gi|393911188|gb|EFO26037.2| casein kinase II subunit beta [Loa loa]   232   7e-59   
gi|402592504|gb|EJW86432.1| casein kinase 2 beta polypeptide [Wu...   231   7e-59   
gi|170592967|ref|XP_001901236.1| Csnk2b protein [Brugia malayi] ...   231   7e-59   
gi|89257694|gb|ABD65181.1| casein kinase II beta chain, putative...   231   7e-59   
gi|384251127|gb|EIE24605.1| hypothetical protein COCSUDRAFT_2290...   231   7e-59   
gi|116794480|gb|ABK27157.1| unknown [Picea sitchensis]                231   7e-59   
gi|334186652|ref|NP_001190757.1| casein kinase II  beta chain 2 ...   231   8e-59   
gi|255646715|gb|ACU23831.1| unknown [Glycine max]                     231   8e-59   
gi|363753682|ref|XP_003647057.1| hypothetical protein Ecym_5497 ...   231   8e-59   
gi|479274690|emb|CCI79678.1| chimera Csnk2b-Ly6g5b splicing isof...   231   9e-59   
gi|312070194|ref|XP_003138033.1| Csnk2b protein [Loa loa]             231   9e-59   
gi|89257558|gb|ABD65048.1| Casein kinase II beta chain, putative...   231   9e-59   
gi|195123029|ref|XP_002006012.1| GI20794 [Drosophila mojavensis]...   231   1e-58   
gi|460392757|ref|XP_004241980.1| PREDICTED: putative casein kina...   231   1e-58   
gi|299472384|emb|CBN77572.1| conserved unknown protein [Ectocarp...   231   1e-58   
gi|359474437|ref|XP_003631465.1| PREDICTED: casein kinase II sub...   231   1e-58   
gi|194707884|gb|ACF88026.1| unknown [Zea mays] >gi|414886791|tpg...   231   1e-58   
gi|255071109|ref|XP_002507636.1| predicted protein [Micromonas s...   230   2e-58   
gi|449461275|ref|XP_004148367.1| PREDICTED: casein kinase II sub...   230   2e-58   
gi|470320782|ref|XP_004348869.1| Csnk2b protein [Capsaspora owcz...   229   3e-58   
gi|479274770|emb|CCI79718.1| chimera Csnk2b-Ly6g5b splicing isof...   229   3e-58   
gi|501291929|dbj|BAN20428.1| hypothetical protein [Riptortus ped...   229   3e-58   
gi|401623657|gb|EJS41749.1| ckb2p [Saccharomyces arboricola H-6]      229   3e-58   
gi|290981982|ref|XP_002673710.1| predicted protein [Naegleria gr...   229   3e-58   
gi|1933|emb|CAA39858.1| casein kinase II beta subunit [Sus scrofa]    229   3e-58   
gi|401841793|gb|EJT44124.1| CKB2-like protein [Saccharomyces kud...   229   4e-58   
gi|332375214|gb|AEE62748.1| unknown [Dendroctonus ponderosae]         229   4e-58   
gi|156118304|gb|ABU49713.1| casein kinase II beta subunit [Danau...   229   5e-58   
gi|478255053|gb|ENN75283.1| hypothetical protein YQE_08060, part...   229   5e-58   
gi|363543539|ref|NP_001241779.1| casein kinase II subunit beta-4...   229   5e-58   
gi|366999767|ref|XP_003684619.1| hypothetical protein TPHA_0C002...   229   5e-58   
gi|363543447|ref|NP_001241733.1| casein kinase II subunit beta-4...   229   5e-58   
gi|479274692|emb|CCI79679.1| chimera Csnk2b-Ly6g5b splicing isof...   229   5e-58   
gi|388511311|gb|AFK43717.1| unknown [Lotus japonicus]                 229   5e-58   
gi|168004469|ref|XP_001754934.1| predicted protein [Physcomitrel...   229   6e-58   
gi|226501036|ref|NP_001149821.1| casein kinase II subunit beta-4...   229   6e-58   
gi|223975169|gb|ACN31772.1| unknown [Zea mays]                        228   6e-58   
gi|47225552|emb|CAG12035.1| unnamed protein product [Tetraodon n...   228   6e-58   
gi|351713144|gb|EHB16063.1| Casein kinase II subunit beta [Heter...   228   6e-58   
gi|15224934|ref|NP_181996.1| casein kinase II  beta subunit 4 [A...   228   6e-58   
gi|479274728|emb|CCI79697.1| chimera CSNK2B-LY6G5B splicing isof...   228   7e-58   
gi|195336072|ref|XP_002034671.1| casein kinase II beta2 subunit ...   228   7e-58   
gi|6016425|sp|O76485.1|CSK2B_SPOFR RecName: Full=Casein kinase I...   228   7e-58   
gi|482563460|gb|EOA27650.1| hypothetical protein CARUB_v10023797...   228   8e-58   
gi|118485664|gb|ABK94682.1| unknown [Populus trichocarpa]             228   8e-58   
gi|195585061|ref|XP_002082313.1| casein kinase II beta2 subunit ...   228   8e-58   
gi|302797338|ref|XP_002980430.1| hypothetical protein SELMODRAFT...   228   9e-58   
gi|297828187|ref|XP_002881976.1| hypothetical protein ARALYDRAFT...   228   9e-58   
gi|302769648|ref|XP_002968243.1| hypothetical protein SELMODRAFT...   228   9e-58   
gi|302758478|ref|XP_002962662.1| hypothetical protein SELMODRAFT...   228   9e-58   
gi|194881549|ref|XP_001974893.1| GG22024 [Drosophila erecta] >gi...   228   1e-57   
gi|307210165|gb|EFN86838.1| Casein kinase II subunit beta [Harpe...   228   1e-57   
gi|224126601|ref|XP_002329595.1| predicted protein [Populus tric...   228   1e-57   
gi|499003366|ref|XP_004535069.1| PREDICTED: casein kinase II sub...   228   1e-57   
gi|15232283|ref|NP_191584.1| casein kinase 2 subunit beta-3 [Ara...   228   1e-57   
gi|366995089|ref|XP_003677308.1| hypothetical protein NCAS_0G006...   228   1e-57   
gi|297820884|ref|XP_002878325.1| hypothetical protein ARALYDRAFT...   228   1e-57   
gi|499003370|ref|XP_004535071.1| PREDICTED: casein kinase II sub...   227   1e-57   
gi|339777579|gb|AEK05627.1| casein kinase II beta subunit [Popul...   227   2e-57   
gi|156843154|ref|XP_001644646.1| hypothetical protein Kpol_526p4...   227   2e-57   
gi|162461786|ref|NP_001105624.1| LOC542628 [Zea mays] >gi|115270...   227   2e-57   
gi|156545555|ref|XP_001606149.1| PREDICTED: casein kinase II sub...   226   3e-57   
gi|482560361|gb|EOA24552.1| hypothetical protein CARUB_v10017809...   226   3e-57   
gi|297804418|ref|XP_002870093.1| hypothetical protein ARALYDRAFT...   226   3e-57   
gi|195382227|ref|XP_002049832.1| GJ20529 [Drosophila virilis] >g...   226   3e-57   
gi|56754953|gb|AAW25659.1| SJCHGC01319 protein [Schistosoma japo...   226   4e-57   
gi|255639654|gb|ACU20121.1| unknown [Glycine max]                     226   4e-57   
gi|323303085|gb|EGA56888.1| Ckb2p [Saccharomyces cerevisiae Fost...   226   4e-57   
gi|6324613|ref|NP_014682.1| Ckb2p [Saccharomyces cerevisiae S288...   226   4e-57   
gi|256273422|gb|EEU08358.1| Ckb2p [Saccharomyces cerevisiae JAY291]   225   5e-57   
gi|256075276|ref|XP_002573946.1| casein kinase II beta subunit [...   225   5e-57   
gi|413955187|gb|AFW87836.1| hypothetical protein ZEAMMB73_000671...   225   5e-57   
gi|195486916|ref|XP_002091705.1| GE12102 [Drosophila yakuba] >gi...   225   7e-57   
gi|326497979|dbj|BAJ94852.1| predicted protein [Hordeum vulgare ...   225   7e-57   
gi|55669667|pdb|1RQF|A Chain A, Structure Of Ck2 Beta Subunit Cr...   225   7e-57   
gi|326524686|dbj|BAK04279.1| predicted protein [Hordeum vulgare ...   225   7e-57   
gi|30689795|ref|NP_850421.1| casein kinase II  beta subunit 4 [A...   225   8e-57   
gi|482563459|gb|EOA27649.1| hypothetical protein CARUB_v10023797...   225   8e-57   
gi|241835876|ref|XP_002415079.1| casein kinase II, beta subunit,...   224   9e-57   
gi|219115940|ref|XP_002178765.1| predicted protein [Phaeodactylu...   224   9e-57   
gi|488553183|ref|XP_004467899.1| PREDICTED: casein kinase II sub...   224   1e-56   
gi|17137628|ref|NP_477407.1| casein kinase II beta2 subunit [Dro...   224   1e-56   
gi|485631103|gb|EOD26246.1| hypothetical protein EMIHUDRAFT_7361...   224   1e-56   
gi|195028809|ref|XP_001987268.1| GH21823 [Drosophila grimshawi] ...   224   1e-56   
gi|326435744|gb|EGD81314.1| casein kinase II beta subunit [Salpi...   224   1e-56   
gi|195429411|ref|XP_002062756.1| GK19625 [Drosophila willistoni]...   224   1e-56   
gi|462416657|gb|EMJ21394.1| hypothetical protein PRUPE_ppa014667...   224   1e-56   
gi|186511221|ref|NP_001118861.1| casein kinase 2 subunit beta-3 ...   224   2e-56   
gi|29841138|gb|AAP06151.1| similar to NM_131187 casein kinase 2 ...   224   2e-56   
gi|470146790|ref|XP_004309004.1| PREDICTED: LOW QUALITY PROTEIN:...   223   2e-56   
gi|405956432|gb|EKC23043.1| Casein kinase II subunit beta [Crass...   223   2e-56   
gi|482560360|gb|EOA24551.1| hypothetical protein CARUB_v10017809...   222   5e-56   
gi|226474328|emb|CAX71650.1| casein kinase 2, beta polypeptide [...   222   5e-56   
gi|308800266|ref|XP_003074914.1| Ck2b protein kinase CK2, B regu...   221   9e-56   
gi|194753458|ref|XP_001959029.1| GF12259 [Drosophila ananassae] ...   221   1e-55   
gi|29650459|gb|AAO86771.1| casein kinase II beta subunit [Schist...   220   2e-55   
gi|195154795|ref|XP_002018298.1| GL17632 [Drosophila persimilis]...   220   2e-55   
gi|412990434|emb|CCO19752.1| predicted protein [Bathycoccus pras...   220   2e-55   
gi|303273322|ref|XP_003056022.1| predicted protein [Micromonas p...   220   2e-55   
gi|145343721|ref|XP_001416461.1| predicted protein [Ostreococcus...   219   4e-55   
gi|29841444|gb|AAP06476.1| similar to NM_009975 Casein kinase II...   219   6e-55   
gi|254569674|ref|XP_002491947.1| Beta' regulatory subunit of cas...   218   8e-55   
gi|7767026|pdb|1QF8|A Chain A, Truncated Form Of Casein Kinase I...   218   9e-55   
gi|226468496|emb|CAX69925.1| beta subunit of casein kinase II [S...   217   2e-54   
gi|168019514|ref|XP_001762289.1| predicted protein [Physcomitrel...   217   2e-54   
gi|226474746|emb|CAX77630.1| casein kinase 2, beta polypeptide [...   217   2e-54   
gi|349916148|dbj|GAA27823.1| casein kinase II subunit beta [Clon...   216   3e-54   
gi|198468341|ref|XP_002134009.1| GA27055 [Drosophila pseudoobscu...   216   3e-54   
gi|325182353|emb|CCA16806.1| casein kinase II subunit beta putat...   216   3e-54   
gi|195165801|ref|XP_002023727.1| GL19762 [Drosophila persimilis]...   216   4e-54   
gi|465995317|gb|EMP39728.1| Casein kinase II subunit beta [Chelo...   215   5e-54   
gi|312101536|ref|XP_003149670.1| casein kinase II [Loa loa] >gi|...   215   6e-54   
gi|356563408|ref|XP_003549955.1| PREDICTED: casein kinase II sub...   214   1e-53   
gi|307109288|gb|EFN57526.1| hypothetical protein CHLNCDRAFT_1146...   214   2e-53   
gi|403183419|gb|EJY58086.1| AAEL017447-PD [Aedes aegypti]             213   2e-53   
gi|403183417|gb|EJY58084.1| AAEL017447-PB [Aedes aegypti]             213   2e-53   
gi|428183090|gb|EKX51949.1| hypothetical protein GUITHDRAFT_8494...   213   2e-53   
gi|301113976|ref|XP_002998758.1| casein kinase II subunit beta [...   213   2e-53   
gi|403183418|gb|EJY58085.1| AAEL017447-PC [Aedes aegypti]             213   3e-53   
gi|403183416|gb|EJY58083.1| AAEL017447-PA [Aedes aegypti]             213   3e-53   
gi|356511057|ref|XP_003524248.1| PREDICTED: putative casein kina...   213   3e-53   
gi|488553180|ref|XP_004467898.1| PREDICTED: casein kinase II sub...   209   3e-52   
gi|441594105|ref|XP_004093098.1| PREDICTED: LOW QUALITY PROTEIN:...   209   6e-52   
gi|470252706|ref|XP_004359450.1| putative casein kinase II beta ...   208   9e-52   
gi|156382693|ref|XP_001632687.1| predicted protein [Nematostella...   206   3e-51   
gi|118489558|gb|ABK96581.1| unknown [Populus trichocarpa x Popul...   206   5e-51   
gi|154346426|ref|XP_001569150.1| putative protein kinase ck2 reg...   204   2e-50   
gi|339257724|ref|XP_003369048.1| casein kinase II subunit beta [...   204   2e-50   
gi|398024970|ref|XP_003865646.1| protein kinase ck2 regulatory s...   203   3e-50   
gi|157877556|ref|XP_001687095.1| putative protein kinase ck2 reg...   203   3e-50   
gi|146104734|ref|XP_001469900.1| putative protein kinase ck2 reg...   202   4e-50   
gi|342186174|emb|CCC95659.1| unnamed protein product [Trypanosom...   202   5e-50   
gi|346975049|gb|EGY18501.1| casein kinase II subunit beta-2 [Ver...   202   5e-50   
gi|66359476|ref|XP_626916.1| protein kinase CK2 regulatory subun...   201   9e-50   
gi|401420756|ref|XP_003874867.1| putative protein kinase ck2 reg...   201   1e-49   
gi|339257728|ref|XP_003369050.1| casein kinase II subunit beta [...   201   1e-49   
gi|340059307|emb|CCC53690.1| putative casein kinase II beta chai...   199   4e-49   
gi|74025160|ref|XP_829146.1| protein kinase ck2 regulatory subun...   197   2e-48   
gi|71406755|ref|XP_805891.1| protein kinase ck2 regulatory subun...   196   3e-48   
gi|407841423|gb|EKG00735.1| dynein heavy chain, putative [Trypan...   196   3e-48   
gi|195123699|ref|XP_002006341.1| GI20990 [Drosophila mojavensis]...   195   8e-48   
gi|474071744|gb|EMS54350.1| Casein kinase II subunit beta [Triti...   195   9e-48   
gi|209882074|ref|XP_002142474.1| casein kinase II regulatory sub...   195   9e-48   
gi|475583963|gb|EMT19628.1| Casein kinase II subunit beta' [Aegi...   195   9e-48   
gi|294868400|ref|XP_002765519.1| Casein kinase II subunit beta, ...   194   1e-47   
gi|313221525|emb|CBY32272.1| unnamed protein product [Oikopleura...   194   2e-47   
gi|348690064|gb|EGZ29878.1| hypothetical protein PHYSODRAFT_3100...   194   2e-47   
gi|301119825|ref|XP_002907640.1| casein kinase II subunit beta [...   193   2e-47   
gi|255965388|gb|ACU44999.1| casein kinase II subunit beta-4 [Pfi...   193   3e-47   
gi|170059054|ref|XP_001865193.1| casein kinase II subunit beta [...   192   5e-47   
gi|194757391|ref|XP_001960948.1| GF11247 [Drosophila ananassae] ...   192   5e-47   
gi|402585178|gb|EJW79118.1| casein kinase II [Wuchereria bancrofti]   192   6e-47   
gi|393246059|gb|EJD53568.1| hypothetical protein AURDEDRAFT_1103...   192   8e-47   
gi|325188678|emb|CCA23209.1| casein kinase II subunit beta putat...   191   1e-46   
gi|406695140|gb|EKC98454.1| hypothetical protein A1Q2_07242 [Tri...   190   2e-46   
gi|403364344|gb|EJY81934.1| Casein kinase 2, beta subunit 1-1 [O...   190   2e-46   
gi|313223670|emb|CBY42023.1| unnamed protein product [Oikopleura...   190   2e-46   
gi|407397552|gb|EKF27803.1| dispersed gene family protein 1 (DGF...   190   3e-46   
gi|471232978|ref|XP_004037545.1| hypothetical protein IMG5_04935...   189   5e-46   
gi|479274670|emb|CCI79668.1| chimera Csnk2b-Ly6g5b splicing isof...   189   6e-46   
gi|19112855|ref|NP_596063.1| CK2 family regulatory subunit (pred...   186   3e-45   
gi|145485203|ref|XP_001428610.1| hypothetical protein [Parameciu...   186   3e-45   
gi|145492766|ref|XP_001432380.1| hypothetical protein [Parameciu...   186   4e-45   
gi|195380681|ref|XP_002049099.1| GJ21399 [Drosophila virilis] >g...   185   9e-45   
gi|294900220|ref|XP_002776937.1| Casein kinase II subunit beta, ...   183   3e-44   
gi|294877978|ref|XP_002768222.1| Casein kinase II subunit beta, ...   183   4e-44   
gi|405122044|gb|AFR96812.1| casein kinase II beta chain [Cryptoc...   182   4e-44   
gi|358059845|dbj|GAA94408.1| hypothetical protein E5Q_01060 [Mix...   182   4e-44   
gi|321261499|ref|XP_003195469.1| casein kinase II beta chain [Cr...   182   4e-44   
gi|195381555|ref|XP_002049513.1| GJ20708 [Drosophila virilis] >g...   182   4e-44   
gi|58269158|ref|XP_571735.1| casein kinase II beta chain [Crypto...   182   5e-44   
gi|470128771|ref|XP_004300308.1| PREDICTED: casein kinase II sub...   182   5e-44   
gi|79330025|ref|NP_001032026.1| casein kinase 2 subunit beta [Ar...   182   6e-44   
gi|470128767|ref|XP_004300306.1| PREDICTED: casein kinase II sub...   182   6e-44   
gi|42573600|ref|NP_974896.1| casein kinase 2 subunit beta [Arabi...   182   6e-44   
gi|475548764|gb|EMT11148.1| Casein kinase II subunit beta [Aegil...   182   6e-44   
gi|300120064|emb|CBK19618.2| unnamed protein product [Blastocyst...   181   1e-43   
gi|403351667|gb|EJY75329.1| Casein kinase 2, beta subunit 1-1 [O...   181   1e-43   


>gi|511007387|gb|EPB88679.1| casein kinase II subunit beta [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 253

 Score =  330 bits (846), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 148/199 (74%), Positives = 183/199 (91%), Gaps = 2/199 (1%)

Query: 4   LTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHY-VQALDLITD 62
           ++SGS+ +YAKYWIDWFL TKGNEYFCEVDEE+ILDRFNLTGL++EV HY ++ALD+ITD
Sbjct: 1   MSSGSEDEYAKYWIDWFLDTKGNEYFCEVDEEFILDRFNLTGLSAEVPHYYLEALDMITD 60

Query: 63  SLEEE-LDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQ 121
           +L+EE LD+++RE +EKSARHL+G+IHARF+ITSRGL KML+KYK+A+FGRCPRVLC+ Q
Sbjct: 61  NLDEEGLDEKVREQIEKSARHLFGMIHARFVITSRGLMKMLDKYKRAEFGRCPRVLCNMQ 120

Query: 122 PLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPP 181
            LLPVGLSD P TK+VKLYCPRCEDIYNPKS+RH +IDGAY+G++FPHMLFQV+ + LP 
Sbjct: 121 SLLPVGLSDIPMTKTVKLYCPRCEDIYNPKSSRHGAIDGAYFGTSFPHMLFQVHSNYLPS 180

Query: 182 KSNERYIPRIFGFKIHDIA 200
           K+ ERY+PRIFGFK+H+IA
Sbjct: 181 KNTERYVPRIFGFKVHEIA 199



>gi|384490754|gb|EIE81976.1| hypothetical protein RO3G_06681 [Rhizopus delemar RA 99-880]
          Length = 220

 Score =  329 bits (844), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 153/200 (76%), Positives = 182/200 (91%), Gaps = 2/200 (1%)

Query: 4   LTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQ-HYVQALDLITD 62
           ++SGSDS+Y+KYWIDWFL +KGNEYFCEVDEEYILDRFNLTGLN EVQ +Y++ALD+ITD
Sbjct: 1   MSSGSDSEYSKYWIDWFLDSKGNEYFCEVDEEYILDRFNLTGLNLEVQQYYLEALDMITD 60

Query: 63  SLEEE-LDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQ 121
           +L+EE  DD+ R+ +E++ARHLYGLIHARFIITSRGL KMLEKYKKA+FGRCPRVLC+ Q
Sbjct: 61  NLDEEKFDDKARDQIERAARHLYGLIHARFIITSRGLIKMLEKYKKAEFGRCPRVLCNLQ 120

Query: 122 PLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPP 181
           PLLPVGLSD P  K+VKLYCP+CEDIYNPKS+RHASIDGAY+G++FPHMLFQ + + +P 
Sbjct: 121 PLLPVGLSDVPCVKTVKLYCPKCEDIYNPKSSRHASIDGAYFGTSFPHMLFQAHANYMPT 180

Query: 182 KSNERYIPRIFGFKIHDIAK 201
           KSN+RY PRIFGFKIH IA+
Sbjct: 181 KSNDRYEPRIFGFKIHHIAE 200



>gi|384498876|gb|EIE89367.1| hypothetical protein RO3G_14078 [Rhizopus delemar RA 99-880]
          Length = 219

 Score =  329 bits (843), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 149/199 (74%), Positives = 183/199 (91%), Gaps = 2/199 (1%)

Query: 5   TSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEV-QHYVQALDLITDS 63
           +SGS+S+YAKYWIDWFL TKGNEYFCEVDEEYILDRFNLTGL++EV Q+Y +AL++ITD+
Sbjct: 4   SSGSESEYAKYWIDWFLDTKGNEYFCEVDEEYILDRFNLTGLSAEVPQYYTEALNMITDN 63

Query: 64  LEEE-LDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQP 122
            +EE +D+  RE +EK+ARHL+GLIHARF+IT+RGL KML+KYK+A+FGRCPRVLC+ Q 
Sbjct: 64  FDEEGVDERAREEIEKAARHLFGLIHARFLITNRGLYKMLDKYKRAEFGRCPRVLCNMQS 123

Query: 123 LLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPK 182
           LLPVGLSD P TK+VKLYCPRCEDIYNPKS+RHA+IDGAY+G++FPHMLFQVYP+ LP K
Sbjct: 124 LLPVGLSDIPMTKTVKLYCPRCEDIYNPKSSRHAAIDGAYFGTSFPHMLFQVYPNYLPSK 183

Query: 183 SNERYIPRIFGFKIHDIAK 201
           + ERY+PRIFGFK+H+IA+
Sbjct: 184 NTERYVPRIFGFKVHNIAE 202



>gi|358057626|dbj|GAA96624.1| hypothetical protein E5Q_03294 [Mixia osmundae IAM 14324]
          Length = 257

 Score =  326 bits (836), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 154/230 (66%), Positives = 180/230 (78%), Gaps = 29/230 (12%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD+++GS+SDYA  W  WFL TKGNEYFCEVD++YILDRFNLTGLN+EV HY QALDLI
Sbjct: 1   MDDISTGSESDYANTWTSWFLATKGNEYFCEVDDDYILDRFNLTGLNAEVHHYAQALDLI 60

Query: 61  TDSLE-EELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCH 119
           TD+ E EE +DEMREA+E SARHLYGLIHARFIITSRGL KM++KYKKADFGRCPRVLC+
Sbjct: 61  TDAAEIEEQNDEMREAIETSARHLYGLIHARFIITSRGLNKMVDKYKKADFGRCPRVLCY 120

Query: 120 NQPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLL 179
            Q LLPVGLSD PY K+VKLYCPRCEDIY+PKS+RH +IDGAY+GSTFPHMLF V PHL+
Sbjct: 121 AQALLPVGLSDVPYQKAVKLYCPRCEDIYSPKSSRHGAIDGAYFGSTFPHMLFMVLPHLV 180

Query: 180 PPKS----------------------------NERYIPRIFGFKIHDIAK 201
           P K+                             ERY PR+FGF++++IA+
Sbjct: 181 PSKTVSPGMTPGQGPAIQQTAGQTGGANASLKAERYKPRVFGFRVYEIAR 230



>gi|340992777|gb|EGS23332.1| enzyme regulator-like protein [Chaetomium thermophilum var.
            thermophilum DSM 1495]
          Length = 1844

 Score =  324 bits (830), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 141/200 (70%), Positives = 175/200 (87%)

Query: 1    MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
            MD+  + SDSDY  YW DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 1556 MDEYGTESDSDYTSYWRDWFISSRGNEYFCEIDEEYLTDRFNLTGLNTEVQYYQYALDLV 1615

Query: 61   TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
            TD  + + DDEMREA+EKSAR LYGL+HAR+I+T+RGLAKMLEKYKKADFG+CPRV+CH+
Sbjct: 1616 TDVFDLDCDDEMREAIEKSARQLYGLVHARYIVTTRGLAKMLEKYKKADFGKCPRVMCHS 1675

Query: 121  QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
             PLLP+GLSD P  K VKLYC +CEDIYNPKS+RHASIDGAY+G++F ++LFQVYP L+P
Sbjct: 1676 HPLLPMGLSDVPNVKPVKLYCAKCEDIYNPKSSRHASIDGAYFGTSFHNILFQVYPALIP 1735

Query: 181  PKSNERYIPRIFGFKIHDIA 200
            PKS ERY+PR++GFK+H  A
Sbjct: 1736 PKSVERYVPRVYGFKVHAAA 1755



>gi|358057627|dbj|GAA96625.1| hypothetical protein E5Q_03295 [Mixia osmundae IAM 14324]
          Length = 260

 Score =  324 bits (830), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 153/233 (65%), Positives = 180/233 (77%), Gaps = 32/233 (13%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD+++GS+SDYA  W  WFL TKGNEYFCEVD++YILDRFNLTGLN+EV HY QALDLI
Sbjct: 1   MDDISTGSESDYANTWTSWFLATKGNEYFCEVDDDYILDRFNLTGLNAEVHHYAQALDLI 60

Query: 61  TDSLEE----ELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRV 116
           TD+ +E    E +DEMREA+E SARHLYGLIHARFIITSRGL KM++KYKKADFGRCPRV
Sbjct: 61  TDAADETEIEEQNDEMREAIETSARHLYGLIHARFIITSRGLNKMVDKYKKADFGRCPRV 120

Query: 117 LCHNQPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYP 176
           LC+ Q LLPVGLSD PY K+VKLYCPRCEDIY+PKS+RH +IDGAY+GSTFPHMLF V P
Sbjct: 121 LCYAQALLPVGLSDVPYQKAVKLYCPRCEDIYSPKSSRHGAIDGAYFGSTFPHMLFMVLP 180

Query: 177 HLLPPKS----------------------------NERYIPRIFGFKIHDIAK 201
           HL+P K+                             ERY PR+FGF++++IA+
Sbjct: 181 HLVPSKTVSPGMTPGQGPAIQQTAGQTGGANASLKAERYKPRVFGFRVYEIAR 233



>gi|296424881|ref|XP_002841974.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295638227|emb|CAZ86165.1| unnamed protein product [Tuber melanosporum]
          Length = 384

 Score =  323 bits (829), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 142/200 (71%), Positives = 172/200 (86%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           M+D  S +DSDYA YW DWF++T+G+EYFCE+DEEY+ DRFNLTGL SEVQ+Y  ALDL+
Sbjct: 143 MEDFNSETDSDYASYWRDWFISTRGHEYFCEIDEEYLTDRFNLTGLQSEVQYYQYALDLV 202

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + E +D+MRE +EKSARHLYGL+HAR+IIT+RGLAKMLEKYKK DFGRCPRVLC +
Sbjct: 203 TDQFDFECEDDMREQIEKSARHLYGLVHARYIITTRGLAKMLEKYKKCDFGRCPRVLCRS 262

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GLSD P+ K VKLYC +CED+Y+PKS+RH +IDGAY+G++FPH+LFQVYP L+P
Sbjct: 263 HPLLPLGLSDLPHQKPVKLYCAKCEDVYSPKSSRHGAIDGAYFGASFPHILFQVYPGLIP 322

Query: 181 PKSNERYIPRIFGFKIHDIA 200
           PKSNERY PR FGFK H  A
Sbjct: 323 PKSNERYTPRCFGFKTHAQA 342



>gi|429856611|gb|ELA31511.1| duf1339 domain protein [Colletotrichum gloeosporioides Nara gc5]
          Length = 1425

 Score =  323 bits (829), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 141/200 (70%), Positives = 173/200 (86%)

Query: 1    MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
            MDD  S SDSDY  YW DWF++++GNEYFCE+DE+Y+ DRFNLTGLN+EVQ+Y  ALDLI
Sbjct: 1169 MDDFGSESDSDYTSYWRDWFISSRGNEYFCEIDEDYLTDRFNLTGLNTEVQYYQYALDLI 1228

Query: 61   TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
            TD  + + DDEMRE +EKSARHLYGL+HARFI+T+RGLAKMLEKYKKADFG+CPRV+CH+
Sbjct: 1229 TDVFDLDCDDEMRETIEKSARHLYGLVHARFIVTTRGLAKMLEKYKKADFGKCPRVMCHS 1288

Query: 121  QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
             PLLP+GLSD P  K VKLYC RCEDIYNPKS+RHA+IDGAY+G++F +++FQ YP L+P
Sbjct: 1289 HPLLPMGLSDVPNLKPVKLYCARCEDIYNPKSSRHAAIDGAYFGTSFHNIIFQAYPALIP 1348

Query: 181  PKSNERYIPRIFGFKIHDIA 200
             KS ERY+PR++GFK+H  A
Sbjct: 1349 TKSVERYVPRVYGFKVHASA 1368



>gi|511002542|gb|EPB83973.1| casein kinase II subunit beta [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 231

 Score =  322 bits (826), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 149/192 (77%), Positives = 175/192 (91%), Gaps = 2/192 (1%)

Query: 12  YAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQ-HYVQALDLITDSLEEE-LD 69
           YAKYWIDWFL TKGNEY+CE+DEEYILDRFNLTGLN EVQ +Y +ALD+ITD+L+EE  D
Sbjct: 16  YAKYWIDWFLETKGNEYYCEIDEEYILDRFNLTGLNLEVQQYYAEALDMITDNLDEERFD 75

Query: 70  DEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLS 129
           ++ R+ +E++ARHLYGLIHARF+IT+RGLAKML+KYKKA+FGRCPRVLC+ Q LLPVGLS
Sbjct: 76  EKARDQIERAARHLYGLIHARFVITTRGLAKMLDKYKKAEFGRCPRVLCNMQSLLPVGLS 135

Query: 130 DQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIP 189
           D P TK+VKLYCPRCEDIYNPKS+RHASIDGAY+G++FPHMLFQV+P+ LP KS ERY P
Sbjct: 136 DIPVTKTVKLYCPRCEDIYNPKSSRHASIDGAYFGTSFPHMLFQVHPNYLPTKSTERYEP 195

Query: 190 RIFGFKIHDIAK 201
           RIFGFKIH IA+
Sbjct: 196 RIFGFKIHQIAE 207



>gi|328859101|gb|EGG08211.1| hypothetical protein MELLADRAFT_47850 [Melampsora larici-populina
           98AG31]
          Length = 281

 Score =  321 bits (822), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 145/184 (78%), Positives = 171/184 (92%), Gaps = 1/184 (0%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MD+L++GS+SDYA  WI WFL+TKGNEYFCEVDEEYILDRFNLTGLNSEVQ+Y QALDLI
Sbjct: 1   MDELSTGSESDYANSWISWFLSTKGNEYFCEVDEEYILDRFNLTGLNSEVQYYGQALDLI 60

Query: 61  TDSL-EEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCH 119
           TD+L E+EL+D  RE+VE +ARHLYGLIHAR+IITSRGL+KML+K+KKADFGRCPRVLC+
Sbjct: 61  TDALGEDELEDTARESVEGAARHLYGLIHARYIITSRGLSKMLDKFKKADFGRCPRVLCY 120

Query: 120 NQPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLL 179
            QPLLPVGLSD PY+K+VKLYCPRCEDIY+PKS+RH +IDGAY+G+TFPHMLF VYP+++
Sbjct: 121 TQPLLPVGLSDSPYSKAVKLYCPRCEDIYSPKSSRHGAIDGAYFGTTFPHMLFMVYPNMV 180

Query: 180 PPKS 183
           P KS
Sbjct: 181 PSKS 184



>gi|380488485|emb|CCF37345.1| casein kinase II subunit beta-2 [Colletotrichum higginsianum]
          Length = 261

 Score =  320 bits (821), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 139/197 (70%), Positives = 172/197 (87%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD  S SDSDY  YW DWF++++GNEYFCE+DE+Y+ DRFNLTGLN+EVQ+Y  ALDLI
Sbjct: 1   MDDFVSESDSDYTSYWRDWFISSRGNEYFCEIDEDYLTDRFNLTGLNTEVQYYQYALDLI 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DDEMRE +EKSARHLYGL+HARFI+T+RGLAKMLEKYKKADFG+CPRV+CH+
Sbjct: 61  TDVFDLDCDDEMRETIEKSARHLYGLVHARFIVTTRGLAKMLEKYKKADFGKCPRVMCHS 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GL+D P  K VKLYC RCEDIYNPKS+RHA+IDGAY+G++F +++FQ YP L+P
Sbjct: 121 HPLLPMGLADIPNMKPVKLYCARCEDIYNPKSSRHAAIDGAYFGTSFHNIIFQAYPALIP 180

Query: 181 PKSNERYIPRIFGFKIH 197
            KS ERY+PR++GFK+H
Sbjct: 181 TKSAERYVPRVYGFKVH 197



>gi|342890448|gb|EGU89266.1| hypothetical protein FOXB_00219 [Fusarium oxysporum Fo5176]
 gi|477507284|gb|ENH60578.1| Casein kinase II subunit beta-2 [Fusarium oxysporum f. sp. cubense
           race 1]
          Length = 256

 Score =  320 bits (819), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 174/200 (87%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD  S SDSDY  YW DWF++++GNEYFCE+DE+Y+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 2   MDDYVSESDSDYTSYWRDWFISSRGNEYFCEIDEDYLTDRFNLTGLNTEVQYYQYALDLV 61

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + E DDEMREA+EKSARHLYGL+HAR+I+T+RGL KML+KYKKA+FG+CPRV+CH+
Sbjct: 62  TDVFDLECDDEMREAIEKSARHLYGLVHARYIVTTRGLTKMLDKYKKAEFGKCPRVMCHS 121

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GLSD P  K VKLYC RCEDIYNPKS+RHA+IDGAY+G++F ++LFQVYP L+P
Sbjct: 122 HPLLPMGLSDVPNMKPVKLYCARCEDIYNPKSSRHAAIDGAYFGTSFHNILFQVYPALIP 181

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS ERY+PR++GFK+H  A
Sbjct: 182 TKSVERYVPRVYGFKVHASA 201



>gi|46108812|ref|XP_381464.1| hypothetical protein FG01288.1 [Fusarium graminearum PH-1]
          Length = 320

 Score =  319 bits (817), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 139/200 (69%), Positives = 175/200 (87%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD  S SDSDY  YW DWF++++GNEYFCE+DE+Y+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 1   MDDYVSESDSDYTSYWRDWFISSRGNEYFCEIDEDYLTDRFNLTGLNTEVQYYQYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + E DDEMREA+EKSARHLYGL+HAR+I+T+RGL+KML+KYKKA+FG+CPRV+CH+
Sbjct: 61  TDVFDLECDDEMREAIEKSARHLYGLVHARYIVTTRGLSKMLDKYKKAEFGKCPRVMCHS 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GLSD P  K VKLYC RCEDIYNPKS+RHA+IDGAY+G++F ++LFQVYP L+P
Sbjct: 121 HPLLPMGLSDVPNLKPVKLYCARCEDIYNPKSSRHAAIDGAYFGTSFHNILFQVYPALIP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS +RY+PR++GFK+H  A
Sbjct: 181 TKSVDRYVPRVYGFKVHASA 200



>gi|408388545|gb|EKJ68228.1| hypothetical protein FPSE_11599 [Fusarium pseudograminearum CS3096]
          Length = 257

 Score =  318 bits (816), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 139/200 (69%), Positives = 175/200 (87%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD  S SDSDY  YW DWF++++GNEYFCE+DE+Y+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 2   MDDYVSESDSDYTSYWRDWFISSRGNEYFCEIDEDYLTDRFNLTGLNTEVQYYQYALDLV 61

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + E DDEMREA+EKSARHLYGL+HAR+I+T+RGL+KML+KYKKA+FG+CPRV+CH+
Sbjct: 62  TDVFDLECDDEMREAIEKSARHLYGLVHARYIVTTRGLSKMLDKYKKAEFGKCPRVMCHS 121

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GLSD P  K VKLYC RCEDIYNPKS+RHA+IDGAY+G++F ++LFQVYP L+P
Sbjct: 122 HPLLPMGLSDVPNLKPVKLYCARCEDIYNPKSSRHAAIDGAYFGTSFHNILFQVYPALIP 181

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS +RY+PR++GFK+H  A
Sbjct: 182 TKSVDRYVPRVYGFKVHASA 201



>gi|403178469|ref|XP_003336905.2| casein kinase 2, beta polypeptide [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|375164170|gb|EFP92486.2| casein kinase 2, beta polypeptide [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 275

 Score =  318 bits (816), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 155/244 (63%), Positives = 182/244 (74%), Gaps = 43/244 (17%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           +D+L++GS+SDYA  W+ WFL+TKGNEYFCEVDEEYILDRFNLTGLNSEV  Y  ALDLI
Sbjct: 6   VDELSTGSESDYANSWVTWFLSTKGNEYFCEVDEEYILDRFNLTGLNSEVHRYGMALDLI 65

Query: 61  TDSLE-EELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCH 119
           TD+   +ELD+  RE+VE +ARHLYGLIHAR+IITSRGLAKML+KYKKADFGRCPRVLC+
Sbjct: 66  TDAFGVDELDEATRESVEGAARHLYGLIHARYIITSRGLAKMLDKYKKADFGRCPRVLCN 125

Query: 120 NQPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLL 179
            QPLLPVGLSD PY+K+VKLYCPRCEDIY+PKS+RH +IDGAY+G+TFPHMLF VYP+++
Sbjct: 126 TQPLLPVGLSDTPYSKAVKLYCPRCEDIYSPKSSRHGTIDGAYFGTTFPHMLFMVYPNMV 185

Query: 180 PPK-------SN-----------------------------------ERYIPRIFGFKIH 197
           P K       SN                                   +RY PRIFGFK+H
Sbjct: 186 PTKLWRLGTISNSNQGGPPPSEVGQMVGTSSNNNTPQTGSLDSALKAQRYRPRIFGFKVH 245

Query: 198 DIAK 201
            IAK
Sbjct: 246 QIAK 249



>gi|367020430|ref|XP_003659500.1| hypothetical protein MYCTH_2296626 [Myceliophthora thermophila ATCC
           42464]
 gi|347006767|gb|AEO54255.1| hypothetical protein MYCTH_2296626 [Myceliophthora thermophila ATCC
           42464]
          Length = 277

 Score =  318 bits (815), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 172/200 (86%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD  + SDSDY  YW DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 1   MDDYATESDSDYTSYWRDWFISSRGNEYFCEIDEEYLTDRFNLTGLNTEVQYYQYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DDEMRE +EKSARHLYGL+HAR+I+T+RGLAKMLEKYKK DFG+CPRV+C++
Sbjct: 61  TDVFDLDCDDEMRETIEKSARHLYGLVHARYIVTTRGLAKMLEKYKKGDFGKCPRVMCNS 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GLSD P  K VKLYC RCED YNPKS+RHASIDGAY+G++F ++LFQVYP L+P
Sbjct: 121 HPLLPMGLSDVPNLKPVKLYCARCEDTYNPKSSRHASIDGAYFGTSFHNILFQVYPGLIP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS ERYIPR++GFK+H  A
Sbjct: 181 TKSAERYIPRVYGFKVHAAA 200



>gi|485921544|gb|EOD47236.1| putative casein kinase ii beta subunit protein [Neofusicoccum
           parvum UCRNP2]
          Length = 254

 Score =  318 bits (815), Expect = 6e-85,   Method: Compositional matrix adjust.
 Identities = 139/200 (69%), Positives = 171/200 (85%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD  S +DSDY  YW DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 1   MDDFNSETDSDYTSYWRDWFISSRGNEYFCEIDEEYLTDRFNLTGLNTEVQYYQYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DDEMREA+EKSARHLYGL+HAR+I+T+RGLAKMLEK+KKADFG+CPRV+C  
Sbjct: 61  TDVFDLDCDDEMREAIEKSARHLYGLVHARYIVTTRGLAKMLEKFKKADFGKCPRVMCDA 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
           QPLLP+G SD P T  VKLYC RCED+YNPKS+RHASIDGAY+G++F ++LFQVYP +LP
Sbjct: 121 QPLLPMGQSDVPNTSPVKLYCARCEDLYNPKSSRHASIDGAYFGTSFHNILFQVYPAMLP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
           PK   RY PR+FGF++H  A
Sbjct: 181 PKFQRRYEPRVFGFRVHAAA 200



>gi|367043420|ref|XP_003652090.1| hypothetical protein THITE_2113125 [Thielavia terrestris NRRL 8126]
 gi|346999352|gb|AEO65754.1| hypothetical protein THITE_2113125 [Thielavia terrestris NRRL 8126]
          Length = 283

 Score =  318 bits (815), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 139/200 (69%), Positives = 173/200 (86%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD  + SDSDY  YW DWF++++GNEYFCE+DE+Y+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 1   MDDYATESDSDYTSYWRDWFISSRGNEYFCEIDEDYLTDRFNLTGLNTEVQYYQYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DDEMREA+EKSARHLYGL+HAR+I+T+RGLAKMLEKYKKADFG+CPRV+C++
Sbjct: 61  TDVFDLDCDDEMREAIEKSARHLYGLVHARYIVTTRGLAKMLEKYKKADFGKCPRVMCNS 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GLSD P  K  KLYC RCED YNPKS+RHASIDGAY+G++F ++LFQVYP L+P
Sbjct: 121 HPLLPMGLSDIPNVKPAKLYCARCEDTYNPKSSRHASIDGAYFGTSFHNILFQVYPGLVP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS ERY+PR++GFK+H  A
Sbjct: 181 AKSIERYVPRVYGFKVHAAA 200



>gi|393231426|gb|EJD39018.1| hypothetical protein AURDEDRAFT_116260 [Auricularia delicata
           TFB-10046 SS5]
          Length = 254

 Score =  318 bits (814), Expect = 9e-85,   Method: Compositional matrix adjust.
 Identities = 148/231 (64%), Positives = 178/231 (77%), Gaps = 30/231 (12%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MD+L++GSDS Y+  WI WFL++KGNEYFCE+D++YILDRFNLTGLN+EVQ+Y QA DLI
Sbjct: 1   MDELSTGSDSAYSNSWISWFLSSKGNEYFCEIDDDYILDRFNLTGLNTEVQNYSQAFDLI 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD+ +EE  +E+R ++E  AR LYGLIHAR+IITSRGLAKMLEKYKKADFGRCPRVLC  
Sbjct: 61  TDNFDEEFPEEVRASLEVQARFLYGLIHARWIITSRGLAKMLEKYKKADFGRCPRVLCQQ 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
           QPLLPVGL+D PY KSVKLYC RCED+Y+PKS+RH SIDGAY+G++FPHMLF VYPH++P
Sbjct: 121 QPLLPVGLTDVPYEKSVKLYCGRCEDLYSPKSSRHGSIDGAYFGTSFPHMLFLVYPHMIP 180

Query: 181 PK------------------------------SNERYIPRIFGFKIHDIAK 201
           PK                                ERY PRIFGF++H+IAK
Sbjct: 181 PKVGPPDVAGAGRGRPEAEGVGEGVSTAAAALKAERYRPRIFGFQVHEIAK 231



>gi|430813180|emb|CCJ29438.1| unnamed protein product [Pneumocystis jirovecii]
          Length = 233

 Score =  317 bits (812), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 139/198 (70%), Positives = 172/198 (86%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDDL S SDSDY+KYWIDWFL  KGNE+FCE+DEEYI D+FNLTG+N+EVQHY  A+D++
Sbjct: 1   MDDLLSRSDSDYSKYWIDWFLGIKGNEFFCEIDEEYIQDKFNLTGINTEVQHYNYAIDMV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + ++ +++R+ VEKSA+HLYGLIHARFI+TSRGL KMLEKYKK DFG CPRV CH+
Sbjct: 61  TDVFDHDVSEDLRDQVEKSAQHLYGLIHARFILTSRGLQKMLEKYKKYDFGCCPRVFCHS 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
           Q LLP+GLSD P + SVKLYC +CEDIY PKS+RHA+IDGAY+G+TFPH++ QVYP+L+P
Sbjct: 121 QALLPIGLSDIPNSSSVKLYCIKCEDIYTPKSSRHATIDGAYFGTTFPHIMLQVYPYLIP 180

Query: 181 PKSNERYIPRIFGFKIHD 198
            +S ERY+PRIFGFKI +
Sbjct: 181 QRSQERYVPRIFGFKIRE 198



>gi|407924548|gb|EKG17584.1| Casein kinase II regulatory subunit [Macrophomina phaseolina MS6]
          Length = 256

 Score =  317 bits (811), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 139/200 (69%), Positives = 171/200 (85%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD  S +DSDY  YW DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 1   MDDFNSETDSDYTSYWRDWFISSRGNEYFCEIDEEYLTDRFNLTGLNTEVQYYQYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DDEMREA+EKSARHLYGL+HAR+I+T+RGLAKMLEK+KKADFG+CPRV+C  
Sbjct: 61  TDVFDLDCDDEMREAIEKSARHLYGLVHARYIVTTRGLAKMLEKFKKADFGKCPRVMCDA 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
           QPLLP+G SD P T  VKLYC RCED+YNPKS+RHASIDGAY+G++F ++LFQVYP +LP
Sbjct: 121 QPLLPMGQSDVPNTSPVKLYCARCEDLYNPKSSRHASIDGAYFGTSFHNILFQVYPAMLP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
           PK   RY PR+FGF++H  A
Sbjct: 181 PKFQRRYEPRVFGFRVHAYA 200



>gi|449542404|gb|EMD33383.1| hypothetical protein CERSUDRAFT_117995 [Ceriporiopsis subvermispora
           B]
          Length = 271

 Score =  316 bits (810), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 150/248 (60%), Positives = 183/248 (73%), Gaps = 47/248 (18%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           M+D ++GSDSDY+KYWI WFL++KGNEYFCEV+E+YILDRFNLTGLN+EVQHY QALDLI
Sbjct: 1   MEDASTGSDSDYSKYWISWFLSSKGNEYFCEVEEDYILDRFNLTGLNTEVQHYSQALDLI 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD+L++E+ D+ R  ++  AR LYGLIHAR+I+T+RGLAKMLEKYKKADFGRCPRVLC +
Sbjct: 61  TDNLDDEIQDDFRGTLDVQARLLYGLIHARWIVTARGLAKMLEKYKKADFGRCPRVLCQS 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
           QPLLPVGL+D PY KSVKLYC RCEDIY+PKS+RH SIDGAY+G++FPH+LF VYP+L+P
Sbjct: 121 QPLLPVGLTDVPYEKSVKLYCGRCEDIYSPKSSRHGSIDGAYFGTSFPHLLFLVYPNLIP 180

Query: 181 PKSN-----------------------------------------------ERYIPRIFG 193
           PKS                                                +RY PRIFG
Sbjct: 181 PKSGPVDFAPNMRGAGDVEASRRNRRGREDQEPPTDSMTEGFSTATAALKADRYRPRIFG 240

Query: 194 FKIHDIAK 201
           F++H+IAK
Sbjct: 241 FQVHEIAK 248



>gi|477525204|gb|ENH77119.1| casein kinase subunit ii beta [Colletotrichum orbiculare MAFF
           240422]
          Length = 264

 Score =  315 bits (807), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 137/197 (69%), Positives = 171/197 (86%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD  S S+SDY  YW DWF++++GNEYFCE+DE+Y+ DRFNLTGLN+EVQ+Y  ALDLI
Sbjct: 2   MDDFVSESESDYTSYWRDWFISSRGNEYFCEIDEDYLTDRFNLTGLNTEVQYYQYALDLI 61

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DDEMRE +EKSARHLYGL+HARF++T+RGLAKMLEKYKKADFG+CPRV+CH+
Sbjct: 62  TDVFDLDCDDEMRETIEKSARHLYGLVHARFVVTTRGLAKMLEKYKKADFGKCPRVMCHS 121

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GLSD P  K VKLYC RCEDIYNPKS+RHA+IDGAY+G++F +++FQ Y  L+P
Sbjct: 122 HPLLPMGLSDVPNVKPVKLYCGRCEDIYNPKSSRHAAIDGAYFGTSFHNIIFQAYGALIP 181

Query: 181 PKSNERYIPRIFGFKIH 197
            KS ERY+PR++GFK+H
Sbjct: 182 TKSVERYVPRVYGFKVH 198



>gi|512188913|gb|EPE04682.1| casein kinase ii beta subunit [Ophiostoma piceae UAMH 11346]
          Length = 264

 Score =  315 bits (807), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 137/200 (68%), Positives = 173/200 (86%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD  S +DS+Y  YW DWF++++GNEYFCE+DE+Y+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 1   MDDFVSETDSEYTSYWRDWFISSRGNEYFCEIDEDYLTDRFNLTGLNTEVQYYQYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + +D+MRE +EKSARHLYGL+HAR+++T+RGLAKMLEKYKK+DFG+CPRV CH+
Sbjct: 61  TDVFDLDCEDDMRETIEKSARHLYGLVHARYVVTTRGLAKMLEKYKKSDFGKCPRVNCHS 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GLSD P  + VKLYC RCEDIYNPKSTRHA IDGAY+G++F ++LFQVYP L+P
Sbjct: 121 HPLLPMGLSDIPNVRPVKLYCARCEDIYNPKSTRHAVIDGAYFGTSFHNILFQVYPALIP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
           PKS ERYIPR++GFK+H  A
Sbjct: 181 PKSVERYIPRVYGFKVHASA 200



>gi|406858971|gb|EKD12049.1| casein kinase II beta subunit [Marssonina brunnea f. sp.
           'multigermtubi' MB_m1]
          Length = 268

 Score =  315 bits (807), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 173/197 (87%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD  S +DSDY  YW DWF++++GNEYFCE+DE+Y+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 1   MDDFNSETDSDYTSYWRDWFISSRGNEYFCEIDEDYLTDRFNLTGLNTEVQYYQYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DDEMRE +EKSARHLYGL+HAR+I+T+RGLAKMLEKYKKADFG+CPRV+C +
Sbjct: 61  TDVFDLDCDDEMRETIEKSARHLYGLVHARYIVTTRGLAKMLEKYKKADFGKCPRVMCKS 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+G SD P  K+VKLYC +CEDIYNPKS+RH++IDGAY+G++F +++FQVYP L+P
Sbjct: 121 HPLLPMGQSDNPNVKAVKLYCAKCEDIYNPKSSRHSAIDGAYFGTSFHNIIFQVYPALIP 180

Query: 181 PKSNERYIPRIFGFKIH 197
           PK+ +RYIPRI+GF++H
Sbjct: 181 PKTADRYIPRIYGFRVH 197



>gi|500254332|gb|EON97940.1| putative glutathione transferase protein [Togninia minima UCRPA7]
          Length = 966

 Score =  314 bits (805), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 172/200 (86%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MD+  S SDSDY  YW DWF++++GNEYFCE+DE+Y+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 705 MDEFVSESDSDYTSYWRDWFISSRGNEYFCEIDEDYLTDRFNLTGLNTEVQYYQYALDLV 764

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DDEMRE +EKSARHLYGL+HAR+I+T+RGLAKMLEKYKKADFG+CPRV+C++
Sbjct: 765 TDVFDLDCDDEMRETIEKSARHLYGLVHARYIVTTRGLAKMLEKYKKADFGKCPRVMCNS 824

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GLSD P  K VKLYC RCED YNPKS+RHA+IDGAY+G++F ++LFQVYP L+P
Sbjct: 825 HPLLPMGLSDIPNLKPVKLYCARCEDTYNPKSSRHATIDGAYFGTSFHNILFQVYPALIP 884

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS ERY PR++GFK+H  A
Sbjct: 885 AKSAERYTPRVYGFKVHAPA 904



>gi|388857380|emb|CCF49054.1| related to casein kinase II beta subunit (regulator of circadian
           clock protein FRQ) [Ustilago hordei]
          Length = 385

 Score =  314 bits (805), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 141/197 (71%), Positives = 166/197 (84%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDDLT GS    A  W+ WFL+TKGNEYFCEVDE+YILDRFNLTGLN+EVQHY QALDLI
Sbjct: 2   MDDLTEGSSDYAANSWVTWFLSTKGNEYFCEVDEDYILDRFNLTGLNAEVQHYPQALDLI 61

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TDSLE++L D +R++VE  A+ LYGL+HAR++IT+RGLAKMLEKYK+ADFGRCPRVLC+ 
Sbjct: 62  TDSLEDDLSDSIRDSVEAQAKLLYGLVHARYVITTRGLAKMLEKYKRADFGRCPRVLCYQ 121

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
           QPLLPVGLSD P+ K+VKL+CPRCEDIY+PKS+RH +IDGA++GSTFPHMLF VYPHLLP
Sbjct: 122 QPLLPVGLSDNPFQKAVKLFCPRCEDIYSPKSSRHGTIDGAFFGSTFPHMLFIVYPHLLP 181

Query: 181 PKSNERYIPRIFGFKIH 197
            KS     P +     H
Sbjct: 182 CKSPSSQSPFLLSATQH 198



>gi|345570844|gb|EGX53663.1| hypothetical protein AOL_s00006g53 [Arthrobotrys oligospora ATCC
           24927]
          Length = 281

 Score =  314 bits (805), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 171/200 (85%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           +++  S +DSDY+ YW DWF++++G+EYFCE+DEEY+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 26  LEEFNSETDSDYSSYWRDWFISSRGHEYFCEIDEEYLTDRFNLTGLNTEVQYYQYALDLV 85

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + E +D+MRE +EKSARHLYGL+HAR+IIT+RGL KMLEKYKK DFGRCPRVLC  
Sbjct: 86  TDVFDFECNDDMREQIEKSARHLYGLVHARYIITTRGLQKMLEKYKKCDFGRCPRVLCSG 145

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
           QPLLP+GLSD P  KSVKLYC RCED+Y PKS+RHA IDGAY+G++FPH+LFQVYP L+P
Sbjct: 146 QPLLPIGLSDLPNVKSVKLYCGRCEDVYVPKSSRHAVIDGAYFGASFPHILFQVYPQLIP 205

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS ER++PR FGFK+H  A
Sbjct: 206 QKSTERHVPRCFGFKVHASA 225



>gi|302925441|ref|XP_003054096.1| hypothetical protein NECHADRAFT_74480 [Nectria haematococca mpVI
           77-13-4]
 gi|256735037|gb|EEU48383.1| hypothetical protein NECHADRAFT_74480 [Nectria haematococca mpVI
           77-13-4]
          Length = 257

 Score =  314 bits (804), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 172/200 (86%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD  S SDSDY  YW DWF++++GNEYFCE+DE+Y+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 2   MDDYVSESDSDYTSYWRDWFISSRGNEYFCEIDEDYLTDRFNLTGLNTEVQYYQYALDLV 61

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + E DDEMREA+EKSARHLYGL+HAR+I+T+RGL KML+KYKKA+FG+CPRV+CH+
Sbjct: 62  TDVFDLECDDEMREAIEKSARHLYGLVHARYIVTTRGLTKMLDKYKKAEFGKCPRVMCHS 121

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GLSD    K VKLYC RCEDIYNPKS+RHA+IDGAY+G++F ++LFQVYP L+P
Sbjct: 122 HPLLPMGLSDVSNLKPVKLYCARCEDIYNPKSSRHAAIDGAYFGTSFHNILFQVYPALIP 181

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS  RY+PR++GFK+H  A
Sbjct: 182 TKSVVRYVPRVYGFKVHASA 201



>gi|470317866|gb|EMR09556.1| hypothetical protein PNEG_02143 [Pneumocystis murina B123]
          Length = 231

 Score =  313 bits (803), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 136/198 (68%), Positives = 173/198 (87%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           M+DL S S SD +KYWIDWFL  KGNE+FCE+DEEYI D+FNLTG+N+EVQHY  A++++
Sbjct: 1   MEDLLSKSYSDCSKYWIDWFLGIKGNEFFCEIDEEYIQDKFNLTGINTEVQHYNYAIEMV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + +++D++R  +EKSA+HLYGLIHARFI+T+RGL KMLEKYKK DFGRCPRVLC++
Sbjct: 61  TDVFDHDVNDDLRNQIEKSAQHLYGLIHARFILTTRGLQKMLEKYKKYDFGRCPRVLCNS 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
           Q +LPVGLSD PY+ SVKLYCP+CEDIY PKS+RH +IDGAY+G+TFPH++ QVYP+L+P
Sbjct: 121 QAVLPVGLSDIPYSSSVKLYCPKCEDIYTPKSSRHVTIDGAYFGTTFPHIMLQVYPYLIP 180

Query: 181 PKSNERYIPRIFGFKIHD 198
            KS ERY+PRIFGFK+ +
Sbjct: 181 HKSQERYVPRIFGFKVRE 198



>gi|475668915|gb|EMT66701.1| Casein kinase II subunit beta-2 [Fusarium oxysporum f. sp. cubense
           race 4]
          Length = 263

 Score =  313 bits (801), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 140/207 (67%), Positives = 174/207 (84%), Gaps = 7/207 (3%)

Query: 1   MDDLTSGSDSDYAKYWIDW-------FLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHY 53
           MDD  S SDSDY  YW DW       F++++GNEYFCE+DE+Y+ DRFNLTGLN+EVQ+Y
Sbjct: 2   MDDYVSESDSDYTSYWRDWANHGSLQFISSRGNEYFCEIDEDYLTDRFNLTGLNTEVQYY 61

Query: 54  VQALDLITDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRC 113
             ALDL+TD  + E DDEMREA+EKSARHLYGL+HAR+I+T+RGL KML+KYKKA+FG+C
Sbjct: 62  QYALDLVTDVFDLECDDEMREAIEKSARHLYGLVHARYIVTTRGLTKMLDKYKKAEFGKC 121

Query: 114 PRVLCHNQPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQ 173
           PRV+CH+ PLLP+GLSD P  K VKLYC RCEDIYNPKS+RHA+IDGAY+G++F ++LFQ
Sbjct: 122 PRVMCHSHPLLPMGLSDVPNMKPVKLYCARCEDIYNPKSSRHAAIDGAYFGTSFHNILFQ 181

Query: 174 VYPHLLPPKSNERYIPRIFGFKIHDIA 200
           VYP L+P KS ERY+PR++GFK+H  A
Sbjct: 182 VYPALIPTKSVERYVPRVYGFKVHASA 208



>gi|320588545|gb|EFX01013.1| casein kinase 2 beta subunit [Grosmannia clavigera kw1407]
          Length = 261

 Score =  313 bits (801), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 172/200 (86%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD  S +DS+Y  YW DWF++++GNEYFCE+DE+Y+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 1   MDDFVSETDSEYTSYWRDWFISSRGNEYFCEIDEDYLTDRFNLTGLNTEVQYYQYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DDEMRE +EKSARHLYGL+HAR+I+T+RGL+KML+KYKK+DFG+CPRV CH+
Sbjct: 61  TDVFDLDCDDEMRETIEKSARHLYGLVHARYIVTTRGLSKMLDKYKKSDFGKCPRVNCHS 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GLSD P  + VKLYC RCEDIYNPKSTRH+ IDGAY+G++F ++LFQVYP L+P
Sbjct: 121 HPLLPMGLSDIPNVRPVKLYCARCEDIYNPKSTRHSVIDGAYFGTSFHNILFQVYPALIP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS ERY+PR+FGFK+H  A
Sbjct: 181 SKSVERYVPRVFGFKVHASA 200



>gi|399164710|emb|CCE34404.1| Ckb-2 casein kinase II subunit beta-2 [Claviceps purpurea 20.1]
          Length = 256

 Score =  312 bits (800), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 171/200 (85%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD  S SDSDY  YW DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 2   MDDFVSESDSDYTSYWRDWFISSRGNEYFCEIDEEYLNDRFNLTGLNTEVQYYQYALDLV 61

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DDEMRE +EKSARHLYGL+HAR+I+T+RGL+KMLEKYKKA+FG+CPRV CH+
Sbjct: 62  TDVFDLDCDDEMRETIEKSARHLYGLVHARYIVTTRGLSKMLEKYKKAEFGKCPRVNCHS 121

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GL+D P    VKLYC RCED YNPKS+RHA+IDGAY+G++F +++FQVYP L+P
Sbjct: 122 HPLLPLGLNDTPNVTPVKLYCGRCEDTYNPKSSRHATIDGAYFGTSFHNIIFQVYPALIP 181

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS ERY+PR++GFK+H  A
Sbjct: 182 SKSTERYVPRVYGFKVHASA 201



>gi|471575361|gb|EMR72930.1| putative casein kinase ii beta subunit protein [Eutypa lata UCREL1]
          Length = 266

 Score =  311 bits (798), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 171/197 (86%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MD+  S SDSDY  YW DWF++++GNEYFCEVDE+Y+ DRFNLTGLN+EVQ+Y  ALDLI
Sbjct: 2   MDEFASESDSDYTSYWRDWFISSRGNEYFCEVDEDYLTDRFNLTGLNTEVQYYQYALDLI 61

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DDEMRE +EKSARHLYGLIHAR+++T+RGLAKML+KYKKADFG+CPRV C +
Sbjct: 62  TDVFDLDCDDEMRETIEKSARHLYGLIHARYVVTTRGLAKMLDKYKKADFGKCPRVFCRS 121

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+G +D P  K+VKLYC RCED+YNPKS+RHA+IDGAY+G++F +++FQVYP L+P
Sbjct: 122 HPLLPMGPTDAPNQKAVKLYCARCEDVYNPKSSRHAAIDGAYFGTSFHNIMFQVYPALVP 181

Query: 181 PKSNERYIPRIFGFKIH 197
           PK+ ERY+ R++GFK+H
Sbjct: 182 PKTPERYVARVYGFKVH 198



>gi|393221340|gb|EJD06825.1| hypothetical protein FOMMEDRAFT_102788 [Fomitiporia mediterranea
           MF3/22]
          Length = 276

 Score =  311 bits (796), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 148/248 (59%), Positives = 181/248 (72%), Gaps = 47/248 (18%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           ++++++GSDSDY+  WI WFL++KGNEYFCEV+E+YI+DRFNLTGLN+EVQ+Y QALDLI
Sbjct: 5   VEEISTGSDSDYSNSWISWFLSSKGNEYFCEVEEDYIMDRFNLTGLNTEVQNYNQALDLI 64

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD+L++E+ DE R +++  AR LYGLIHAR+IITSRGLAKMLEKYKKADFGRCPRVLC  
Sbjct: 65  TDNLDDEMADEFRGSLDVQARLLYGLIHARWIITSRGLAKMLEKYKKADFGRCPRVLCQQ 124

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
           QPLLPVGLSD PY KSVKLYC RCEDIY+PKS+RH SIDGAY+G++FPHMLF VYP ++P
Sbjct: 125 QPLLPVGLSDIPYEKSVKLYCGRCEDIYSPKSSRHGSIDGAYFGTSFPHMLFLVYPAMIP 184

Query: 181 PKSN-----------------------------------------------ERYIPRIFG 193
           PKS                                                ERY P+IFG
Sbjct: 185 PKSGPPDVLSGSVRGTEGSESSRRRRARDEPEAIAEGVGEGVSTAAAALKAERYRPKIFG 244

Query: 194 FKIHDIAK 201
           F++H+IAK
Sbjct: 245 FQVHEIAK 252



>gi|154318245|ref|XP_001558441.1| casein kinase II beta subunit [Botryotinia fuckeliana B05.10]
 gi|507414577|emb|CCD52126.2| similar to protein kinase [Botryotinia fuckeliana T4]
          Length = 270

 Score =  310 bits (795), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 133/197 (67%), Positives = 171/197 (86%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           M+D  S +DSDY  YW DWF++++GNEYFCE+DE+Y+ DRFNLTGL +EVQ+Y  ALDL+
Sbjct: 1   MEDFNSETDSDYTSYWRDWFISSRGNEYFCEIDEDYLTDRFNLTGLQTEVQYYQYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DDEMRE +EKSARHLYGL+HAR+I+T+RGLAKMLEKYKKADFG+CPRV+C +
Sbjct: 61  TDVFDLDCDDEMRETIEKSARHLYGLVHARYIVTTRGLAKMLEKYKKADFGKCPRVMCKS 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+G SD P  K+VKLYC RCEDIYNPKS+RH++IDGAY+G++F ++LFQVYP ++P
Sbjct: 121 HPLLPMGQSDNPNIKAVKLYCSRCEDIYNPKSSRHSAIDGAYFGTSFHNILFQVYPAMIP 180

Query: 181 PKSNERYIPRIFGFKIH 197
            KS +RY+PRI+GFK+H
Sbjct: 181 AKSYDRYVPRIYGFKVH 197



>gi|400595246|gb|EJP63053.1| casein kinase II beta subunit [Beauveria bassiana ARSEF 2860]
          Length = 251

 Score =  310 bits (794), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 171/200 (85%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD  S +DSDY  YW DWF++++GNEYFCE+DEEY++DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 1   MDDYGSETDSDYTSYWRDWFISSRGNEYFCEIDEEYLMDRFNLTGLNTEVQYYQYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DDEMRE +EKSARHLYGL+HAR+I+T+RGL KMLEKYKKA+FG+CPRV C  
Sbjct: 61  TDVFDLDCDDEMRETIEKSARHLYGLVHARYIVTTRGLTKMLEKYKKAEFGKCPRVDCLL 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GLSD P  + VKLYC RCEDIYNPKS+RHA+IDGAY+G++F +++FQVYP L+P
Sbjct: 121 HPLLPMGLSDVPNHRPVKLYCARCEDIYNPKSSRHAAIDGAYFGTSFQNIMFQVYPALIP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS ERY+PR++GFK+H  A
Sbjct: 181 SKSLERYVPRVYGFKVHAAA 200



>gi|501305036|dbj|GAC94305.1| casein kinase II beta subunit [Pseudozyma hubeiensis SY62]
          Length = 391

 Score =  309 bits (792), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 165/193 (85%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDDLT  S    A  W+ WFL+TKGNEYFCEVDE+YILDRFNLTGLN+EVQHY QALDLI
Sbjct: 2   MDDLTEASSDYAANSWVTWFLSTKGNEYFCEVDEDYILDRFNLTGLNAEVQHYPQALDLI 61

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TDSLE++L D +R++VE  A+ LYGL+HAR+IIT+RGLAKMLEKYK+ADFGRCPRVLC+ 
Sbjct: 62  TDSLEDDLSDSIRDSVEAQAKLLYGLVHARYIITTRGLAKMLEKYKRADFGRCPRVLCYQ 121

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
           QPLLPVGLSD P+ K+VKL+CPRCEDIY+PKS+RH +IDGA++GSTFPHMLF VYP++LP
Sbjct: 122 QPLLPVGLSDNPFQKAVKLFCPRCEDIYSPKSSRHGTIDGAFFGSTFPHMLFMVYPNVLP 181

Query: 181 PKSNERYIPRIFG 193
            KS     P + G
Sbjct: 182 SKSPTSQSPFLLG 194



>gi|343427855|emb|CBQ71381.1| related to casein kinase II beta subunit (regulator of circadian
           clock protein FRQ) [Sporisorium reilianum SRZ2]
          Length = 388

 Score =  309 bits (791), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 163/189 (86%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDDLT  S    A  W+ WFL+TKGNEYFCEVDE+YILDRFNLTGLN+EVQHY QALDLI
Sbjct: 2   MDDLTEASSDYAANSWVTWFLSTKGNEYFCEVDEDYILDRFNLTGLNAEVQHYPQALDLI 61

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TDSLE++L D +R++VE  A+ LYGL+HAR+IIT+RGLAKMLEKYK+ADFGRCPRVLC+ 
Sbjct: 62  TDSLEDDLSDSIRDSVEAQAKLLYGLVHARYIITTRGLAKMLEKYKRADFGRCPRVLCYQ 121

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
           QPLLPVGLSD P+ K+VKL+CPRCEDIY+PKS+RH +IDGA++GSTFPHMLF VYP++LP
Sbjct: 122 QPLLPVGLSDNPFQKAVKLFCPRCEDIYSPKSSRHGTIDGAFFGSTFPHMLFMVYPNVLP 181

Query: 181 PKSNERYIP 189
            KS     P
Sbjct: 182 SKSPASQSP 190



>gi|242205786|ref|XP_002468750.1| predicted protein [Postia placenta Mad-698-R]
 gi|220732135|gb|EED85973.1| predicted protein [Postia placenta Mad-698-R]
          Length = 277

 Score =  308 bits (789), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 146/247 (59%), Positives = 181/247 (73%), Gaps = 46/247 (18%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           ++D ++GSDSDY   WI WFL++KGNEYFCEV+E+YILDRFNLTGLN+EVQHY QALDLI
Sbjct: 6   VEDNSTGSDSDYTNSWISWFLSSKGNEYFCEVEEDYILDRFNLTGLNTEVQHYSQALDLI 65

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD+L++++ DE+R  ++  AR LYGLIHAR+I+T+RGLAKMLEKYK+ADFGRCPRVLC +
Sbjct: 66  TDNLDDDIQDEIRSTLDVQARLLYGLIHARWIVTARGLAKMLEKYKRADFGRCPRVLCQS 125

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
           QPLLPVGL+D PY KSVKLYC RCEDIY+PKS+RH SIDGAY+G++FPH+LF VYP+L+P
Sbjct: 126 QPLLPVGLTDVPYEKSVKLYCGRCEDIYSPKSSRHGSIDGAYFGTSFPHLLFLVYPNLIP 185

Query: 181 PKSN----------------------------------------------ERYIPRIFGF 194
           PKS                                               ERY PRIFGF
Sbjct: 186 PKSGPVDFPALRAGGEAEGSRRSRRARDEQEPPSDIVGEGFNTTSVALKAERYRPRIFGF 245

Query: 195 KIHDIAK 201
           ++++IAK
Sbjct: 246 QVNEIAK 252



>gi|346326889|gb|EGX96485.1| casein kinase II beta subunit [Cordyceps militaris CM01]
          Length = 341

 Score =  308 bits (788), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 135/200 (67%), Positives = 171/200 (85%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD  S +DSDY  YW DWF++++GNEYFCE+DEEY++DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 92  MDDYGSETDSDYTSYWRDWFISSRGNEYFCEIDEEYLMDRFNLTGLNTEVQYYQYALDLV 151

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DDEMRE +EKSARHLYGL+HAR+I+T+RGL KML+KYKKA+FG+CPRV C  
Sbjct: 152 TDVFDLDCDDEMRETIEKSARHLYGLVHARYIVTTRGLTKMLDKYKKAEFGKCPRVDCLL 211

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GLSD P  + VKLYC RCEDIYNPKS+RHA+IDGAY+G++F +++FQVYP L+P
Sbjct: 212 HPLLPMGLSDVPNHRPVKLYCGRCEDIYNPKSSRHAAIDGAYFGTSFQNIMFQVYPTLMP 271

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS ERY+PR++GFK+H  A
Sbjct: 272 SKSLERYVPRVYGFKVHAAA 291



>gi|322694992|gb|EFY86808.1| casein kinase II beta subunit [Metarhizium acridum CQMa 102]
          Length = 256

 Score =  307 bits (786), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 170/197 (86%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           M D  S SDSDY  YW DWF++++GNEYFCE+DE+Y+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 1   MQDYVSESDSDYTSYWRDWFISSRGNEYFCEIDEDYLTDRFNLTGLNTEVQYYQYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DDEMRE +EKSARHLYGL+HAR+I+T+RGL +ML+KYKKA+FG+CPRV CH+
Sbjct: 61  TDVFDLDCDDEMRETIEKSARHLYGLVHARYIVTTRGLTRMLDKYKKAEFGKCPRVNCHS 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GLSD P  K VKL+C RCEDIYNPKS+RHA+IDGAY+G++F +++FQVYP L+P
Sbjct: 121 HPLLPMGLSDVPNVKPVKLFCARCEDIYNPKSSRHATIDGAYFGTSFHNIIFQVYPALIP 180

Query: 181 PKSNERYIPRIFGFKIH 197
            K+ ERY+PR++GFK+H
Sbjct: 181 TKTMERYVPRVYGFKVH 197



>gi|402086431|gb|EJT81329.1| casein kinase II subunit beta-2 [Gaeumannomyces graminis var.
           tritici R3-111a-1]
          Length = 286

 Score =  307 bits (786), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 137/200 (68%), Positives = 165/200 (82%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD  S SDSDY  YW DWF+ +KGNEY+CE+DEEY+ DRFNLTGLN+EV +Y  ALDLI
Sbjct: 1   MDDFGSESDSDYTSYWRDWFIGSKGNEYYCEIDEEYLTDRFNLTGLNTEVSYYQYALDLI 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DDEMRE +EKSARHLYGL+HAR+I+T+RGL KML+KYKK +FG+CPRV C +
Sbjct: 61  TDVFDMDCDDEMRETIEKSARHLYGLVHARYIVTTRGLTKMLDKYKKGEFGKCPRVNCGS 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GL D P  K VKLYC RCEDIYNPKSTRHA IDGAY+G++F ++LFQVYP  +P
Sbjct: 121 HPLLPMGLCDIPNVKPVKLYCARCEDIYNPKSTRHAGIDGAYFGTSFHNILFQVYPTFIP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS ERY+PR+FGFK+H  A
Sbjct: 181 TKSAERYVPRVFGFKVHGSA 200



>gi|171680291|ref|XP_001905091.1| hypothetical protein [Podospora anserina S mat+]
 gi|170939772|emb|CAP64998.1| unnamed protein product [Podospora anserina S mat+]
          Length = 275

 Score =  307 bits (786), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 132/189 (69%), Positives = 166/189 (87%)

Query: 12  YAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELDDE 71
           Y  YW DWF++++GNEY+CE+DE+Y+ DRFNLTGLN+EVQ+Y  ALDLITD  + + DDE
Sbjct: 15  YTSYWRDWFISSRGNEYYCEIDEDYLTDRFNLTGLNTEVQYYQYALDLITDVFDLDCDDE 74

Query: 72  MREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQ 131
           MRE +EKSARHLYGLIHAR+I+T+RGLAKMLEKYKK DFG+CPRV+CH+ PLLP+GLSD 
Sbjct: 75  MRETIEKSARHLYGLIHARYIVTTRGLAKMLEKYKKCDFGKCPRVMCHSHPLLPMGLSDV 134

Query: 132 PYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRI 191
              K+VKLYC RCEDIYNPKSTRH++IDGAY+G++F ++LFQVYP L+PPK+ ERY+PR+
Sbjct: 135 ANQKAVKLYCARCEDIYNPKSTRHSAIDGAYFGTSFHNILFQVYPALVPPKTTERYVPRV 194

Query: 192 FGFKIHDIA 200
           +GFK+H  A
Sbjct: 195 YGFKVHAAA 203



>gi|396462894|ref|XP_003836058.1| similar to casein kinase subunit II beta [Leptosphaeria maculans
           JN3]
 gi|312212610|emb|CBX92693.1| similar to casein kinase subunit II beta [Leptosphaeria maculans
           JN3]
          Length = 255

 Score =  306 bits (785), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 137/200 (68%), Positives = 171/200 (85%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD  S +DSDY  YW DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 1   MDDFNSDTDSDYTSYWRDWFISSRGNEYFCEIDEEYLTDRFNLTGLNTEVQYYQYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DD+MRE +EKSARHLYGL+HAR+I+T+RGLAKMLEK+KK+DFG+CPRV+C +
Sbjct: 61  TDVFDFDCDDDMREQIEKSARHLYGLVHARYIVTTRGLAKMLEKFKKSDFGKCPRVMCES 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
           QPLLP+G SD P T  VKLYC RCED+YNPKS+RHA IDGAY+G++F ++LFQVYP +LP
Sbjct: 121 QPLLPMGPSDVPNTSPVKLYCARCEDLYNPKSSRHAVIDGAYFGTSFHNILFQVYPAMLP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
           PKS  RY PR+FGFK+H  A
Sbjct: 181 PKSQRRYEPRVFGFKVHAAA 200



>gi|71024049|ref|XP_762254.1| hypothetical protein UM06107.1 [Ustilago maydis 521]
 gi|46101756|gb|EAK86989.1| hypothetical protein UM06107.1 [Ustilago maydis 521]
          Length = 402

 Score =  306 bits (784), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 137/197 (69%), Positives = 164/197 (83%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDDLT  S    A  W+ WFL+TKGNEYFCEVDE+YILDRFNLTGLN+EVQHY  ALDLI
Sbjct: 2   MDDLTEASSDYAANSWVTWFLSTKGNEYFCEVDEDYILDRFNLTGLNAEVQHYPHALDLI 61

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TDSLE +L + +R++VE  A+ LYGL+HAR+IIT+RGLAKMLEKYK+ADFGRCPRVLC+ 
Sbjct: 62  TDSLEGDLSESIRDSVEAQAKLLYGLVHARYIITTRGLAKMLEKYKRADFGRCPRVLCYQ 121

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
           QPLLPVGLSD P+ K+VKL+CPRCEDIY+PKS+RH +IDGA++GSTFPHMLF VYP++LP
Sbjct: 122 QPLLPVGLSDNPFQKAVKLFCPRCEDIYSPKSSRHGTIDGAFFGSTFPHMLFMVYPNVLP 181

Query: 181 PKSNERYIPRIFGFKIH 197
            KS     P +    +H
Sbjct: 182 SKSPTAQSPFLLTSSLH 198



>gi|261194727|ref|XP_002623768.1| casein kinase subunit II beta [Ajellomyces dermatitidis SLH14081]
 gi|239588306|gb|EEQ70949.1| casein kinase subunit II beta [Ajellomyces dermatitidis SLH14081]
 gi|239613416|gb|EEQ90403.1| casein kinase subunit II beta [Ajellomyces dermatitidis ER-3]
          Length = 273

 Score =  306 bits (784), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 135/200 (67%), Positives = 169/200 (84%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           M+D  S ++SDY  YW DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 1   MEDFNSETESDYTSYWKDWFISSRGNEYFCEIDEEYLTDRFNLTGLNNEVQYYQYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + E D++ RE +EKSARHLYGL+HAR+I+T+RGLAKML+KYKKADFG+CPRVLC+ 
Sbjct: 61  TDVYDHETDEDTREQIEKSARHLYGLVHARYIVTTRGLAKMLDKYKKADFGKCPRVLCNQ 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GLSD P  KSV LYC +CEDIYNPKS+RHA+IDGAY+GS+F  +LFQVYP L+P
Sbjct: 121 HPLLPMGLSDLPGEKSVTLYCAKCEDIYNPKSSRHAAIDGAYFGSSFHSILFQVYPALIP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS  RY PR+FGF++H  A
Sbjct: 181 EKSLRRYDPRVFGFRVHASA 200



>gi|482805151|gb|EOA82250.1| hypothetical protein SETTUDRAFT_142347 [Setosphaeria turcica Et28A]
 gi|510031383|gb|AGN32415.1| casein kinase II regulator subunit, partial [Setosphaeria turcica]
          Length = 256

 Score =  306 bits (783), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 170/200 (85%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD  S +DSDY  YW DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 1   MDDFNSETDSDYTSYWRDWFISSRGNEYFCEIDEEYLTDRFNLTGLNTEVQYYQYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DD+MRE +EKSARHLYGL+HAR+I+T+RGLAKMLEK+KK+DFG+CPRV+C +
Sbjct: 61  TDVFDFDCDDDMREQIEKSARHLYGLVHARYIVTTRGLAKMLEKFKKSDFGKCPRVMCES 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
           QPLLP+G SD P    VKLYC RCED+YNPKS+RHA IDGAY+G++F ++LFQVYP +LP
Sbjct: 121 QPLLPMGQSDVPNASPVKLYCARCEDLYNPKSSRHAIIDGAYFGTSFHNILFQVYPAMLP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
           PKS  RY PR+FGFK+H  A
Sbjct: 181 PKSQRRYEPRVFGFKVHSAA 200



>gi|327351919|gb|EGE80776.1| casein kinase subunit II beta [Ajellomyces dermatitidis ATCC 18188]
          Length = 284

 Score =  305 bits (782), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 135/200 (67%), Positives = 169/200 (84%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           M+D  S ++SDY  YW DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 1   MEDFNSETESDYTSYWKDWFISSRGNEYFCEIDEEYLTDRFNLTGLNNEVQYYQYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + E D++ RE +EKSARHLYGL+HAR+I+T+RGLAKML+KYKKADFG+CPRVLC+ 
Sbjct: 61  TDVYDHETDEDTREQIEKSARHLYGLVHARYIVTTRGLAKMLDKYKKADFGKCPRVLCNQ 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GLSD P  KSV LYC +CEDIYNPKS+RHA+IDGAY+GS+F  +LFQVYP L+P
Sbjct: 121 HPLLPMGLSDLPGEKSVTLYCAKCEDIYNPKSSRHAAIDGAYFGSSFHSILFQVYPALIP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS  RY PR+FGF++H  A
Sbjct: 181 EKSLRRYDPRVFGFRVHASA 200



>gi|405120747|gb|AFR95517.1| casein kinase II beta chain [Cryptococcus neoformans var. grubii
           H99]
          Length = 271

 Score =  305 bits (782), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 146/238 (61%), Positives = 179/238 (75%), Gaps = 37/238 (15%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEV-QHYVQALDL 59
           M+DL++GS+SDYA  WI WFL++KGNEYFCEVDE+YILDRFNLTGLN+EV Q Y +AL L
Sbjct: 1   MEDLSTGSESDYADSWISWFLSSKGNEYFCEVDEDYILDRFNLTGLNAEVVQEYSRALSL 60

Query: 60  ITDSL-EEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLC 118
           ITD+L E++LD++ RE++E SAR LYGLIHARFI+T+RGLAKMLEKY+KADFGRCPRV C
Sbjct: 61  ITDNLNEDDLDEDTRESIETSARFLYGLIHARFIVTTRGLAKMLEKYRKADFGRCPRVYC 120

Query: 119 HNQPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHL 178
           ++QPLLPVGLSD PY K+VKLYCPRCEDIY+PKS RH SIDG+Y+G+TFPHMLF VYP +
Sbjct: 121 YSQPLLPVGLSDIPYQKAVKLYCPRCEDIYSPKSNRHGSIDGSYFGTTFPHMLFMVYPQM 180

Query: 179 LPPKSN-----------------------------------ERYIPRIFGFKIHDIAK 201
           +P K                                     E + P+IFGFK+++ AK
Sbjct: 181 IPGKGQPVGSSVADVNRSLLSAGQSREGGAGVSTSAIALKAEMFEPKIFGFKVNENAK 238



>gi|336464655|gb|EGO52895.1| hypothetical protein NEUTE1DRAFT_91678 [Neurospora tetrasperma FGSC
           2508]
          Length = 285

 Score =  305 bits (781), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 139/200 (69%), Positives = 171/200 (85%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD  S S+SDYA YW DWF++++GNEYFCE+DE+YI DRFNLTGLN+EVQ+Y  ALDLI
Sbjct: 1   MDDFVSESESDYASYWRDWFISSRGNEYFCEIDEDYITDRFNLTGLNTEVQYYQYALDLI 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DD+MRE +EKSARHLYGL+HAR+I+T+RGL KM EKYKKADFG+CPRV+C +
Sbjct: 61  TDVFDLDCDDDMRETIEKSARHLYGLVHARYIVTTRGLQKMFEKYKKADFGKCPRVMCSS 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GLSD P +K VKLYC RCEDIYNPKS+RHA+IDGAY+G++F ++ FQVYP L+P
Sbjct: 121 HPLLPMGLSDVPNSKPVKLYCARCEDIYNPKSSRHAAIDGAYFGTSFHNIFFQVYPTLVP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS ERYIPR +GFK+H  A
Sbjct: 181 AKSVERYIPRCYGFKVHAAA 200



>gi|321259199|ref|XP_003194320.1| casein kinase II beta chain [Cryptococcus gattii WM276]
 gi|317460791|gb|ADV22533.1| Casein kinase II beta chain, putative [Cryptococcus gattii WM276]
          Length = 271

 Score =  305 bits (781), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 146/238 (61%), Positives = 179/238 (75%), Gaps = 37/238 (15%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEV-QHYVQALDL 59
           M+DL++GS+SDYA  WI WFL++KGNEYFCEVDE+YILDRFNLTGLN+EV Q Y +AL L
Sbjct: 1   MEDLSTGSESDYADSWISWFLSSKGNEYFCEVDEDYILDRFNLTGLNAEVVQEYSRALSL 60

Query: 60  ITDSL-EEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLC 118
           ITD+L E++LD++ RE++E SAR LYGLIHARFI+T+RGLAKMLEKY+KADFGRCPRV C
Sbjct: 61  ITDNLNEDDLDEDTRESIETSARFLYGLIHARFIVTTRGLAKMLEKYRKADFGRCPRVYC 120

Query: 119 HNQPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHL 178
           ++QPLLPVGLSD PY K+VKLYCPRCEDIY+PKS RH SIDG+Y+G+TFPHMLF VYP +
Sbjct: 121 YSQPLLPVGLSDIPYQKAVKLYCPRCEDIYSPKSNRHGSIDGSYFGTTFPHMLFMVYPQM 180

Query: 179 LPPKSN-----------------------------------ERYIPRIFGFKIHDIAK 201
           +P K                                     E + P+IFGFK+++ AK
Sbjct: 181 IPGKGQPVGSSVADVNRSLLSAGQSREGGVGVSTSAMALKAEMFEPKIFGFKVNENAK 238



>gi|164427743|ref|XP_001728406.1| casein kinase II beta subunit [Neurospora crassa OR74A]
 gi|30580434|sp|Q8TG11.1|CSK2C_NEUCR RecName: Full=Casein kinase II subunit beta-2; Short=CK II beta-2
 gi|20162525|gb|AAM14626.1|AF494378_1 casein kinase II beta subunit CKB2 [Neurospora crassa]
 gi|157071866|gb|EDO65315.1| casein kinase II beta subunit [Neurospora crassa OR74A]
 gi|350296753|gb|EGZ77730.1| casein kinase II subunit beta-2 [Neurospora tetrasperma FGSC 2509]
          Length = 285

 Score =  305 bits (781), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 139/200 (69%), Positives = 171/200 (85%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD  S S+SDYA YW DWF++++GNEYFCE+DE+YI DRFNLTGLN+EVQ+Y  ALDLI
Sbjct: 1   MDDFVSESESDYASYWRDWFISSRGNEYFCEIDEDYITDRFNLTGLNTEVQYYQYALDLI 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DD+MRE +EKSARHLYGL+HAR+I+T+RGL KM EKYKKADFG+CPRV+C +
Sbjct: 61  TDVFDLDCDDDMRETIEKSARHLYGLVHARYIVTTRGLQKMFEKYKKADFGKCPRVMCSS 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GLSD P +K VKLYC RCEDIYNPKS+RHA+IDGAY+G++F ++ FQVYP L+P
Sbjct: 121 HPLLPMGLSDVPNSKPVKLYCARCEDIYNPKSSRHAAIDGAYFGTSFHNIFFQVYPTLVP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS ERYIPR +GFK+H  A
Sbjct: 181 AKSVERYIPRCYGFKVHAAA 200



>gi|189189698|ref|XP_001931188.1| casein kinase II subunit beta [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187972794|gb|EDU40293.1| casein kinase II subunit beta [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 254

 Score =  305 bits (781), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 170/200 (85%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD  S +DSDY  YW DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 1   MDDFNSETDSDYTSYWRDWFISSRGNEYFCEIDEEYLTDRFNLTGLNTEVQYYQYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DD+MRE +EKSARHLYGL+HAR+I+T+RGLAKMLEK+KK+DFG+CPRV+C +
Sbjct: 61  TDVFDFDCDDDMREQIEKSARHLYGLVHARYIVTTRGLAKMLEKFKKSDFGKCPRVMCES 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
           QPLLP+G SD P    VKLYC RCED+YNPKS+RHA IDGAY+G++F ++LFQVYP +LP
Sbjct: 121 QPLLPMGQSDVPNASPVKLYCARCEDLYNPKSSRHAVIDGAYFGTSFHNILFQVYPAVLP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
           PKS  RY PR+FGFK+H  A
Sbjct: 181 PKSQRRYEPRVFGFKVHSAA 200



>gi|134111973|ref|XP_775522.1| hypothetical protein CNBE2360 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50258181|gb|EAL20875.1| hypothetical protein CNBE2360 [Cryptococcus neoformans var.
           neoformans B-3501A]
          Length = 271

 Score =  305 bits (781), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 146/238 (61%), Positives = 179/238 (75%), Gaps = 37/238 (15%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEV-QHYVQALDL 59
           M+DL++GS+SDYA  WI WFL++KGNEYFCEVDE+YILDRFNLTGLN+EV Q Y +AL L
Sbjct: 1   MEDLSTGSESDYADSWISWFLSSKGNEYFCEVDEDYILDRFNLTGLNAEVVQEYSRALSL 60

Query: 60  ITDSL-EEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLC 118
           ITD+L E++LD++ RE++E SAR LYGLIHARFI+T+RGLAKMLEKY+KADFGRCPRV C
Sbjct: 61  ITDNLNEDDLDEDTRESIETSARFLYGLIHARFIVTTRGLAKMLEKYRKADFGRCPRVYC 120

Query: 119 HNQPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHL 178
           ++QPLLPVGLSD PY K+VKLYCPRCEDIY+PKS RH SIDG+Y+G+TFPHMLF VYP +
Sbjct: 121 YSQPLLPVGLSDIPYQKAVKLYCPRCEDIYSPKSNRHGSIDGSYFGTTFPHMLFMVYPQM 180

Query: 179 LPPKSN-----------------------------------ERYIPRIFGFKIHDIAK 201
           +P K                                     E + P+IFGFK+++ AK
Sbjct: 181 IPGKGQPVGSSVADVNRSLVSAGQSREGGAGISTSAMALKAEMFEPKIFGFKVNEDAK 238



>gi|451848081|gb|EMD61387.1| hypothetical protein COCSADRAFT_230788 [Bipolaris sorokiniana
           ND90Pr]
 gi|451999285|gb|EMD91748.1| hypothetical protein COCHEDRAFT_1194496 [Bipolaris maydis C5]
 gi|477591421|gb|ENI08493.1| hypothetical protein COCC4DRAFT_57230 [Bipolaris maydis ATCC 48331]
          Length = 255

 Score =  305 bits (780), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 135/200 (67%), Positives = 170/200 (85%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD  S +DSDY  YW DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 1   MDDFNSETDSDYTSYWRDWFISSRGNEYFCEIDEEYLTDRFNLTGLNTEVQYYQYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DD+MRE +EKSARHLYGL+HAR+I+T+RGLAKMLEK+KK+DFG+CPRV+C +
Sbjct: 61  TDVFDFDCDDDMREQIEKSARHLYGLVHARYIVTTRGLAKMLEKFKKSDFGKCPRVMCES 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
           QPLLP+G SD P    VKLYC RCED+YNPKS+RHA IDGAY+G++F ++LFQVYP +LP
Sbjct: 121 QPLLPMGQSDVPNASPVKLYCARCEDLYNPKSSRHAIIDGAYFGTSFHNILFQVYPAMLP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
           PK+  RY PR+FGFK+H  A
Sbjct: 181 PKTQRRYEPRVFGFKVHSAA 200



>gi|336272403|ref|XP_003350958.1| hypothetical protein SMAC_04262 [Sordaria macrospora k-hell]
 gi|380090725|emb|CCC04895.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 287

 Score =  304 bits (778), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 139/200 (69%), Positives = 171/200 (85%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD  S S+SDYA YW DWF++++GNEYFCE+DE+YI DRFNLTGLN+EVQ+Y  ALDLI
Sbjct: 1   MDDFVSESESDYASYWRDWFISSRGNEYFCEIDEDYITDRFNLTGLNTEVQYYQYALDLI 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DD+MRE +EKSARHLYGL+HAR+I+T+RGL KM EKYKKADFG+CPRV+C +
Sbjct: 61  TDVFDLDCDDDMRETIEKSARHLYGLVHARYIVTTRGLQKMFEKYKKADFGKCPRVMCSS 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GLSD P +K VKLYC RCEDIYNPKS+RHA+IDGAY+G++F ++ FQVYP L+P
Sbjct: 121 HPLLPMGLSDVPNSKPVKLYCARCEDIYNPKSSRHAAIDGAYFGTSFHNIFFQVYPTLVP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS ERYIPR +GFK+H  A
Sbjct: 181 GKSVERYIPRCYGFKVHAAA 200



>gi|358378734|gb|EHK16415.1| hypothetical protein TRIVIDRAFT_232164 [Trichoderma virens Gv29-8]
          Length = 1463

 Score =  303 bits (777), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 171/200 (85%)

Query: 1    MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
            MDD  S SDSDY  YW DWF++++GNEYFCE+DE+Y+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 1203 MDDYVSESDSDYTSYWRDWFISSRGNEYFCEIDEDYLTDRFNLTGLNTEVQYYQYALDLV 1262

Query: 61   TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
            TD  + + DD+MRE +E SARHLYGL+HAR+I+T+RGL KML+KYKKA+FG+CPRV CH+
Sbjct: 1263 TDVFDLDCDDDMRETIESSARHLYGLVHARYIVTTRGLTKMLDKYKKAEFGKCPRVNCHS 1322

Query: 121  QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
             PLLP+GLSD P  K VKLYC RCED+YNPKS+RHASIDGAY+G++F +++FQVYP L+P
Sbjct: 1323 HPLLPMGLSDIPNLKPVKLYCARCEDLYNPKSSRHASIDGAYFGTSFHNIIFQVYPALIP 1382

Query: 181  PKSNERYIPRIFGFKIHDIA 200
             KS ERYIPR++GFK+H  A
Sbjct: 1383 SKSIERYIPRVYGFKVHAAA 1402



>gi|336371028|gb|EGN99368.1| hypothetical protein SERLA73DRAFT_160780 [Serpula lacrymans var.
           lacrymans S7.3]
          Length = 274

 Score =  303 bits (776), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 141/246 (57%), Positives = 181/246 (73%), Gaps = 45/246 (18%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           ++D+++GSDSDY+  WI WFL++KGNEYFCEVDE+YILDRFNLTGLNS+V +Y QAL+LI
Sbjct: 6   VEDISTGSDSDYSNSWISWFLSSKGNEYFCEVDEDYILDRFNLTGLNSDVSNYSQALELI 65

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD+L++E+ DE+R A++  AR LYGLIHAR+I+T+RGLAKMLEK+K+ DFGRCPRVLC +
Sbjct: 66  TDNLDDEIQDELRGALDVQARLLYGLIHARWIVTARGLAKMLEKFKRVDFGRCPRVLCQS 125

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
           QPLLPVGL+D PY KSVKLYC RCEDIY+PKS+RH SIDGAY+G++FPH+LF VYP+L+P
Sbjct: 126 QPLLPVGLTDTPYEKSVKLYCGRCEDIYSPKSSRHGSIDGAYFGTSFPHLLFLVYPNLIP 185

Query: 181 PKSN---------------------------------------------ERYIPRIFGFK 195
           PKS                                              +RY PRI+GF+
Sbjct: 186 PKSGSPDLSFGSRSTDAESGKRNRRMREEQEVTEGVGELISTASVAMKADRYRPRIYGFQ 245

Query: 196 IHDIAK 201
           +++ AK
Sbjct: 246 LNETAK 251



>gi|403417520|emb|CCM04220.1| predicted protein [Fibroporia radiculosa]
          Length = 284

 Score =  302 bits (773), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 148/252 (58%), Positives = 182/252 (72%), Gaps = 52/252 (20%)

Query: 2   DDLTSGSDSDYAKY------WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQ 55
           D+ ++GS+SDY+KY      WI WFL++KGNEYFCEV+++YILDRFNLTGLN+EVQHY Q
Sbjct: 8   DNNSTGSESDYSKYGARISGWISWFLSSKGNEYFCEVEDDYILDRFNLTGLNTEVQHYSQ 67

Query: 56  ALDLITDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPR 115
           ALDLITD+L++E+ DE R A++  AR LYGLIHAR+I+T+RGLAKMLEKYK+ADFGRCPR
Sbjct: 68  ALDLITDNLDDEILDEHRGALDVQARLLYGLIHARWIVTARGLAKMLEKYKRADFGRCPR 127

Query: 116 VLCHNQPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVY 175
           VLC +QPLLPVGL+D PY KSVKLYC RCEDIY+PKS+RH SIDGAY+G++FPH+LF VY
Sbjct: 128 VLCQSQPLLPVGLTDIPYEKSVKLYCGRCEDIYSPKSSRHGSIDGAYFGTSFPHLLFLVY 187

Query: 176 PHLLPPKSN----------------------------------------------ERYIP 189
           P L+PPKS                                               ERY P
Sbjct: 188 PTLIPPKSGPIDFVPLRTSGDAESSRRNRRNREEQETPREIVQEGLSTVAVALKAERYRP 247

Query: 190 RIFGFKIHDIAK 201
           RIFGF++++IAK
Sbjct: 248 RIFGFQVNEIAK 259



>gi|388581534|gb|EIM21842.1| hypothetical protein WALSEDRAFT_54395 [Wallemia sebi CBS 633.66]
          Length = 248

 Score =  301 bits (772), Expect = 6e-80,   Method: Compositional matrix adjust.
 Identities = 146/221 (66%), Positives = 180/221 (81%), Gaps = 20/221 (9%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           +DDLT+GS+  ++  WI WFL+TKGNEYFCEVDEEYILDRFNLTGLN++VQ+Y QAL+LI
Sbjct: 2   IDDLTTGSEDSFSNSWISWFLSTKGNEYFCEVDEEYILDRFNLTGLNNDVQNYSQALELI 61

Query: 61  TDSLEEELDDE-MREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCH 119
           TDSL++E  D+  R+A+E SAR+LYGLIHAR+IITSRGLAKML+KY+K DFGRCPRV C 
Sbjct: 62  TDSLDDEDLDDEQRDAIENSARYLYGLIHARYIITSRGLAKMLDKYRKTDFGRCPRVFCA 121

Query: 120 NQPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLL 179
           +QPLLPVGLSD PYTK+VKLYCPRCED+Y+PKS+RH SIDGAY+G++FPHMLF VYP  L
Sbjct: 122 SQPLLPVGLSDVPYTKAVKLYCPRCEDLYSPKSSRHGSIDGAYFGTSFPHMLFLVYPQHL 181

Query: 180 PPKSN-------------------ERYIPRIFGFKIHDIAK 201
           P K+                    +RY+P+IFGF +H++AK
Sbjct: 182 PSKTTNSLPSTSTPTTSAHAAIGVDRYLPKIFGFPVHEMAK 222



>gi|116206920|ref|XP_001229269.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51]
 gi|88183350|gb|EAQ90818.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51]
          Length = 311

 Score =  301 bits (771), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 140/232 (60%), Positives = 173/232 (74%), Gaps = 32/232 (13%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD  + SDSDY  YW DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 1   MDDYGTESDSDYTSYWRDWFISSRGNEYFCEIDEEYLTDRFNLTGLNTEVQYYQYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKM------------------- 101
           TD  + + DDEMRE +EKSARHLYGL+HAR+I+T+RGLAKM                   
Sbjct: 61  TDVFDLDCDDEMRETIEKSARHLYGLVHARYIVTTRGLAKMVKLPPLPPTCPFALPALPS 120

Query: 102 -------------LEKYKKADFGRCPRVLCHNQPLLPVGLSDQPYTKSVKLYCPRCEDIY 148
                        LEKYKKADFG+CPRV+CH+ PLLP+GLSD P  K VKL+C RCED Y
Sbjct: 121 NIILTDDAPALPQLEKYKKADFGKCPRVMCHSHPLLPMGLSDIPNLKPVKLHCARCEDTY 180

Query: 149 NPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIFGFKIHDIA 200
           NPKS+RHASIDGAY+G++F ++LFQVYP L+P KS ERY+PR++GFK+H  A
Sbjct: 181 NPKSSRHASIDGAYFGTSFHNILFQVYPALIPAKSAERYVPRVYGFKVHAAA 232



>gi|226290226|gb|EEH45710.1| casein kinase II subunit beta [Paracoccidioides brasiliensis Pb18]
          Length = 315

 Score =  301 bits (771), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 171/200 (85%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           M++  S ++SDY  YW DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 49  MENFNSETESDYTSYWRDWFISSRGNEYFCEIDEEYLTDRFNLTGLNNEVQYYRYALDLV 108

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DD++RE +EKSARHLYGL+HAR+I+T+RGLAKMLEKYKKADFG+CPRVLC+ 
Sbjct: 109 TDVFDLDADDDLREQIEKSARHLYGLVHARYIVTTRGLAKMLEKYKKADFGKCPRVLCNQ 168

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GLSD P  KSVKLYC +CEDIYNPKS+RHASIDGAY+GS+F  +LFQVYP LLP
Sbjct: 169 HPLLPMGLSDLPGEKSVKLYCAKCEDIYNPKSSRHASIDGAYFGSSFHSILFQVYPALLP 228

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS  RY PR+FGF++H  A
Sbjct: 229 EKSIRRYDPRVFGFRVHACA 248



>gi|378729739|gb|EHY56198.1| casein kinase II subunit beta-2 [Exophiala dermatitidis NIH/UT8656]
          Length = 275

 Score =  301 bits (771), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 135/200 (67%), Positives = 170/200 (85%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           M+D  S +DSDY  YW DWF++++GNEYFCE+DEEYI DRFNLTGLN+EV +Y  ALDLI
Sbjct: 2   MEDFQSETDSDYTSYWRDWFISSRGNEYFCEIDEEYITDRFNLTGLNTEVHYYQHALDLI 61

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DD+MRE +EKSARHLYGL+HAR+I+T+RGLAKM++K+K++DFGRCPRVLC +
Sbjct: 62  TDVFDLDCDDDMRETIEKSARHLYGLVHARYIVTTRGLAKMVDKFKRSDFGRCPRVLCDS 121

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP G SD P  KSVKL+C +CEDIYNPKS+RHA+IDGAY+GS+F ++LFQVYP L+P
Sbjct: 122 HPLLPFGPSDNPGQKSVKLFCAKCEDIYNPKSSRHAAIDGAYFGSSFHNILFQVYPALVP 181

Query: 181 PKSNERYIPRIFGFKIHDIA 200
           PKS  RY P+IFGF++H  A
Sbjct: 182 PKSRRRYEPKIFGFRVHAAA 201



>gi|295669614|ref|XP_002795355.1| casein kinase II subunit beta-2 [Paracoccidioides sp. 'lutzii'
           Pb01]
 gi|226285289|gb|EEH40855.1| casein kinase II subunit beta-2 [Paracoccidioides sp. 'lutzii'
           Pb01]
          Length = 336

 Score =  301 bits (771), Expect = 9e-80,   Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 171/200 (85%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           M++  S ++SDY  YW DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 70  MENFNSETESDYTSYWRDWFISSRGNEYFCEIDEEYLTDRFNLTGLNNEVQYYRYALDLV 129

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DD++RE +EKSARHLYGL+HAR+I+T+RGLAKMLEKYKKADFG+CPRVLC+ 
Sbjct: 130 TDVFDLDADDDLREQIEKSARHLYGLVHARYIVTTRGLAKMLEKYKKADFGKCPRVLCNQ 189

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GLSD P  KSVKLYC +CEDIYNPKS+RHASIDGAY+GS+F  +LFQVYP LLP
Sbjct: 190 HPLLPMGLSDLPGEKSVKLYCAKCEDIYNPKSSRHASIDGAYFGSSFHSILFQVYPALLP 249

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS  RY PR+FGF++H  A
Sbjct: 250 EKSIRRYDPRVFGFRVHACA 269



>gi|302682390|ref|XP_003030876.1| hypothetical protein SCHCODRAFT_77011 [Schizophyllum commune H4-8]
 gi|300104568|gb|EFI95973.1| hypothetical protein SCHCODRAFT_77011 [Schizophyllum commune H4-8]
          Length = 287

 Score =  301 bits (770), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 165/182 (90%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           M+D+++GSDSDY++ WI WFL++KGNEYFCEVDE++ILDRFNLTGLN+EV +Y QALDLI
Sbjct: 5   MEDVSTGSDSDYSRCWISWFLSSKGNEYFCEVDEDFILDRFNLTGLNNEVANYAQALDLI 64

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD+L++E+ DEMR +++  AR LYGLIHAR+I+T+RGLAKMLEKYK+ADFG+CPRVLC  
Sbjct: 65  TDNLDDEMQDEMRGSLDVQARLLYGLIHARWIVTARGLAKMLEKYKRADFGKCPRVLCAA 124

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
           QPLLPVGL+D PY KSVKLYC RCEDIY+PKS+RH SIDGAY+G+TFPH+LF VYP+L+P
Sbjct: 125 QPLLPVGLTDIPYEKSVKLYCGRCEDIYSPKSSRHGSIDGAYFGTTFPHLLFLVYPNLIP 184

Query: 181 PK 182
            K
Sbjct: 185 AK 186



>gi|19115518|ref|NP_594606.1| CK2 family regulatory subunit Ckb1 [Schizosaccharomyces pombe
           972h-]
 gi|19859294|sp|P40232.2|CSK2B_SCHPO RecName: Full=Casein kinase II subunit beta; Short=CK II beta
 gi|6562196|emb|CAB62429.1| CK2 family regulatory subunit Ckb1 [Schizosaccharomyces pombe]
          Length = 231

 Score =  300 bits (769), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 160/184 (86%)

Query: 14  KYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELDDEMR 73
           +YW+DWFL  KGNE+FCEVDE++I DRFNLTGL+ EV HY Q+LDLI D L+ +L +E++
Sbjct: 14  QYWVDWFLGLKGNEFFCEVDEDFIQDRFNLTGLSHEVPHYSQSLDLILDVLDPDLPEEVQ 73

Query: 74  EAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQPY 133
           + VE SARHLYGLIHAR+I+T++GL KMLEKYKK DFG CPRVLC+ QP+LPVGLSD  +
Sbjct: 74  DEVEASARHLYGLIHARYILTAQGLYKMLEKYKKCDFGHCPRVLCNGQPMLPVGLSDIAH 133

Query: 134 TKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIFG 193
           TKSVKLYCPRCED+Y PKS RHASIDGAY+G++FPHMLFQVYP L  PKS ERYIPRIFG
Sbjct: 134 TKSVKLYCPRCEDVYTPKSQRHASIDGAYFGTSFPHMLFQVYPELAVPKSQERYIPRIFG 193

Query: 194 FKIH 197
           FK+H
Sbjct: 194 FKVH 197



>gi|225682779|gb|EEH21063.1| casein kinase II subunit beta [Paracoccidioides brasiliensis Pb03]
          Length = 257

 Score =  300 bits (769), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 138/200 (69%), Positives = 171/200 (85%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           M++  S ++SDY  YW DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 1   MENFNSETESDYTSYWRDWFISSRGNEYFCEIDEEYLTDRFNLTGLNNEVQYYRYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DD++RE +EKSARHLYGL+HAR+I+T+RGLAKMLEKYKKADFG+CPRVLC+ 
Sbjct: 61  TDVFDLDADDDLREQIEKSARHLYGLVHARYIVTTRGLAKMLEKYKKADFGKCPRVLCNQ 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GLSD P  KSVKLYC +CEDIYNPKS+RHASIDGAY+GS+F  +LFQVYP LLP
Sbjct: 121 HPLLPMGLSDLPGEKSVKLYCAKCEDIYNPKSSRHASIDGAYFGSSFHSILFQVYPALLP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS  RY PR+FGF++H  A
Sbjct: 181 EKSIRRYDPRVFGFRVHACA 200



>gi|392594477|gb|EIW83801.1| hypothetical protein CONPUDRAFT_80378 [Coniophora puteana
           RWD-64-598 SS2]
          Length = 283

 Score =  300 bits (768), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 164/182 (90%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           +DD+++GSDSDY+  WI WFL++KGNEYFCEV+E+YILDRFNLTGLN+EV +Y QALDLI
Sbjct: 5   VDDVSTGSDSDYSNSWISWFLSSKGNEYFCEVEEDYILDRFNLTGLNTEVSNYSQALDLI 64

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD+L++E+ DE+R  ++  AR LYGLIHAR+I+T+RGL+KM+EKYK+ DFGRCPRVLC +
Sbjct: 65  TDNLDDEIQDELRGTLDVQARLLYGLIHARWIVTARGLSKMIEKYKRVDFGRCPRVLCQS 124

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
           QPLLPVGLSD PY KSVKLYC RCED+Y+PKS+RH SIDGAY+G++FPH+LF VYP+L+P
Sbjct: 125 QPLLPVGLSDVPYEKSVKLYCGRCEDVYSPKSSRHGSIDGAYFGTSFPHLLFLVYPNLIP 184

Query: 181 PK 182
           PK
Sbjct: 185 PK 186



>gi|340520333|gb|EGR50569.1| casein kinase II, regulatory subunit [Trichoderma reesei QM6a]
          Length = 245

 Score =  300 bits (767), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 135/200 (67%), Positives = 171/200 (85%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD  S SDSDY  YW DWF++++GNEYFCE+DE+Y+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 1   MDDYVSESDSDYTSYWRDWFISSRGNEYFCEIDEDYLTDRFNLTGLNTEVQYYQYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DD+MRE +E SARHLYGL+HAR+I+T+RGL KML+KYKKA+FG+CPRV CH+
Sbjct: 61  TDVFDLDCDDDMRETIESSARHLYGLVHARYIVTTRGLTKMLDKYKKAEFGKCPRVNCHS 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GLSD P  K VKLYC RCED+YNPKS+RHASIDGAY+G++F +++FQVYP L+P
Sbjct: 121 HPLLPMGLSDIPNLKPVKLYCARCEDLYNPKSSRHASIDGAYFGTSFHNIIFQVYPALIP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS ERY+PR++GFK+H  A
Sbjct: 181 SKSIERYVPRVYGFKVHAAA 200



>gi|398411450|ref|XP_003857063.1| hypothetical protein MYCGRDRAFT_67079 [Zymoseptoria tritici IPO323]
 gi|339476948|gb|EGP92039.1| hypothetical protein MYCGRDRAFT_67079 [Zymoseptoria tritici IPO323]
          Length = 264

 Score =  299 bits (766), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 129/200 (64%), Positives = 166/200 (83%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD  S +DSDY  YW DWF++++GNEYFCE+DE+Y+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 1   MDDFASDTDSDYTSYWRDWFISSRGNEYFCEIDEDYLTDRFNLTGLNTEVQYYQYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + E+DD+MRE +EKSARHLYGL+HAR+++T+RGLAKM+EKYK+  FG+CPRV+C +
Sbjct: 61  TDVFDMEVDDDMREQIEKSARHLYGLVHARYVVTTRGLAKMMEKYKQGVFGKCPRVICES 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
           Q LLP+G  D P T  VKLYC +CEDIYNPKS+RH SIDGAY+G++F ++LFQVYP L P
Sbjct: 121 QHLLPMGQHDVPNTSHVKLYCAKCEDIYNPKSSRHNSIDGAYFGTSFHNILFQVYPALQP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            K+  RY PRI+GF++H  A
Sbjct: 181 QKTQRRYEPRIYGFRVHASA 200



>gi|358391190|gb|EHK40594.1| hypothetical protein TRIATDRAFT_29121 [Trichoderma atroviride IMI
           206040]
          Length = 263

 Score =  299 bits (765), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 135/200 (67%), Positives = 171/200 (85%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MD+  S SDSDY  YW DWF++++GNEYFCE+DE+Y+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 1   MDEYASESDSDYTSYWRDWFISSRGNEYFCEIDEDYLTDRFNLTGLNTEVQYYQYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DD+MRE +E SARHLYGL+HAR+I+T+RGL KML+KYKKA+FG+CPRV CH+
Sbjct: 61  TDVFDLDCDDDMRETIESSARHLYGLVHARYIVTTRGLTKMLDKYKKAEFGKCPRVNCHS 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GLSD P  K VKLYC RCED+YNPKS+RHASIDGAY+G++F +++FQVYP L+P
Sbjct: 121 HPLLPMGLSDIPNLKPVKLYCARCEDLYNPKSSRHASIDGAYFGTSFHNIIFQVYPALIP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS ERYIPR++GFK+H  A
Sbjct: 181 SKSIERYIPRVYGFKVHAAA 200



>gi|212542893|ref|XP_002151601.1| casein kinase 2 beta' regulatory subunit Ckb2, putative
           [Talaromyces marneffei ATCC 18224]
 gi|210066508|gb|EEA20601.1| casein kinase 2 beta' regulatory subunit Ckb2, putative
           [Talaromyces marneffei ATCC 18224]
          Length = 268

 Score =  299 bits (765), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 170/200 (85%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           M+D  S +DSDY  YW DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EVQ+Y  ALDLI
Sbjct: 1   MEDFNSETDSDYTSYWRDWFISSRGNEYFCEIDEEYLTDRFNLTGLNTEVQYYQYALDLI 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DD++RE +EKSARHLYGL+HAR+I+T+RGLAKML+KYKK DFG+CPRVLC  
Sbjct: 61  TDVFDLDADDDLREQIEKSARHLYGLVHARYIVTTRGLAKMLDKYKKGDFGKCPRVLCDQ 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+G SD P  K+VKLYC +CEDIYNPKS+RHASIDGAY+G++F ++LFQVYP L+P
Sbjct: 121 HPLLPMGQSDLPNQKTVKLYCAKCEDIYNPKSSRHASIDGAYFGTSFHNILFQVYPALVP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS +RY PRI+GFK+H  A
Sbjct: 181 EKSIQRYEPRIYGFKVHATA 200



>gi|452290|emb|CAA52330.1| casein kinase II beta subunit [Schizosaccharomyces pombe]
          Length = 231

 Score =  299 bits (765), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 134/184 (72%), Positives = 159/184 (86%)

Query: 14  KYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELDDEMR 73
           +YW+DWFL  KGNE+FCEVDE++I DRFNLTGL+ EV HY Q+LDLI D L+ +L +E++
Sbjct: 14  QYWVDWFLGLKGNEFFCEVDEDFIQDRFNLTGLSHEVPHYSQSLDLILDVLDPDLPEEVQ 73

Query: 74  EAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQPY 133
           + VE SARHLYGLIHAR+I+T++GL KMLEKYKK DFG CPRVLC+ QP+LPVGLSD  +
Sbjct: 74  DEVEASARHLYGLIHARYILTAQGLYKMLEKYKKCDFGHCPRVLCNGQPMLPVGLSDIAH 133

Query: 134 TKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIFG 193
            KSVKLYCPRCED+Y PKS RHASIDGAY+G++FPHMLFQVYP L  PKS ERYIPRIFG
Sbjct: 134 AKSVKLYCPRCEDVYTPKSQRHASIDGAYFGTSFPHMLFQVYPELAVPKSQERYIPRIFG 193

Query: 194 FKIH 197
           FK+H
Sbjct: 194 FKVH 197



>gi|452988495|gb|EME88250.1| casein kinase II, beta subunit [Pseudocercospora fijiensis CIRAD86]
          Length = 238

 Score =  298 bits (764), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 167/200 (83%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD  S +DSDY  YW DWF++++GNEYFCE+DE+Y+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 1   MDDFASDTDSDYTSYWRDWFISSRGNEYFCEIDEDYLTDRFNLTGLNTEVQYYQYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + E+DD+MRE +EKSARHLYGL+HAR+++T+RGLAKM+EK+K+  FG+CPRV+C +
Sbjct: 61  TDVFDMEVDDDMREQIEKSARHLYGLVHARYVVTTRGLAKMMEKFKQGVFGKCPRVICES 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
           Q LLP+G  D   T +VKLYC +CEDIYNPKS+RH SIDGAY+G++F ++LFQVYP LLP
Sbjct: 121 QHLLPMGQHDIANTSNVKLYCAKCEDIYNPKSSRHNSIDGAYFGTSFHNILFQVYPALLP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            K+  RY PRI+GF++H  A
Sbjct: 181 QKTQRRYEPRIYGFRVHASA 200



>gi|453088818|gb|EMF16858.1| casein kinase II subunit beta [Mycosphaerella populorum SO2202]
          Length = 264

 Score =  298 bits (764), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 129/200 (64%), Positives = 167/200 (83%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD  S +DSDY  YW DWF++++GNEYFCE+DE+Y+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 1   MDDFQSDTDSDYTSYWRDWFISSRGNEYFCEIDEDYLTDRFNLTGLNTEVQYYQYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + E+DD+MRE +EKSARHLYGL+HAR+I+T+RGLAKM+EK+K+  FG+CPRV+C +
Sbjct: 61  TDVFDMEVDDDMREQIEKSARHLYGLVHARYIVTTRGLAKMMEKFKQGVFGKCPRVICES 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
           Q LLP+G  D P T +VKLYC +CEDIYNPKS+RH SIDGAY+G++F ++LFQVYP L P
Sbjct: 121 QHLLPMGQHDIPNTSNVKLYCAKCEDIYNPKSSRHNSIDGAYFGTSFHNILFQVYPALQP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            K+  RY PRI+GF++H  A
Sbjct: 181 QKTQRRYEPRIYGFRVHASA 200



>gi|242767776|ref|XP_002341435.1| casein kinase 2 beta' regulatory subunit Ckb2, putative
           [Talaromyces stipitatus ATCC 10500]
 gi|218724631|gb|EED24048.1| casein kinase 2 beta' regulatory subunit Ckb2, putative
           [Talaromyces stipitatus ATCC 10500]
          Length = 268

 Score =  298 bits (764), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 170/200 (85%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           M+D  S +DSDY  YW DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EVQ+Y  ALDLI
Sbjct: 1   MEDFNSETDSDYTSYWRDWFISSRGNEYFCEIDEEYLTDRFNLTGLNTEVQYYQYALDLI 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DD++RE +EKSARHLYGL+HAR+I+T+RGLAKML+KYKK DFG+CPRVLC  
Sbjct: 61  TDVFDLDADDDLREQIEKSARHLYGLVHARYIVTTRGLAKMLDKYKKGDFGKCPRVLCDQ 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+G SD P  K+VKLYC +CEDIYNPKS+RHASIDGAY+G++F ++LFQVYP L+P
Sbjct: 121 HPLLPMGQSDLPNQKTVKLYCAKCEDIYNPKSSRHASIDGAYFGTSFHNILFQVYPALVP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS +RY PRI+GFK+H  A
Sbjct: 181 EKSIQRYEPRIYGFKVHATA 200



>gi|325089728|gb|EGC43038.1| casein kinase II [Ajellomyces capsulatus H88]
          Length = 272

 Score =  298 bits (763), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 169/200 (84%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           M++  S ++SDY  YW DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 1   MEEFNSETESDYTSYWRDWFISSRGNEYFCEIDEEYLTDRFNLTGLNTEVQYYQYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DD++RE +EKSARHLYGL+HAR+I+T+RGLAKMLEKYKKADFG+CPRVLC+ 
Sbjct: 61  TDVFDLDADDDLREQIEKSARHLYGLVHARYIVTTRGLAKMLEKYKKADFGKCPRVLCNQ 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GLSD P  KSV LYC +CEDIYNPKS+RHASIDGAY+GS+F  +LFQVYP  LP
Sbjct: 121 HPLLPMGLSDLPGEKSVSLYCAKCEDIYNPKSSRHASIDGAYFGSSFHSILFQVYPAFLP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS  RY PR+FGF++H  A
Sbjct: 181 EKSLRRYDPRVFGFRVHASA 200



>gi|225559719|gb|EEH08001.1| casein kinase subunit II beta [Ajellomyces capsulatus G186AR]
          Length = 272

 Score =  298 bits (763), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 169/200 (84%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           M++  S ++SDY  YW DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 1   MEEFNSETESDYTSYWRDWFISSRGNEYFCEIDEEYLTDRFNLTGLNNEVQYYQYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DD++RE +EKSARHLYGL+HAR+I+T+RGLAKMLEKYKKADFG+CPRVLC+ 
Sbjct: 61  TDVFDLDADDDLREQIEKSARHLYGLVHARYIVTTRGLAKMLEKYKKADFGKCPRVLCNQ 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GLSD P  KSV LYC +CEDIYNPKS+RHASIDGAY+GS+F  +LFQVYP  LP
Sbjct: 121 HPLLPMGLSDLPGEKSVSLYCAKCEDIYNPKSSRHASIDGAYFGSSFHSILFQVYPAFLP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS  RY PR+FGF++H  A
Sbjct: 181 EKSLRRYDPRVFGFRVHASA 200



>gi|240276410|gb|EER39922.1| casein kinase subunit II beta [Ajellomyces capsulatus H143]
          Length = 272

 Score =  298 bits (763), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 169/200 (84%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           M++  S ++SDY  YW DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 1   MEEFNSETESDYTSYWRDWFISSRGNEYFCEIDEEYLTDRFNLTGLNNEVQYYQYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DD++RE +EKSARHLYGL+HAR+I+T+RGLAKMLEKYKKADFG+CPRVLC+ 
Sbjct: 61  TDVFDLDADDDLREQIEKSARHLYGLVHARYIVTTRGLAKMLEKYKKADFGKCPRVLCNQ 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GLSD P  KSV LYC +CEDIYNPKS+RHASIDGAY+GS+F  +LFQVYP  LP
Sbjct: 121 HPLLPMGLSDLPGEKSVSLYCAKCEDIYNPKSSRHASIDGAYFGSSFHSILFQVYPAFLP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS  RY PR+FGF++H  A
Sbjct: 181 EKSLRRYDPRVFGFRVHASA 200



>gi|154280871|ref|XP_001541248.1| casein kinase II beta 2 subunit [Ajellomyces capsulatus NAm1]
 gi|150411427|gb|EDN06815.1| casein kinase II beta 2 subunit [Ajellomyces capsulatus NAm1]
          Length = 497

 Score =  298 bits (763), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 169/200 (84%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           M++  S ++SDY  YW DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 226 MEEFNSETESDYTSYWRDWFISSRGNEYFCEIDEEYLTDRFNLTGLNNEVQYYQYALDLV 285

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DD++RE +EKSARHLYGL+HAR+I+T+RGLAKMLEKYKKADFG+CPRVLC+ 
Sbjct: 286 TDVFDLDADDDLREQIEKSARHLYGLVHARYIVTTRGLAKMLEKYKKADFGKCPRVLCNQ 345

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GLSD P  KSV LYC +CEDIYNPKS+RHASIDGAY+GS+F  +LFQVYP  LP
Sbjct: 346 HPLLPMGLSDLPGEKSVSLYCAKCEDIYNPKSSRHASIDGAYFGSSFHSILFQVYPAFLP 405

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS  RY PR+FGF++H  A
Sbjct: 406 EKSLRRYDPRVFGFRVHASA 425



>gi|452847906|gb|EME49838.1| hypothetical protein DOTSEDRAFT_68586 [Dothistroma septosporum
           NZE10]
          Length = 262

 Score =  298 bits (762), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 167/200 (83%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD  S +DSDY  YW DWF++++GNEYFCE+DE+Y+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 1   MDDFASDTDSDYTSYWRDWFISSRGNEYFCEIDEDYLTDRFNLTGLNTEVQYYQYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + E+DD+MRE +EKSARHLYGL+HAR+++T+RGLAKM+EKYK+  FG+CPRV+C +
Sbjct: 61  TDVFDMEVDDDMREQIEKSARHLYGLVHARYVVTTRGLAKMMEKYKQGVFGKCPRVICES 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
           Q LLP+G  D P   +VKLYC +CEDIYNPKS+RH SIDGAY+G++F ++LFQVYP L+P
Sbjct: 121 QHLLPMGQHDIPNMSNVKLYCAKCEDIYNPKSSRHNSIDGAYFGTSFHNILFQVYPALMP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            K+  RY PRI+GF++H  A
Sbjct: 181 QKTQRRYEPRIYGFRVHASA 200



>gi|303324425|ref|XP_003072200.1| Casein kinase II beta chain 2, putative [Coccidioides posadasii
           C735 delta SOWgp]
 gi|240111910|gb|EER30055.1| Casein kinase II beta chain 2, putative [Coccidioides posadasii
           C735 delta SOWgp]
 gi|320037236|gb|EFW19174.1| casein kinase II beta subunit [Coccidioides posadasii str.
           Silveira]
          Length = 267

 Score =  297 bits (760), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 166/200 (83%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           M+D  + SDSDY  +W DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EV  Y  ALDL+
Sbjct: 1   MEDFNTESDSDYTSFWRDWFISSRGNEYFCEIDEEYLTDRFNLTGLNTEVDFYQYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DDE RE +EK+ARHLYG++HAR+I+T+RGLAKMLEKYK+ADFG+CPRV+C  
Sbjct: 61  TDVFDLDADDETREQIEKNARHLYGMVHARYIVTTRGLAKMLEKYKRADFGKCPRVMCEQ 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GL+D    K VKLYC +CED+YNPKS+RHASIDGAY+G++F ++LFQVYP L+P
Sbjct: 121 HPLLPMGLTDVAGVKPVKLYCAKCEDLYNPKSSRHASIDGAYFGTSFHNILFQVYPCLIP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS  RY P++FGF++H  A
Sbjct: 181 EKSLRRYEPKVFGFRVHASA 200



>gi|119173743|ref|XP_001239268.1| casein kinase II beta chain [Coccidioides immitis RS]
 gi|392869475|gb|EJB11820.1| casein kinase II subunit beta-2 [Coccidioides immitis RS]
          Length = 267

 Score =  297 bits (760), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 166/200 (83%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           M+D  + SDSDY  +W DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EV  Y  ALDL+
Sbjct: 1   MEDFNTESDSDYTSFWRDWFISSRGNEYFCEIDEEYLTDRFNLTGLNTEVDFYQYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DDE RE +EK+ARHLYG++HAR+I+T+RGLAKMLEKYK+ADFG+CPRV+C  
Sbjct: 61  TDVFDLDADDETREQIEKNARHLYGMVHARYIVTTRGLAKMLEKYKRADFGKCPRVMCEQ 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GL+D    K VKLYC +CED+YNPKS+RHASIDGAY+G++F ++LFQVYP L+P
Sbjct: 121 HPLLPMGLTDVAGVKPVKLYCAKCEDLYNPKSSRHASIDGAYFGTSFHNILFQVYPCLIP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS  RY P++FGF++H  A
Sbjct: 181 EKSLRRYEPKVFGFRVHASA 200



>gi|389625781|ref|XP_003710544.1| casein kinase II subunit beta-2 [Magnaporthe oryzae 70-15]
 gi|351650073|gb|EHA57932.1| casein kinase II subunit beta-2 [Magnaporthe oryzae 70-15]
 gi|440467738|gb|ELQ36937.1| casein kinase II subunit beta-2 [Magnaporthe oryzae Y34]
 gi|440478363|gb|ELQ59203.1| casein kinase II subunit beta-2 [Magnaporthe oryzae P131]
          Length = 273

 Score =  297 bits (760), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 135/200 (67%), Positives = 167/200 (83%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           M+D  S SDSDY  YW DWF+ +KGNEYFCE+DE+Y+ DRFNLTGLN+EV +Y  ALDLI
Sbjct: 1   MEDFGSESDSDYTSYWRDWFIGSKGNEYFCEIDEDYLTDRFNLTGLNTEVSYYQYALDLI 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DD+MRE +EKSARHLYGL+HAR+I+T+RGL+KMLEKYKK DFG+CPRV C +
Sbjct: 61  TDVFDLDCDDDMRETIEKSARHLYGLVHARYIVTTRGLSKMLEKYKKGDFGKCPRVHCGS 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+G+ D P +K VKLYC RCEDIYNPKS+RHA IDGAY+G++F ++LFQVYP L+P
Sbjct: 121 HPLLPMGMCDIPSSKPVKLYCARCEDIYNPKSSRHAGIDGAYFGTSFHNILFQVYPALMP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS ERY+PR FGF++H  A
Sbjct: 181 VKSAERYVPRCFGFRVHAAA 200



>gi|326475405|gb|EGD99414.1| casein kinase subunit II beta [Trichophyton tonsurans CBS 112818]
 gi|326482400|gb|EGE06410.1| casein kinase II subunit beta-2 [Trichophyton equinum CBS 127.97]
          Length = 267

 Score =  296 bits (758), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 128/201 (63%), Positives = 169/201 (84%), Gaps = 1/201 (0%)

Query: 1   MDDLT-SGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDL 59
           MD+   + +DSDY  +W DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EVQ+Y  ALD+
Sbjct: 1   MDEFNNTDTDSDYTSFWRDWFISSRGNEYFCEIDEEYLTDRFNLTGLNTEVQYYQYALDM 60

Query: 60  ITDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCH 119
           +TD  + + D+++RE +EKSARHLYGL+HAR+I+T+RGLAKM+EKYK ADFG+CPRV+C 
Sbjct: 61  VTDLFDLDADEDLREQIEKSARHLYGLVHARYIVTTRGLAKMVEKYKNADFGKCPRVMCE 120

Query: 120 NQPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLL 179
             PLLP+G SD P  K VKLYC +CEDIYNPKS+RHA++DGAY+GS+F ++LFQVYP L+
Sbjct: 121 QHPLLPMGQSDIPGQKPVKLYCAKCEDIYNPKSSRHAAVDGAYFGSSFHNVLFQVYPDLI 180

Query: 180 PPKSNERYIPRIFGFKIHDIA 200
           P KS +RY PR+FGF++H  A
Sbjct: 181 PDKSRQRYEPRVFGFRVHACA 201



>gi|302502658|ref|XP_003013290.1| hypothetical protein ARB_00475 [Arthroderma benhamiae CBS 112371]
 gi|291176853|gb|EFE32650.1| hypothetical protein ARB_00475 [Arthroderma benhamiae CBS 112371]
          Length = 268

 Score =  296 bits (758), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 128/201 (63%), Positives = 169/201 (84%), Gaps = 1/201 (0%)

Query: 1   MDDLT-SGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDL 59
           MD+   + +DSDY  +W DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EVQ+Y  ALD+
Sbjct: 1   MDEFNNTDTDSDYTSFWRDWFISSRGNEYFCEIDEEYLTDRFNLTGLNTEVQYYQYALDM 60

Query: 60  ITDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCH 119
           +TD  + + D+++RE +EKSARHLYGL+HAR+I+T+RGLAKM+EKYK ADFG+CPRV+C 
Sbjct: 61  VTDLFDLDADEDLREQIEKSARHLYGLVHARYIVTTRGLAKMVEKYKNADFGKCPRVMCE 120

Query: 120 NQPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLL 179
             PLLP+G SD P  K VKLYC +CEDIYNPKS+RHA++DGAY+GS+F ++LFQVYP L+
Sbjct: 121 QHPLLPMGQSDIPGQKPVKLYCAKCEDIYNPKSSRHAAVDGAYFGSSFHNVLFQVYPDLI 180

Query: 180 PPKSNERYIPRIFGFKIHDIA 200
           P KS +RY PR+FGF++H  A
Sbjct: 181 PDKSRQRYEPRVFGFRVHACA 201



>gi|327292857|ref|XP_003231126.1| casein kinase subunit II beta [Trichophyton rubrum CBS 118892]
 gi|326466756|gb|EGD92209.1| casein kinase subunit II beta [Trichophyton rubrum CBS 118892]
          Length = 260

 Score =  296 bits (758), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 128/201 (63%), Positives = 169/201 (84%), Gaps = 1/201 (0%)

Query: 1   MDDLT-SGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDL 59
           MD+   + +DSDY  +W DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EVQ+Y  ALD+
Sbjct: 1   MDEFNNTDTDSDYTSFWRDWFISSRGNEYFCEIDEEYLTDRFNLTGLNTEVQYYQYALDM 60

Query: 60  ITDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCH 119
           +TD  + + D+++RE +EKSARHLYGL+HAR+I+T+RGLAKM+EKYK ADFG+CPRV+C 
Sbjct: 61  VTDLFDLDADEDLREQIEKSARHLYGLVHARYIVTTRGLAKMVEKYKNADFGKCPRVMCE 120

Query: 120 NQPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLL 179
             PLLP+G SD P  K VKLYC +CEDIYNPKS+RHA++DGAY+GS+F ++LFQVYP L+
Sbjct: 121 QHPLLPMGQSDIPGQKPVKLYCAKCEDIYNPKSSRHAAVDGAYFGSSFHNVLFQVYPDLI 180

Query: 180 PPKSNERYIPRIFGFKIHDIA 200
           P KS +RY PR+FGF++H  A
Sbjct: 181 PDKSRQRYEPRVFGFRVHACA 201



>gi|317155760|ref|XP_001825358.2| casein kinase II subunit beta-2 [Aspergillus oryzae RIB40]
          Length = 264

 Score =  296 bits (757), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 131/200 (65%), Positives = 167/200 (83%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           M+D  S +DSDY  YW DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EV +Y  ALDL+
Sbjct: 1   MEDFNSETDSDYTSYWRDWFISSRGNEYFCEIDEEYLTDRFNLTGLNTEVPYYQYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DD++RE +EKSARHLYGL+HAR+I+T+RGL KM++KYKK DFG+CPRV+C  
Sbjct: 61  TDVFDLDADDDLREQIEKSARHLYGLVHARYIVTTRGLTKMVDKYKKGDFGKCPRVMCEG 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
           QPLLP+G  D P   +V+LYCP+CED+YNPKS+RHASIDGAY+G++FP MLFQVYP L+P
Sbjct: 121 QPLLPMGQHDIPNMSTVRLYCPKCEDLYNPKSSRHASIDGAYFGASFPSMLFQVYPGLVP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS  RY PRI+GFK+H  A
Sbjct: 181 EKSTSRYEPRIYGFKVHAAA 200



>gi|391867655|gb|EIT76898.1| casein kinase II, beta subunit [Aspergillus oryzae 3.042]
          Length = 265

 Score =  296 bits (757), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 131/200 (65%), Positives = 167/200 (83%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           M+D  S +DSDY  YW DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EV +Y  ALDL+
Sbjct: 2   MEDFNSETDSDYTSYWRDWFISSRGNEYFCEIDEEYLTDRFNLTGLNTEVPYYQYALDLV 61

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DD++RE +EKSARHLYGL+HAR+I+T+RGL KM++KYKK DFG+CPRV+C  
Sbjct: 62  TDVFDLDADDDLREQIEKSARHLYGLVHARYIVTTRGLTKMVDKYKKGDFGKCPRVMCEG 121

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
           QPLLP+G  D P   +V+LYCP+CED+YNPKS+RHASIDGAY+G++FP MLFQVYP L+P
Sbjct: 122 QPLLPMGQHDIPNMSTVRLYCPKCEDLYNPKSSRHASIDGAYFGASFPSMLFQVYPGLVP 181

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS  RY PRI+GFK+H  A
Sbjct: 182 EKSTSRYEPRIYGFKVHAAA 201



>gi|83774100|dbj|BAE64225.1| unnamed protein product [Aspergillus oryzae RIB40]
          Length = 237

 Score =  295 bits (756), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 131/200 (65%), Positives = 167/200 (83%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           M+D  S +DSDY  YW DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EV +Y  ALDL+
Sbjct: 2   MEDFNSETDSDYTSYWRDWFISSRGNEYFCEIDEEYLTDRFNLTGLNTEVPYYQYALDLV 61

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DD++RE +EKSARHLYGL+HAR+I+T+RGL KM++KYKK DFG+CPRV+C  
Sbjct: 62  TDVFDLDADDDLREQIEKSARHLYGLVHARYIVTTRGLTKMVDKYKKGDFGKCPRVMCEG 121

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
           QPLLP+G  D P   +V+LYCP+CED+YNPKS+RHASIDGAY+G++FP MLFQVYP L+P
Sbjct: 122 QPLLPMGQHDIPNMSTVRLYCPKCEDLYNPKSSRHASIDGAYFGASFPSMLFQVYPGLVP 181

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS  RY PRI+GFK+H  A
Sbjct: 182 EKSTSRYEPRIYGFKVHAAA 201



>gi|472588537|gb|EMS26009.1| casein kinase II subunit beta [Rhodosporidium toruloides NP11]
          Length = 255

 Score =  295 bits (755), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 143/227 (62%), Positives = 167/227 (73%), Gaps = 27/227 (11%)

Query: 2   DDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLIT 61
           DDL+  S   YA  WI WFL +KGNEYFCEVDEEYI DRFNLTGLN+EV  Y  ALDLI 
Sbjct: 3   DDLSISSSPSYANSWISWFLASKGNEYFCEVDEEYIQDRFNLTGLNAEVSGYSAALDLIL 62

Query: 62  DSL-EEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           D+  +E+L+DE RE +E SARHLYGLIHAR++ITSRGL+KM+EKYKK DFGRCPRVLC+ 
Sbjct: 63  DTAADEDLNDEQREELESSARHLYGLIHARYVITSRGLSKMIEKYKKGDFGRCPRVLCYG 122

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
           Q LLP+GLSD PY K+VKLYCPRCED+Y+PKS+RH SIDGAY+GSTF HMLF VYP ++P
Sbjct: 123 QSLLPLGLSDIPYQKAVKLYCPRCEDLYSPKSSRHGSIDGAYFGSTFAHMLFMVYPGMIP 182

Query: 181 PKS--------------------------NERYIPRIFGFKIHDIAK 201
            KS                           ER  PRIFGF++H+ AK
Sbjct: 183 SKSVPGAGQGAGGQAGLSGGGLGAQAAAKVERIRPRIFGFQVHEHAK 229



>gi|389749564|gb|EIM90735.1| hypothetical protein STEHIDRAFT_90583 [Stereum hirsutum FP-91666
           SS1]
          Length = 312

 Score =  294 bits (752), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 128/179 (71%), Positives = 161/179 (89%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD+++GSDSDY+K WI WFL++KGNEYFCEV+E+YILDRFNLTGLN+EVQ+Y QALDLI
Sbjct: 1   MDDVSTGSDSDYSKCWISWFLSSKGNEYFCEVEEDYILDRFNLTGLNTEVQNYSQALDLI 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD+L+E+  D++R  ++  AR LYGLIHAR+I+T+RGL KML+K+K+ADFGRCPRVLCH+
Sbjct: 61  TDNLDEDFQDDLRSGLDIQARLLYGLIHARWILTARGLQKMLDKFKRADFGRCPRVLCHS 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLL 179
           QPLLP+GL+D PY  SVKLYC RCEDIY+PKS+RH SIDGAY+G++FPH+LF VYP L+
Sbjct: 121 QPLLPLGLTDTPYESSVKLYCGRCEDIYSPKSSRHGSIDGAYFGTSFPHLLFLVYPGLI 179



>gi|296807843|ref|XP_002844260.1| casein kinase II subunit beta-2 [Arthroderma otae CBS 113480]
 gi|238843743|gb|EEQ33405.1| casein kinase II subunit beta-2 [Arthroderma otae CBS 113480]
          Length = 269

 Score =  293 bits (751), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 133/201 (66%), Positives = 171/201 (85%), Gaps = 1/201 (0%)

Query: 1   MDDLT-SGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDL 59
           MD+   + +DSDY  +W DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EVQ+Y  ALD+
Sbjct: 1   MDEFNNTDTDSDYTSFWRDWFISSRGNEYFCEIDEEYLTDRFNLTGLNTEVQYYQYALDM 60

Query: 60  ITDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCH 119
           +TD  + + DD++RE +EKSARHLYGL+HAR+I+T+RGLAKMLEKYK+ADFG+CPRV+CH
Sbjct: 61  VTDLFDLDADDDLREQIEKSARHLYGLVHARYIVTTRGLAKMLEKYKRADFGKCPRVMCH 120

Query: 120 NQPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLL 179
             PLLP+G SD P  K VKLYC +CEDIYNPKS+RHA++DGAY+GS+F ++LFQVYP L+
Sbjct: 121 QHPLLPMGQSDLPGLKPVKLYCAKCEDIYNPKSSRHAAVDGAYFGSSFHNILFQVYPDLI 180

Query: 180 PPKSNERYIPRIFGFKIHDIA 200
           P KS ERY PR+FGFK+H  A
Sbjct: 181 PDKSRERYEPRVFGFKVHACA 201



>gi|443898915|dbj|GAC76248.1| casein kinase II, beta subunit, partial [Pseudozyma antarctica
           T-34]
          Length = 189

 Score =  293 bits (751), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 131/180 (72%), Positives = 155/180 (86%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           +DDLT  S       W+ WFL TKGNEYFCEVDE+YILDRFNLTGLN+EVQHY QALDLI
Sbjct: 9   VDDLTEASSDYVPNSWVTWFLATKGNEYFCEVDEDYILDRFNLTGLNAEVQHYPQALDLI 68

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TDSLE++L D +R++VE  A+ LYGL+HAR+IIT+RGL KMLEKYK+ADFGRCPRVLC  
Sbjct: 69  TDSLEDDLSDSIRDSVEAQAKLLYGLVHARYIITTRGLGKMLEKYKRADFGRCPRVLCWQ 128

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
           QPLLPVGLSD P+ K+VKL+CPRCEDIY+PKS+RH +IDGA++GSTFPHMLF VYP ++P
Sbjct: 129 QPLLPVGLSDNPFQKAVKLFCPRCEDIYSPKSSRHGTIDGAFFGSTFPHMLFMVYPTVIP 188



>gi|392564754|gb|EIW57932.1| hypothetical protein TRAVEDRAFT_126290 [Trametes versicolor
           FP-101664 SS1]
          Length = 259

 Score =  293 bits (750), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 138/232 (59%), Positives = 170/232 (73%), Gaps = 46/232 (19%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELDDEMREA 75
           WI WFL++KGNEYFCEV+E+YILDRFNLTGLN+EVQHY QALD+ITD+L+EE+ D++R  
Sbjct: 4   WISWFLSSKGNEYFCEVEEDYILDRFNLTGLNTEVQHYAQALDMITDNLDEEIQDDLRGN 63

Query: 76  VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQPYTK 135
           ++  AR LYGLIHAR+I+T+RGLAKMLEKYK+ADFGRCPRVLC +QPLLPVGL+D PY K
Sbjct: 64  LDLQARLLYGLIHARWIVTARGLAKMLEKYKRADFGRCPRVLCQSQPLLPVGLTDVPYEK 123

Query: 136 SVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSN----------- 184
           SVKLYC RCEDIY+PKS+RH SIDGAY+G++FPH+LF VYP+L+PPKS            
Sbjct: 124 SVKLYCGRCEDIYSPKSSRHGSIDGAYFGTSFPHLLFLVYPNLIPPKSGPVELGLPGRGA 183

Query: 185 -----------------------------------ERYIPRIFGFKIHDIAK 201
                                              +RY PRIFGF++++IAK
Sbjct: 184 DIEGSRRSRRVREEQDAQAEGVGEAGSTAAVALKADRYRPRIFGFQVNEIAK 235



>gi|409039294|gb|EKM48934.1| hypothetical protein PHACADRAFT_107917, partial [Phanerochaete
           carnosa HHB-10118-sp]
          Length = 303

 Score =  293 bits (750), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 139/227 (61%), Positives = 170/227 (74%), Gaps = 41/227 (18%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELDDEMREA 75
           WI WFL++KGNEYFCEV+EEYILDRFNLTGLN+EV +Y QALDLITD+L++++ DE+R A
Sbjct: 1   WISWFLSSKGNEYFCEVEEEYILDRFNLTGLNTEVSNYNQALDLITDNLDDDIQDELRGA 60

Query: 76  VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQPYTK 135
           ++  AR LYGLIHAR+I+T+RGLAKMLEKYK+ADFGRCPRVLC +QPLLPVGL+D PY K
Sbjct: 61  LDVQARLLYGLIHARWIVTARGLAKMLEKYKRADFGRCPRVLCQSQPLLPVGLTDVPYEK 120

Query: 136 SVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSN----------- 184
           SVKLYC RCEDIY+PKS+RH SIDGAY+G++FPH+LF VYP+L+PPKS            
Sbjct: 121 SVKLYCGRCEDIYSPKSSRHGSIDGAYFGTSFPHLLFLVYPNLIPPKSGPVDLGIRGTEG 180

Query: 185 ------------------------------ERYIPRIFGFKIHDIAK 201
                                         ERY P+IFGF++H+IAK
Sbjct: 181 DGKRRRREEQELPTEGLGEGTSTAAVALKAERYRPKIFGFQVHEIAK 227



>gi|471901770|emb|CCO29864.1| Casein kinase II subunit beta-2 Short=CK II beta-2 [Rhizoctonia
           solani AG-1 IB]
          Length = 250

 Score =  293 bits (750), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 167/218 (76%), Gaps = 32/218 (14%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELDDEMREA 75
           W+ WFL++KGNEYFCEV+E+YILDRFNLTGLNSEV +Y  ALD +TD+L++++D+E+R++
Sbjct: 6   WVSWFLSSKGNEYFCEVEEDYILDRFNLTGLNSEVSNYQLALDFVTDNLDDDIDEELRQS 65

Query: 76  VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQPYTK 135
           VE SAR LYGLIHAR+I+TSRGL+KMLEKYKKADFGRCPRV+C +QPLLP GL+D PY K
Sbjct: 66  VEVSARLLYGLIHARWIVTSRGLSKMLEKYKKADFGRCPRVMCQSQPLLPCGLTDVPYEK 125

Query: 136 SVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSN----------- 184
           +VKLYCPRCED+Y+PKS+RH SIDGAY+G+TFPHML   YPH++P K N           
Sbjct: 126 AVKLYCPRCEDLYSPKSSRHGSIDGAYFGTTFPHMLLMGYPHMIPSKENRDGRRRDGEDD 185

Query: 185 ---------------------ERYIPRIFGFKIHDIAK 201
                                ERY P+IFGF +H+I+K
Sbjct: 186 KGVPSGVGVVEQSTAAAALKAERYRPKIFGFGVHEISK 223



>gi|310793251|gb|EFQ28712.1| casein kinase II regulatory subunit [Glomerella graminicola M1.001]
          Length = 251

 Score =  293 bits (749), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 128/181 (70%), Positives = 160/181 (88%)

Query: 17  IDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELDDEMREAV 76
           I  F++++GNEYFCE+DE+Y+ DRFNLTGLN+EVQ+Y  ALDLITD  + + DDEMRE +
Sbjct: 10  ITAFISSRGNEYFCEIDEDYLTDRFNLTGLNTEVQYYQYALDLITDVFDLDCDDEMRETI 69

Query: 77  EKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQPYTKS 136
           EKSARHLYGL+HARFI+T+RGLAKMLEKYKKADFG+CPRV+CH+ PLLP+GL+D P  K 
Sbjct: 70  EKSARHLYGLVHARFIVTTRGLAKMLEKYKKADFGKCPRVMCHSHPLLPMGLADIPNMKP 129

Query: 137 VKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIFGFKI 196
           VKLYC RCEDIYNPKS+RHA+IDGAY+G++F +++FQ YP L+P KS ERYIPR++GFK+
Sbjct: 130 VKLYCARCEDIYNPKSSRHAAIDGAYFGTSFHNIIFQAYPALIPTKSAERYIPRVYGFKV 189

Query: 197 H 197
           H
Sbjct: 190 H 190



>gi|67521630|ref|XP_658876.1| hypothetical protein AN1272.2 [Aspergillus nidulans FGSC A4]
 gi|40746709|gb|EAA65865.1| hypothetical protein AN1272.2 [Aspergillus nidulans FGSC A4]
 gi|259488405|tpe|CBF87816.1| TPA: beta' regulatory subunit of casein kinase 2 (Eurofung)
           [Aspergillus nidulans FGSC A4]
          Length = 264

 Score =  292 bits (747), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 131/200 (65%), Positives = 165/200 (82%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           M+D  S +DSDY  YW DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EV +Y  ALDL+
Sbjct: 2   MEDFNSETDSDYTSYWRDWFISSRGNEYFCEIDEEYLTDRFNLTGLNTEVPYYQYALDLV 61

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DD++RE +EKSARHLYGL+HAR+I+T+RGLAKM+EKYKK DFG+CPRV+C  
Sbjct: 62  TDVFDLDADDDLREQIEKSARHLYGLVHARYIVTTRGLAKMVEKYKKGDFGKCPRVMCEG 121

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP G +D P   +V+LYC +CEDIYNPKS+RHASIDGAY+G++F  MLFQVYP LLP
Sbjct: 122 HPLLPTGQNDVPNMSTVRLYCSKCEDIYNPKSSRHASIDGAYFGTSFTSMLFQVYPALLP 181

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS  RY PRI+GF++H  A
Sbjct: 182 EKSIRRYEPRIYGFRVHASA 201



>gi|505755226|gb|EOQ99450.1| Casein kinase II subunit beta [Wallemia ichthyophaga EXF-994]
          Length = 973

 Score =  291 bits (746), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 138/209 (66%), Positives = 172/209 (82%), Gaps = 19/209 (9%)

Query: 12  YAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELDDE 71
           ++  WI WFL+TKGNEYFCEVDEEYILDRFNLTGLN++VQ+Y QAL+LITD+L++E  D+
Sbjct: 739 FSNSWISWFLSTKGNEYFCEVDEEYILDRFNLTGLNNDVQNYSQALELITDNLDDEDLDD 798

Query: 72  -MREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSD 130
             R+A+E SAR+LYGLIHAR+IITSRGLAKML+K+K+ADFGRCPRV C +Q LLPVGLSD
Sbjct: 799 EQRDAIENSARYLYGLIHARYIITSRGLAKMLDKHKRADFGRCPRVFCTSQSLLPVGLSD 858

Query: 131 QPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSN------ 184
            PYTK+VKL+CPRCED+Y+PKS+RH SIDGAY+G+TFPHMLF VYP  LP K++      
Sbjct: 859 VPYTKAVKLFCPRCEDLYSPKSSRHGSIDGAYFGTTFPHMLFLVYPQQLPSKTSNNLPTS 918

Query: 185 ------------ERYIPRIFGFKIHDIAK 201
                       ERY+P+IFGF +H+++K
Sbjct: 919 KPATSTDAAIGVERYLPKIFGFPVHEMSK 947



>gi|350629476|gb|EHA17849.1| hypothetical protein ASPNIDRAFT_208357 [Aspergillus niger ATCC
           1015]
          Length = 264

 Score =  291 bits (746), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 166/200 (83%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           M+D  S +DSDY  YW DWF++++GNEYFCE+DE+Y+ DRFNLTGLN+EV +Y  ALDL+
Sbjct: 1   MEDFNSETDSDYTSYWRDWFISSRGNEYFCEIDEDYLTDRFNLTGLNTEVAYYQYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DD++RE +EKSARHLYGL+HAR+I+T+RGLAKM+EKYK+ DFG+CPRV+C  
Sbjct: 61  TDVFDLDADDDLREQIEKSARHLYGLVHARYIVTTRGLAKMVEKYKRCDFGKCPRVMCDG 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+G  D     +V+LYCP+CEDIYNPKS+RHASIDGAY+G++F  MLFQVYP LLP
Sbjct: 121 HPLLPMGQHDVANQSTVRLYCPKCEDIYNPKSSRHASIDGAYFGTSFHSMLFQVYPALLP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS  RY PR+FGFK+H +A
Sbjct: 181 EKSIRRYEPRVFGFKVHAMA 200



>gi|145239299|ref|XP_001392296.1| casein kinase II subunit beta-2 [Aspergillus niger CBS 513.88]
 gi|134076802|emb|CAK39857.1| unnamed protein product [Aspergillus niger]
          Length = 264

 Score =  291 bits (746), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 166/200 (83%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           M+D  S +DSDY  YW DWF++++GNEYFCE+DE+Y+ DRFNLTGLN+EV +Y  ALDL+
Sbjct: 1   MEDFNSETDSDYTSYWRDWFISSRGNEYFCEIDEDYLTDRFNLTGLNTEVAYYQYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DD++RE +EKSARHLYGL+HAR+I+T+RGLAKM+EKYK+ DFG+CPRV+C  
Sbjct: 61  TDVFDLDADDDLREQIEKSARHLYGLVHARYIVTTRGLAKMVEKYKRCDFGKCPRVMCDG 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+G  D     +V+LYCP+CEDIYNPKS+RHASIDGAY+G++F  MLFQVYP LLP
Sbjct: 121 HPLLPMGQHDVANQSTVRLYCPKCEDIYNPKSSRHASIDGAYFGTSFHSMLFQVYPALLP 180

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS  RY PR+FGFK+H +A
Sbjct: 181 EKSIRRYEPRVFGFKVHAMA 200



>gi|336383780|gb|EGO24929.1| hypothetical protein SERLADRAFT_349302 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 223

 Score =  291 bits (746), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 134/212 (63%), Positives = 168/212 (79%), Gaps = 26/212 (12%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELDDEMREA 75
           WI WFL++KGNEYFCEVDE+YILDRFNLTGLNS+V +Y QAL+LITD+L++E+ DE+R A
Sbjct: 1   WISWFLSSKGNEYFCEVDEDYILDRFNLTGLNSDVSNYSQALELITDNLDDEIQDELRGA 60

Query: 76  VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQPYTK 135
           ++  AR LYGLIHAR+I+T+RGLAKMLEK+K+ DFGRCPRVLC +QPLLPVGL+D PY K
Sbjct: 61  LDVQARLLYGLIHARWIVTARGLAKMLEKFKRVDFGRCPRVLCQSQPLLPVGLTDTPYEK 120

Query: 136 SVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSN----------- 184
           SVKLYC RCEDIY+PKS+RH SIDGAY+G++FPH+LF VYP+L+PPKS            
Sbjct: 121 SVKLYCGRCEDIYSPKSSRHGSIDGAYFGTSFPHLLFLVYPNLIPPKSGSPDLSFGSRST 180

Query: 185 ---------------ERYIPRIFGFKIHDIAK 201
                          +RY PRI+GF++++ AK
Sbjct: 181 DAEKLISTASVAMKADRYRPRIYGFQLNETAK 212



>gi|402222662|gb|EJU02728.1| hypothetical protein DACRYDRAFT_21714, partial [Dacryopinax sp.
           DJM-731 SS1]
          Length = 263

 Score =  291 bits (744), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 154/170 (90%), Gaps = 1/170 (0%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSL-EEELDDEMRE 74
           WI WFL+TKGNEYFCEV+E+YILDRFNLTGLN+EVQ+Y QALDLI D+L +++++DEMR 
Sbjct: 1   WISWFLSTKGNEYFCEVEEDYILDRFNLTGLNAEVQNYAQALDLINDNLGDDDIEDEMRA 60

Query: 75  AVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQPYT 134
            +E +AR LYGLIHAR+I+TSRGLAKMLEKYKK+DFGRCPR  C+ QPLLPVGL+D PY 
Sbjct: 61  TIEVNARFLYGLIHARWIVTSRGLAKMLEKYKKSDFGRCPRAFCYMQPLLPVGLTDVPYE 120

Query: 135 KSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSN 184
           K+VKLYCPRCEDIY PKS+RH SIDGAY+G+TFPHMLF VYPH++PPK++
Sbjct: 121 KAVKLYCPRCEDIYTPKSSRHGSIDGAYFGTTFPHMLFMVYPHMVPPKNS 170



>gi|449304708|gb|EMD00715.1| hypothetical protein BAUCODRAFT_118459 [Baudoinia compniacensis
           UAMH 10762]
          Length = 260

 Score =  291 bits (744), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 165/200 (82%), Gaps = 1/200 (0%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD  S SDS+Y  YW DWF++++GNEYFCE+DE+Y+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 1   MDDYAS-SDSEYTSYWRDWFISSRGNEYFCEIDEDYLTDRFNLTGLNTEVQYYQYALDLV 59

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + E+DD+MRE +EK+ARHLYGL+HAR+I+T+RGLAKM+EKYK+  FG+CPRV+C  
Sbjct: 60  TDVFDMEVDDDMREQIEKAARHLYGLVHARYIVTTRGLAKMMEKYKQGVFGKCPRVICEA 119

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
           Q LLP+G  D P    VKLYCP+CEDIYNPKS+RH SIDGAY+G++F ++LFQVY  L+P
Sbjct: 120 QHLLPMGQHDVPNVSHVKLYCPKCEDIYNPKSSRHNSIDGAYFGTSFHNILFQVYGTLMP 179

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            K+  RY PRI+GF++H  A
Sbjct: 180 QKTQRRYEPRIYGFRVHASA 199



>gi|169607477|ref|XP_001797158.1| hypothetical protein SNOG_06796 [Phaeosphaeria nodorum SN15]
 gi|160701418|gb|EAT85447.2| hypothetical protein SNOG_06796 [Phaeosphaeria nodorum SN15]
          Length = 242

 Score =  290 bits (743), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 126/183 (68%), Positives = 160/183 (87%)

Query: 18  DWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELDDEMREAVE 77
           D F++++GNEYFCE+DEEY+ DRFNLTGLN+EVQ+Y  ALDL+TD  + + DDEMREA+E
Sbjct: 6   DQFISSRGNEYFCEIDEEYLTDRFNLTGLNTEVQYYQYALDLVTDVFDFDCDDEMREAIE 65

Query: 78  KSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQPYTKSV 137
           KSARHLYGL+HAR+I+T+RGLAKMLEK+KK+DFG+CPRV+C +QPLLP+G SD P +  V
Sbjct: 66  KSARHLYGLVHARYIVTTRGLAKMLEKFKKSDFGKCPRVMCESQPLLPMGQSDVPNSSPV 125

Query: 138 KLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIFGFKIH 197
           KLYC RCED+YNPKS+RHA IDGAY+G++F ++LFQVYP +LPPKS  R+ PR+FGFK+H
Sbjct: 126 KLYCARCEDLYNPKSSRHAIIDGAYFGTSFHNILFQVYPAMLPPKSQRRFEPRVFGFKVH 185

Query: 198 DIA 200
             A
Sbjct: 186 AAA 188



>gi|58267552|ref|XP_570932.1| casein kinase ii beta chain (ck ii) [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|57227166|gb|AAW43625.1| casein kinase ii beta chain (ck ii), putative [Cryptococcus
           neoformans var. neoformans JEC21]
          Length = 271

 Score =  290 bits (741), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 145/238 (60%), Positives = 175/238 (73%), Gaps = 37/238 (15%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEV-QHYVQALDL 59
           M+DL++GS+SDYA  WI WFL++KGNEYFCEVDE+YILDRFNLTGLN+EV Q Y +AL L
Sbjct: 1   MEDLSTGSESDYADSWISWFLSSKGNEYFCEVDEDYILDRFNLTGLNAEVVQEYSRALSL 60

Query: 60  ITDSLEEELDDE-MREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLC 118
           ITD+L E+  D+  RE +E SAR LYGLIHARFI+T+RGLAKMLEKY+KADFGRCPRV C
Sbjct: 61  ITDNLNEDDLDDDTREGIETSARFLYGLIHARFIVTTRGLAKMLEKYRKADFGRCPRVYC 120

Query: 119 HNQPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHL 178
           ++QPLLPVGLSD PY K+VKLYCPRCEDIY+PKS RH SIDG+Y+G+TFPHMLF VYP +
Sbjct: 121 YSQPLLPVGLSDIPYQKAVKLYCPRCEDIYSPKSNRHGSIDGSYFGTTFPHMLFMVYPQM 180

Query: 179 LPPKSN-----------------------------------ERYIPRIFGFKIHDIAK 201
           +P K                                     E + P+IFGFK+++ AK
Sbjct: 181 IPGKGQPVGSSVADVNRSLVSAGQSREGGAGISTSAMALKAEMFEPKIFGFKVNEDAK 238



>gi|328773712|gb|EGF83749.1| hypothetical protein BATDEDRAFT_15229 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 222

 Score =  289 bits (739), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 124/186 (66%), Positives = 159/186 (85%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELDDEMREA 75
           WI+WFL+ +GNE+FCE+DEEYILDRFNL GL++EV++Y QA +LITDSLE+ELD  M + 
Sbjct: 16  WIEWFLSLRGNEFFCEIDEEYILDRFNLAGLHAEVKYYSQAFELITDSLEDELDPAMWDE 75

Query: 76  VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQPYTK 135
           VEKSARHLYGLIHARF+IT+RGL+KMLEK+K  +FGRCPRV CHNQ +LPVGLSD    K
Sbjct: 76  VEKSARHLYGLIHARFVITNRGLSKMLEKFKACEFGRCPRVFCHNQTVLPVGLSDSCGNK 135

Query: 136 SVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIFGFK 195
            VKLYCPRCED+Y+P S +HA++DGAY+G++ PH+L Q++P + P K+ ERY+PRIFGF+
Sbjct: 136 GVKLYCPRCEDVYSPISKKHAAVDGAYFGTSLPHLLLQMFPTMAPQKTIERYVPRIFGFR 195

Query: 196 IHDIAK 201
           +H  A+
Sbjct: 196 LHQFAE 201



>gi|302665292|ref|XP_003024258.1| hypothetical protein TRV_01609 [Trichophyton verrucosum HKI 0517]
 gi|291188305|gb|EFE43647.1| hypothetical protein TRV_01609 [Trichophyton verrucosum HKI 0517]
          Length = 276

 Score =  288 bits (738), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 128/210 (60%), Positives = 169/210 (80%), Gaps = 10/210 (4%)

Query: 1   MDDLT-SGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDL 59
           MD+   + +DSDY  +W DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EVQ+Y  ALD+
Sbjct: 1   MDEFNNTDTDSDYTSFWRDWFISSRGNEYFCEIDEEYLTDRFNLTGLNTEVQYYQYALDM 60

Query: 60  ITDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKML---------EKYKKADF 110
           +TD  + + D+++RE +EKSARHLYGL+HAR+I+T+RGLAKM+         EKYK ADF
Sbjct: 61  VTDLFDLDADEDLREQIEKSARHLYGLVHARYIVTTRGLAKMVHSPQRSLQVEKYKNADF 120

Query: 111 GRCPRVLCHNQPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHM 170
           G+CPRV+C   PLLP+G SD P  K VKLYC +CEDIYNPKS+RHA++DGAY+GS+F ++
Sbjct: 121 GKCPRVMCEQHPLLPMGQSDIPGQKPVKLYCAKCEDIYNPKSSRHAAVDGAYFGSSFHNV 180

Query: 171 LFQVYPHLLPPKSNERYIPRIFGFKIHDIA 200
           LFQVYP L+P KS +RY PR+FGF++H  A
Sbjct: 181 LFQVYPDLIPDKSRQRYEPRVFGFRVHACA 210



>gi|299750280|ref|XP_001836649.2| casein kinase subunit II beta [Coprinopsis cinerea okayama7#130]
 gi|298408829|gb|EAU85220.2| casein kinase subunit II beta [Coprinopsis cinerea okayama7#130]
          Length = 278

 Score =  288 bits (738), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 139/245 (56%), Positives = 173/245 (70%), Gaps = 44/245 (17%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           ++ L  G    Y   WI WFL++KGNEYFCEVDE++I+DRFNLTGLN+EV +Y QALDLI
Sbjct: 9   LNRLRLGLLQTYYSSWISWFLSSKGNEYFCEVDEDFIVDRFNLTGLNNEVANYSQALDLI 68

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD+L++++ DE+R +++  AR LYGLIHAR+IIT+RGL KMLEKYK+ADFGRCPRVLCH 
Sbjct: 69  TDNLDDDIQDELRGSLDVQARLLYGLIHARWIITARGLQKMLEKYKRADFGRCPRVLCHQ 128

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
           QPLLPVGL+D PY KSVKLYC RCED+Y+PKS+RH SIDGAY+G+TFPH+LF VYP LLP
Sbjct: 129 QPLLPVGLTDIPYEKSVKLYCGRCEDLYSPKSSRHGSIDGAYFGTTFPHLLFLVYPTLLP 188

Query: 181 PKSN--------------------------------------------ERYIPRIFGFKI 196
           PKS                                             +RY P+I+GF++
Sbjct: 189 PKSGPSDFGSGSSRDMAGDSRRRRLREEQEIAEGGGDAISTASVALKADRYRPKIYGFQV 248

Query: 197 HDIAK 201
           H+IAK
Sbjct: 249 HEIAK 253



>gi|322711522|gb|EFZ03095.1| DUF1339 domain protein [Metarhizium anisopliae ARSEF 23]
          Length = 1281

 Score =  287 bits (735), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 123/181 (67%), Positives = 159/181 (87%)

Query: 20   FLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELDDEMREAVEKS 79
            F++++GNEYFCE+DE+Y+ DRFNLTGLN+EVQ+Y  ALDL+TD  + + DDEMRE +EKS
Sbjct: 1045 FISSRGNEYFCEIDEDYLTDRFNLTGLNTEVQYYQYALDLVTDVFDLDCDDEMRETIEKS 1104

Query: 80   ARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQPYTKSVKL 139
            ARHLYGL+HARFI+T+RGL KML+KYKKA+FG+CPRV CH+ PLLP+GLSD P  K VKL
Sbjct: 1105 ARHLYGLVHARFIVTTRGLTKMLDKYKKAEFGKCPRVNCHSHPLLPMGLSDVPNVKPVKL 1164

Query: 140  YCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIFGFKIHDI 199
            +C RCEDIYNPKS+RHA+IDGAY+G++F +++FQVYP L+P K+ ERY+PR++GFK+H  
Sbjct: 1165 FCARCEDIYNPKSSRHATIDGAYFGTSFHNIIFQVYPALIPTKTMERYVPRVYGFKVHAS 1224

Query: 200  A 200
            A
Sbjct: 1225 A 1225



>gi|315042580|ref|XP_003170666.1| casein kinase II subunit beta-2 [Arthroderma gypseum CBS 118893]
 gi|311344455|gb|EFR03658.1| casein kinase II subunit beta-2 [Arthroderma gypseum CBS 118893]
          Length = 269

 Score =  287 bits (735), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 169/201 (84%), Gaps = 1/201 (0%)

Query: 1   MDDLT-SGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDL 59
           MD+   + +DSDY  +W DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EVQ+Y  ALD+
Sbjct: 1   MDEFNNTDTDSDYTSFWRDWFISSRGNEYFCEIDEEYLTDRFNLTGLNTEVQYYQYALDM 60

Query: 60  ITDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCH 119
           +TD  + + DD++RE +EKSARHLYGL+HAR+I+T+RGLAKM+EKYK ADFG+CPRV+C 
Sbjct: 61  VTDLFDLDADDDLREQIEKSARHLYGLVHARYIVTTRGLAKMVEKYKSADFGKCPRVMCE 120

Query: 120 NQPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLL 179
             PLLP+G SD P  K VKLYC +CEDIYNPKS+RHA++DGAY+GS+F ++LFQVYP L+
Sbjct: 121 QHPLLPMGQSDIPGQKPVKLYCAKCEDIYNPKSSRHAAVDGAYFGSSFHNVLFQVYPDLI 180

Query: 180 PPKSNERYIPRIFGFKIHDIA 200
           P KS +RY PR+FGF++H  A
Sbjct: 181 PDKSRQRYEPRVFGFRVHACA 201



>gi|512202746|gb|EPE31572.1| Casein kinase II beta subunit [Glarea lozoyensis ATCC 20868]
          Length = 427

 Score =  286 bits (731), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 158/181 (87%)

Query: 20  FLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELDDEMREAVEKS 79
           F++++GNEYFCE+DE+Y+ DRFNLTGLN+EVQ+Y  ALDL+TD  + + DDEMRE +EKS
Sbjct: 180 FISSRGNEYFCEIDEDYLTDRFNLTGLNTEVQYYQYALDLVTDVFDLDCDDEMRETIEKS 239

Query: 80  ARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQPYTKSVKL 139
           ARHLYGL+HAR+I+T+RGLAKMLEKYKKADFG+CPRV C + PLLP+G SD P  K+VKL
Sbjct: 240 ARHLYGLVHARYIVTTRGLAKMLEKYKKADFGKCPRVACKSHPLLPMGQSDNPNIKAVKL 299

Query: 140 YCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIFGFKIHDI 199
           YC RCEDIYNPKS+RH++IDGAY+G++F +++FQVYP L+P KS ERY PRI+GFK+H  
Sbjct: 300 YCARCEDIYNPKSSRHSAIDGAYFGTSFHNIIFQVYPALIPIKSYERYTPRIYGFKVHAP 359

Query: 200 A 200
           A
Sbjct: 360 A 360



>gi|115491301|ref|XP_001210278.1| casein kinase II beta 2 subunit [Aspergillus terreus NIH2624]
 gi|114197138|gb|EAU38838.1| casein kinase II beta 2 subunit [Aspergillus terreus NIH2624]
          Length = 266

 Score =  285 bits (729), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 165/200 (82%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           M+D  S +DSDY  YW DWF++++GNEYFCE+DEEY+ DRFNLTGLN+EV +Y  ALDL+
Sbjct: 2   MEDFNSETDSDYTSYWRDWFISSRGNEYFCEIDEEYLTDRFNLTGLNTEVPYYQYALDLV 61

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DD++RE +EKSARHLYGL+HAR+I+T+RGLAKM++KYKK DFG+CPRV+C  
Sbjct: 62  TDVFDVDADDDLREQIEKSARHLYGLVHARYIVTTRGLAKMVDKYKKGDFGKCPRVVCEG 121

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+G  D P   +V+LYC +CEDIYNPKS+RHA+IDGAY+GS+F  MLFQVYP L+P
Sbjct: 122 HPLLPMGQHDVPGMSTVRLYCAKCEDIYNPKSSRHAAIDGAYFGSSFHSMLFQVYPALVP 181

Query: 181 PKSNERYIPRIFGFKIHDIA 200
            KS  RY PRI+GFK+H  A
Sbjct: 182 EKSIRRYEPRIYGFKVHAAA 201



>gi|395326764|gb|EJF59170.1| hypothetical protein DICSQDRAFT_172319 [Dichomitus squalens
           LYAD-421 SS1]
          Length = 263

 Score =  284 bits (726), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 167/225 (74%), Gaps = 43/225 (19%)

Query: 20  FLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELDDEMREAVEKS 79
           FL++KGNEYFCEV+E+YILDRFNLTGLN+EVQHY QALD+ITD+L+EE+ D++R  ++  
Sbjct: 16  FLSSKGNEYFCEVEEDYILDRFNLTGLNTEVQHYAQALDMITDNLDEEIQDDLRGNLDLQ 75

Query: 80  ARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQPYTKSVKL 139
           AR LYGLIHAR+I+T+RGLAKMLEKYK+ADFGRCPRVLC +QPLLPVGL+D PY KSVKL
Sbjct: 76  ARLLYGLIHARWIVTARGLAKMLEKYKRADFGRCPRVLCQSQPLLPVGLTDVPYEKSVKL 135

Query: 140 YCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSN--------------- 184
           YC RCEDIY+PKS+RH SIDGAY+G++FPH+LF VYP+L+PPKS                
Sbjct: 136 YCGRCEDIYSPKSSRHGSIDGAYFGTSFPHLLFLVYPNLIPPKSGPVELALAGRGDVEGS 195

Query: 185 ----------------------------ERYIPRIFGFKIHDIAK 201
                                       +RY PRIFGF++++IAK
Sbjct: 196 RRSRRVRDEQETEGVGEGMSTASVALKADRYRPRIFGFQVNEIAK 240



>gi|390594580|gb|EIN03990.1| casein kinase subunit II beta [Punctularia strigosozonata HHB-11173
           SS5]
          Length = 265

 Score =  283 bits (725), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 136/237 (57%), Positives = 170/237 (71%), Gaps = 48/237 (20%)

Query: 13  AKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEE-LDDE 71
           A  WI WFL++KGNEYFCEV+E+YILDRFNLTGLN+EV +Y QALDLITD+LE++ + DE
Sbjct: 7   ALQWISWFLSSKGNEYFCEVEEDYILDRFNLTGLNTEVANYSQALDLITDNLEDDDVQDE 66

Query: 72  MREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQ 131
           +R +++  AR LYGLIHAR+I+T RGL+KML+KYK+ADFGRCPRV C +QPLLPVGL+D 
Sbjct: 67  LRGSLDVQARLLYGLIHARWIVTVRGLSKMLDKYKRADFGRCPRVFCQSQPLLPVGLTDV 126

Query: 132 PYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSN------- 184
           PY KSVKLYC RCEDIY+PKS+RH SIDGAY+G+TFPH++F VYPHL+PPK+N       
Sbjct: 127 PYEKSVKLYCGRCEDIYSPKSSRHGSIDGAYFGTTFPHLMFLVYPHLIPPKANPSDPARG 186

Query: 185 ----------------------------------------ERYIPRIFGFKIHDIAK 201
                                                   ERY P+IFGF++++IAK
Sbjct: 187 DGRAEDWAKGVRRRGSTREDEVVAEGAAEGLSTATAALKAERYRPKIFGFQVNEIAK 243



>gi|472243050|gb|EMR87718.1| putative casein kinase ii beta subunit protein [Botryotinia
           fuckeliana BcDW1]
          Length = 363

 Score =  282 bits (722), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 123/181 (67%), Positives = 159/181 (87%)

Query: 20  FLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELDDEMREAVEKS 79
           F++++GNEYFCE+DE+Y+ DRFNLTGL +EVQ+Y  ALDL+TD  + + DDEMRE +EKS
Sbjct: 113 FISSRGNEYFCEIDEDYLTDRFNLTGLQTEVQYYQYALDLVTDVFDLDCDDEMRETIEKS 172

Query: 80  ARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQPYTKSVKL 139
           ARHLYGL+HAR+I+T+RGLAKMLEKYKKADFG+CPRV+C + PLLP+G SD P  K+VKL
Sbjct: 173 ARHLYGLVHARYIVTTRGLAKMLEKYKKADFGKCPRVMCKSHPLLPMGQSDNPNIKAVKL 232

Query: 140 YCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIFGFKIHDI 199
           YC RCEDIYNPKS+RH++IDGAY+G++F ++LFQVYP ++P KS +RY+PRI+GFK+H  
Sbjct: 233 YCSRCEDIYNPKSSRHSAIDGAYFGTSFHNILFQVYPAMIPAKSYDRYVPRIYGFKVHAP 292

Query: 200 A 200
           A
Sbjct: 293 A 293



>gi|353235510|emb|CCA67522.1| related to casein kinase II beta subunit (regulator of circadian
           clock protein FRQ) [Piriformospora indica DSM 11827]
          Length = 280

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 138/238 (57%), Positives = 164/238 (68%), Gaps = 52/238 (21%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSL-EEELDDEMRE 74
           WI WFL+ KGNEYFC+V+E+YILDRFNLTGLN EVQHY  ALDLITD+L ++E ++E R 
Sbjct: 19  WISWFLSNKGNEYFCQVEEDYILDRFNLTGLNVEVQHYTHALDLITDNLADDEFEEEHRG 78

Query: 75  AVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQPYT 134
            +E SAR LYGLIHAR+IITSRGL KMLEK+KKADFGRCPRVLCH QPLLPVGL+D PY 
Sbjct: 79  GIELSARFLYGLIHARWIITSRGLVKMLEKFKKADFGRCPRVLCHGQPLLPVGLTDVPYE 138

Query: 135 KSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPK------------ 182
           KSVKLYC RCEDIY+PKSTRH S+DGA++G++FPHM++ VYP LLP K            
Sbjct: 139 KSVKLYCGRCEDIYSPKSTRHGSVDGAFFGTSFPHMMYLVYPALLPSKAGPSDHLLPAPA 198

Query: 183 ---------------------------------------SNERYIPRIFGFKIHDIAK 201
                                                  S ERY P++FGF+I++IAK
Sbjct: 199 GTDPRTRRRDKPEDVQNPAAQMTTAQLSEEQGSTATAALSAERYRPKVFGFQINEIAK 256



>gi|330927665|ref|XP_003301953.1| hypothetical protein PTT_13604 [Pyrenophora teres f. teres 0-1]
 gi|311322955|gb|EFQ89955.1| hypothetical protein PTT_13604 [Pyrenophora teres f. teres 0-1]
          Length = 678

 Score =  279 bits (713), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 124/181 (68%), Positives = 157/181 (86%)

Query: 20  FLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELDDEMREAVEKS 79
           F++++GNEYFCE+DEEY+ DRFNLTGLN+EVQ+Y  ALDL+TD  + + DD+MRE +EKS
Sbjct: 444 FISSRGNEYFCEIDEEYLTDRFNLTGLNTEVQYYQYALDLVTDVFDFDCDDDMREQIEKS 503

Query: 80  ARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQPYTKSVKL 139
           ARHLYGL+HAR+I+T+RGLAKMLEK+KK+DFG+CPRV+C +QPLLP+G SD P    VKL
Sbjct: 504 ARHLYGLVHARYIVTTRGLAKMLEKFKKSDFGKCPRVMCESQPLLPMGQSDVPNASPVKL 563

Query: 140 YCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIFGFKIHDI 199
           YC RCED+YNPKS+RHA IDGAY+G++F ++LFQVYP +LPPKS  RY PR+FGFK+H  
Sbjct: 564 YCARCEDLYNPKSSRHAVIDGAYFGTSFHNILFQVYPAVLPPKSQRRYEPRVFGFKVHSA 623

Query: 200 A 200
           A
Sbjct: 624 A 624



>gi|392578538|gb|EIW71666.1| hypothetical protein TREMEDRAFT_27752 [Tremella mesenterica DSM
           1558]
          Length = 273

 Score =  278 bits (712), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 137/241 (56%), Positives = 166/241 (68%), Gaps = 45/241 (18%)

Query: 6   SGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEV-QHYVQALDLITDSL 64
           S  +SDYA  WI WFL+TKGNEYF EVDE+YI DRFNLTGLNS+V   Y +ALDLITDSL
Sbjct: 5   STEESDYADSWISWFLSTKGNEYFAEVDEDYIFDRFNLTGLNSDVVAEYPKALDLITDSL 64

Query: 65  EEE-LDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPL 123
           ++E LDD+ RE +E SAR LYGLIHAR+I+TSRGLAKML+K++KADFGRCPRV C++QPL
Sbjct: 65  DDEALDDDTRETIEHSARFLYGLIHARYIVTSRGLAKMLDKFRKADFGRCPRVYCYSQPL 124

Query: 124 LPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKS 183
           LPVGLSD P  K+VKLYCPRCEDIY+PKS RH +IDGA++G+TFPHML  VYP  +P K 
Sbjct: 125 LPVGLSDIPDQKAVKLYCPRCEDIYSPKSNRHGTIDGAFFGTTFPHMLLMVYPQAIPTKG 184

Query: 184 N-------------------------------------------ERYIPRIFGFKIHDIA 200
                                                       + Y PR+FGF++H+ A
Sbjct: 185 QPVGATTGGLMDLRGVQAVREGGIVSGVGGVGTLGSTANVALKADTYQPRLFGFRVHEEA 244

Query: 201 K 201
           +
Sbjct: 245 R 245



>gi|440631837|gb|ELR01756.1| casein kinase 2, beta polypeptide [Geomyces destructans 20631-21]
          Length = 253

 Score =  275 bits (704), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 124/178 (69%), Positives = 158/178 (88%)

Query: 20  FLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELDDEMREAVEKS 79
           F++++GNEYFCE+DEEY+ DRFNLTGLN+EVQ+Y  ALDL+TD  + + DD+MRE +EKS
Sbjct: 12  FISSRGNEYFCEIDEEYLTDRFNLTGLNTEVQYYQYALDLVTDVFDLDCDDDMRETIEKS 71

Query: 80  ARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQPYTKSVKL 139
           ARHLYGL+HAR+I+T+RGLAKML+KYKK DFG+CPRV+C +QPLLP+G SD P  K+VKL
Sbjct: 72  ARHLYGLVHARYIVTTRGLAKMLDKYKKNDFGKCPRVMCKSQPLLPMGQSDNPNIKAVKL 131

Query: 140 YCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIFGFKIH 197
           YC +CEDIYNPKS+RHA+IDGAY+G++F ++LFQVYP L+P KS ERY PRI+GFK+H
Sbjct: 132 YCAKCEDIYNPKSSRHAAIDGAYFGTSFHNILFQVYPALMPAKSYERYSPRIYGFKVH 189



>gi|156053165|ref|XP_001592509.1| hypothetical protein SS1G_06750 [Sclerotinia sclerotiorum 1980]
 gi|154704528|gb|EDO04267.1| hypothetical protein SS1G_06750 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 429

 Score =  275 bits (702), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 124/189 (65%), Positives = 162/189 (85%), Gaps = 1/189 (0%)

Query: 10  SDYAKYW-IDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEEL 68
           S +A Y     F++++GNEYFCE+DE+Y+ DRFNLTGL +EVQ+Y  ALDL+TD  + + 
Sbjct: 171 SSFATYMPFKHFISSRGNEYFCEIDEDYLTDRFNLTGLQTEVQYYQYALDLVTDVFDLDC 230

Query: 69  DDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGL 128
           DD+MRE +EKSARHLYGL+HAR+I+T+RGLAKMLEKYKKADFG+CPRV+C + PLLP+G 
Sbjct: 231 DDDMRETIEKSARHLYGLVHARYIVTTRGLAKMLEKYKKADFGKCPRVMCKSHPLLPMGQ 290

Query: 129 SDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYI 188
           SD P  K+VKLYC RCEDIYNPKS+RH++IDGAY+G++F ++LFQVYP ++P KS +RY+
Sbjct: 291 SDNPNVKAVKLYCSRCEDIYNPKSSRHSAIDGAYFGTSFHNILFQVYPAMIPAKSFDRYV 350

Query: 189 PRIFGFKIH 197
           PRI+GFK+H
Sbjct: 351 PRIYGFKVH 359



>gi|238498606|ref|XP_002380538.1| casein kinase 2 beta' regulatory subunit Ckb2, putative
           [Aspergillus flavus NRRL3357]
 gi|220693812|gb|EED50157.1| casein kinase 2 beta' regulatory subunit Ckb2, putative
           [Aspergillus flavus NRRL3357]
          Length = 302

 Score =  274 bits (700), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 157/191 (82%)

Query: 10  SDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELD 69
           SD    W   F++++GNEYFCE+DEEY+ DRFNLTGLN+EV +Y  ALDL+TD  + + D
Sbjct: 48  SDDTANWRTQFISSRGNEYFCEIDEEYLTDRFNLTGLNTEVPYYQYALDLVTDVFDLDAD 107

Query: 70  DEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLS 129
           D++RE +EKSARHLYGL+HAR+I+T+RGL KM++KYKK DFG+CPRV+C  QPLLP+G  
Sbjct: 108 DDLREQIEKSARHLYGLVHARYIVTTRGLTKMVDKYKKGDFGKCPRVMCEGQPLLPMGQH 167

Query: 130 DQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIP 189
           D P   +V+LYCP+CED+YNPKS+RHASIDGAY+G++FP MLFQVYP L+P KS  RY P
Sbjct: 168 DIPNMSTVRLYCPKCEDLYNPKSSRHASIDGAYFGASFPSMLFQVYPGLVPEKSTSRYEP 227

Query: 190 RIFGFKIHDIA 200
           RI+GFK+H  A
Sbjct: 228 RIYGFKVHAAA 238



>gi|406604755|emb|CCH43815.1| Casein kinase II subunit beta [Wickerhamomyces ciferrii]
          Length = 251

 Score =  273 bits (698), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 157/201 (78%), Gaps = 1/201 (0%)

Query: 2   DDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLIT 61
           ++ TS S SD+ ++WIDWFL TKGNEYF ++D EYI D+FNLTGL  EV+   Q +D+IT
Sbjct: 5   EEYTSDSGSDFTEFWIDWFLGTKGNEYFVDIDVEYITDKFNLTGLYQEVEKIPQVIDVIT 64

Query: 62  DSLE-EELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           D L+ EEL DE RE +E +AR LYGLIH+R+IIT+RGL KMLEKYK ADFG C RV C  
Sbjct: 65  DGLKIEELTDEEREILEFNARLLYGLIHSRYIITARGLTKMLEKYKNADFGYCSRVFCQL 124

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
           Q LLPVGLSD     +VKLYCP+CED+YNPKS+RH+ IDGA++G++FP M  Q +PHL+P
Sbjct: 125 QHLLPVGLSDTTGVSAVKLYCPKCEDLYNPKSSRHSLIDGAFFGTSFPGMFLQAFPHLVP 184

Query: 181 PKSNERYIPRIFGFKIHDIAK 201
             S ERY+P+IFGF +HD +K
Sbjct: 185 QHSTERYVPKIFGFNLHDYSK 205



>gi|242767771|ref|XP_002341434.1| casein kinase 2 beta' regulatory subunit Ckb2, putative
           [Talaromyces stipitatus ATCC 10500]
 gi|218724630|gb|EED24047.1| casein kinase 2 beta' regulatory subunit Ckb2, putative
           [Talaromyces stipitatus ATCC 10500]
          Length = 309

 Score =  270 bits (690), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 125/190 (65%), Positives = 161/190 (84%)

Query: 11  DYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELDD 70
           ++ + +   F++++GNEYFCE+DEEY+ DRFNLTGLN+EVQ+Y  ALDLITD  + + DD
Sbjct: 52  NFRRPFSPQFISSRGNEYFCEIDEEYLTDRFNLTGLNTEVQYYQYALDLITDVFDLDADD 111

Query: 71  EMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSD 130
           ++RE +EKSARHLYGL+HAR+I+T+RGLAKML+KYKK DFG+CPRVLC   PLLP+G SD
Sbjct: 112 DLREQIEKSARHLYGLVHARYIVTTRGLAKMLDKYKKGDFGKCPRVLCDQHPLLPMGQSD 171

Query: 131 QPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPR 190
            P  K+VKLYC +CEDIYNPKS+RHASIDGAY+G++F ++LFQVYP L+P KS +RY PR
Sbjct: 172 LPNQKTVKLYCAKCEDIYNPKSSRHASIDGAYFGTSFHNILFQVYPALVPEKSIQRYEPR 231

Query: 191 IFGFKIHDIA 200
           I+GFK+H  A
Sbjct: 232 IYGFKVHATA 241



>gi|50553598|ref|XP_504210.1| YALI0E20955p [Yarrowia lipolytica]
 gi|49650079|emb|CAG79805.1| YALI0E20955p [Yarrowia lipolytica CLIB122]
          Length = 280

 Score =  267 bits (682), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 123/203 (60%), Positives = 159/203 (78%), Gaps = 2/203 (0%)

Query: 1   MDDLTSGSDSDYAK-YWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDL 59
           +D  T GS+S  ++ YW+DWFL  KGNEYFCEVDE++I DRFNLTGL++EV H   A +L
Sbjct: 10  VDYYTDGSESGLSEEYWVDWFLRAKGNEYFCEVDEDFITDRFNLTGLSTEVSHLQYAAEL 69

Query: 60  ITDSLE-EELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLC 118
           ITD+L+ +   D +R+ ++  A+HLYGLIHAR+I+T RGL KM+EKYK A FG+CPRV C
Sbjct: 70  ITDALDLDSFQDPVRQEIDADAKHLYGLIHARYILTPRGLTKMMEKYKLAHFGKCPRVNC 129

Query: 119 HNQPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHL 178
           +  PLLPVGL D     SVKLYC +CED+Y PKSTRHA+IDGAY+G++FP M+ Q +P L
Sbjct: 130 YFNPLLPVGLYDVAGQSSVKLYCTKCEDLYIPKSTRHANIDGAYFGTSFPAMILQAFPQL 189

Query: 179 LPPKSNERYIPRIFGFKIHDIAK 201
           LP K+NER++P IFGFK+H+ AK
Sbjct: 190 LPTKTNERHVPTIFGFKMHEHAK 212



>gi|358372969|dbj|GAA89570.1| casein kinase II beta 2 subunit [Aspergillus kawachii IFO 4308]
          Length = 300

 Score =  264 bits (675), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 154/185 (83%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELDDEMREA 75
           ++  F++++GNEYFCE+DE+Y+ DRFNLTGLN+EV +Y  ALDL+TD  + + DD++RE 
Sbjct: 52  FVRQFISSRGNEYFCEIDEDYLTDRFNLTGLNTEVAYYQYALDLVTDVFDLDADDDLREQ 111

Query: 76  VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQPYTK 135
           +EKSARHLYGL+HAR+I+T+RGLAKM+EKYK+ DFG+CPRV+C   PLLP+G  D     
Sbjct: 112 IEKSARHLYGLVHARYIVTTRGLAKMVEKYKRCDFGKCPRVMCDGHPLLPMGQHDVANQS 171

Query: 136 SVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIFGFK 195
           +V+LYCP+CEDIYNPKS+RHASIDGAY+G++F  MLFQVYP LLP KS  RY PR FGFK
Sbjct: 172 TVRLYCPKCEDIYNPKSSRHASIDGAYFGTSFHSMLFQVYPALLPEKSIRRYQPRCFGFK 231

Query: 196 IHDIA 200
           +H +A
Sbjct: 232 VHAMA 236



>gi|258570259|ref|XP_002543933.1| casein kinase II beta subunit [Uncinocarpus reesii 1704]
 gi|237904203|gb|EEP78604.1| casein kinase II beta subunit [Uncinocarpus reesii 1704]
          Length = 267

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 121/181 (66%), Positives = 152/181 (83%)

Query: 20  FLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELDDEMREAVEKS 79
           F++++GNEYFCE+DEEY++DRFNLTGLNSEV  Y  ALDL+TD  + + DD+ RE +EKS
Sbjct: 19  FISSRGNEYFCEIDEEYLIDRFNLTGLNSEVDFYQYALDLVTDVFDLDADDDTREQIEKS 78

Query: 80  ARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQPYTKSVKL 139
           ARHLYGL+HAR+I+T+RGLAKMLEKYK ADFG+CPRV+C   PLLP+GL+D    K VKL
Sbjct: 79  ARHLYGLVHARYIVTTRGLAKMLEKYKSADFGKCPRVMCEQHPLLPMGLTDVAGVKPVKL 138

Query: 140 YCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIFGFKIHDI 199
           YC +CEDIYNPKS RHASIDGAY+G++F ++LFQVYP L+P KS  RY P++FGF++H  
Sbjct: 139 YCAKCEDIYNPKSARHASIDGAYFGTSFHNILFQVYPCLIPEKSLRRYEPKVFGFRVHAS 198

Query: 200 A 200
           A
Sbjct: 199 A 199



>gi|425774404|gb|EKV12711.1| Casein kinase 2 beta' regulatory subunit Ckb2, putative
           [Penicillium digitatum PHI26]
 gi|425783608|gb|EKV21450.1| Casein kinase 2 beta' regulatory subunit Ckb2, putative
           [Penicillium digitatum Pd1]
          Length = 406

 Score =  264 bits (674), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 153/181 (84%)

Query: 20  FLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELDDEMREAVEKS 79
           F++++GNEYFCE+DE+Y+ DRFNLTGLN+EV +Y  ALDL+TD  + + DD++RE +EKS
Sbjct: 157 FVSSRGNEYFCEIDEDYLTDRFNLTGLNTEVSYYQYALDLVTDVFDLDADDDLREQIEKS 216

Query: 80  ARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQPYTKSVKL 139
           ARHLYGL+HAR+I+T+RGLAKMLEKYKK+DFG+CPRV+C    LLPVG SD P   +VKL
Sbjct: 217 ARHLYGLVHARYIVTTRGLAKMLEKYKKSDFGKCPRVMCDGHALLPVGESDLPNISTVKL 276

Query: 140 YCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIFGFKIHDI 199
           YCP+CEDIYNPKS+RH+SIDGAY+G++F  +LFQVYP L P KS  RY PRIFGFK+H  
Sbjct: 277 YCPKCEDIYNPKSSRHSSIDGAYFGTSFHSILFQVYPALNPEKSCRRYEPRIFGFKVHAA 336

Query: 200 A 200
           A
Sbjct: 337 A 337



>gi|320581875|gb|EFW96094.1| casein kinase II beta 2 subunit [Ogataea parapolymorpha DL-1]
          Length = 252

 Score =  262 bits (669), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 121/198 (61%), Positives = 148/198 (74%), Gaps = 2/198 (1%)

Query: 6   SGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD--S 63
           S S S+Y +YWIDWFL ++GNEYFC+VD EYI DRFNLTGLN  V      +D+ITD   
Sbjct: 8   SDSGSEYTEYWIDWFLGSRGNEYFCDVDVEYITDRFNLTGLNQYVDRISLLVDIITDRTQ 67

Query: 64  LEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPL 123
           + E   ++ R  +E +A+ LY LIHAR+IIT RGL KM+EKYK ADFG CPRV C   PL
Sbjct: 68  ISENESEQTRARLEDNAKFLYALIHARYIITQRGLNKMMEKYKNADFGYCPRVFCKLTPL 127

Query: 124 LPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKS 183
           LPVGLSD P   SVKLYCP CEDIYNPKS+RH+S+DGA++G++FP M FQ +P L+P  S
Sbjct: 128 LPVGLSDTPKVASVKLYCPNCEDIYNPKSSRHSSLDGAFFGTSFPAMFFQAFPELIPSHS 187

Query: 184 NERYIPRIFGFKIHDIAK 201
            + Y P+IFGF+IHD AK
Sbjct: 188 VDIYTPKIFGFQIHDYAK 205



>gi|50426617|ref|XP_461905.1| DEHA2G08206p [Debaryomyces hansenii CBS767]
 gi|49657575|emb|CAG90368.1| DEHA2G08206p [Debaryomyces hansenii CBS767]
          Length = 251

 Score =  261 bits (666), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 118/201 (58%), Positives = 153/201 (76%), Gaps = 1/201 (0%)

Query: 2   DDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLIT 61
           ++  S S SD+ +YWID FL  KGNEYFC++DEEYI DRFNLTGLN EV      +D+IT
Sbjct: 8   EEYISDSSSDFTEYWIDLFLGIKGNEYFCDIDEEYIRDRFNLTGLNQEVSKLPTLIDIIT 67

Query: 62  DSLE-EELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           D ++ E+  +E ++A+E +AR LYGLIHAR+I+TSRGL KM EKY+  DFG CPRV C  
Sbjct: 68  DLVDIEQQPEEHKDALELNARILYGLIHARYILTSRGLNKMFEKYRNGDFGYCPRVHCQL 127

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLPVGL+DQP   SVKLYC +CED+YNPKS RH+ +DGAY+G++FP M FQ +P ++P
Sbjct: 128 HPLLPVGLNDQPRLASVKLYCAKCEDLYNPKSGRHSVVDGAYFGTSFPAMFFQNFPQVIP 187

Query: 181 PKSNERYIPRIFGFKIHDIAK 201
               E Y+P++FGFK+HD +K
Sbjct: 188 THVKETYVPKVFGFKLHDYSK 208



>gi|344234111|gb|EGV65981.1| hypothetical protein CANTEDRAFT_112856 [Candida tenuis ATCC 10573]
          Length = 254

 Score =  258 bits (659), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 118/201 (58%), Positives = 149/201 (74%), Gaps = 1/201 (0%)

Query: 2   DDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLIT 61
           ++  + S SD+ +YWID FL  KGNEYFC++DEEYI DRFNLTGLN EV      +D+IT
Sbjct: 7   EEFYTDSSSDFTEYWIDLFLGIKGNEYFCDIDEEYIRDRFNLTGLNQEVNKLPTLIDIIT 66

Query: 62  DSLE-EELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           D ++ E  D+E RE +E +AR LYGLIHAR+I+TSRGL KM EKY+K DFG CPRV C  
Sbjct: 67  DVIDLESQDEEQRETLEHNARILYGLIHARYILTSRGLNKMFEKYRKGDFGYCPRVNCQL 126

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLPVGL+DQP   S+KLYC +CED YNPKS RH+ IDGAY+G++FP M FQ +P  +P
Sbjct: 127 HPLLPVGLNDQPRLASIKLYCAKCEDFYNPKSGRHSVIDGAYFGTSFPAMFFQNFPQAIP 186

Query: 181 PKSNERYIPRIFGFKIHDIAK 201
                 Y P++FGFK+HD ++
Sbjct: 187 VHDRRCYTPKVFGFKLHDYSQ 207



>gi|119495995|ref|XP_001264771.1| casein kinase II beta subunit CKB2 [Neosartorya fischeri NRRL 181]
 gi|119412933|gb|EAW22874.1| casein kinase II beta subunit CKB2 [Neosartorya fischeri NRRL 181]
          Length = 294

 Score =  258 bits (659), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 116/185 (62%), Positives = 151/185 (81%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELDDEMREA 75
           +   F++++GNEYFCE+DEEY+ DRFNLTGLN+EV +Y  ALDL+TD  + + DD++RE 
Sbjct: 43  YTTQFISSRGNEYFCEIDEEYLTDRFNLTGLNTEVPYYQYALDLVTDVFDLDADDDLREQ 102

Query: 76  VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQPYTK 135
           +EKSARHLYGL+HAR+I+T+RGL KM EKYK  DFG+CPRVLC  Q LLP+GL D     
Sbjct: 103 IEKSARHLYGLVHARYIVTTRGLGKMAEKYKNGDFGKCPRVLCEGQHLLPMGLHDIANQS 162

Query: 136 SVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIFGFK 195
           +V+LYC +CEDIYNPKS+RH+SIDGAY+GS+F  + FQV+P+L+PPKS  RY PRI+GF+
Sbjct: 163 TVRLYCAKCEDIYNPKSSRHSSIDGAYFGSSFHSIFFQVFPNLVPPKSTRRYEPRIYGFR 222

Query: 196 IHDIA 200
           +H  A
Sbjct: 223 VHASA 227



>gi|70995195|ref|XP_752362.1| casein kinase 2 beta' regulatory subunit Ckb2 [Aspergillus
           fumigatus Af293]
 gi|66849997|gb|EAL90324.1| casein kinase 2 beta' regulatory subunit Ckb2, putative
           [Aspergillus fumigatus Af293]
 gi|159131118|gb|EDP56231.1| casein kinase II beta subunit CKB2 [Aspergillus fumigatus A1163]
          Length = 294

 Score =  258 bits (658), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 116/185 (62%), Positives = 151/185 (81%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELDDEMREA 75
           +   F++++GNEYFCE+DEEY+ DRFNLTGLN+EV +Y  ALDL+TD  + + DD++RE 
Sbjct: 43  YTTQFISSRGNEYFCEIDEEYLTDRFNLTGLNTEVPYYQYALDLVTDVFDLDADDDLREQ 102

Query: 76  VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQPYTK 135
           +EKSARHLYGL+HAR+I+T+RGL KM EKYK  DFG+CPRVLC  Q LLP+GL D     
Sbjct: 103 IEKSARHLYGLVHARYIVTTRGLGKMAEKYKNGDFGKCPRVLCEGQHLLPMGLHDIANQS 162

Query: 136 SVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIFGFK 195
           +V+LYC +CEDIYNPKS+RH+SIDGAY+GS+F  + FQV+P+L+PPKS  RY PRI+GF+
Sbjct: 163 TVRLYCAKCEDIYNPKSSRHSSIDGAYFGSSFHSIFFQVFPNLVPPKSTRRYEPRIYGFR 222

Query: 196 IHDIA 200
           +H  A
Sbjct: 223 VHASA 227



>gi|150865565|ref|XP_001384834.2| hypothetical protein PICST_83851 [Scheffersomyces stipitis CBS
           6054]
 gi|149386821|gb|ABN66805.2| predicted protein [Scheffersomyces stipitis CBS 6054]
          Length = 253

 Score =  257 bits (657), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 116/201 (57%), Positives = 152/201 (75%), Gaps = 1/201 (0%)

Query: 2   DDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLIT 61
           ++  + S SD+ +YWID FL  KGNEYFC+VD+EYI DRFNLTGLN EV      +D+IT
Sbjct: 4   EEYVTDSSSDFTEYWIDLFLGIKGNEYFCDVDDEYIRDRFNLTGLNQEVSKLPTLIDIIT 63

Query: 62  DSLE-EELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           D ++ E   +E R+ +E +AR LYGLIHAR+I+TSRGL KM EKY+  DFG CPRV C  
Sbjct: 64  DLVDIESQPEEHRDTLEHNARILYGLIHARYILTSRGLNKMFEKYRNGDFGYCPRVHCQL 123

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GL+DQP   SVKLYC +CED++NPKS RH+ IDGAY+G++FP M FQ +P ++P
Sbjct: 124 HPLLPIGLNDQPRLNSVKLYCAKCEDLFNPKSARHSVIDGAYFGTSFPAMFFQNFPQVIP 183

Query: 181 PKSNERYIPRIFGFKIHDIAK 201
             S E Y+P++FGFK+H+ +K
Sbjct: 184 IHSKETYVPKVFGFKLHEYSK 204



>gi|494824111|gb|EON61430.1| hypothetical protein W97_00645 [Coniosporium apollinis CBS 100218]
          Length = 504

 Score =  256 bits (655), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 117/188 (62%), Positives = 153/188 (81%), Gaps = 7/188 (3%)

Query: 20  FLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELDDEMREAVEKS 79
           F++++GNEYFCE+DEEY+ DRFNLTGLN+EVQ+Y  ALDL+TD  + + DD+MRE +EKS
Sbjct: 260 FISSRGNEYFCEIDEEYLTDRFNLTGLNTEVQYYQYALDLVTDVFDLDCDDDMREQIEKS 319

Query: 80  ARHLYGLIHARFIITSRGLAKM-------LEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
           ARHLYGL+HAR+I+T+RGLAKM       L+K+KKADFG+CPRV C  Q LLP+G  D P
Sbjct: 320 ARHLYGLVHARYIVTTRGLAKMASQKCYALDKFKKADFGKCPRVACDQQALLPMGQHDTP 379

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYC +CEDIYNPKS+RHA+IDGAY+G++F ++LFQVYP ++P K+  RY P++F
Sbjct: 380 NGSPVKLYCAKCEDIYNPKSSRHATIDGAYFGTSFHNILFQVYPAMVPVKTQRRYEPKVF 439

Query: 193 GFKIHDIA 200
           GF++H  A
Sbjct: 440 GFRVHASA 447



>gi|459369657|gb|EMG47998.1| Casein kinase 2 beta' subunit [Candida maltosa Xu316]
          Length = 269

 Score =  256 bits (654), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 154/202 (76%), Gaps = 1/202 (0%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           +++  + S SD+ +YWID FL  KGNEYFC++D+EYI DRFNLTGLN EV      +D+I
Sbjct: 3   IEEYATDSSSDFTEYWIDLFLGIKGNEYFCDIDDEYIRDRFNLTGLNQEVSKLPTLIDII 62

Query: 61  TDSLE-EELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCH 119
           TD ++ +   +E R+++E +AR LYGLIHAR+I+T+RGL KM EK++  DFG CPRV C 
Sbjct: 63  TDVIDLDSQPEEHRDSLEHNARILYGLIHARYILTTRGLNKMFEKFRSGDFGYCPRVHCQ 122

Query: 120 NQPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLL 179
             PLLP+GL+DQP   SVKLYC +CED+YNPKS RH+ IDGAY+G++FP M FQ +P+ +
Sbjct: 123 LNPLLPIGLNDQPRMASVKLYCSKCEDLYNPKSGRHSVIDGAYFGTSFPAMFFQNFPNTI 182

Query: 180 PPKSNERYIPRIFGFKIHDIAK 201
           P  S E Y+PR+FGFK+H+ +K
Sbjct: 183 PIHSKETYVPRVFGFKLHEYSK 204



>gi|121701997|ref|XP_001269263.1| casein kinase II beta subunit CKB2 [Aspergillus clavatus NRRL 1]
 gi|119397406|gb|EAW07837.1| casein kinase II beta subunit CKB2 [Aspergillus clavatus NRRL 1]
          Length = 296

 Score =  255 bits (651), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 150/181 (82%)

Query: 20  FLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELDDEMREAVEKS 79
           F++++GNEYFCE+DEEY+ DRFNLTGLN+EV +Y  ALDL+TD  + + DD++RE +EKS
Sbjct: 49  FISSRGNEYFCEIDEEYLTDRFNLTGLNTEVPYYQYALDLVTDVFDLDADDDLREQIEKS 108

Query: 80  ARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQPYTKSVKL 139
           ARHLYGL+HAR+I+T+RGL KM EKYK  DFG+CPRVLC  Q LLP+GL D     +V+L
Sbjct: 109 ARHLYGLVHARYIVTTRGLGKMAEKYKNGDFGKCPRVLCEGQHLLPMGLHDIANMSTVRL 168

Query: 140 YCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIFGFKIHDI 199
           YCP+CEDIYNPKS+RH+SIDGAY+GS+F  + FQV+ +L+PPKS  RY PRI+GF++H  
Sbjct: 169 YCPKCEDIYNPKSSRHSSIDGAYFGSSFHSIFFQVFTNLVPPKSIRRYEPRIYGFRVHAS 228

Query: 200 A 200
           A
Sbjct: 229 A 229



>gi|361130679|gb|EHL02429.1| putative Casein kinase II subunit beta-2 [Glarea lozoyensis 74030]
          Length = 204

 Score =  255 bits (651), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 111/159 (69%), Positives = 137/159 (86%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           M+D  S +DSDY  YW DWF++++GNEYFCE+DE+Y+ DRFNLTGLN+EVQ+Y  ALDL+
Sbjct: 1   MEDFNSETDSDYTSYWRDWFISSRGNEYFCEIDEDYLTDRFNLTGLNTEVQYYQYALDLV 60

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           TD  + + DDEMRE +EKSARHLYGL+HAR+I+T+RGLAKMLEKYKKADFG+CPRV C +
Sbjct: 61  TDVFDLDCDDEMRETIEKSARHLYGLVHARYIVTTRGLAKMLEKYKKADFGKCPRVACKS 120

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASID 159
            PLLP+G SD P  K+VKLYC RCEDIYNPKS+RH++ID
Sbjct: 121 HPLLPMGQSDNPNIKAVKLYCARCEDIYNPKSSRHSAID 159



>gi|344301935|gb|EGW32240.1| hypothetical protein SPAPADRAFT_61320 [Spathaspora passalidarum
           NRRL Y-27907]
          Length = 242

 Score =  254 bits (649), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 113/202 (55%), Positives = 151/202 (74%), Gaps = 1/202 (0%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           M D  + S SD+ +YWID FL  KGNEYFC++D+EYI DRFNLTGLN EV      +D+I
Sbjct: 1   MADYITDSSSDFTEYWIDLFLGIKGNEYFCDIDDEYIRDRFNLTGLNQEVSKLPTLIDII 60

Query: 61  TDSLE-EELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCH 119
           TD ++ +   ++ R+ +E +AR LYGLIHAR+I+TSRGL KM EK++  DFG CPR+ C 
Sbjct: 61  TDLIDLDSQPEDQRDTLEHNARILYGLIHARYILTSRGLNKMFEKFRNGDFGYCPRINCQ 120

Query: 120 NQPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLL 179
             PLLP+GL+D P   SVKLYC +CED++NPKS RHA IDGAY+G++FP M FQ +P+ +
Sbjct: 121 LHPLLPIGLNDSPRVASVKLYCAKCEDLFNPKSNRHAVIDGAYFGTSFPAMFFQNFPNAI 180

Query: 180 PPKSNERYIPRIFGFKIHDIAK 201
           P  S E Y+PR+FGFK+H+ ++
Sbjct: 181 PIHSKETYVPRVFGFKLHEYSQ 202



>gi|340372967|ref|XP_003385015.1| PREDICTED: casein kinase II subunit beta-like [Amphimedon
           queenslandica]
          Length = 221

 Score =  253 bits (645), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 144/186 (77%), Gaps = 1/186 (0%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDEMRE 74
           WI WF + +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD I D   ++EL+D   +
Sbjct: 9   WISWFCSLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDTILDLEPDDELEDNQSD 68

Query: 75  AVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQPYT 134
            VE++A  LYGLIHAR+I+T+RGLA+M+EKY++ DFG C RV C NQP+LP+GLSD P  
Sbjct: 69  LVEQAAEMLYGLIHARYILTNRGLAQMIEKYQQGDFGHCSRVFCENQPVLPIGLSDVPGE 128

Query: 135 KSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIFGF 194
             VKLYCP+C D+Y PKS+RH  IDG Y+G+ FPHMLF V+  L PPK   ++IPR++GF
Sbjct: 129 SMVKLYCPKCCDVYTPKSSRHHHIDGVYFGTGFPHMLFMVHQELRPPKPTNQFIPRLYGF 188

Query: 195 KIHDIA 200
           KIH +A
Sbjct: 189 KIHPLA 194



>gi|146417981|ref|XP_001484957.1| hypothetical protein PGUG_02686 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 242

 Score =  252 bits (643), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 118/201 (58%), Positives = 147/201 (73%), Gaps = 1/201 (0%)

Query: 2   DDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLIT 61
           D+  S S SD+  YWID FL  KGNEYFC++D+EYI DRFNLTGLN EV      +D+IT
Sbjct: 3   DEYISDSSSDFTDYWIDLFLGIKGNEYFCDIDDEYIRDRFNLTGLNQEVSRLPTLIDIIT 62

Query: 62  DSLEEELD-DEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           D ++ EL  +E R+A+E +AR LYGLIHAR+I+T+RGL KM EKY+  DFG CPRV C  
Sbjct: 63  DLVDIELQPEEHRDALEHNARVLYGLIHARYILTTRGLNKMFEKYRNGDFGYCPRVHCQL 122

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLPVGL D P   SVKLYC +CED+YNPKS RH+ IDGAY+GS+FP M  Q +   +P
Sbjct: 123 HPLLPVGLHDLPRVSSVKLYCSKCEDLYNPKSGRHSVIDGAYFGSSFPAMFLQNFSQAIP 182

Query: 181 PKSNERYIPRIFGFKIHDIAK 201
             S E Y P++FGFK+H+ +K
Sbjct: 183 THSAEMYTPKVFGFKLHEYSK 203



>gi|190346490|gb|EDK38588.2| hypothetical protein PGUG_02686 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 242

 Score =  251 bits (640), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 146/201 (72%), Gaps = 1/201 (0%)

Query: 2   DDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLIT 61
           D+  S S SD+  YWID FL  KGNEYFC++D+EYI DRFNLTGLN EV      +D+IT
Sbjct: 3   DEYISDSSSDFTDYWIDLFLGIKGNEYFCDIDDEYIRDRFNLTGLNQEVSRLPTLIDIIT 62

Query: 62  DSLE-EELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           D ++ E   +E R+A+E +AR LYGLIHAR+I+T+RGL KM EKY+  DFG CPRV C  
Sbjct: 63  DLVDIESQPEEHRDALEHNARVLYGLIHARYILTTRGLNKMFEKYRNGDFGYCPRVHCQL 122

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLPVGL D P   SVKLYC +CED+YNPKS RH+ IDGAY+GS+FP M  Q +   +P
Sbjct: 123 HPLLPVGLHDSPRVSSVKLYCSKCEDLYNPKSGRHSVIDGAYFGSSFPAMFLQNFSQAIP 182

Query: 181 PKSNERYIPRIFGFKIHDIAK 201
             S E Y P++FGFK+H+ +K
Sbjct: 183 THSAEMYTPKVFGFKLHEYSK 203



>gi|301789295|ref|XP_002930069.1| PREDICTED: casein kinase II subunit beta-like isoform 1 [Ailuropoda
           melanoleuca]
          Length = 235

 Score =  248 bits (634), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 110/188 (58%), Positives = 145/188 (77%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDEMRE 74
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   +EEL+D   +
Sbjct: 29  WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQ 88

Query: 75  A--VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
           +  +E++A  LYGLIHAR+I+T+RG+A+MLEKY++ DFG CPRV C NQP+LP+GLSD P
Sbjct: 89  SDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIP 148

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 149 GEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLY 208

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 209 GFKIHPMA 216



>gi|478500191|ref|XP_004424419.1| PREDICTED: casein kinase II subunit beta isoform 1 [Ceratotherium
           simum simum]
          Length = 235

 Score =  248 bits (633), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 110/188 (58%), Positives = 145/188 (77%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDEMRE 74
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   +EEL+D   +
Sbjct: 29  WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQ 88

Query: 75  A--VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
           +  +E++A  LYGLIHAR+I+T+RG+A+MLEKY++ DFG CPRV C NQP+LP+GLSD P
Sbjct: 89  SDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIP 148

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 149 GEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLY 208

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 209 GFKIHPMA 216



>gi|466089368|ref|XP_004286643.1| PREDICTED: casein kinase II subunit beta isoform 1 [Orcinus orca]
 gi|470597213|ref|XP_004311254.1| PREDICTED: casein kinase II subunit beta isoform 1 [Tursiops
           truncatus]
          Length = 235

 Score =  248 bits (633), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 110/188 (58%), Positives = 145/188 (77%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDEMRE 74
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   +EEL+D   +
Sbjct: 29  WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQ 88

Query: 75  A--VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
           +  +E++A  LYGLIHAR+I+T+RG+A+MLEKY++ DFG CPRV C NQP+LP+GLSD P
Sbjct: 89  SDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIP 148

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 149 GEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLY 208

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 209 GFKIHPMA 216



>gi|395537127|ref|XP_003770556.1| PREDICTED: casein kinase II subunit beta-like, partial [Sarcophilus
           harrisii]
          Length = 250

 Score =  248 bits (633), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 110/188 (58%), Positives = 145/188 (77%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDEMRE 74
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   +EEL+D   +
Sbjct: 44  WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQ 103

Query: 75  A--VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
           +  +E++A  LYGLIHAR+I+T+RG+A+MLEKY++ DFG CPRV C NQP+LP+GLSD P
Sbjct: 104 SDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIP 163

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 164 GEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLY 223

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 224 GFKIHPMA 231



>gi|472392017|ref|XP_004415292.1| PREDICTED: casein kinase II subunit beta isoform 1 [Odobenus
           rosmarus divergens]
          Length = 235

 Score =  248 bits (633), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 110/188 (58%), Positives = 145/188 (77%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDEMRE 74
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   +EEL+D   +
Sbjct: 29  WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQ 88

Query: 75  A--VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
           +  +E++A  LYGLIHAR+I+T+RG+A+MLEKY++ DFG CPRV C NQP+LP+GLSD P
Sbjct: 89  SDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIP 148

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 149 GEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLY 208

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 209 GFKIHPMA 216



>gi|444721101|gb|ELW61854.1| Casein kinase II subunit beta [Tupaia chinensis]
          Length = 235

 Score =  248 bits (633), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 110/188 (58%), Positives = 145/188 (77%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDEMRE 74
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   +EEL+D   +
Sbjct: 29  WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQ 88

Query: 75  A--VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
           +  +E++A  LYGLIHAR+I+T+RG+A+MLEKY++ DFG CPRV C NQP+LP+GLSD P
Sbjct: 89  SDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIP 148

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 149 GEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLY 208

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 209 GFKIHPMA 216



>gi|512925596|ref|XP_004905498.1| PREDICTED: casein kinase II subunit beta [Heterocephalus glaber]
          Length = 236

 Score =  248 bits (633), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 110/188 (58%), Positives = 145/188 (77%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDEMRE 74
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   +EEL+D   +
Sbjct: 30  WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQ 89

Query: 75  A--VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
           +  +E++A  LYGLIHAR+I+T+RG+A+MLEKY++ DFG CPRV C NQP+LP+GLSD P
Sbjct: 90  SDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIP 149

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 150 GEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLY 209

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 210 GFKIHPMA 217



>gi|511923747|ref|XP_004781035.1| PREDICTED: casein kinase II subunit beta isoform X3 [Mustela
           putorius furo]
 gi|512019053|ref|XP_004826784.1| PREDICTED: casein kinase II subunit beta isoform X3 [Mustela
           putorius furo]
          Length = 235

 Score =  248 bits (633), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 110/188 (58%), Positives = 145/188 (77%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDEMRE 74
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   +EEL+D   +
Sbjct: 29  WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQ 88

Query: 75  A--VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
           +  +E++A  LYGLIHAR+I+T+RG+A+MLEKY++ DFG CPRV C NQP+LP+GLSD P
Sbjct: 89  SDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIP 148

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 149 GEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLY 208

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 209 GFKIHPMA 216



>gi|471418618|ref|XP_004390805.1| PREDICTED: casein kinase II subunit beta isoform 1 [Trichechus
           manatus latirostris]
          Length = 235

 Score =  248 bits (633), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 110/188 (58%), Positives = 145/188 (77%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDEMRE 74
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   +EEL+D   +
Sbjct: 29  WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQ 88

Query: 75  A--VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
           +  +E++A  LYGLIHAR+I+T+RG+A+MLEKY++ DFG CPRV C NQP+LP+GLSD P
Sbjct: 89  SDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIP 148

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 149 GEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLY 208

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 209 GFKIHPMA 216



>gi|426352425|ref|XP_004043713.1| PREDICTED: casein kinase II subunit beta isoform 2 [Gorilla gorilla
           gorilla]
 gi|119623880|gb|EAX03475.1| casein kinase 2, beta polypeptide, isoform CRA_d [Homo sapiens]
 gi|355561533|gb|EHH18165.1| hypothetical protein EGK_14715 [Macaca mulatta]
 gi|355748435|gb|EHH52918.1| hypothetical protein EGM_13453 [Macaca fascicularis]
          Length = 234

 Score =  248 bits (633), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 110/188 (58%), Positives = 145/188 (77%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDEMRE 74
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   +EEL+D   +
Sbjct: 28  WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQ 87

Query: 75  A--VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
           +  +E++A  LYGLIHAR+I+T+RG+A+MLEKY++ DFG CPRV C NQP+LP+GLSD P
Sbjct: 88  SDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIP 147

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 148 GEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLY 207

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 208 GFKIHPMA 215



>gi|440898775|gb|ELR50200.1| Casein kinase II subunit beta [Bos grunniens mutus]
          Length = 235

 Score =  248 bits (633), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 110/188 (58%), Positives = 145/188 (77%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDEMRE 74
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   +EEL+D   +
Sbjct: 29  WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQ 88

Query: 75  A--VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
           +  +E++A  LYGLIHAR+I+T+RG+A+MLEKY++ DFG CPRV C NQP+LP+GLSD P
Sbjct: 89  SDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIP 148

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 149 GEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLY 208

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 209 GFKIHPMA 216



>gi|148694713|gb|EDL26660.1| casein kinase II, beta subunit, isoform CRA_c [Mus musculus]
          Length = 236

 Score =  248 bits (633), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 110/188 (58%), Positives = 145/188 (77%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDEMRE 74
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   +EEL+D   +
Sbjct: 30  WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQ 89

Query: 75  A--VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
           +  +E++A  LYGLIHAR+I+T+RG+A+MLEKY++ DFG CPRV C NQP+LP+GLSD P
Sbjct: 90  SDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIP 149

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 150 GEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLY 209

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 210 GFKIHPMA 217



>gi|149028072|gb|EDL83523.1| casein kinase 2, beta subunit, isoform CRA_b [Rattus norvegicus]
          Length = 235

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 110/188 (58%), Positives = 145/188 (77%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDEMRE 74
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   +EEL+D   +
Sbjct: 29  WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQ 88

Query: 75  A--VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
           +  +E++A  LYGLIHAR+I+T+RG+A+MLEKY++ DFG CPRV C NQP+LP+GLSD P
Sbjct: 89  SDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIP 148

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 149 GEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLY 208

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 209 GFKIHPMA 216



>gi|479274680|emb|CCI79673.1| Csnk2b splicing isoform 670 [Mus musculus]
          Length = 215

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 110/188 (58%), Positives = 146/188 (77%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSL-EEELDDEMRE 74
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D + +EEL+D   +
Sbjct: 9   WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLVPDEELEDNPNQ 68

Query: 75  A--VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
           +  +E++A  LYGLIHAR+I+T+RG+A+MLEKY++ DFG CPRV C NQP+LP+GLSD P
Sbjct: 69  SDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 129 GEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLY 188

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 189 GFKIHPMA 196



>gi|452824770|gb|EME31771.1| casein kinase 2, beta polypeptide [Galdieria sulphuraria]
          Length = 244

 Score =  248 bits (632), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 112/197 (56%), Positives = 149/197 (75%), Gaps = 4/197 (2%)

Query: 9   DSDYAK--YWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD--SL 64
           DS+ +K   WI WF + KGNE+FCEVDEE+I D FNLTGL+++V  Y  A+D I D    
Sbjct: 29  DSELSKDTSWIMWFCSLKGNEFFCEVDEEFIHDDFNLTGLSTQVAFYEHAVDTILDFDIP 88

Query: 65  EEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLL 124
           E ELD+  +E VE +A  LYGLIHARFI+T+RGL  MLEK+ +ADFGRCPRVLCH QP++
Sbjct: 89  EGELDERQQELVEVAAETLYGLIHARFILTARGLQLMLEKFNRADFGRCPRVLCHGQPVV 148

Query: 125 PVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSN 184
           PVGLSD P   +VK++CPRC DI+NP+S  H ++DGAY+G+TF H+ F  YP  +P ++ 
Sbjct: 149 PVGLSDTPRQNTVKVFCPRCWDIFNPRSRSHCTLDGAYWGTTFAHLFFHTYPDRIPVRNK 208

Query: 185 ERYIPRIFGFKIHDIAK 201
           E YIPRI+GF++H+ ++
Sbjct: 209 ETYIPRIYGFRLHETSE 225



>gi|89269873|emb|CAJ83806.1| casein kinase 2, beta subunit [Xenopus (Silurana) tropicalis]
          Length = 215

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 110/188 (58%), Positives = 145/188 (77%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDEMRE 74
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   +EEL+D   +
Sbjct: 9   WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLQPDEELEDNPNQ 68

Query: 75  A--VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
           +  +E++A  LYGLIHAR+I+T+RG+A+MLEKY++ DFG CPRV C NQP+LP+GLSD P
Sbjct: 69  SDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 129 GEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLY 188

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 189 GFKIHPMA 196



>gi|281342582|gb|EFB18166.1| hypothetical protein PANDA_020408 [Ailuropoda melanoleuca]
          Length = 219

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 110/188 (58%), Positives = 145/188 (77%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDEMRE 74
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   +EEL+D   +
Sbjct: 13  WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQ 72

Query: 75  A--VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
           +  +E++A  LYGLIHAR+I+T+RG+A+MLEKY++ DFG CPRV C NQP+LP+GLSD P
Sbjct: 73  SDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIP 132

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 133 GEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLY 192

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 193 GFKIHPMA 200



>gi|181155|gb|AAA52123.1| casein kinase II beta subunit [Homo sapiens]
          Length = 215

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 110/188 (58%), Positives = 145/188 (77%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDEMRE 74
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   +EEL+D   +
Sbjct: 9   WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQ 68

Query: 75  A--VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
           +  +E++A  LYGLIHAR+I+T+RG+A+MLEKY++ DFG CPRV C NQP+LP+GLSD P
Sbjct: 69  SDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 129 GEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLY 188

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 189 GFKIHAMA 196



>gi|18858421|ref|NP_571262.1| casein kinase II subunit beta [Danio rerio]
 gi|348519371|ref|XP_003447204.1| PREDICTED: casein kinase II subunit beta-like [Oreochromis
           niloticus]
 gi|432881500|ref|XP_004073813.1| PREDICTED: casein kinase II subunit beta-like [Oryzias latipes]
 gi|498977122|ref|XP_004549036.1| PREDICTED: casein kinase II subunit beta-like isoform X2 [Maylandia
           zebra]
 gi|6016423|sp|Q91398.1|CSK2B_DANRE RecName: Full=Casein kinase II subunit beta; Short=CK II beta
 gi|11280586|pir||JC7269 protein kinase (EC 2.7.1.37) CK2 beta chain - common carp
 gi|7672353|gb|AAF66446.1|AF133088_1 CK2 beta subunit [Cyprinus carpio]
 gi|914051|gb|AAB34249.1| casein kinase 2 beta subunit [Danio rerio]
 gi|94732796|emb|CAK10926.1| casein kinase 2 beta [Danio rerio]
 gi|190336668|gb|AAI62496.1| Ck2b protein [Danio rerio]
 gi|190337992|gb|AAI62490.1| Ck2b protein [Danio rerio]
 gi|209154458|gb|ACI33461.1| Casein kinase II subunit beta [Salmo salar]
 gi|209736036|gb|ACI68887.1| Casein kinase II subunit beta [Salmo salar]
 gi|223648390|gb|ACN10953.1| Casein kinase II subunit beta [Salmo salar]
 gi|223649430|gb|ACN11473.1| Casein kinase II subunit beta [Salmo salar]
 gi|308322005|gb|ADO28140.1| casein kinase II subunit beta [Ictalurus furcatus]
          Length = 215

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 110/188 (58%), Positives = 145/188 (77%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDEMRE 74
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   +EEL+D   +
Sbjct: 9   WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQ 68

Query: 75  A--VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
           +  +E++A  LYGLIHAR+I+T+RG+A+MLEKY++ DFG CPRV C NQP+LP+GLSD P
Sbjct: 69  SDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 129 GEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLY 188

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 189 GFKIHPMA 196



>gi|512969761|ref|XP_004847035.1| PREDICTED: casein kinase II subunit beta isoform X1 [Heterocephalus
           glaber]
          Length = 234

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 110/188 (58%), Positives = 145/188 (77%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDEMRE 74
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   +EEL+D   +
Sbjct: 28  WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQ 87

Query: 75  A--VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
           +  +E++A  LYGLIHAR+I+T+RG+A+MLEKY++ DFG CPRV C NQP+LP+GLSD P
Sbjct: 88  SDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIP 147

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 148 GEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLY 207

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 208 GFKIHPMA 215



>gi|30059126|gb|AAO38844.1| casein kinase 2 beta' subunit [Candida albicans]
          Length = 267

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 156/201 (77%), Gaps = 1/201 (0%)

Query: 2   DDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLIT 61
           ++  + S SD+ +YWID FL  KGNEYFC++D+EYI DRFNLTGLNSEV      +D+IT
Sbjct: 4   EEYVTDSSSDFTEYWIDLFLGIKGNEYFCDIDDEYIRDRFNLTGLNSEVSKLPTLIDIIT 63

Query: 62  DSLEEELD-DEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
           D ++ EL  +E ++++E +AR LYGLIHAR+I+T+RGL KM EK++  DFG CPRV C  
Sbjct: 64  DVIDIELQPEEHKDSLEHNARILYGLIHARYILTTRGLNKMFEKFRSGDFGYCPRVHCQL 123

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GL+DQP   SVKLYC +CED+YNPKS RH++IDGAY+G++FP M FQ +P+ +P
Sbjct: 124 NPLLPIGLNDQPRMASVKLYCSKCEDLYNPKSGRHSAIDGAYFGTSFPAMFFQNFPNTVP 183

Query: 181 PKSNERYIPRIFGFKIHDIAK 201
             + E Y+PR+FGFK+H+ +K
Sbjct: 184 IHAKETYVPRVFGFKLHEYSK 204



>gi|52346076|ref|NP_001005081.1| casein kinase 2, beta polypeptide [Xenopus (Silurana) tropicalis]
 gi|147900105|ref|NP_001084126.1| casein kinase II subunit beta [Xenopus laevis]
 gi|125277|sp|P28021.1|CSK2B_XENLA RecName: Full=Casein kinase II subunit beta; Short=CK II beta;
           AltName: Full=Phosvitin
 gi|64630|emb|CAA44239.1| Beta subunit of casein kinase II [Xenopus laevis]
 gi|49899997|gb|AAH77003.1| casein kinase 2, beta polypeptide [Xenopus (Silurana) tropicalis]
 gi|50414549|gb|AAH77212.1| Ck2b protein [Xenopus laevis]
 gi|89271289|emb|CAJ82633.1| casein kinase 2, beta subunit [Xenopus (Silurana) tropicalis]
          Length = 215

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 110/188 (58%), Positives = 145/188 (77%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDEMRE 74
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   +EEL+D   +
Sbjct: 9   WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQ 68

Query: 75  A--VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
           +  +E++A  LYGLIHAR+I+T+RG+A+MLEKY++ DFG CPRV C NQP+LP+GLSD P
Sbjct: 69  SDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 129 GEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLY 188

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 189 GFKIHPMA 196



>gi|60834087|gb|AAX37079.1| casein kinase 2 beta polypeptide [synthetic construct]
          Length = 216

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 110/188 (58%), Positives = 145/188 (77%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDEMRE 74
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   +EEL+D   +
Sbjct: 9   WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQ 68

Query: 75  A--VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
           +  +E++A  LYGLIHAR+I+T+RG+A+MLEKY++ DFG CPRV C NQP+LP+GLSD P
Sbjct: 69  SDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 129 GEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLY 188

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 189 GFKIHPMA 196



>gi|348533844|ref|XP_003454414.1| PREDICTED: casein kinase II subunit beta-like [Oreochromis
           niloticus]
 gi|498938211|ref|XP_004541598.1| PREDICTED: casein kinase II subunit beta-like [Maylandia zebra]
          Length = 215

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 110/188 (58%), Positives = 145/188 (77%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDEMRE 74
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   +EEL+D   +
Sbjct: 9   WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQ 68

Query: 75  A--VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
           +  +E++A  LYGLIHAR+I+T+RG+A+MLEKY++ DFG CPRV C NQP+LP+GLSD P
Sbjct: 69  SDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 129 GEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLY 188

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 189 GFKIHPMA 196



>gi|7106277|ref|NP_034105.1| casein kinase II subunit beta [Mus musculus]
 gi|13591930|ref|NP_112283.1| casein kinase II subunit beta [Rattus norvegicus]
 gi|23503295|ref|NP_001311.3| casein kinase II subunit beta [Homo sapiens]
 gi|78214347|ref|NP_001030315.1| casein kinase II subunit beta [Rattus norvegicus]
 gi|114326228|ref|NP_001039919.1| casein kinase II subunit beta [Bos taurus]
 gi|215983072|ref|NP_001135983.1| casein kinase II subunit beta [Ovis aries]
 gi|224458304|ref|NP_001138849.1| casein kinase II subunit beta [Sus scrofa]
 gi|237757367|ref|NP_001153755.1| casein kinase II subunit beta [Oryctolagus cuniculus]
 gi|380748933|ref|NP_001244133.1| casein kinase II subunit beta [Gallus gallus]
 gi|383872800|ref|NP_001244617.1| casein kinase II subunit beta [Macaca mulatta]
 gi|194223340|ref|XP_001917725.1| PREDICTED: casein kinase II subunit beta-like isoform 1 [Equus
           caballus]
 gi|297677708|ref|XP_002816781.1| PREDICTED: casein kinase II subunit beta isoform 2 [Pongo abelii]
 gi|297677710|ref|XP_002816782.1| PREDICTED: casein kinase II subunit beta isoform 3 [Pongo abelii]
 gi|301789297|ref|XP_002930070.1| PREDICTED: casein kinase II subunit beta-like isoform 2 [Ailuropoda
           melanoleuca]
 gi|327266447|ref|XP_003218017.1| PREDICTED: casein kinase II subunit beta-like [Anolis carolinensis]
 gi|332823579|ref|XP_003311218.1| PREDICTED: casein kinase II subunit beta isoform 1 [Pan
           troglodytes]
 gi|332823581|ref|XP_003311219.1| PREDICTED: casein kinase II subunit beta isoform 2 [Pan
           troglodytes]
 gi|334323563|ref|XP_001376125.2| PREDICTED: casein kinase II subunit beta-like [Monodelphis
           domestica]
 gi|344307306|ref|XP_003422323.1| PREDICTED: casein kinase II subunit beta-like [Loxodonta africana]
 gi|345778195|ref|XP_532075.3| PREDICTED: casein kinase II subunit beta isoform 2 [Canis lupus
           familiaris]
 gi|345778197|ref|XP_003431700.1| PREDICTED: casein kinase II subunit beta isoform 1 [Canis lupus
           familiaris]
 gi|348576502|ref|XP_003474026.1| PREDICTED: casein kinase II subunit beta-like [Cavia porcellus]
 gi|354492793|ref|XP_003508530.1| PREDICTED: casein kinase II subunit beta-like [Cricetulus griseus]
 gi|395737013|ref|XP_002816780.2| PREDICTED: casein kinase II subunit beta isoform 1 [Pongo abelii]
 gi|395831986|ref|XP_003789059.1| PREDICTED: casein kinase II subunit beta [Otolemur garnettii]
 gi|397523154|ref|XP_003831606.1| PREDICTED: casein kinase II subunit beta isoform 1 [Pan paniscus]
 gi|397523156|ref|XP_003831607.1| PREDICTED: casein kinase II subunit beta isoform 2 [Pan paniscus]
 gi|397523158|ref|XP_003831608.1| PREDICTED: casein kinase II subunit beta isoform 3 [Pan paniscus]
 gi|397523160|ref|XP_003831609.1| PREDICTED: casein kinase II subunit beta isoform 4 [Pan paniscus]
 gi|402866476|ref|XP_003897408.1| PREDICTED: casein kinase II subunit beta [Papio anubis]
 gi|410040526|ref|XP_003950831.1| PREDICTED: casein kinase II subunit beta [Pan troglodytes]
 gi|410040528|ref|XP_003950832.1| PREDICTED: casein kinase II subunit beta [Pan troglodytes]
 gi|410958748|ref|XP_003985976.1| PREDICTED: casein kinase II subunit beta isoform 1 [Felis catus]
 gi|410958750|ref|XP_003985977.1| PREDICTED: casein kinase II subunit beta isoform 2 [Felis catus]
 gi|426352423|ref|XP_004043712.1| PREDICTED: casein kinase II subunit beta isoform 1 [Gorilla gorilla
           gorilla]
 gi|426352427|ref|XP_004043714.1| PREDICTED: casein kinase II subunit beta isoform 3 [Gorilla gorilla
           gorilla]
 gi|426352429|ref|XP_004043715.1| PREDICTED: casein kinase II subunit beta isoform 4 [Gorilla gorilla
           gorilla]
 gi|466089371|ref|XP_004286644.1| PREDICTED: casein kinase II subunit beta isoform 2 [Orcinus orca]
 gi|470597215|ref|XP_004311255.1| PREDICTED: casein kinase II subunit beta isoform 2 [Tursiops
           truncatus]
 gi|471418620|ref|XP_004390806.1| PREDICTED: casein kinase II subunit beta isoform 2 [Trichechus
           manatus latirostris]
 gi|472392019|ref|XP_004415293.1| PREDICTED: casein kinase II subunit beta isoform 2 [Odobenus
           rosmarus divergens]
 gi|478500193|ref|XP_004424420.1| PREDICTED: casein kinase II subunit beta isoform 2 [Ceratotherium
           simum simum]
 gi|488553186|ref|XP_004467900.1| PREDICTED: casein kinase II subunit beta isoform 3 [Dasypus
           novemcinctus]
 gi|504179941|ref|XP_004598763.1| PREDICTED: casein kinase II subunit beta [Ochotona princeps]
 gi|505855855|ref|XP_004621336.1| PREDICTED: casein kinase II subunit beta [Sorex araneus]
 gi|507576780|ref|XP_004671927.1| PREDICTED: casein kinase II subunit beta [Jaculus jaculus]
 gi|507617818|ref|XP_004624367.1| PREDICTED: casein kinase II subunit beta [Octodon degus]
 gi|507685741|ref|XP_004711762.1| PREDICTED: casein kinase II subunit beta [Echinops telfairi]
 gi|507984176|ref|XP_004695189.1| PREDICTED: casein kinase II subunit beta [Condylura cristata]
 gi|512969763|ref|XP_004847036.1| PREDICTED: casein kinase II subunit beta isoform X2 [Heterocephalus
           glaber]
 gi|54037490|sp|P67872.1|CSK2B_PIG RecName: Full=Casein kinase II subunit beta; Short=CK II beta;
           AltName: Full=Phosvitin
 gi|54037491|sp|P67874.1|CSK2B_RAT RecName: Full=Casein kinase II subunit beta; Short=CK II beta;
           AltName: Full=Phosvitin
 gi|54037517|sp|P67869.1|CSK2B_CHICK RecName: Full=Casein kinase II subunit beta; Short=CK II beta;
           AltName: Full=Phosvitin
 gi|54037520|sp|P67870.1|CSK2B_HUMAN RecName: Full=Casein kinase II subunit beta; Short=CK II beta;
           AltName: Full=Phosvitin; AltName: Full=Protein G5a
 gi|54037523|sp|P67871.1|CSK2B_MOUSE RecName: Full=Casein kinase II subunit beta; Short=CK II beta;
           AltName: Full=Phosvitin
 gi|54037524|sp|P67873.1|CSK2B_RABIT RecName: Full=Casein kinase II subunit beta; Short=CK II beta;
           AltName: Full=Phosvitin
 gi|54041568|sp|P67868.1|CSK2B_BOVIN RecName: Full=Casein kinase II subunit beta; Short=CK II beta;
           AltName: Full=Phosvitin
 gi|20150573|pdb|1JWH|C Chain C, Crystal Structure Of Human Protein Kinase Ck2 Holoenzyme
 gi|20150574|pdb|1JWH|D Chain D, Crystal Structure Of Human Protein Kinase Ck2 Holoenzyme
 gi|206581671|pdb|2R6M|A Chain A, Crystal Structure Of Rat Ck2-Beta Subunit
 gi|206581672|pdb|2R6M|B Chain B, Crystal Structure Of Rat Ck2-Beta Subunit
 gi|385867770|pdb|4DGL|A Chain A, Crystal Structure Of The Ck2 Tetrameric Holoenzyme
 gi|385867771|pdb|4DGL|B Chain B, Crystal Structure Of The Ck2 Tetrameric Holoenzyme
 gi|6114860|gb|AAF03911.1|AF109719_1 CSK2B [Mus musculus]
 gi|29965|emb|CAA34379.1| unnamed protein product [Homo sapiens]
 gi|29967|emb|CAA34811.1| unnamed protein product [Homo sapiens]
 gi|29969|emb|CAA40442.1| casein kinase II subunit beta [Homo sapiens]
 gi|50419|emb|CAA37132.1| unnamed protein product [Mus musculus]
 gi|50421|emb|CAA39857.1| casein kinase II beta subunit [Mus musculus]
 gi|211536|gb|AAA48692.1| casein kinase II beta subunit [Gallus gallus]
 gi|298367|gb|AAB25555.1| casein kinase-II beta subunit [Oryctolagus cuniculus]
 gi|415718|gb|AAA40928.1| casein kinase II beta subunit [Rattus norvegicus]
 gi|1220475|gb|AAA91892.1| casein kinase-II beta [Oryctolagus cuniculus]
 gi|1262828|emb|CAA56700.1| protein kinase [Mus musculus]
 gi|4337105|gb|AAD18081.1| casein kinase II beta subunit [Homo sapiens]
 gi|12833230|dbj|BAB22445.1| unnamed protein product [Mus musculus]
 gi|12846383|dbj|BAB27147.1| unnamed protein product [Mus musculus]
 gi|12849066|dbj|BAB28193.1| unnamed protein product [Mus musculus]
 gi|13277765|gb|AAH03775.1| Casein kinase 2, beta polypeptide [Mus musculus]
 gi|15277284|dbj|BAB63386.1| Casein kinase II beta subunit [Homo sapiens]
 gi|21428317|gb|AAM50092.1| casein kinase II beta subunit [Homo sapiens]
 gi|46237616|emb|CAE83994.1| casein kinase 2, beta subunit [Rattus norvegicus]
 gi|49456359|emb|CAG46500.1| CSNK2B [Homo sapiens]
 gi|74148357|dbj|BAE36328.1| unnamed protein product [Mus musculus]
 gi|74222325|dbj|BAE26962.1| unnamed protein product [Mus musculus]
 gi|82571788|gb|AAI10171.1| Casein kinase 2, beta polypeptide [Bos taurus]
 gi|83699643|gb|ABC40727.1| casein kinase 2, beta polypeptide [Homo sapiens]
 gi|85566682|gb|AAI12020.1| Casein kinase 2, beta polypeptide [Homo sapiens]
 gi|85567104|gb|AAI12018.1| Casein kinase 2, beta polypeptide [Homo sapiens]
 gi|119623878|gb|EAX03473.1| casein kinase 2, beta polypeptide, isoform CRA_b [Homo sapiens]
 gi|127799696|gb|AAH78807.2| Casein kinase 2, beta subunit [Rattus norvegicus]
 gi|148694710|gb|EDL26657.1| casein kinase II, beta subunit, isoform CRA_a [Mus musculus]
 gi|148694712|gb|EDL26659.1| casein kinase II, beta subunit, isoform CRA_a [Mus musculus]
 gi|149028070|gb|EDL83521.1| casein kinase 2, beta subunit, isoform CRA_a [Rattus norvegicus]
 gi|149028071|gb|EDL83522.1| casein kinase 2, beta subunit, isoform CRA_a [Rattus norvegicus]
 gi|162138220|gb|ABX82815.1| casein kinase 2 beta polypeptide [Sus scrofa]
 gi|189053179|dbj|BAG34801.1| unnamed protein product [Homo sapiens]
 gi|213688918|gb|ACJ53942.1| CSNK2B [Ovis aries]
 gi|296474273|tpg|DAA16388.1| TPA: casein kinase II subunit beta [Bos taurus]
 gi|307685869|dbj|BAJ20865.1| casein kinase 2, beta polypeptide [synthetic construct]
 gi|344239184|gb|EGV95287.1| Casein kinase II subunit beta [Cricetulus griseus]
 gi|431921571|gb|ELK18925.1| Casein kinase II subunit beta [Pteropus alecto]
 gi|432089438|gb|ELK23380.1| Casein kinase II subunit beta [Myotis davidii]
 gi|479274656|emb|CCI79661.1| chimera Csnk2b-Ly6g5b splicing isoform 1239 [Bos taurus]
 gi|479274660|emb|CCI79663.1| Csnk2b splicing isoform 662 [Rattus norvegicus]
 gi|479274672|emb|CCI79669.1| chimera Csnk2b-Ly6g5b splicing isoform 2050 [Rattus norvegicus]
 gi|479274674|emb|CCI79670.1| chimera Csnk2b-Ly6g5b splicing isoform 2275 [Rattus norvegicus]
 gi|479274676|emb|CCI79671.1| chimera Csnk2b-Ly6g5b splicing isoform 2531 [Rattus norvegicus]
 gi|479274700|emb|CCI79683.1| casein kinase II b subunit splicing isoform 660 [Homo sapiens]
 gi|479274738|emb|CCI79702.1| casein kinase II b subunit splicing isoform 660, partial [Macaca
           mulatta]
 gi|479274750|emb|CCI79708.1| chimera Csnk2b-Ly6g5b splicing isoform 1331 [Macaca mulatta]
 gi|479274752|emb|CCI79709.1| chimera Csnk2b-Ly6g5b splicing isoform 2338 [Macaca mulatta]
 gi|479274760|emb|CCI79713.1| casein kinase II b subunit splicing isoform 666 [Sus scrofa]
 gi|479274782|emb|CCI79724.1| casein kinase II b subunit splicing isoform 663 [Bos taurus]
          Length = 215

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 110/188 (58%), Positives = 145/188 (77%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDEMRE 74
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   +EEL+D   +
Sbjct: 9   WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQ 68

Query: 75  A--VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
           +  +E++A  LYGLIHAR+I+T+RG+A+MLEKY++ DFG CPRV C NQP+LP+GLSD P
Sbjct: 69  SDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 129 GEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLY 188

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 189 GFKIHPMA 196



>gi|432908434|ref|XP_004077859.1| PREDICTED: casein kinase II subunit beta-like [Oryzias latipes]
          Length = 215

 Score =  247 bits (631), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 110/188 (58%), Positives = 145/188 (77%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDEMRE 74
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   +EEL+D   +
Sbjct: 9   WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQ 68

Query: 75  A--VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
           +  +E++A  LYGLIHAR+I+T+RG+A+MLEKY++ DFG CPRV C NQP+LP+GLSD P
Sbjct: 69  SDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 129 GEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLY 188

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 189 GFKIHPMA 196



>gi|470501653|ref|XP_004347173.1| casein kinase ii subunit beta, putative [Acanthamoeba castellanii
           str. Neff]
 gi|440800756|gb|ELR21791.1| casein kinase ii subunit beta, putative [Acanthamoeba castellanii
           str. Neff]
          Length = 246

 Score =  247 bits (630), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 141/187 (75%), Gaps = 1/187 (0%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDS-LEEELDDEMRE 74
           WI WF + KGNE+F EVDE+YI D FNLTGL S V +Y  ALD+I D+  +E L +E ++
Sbjct: 37  WIQWFCSLKGNEFFVEVDEDYIQDDFNLTGLRSIVSNYDYALDMILDAESDEALTEEQQD 96

Query: 75  AVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQPYT 134
           ++E +A  LYGLIHAR+I+T+RGLA M++KY   +FGRCPRV C  Q +LPVG SD P  
Sbjct: 97  SIESAAEMLYGLIHARYILTNRGLASMVDKYNAMEFGRCPRVYCQGQAVLPVGQSDIPRM 156

Query: 135 KSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIFGF 194
            +VKL+CPRCEDIY PK +RH  IDGAY+GSTFPH+L Q+YP  +PPK    Y+PRI+GF
Sbjct: 157 NTVKLFCPRCEDIYYPKLSRHNQIDGAYFGSTFPHLLLQMYPEFIPPKPTISYVPRIYGF 216

Query: 195 KIHDIAK 201
           KIH  A+
Sbjct: 217 KIHKSAR 223



>gi|498977118|ref|XP_004549035.1| PREDICTED: casein kinase II subunit beta-like isoform X1 [Maylandia
           zebra]
          Length = 219

 Score =  246 bits (629), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 110/188 (58%), Positives = 145/188 (77%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDEMRE 74
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   +EEL+D   +
Sbjct: 13  WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQ 72

Query: 75  A--VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
           +  +E++A  LYGLIHAR+I+T+RG+A+MLEKY++ DFG CPRV C NQP+LP+GLSD P
Sbjct: 73  SDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIP 132

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 133 GEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLY 192

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 193 GFKIHPMA 200



>gi|255723141|ref|XP_002546504.1| casein kinase II beta' subunit [Candida tropicalis MYA-3404]
 gi|240130635|gb|EER30198.1| casein kinase II beta' subunit [Candida tropicalis MYA-3404]
          Length = 280

 Score =  245 bits (626), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 112/201 (55%), Positives = 146/201 (72%), Gaps = 1/201 (0%)

Query: 2   DDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHY-VQALDLI 60
           ++  + S SD+ +YWID FL  KGNEYFC++D+EYI DRFNLTGLN EV         + 
Sbjct: 4   EEYATDSSSDFTEYWIDLFLGIKGNEYFCDIDDEYIRDRFNLTGLNQEVSKLPTLIDIIT 63

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
                +   DE R+++E +AR LYGLIHAR+I+T+RGL KM EKY+  DFG CPRV C  
Sbjct: 64  DVIDIDSQPDEHRDSLEHNARILYGLIHARYILTTRGLNKMFEKYRSGDFGYCPRVHCQL 123

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GL+DQP   SVKLYC +CED+YNPKS RH+ IDGAY+G++FP M FQ +P+ +P
Sbjct: 124 NPLLPIGLNDQPRMASVKLYCSKCEDLYNPKSGRHSVIDGAYFGTSFPAMFFQNFPNTIP 183

Query: 181 PKSNERYIPRIFGFKIHDIAK 201
             S E Y+PR+FGFK+H+ +K
Sbjct: 184 VHSKETYVPRVFGFKLHEYSK 204



>gi|68470456|ref|XP_720732.1| hypothetical protein CaO19.11773 [Candida albicans SC5314]
 gi|68470717|ref|XP_720604.1| hypothetical protein CaO19.4297 [Candida albicans SC5314]
 gi|46442480|gb|EAL01769.1| hypothetical protein CaO19.4297 [Candida albicans SC5314]
 gi|46442615|gb|EAL01903.1| hypothetical protein CaO19.11773 [Candida albicans SC5314]
          Length = 267

 Score =  245 bits (626), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 110/201 (54%), Positives = 148/201 (73%), Gaps = 1/201 (0%)

Query: 2   DDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHY-VQALDLI 60
           ++  + S SD+ +YWID FL  KGNEYFC++D+EYI DRFNLTGLNSEV         + 
Sbjct: 4   EEYVTDSSSDFTEYWIDLFLGIKGNEYFCDIDDEYIRDRFNLTGLNSEVSKLPTLIDIIT 63

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
                E   +E ++++E +AR LYGLIHAR+I+T+RGL KM EK++  DFG CPRV C  
Sbjct: 64  DVIDIESQPEEHKDSLEHNARILYGLIHARYILTTRGLNKMFEKFRSGDFGYCPRVHCQL 123

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GL+DQP   SVKLYC +CED+YNPKS RH++IDGAY+G++FP M FQ +P+ +P
Sbjct: 124 NPLLPIGLNDQPRMASVKLYCSKCEDLYNPKSGRHSAIDGAYFGTSFPAMFFQNFPNTVP 183

Query: 181 PKSNERYIPRIFGFKIHDIAK 201
             + E Y+PR+FGFK+H+ +K
Sbjct: 184 IHAKETYVPRVFGFKLHEYSK 204



>gi|50289727|ref|XP_447295.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49526605|emb|CAG60232.1| unnamed protein product [Candida glabrata]
          Length = 259

 Score =  245 bits (625), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 115/205 (56%), Positives = 144/205 (70%), Gaps = 6/205 (2%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MDD T  S+  YA+ WID FL  KG+EYFC+VD EYI DRFNL  L   V  + Q +  I
Sbjct: 26  MDDATDSSE--YAQMWIDLFLGRKGHEYFCDVDPEYITDRFNLINLQKTVSKFSQVVQYI 83

Query: 61  TDSLEEELDDEMREA----VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRV 116
            D L++ + + M +A    +E  AR  YGLIHAR+IIT +GL KML KYK ADFGRC RV
Sbjct: 84  VDELDDSIVENMSKARLEQLENDARKFYGLIHARYIITVKGLQKMLSKYKDADFGRCSRV 143

Query: 117 LCHNQPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYP 176
            C+ QPLLPVGL D P   SVKLYCP CED+YNPKS+RH+SIDGAY+G++FP M  Q +P
Sbjct: 144 YCNFQPLLPVGLHDVPGIDSVKLYCPSCEDLYNPKSSRHSSIDGAYFGTSFPGMFLQAFP 203

Query: 177 HLLPPKSNERYIPRIFGFKIHDIAK 201
            ++P     RY+P+IFGF++H  A+
Sbjct: 204 DMVPKHPTARYVPKIFGFELHKQAQ 228



>gi|203282561|pdb|3EED|A Chain A, Crystal Structure Of Human Protein Kinase Ck2 Regulatory
           Subunit (Ck2beta; Mutant 1-193)
 gi|203282562|pdb|3EED|B Chain B, Crystal Structure Of Human Protein Kinase Ck2 Regulatory
           Subunit (Ck2beta; Mutant 1-193)
          Length = 193

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 109/185 (58%), Positives = 143/185 (77%), Gaps = 3/185 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDEMRE 74
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   +EEL+D   +
Sbjct: 9   WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQ 68

Query: 75  A--VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
           +  +E++A  LYGLIHAR+I+T+RG+A+MLEKY++ DFG CPRV C NQP+LP+GLSD P
Sbjct: 69  SDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 129 GEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLY 188

Query: 193 GFKIH 197
           GFKIH
Sbjct: 189 GFKIH 193



>gi|195999064|ref|XP_002109400.1| protein kinase Ck2-beta [Trichoplax adhaerens]
 gi|190587524|gb|EDV27566.1| protein kinase Ck2-beta, partial [Trichoplax adhaerens]
          Length = 209

 Score =  244 bits (623), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 110/188 (58%), Positives = 143/188 (76%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEEL---DDEM 72
           WI WF   +GNE+FCEVDE+YI D+FNLTGL+ +V HY QA D+I D   ++    +   
Sbjct: 9   WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLSEQVPHYRQAQDMILDLEPDDDLEDNPAQ 68

Query: 73  REAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
            E +E++A  LYGLIHAR+I+T+RGLA+MLEKY++ DFG C RV C NQP+LPVGLSD P
Sbjct: 69  SEVIEQAAEVLYGLIHARYIMTNRGLAQMLEKYQQGDFGHCSRVYCENQPMLPVGLSDIP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               +KLYCP+C+D+Y PKS+R+  IDGAY+G++FPHMLF V+P   P +SN +Y+PRIF
Sbjct: 129 GESMLKLYCPKCQDVYTPKSSRYHHIDGAYFGTSFPHMLFMVHPEYRPKRSNTQYVPRIF 188

Query: 193 GFKIHDIA 200
           GFKIH  A
Sbjct: 189 GFKIHPTA 196



>gi|291231545|ref|XP_002735719.1| PREDICTED: casein kinase 2, beta polypeptide-like [Saccoglossus
           kowalevskii]
          Length = 223

 Score =  244 bits (622), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 112/191 (58%), Positives = 141/191 (73%), Gaps = 9/191 (4%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELDDEMREA 75
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D    E DDE+ E 
Sbjct: 9   WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDL---EPDDELEEN 65

Query: 76  ------VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLS 129
                 +E++A  LYGLIHARFI+T+RG+A MLEKY + DFG CPRV C NQP LP+GLS
Sbjct: 66  PNQSDLIEQAAEMLYGLIHARFIMTNRGIALMLEKYLQNDFGHCPRVYCENQPCLPIGLS 125

Query: 130 DQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIP 189
           D P    VKLYCP+C+D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++P
Sbjct: 126 DVPGEAMVKLYCPKCQDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPPNQFVP 185

Query: 190 RIFGFKIHDIA 200
           R++GFKIH +A
Sbjct: 186 RLYGFKIHPMA 196



>gi|255717274|ref|XP_002554918.1| KLTH0F16852p [Lachancea thermotolerans]
 gi|238936301|emb|CAR24481.1| KLTH0F16852p [Lachancea thermotolerans CBS 6340]
          Length = 241

 Score =  244 bits (622), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 112/204 (54%), Positives = 148/204 (72%), Gaps = 5/204 (2%)

Query: 3   DLTSGS-DSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLIT 61
           D   GS  S+Y ++WID FL  KG+EYFC+VD +YI DRFNL  L   V  + Q +  I 
Sbjct: 12  DTAEGSISSEYVEFWIDLFLGRKGHEYFCDVDTDYITDRFNLINLQKTVNKFTQVIQYIV 71

Query: 62  DSLEEELDDEMR----EAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVL 117
           D L++ + ++M     E +E  AR LYGLIHAR++IT +GL KML+KYK+ADFGRCPRV 
Sbjct: 72  DELDDGVLEQMSSARLEQLEHDARKLYGLIHARYVITIKGLQKMLQKYKEADFGRCPRVY 131

Query: 118 CHNQPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPH 177
           C+ QPLLPVGL D P    VKLYCP CED+Y PKS+RH++IDGAY+G++FP M  Q +P 
Sbjct: 132 CNFQPLLPVGLHDTPGVDCVKLYCPCCEDLYIPKSSRHSAIDGAYFGTSFPGMFLQAFPE 191

Query: 178 LLPPKSNERYIPRIFGFKIHDIAK 201
           ++PP+  +RY+PRIFGF++H  A+
Sbjct: 192 MVPPRPVKRYVPRIFGFELHKQAQ 215



>gi|354547231|emb|CCE43965.1| hypothetical protein CPAR2_501900 [Candida parapsilosis]
          Length = 246

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 146/201 (72%), Gaps = 1/201 (0%)

Query: 2   DDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHY-VQALDLI 60
           ++  + S SD+ +YWID FL  KGNEYFC++D+EYI DRFNLTGLN EV         + 
Sbjct: 4   EEYVTDSSSDFTEYWIDSFLGIKGNEYFCDIDDEYIRDRFNLTGLNQEVSKLPTLIDIIT 63

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
                +   +E REA+E +AR LYGLIHAR+I+T+RGL KM EK++  DFG CPRV C  
Sbjct: 64  DVIDIDSQPEEHREALEHNARILYGLIHARYILTTRGLNKMFEKFRNGDFGYCPRVHCQL 123

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GL+DQP   SVKLYC +CED+YNPKS RH+ IDGAY+G++FP M FQ +P+++P
Sbjct: 124 NPLLPIGLNDQPRMASVKLYCSKCEDLYNPKSGRHSVIDGAYFGTSFPAMFFQNFPNMIP 183

Query: 181 PKSNERYIPRIFGFKIHDIAK 201
               E Y+PR+FGFK+H+ +K
Sbjct: 184 IHPKETYVPRVFGFKLHEYSK 204



>gi|238882675|gb|EEQ46313.1| casein kinase II beta' subunit [Candida albicans WO-1]
          Length = 213

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 149/201 (74%), Gaps = 1/201 (0%)

Query: 2   DDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHY-VQALDLI 60
           ++  + S SD+ +YWID FL  KGNEYFC++D+EYI DRFNLTGLNSEV    +    + 
Sbjct: 4   EEYVTDSSSDFTEYWIDLFLGIKGNEYFCDIDDEYIRDRFNLTGLNSEVSKLPILIDIIT 63

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
                E   +E ++++E +AR LYGLIHAR+I+T+RGL KM EK++  DFG CPRV C  
Sbjct: 64  DVIDIESQPEEHKDSLEHNARILYGLIHARYILTTRGLNKMFEKFRSGDFGYCPRVHCQL 123

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLPVGL+DQP   SVKLYC +CED+YNPKS RH++IDGAY+G++FP M FQ +P+ +P
Sbjct: 124 NPLLPVGLNDQPRMASVKLYCSKCEDLYNPKSGRHSAIDGAYFGTSFPAMFFQNFPNTVP 183

Query: 181 PKSNERYIPRIFGFKIHDIAK 201
             + E Y+PR+FGFK+H+ +K
Sbjct: 184 IHAKETYVPRVFGFKLHEYSK 204



>gi|313573614|emb|CBK38916.1| protein kinase CK2beta regulatory subunit [Mytilus
           galloprovincialis]
          Length = 221

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 105/188 (55%), Positives = 146/188 (77%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDEMRE 74
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD++ D   ++EL+D   +
Sbjct: 9   WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMVLDLEPDDELEDNPNQ 68

Query: 75  A--VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
           +  +E++A  LYGLIHAR+I+T+RG+A+M+EK+++ DFG CPRV C NQP+LP+GLSD P
Sbjct: 69  SDLIEQAAEMLYGLIHARYIMTNRGIAQMIEKWQQGDFGYCPRVYCENQPMLPIGLSDVP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C+D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++P+++
Sbjct: 129 GEAMVKLYCPKCQDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPKLY 188

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 189 GFKIHPLA 196



>gi|448515532|ref|XP_003867362.1| Ckb2 regulatory subunit of protein kinase CK2 (casein kinase II),
           beta prime subunit [Candida orthopsilosis Co 90-125]
 gi|380351701|emb|CCG21924.1| Ckb2 regulatory subunit of protein kinase CK2 (casein kinase II),
           beta prime subunit [Candida orthopsilosis]
          Length = 246

 Score =  243 bits (621), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 146/201 (72%), Gaps = 1/201 (0%)

Query: 2   DDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHY-VQALDLI 60
           ++  + S SD+ +YWID FL  KGNEYFC++D+EYI DRFNLTGLN EV         + 
Sbjct: 4   EEYVTDSSSDFTEYWIDSFLGIKGNEYFCDIDDEYIRDRFNLTGLNQEVSKLPTLIDIIT 63

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
                +   +E REA+E +AR LYGLIHAR+I+T+RGL KM EK++  DFG CPRV C  
Sbjct: 64  DVIDIDSQPEEHREALEHNARILYGLIHARYILTTRGLNKMFEKFRNGDFGYCPRVHCQL 123

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GL+DQP   SVKLYC +CED+YNPKS RH+ IDGAY+G++FP M FQ +P+++P
Sbjct: 124 NPLLPIGLNDQPRMASVKLYCSKCEDLYNPKSGRHSVIDGAYFGTSFPAMFFQNFPNMIP 183

Query: 181 PKSNERYIPRIFGFKIHDIAK 201
               E Y+PR+FGFK+H+ +K
Sbjct: 184 IHPKETYVPRVFGFKLHEYSK 204



>gi|390349651|ref|XP_003727253.1| PREDICTED: casein kinase II subunit beta-like [Strongylocentrotus
           purpuratus]
          Length = 219

 Score =  243 bits (619), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 141/191 (73%), Gaps = 9/191 (4%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELDDEMREA 75
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D    E DDEM E 
Sbjct: 9   WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDL---EPDDEMEEN 65

Query: 76  ------VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLS 129
                 +E++A  LYGLIHARFI+T+RG+A MLEKY++ DFG CPRV C NQ +LP+GLS
Sbjct: 66  PNQNDLIEQAAEMLYGLIHARFIMTNRGIALMLEKYQQGDFGHCPRVYCENQLVLPIGLS 125

Query: 130 DQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIP 189
           D P    VKLYCP+C+D+Y PKS+RH   DGAY+G+ FPHM F V+P   P +   +++P
Sbjct: 126 DVPGEAMVKLYCPKCQDVYTPKSSRHHHTDGAYFGTGFPHMFFMVHPEYRPKRPPNQFVP 185

Query: 190 RIFGFKIHDIA 200
           R++GFKIH +A
Sbjct: 186 RLYGFKIHPLA 196



>gi|444315205|ref|XP_004178260.1| hypothetical protein TBLA_0A09570 [Tetrapisispora blattae CBS 6284]
 gi|387511299|emb|CCH58741.1| hypothetical protein TBLA_0A09570 [Tetrapisispora blattae CBS 6284]
          Length = 237

 Score =  243 bits (619), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 111/205 (54%), Positives = 146/205 (71%), Gaps = 6/205 (2%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           MD +T  SD  Y + WID FL  KG+EYFC++D +YI DRFNL  L   V  + Q +  I
Sbjct: 5   MDGMTDSSD--YVEMWIDLFLGRKGSEYFCDIDPDYITDRFNLINLQKTVPKFTQVIQYI 62

Query: 61  TDSLEEELDDEMR----EAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRV 116
            D L+E + + M     E +E  AR LYGLIHAR+IIT +GL KML+KY+ ADFGRCPRV
Sbjct: 63  VDELDETVLESMSHSRLEQLENDARKLYGLIHARYIITIKGLQKMLQKYRDADFGRCPRV 122

Query: 117 LCHNQPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYP 176
            C++QPLLPVGL D P   SV+LYCP CED+YNPKS+RH++IDGAY+G++FP M  Q +P
Sbjct: 123 FCNSQPLLPVGLHDVPGIDSVRLYCPACEDLYNPKSSRHSTIDGAYFGTSFPGMFLQAFP 182

Query: 177 HLLPPKSNERYIPRIFGFKIHDIAK 201
            ++P    + Y+P+IFGF++H  A+
Sbjct: 183 EIVPRHPTKTYVPKIFGFELHKQAQ 207



>gi|156373129|ref|XP_001629386.1| predicted protein [Nematostella vectensis]
 gi|156216385|gb|EDO37323.1| predicted protein [Nematostella vectensis]
          Length = 223

 Score =  243 bits (619), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 110/188 (58%), Positives = 141/188 (75%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDEMRE 74
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   ++EL+D   +
Sbjct: 9   WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDMEPDDELEDNPNQ 68

Query: 75  A--VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
           +  +E++A  LYGLIHAR+I+T+RGLA+MLEKY+  DFG C RV C NQP+LP+GLSD P
Sbjct: 69  SDLIEQAAEMLYGLIHARYILTNRGLAQMLEKYQNGDFGHCSRVYCENQPVLPIGLSDVP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D Y PKS+RH   DGAY+G+ FPHMLF V+P   P +    ++PR+F
Sbjct: 129 GEAMVKLYCPKCMDAYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANHFVPRLF 188

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 189 GFKIHPMA 196



>gi|449686740|ref|XP_002161949.2| PREDICTED: casein kinase II subunit beta-like isoform 2 [Hydra
           magnipapillata]
          Length = 225

 Score =  242 bits (618), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 144/188 (76%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEE--ELDDEMR 73
           WI WF   +GNE+FCEVDE+YI DRFNLT LN +V HY QALD+I D   E  E +D+ +
Sbjct: 9   WIAWFCGLRGNEFFCEVDEDYIQDRFNLTSLNEQVPHYRQALDMILDLEPEYDEFEDQTK 68

Query: 74  -EAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
            + +E++A  LYGLIHAR+I+T+RG+A+ML+K++  DFG CPRV C NQP++P+GLSD P
Sbjct: 69  SDLIEQAAEMLYGLIHARYILTNRGIAQMLDKWQNRDFGHCPRVYCENQPVMPIGLSDVP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D+YNPKS+RH   DGAY+G+ FPHMLF V+P   P +S  +++PR+F
Sbjct: 129 GEAMVKLYCPKCMDVYNPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRSPNQFVPRLF 188

Query: 193 GFKIHDIA 200
           GFKIH ++
Sbjct: 189 GFKIHPMS 196



>gi|260944470|ref|XP_002616533.1| hypothetical protein CLUG_03774 [Clavispora lusitaniae ATCC 42720]
 gi|238850182|gb|EEQ39646.1| hypothetical protein CLUG_03774 [Clavispora lusitaniae ATCC 42720]
          Length = 248

 Score =  242 bits (618), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 117/195 (60%), Positives = 149/195 (76%), Gaps = 1/195 (0%)

Query: 8   SDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLE-E 66
           + SD+++YWID FL  KGNEYFC++D++YI DRFNLTGLN EV      +D+ITD ++ E
Sbjct: 16  TSSDFSEYWIDLFLGIKGNEYFCDIDDDYIRDRFNLTGLNQEVSKMATLVDIITDMVDIE 75

Query: 67  ELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPV 126
              +E R A+E +AR LYGLIHAR+I+T +GL+KM EKYK  DFG CPRV C   PLLPV
Sbjct: 76  SQAEEHRIALEHNARILYGLIHARYILTHKGLSKMFEKYKNGDFGYCPRVHCQLHPLLPV 135

Query: 127 GLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNER 186
           GLSDQP   SVKLYC +CED+YNPKS RHA +DGAY+G++FP M FQ +P  +P  + E 
Sbjct: 136 GLSDQPRINSVKLYCAKCEDLYNPKSGRHAVVDGAYFGTSFPAMFFQNFPQAIPVHNRET 195

Query: 187 YIPRIFGFKIHDIAK 201
           Y+PR+FGFKIH+ +K
Sbjct: 196 YVPRVFGFKIHEYSK 210



>gi|241955675|ref|XP_002420558.1| beta' regulatory subunit of casein kinase 2, putative; casein
           kinase II regulatory subunit, putative; casein kinase II
           subunit beta', putative [Candida dubliniensis CD36]
 gi|223643900|emb|CAX41637.1| beta' regulatory subunit of casein kinase 2, putative [Candida
           dubliniensis CD36]
          Length = 270

 Score =  242 bits (617), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 147/201 (73%), Gaps = 1/201 (0%)

Query: 2   DDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHY-VQALDLI 60
           ++  + S SD+ +YWID FL  KGNEYFC++D+EYI DRFNLTGLNSEV         + 
Sbjct: 4   EEYVTDSSSDFTEYWIDLFLGIKGNEYFCDIDDEYIRDRFNLTGLNSEVSKLPTLIDIIT 63

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
                E   +E ++++E +AR LYGLIHAR+I+T+RGL KM EK++  DFG CPRV C  
Sbjct: 64  DVIDIESQPEEHKDSLEHNARILYGLIHARYILTTRGLNKMFEKFRSGDFGYCPRVHCQL 123

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GL+DQP   SVKLYC +CED+YNPKS RH+ IDGAY+G++FP M FQ +P+ +P
Sbjct: 124 NPLLPIGLNDQPRMASVKLYCSKCEDLYNPKSGRHSVIDGAYFGTSFPAMFFQNFPNTVP 183

Query: 181 PKSNERYIPRIFGFKIHDIAK 201
             + + Y+PR+FGFK+H+ +K
Sbjct: 184 IHAKDTYVPRVFGFKLHEYSK 204



>gi|328351558|emb|CCA37957.1| Casein kinase II subunit beta [Komagataella pastoris CBS 7435]
          Length = 233

 Score =  241 bits (616), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 109/196 (55%), Positives = 140/196 (71%), Gaps = 2/196 (1%)

Query: 8   SDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDS--LE 65
           S SDY +YWIDWFL  KGNEYFC++D EYI DRFNLTGLN  V      +D+ITD   ++
Sbjct: 6   SGSDYTEYWIDWFLGMKGNEYFCDIDPEYIRDRFNLTGLNKYVNRLTTLIDIITDVSVID 65

Query: 66  EELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLP 125
           + L ++ R  +E   + LY LIH+R+I+T +GL++M EKY  +DFG CPR  C  QPLLP
Sbjct: 66  DSLPEKKRREIEDDCKFLYSLIHSRYILTIKGLSQMYEKYTDSDFGYCPREFCRLQPLLP 125

Query: 126 VGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNE 185
           VGLSD P   +VKLYCP CEDIYNPKS RH+ +DGA++G++FP M FQ YP L+P  S  
Sbjct: 126 VGLSDIPNLSTVKLYCPNCEDIYNPKSVRHSRLDGAFFGTSFPAMFFQTYPELIPTHSLN 185

Query: 186 RYIPRIFGFKIHDIAK 201
            Y P++FGF +H  A+
Sbjct: 186 IYTPKMFGFHVHQSAQ 201



>gi|149237983|ref|XP_001524868.1| casein kinase II beta 2 subunit [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146451465|gb|EDK45721.1| casein kinase II beta 2 subunit [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 269

 Score =  241 bits (616), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 145/201 (72%), Gaps = 1/201 (0%)

Query: 2   DDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHY-VQALDLI 60
           ++  + S SD+ +YWID FL  KGNEYFC++D+EYI DRFNLTGLN EV         + 
Sbjct: 4   EEYVTDSSSDFTEYWIDSFLGIKGNEYFCDIDDEYIRDRFNLTGLNQEVSKLPTLIDIIT 63

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
                +   +E R+ +E +AR LYGLIHAR+I+T+RGL KM EK++  DFG CPRV C  
Sbjct: 64  DVIDIDSQPEEHRDTLEHNARILYGLIHARYILTTRGLNKMFEKFRNGDFGYCPRVHCQL 123

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GL+DQP   SVKLYC +CED+YNPKS RH+ IDGAY+G++FP M FQ +P+++P
Sbjct: 124 NPLLPIGLNDQPRMASVKLYCSKCEDLYNPKSGRHSVIDGAYFGTSFPAMFFQNFPNMIP 183

Query: 181 PKSNERYIPRIFGFKIHDIAK 201
               E Y+PR+FGFK+H+ +K
Sbjct: 184 IHLKETYVPRVFGFKLHEYSK 204



>gi|281204801|gb|EFA78996.1| putative casein kinase II beta chain [Polysphondylium pallidum
           PN500]
          Length = 230

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 110/187 (58%), Positives = 143/187 (76%), Gaps = 1/187 (0%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDS-LEEELDDEMRE 74
           WI W+   KGNE+F  V+E+YI D FNLTGL+S V +Y  AL +I DS  EE L ++ +E
Sbjct: 29  WIPWYCNLKGNEFFATVEEDYIQDDFNLTGLSSTVPNYESALGIILDSDPEETLSEDQQE 88

Query: 75  AVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQPYT 134
           ++E+SA  LYGLIHAR+I+TS+GLA M EK+K A+FGRCPRV C NQP+LPVGL+D    
Sbjct: 89  SLERSADILYGLIHARYILTSKGLAHMNEKFKNAEFGRCPRVFCQNQPVLPVGLADMQGV 148

Query: 135 KSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIFGF 194
            +VK+YCPRC DI+NPK  RH+ IDGAY+G+TFPH+L   YP L PPK ++ Y+P+I+GF
Sbjct: 149 DTVKVYCPRCNDIFNPKYRRHSHIDGAYFGTTFPHLLLITYPELAPPKPHQTYVPKIYGF 208

Query: 195 KIHDIAK 201
           KIH  A+
Sbjct: 209 KIHKSAR 215



>gi|323449556|gb|EGB05443.1| hypothetical protein AURANDRAFT_54649 [Aureococcus anophagefferens]
          Length = 279

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 107/193 (55%), Positives = 138/193 (71%), Gaps = 3/193 (1%)

Query: 8   SDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD---SL 64
           S SD    WI WFL+ +GNE+FCEVDEEYI D FNLTGL+S V +Y  ALD+I D   ++
Sbjct: 41  SASDEESSWIAWFLSLRGNEFFCEVDEEYIQDDFNLTGLSSLVPYYDYALDMILDVEMAI 100

Query: 65  EEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLL 124
           EE L +E +E VE +A  LYGLIHAR++IT+RG+  M EKY  A FGRCPR  C  QP L
Sbjct: 101 EESLTEEQQELVESAAEMLYGLIHARYVITNRGMQAMYEKYASASFGRCPRAFCCGQPAL 160

Query: 125 PVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSN 184
           PVG SD P   +V ++CP C DI+ P+S+R ASIDGAY+G+TFPH+    +P L+P    
Sbjct: 161 PVGRSDLPRNYTVHVFCPMCRDIFTPRSSRSASIDGAYFGTTFPHLFLMTFPELIPQHGV 220

Query: 185 ERYIPRIFGFKIH 197
           + ++PR+FGF+IH
Sbjct: 221 QSFVPRVFGFRIH 233



>gi|318087154|gb|ADV40169.1| casein kinase 2 beta subunit isoform CRA_b [Latrodectus hesperus]
          Length = 230

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 144/191 (75%), Gaps = 9/191 (4%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELDDEMRE- 74
           WI WF   +GNE+FCEVDE+YI D+FNLTGL+ +V HY Q+LD+I   L+ E DDE+ E 
Sbjct: 9   WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLSDQVPHYRQSLDMI---LDLEPDDELEEN 65

Query: 75  -----AVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLS 129
                 +E++A  LYG+IHAR+I+T+RG+A+M+EK++  DFG CPRV C NQP+LP+GLS
Sbjct: 66  PNQSDLIEQAAEMLYGMIHARYILTNRGIAQMIEKHQNGDFGACPRVYCENQPMLPIGLS 125

Query: 130 DQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIP 189
           D P    VKLYCP+C D+YNPKS+RH   DGAY+G+ FPHML+ V+P   P +   +++P
Sbjct: 126 DIPGESMVKLYCPKCTDVYNPKSSRHNQTDGAYFGTGFPHMLYMVHPDYRPKRPTNQFVP 185

Query: 190 RIFGFKIHDIA 200
           R++GFKIH +A
Sbjct: 186 RLYGFKIHPLA 196



>gi|50309855|ref|XP_454941.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49644076|emb|CAH00028.1| KLLA0E21869p [Kluyveromyces lactis]
          Length = 260

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 111/206 (53%), Positives = 145/206 (70%), Gaps = 5/206 (2%)

Query: 1   MDDLTSGSDS-DYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDL 59
           ++D   GSDS +Y +YWID FL  KG+EYFC++D EYI DRFNL  L   V  +   +  
Sbjct: 24  VNDQDDGSDSGEYVEYWIDLFLGKKGHEYFCDIDTEYITDRFNLINLQKTVSKFTTVVQY 83

Query: 60  ITDSLEEELDDEMR----EAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPR 115
           + D LEE + + M     E +E   R LYGLIHAR+IIT++GL KML+KYK ADFGRCPR
Sbjct: 84  MVDDLEEGIIESMSPARLEQLETDTRKLYGLIHARYIITAKGLQKMLQKYKAADFGRCPR 143

Query: 116 VLCHNQPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVY 175
             C++QPLLPVGL D P    VKLYCP CED+YNPKS+RH++IDGAY+G++FP M  Q +
Sbjct: 144 YHCNHQPLLPVGLHDIPGIDCVKLYCPSCEDLYNPKSSRHSAIDGAYFGTSFPGMFLQGF 203

Query: 176 PHLLPPKSNERYIPRIFGFKIHDIAK 201
           P + P    +RY+P++FGF +H  A+
Sbjct: 204 PEMCPKHPTKRYVPKVFGFDLHKQAQ 229



>gi|72110360|ref|XP_780696.1| PREDICTED: casein kinase II subunit beta-like isoform 1
           [Strongylocentrotus purpuratus]
          Length = 223

 Score =  241 bits (615), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 140/191 (73%), Gaps = 9/191 (4%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELDDEMRE- 74
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D    E DDEM E 
Sbjct: 9   WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDL---EPDDEMEEN 65

Query: 75  -----AVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLS 129
                 +E++A  LYGLIHARFI+T+RG+A MLEKY++ DFG CPRV C NQ +LP+GLS
Sbjct: 66  PNQNDLIEQAAEMLYGLIHARFIMTNRGIALMLEKYQQGDFGHCPRVYCENQLVLPIGLS 125

Query: 130 DQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIP 189
           D P    VKLYCP+C+D+Y PKS+RH   DGAY+G+ FPHM F V+P   P +   +++P
Sbjct: 126 DVPGEAMVKLYCPKCQDVYTPKSSRHHHTDGAYFGTGFPHMFFMVHPEYRPKRPPNQFVP 185

Query: 190 RIFGFKIHDIA 200
           R++GFKIH  A
Sbjct: 186 RLYGFKIHPQA 196



>gi|350416270|ref|XP_003490894.1| PREDICTED: casein kinase II subunit beta-like [Bombus impatiens]
          Length = 227

 Score =  241 bits (614), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 107/188 (56%), Positives = 141/188 (75%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDD--EM 72
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   ++ELD     
Sbjct: 15  WISWFCNLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDDELDGHPNQ 74

Query: 73  REAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
            E +E++A  LYGLIHAR+I+T+RG+A+M+EKY+  DFG CPRV C +QP+LP+GLSD P
Sbjct: 75  SELIEQAAELLYGLIHARYILTNRGIAQMIEKYQAGDFGHCPRVYCESQPMLPLGLSDVP 134

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VK YCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 135 GEAMVKSYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPTNQFVPRLY 194

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 195 GFKIHPLA 202



>gi|410925180|ref|XP_003976059.1| PREDICTED: casein kinase II subunit beta-like [Takifugu rubripes]
          Length = 215

 Score =  240 bits (613), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 143/188 (76%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDEMRE 74
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   +EEL+D   +
Sbjct: 9   WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQ 68

Query: 75  A--VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
           +  +E++A  LYGLIHAR+I+T+RG+A+MLEKY++ DFG CPRV C NQ +LP+GLSD P
Sbjct: 69  SDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQHMLPIGLSDIP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P     +   +++PR++
Sbjct: 129 GEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRSKRPANQFVPRLY 188

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 189 GFKIHPMA 196



>gi|328777239|ref|XP_624048.2| PREDICTED: casein kinase II subunit beta [Apis mellifera]
 gi|380030058|ref|XP_003698675.1| PREDICTED: casein kinase II subunit beta-like [Apis florea]
          Length = 227

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 107/188 (56%), Positives = 141/188 (75%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDD--EM 72
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   ++ELD     
Sbjct: 15  WISWFCNLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDDELDGHPNQ 74

Query: 73  REAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
            E +E++A  LYGLIHAR+I+T+RG+A+M+EKY+  DFG CPRV C +QP+LP+GLSD P
Sbjct: 75  SELIEQAAELLYGLIHARYILTNRGIAQMIEKYQSGDFGYCPRVYCESQPMLPLGLSDVP 134

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VK YCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 135 GEAMVKSYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPTNQFVPRLY 194

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 195 GFKIHPLA 202



>gi|365987614|ref|XP_003670638.1| hypothetical protein NDAI_0F00760 [Naumovozyma dairenensis CBS 421]
 gi|343769409|emb|CCD25395.1| hypothetical protein NDAI_0F00760 [Naumovozyma dairenensis CBS 421]
          Length = 252

 Score =  240 bits (612), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 110/194 (56%), Positives = 138/194 (71%), Gaps = 4/194 (2%)

Query: 12  YAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELDDE 71
           Y + WID FL  KGNEYFC++D EYI DRFNL  L   V  + Q +  I D L+E + + 
Sbjct: 28  YVEMWIDVFLGRKGNEYFCDIDPEYITDRFNLINLQKSVSKFSQVVQYIVDDLDENVLES 87

Query: 72  MR----EAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVG 127
           M     E +E  AR  YGLIHAR+IIT +GL KML+KYK ADFGRCPRV C+ QPLLPVG
Sbjct: 88  MSHSRLEQLESDARKFYGLIHARYIITIKGLQKMLDKYKDADFGRCPRVYCNYQPLLPVG 147

Query: 128 LSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERY 187
           L DQP    VKLYCP CED+Y PKS+RH+SIDGA++G++FP M  Q YP ++P    +RY
Sbjct: 148 LHDQPGIDCVKLYCPSCEDLYVPKSSRHSSIDGAFFGTSFPGMFLQAYPDMVPKHPTKRY 207

Query: 188 IPRIFGFKIHDIAK 201
           +P+IFGF++H  A+
Sbjct: 208 VPKIFGFELHKQAQ 221



>gi|340711481|ref|XP_003394304.1| PREDICTED: casein kinase II subunit beta-like isoform 2 [Bombus
           terrestris]
          Length = 227

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 142/188 (75%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDD--EM 72
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   ++ELD     
Sbjct: 15  WISWFCNLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDDELDGHPNQ 74

Query: 73  REAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
            E +E+++  LYGLIHAR+I+T+RG+A+M+EKY+  DFG CPRV C +QP+LP+GLSD P
Sbjct: 75  SELIEQASELLYGLIHARYILTNRGIAQMIEKYQAGDFGHCPRVYCESQPMLPLGLSDVP 134

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VK YCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P + + +++PR++
Sbjct: 135 GEAMVKSYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPSNQFVPRLY 194

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 195 GFKIHPLA 202



>gi|66809541|ref|XP_638493.1| hypothetical protein DDB_G0284601 [Dictyostelium discoideum AX4]
 gi|74854188|sp|Q54PF1.1|CK2B_DICDI RecName: Full=Casein kinase II subunit beta; Short=CK II beta
 gi|60467099|gb|EAL65139.1| hypothetical protein DDB_G0284601 [Dictyostelium discoideum AX4]
          Length = 268

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 110/187 (58%), Positives = 143/187 (76%), Gaps = 1/187 (0%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDS-LEEELDDEMRE 74
           WI W+   KGNE+F  +DE+YI D FNLTGL+S VQ Y  AL +I DS  ++ L ++ +E
Sbjct: 23  WIPWYCNLKGNEFFATIDEDYINDDFNLTGLSSLVQFYDSALGIILDSDPDDPLSEDQQE 82

Query: 75  AVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQPYT 134
           A+E+SA  LYGLIHAR+I+T +GLA M EK+KKA+FGRCPRV C NQP+LPVGL+D    
Sbjct: 83  ALERSADILYGLIHARYILTPKGLAHMHEKFKKAEFGRCPRVFCQNQPVLPVGLADMQGV 142

Query: 135 KSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIFGF 194
            +VK+YCPRC DI+NPK  RH+ IDGAY+G+TFPH+L   YP L+P K  ++YIP+I+GF
Sbjct: 143 DTVKVYCPRCNDIFNPKYRRHSHIDGAYFGTTFPHLLLITYPELIPTKPPQQYIPKIYGF 202

Query: 195 KIHDIAK 201
           KIH  A+
Sbjct: 203 KIHKSAR 209



>gi|391341916|ref|XP_003745272.1| PREDICTED: casein kinase II subunit beta-like [Metaseiulus
           occidentalis]
          Length = 221

 Score =  239 bits (610), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 140/188 (74%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD---SLEEELDDEM 72
           WI WF   +GNE+FCE DE+YI D+FNLTGLN +V HY QALD+I D     + + +   
Sbjct: 9   WISWFCGLRGNEFFCECDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEADDDIDDNPNQ 68

Query: 73  REAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
            + +E++A  LYGLIHAR+I+T+RG+A+MLEKY+  DFG CPRV C NQ LLP+GLSD P
Sbjct: 69  NDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQNGDFGYCPRVYCENQSLLPIGLSDVP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               V+LYCP+C D+YNPKSTRH   DGAY+G+ FPHMLF V+P   P +  ++++PR++
Sbjct: 129 GEAMVQLYCPKCMDVYNPKSTRHHHCDGAYFGTGFPHMLFMVHPECRPKQPVKQFVPRLY 188

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 189 GFKIHPLA 196



>gi|340711479|ref|XP_003394303.1| PREDICTED: casein kinase II subunit beta-like isoform 1 [Bombus
           terrestris]
          Length = 221

 Score =  239 bits (610), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 142/188 (75%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDD--EM 72
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   ++ELD     
Sbjct: 9   WISWFCNLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDDELDGHPNQ 68

Query: 73  REAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
            E +E+++  LYGLIHAR+I+T+RG+A+M+EKY+  DFG CPRV C +QP+LP+GLSD P
Sbjct: 69  SELIEQASELLYGLIHARYILTNRGIAQMIEKYQAGDFGHCPRVYCESQPMLPLGLSDVP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VK YCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P + + +++PR++
Sbjct: 129 GEAMVKSYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPSNQFVPRLY 188

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 189 GFKIHPLA 196



>gi|508776888|gb|EOY24144.1| Casein kinase II beta chain 1 isoform 3 [Theobroma cacao]
          Length = 280

 Score =  239 bits (610), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 140/193 (72%), Gaps = 3/193 (1%)

Query: 5   TSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSL 64
            SGSD D    WI WF   +GNE+FCEVD++YI D FNL GL+S+V +Y  ALDLI D  
Sbjct: 89  VSGSDGDDTS-WISWFCNLRGNEFFCEVDDDYIQDDFNLCGLSSQVPYYDYALDLILDV- 146

Query: 65  EEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLL 124
            E   +E  E VE +A  LYGLIH+R+I+TS+G+A ML+KYK  DFGRCPRV C  QP L
Sbjct: 147 -ESSHEEQNELVESAAEMLYGLIHSRYILTSKGMAAMLDKYKNYDFGRCPRVYCCGQPCL 205

Query: 125 PVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSN 184
           PVG SD P + +VK+YCPRCEDIY P+S    +IDGAY+G+TFPH+    Y HL P K++
Sbjct: 206 PVGQSDIPRSSTVKIYCPRCEDIYYPRSKYQGNIDGAYFGTTFPHLFLMTYGHLKPLKAS 265

Query: 185 ERYIPRIFGFKIH 197
           + Y+PR+FGFKIH
Sbjct: 266 QSYVPRVFGFKIH 278



>gi|148909061|gb|ABR17633.1| unknown [Picea sitchensis]
          Length = 297

 Score =  239 bits (610), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 111/199 (55%), Positives = 140/199 (70%), Gaps = 4/199 (2%)

Query: 6   SGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD--- 62
           SGSD D    WI WF   +GNE+FCEVD+EYI D FNL GL+S+V +Y  ALDLI D   
Sbjct: 100 SGSDGDDTS-WISWFCNLRGNEFFCEVDDEYIQDDFNLCGLSSQVPYYDYALDLILDVES 158

Query: 63  SLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQP 122
           S ++ L +E  E VE +A  LYGLIH R+I+TS+G+  MLEKYK  DFGRCPRV C  QP
Sbjct: 159 SNDDILTEEQNELVESAAEMLYGLIHVRYILTSKGMNAMLEKYKNTDFGRCPRVYCSGQP 218

Query: 123 LLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPK 182
            LPVG SD P T +VK+YCP+CED+Y P+S    + DGAY+G+TFPH+    Y H+ P +
Sbjct: 219 CLPVGQSDIPRTSTVKIYCPKCEDVYYPRSKYQGNTDGAYFGTTFPHLFLMTYAHIKPSR 278

Query: 183 SNERYIPRIFGFKIHDIAK 201
             + Y+P+IFGFKIH  A+
Sbjct: 279 PMQSYVPKIFGFKIHKSAR 297



>gi|448120059|ref|XP_004203879.1| Piso0_000902 [Millerozyma farinosa CBS 7064]
 gi|359384747|emb|CCE78282.1| Piso0_000902 [Millerozyma farinosa CBS 7064]
          Length = 253

 Score =  239 bits (609), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 108/201 (53%), Positives = 145/201 (72%), Gaps = 1/201 (0%)

Query: 2   DDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHY-VQALDLI 60
           ++  S S SD+ +YWID FL  KGNEYFC++DE+YI DRFNLTGLN E+         + 
Sbjct: 8   EEYVSDSSSDFTEYWIDLFLGIKGNEYFCDIDEDYIRDRFNLTGLNQEISKLPTLIDIIT 67

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
                E+  ++ R  +E +AR LYGLIHAR+I+T+RGL KM EKY+  DFG CPRV CH 
Sbjct: 68  DIIEIEKQPEDQRSTLEHNARVLYGLIHARYILTTRGLNKMFEKYRNGDFGYCPRVHCHL 127

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GL DQP   SVKLYC +CED+YNPKS RH+ +DGAY+G++FP M +Q +P  +P
Sbjct: 128 YPLLPMGLHDQPRISSVKLYCAKCEDLYNPKSGRHSVVDGAYFGTSFPAMFYQNFPQAIP 187

Query: 181 PKSNERYIPRIFGFKIHDIAK 201
            ++ + Y+PR+FGFK+H+ +K
Sbjct: 188 VRTKDMYVPRVFGFKLHNYSK 208



>gi|448117601|ref|XP_004203296.1| Piso0_000902 [Millerozyma farinosa CBS 7064]
 gi|359384164|emb|CCE78868.1| Piso0_000902 [Millerozyma farinosa CBS 7064]
          Length = 253

 Score =  239 bits (609), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 108/201 (53%), Positives = 145/201 (72%), Gaps = 1/201 (0%)

Query: 2   DDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHY-VQALDLI 60
           ++  S S SD+ +YWID FL  KGNEYFC++DE+YI DRFNLTGLN E+         + 
Sbjct: 8   EEYVSDSSSDFTEYWIDLFLGIKGNEYFCDIDEDYIRDRFNLTGLNQEISKLPTLIDIIT 67

Query: 61  TDSLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHN 120
                E+  ++ R  +E +AR LYGLIHAR+I+T+RGL KM EKY+  DFG CPRV CH 
Sbjct: 68  DIIEIEKQPEDQRSTLEHNARVLYGLIHARYILTTRGLNKMFEKYRNGDFGYCPRVHCHL 127

Query: 121 QPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLP 180
            PLLP+GL DQP   SVKLYC +CED+YNPKS RH+ +DGAY+G++FP M +Q +P  +P
Sbjct: 128 YPLLPMGLHDQPRISSVKLYCAKCEDLYNPKSGRHSVVDGAYFGTSFPAMFYQNFPQAIP 187

Query: 181 PKSNERYIPRIFGFKIHDIAK 201
            ++ + Y+PR+FGFK+H+ +K
Sbjct: 188 VRTKDMYVPRVFGFKLHNYSK 208



>gi|449017504|dbj|BAM80906.1| probable protein kinase CK2 regulatory subunit CK2B1
           [Cyanidioschyzon merolae strain 10D]
          Length = 329

 Score =  239 bits (609), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 109/203 (53%), Positives = 144/203 (70%), Gaps = 2/203 (0%)

Query: 1   MDDLTSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLI 60
           +D    G D++    WI WF +  GNE+FCEVDEE+I D FNLTGL+S V +Y  ALD I
Sbjct: 105 IDSEAEGDDTEEDLSWISWFCSLSGNEFFCEVDEEFIQDDFNLTGLSSLVSYYEYALDTI 164

Query: 61  TDS--LEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLC 118
            D    +  +D+  RE +E +A  LYGLIHAR+I+T+RGL  MLEKY   DFGRCPRV C
Sbjct: 165 LDIELPDPGIDERQREIIEMNAEFLYGLIHARYILTNRGLHDMLEKYNNVDFGRCPRVFC 224

Query: 119 HNQPLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHL 178
           + QP+LPVG SD P T  VKL+CP+C DIY P+S  H+ +DGA++G+TFPH+  Q YP L
Sbjct: 225 NGQPVLPVGQSDLPRTAVVKLFCPKCWDIYVPRSAAHSHLDGAFWGTTFPHLFLQTYPEL 284

Query: 179 LPPKSNERYIPRIFGFKIHDIAK 201
           +P ++  RY+PRIFGF++ + +K
Sbjct: 285 VPERNPCRYVPRIFGFRVSEKSK 307



>gi|260793664|ref|XP_002591831.1| hypothetical protein BRAFLDRAFT_59924 [Branchiostoma floridae]
 gi|229277042|gb|EEN47842.1| hypothetical protein BRAFLDRAFT_59924 [Branchiostoma floridae]
          Length = 227

 Score =  239 bits (609), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 109/200 (54%), Positives = 146/200 (73%), Gaps = 15/200 (7%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDEMRE 74
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   ++EL+D   +
Sbjct: 9   WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDDELEDNPNQ 68

Query: 75  A--VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
           +  +E++A  LYGLIHAR+I+T+RG+A+MLEKY++ DFG C RV C NQP+LP+GLSD P
Sbjct: 69  SDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGHCSRVYCENQPMLPIGLSDVP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASI------------DGAYYGSTFPHMLFQVYPHLLP 180
               VKLYCP+C+D+Y PKS+RH  I            DGAY+G++FPHMLF V+P   P
Sbjct: 129 GEAMVKLYCPKCQDVYTPKSSRHHHILSYDTTIYHNFSDGAYFGTSFPHMLFMVHPEYRP 188

Query: 181 PKSNERYIPRIFGFKIHDIA 200
                +++PR++GFKIH +A
Sbjct: 189 QPPKNKFVPRLYGFKIHPLA 208



>gi|147801660|emb|CAN72327.1| hypothetical protein VITISV_022015 [Vitis vinifera]
          Length = 282

 Score =  238 bits (608), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 112/193 (58%), Positives = 138/193 (71%), Gaps = 4/193 (2%)

Query: 5   TSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSL 64
            SGSD D    WI WF   +GNE+FCEVD+EYI D FNL GL+S+V +Y  ALDLI   L
Sbjct: 92  VSGSDGDDTS-WISWFCNLRGNEFFCEVDDEYIQDDFNLCGLSSQVPYYDYALDLI---L 147

Query: 65  EEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLL 124
           + E   E  E VE +A  LYGLIH R+I+TS+G++ MLEKYK  DFGRCPRV C  QP L
Sbjct: 148 DVESSHEQNELVESAAEMLYGLIHVRYILTSKGMSAMLEKYKSYDFGRCPRVYCCGQPCL 207

Query: 125 PVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSN 184
           PVG SD P + +VK+YCP+CEDIY P+S    +IDGAY+G+TFPH+    Y HL P K+ 
Sbjct: 208 PVGQSDIPRSSTVKIYCPKCEDIYYPRSKYQGNIDGAYFGTTFPHLFLMTYGHLKPQKAA 267

Query: 185 ERYIPRIFGFKIH 197
           + Y+PR+FGFKIH
Sbjct: 268 QSYVPRVFGFKIH 280



>gi|508776886|gb|EOY24142.1| Casein kinase II beta chain 1 isoform 1 [Theobroma cacao]
          Length = 285

 Score =  238 bits (608), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 141/196 (71%), Gaps = 4/196 (2%)

Query: 5   TSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-- 62
            SGSD D    WI WF   +GNE+FCEVD++YI D FNL GL+S+V +Y  ALDLI D  
Sbjct: 89  VSGSDGDDTS-WISWFCNLRGNEFFCEVDDDYIQDDFNLCGLSSQVPYYDYALDLILDVE 147

Query: 63  -SLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQ 121
            S  +   +E  E VE +A  LYGLIH+R+I+TS+G+A ML+KYK  DFGRCPRV C  Q
Sbjct: 148 SSHGDMFTEEQNELVESAAEMLYGLIHSRYILTSKGMAAMLDKYKNYDFGRCPRVYCCGQ 207

Query: 122 PLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPP 181
           P LPVG SD P + +VK+YCPRCEDIY P+S    +IDGAY+G+TFPH+    Y HL P 
Sbjct: 208 PCLPVGQSDIPRSSTVKIYCPRCEDIYYPRSKYQGNIDGAYFGTTFPHLFLMTYGHLKPL 267

Query: 182 KSNERYIPRIFGFKIH 197
           K+++ Y+PR+FGFKIH
Sbjct: 268 KASQSYVPRVFGFKIH 283



>gi|242020270|ref|XP_002430578.1| Casein kinase II subunit beta, putative [Pediculus humanus
           corporis]
 gi|212515750|gb|EEB17840.1| Casein kinase II subunit beta, putative [Pediculus humanus
           corporis]
          Length = 221

 Score =  238 bits (608), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 107/188 (56%), Positives = 143/188 (76%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDEMRE 74
           WI WF   KGNE+FCEVDE+YI D+FNLTGLN  V HY QALD+I D   ++E+DD   +
Sbjct: 9   WISWFCGLKGNEFFCEVDEDYIQDKFNLTGLNELVPHYRQALDMILDLEPDDEIDDNPNQ 68

Query: 75  A--VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
           +  +E++A  LYGLIHAR+I+T+RG+A+M+EKY+  DFG CPRV C +QP+LP+GLSD P
Sbjct: 69  SDLIEQAAEMLYGLIHARYILTNRGIAQMIEKYQSGDFGCCPRVYCESQPMLPIGLSDVP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VK YC RC D+Y PKS+R+   DGAY+G+ FPHMLF V+P   P +S+ +++PR++
Sbjct: 129 GEAMVKSYCARCMDVYTPKSSRYHHTDGAYFGTGFPHMLFMVHPEYRPKRSSNQFVPRLY 188

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 189 GFKIHPLA 196



>gi|391341918|ref|XP_003745273.1| PREDICTED: casein kinase II subunit beta-like [Metaseiulus
           occidentalis]
          Length = 221

 Score =  238 bits (608), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 140/188 (74%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD---SLEEELDDEM 72
           WI WF   +GNE+FCE DE+YI D+FNLTGLN +V HY QALD+I D     + + +   
Sbjct: 9   WISWFCGLRGNEFFCECDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEADDDIDDNPNQ 68

Query: 73  REAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
            + +E++A  LYGLIHAR+I+T+RG+A+MLEKY+  DFG CPRV C NQ LLP+GLSD P
Sbjct: 69  NDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQNGDFGYCPRVYCENQSLLPIGLSDVP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D+Y+PKSTRH   DGAY+G+ FPHMLF V+P   P +  ++++PR++
Sbjct: 129 GESMVKLYCPKCMDVYSPKSTRHHHCDGAYFGTGFPHMLFMVHPECRPKQPVKQFVPRLY 188

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 189 GFKIHPLA 196



>gi|482549616|gb|EOA13810.1| hypothetical protein CARUB_v10026904mg [Capsella rubella]
          Length = 288

 Score =  238 bits (608), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 140/196 (71%), Gaps = 4/196 (2%)

Query: 5   TSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-- 62
            SGSD +    WI WF   +GNE+FCEVD++YI D FNL GL+S V +Y  ALDLI D  
Sbjct: 92  VSGSDGEDTS-WISWFCNLRGNEFFCEVDDDYIQDDFNLCGLSSLVPYYDYALDLILDVE 150

Query: 63  -SLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQ 121
            S  E   +E  E +E +A  LYGLIHAR+I+TS+GLA MLEKYK  DFGRCPRV C  Q
Sbjct: 151 SSHGEMFTEEQNELIESAAEMLYGLIHARYILTSKGLAAMLEKYKSYDFGRCPRVYCCGQ 210

Query: 122 PLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPP 181
           P LPVG SD P + +VK+YCP+CEDIY P+S    +IDGAY+G+TFPH+    Y HL PP
Sbjct: 211 PCLPVGQSDLPRSSTVKIYCPKCEDIYYPRSKYQGNIDGAYFGTTFPHLFLMTYGHLKPP 270

Query: 182 KSNERYIPRIFGFKIH 197
           K+++ Y+ R+FGFK+H
Sbjct: 271 KASQNYVQRVFGFKLH 286



>gi|357482235|ref|XP_003611403.1| Casein kinase II subunit beta-4 [Medicago truncatula]
 gi|355512738|gb|AES94361.1| Casein kinase II subunit beta-4 [Medicago truncatula]
          Length = 281

 Score =  238 bits (608), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 111/196 (56%), Positives = 140/196 (71%), Gaps = 4/196 (2%)

Query: 5   TSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-- 62
            SGSD D    WI WF   +GNE+FCEVD++YI D FNL GL+S+V +Y  ALDLI D  
Sbjct: 85  VSGSDGDDTS-WISWFCNLRGNEFFCEVDDDYIQDDFNLCGLSSQVPYYDYALDLILDVE 143

Query: 63  -SLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQ 121
            S  +   +E  E +E +A  LYG+IHAR+I+TS+GLA ML+KYK  DFGRCPRV C  Q
Sbjct: 144 SSHGDMFTEEQNELIESAAEMLYGMIHARYILTSKGLAAMLDKYKNYDFGRCPRVYCSGQ 203

Query: 122 PLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPP 181
           P LPVG SD P + +VK+YCPRCEDIY P+S    +IDGAY+G+TFPH+L   Y  L P 
Sbjct: 204 PCLPVGQSDIPRSSTVKIYCPRCEDIYYPRSKYQGNIDGAYFGTTFPHLLLMTYGQLKPQ 263

Query: 182 KSNERYIPRIFGFKIH 197
           K ++ Y+PR+FGFK+H
Sbjct: 264 KPSQNYVPRVFGFKLH 279



>gi|225453309|ref|XP_002269020.1| PREDICTED: putative casein kinase II subunit beta-4 isoform 1
           [Vitis vinifera]
 gi|297734650|emb|CBI16701.3| unnamed protein product [Vitis vinifera]
          Length = 288

 Score =  238 bits (608), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 112/196 (57%), Positives = 139/196 (70%), Gaps = 4/196 (2%)

Query: 5   TSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-- 62
            SGSD D    WI WF   +GNE+FCEVD+EYI D FNL GL+S+V +Y  ALDLI D  
Sbjct: 92  VSGSDGDDTS-WISWFCNLRGNEFFCEVDDEYIQDDFNLCGLSSQVPYYDYALDLILDVE 150

Query: 63  -SLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQ 121
            S  +   +E  E VE +A  LYGLIH R+I+TS+G++ MLEKYK  DFGRCPRV C  Q
Sbjct: 151 SSHGDMFTEEQNELVESAAEMLYGLIHVRYILTSKGMSAMLEKYKSYDFGRCPRVYCCGQ 210

Query: 122 PLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPP 181
           P LPVG SD P + +VK+YCP+CEDIY P+S    +IDGAY+G+TFPH+    Y HL P 
Sbjct: 211 PCLPVGQSDIPRSSTVKIYCPKCEDIYYPRSKYQGNIDGAYFGTTFPHLFLMTYGHLKPQ 270

Query: 182 KSNERYIPRIFGFKIH 197
           K+ + Y+PR+FGFKIH
Sbjct: 271 KAAQSYVPRVFGFKIH 286



>gi|21261784|emb|CAD32500.1| protein kinase Ck2 regulatory subunit 2 [Nicotiana tabacum]
          Length = 280

 Score =  238 bits (607), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 112/195 (57%), Positives = 139/195 (71%), Gaps = 4/195 (2%)

Query: 6   SGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD--- 62
           SGSD +    WI WF   +GNE+FCEVD+EYI D FNL GL+S+V +Y  ALDLI D   
Sbjct: 85  SGSDGEDTS-WISWFCNLRGNEFFCEVDDEYIQDDFNLCGLSSQVPYYDYALDLILDVES 143

Query: 63  SLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQP 122
           S  +   +E  E VE +A  LYGLIH R+I+TS+G+A MLEKYK  DFGRCPRV C  QP
Sbjct: 144 SHGDMFTEEQNELVESAAEMLYGLIHVRYILTSKGMAAMLEKYKNYDFGRCPRVYCCGQP 203

Query: 123 LLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPK 182
            LPVG SD P + +VK+YCP+CEDIY P+S    +IDGAY+G+TFPH+    Y HL P K
Sbjct: 204 CLPVGQSDIPRSSTVKIYCPKCEDIYYPRSKYQGNIDGAYFGTTFPHLFLMTYGHLKPQK 263

Query: 183 SNERYIPRIFGFKIH 197
           S + Y+PR+FGFK+H
Sbjct: 264 STQNYVPRVFGFKLH 278



>gi|330840241|ref|XP_003292127.1| hypothetical protein DICPUDRAFT_156809 [Dictyostelium purpureum]
 gi|325077652|gb|EGC31351.1| hypothetical protein DICPUDRAFT_156809 [Dictyostelium purpureum]
          Length = 242

 Score =  238 bits (607), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 143/187 (76%), Gaps = 1/187 (0%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDS-LEEELDDEMRE 74
           WI W+   KGNE+F  +DE+YI D FNLTGL+S VQ Y  AL +I DS  E+ L ++ +E
Sbjct: 23  WIPWYCNLKGNEFFATIDEDYINDDFNLTGLSSLVQFYDGALGIILDSDPEDPLSEDQQE 82

Query: 75  AVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQPYT 134
           A+E+SA  LYGLIHAR+I+T +GLA M EK+KKA+FGRCPRV C NQP+LPVGL+D    
Sbjct: 83  ALERSADILYGLIHARYILTPKGLAHMHEKFKKAEFGRCPRVFCQNQPVLPVGLADMQGV 142

Query: 135 KSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIFGF 194
            +VK+YCP+C DI+NPK  RH+ IDGAY+G+TFPH+L   YP L+P K  ++Y+P+I+GF
Sbjct: 143 DTVKVYCPKCNDIFNPKYRRHSHIDGAYFGTTFPHLLLITYPELIPTKPPQQYVPKIYGF 202

Query: 195 KIHDIAK 201
           KIH  A+
Sbjct: 203 KIHKSAR 209



>gi|482549615|gb|EOA13809.1| hypothetical protein CARUB_v10026904mg [Capsella rubella]
          Length = 283

 Score =  238 bits (607), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 111/193 (57%), Positives = 139/193 (72%), Gaps = 3/193 (1%)

Query: 5   TSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSL 64
            SGSD +    WI WF   +GNE+FCEVD++YI D FNL GL+S V +Y  ALDLI D  
Sbjct: 92  VSGSDGEDTS-WISWFCNLRGNEFFCEVDDDYIQDDFNLCGLSSLVPYYDYALDLILDV- 149

Query: 65  EEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLL 124
            E   +E  E +E +A  LYGLIHAR+I+TS+GLA MLEKYK  DFGRCPRV C  QP L
Sbjct: 150 -ESSHEEQNELIESAAEMLYGLIHARYILTSKGLAAMLEKYKSYDFGRCPRVYCCGQPCL 208

Query: 125 PVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSN 184
           PVG SD P + +VK+YCP+CEDIY P+S    +IDGAY+G+TFPH+    Y HL PPK++
Sbjct: 209 PVGQSDLPRSSTVKIYCPKCEDIYYPRSKYQGNIDGAYFGTTFPHLFLMTYGHLKPPKAS 268

Query: 185 ERYIPRIFGFKIH 197
           + Y+ R+FGFK+H
Sbjct: 269 QNYVQRVFGFKLH 281



>gi|195355288|ref|XP_002044124.1| GM13109 [Drosophila sechellia]
 gi|195566289|ref|XP_002106719.1| GD17050 [Drosophila simulans]
 gi|194129393|gb|EDW51436.1| GM13109 [Drosophila sechellia]
 gi|194204105|gb|EDX17681.1| GD17050 [Drosophila simulans]
          Length = 246

 Score =  238 bits (607), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 105/188 (55%), Positives = 141/188 (75%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDE--M 72
           W+ WF   +GNE+FCEVDE+YI D+FNLTGLN +V +Y QALD+I D   E+EL+D    
Sbjct: 20  WVTWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPNYRQALDMILDLEPEDELEDNPLQ 79

Query: 73  REAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
            +  E++A  LYGLIHAR+I+T+RG+A+M+EKY+  DFG CPRV C +QP+LP+GLSD P
Sbjct: 80  SDMTEQAAEMLYGLIHARYILTNRGIAQMIEKYQTGDFGHCPRVYCESQPMLPLGLSDIP 139

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VK YCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 140 GEAMVKTYCPKCIDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPTNQFVPRLY 199

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 200 GFKIHSLA 207



>gi|321466375|gb|EFX77371.1| hypothetical protein DAPPUDRAFT_305830 [Daphnia pulex]
          Length = 221

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 109/189 (57%), Positives = 139/189 (73%), Gaps = 5/189 (2%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELDDE---- 71
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D LE + D E    
Sbjct: 9   WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILD-LEPDDDVEDNPN 67

Query: 72  MREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQ 131
             + +E++A  LYGLIHAR+I+T+RG+ +MLEKY   DFG CPRV C NQ +LP+GLSD 
Sbjct: 68  QSDLIEQAAEMLYGLIHARYILTNRGILQMLEKYHAGDFGHCPRVYCENQLMLPIGLSDV 127

Query: 132 PYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRI 191
           P    VKLYCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P K   +++PR+
Sbjct: 128 PGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKKPTNQFVPRL 187

Query: 192 FGFKIHDIA 200
           +GFKIH +A
Sbjct: 188 YGFKIHPLA 196



>gi|195131885|ref|XP_002010375.1| GI15890 [Drosophila mojavensis]
 gi|193908825|gb|EDW07692.1| GI15890 [Drosophila mojavensis]
          Length = 236

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 105/188 (55%), Positives = 141/188 (75%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDE--M 72
           W+ WF   +GNE+FCEVDE+YI D+FNLTGLN +V +Y QALD+I D   E+EL+D    
Sbjct: 9   WVTWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPNYRQALDMILDLEPEDELEDNPLQ 68

Query: 73  REAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
            +  E++A  LYGLIHAR+I+T+RG+A+M+EKY+  DFG CPRV C +QP+LP+GLSD P
Sbjct: 69  SDMTEQAAEMLYGLIHARYILTNRGIAQMIEKYQTGDFGHCPRVYCESQPMLPLGLSDIP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VK YCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 129 GEAMVKTYCPKCIDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPTNQFVPRLY 188

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 189 GFKIHSLA 196



>gi|194889399|ref|XP_001977076.1| GG18445 [Drosophila erecta]
 gi|195480745|ref|XP_002101375.1| GE15667 [Drosophila yakuba]
 gi|190648725|gb|EDV46003.1| GG18445 [Drosophila erecta]
 gi|194188899|gb|EDX02483.1| GE15667 [Drosophila yakuba]
          Length = 246

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 105/188 (55%), Positives = 141/188 (75%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDE--M 72
           W+ WF   +GNE+FCEVDE+YI D+FNLTGLN +V +Y QALD+I D   E+EL+D    
Sbjct: 20  WVTWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPNYRQALDMILDLEPEDELEDNPLQ 79

Query: 73  REAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
            +  E++A  LYGLIHAR+I+T+RG+A+M+EKY+  DFG CPRV C +QP+LP+GLSD P
Sbjct: 80  SDMTEQAAEMLYGLIHARYILTNRGIAQMIEKYQTGDFGHCPRVYCESQPMLPLGLSDIP 139

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VK YCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 140 GEAMVKTYCPKCIDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPTNQFVPRLY 199

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 200 GFKIHSLA 207



>gi|470143175|ref|XP_004307257.1| PREDICTED: putative casein kinase II subunit beta-4-like [Fragaria
           vesca subsp. vesca]
          Length = 287

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 111/196 (56%), Positives = 140/196 (71%), Gaps = 4/196 (2%)

Query: 5   TSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-- 62
            SGSD D    WI WF   +GNE+FCEVD+EYI D FNL GL+S+V +Y  ALDLI D  
Sbjct: 91  VSGSDGDDTS-WISWFCNLRGNEFFCEVDDEYIQDDFNLCGLSSQVPYYDYALDLILDVE 149

Query: 63  -SLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQ 121
            S  +   +E  E VE +A  LYGLIH R+I+TS+G++ MLEKYK  DFGRCPRV C  Q
Sbjct: 150 SSHGDMFTEEQNELVESAAEMLYGLIHVRYILTSKGMSAMLEKYKNYDFGRCPRVYCCGQ 209

Query: 122 PLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPP 181
           P LPVG SD P + +VK+YCP+CEDIY P+S    +IDGAY+G+TFPH+    Y HL P 
Sbjct: 210 PCLPVGQSDIPRSSTVKIYCPKCEDIYYPRSKYQGNIDGAYFGTTFPHLFLMTYGHLKPQ 269

Query: 182 KSNERYIPRIFGFKIH 197
           K+++ Y+PR+FGFK+H
Sbjct: 270 KASQSYVPRVFGFKLH 285



>gi|442616024|ref|NP_001259462.1| casein kinase II beta subunit, isoform K [Drosophila melanogaster]
 gi|440216674|gb|AGB95305.1| casein kinase II beta subunit, isoform K [Drosophila melanogaster]
          Length = 234

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 105/188 (55%), Positives = 141/188 (75%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDE--M 72
           W+ WF   +GNE+FCEVDE+YI D+FNLTGLN +V +Y QALD+I D   E+EL+D    
Sbjct: 9   WVTWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPNYRQALDMILDLEPEDELEDNPLQ 68

Query: 73  REAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
            +  E++A  LYGLIHAR+I+T+RG+A+M+EKY+  DFG CPRV C +QP+LP+GLSD P
Sbjct: 69  SDMTEQAAEMLYGLIHARYILTNRGIAQMIEKYQTGDFGHCPRVYCESQPMLPLGLSDIP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VK YCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 129 GEAMVKTYCPKCIDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPTNQFVPRLY 188

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 189 GFKIHSLA 196



>gi|367009086|ref|XP_003679044.1| hypothetical protein TDEL_0A05010 [Torulaspora delbrueckii]
 gi|359746701|emb|CCE89833.1| hypothetical protein TDEL_0A05010 [Torulaspora delbrueckii]
          Length = 264

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 114/222 (51%), Positives = 146/222 (65%), Gaps = 7/222 (3%)

Query: 10  SDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELD 69
           S+Y + WID FL  KG+EYFC+VD EYI DRFNL  L   V  + Q +  I D L+E + 
Sbjct: 38  SEYVEMWIDLFLGRKGHEYFCDVDPEYITDRFNLINLQKTVSKFTQVVQYIVDELDEFVL 97

Query: 70  DEMR----EAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLP 125
           + M     E +E  AR  YGLIHAR+IIT +GL+KML KYK ADFGRCPRV C+ QPLLP
Sbjct: 98  EGMSHARLEQLESDARKFYGLIHARYIITVKGLSKMLTKYKSADFGRCPRVYCNCQPLLP 157

Query: 126 VGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNE 185
           VGL D P    VKLYCP CED+Y PKS+RH++IDGAY+G++FP M  Q +P ++P    +
Sbjct: 158 VGLHDVPGIDCVKLYCPSCEDLYIPKSSRHSTIDGAYFGTSFPGMFLQAFPEMVPDHPVK 217

Query: 186 RYIPRIFGFKIHDIAKXXXXXXXXXXXXXXXITVVGEGNVNS 227
           RY+PRIFGF++H   K               +  +GE N+N+
Sbjct: 218 RYVPRIFGFELH---KQAQLARWQELQRLKLVAKLGEENLNA 256



>gi|45554910|ref|NP_996415.1| casein kinase II beta subunit, isoform E [Drosophila melanogaster]
 gi|52788230|sp|P08182.2|CSK2B_DROME RecName: Full=Casein kinase II subunit beta; Short=CK II beta
 gi|45446919|gb|AAS65321.1| casein kinase II beta subunit, isoform E [Drosophila melanogaster]
          Length = 235

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 105/188 (55%), Positives = 141/188 (75%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDE--M 72
           W+ WF   +GNE+FCEVDE+YI D+FNLTGLN +V +Y QALD+I D   E+EL+D    
Sbjct: 9   WVTWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPNYRQALDMILDLEPEDELEDNPLQ 68

Query: 73  REAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
            +  E++A  LYGLIHAR+I+T+RG+A+M+EKY+  DFG CPRV C +QP+LP+GLSD P
Sbjct: 69  SDMTEQAAEMLYGLIHARYILTNRGIAQMIEKYQTGDFGHCPRVYCESQPMLPLGLSDIP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VK YCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 129 GEAMVKTYCPKCIDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPTNQFVPRLY 188

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 189 GFKIHSLA 196



>gi|290562888|gb|ADD38838.1| Casein kinase II subunit beta [Lepeophtheirus salmonis]
          Length = 221

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 139/185 (75%), Gaps = 3/185 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEEL---DDEM 72
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALDLI D   +E    +   
Sbjct: 9   WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDLILDLESDEDLDDNPNQ 68

Query: 73  REAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
            + +E++A  LYGLIHAR+I+T+RG+A+M+EKY+  DFG CPRV C NQP+LP+GLSD P
Sbjct: 69  SDLIEQAAEMLYGLIHARYILTNRGIAQMIEKYQSGDFGHCPRVYCENQPMLPIGLSDIP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D+YNPKS+RH   DG+Y+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 129 GEAMVKLYCPKCMDVYNPKSSRHHHTDGSYFGTGFPHMLFMVHPEYRPKRPASQFVPRLY 188

Query: 193 GFKIH 197
           GFKIH
Sbjct: 189 GFKIH 193



>gi|261259993|gb|ACX54931.1| MIP14664p [Drosophila melanogaster]
          Length = 222

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 105/188 (55%), Positives = 141/188 (75%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDE--M 72
           W+ WF   +GNE+FCEVDE+YI D+FNLTGLN +V +Y QALD+I D   E+EL+D    
Sbjct: 9   WVTWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPNYRQALDMILDLEPEDELEDNPLQ 68

Query: 73  REAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
            +  E++A  LYGLIHAR+I+T+RG+A+M+EKY+  DFG CPRV C +QP+LP+GLSD P
Sbjct: 69  SDMTEQAAEMLYGLIHARYILTNRGIAQMIEKYQTGDFGHCPRVYCESQPMLPLGLSDIP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VK YCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 129 GEAMVKTYCPKCIDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPTNQFVPRLY 188

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 189 GFKIHSLA 196



>gi|187121192|ref|NP_001119697.1| casein kinase II beta subunit [Acyrthosiphon pisum]
 gi|89473704|gb|ABD72664.1| putative casein kinase II beta subunit [Acyrthosiphon pisum]
 gi|239789307|dbj|BAH71284.1| ACYPI000089 [Acyrthosiphon pisum]
 gi|239789309|dbj|BAH71285.1| ACYPI000089 [Acyrthosiphon pisum]
          Length = 220

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 104/187 (55%), Positives = 140/187 (74%), Gaps = 3/187 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEEL---DDEM 72
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   ++    +   
Sbjct: 9   WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDDDLDDNPNH 68

Query: 73  REAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
            + +E++A  LYGLIHAR+I+T+RG+A+M+EKY+  DFG CPRV C N P+LP+GLSD P
Sbjct: 69  SDLIEQAAEMLYGLIHARYILTNRGIAQMIEKYQTGDFGHCPRVYCENSPMLPIGLSDVP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   PP+ + +++PR++
Sbjct: 129 GEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPPRPSNQFVPRLY 188

Query: 193 GFKIHDI 199
           GFKIH +
Sbjct: 189 GFKIHGL 195



>gi|225710276|gb|ACO10984.1| Casein kinase II subunit beta [Caligus rogercresseyi]
          Length = 221

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 139/185 (75%), Gaps = 3/185 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEEL---DDEM 72
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALDLI D   +E    +   
Sbjct: 9   WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDLILDLESDEDLDDNPNQ 68

Query: 73  REAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
            + +E++A  LYGLIHAR+I+T+RG+A+M+EKY+  DFG CPRV C NQP+LP+GLSD P
Sbjct: 69  SDLIEQAAEMLYGLIHARYILTNRGIAQMIEKYQSGDFGHCPRVYCENQPMLPIGLSDIP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D+YNPKS+RH   DG+Y+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 129 GEAMVKLYCPKCMDVYNPKSSRHHHTDGSYFGTGFPHMLFMVHPEYRPKRPASQFVPRLY 188

Query: 193 GFKIH 197
           GFKIH
Sbjct: 189 GFKIH 193



>gi|195396573|ref|XP_002056905.1| GJ16637 [Drosophila virilis]
 gi|194146672|gb|EDW62391.1| GJ16637 [Drosophila virilis]
          Length = 236

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 105/188 (55%), Positives = 141/188 (75%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDE--M 72
           W+ WF   +GNE+FCEVDE+YI D+FNLTGLN +V +Y QALD+I D   E+EL+D    
Sbjct: 9   WVTWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPNYRQALDMILDLEPEDELEDNPLQ 68

Query: 73  REAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
            +  E++A  LYGLIHAR+I+T+RG+A+M+EKY+  DFG CPRV C +QP+LP+GLSD P
Sbjct: 69  SDMTEQAAEMLYGLIHARYILTNRGIAQMIEKYQTGDFGHCPRVYCESQPMLPLGLSDIP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VK YCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 129 GEAMVKTYCPKCIDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPTNQFVPRLY 188

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 189 GFKIHSLA 196



>gi|386764249|ref|NP_001245630.1| casein kinase II beta subunit, isoform J [Drosophila melanogaster]
 gi|383293339|gb|AFH07344.1| casein kinase II beta subunit, isoform J [Drosophila melanogaster]
          Length = 233

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 105/188 (55%), Positives = 141/188 (75%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDE--M 72
           W+ WF   +GNE+FCEVDE+YI D+FNLTGLN +V +Y QALD+I D   E+EL+D    
Sbjct: 9   WVTWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPNYRQALDMILDLEPEDELEDNPLQ 68

Query: 73  REAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
            +  E++A  LYGLIHAR+I+T+RG+A+M+EKY+  DFG CPRV C +QP+LP+GLSD P
Sbjct: 69  SDMTEQAAEMLYGLIHARYILTNRGIAQMIEKYQTGDFGHCPRVYCESQPMLPLGLSDIP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VK YCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 129 GEAMVKTYCPKCIDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPTNQFVPRLY 188

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 189 GFKIHSLA 196



>gi|195457224|ref|XP_002075481.1| GK14838 [Drosophila willistoni]
 gi|194171566|gb|EDW86467.1| GK14838 [Drosophila willistoni]
          Length = 238

 Score =  238 bits (606), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 105/188 (55%), Positives = 141/188 (75%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDE--M 72
           W+ WF   +GNE+FCEVDE+YI D+FNLTGLN +V +Y QALD+I D   E+EL+D    
Sbjct: 9   WVTWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPNYRQALDMILDLEPEDELEDNPLQ 68

Query: 73  REAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
            +  E++A  LYGLIHAR+I+T+RG+A+M+EKY+  DFG CPRV C +QP+LP+GLSD P
Sbjct: 69  SDMTEQAAEMLYGLIHARYILTNRGIAQMIEKYQTGDFGHCPRVYCESQPMLPLGLSDIP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VK YCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 129 GEAMVKTYCPKCIDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPTNQFVPRLY 188

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 189 GFKIHSLA 196



>gi|386764247|ref|NP_001245629.1| casein kinase II beta subunit, isoform I [Drosophila melanogaster]
 gi|383293338|gb|AFH07343.1| casein kinase II beta subunit, isoform I [Drosophila melanogaster]
          Length = 233

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 105/188 (55%), Positives = 141/188 (75%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDE--M 72
           W+ WF   +GNE+FCEVDE+YI D+FNLTGLN +V +Y QALD+I D   E+EL+D    
Sbjct: 9   WVTWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPNYRQALDMILDLEPEDELEDNPLQ 68

Query: 73  REAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
            +  E++A  LYGLIHAR+I+T+RG+A+M+EKY+  DFG CPRV C +QP+LP+GLSD P
Sbjct: 69  SDMTEQAAEMLYGLIHARYILTNRGIAQMIEKYQTGDFGHCPRVYCESQPMLPLGLSDIP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VK YCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 129 GEAMVKTYCPKCIDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPTNQFVPRLY 188

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 189 GFKIHSLA 196



>gi|225717930|gb|ACO14811.1| Casein kinase II subunit beta [Caligus clemensi]
          Length = 222

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 139/185 (75%), Gaps = 3/185 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEEL---DDEM 72
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALDLI D   +E    +   
Sbjct: 9   WISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDLILDLESDEDLDDNPNQ 68

Query: 73  REAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
            + +E++A  LYGLIHAR+I+T+RG+A+M+EKY+  DFG CPRV C NQP+LP+GLSD P
Sbjct: 69  SDLIEQAAEMLYGLIHARYILTNRGIAQMIEKYQSGDFGHCPRVYCENQPMLPIGLSDIP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCP+C D+YNPKS+RH   DG+Y+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 129 GEAMVKLYCPKCMDVYNPKSSRHHHTDGSYFGTGFPHMLFMVHPEYRPKRPASQFVPRLY 188

Query: 193 GFKIH 197
           GFKIH
Sbjct: 189 GFKIH 193



>gi|195043323|ref|XP_001991596.1| GH12745 [Drosophila grimshawi]
 gi|193901354|gb|EDW00221.1| GH12745 [Drosophila grimshawi]
          Length = 236

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 105/188 (55%), Positives = 141/188 (75%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDE--M 72
           W+ WF   +GNE+FCEVDE+YI D+FNLTGLN +V +Y QALD+I D   E+EL+D    
Sbjct: 9   WVTWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPNYRQALDMILDLEPEDELEDNPLQ 68

Query: 73  REAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
            +  E++A  LYGLIHAR+I+T+RG+A+M+EKY+  DFG CPRV C +QP+LP+GLSD P
Sbjct: 69  SDMTEQAAEMLYGLIHARYILTNRGIAQMIEKYQTGDFGHCPRVYCESQPMLPLGLSDIP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VK YCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 129 GEAMVKTYCPKCIDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPTNQFVPRLY 188

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 189 GFKIHSLA 196



>gi|18158427|ref|NP_542940.1| casein kinase II beta subunit, isoform B [Drosophila melanogaster]
 gi|24641398|ref|NP_727561.1| casein kinase II beta subunit, isoform C [Drosophila melanogaster]
 gi|24641400|ref|NP_727562.1| casein kinase II beta subunit, isoform D [Drosophila melanogaster]
 gi|62473586|ref|NP_001014731.1| casein kinase II beta subunit, isoform F [Drosophila melanogaster]
 gi|221329852|ref|NP_511131.3| casein kinase II beta subunit, isoform G [Drosophila melanogaster]
 gi|386764245|ref|NP_001245628.1| casein kinase II beta subunit, isoform H [Drosophila melanogaster]
 gi|157125|gb|AAA28430.1| casein kinase II beta subunit [Drosophila melanogaster]
 gi|1289330|gb|AAC13880.1| CKII beta subunit [Drosophila melanogaster]
 gi|7292696|gb|AAF48093.1| casein kinase II beta subunit, isoform B [Drosophila melanogaster]
 gi|7292697|gb|AAF48094.1| casein kinase II beta subunit, isoform C [Drosophila melanogaster]
 gi|21064445|gb|AAM29452.1| RE31047p [Drosophila melanogaster]
 gi|22832108|gb|AAN09298.1| casein kinase II beta subunit, isoform D [Drosophila melanogaster]
 gi|61677888|gb|AAX52485.1| casein kinase II beta subunit, isoform F [Drosophila melanogaster]
 gi|220901741|gb|AAF48092.3| casein kinase II beta subunit, isoform G [Drosophila melanogaster]
 gi|220948376|gb|ACL86731.1| CkIIbeta-PB [synthetic construct]
 gi|220957510|gb|ACL91298.1| CkIIbeta-PB [synthetic construct]
 gi|281183403|gb|ADA53570.1| RE20707p [Drosophila melanogaster]
 gi|383293337|gb|AFH07342.1| casein kinase II beta subunit, isoform H [Drosophila melanogaster]
          Length = 215

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 105/188 (55%), Positives = 141/188 (75%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDE--M 72
           W+ WF   +GNE+FCEVDE+YI D+FNLTGLN +V +Y QALD+I D   E+EL+D    
Sbjct: 9   WVTWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPNYRQALDMILDLEPEDELEDNPLQ 68

Query: 73  REAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
            +  E++A  LYGLIHAR+I+T+RG+A+M+EKY+  DFG CPRV C +QP+LP+GLSD P
Sbjct: 69  SDMTEQAAEMLYGLIHARYILTNRGIAQMIEKYQTGDFGHCPRVYCESQPMLPLGLSDIP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VK YCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 129 GEAMVKTYCPKCIDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPTNQFVPRLY 188

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 189 GFKIHSLA 196



>gi|194762780|ref|XP_001963512.1| GF20435 [Drosophila ananassae]
 gi|190629171|gb|EDV44588.1| GF20435 [Drosophila ananassae]
          Length = 235

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 105/188 (55%), Positives = 141/188 (75%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDE--M 72
           W+ WF   +GNE+FCEVDE+YI D+FNLTGLN +V +Y QALD+I D   E+EL+D    
Sbjct: 9   WVTWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPNYRQALDMILDLEPEDELEDNPLQ 68

Query: 73  REAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
            +  E++A  LYGLIHAR+I+T+RG+A+M+EKY+  DFG CPRV C +QP+LP+GLSD P
Sbjct: 69  SDMTEQAAEMLYGLIHARYILTNRGIAQMIEKYQTGDFGHCPRVYCESQPMLPLGLSDIP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VK YCP+C D+Y PKS+RH   DGAY+G+ FPHMLF V+P   P +   +++PR++
Sbjct: 129 GEAMVKTYCPKCIDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPTNQFVPRLY 188

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 189 GFKIHSLA 196



>gi|356541308|ref|XP_003539120.1| PREDICTED: casein kinase II subunit beta-like [Glycine max]
          Length = 286

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 109/196 (55%), Positives = 139/196 (70%), Gaps = 4/196 (2%)

Query: 5   TSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-- 62
            SGSD D    WI WF   +GNE+FCEVD++YI D FNL GL+S+V +Y  ALDLI D  
Sbjct: 90  VSGSDGDDTS-WISWFCNLRGNEFFCEVDDDYIQDDFNLCGLSSQVPYYDYALDLILDVE 148

Query: 63  -SLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQ 121
            S  +   +E  E +E +A  LYGLIHAR+I+TS+G+A ML+KYK  DFGRCPRV C  Q
Sbjct: 149 SSHGDMFTEEQNELIESAAEMLYGLIHARYILTSKGMAAMLDKYKNYDFGRCPRVYCSGQ 208

Query: 122 PLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPP 181
           P +PVG SD P + +VK+YCPRCEDIY P+S    +IDGAY+G+TFPH+    Y  L P 
Sbjct: 209 PCIPVGQSDIPRSSTVKIYCPRCEDIYYPRSKYQGNIDGAYFGTTFPHLFLMTYGQLKPQ 268

Query: 182 KSNERYIPRIFGFKIH 197
           K ++ Y+PR+FGFK+H
Sbjct: 269 KPSQSYVPRVFGFKLH 284



>gi|383848595|ref|XP_003699934.1| PREDICTED: casein kinase II subunit beta-like [Megachile rotundata]
          Length = 227

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 105/188 (55%), Positives = 141/188 (75%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDD--EM 72
           WI WF   +GNE+FCEVDE+YI D+FNLTGLN +V HY QALD+I D   ++ELD     
Sbjct: 15  WISWFCNLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDDELDGHPNQ 74

Query: 73  REAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
            E +E++A  LYGLIHAR+I+T+RG+A+M+EKY+  DFG CPRV C +QP+LP+GLSD P
Sbjct: 75  SELIEQAAELLYGLIHARYILTNRGIAQMIEKYQAGDFGHCPRVYCESQPMLPLGLSDVP 134

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VK YCP+C D+Y PKS+R+   DGA++G+ FPHMLF V+P   P +   +++PR++
Sbjct: 135 GEAMVKSYCPKCMDVYTPKSSRYHHTDGAFFGTGFPHMLFMVHPEYRPKRPTNQFVPRLY 194

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 195 GFKIHPLA 202



>gi|462416991|gb|EMJ21728.1| hypothetical protein PRUPE_ppa009433mg [Prunus persica]
          Length = 292

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 110/195 (56%), Positives = 139/195 (71%), Gaps = 4/195 (2%)

Query: 6   SGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD--- 62
           SGSD D    WI WF   +GNE+FCEVD+EYI D FNL GL+S+V +Y  ALDLI D   
Sbjct: 97  SGSDGDDTS-WISWFCNLRGNEFFCEVDDEYIQDDFNLCGLSSQVPYYDYALDLILDVES 155

Query: 63  SLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQP 122
           S  +   +E  E VE +A  LYGLIH R+I+T++G++ MLEKYK  DFGRCPRV C  QP
Sbjct: 156 SHGDMFTEEQNELVESAAEMLYGLIHVRYILTTKGMSAMLEKYKNYDFGRCPRVYCCGQP 215

Query: 123 LLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPK 182
            LPVG SD P + +VK+YCP+CEDIY P+S    +IDGAY+G+TFPH+    Y HL P K
Sbjct: 216 CLPVGQSDIPRSSTVKIYCPKCEDIYYPRSKYQGNIDGAYFGTTFPHLFLMTYGHLKPQK 275

Query: 183 SNERYIPRIFGFKIH 197
           + + Y+PR+FGFK+H
Sbjct: 276 ATQSYVPRVFGFKLH 290



>gi|502160448|ref|XP_004511748.1| PREDICTED: casein kinase II subunit beta-like isoform X1 [Cicer
           arietinum]
          Length = 289

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 109/196 (55%), Positives = 139/196 (70%), Gaps = 4/196 (2%)

Query: 5   TSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-- 62
            SGSD D    WI WF   +GNE+FCEVD++YI D FNL GL+S+V +Y  ALDLI D  
Sbjct: 93  VSGSDGDDTS-WISWFCNLRGNEFFCEVDDDYIQDDFNLCGLSSQVPYYDYALDLILDVE 151

Query: 63  -SLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQ 121
            S  +   +E  E +E +A  LYG+IHAR+I+TS+G+A ML+KYK  DFGRCPRV C  Q
Sbjct: 152 SSHGDMFTEEQNELIESAAEMLYGMIHARYILTSKGMAAMLDKYKNYDFGRCPRVYCSGQ 211

Query: 122 PLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPP 181
           P LPVG SD P + +VK+YCPRCEDIY P+S    +IDGAY+G+TFPH+    Y  L P 
Sbjct: 212 PCLPVGQSDIPRSSTVKIYCPRCEDIYYPRSKYQGNIDGAYFGTTFPHLFLMTYGQLKPQ 271

Query: 182 KSNERYIPRIFGFKIH 197
           K ++ Y+PR+FGFK+H
Sbjct: 272 KPSQNYVPRVFGFKLH 287



>gi|356497080|ref|XP_003517392.1| PREDICTED: casein kinase II subunit beta'-like isoform 1 [Glycine
           max]
          Length = 285

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 109/196 (55%), Positives = 139/196 (70%), Gaps = 4/196 (2%)

Query: 5   TSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-- 62
            SGSD D    WI WF   +GNE+FCEVD++YI D FNL GL+S+V +Y  ALDLI D  
Sbjct: 89  VSGSDGDDTS-WISWFCNLRGNEFFCEVDDDYIQDDFNLCGLSSQVPYYDYALDLILDVE 147

Query: 63  -SLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQ 121
            S  +   +E  E +E +A  LYGLIHAR+I+TS+G+A ML+KYK  DFGRCPRV C  Q
Sbjct: 148 SSHGDMFTEEQNELIESAAEMLYGLIHARYILTSKGMAAMLDKYKNYDFGRCPRVYCSGQ 207

Query: 122 PLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPP 181
           P +PVG SD P + +VK+YCPRCEDIY P+S    +IDGAY+G+TFPH+    Y  L P 
Sbjct: 208 PCIPVGQSDIPRSSTVKIYCPRCEDIYYPRSKYQGNIDGAYFGTTFPHLFLMTYGQLKPQ 267

Query: 182 KSNERYIPRIFGFKIH 197
           K ++ Y+PR+FGFK+H
Sbjct: 268 KPSQSYVPRVFGFKLH 283



>gi|460388830|ref|XP_004240067.1| PREDICTED: putative casein kinase II subunit beta-4-like isoform 2
           [Solanum lycopersicum]
          Length = 285

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 111/193 (57%), Positives = 136/193 (70%), Gaps = 3/193 (1%)

Query: 5   TSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSL 64
            SGSD D    WI WF   +GNE+FCEVD++YI D FNL GL+S+V +Y  ALDLI D  
Sbjct: 94  VSGSDGDDTS-WISWFCNLRGNEFFCEVDDDYIQDDFNLCGLSSQVPYYDYALDLILDV- 151

Query: 65  EEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLL 124
            E   +E  E VE +A  LYGLIH R+I+TS+G+A MLEKYK  DFGRCPRV C  QP L
Sbjct: 152 -ESSHEEQNELVESAAEMLYGLIHVRYILTSKGIAAMLEKYKNYDFGRCPRVYCSGQPCL 210

Query: 125 PVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSN 184
           PVG SD P   +VK+YCP+CEDIY P+S    +IDGAY+G+TFPH+    Y HL P K  
Sbjct: 211 PVGQSDIPRASTVKIYCPKCEDIYYPRSKYQGNIDGAYFGTTFPHLFLMTYGHLKPQKPT 270

Query: 185 ERYIPRIFGFKIH 197
           + ++PR+FGFKIH
Sbjct: 271 QNFVPRVFGFKIH 283



>gi|341877475|gb|EGT33410.1| CBN-KIN-10 protein [Caenorhabditis brenneri]
          Length = 229

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 142/188 (75%), Gaps = 3/188 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-SLEEELDDEMRE 74
           WI WF   +GNE+FCEVDEEYI DRFNLTGLN +V  Y QALD+I D   E++L+D    
Sbjct: 9   WITWFCGLRGNEFFCEVDEEYIQDRFNLTGLNEQVPKYRQALDMILDLEPEDDLEDNATN 68

Query: 75  A--VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQP 132
              VE++A  LYGLIHAR+I+T+RG+++M+EK++  DFG CPRV C NQP+LP+GLSD P
Sbjct: 69  TDLVEQAAEMLYGLIHARYILTNRGISQMVEKWRDHDFGVCPRVYCENQPMLPIGLSDVP 128

Query: 133 YTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIF 192
               VKLYCPRC D++ P+S+RH   DG+Y+G+ FPHMLF V+P L P +   +++P+++
Sbjct: 129 GEAMVKLYCPRCNDVFVPRSSRHQHTDGSYFGTGFPHMLFFVHPDLRPRRPVTQFVPKLY 188

Query: 193 GFKIHDIA 200
           GFKIH +A
Sbjct: 189 GFKIHPVA 196



>gi|17508231|ref|NP_492255.1| Protein KIN-10, isoform a [Caenorhabditis elegans]
 gi|205829170|sp|P28548.2|CSK2B_CAEEL RecName: Full=Casein kinase II subunit beta; Short=CK II beta
 gi|3879276|emb|CAB00056.1| Protein KIN-10, isoform a [Caenorhabditis elegans]
          Length = 234

 Score =  237 bits (604), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 104/187 (55%), Positives = 141/187 (75%), Gaps = 2/187 (1%)

Query: 16  WIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITDSLEEELDDEMREA 75
           WI WF   +GNE+FCEVDEEYI DRFNLTGLN +V  Y QALD+I D   ++++D     
Sbjct: 9   WITWFCGLRGNEFFCEVDEEYIQDRFNLTGLNEQVPKYRQALDMILDLEPDDIEDNATNT 68

Query: 76  --VEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQPLLPVGLSDQPY 133
             VE++A  LYGLIHAR+I+T+RG+++M+EK++  DFG CPRV C NQP+LP+GLSD P 
Sbjct: 69  DLVEQAAEMLYGLIHARYILTNRGISQMVEKWRDHDFGVCPRVYCENQPMLPIGLSDVPG 128

Query: 134 TKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPPKSNERYIPRIFG 193
              VKLYCPRC D++ P+S+RH   DG+Y+G+ FPHMLF V+P L P +   +++P+++G
Sbjct: 129 EAMVKLYCPRCNDVFVPRSSRHQHTDGSYFGTGFPHMLFFVHPDLRPRRPVTQFVPKLYG 188

Query: 194 FKIHDIA 200
           FKIH +A
Sbjct: 189 FKIHPVA 195



>gi|224063639|ref|XP_002301241.1| predicted protein [Populus trichocarpa]
 gi|222842967|gb|EEE80514.1| predicted protein [Populus trichocarpa]
          Length = 301

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 138/196 (70%), Gaps = 4/196 (2%)

Query: 5   TSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-- 62
            SGSD D    WI WF   +GNE+FCEVD+EYI D FNL GL+S+V +Y  ALDLI D  
Sbjct: 105 VSGSDGDDTS-WISWFCNLRGNEFFCEVDDEYIQDDFNLCGLSSQVPYYDYALDLILDVE 163

Query: 63  -SLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQ 121
            S  +   +E  E VE +A  LYGLIH R+I+TS+G++ MLEKYK  DFGRCPRV C  Q
Sbjct: 164 SSHGDMFTEEQNELVESAAEMLYGLIHVRYILTSKGMSAMLEKYKNYDFGRCPRVYCCGQ 223

Query: 122 PLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPP 181
           P  PVG SD P + +VK+YCP+CEDIY P+S    +IDGAY+G+TFPH+    Y HL P 
Sbjct: 224 PCFPVGQSDIPRSSTVKIYCPKCEDIYYPRSKYQGNIDGAYFGTTFPHLFLMTYGHLKPQ 283

Query: 182 KSNERYIPRIFGFKIH 197
           K+ + Y+PR+FGFK+H
Sbjct: 284 KATQSYVPRVFGFKLH 299



>gi|224137102|ref|XP_002327022.1| predicted protein [Populus trichocarpa]
 gi|222835337|gb|EEE73772.1| predicted protein [Populus trichocarpa]
          Length = 300

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 111/196 (56%), Positives = 139/196 (70%), Gaps = 4/196 (2%)

Query: 5   TSGSDSDYAKYWIDWFLTTKGNEYFCEVDEEYILDRFNLTGLNSEVQHYVQALDLITD-- 62
            SGSD D    WI WF   +GNE+FCEVD+EYI D FNL GL+S+V +Y  ALDLI D  
Sbjct: 104 VSGSDGDDTS-WISWFCNLRGNEFFCEVDDEYIQDDFNLCGLSSQVPYYDYALDLILDVE 162

Query: 63  -SLEEELDDEMREAVEKSARHLYGLIHARFIITSRGLAKMLEKYKKADFGRCPRVLCHNQ 121
            S  +   +E  E VE +A  LYGLIH R+I+TS+G++ MLEKYK  DFGRCPRV C  Q
Sbjct: 163 SSHGDMFTEEQNELVESAAEMLYGLIHVRYILTSKGMSAMLEKYKNYDFGRCPRVYCCGQ 222

Query: 122 PLLPVGLSDQPYTKSVKLYCPRCEDIYNPKSTRHASIDGAYYGSTFPHMLFQVYPHLLPP 181
           P LPVG SD P + +VK+YCP+CEDIY P+S    +IDGAY+G+TFPH+    Y HL P 
Sbjct: 223 PCLPVGQSDIPRSSTVKIYCPKCEDIYYPRSKYQGNIDGAYFGTTFPHLFLMTYGHLKPQ 282

Query: 182 KSNERYIPRIFGFKIH 197
           K+ + Y+PR+FGFK+H
Sbjct: 283 KAIQSYVPRVFGFKLH 298