BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10154_c0_seq1-m.59 complete 68-1111(-) 348 (-)
         (347 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|384499628|gb|EIE90119.1| hypothetical protein RO3G_14830 [Rhi...   309   6e-82   Rhizopus delemar RA 99-880
gi|511009601|gb|EPB90839.1| hypothetical protein HMPREF1544_0225...   305   1e-80   Mucor circinelloides f. circinelloides 1006PhL
gi|258575287|ref|XP_002541825.1| conserved hypothetical protein ...   280   3e-73   Uncinocarpus reesii 1704
gi|511003113|gb|EPB84526.1| hypothetical protein HMPREF1544_0869...   277   4e-72   Mucor circinelloides f. circinelloides 1006PhL
gi|358373902|dbj|GAA90497.1| mitochondrial deoxynucleotide carri...   274   2e-71   Aspergillus kawachii IFO 4308
gi|303311549|ref|XP_003065786.1| Mitochondrial carrier protein [...   274   3e-71   Coccidioides posadasii C735 delta SOWgp
gi|119194097|ref|XP_001247652.1| hypothetical protein CIMG_01423...   273   6e-71   Coccidioides immitis RS
gi|358400685|gb|EHK50011.1| hypothetical protein TRIATDRAFT_2893...   271   2e-70   Trichoderma atroviride IMI 206040
gi|240273463|gb|EER36983.1| mitochondrial deoxynucleotide carrie...   271   3e-70   Histoplasma capsulatum H143
gi|225554425|gb|EEH02723.1| mitochondrial deoxynucleotide carrie...   269   8e-70   Histoplasma capsulatum G186AR
gi|119481865|ref|XP_001260961.1| mitochondrial deoxynucleotide c...   269   1e-69   Aspergillus fischeri NRRL 181
gi|154271308|ref|XP_001536507.1| conserved hypothetical protein ...   269   1e-69   Histoplasma capsulatum NAm1
gi|146323026|ref|XP_755831.2| mitochondrial deoxynucleotide carr...   268   2e-69   Aspergillus fumigatus Af293
gi|322708672|gb|EFZ00249.1| Mitochondrial thiamine pyrophosphate...   268   2e-69   
gi|182705188|sp|Q4X022.3|TPC1_ASPFU RecName: Full=Mitochondrial ...   268   2e-69   Aspergillus fumigatus Af293
gi|296805666|ref|XP_002843657.1| mitochondrial deoxynucleotide c...   266   4e-69   Arthroderma otae CBS 113480
gi|425767863|gb|EKV06416.1| Mitochondrial deoxynucleotide carrie...   266   5e-69   Penicillium digitatum PHI26
gi|384490150|gb|EIE81372.1| hypothetical protein RO3G_06077 [Rhi...   265   1e-68   Rhizopus delemar RA 99-880
gi|145250689|ref|XP_001396858.1| thiamine pyrophosphate carrier ...   265   1e-68   Aspergillus niger CBS 513.88
gi|452987927|gb|EME87682.1| hypothetical protein MYCFIDRAFT_7552...   265   1e-68   Cercospora fijiensis CIRAD86
gi|407918626|gb|EKG11895.1| Mitochondrial carrier protein [Macro...   265   2e-68   Macrophomina phaseolina MS6
gi|115401756|ref|XP_001216466.1| conserved hypothetical protein ...   265   2e-68   Aspergillus terreus NIH2624
gi|389641881|ref|XP_003718573.1| mitochondrial thiamine pyrophos...   264   3e-68   Magnaporthe oryzae 70-15
gi|470318824|gb|EMR10465.1| hypothetical protein PNEG_01179 [Pne...   264   4e-68   Pneumocystis murina B123
gi|156050337|ref|XP_001591130.1| hypothetical protein SS1G_07755...   263   4e-68   Sclerotinia sclerotiorum 1980 UF-70
gi|367019834|ref|XP_003659202.1| hypothetical protein MYCTH_2295...   263   5e-68   Myceliophthora thermophila ATCC 42464
gi|255930711|ref|XP_002556912.1| Pc12g00060 [Penicillium chrysog...   263   5e-68   Penicillium rubens Wisconsin 54-1255
gi|327305555|ref|XP_003237469.1| mitochondrial thiamine pyrophos...   263   7e-68   Trichophyton rubrum CBS 118892
gi|315046672|ref|XP_003172711.1| mitochondrial deoxynucleotide c...   262   1e-67   Microsporum gypseum CBS 118893
gi|242761373|ref|XP_002340167.1| mitochondrial deoxynucleotide c...   261   1e-67   Talaromyces stipitatus ATCC 10500
gi|212539133|ref|XP_002149722.1| mitochondrial deoxynucleotide c...   261   2e-67   Talaromyces marneffei ATCC 18224
gi|512198324|gb|EPE27159.1| Mitochondrial carrier [Glarea lozoye...   261   2e-67   Glarea lozoyensis ATCC 20868
gi|225683197|gb|EEH21481.1| mitochondrial deoxynucleotide carrie...   261   2e-67   Paracoccidioides brasiliensis Pb03
gi|322696924|gb|EFY88710.1| Mitochondrial thiamine pyrophosphate...   261   3e-67   Metarhizium acridum CQMa 102
gi|345566336|gb|EGX49279.1| hypothetical protein AOL_s00078g312 ...   260   3e-67   Arthrobotrys oligospora ATCC 24927
gi|154295049|ref|XP_001547962.1| hypothetical protein BC1G_13653...   260   5e-67   Botrytis cinerea B05.10
gi|239608403|gb|EEQ85390.1| mitochondrial thiamine pyrophosphate...   259   6e-67   Blastomyces dermatitidis ER-3
gi|261203123|ref|XP_002628775.1| mitochondrial thiamine pyrophos...   259   6e-67   Blastomyces gilchristii SLH14081
gi|350296127|gb|EGZ77104.1| mitochondrial thiamine pyrophosphate...   259   7e-67   Neurospora tetrasperma FGSC 2509
gi|226288326|gb|EEH43838.1| mitochondrial deoxynucleotide carrie...   259   7e-67   
gi|295672187|ref|XP_002796640.1| mitochondrial deoxynucleotide c...   259   8e-67   Paracoccidioides lutzii Pb01
gi|85091387|ref|XP_958877.1| hypothetical protein NCU07384 [Neur...   259   1e-66   Neurospora crassa OR74A
gi|169763072|ref|XP_001727436.1| thiamine pyrophosphate carrier ...   258   1e-66   Aspergillus oryzae RIB40
gi|340521293|gb|EGR51528.1| predicted protein [Trichoderma reese...   258   2e-66   Trichoderma reesei QM6a
gi|336464044|gb|EGO52284.1| hypothetical protein NEUTE1DRAFT_132...   257   3e-66   Neurospora tetrasperma FGSC 2508
gi|121716068|ref|XP_001275643.1| mitochondrial deoxynucleotide c...   257   3e-66   Aspergillus clavatus NRRL 1
gi|67901164|ref|XP_680838.1| hypothetical protein AN7569.2 [Aspe...   254   2e-65   Aspergillus nidulans FGSC A4
gi|429854577|gb|ELA29581.1| mitochondrial deoxynucleotide carrie...   253   8e-65   Colletotrichum gloeosporioides Nara gc5
gi|171687561|ref|XP_001908721.1| hypothetical protein [Podospora...   251   3e-64   Podospora anserina S mat+
gi|501756255|emb|CCG85136.1| Mitochondrial thiamine pyrophosphat...   251   3e-64   Taphrina deformans PYCC 5710
gi|326476071|gb|EGE00081.1| mitochondrial thiamine pyrophosphate...   250   4e-64   Trichophyton tonsurans CBS 112818
gi|494824799|gb|EON62053.1| mitochondrial thiamine pyrophosphate...   249   8e-64   Coniosporium apollinis CBS 100218
gi|358379859|gb|EHK17538.1| hypothetical protein TRIVIDRAFT_2141...   248   1e-63   Trichoderma virens Gv29-8
gi|302922605|ref|XP_003053501.1| predicted protein [Nectria haem...   248   1e-63   Nectria haematococca mpVI 77-13-4
gi|408387832|gb|EKJ67537.1| hypothetical protein FPSE_12282 [Fus...   248   2e-63   Fusarium pseudograminearum CS3096
gi|326484040|gb|EGE08050.1| mitochondrial deoxynucleotide carrie...   248   2e-63   Trichophyton equinum CBS 127.97
gi|402217544|gb|EJT97624.1| mitochondrial carrier [Dacryopinax s...   247   4e-63   Dacryopinax primogenitus
gi|440473758|gb|ELQ42536.1| mitochondrial deoxynucleotide carrie...   246   8e-63   Magnaporthe oryzae Y34
gi|46108312|ref|XP_381214.1| hypothetical protein FG01038.1 [Fus...   246   1e-62   
gi|430812153|emb|CCJ30426.1| unnamed protein product [Pneumocyst...   244   2e-62   Pneumocystis jirovecii
gi|378733175|gb|EHY59634.1| mitochondrial thiamine pyrophosphate...   244   2e-62   Exophiala dermatitidis NIH/UT8656
gi|336274066|ref|XP_003351787.1| hypothetical protein SMAC_00332...   244   3e-62   Sordaria macrospora k-hell
gi|342887899|gb|EGU87327.1| hypothetical protein FOXB_02203 [Fus...   244   4e-62   Fusarium oxysporum Fo5176
gi|310790775|gb|EFQ26308.1| hypothetical protein GLRG_01452 [Glo...   244   4e-62   Colletotrichum graminicola M1.001
gi|340923797|gb|EGS18700.1| putative thiamine pyrophosphate prot...   243   5e-62   Chaetomium thermophilum var. thermophilum DSM 1495
gi|449297377|gb|EMC93395.1| hypothetical protein BAUCODRAFT_1252...   243   6e-62   Baudoinia panamericana UAMH 10762
gi|477535973|gb|ENH87470.1| mitochondrial deoxynucleotide carrie...   243   7e-62   Colletotrichum orbiculare MAFF 240422
gi|453088134|gb|EMF16175.1| mitochondrial deoxynucleotide carrie...   241   2e-61   Sphaerulina musiva SO2202
gi|471559942|gb|EMR62197.1| putative mitochondrial deoxynucleoti...   240   4e-61   Eutypa lata UCREL1
gi|451853642|gb|EMD66935.1| hypothetical protein COCSADRAFT_3385...   239   8e-61   Bipolaris sorokiniana ND90Pr
gi|396471117|ref|XP_003838794.1| similar to mitochondrial thiami...   239   9e-61   Leptosphaeria maculans JN3
gi|296412099|ref|XP_002835765.1| hypothetical protein [Tuber mel...   239   9e-61   Tuber melanosporum Mel28
gi|402086530|gb|EJT81428.1| hypothetical protein GGTG_01408 [Gae...   238   1e-60   Gaeumannomyces graminis var. tritici R3-111a-1
gi|452002017|gb|EMD94476.1| hypothetical protein COCHEDRAFT_1153...   238   2e-60   Bipolaris maydis C5
gi|330934819|ref|XP_003304722.1| hypothetical protein PTT_17371 ...   237   3e-60   Pyrenophora teres f. teres 0-1
gi|452848385|gb|EME50317.1| hypothetical protein DOTSEDRAFT_1654...   237   4e-60   Dothistroma septosporum NZE10
gi|189203267|ref|XP_001937969.1| mitochondrial deoxynucleotide c...   237   4e-60   Pyrenophora tritici-repentis Pt-1C-BFP
gi|367044038|ref|XP_003652399.1| hypothetical protein THITE_2087...   236   6e-60   Thielavia terrestris NRRL 8126
gi|482812184|gb|EOA88916.1| hypothetical protein SETTUDRAFT_1681...   236   7e-60   Setosphaeria turcica Et28A
gi|485919250|gb|EOD45634.1| putative mitochondrial deoxynucleoti...   235   2e-59   Neofusicoccum parvum UCRNP2
gi|169603169|ref|XP_001795006.1| hypothetical protein SNOG_04593...   234   2e-59   Parastagonospora nodorum SN15
gi|121920754|sp|Q0UUH1.3|TPC1_PHANO RecName: Full=Mitochondrial ...   233   5e-59   Parastagonospora nodorum SN15
gi|346979278|gb|EGY22730.1| mitochondrial deoxynucleotide carrie...   232   1e-58   Verticillium dahliae VdLs.17
gi|470289124|ref|XP_004342772.1| mitochondrial thiamine pyrophos...   232   1e-58   Capsaspora owczarzaki ATCC 30864
gi|389740924|gb|EIM82114.1| mitochondrial carrier [Stereum hirsu...   231   2e-58   Stereum hirsutum FP-91666 SS1
gi|380482016|emb|CCF41502.1| mitochondrial thiamine pyrophosphat...   230   6e-58   Colletotrichum higginsianum
gi|406863764|gb|EKD16811.1| hypothetical protein MBM_05280 [Mars...   229   6e-58   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|398412006|ref|XP_003857335.1| hypothetical protein MYCGRDRAFT...   228   1e-57   Zymoseptoria tritici IPO323
gi|346322162|gb|EGX91761.1| Mitochondrial substrate carrier [Cor...   228   2e-57   Cordyceps militaris CM01
gi|512191328|gb|EPE07089.1| mitochondrial deoxynucleotide carrie...   228   2e-57   Ophiostoma piceae UAMH 11346
gi|400603144|gb|EJP70742.1| Mitochondrial carrier protein [Beauv...   227   3e-57   Beauveria bassiana ARSEF 2860
gi|301107378|ref|XP_002902771.1| Mitochondrial Carrier (MC) Fami...   225   1e-56   Phytophthora infestans T30-4
gi|238488929|ref|XP_002375702.1| mitochondrial deoxynucleotide c...   225   1e-56   Aspergillus flavus NRRL3357
gi|500256431|gb|EON99687.1| putative mitochondrial deoxynucleoti...   225   1e-56   Phaeoacremonium minimum UCRPA7
gi|348671157|gb|EGZ10978.1| hypothetical protein PHYSODRAFT_3046...   221   2e-55   Phytophthora sojae
gi|449450672|ref|XP_004143086.1| PREDICTED: mitochondrial thiami...   221   2e-55   Cucumis sativus [cucumbers]
gi|212723136|ref|NP_001132898.1| uncharacterized protein LOC1001...   221   2e-55   Zea mays [maize]
gi|413951382|gb|AFW84031.1| hypothetical protein ZEAMMB73_394006...   221   3e-55   Zea mays [maize]
gi|50556494|ref|XP_505655.1| YALI0F20262p [Yarrowia lipolytica] ...   221   3e-55   Yarrowia lipolytica CLIB122
gi|168027181|ref|XP_001766109.1| predicted protein [Physcomitrel...   220   5e-55   Physcomitrella patens
gi|399166827|emb|CCE32348.1| related to TPC1-mitochondrial trans...   219   1e-54   Claviceps purpurea 20.1
gi|302821417|ref|XP_002992371.1| hypothetical protein SELMODRAFT...   218   3e-54   Selaginella moellendorffii
gi|302768663|ref|XP_002967751.1| hypothetical protein SELMODRAFT...   217   3e-54   Selaginella moellendorffii
gi|115442059|ref|NP_001045309.1| Os01g0934200 [Oryza sativa Japo...   217   3e-54   
gi|326524836|dbj|BAK04354.1| predicted protein [Hordeum vulgare ...   216   6e-54   Hordeum vulgare subsp. vulgare [barley]
gi|356556120|ref|XP_003546375.1| PREDICTED: mitochondrial thiami...   216   9e-54   Glycine max [soybeans]
gi|462419515|gb|EMJ23778.1| hypothetical protein PRUPE_ppa008444...   216   1e-53   Prunus persica
gi|414878825|tpg|DAA55956.1| TPA: hypothetical protein ZEAMMB73_...   215   1e-53   Zea mays [maize]
gi|502085304|ref|XP_004487886.1| PREDICTED: mitochondrial thiami...   215   1e-53   Cicer arietinum [garbanzo]
gi|224123216|ref|XP_002330367.1| predicted protein [Populus tric...   215   1e-53   
gi|502151096|ref|XP_004508276.1| PREDICTED: mitochondrial thiami...   215   2e-53   Cicer arietinum [garbanzo]
gi|62859815|ref|NP_001015953.1| solute carrier family 25 (mitoch...   214   2e-53   Xenopus tropicalis [western clawed frog]
gi|116788977|gb|ABK25070.1| unknown [Picea sitchensis]                214   2e-53   Picea sitchensis
gi|357126690|ref|XP_003565020.1| PREDICTED: mitochondrial thiami...   214   3e-53   Brachypodium distachyon [annual false brome]
gi|504166517|ref|XP_004593115.1| PREDICTED: mitochondrial thiami...   214   3e-53   Ochotona princeps [southern American pika]
gi|327265025|ref|XP_003217309.1| PREDICTED: mitochondrial thiami...   214   4e-53   
gi|508714588|gb|EOY06485.1| Mitochondrial substrate carrier fami...   213   5e-53   Theobroma cacao [chocolate]
gi|320592384|gb|EFX04823.1| mitochondrial dicarboxylate carrier ...   213   5e-53   Grosmannia clavigera kw1407
gi|334322913|ref|XP_001377722.2| PREDICTED: mitochondrial thiami...   213   5e-53   
gi|475664328|gb|EMT62123.1| Mitochondrial thiamine pyrophosphate...   213   9e-53   Fusarium oxysporum f. sp. cubense race 4
gi|414878826|tpg|DAA55957.1| TPA: hypothetical protein ZEAMMB73_...   213   9e-53   Zea mays [maize]
gi|356529708|ref|XP_003533430.1| PREDICTED: mitochondrial thiami...   212   1e-52   Glycine max [soybeans]
gi|470121545|ref|XP_004296825.1| PREDICTED: mitochondrial thiami...   212   1e-52   Fragaria vesca subsp. vesca
gi|363814342|ref|NP_001242812.1| uncharacterized protein LOC1008...   211   2e-52   Glycine max [soybeans]
gi|339259078|ref|XP_003369725.1| conserved hypothetical protein ...   211   2e-52   Trichinella spiralis
gi|354466489|ref|XP_003495706.1| PREDICTED: mitochondrial thiami...   211   2e-52   Cricetulus griseus [Chinese hamsters]
gi|465950371|gb|EMP23805.1| Mitochondrial thiamine pyrophosphate...   211   3e-52   Chelonia mydas [green seaturtle]
gi|395826864|ref|XP_003786634.1| PREDICTED: mitochondrial thiami...   211   3e-52   Otolemur garnettii
gi|224107339|ref|XP_002314452.1| predicted protein [Populus tric...   211   3e-52   
gi|460366721|ref|XP_004229228.1| PREDICTED: mitochondrial thiami...   210   4e-52   Solanum lycopersicum
gi|291413456|ref|XP_002722987.1| PREDICTED: mitochondrial thiami...   210   6e-52   Oryctolagus cuniculus [European rabbit]
gi|66773796|sp|Q5IS35.1|TPC_MACFA RecName: Full=Mitochondrial th...   210   6e-52   Macaca fascicularis [crab eating macaque]
gi|482549474|gb|EOA13668.1| hypothetical protein CARUB_v10026741...   210   6e-52   Capsella rubella
gi|449019328|dbj|BAM82730.1| probable mitochondrial carrier prot...   209   7e-52   Cyanidioschyzon merolae strain 10D
gi|356521873|ref|XP_003529575.1| PREDICTED: mitochondrial thiami...   209   8e-52   Glycine max [soybeans]
gi|296203170|ref|XP_002748776.1| PREDICTED: mitochondrial thiami...   209   8e-52   Callithrix jacchus [common marmoset]
gi|483522006|gb|EOB06890.1| Mitochondrial deoxynucleotide carrie...   209   1e-51   Anas platyrhynchos [duck]
gi|15239754|ref|NP_199708.1| mitochondrial substrate carrier fam...   209   1e-51   Arabidopsis thaliana [mouse-ear cress]
gi|225432282|ref|XP_002272682.1| PREDICTED: mitochondrial thiami...   208   2e-51   Vitis vinifera
gi|348550447|ref|XP_003461043.1| PREDICTED: mitochondrial thiami...   208   2e-51   Cavia porcellus [guinea pig]
gi|328770648|gb|EGF80689.1| hypothetical protein BATDEDRAFT_2450...   208   2e-51   Batrachochytrium dendrobatidis JAM81
gi|431908779|gb|ELK12371.1| Mitochondrial thiamine pyrophosphate...   208   2e-51   Pteropus alecto
gi|403280562|ref|XP_003931785.1| PREDICTED: mitochondrial thiami...   207   3e-51   
gi|18402984|ref|NP_566683.1| mitochondrial thiamin diphosphate c...   207   3e-51   Arabidopsis thaliana [mouse-ear cress]
gi|156346263|ref|XP_001621491.1| hypothetical protein NEMVEDRAFT...   207   3e-51   Nematostella vectensis
gi|297795621|ref|XP_002865695.1| mitochondrial substrate carrier...   207   3e-51   Arabidopsis lyrata subsp. lyrata
gi|9294686|dbj|BAB03052.1| mitochondrial carrier protein-like [A...   207   3e-51   Arabidopsis thaliana [mouse-ear cress]
gi|507543491|ref|XP_004655735.1| PREDICTED: mitochondrial thiami...   207   5e-51   
gi|57099337|ref|XP_540430.1| PREDICTED: mitochondrial thiamine p...   207   5e-51   
gi|449479356|ref|XP_002190516.2| PREDICTED: mitochondrial thiami...   206   8e-51   Taeniopygia guttata
gi|255964670|gb|ACU44652.1| solute carrier family 25 member 19 [...   206   9e-51   Sus scrofa [pigs]
gi|260792436|ref|XP_002591221.1| hypothetical protein BRAFLDRAFT...   206   9e-51   Branchiostoma floridae
gi|312373981|gb|EFR21641.1| hypothetical protein AND_16672 [Anop...   206   9e-51   
gi|410981684|ref|XP_003997196.1| PREDICTED: mitochondrial thiami...   206   1e-50   Felis catus [cat]
gi|395533041|ref|XP_003768572.1| PREDICTED: mitochondrial thiami...   205   1e-50   Sarcophilus harrisii
gi|114052681|ref|NP_001039352.1| mitochondrial thiamine pyrophos...   205   2e-50   Bos taurus [bovine]
gi|478517147|ref|XP_004432808.1| PREDICTED: mitochondrial thiami...   205   2e-50   
gi|511849296|ref|XP_004749004.1| PREDICTED: mitochondrial thiami...   205   2e-50   Mustela putorius furo [black ferret]
gi|170037007|ref|XP_001846352.1| mitochondrial deoxynucleotide c...   204   2e-50   Culex quinquefasciatus
gi|440895189|gb|ELR47450.1| Mitochondrial thiamine pyrophosphate...   204   2e-50   Bos mutus
gi|21313024|ref|NP_080347.1| mitochondrial thiamine pyrophosphat...   204   2e-50   Mus musculus [mouse]
gi|256838113|ref|NP_001157986.1| mitochondrial thiamine pyrophos...   204   2e-50   Sus scrofa [pigs]
gi|301768969|ref|XP_002919889.1| PREDICTED: mitochondrial thiami...   204   2e-50   
gi|390360830|ref|XP_784294.3| PREDICTED: mitochondrial thiamine ...   204   3e-50   Strongylocentrotus purpuratus [purple urchin]
gi|218783548|ref|NP_001136362.1| mitochondrial thiamine pyrophos...   204   3e-50   Ovis aries [domestic sheep]
gi|472349397|ref|XP_004394399.1| PREDICTED: mitochondrial thiami...   204   3e-50   Odobenus rosmarus divergens
gi|466036884|ref|XP_004275520.1| PREDICTED: mitochondrial thiami...   204   3e-50   
gi|470605014|ref|XP_004313688.1| PREDICTED: mitochondrial thiami...   204   3e-50   Tursiops truncatus [Atlantic bottle-nosed dolphin]
gi|513214514|ref|XP_004946425.1| PREDICTED: mitochondrial thiami...   204   4e-50   
gi|512890925|ref|XP_004896960.1| PREDICTED: mitochondrial thiami...   204   4e-50   
gi|255551717|ref|XP_002516904.1| Mitochondrial deoxynucleotide c...   204   4e-50   Ricinus communis
gi|507979399|ref|XP_004693552.1| PREDICTED: mitochondrial thiami...   204   4e-50   Condylura cristata
gi|170063406|ref|XP_001867091.1| conserved hypothetical protein ...   203   5e-50   Culex quinquefasciatus
gi|410902324|ref|XP_003964644.1| PREDICTED: mitochondrial thiami...   203   5e-50   Takifugu rubripes [tiger puffer]
gi|350539009|ref|NP_001233547.1| mitochondrial thiamine pyrophos...   203   5e-50   Pan troglodytes
gi|513214885|ref|XP_004946427.1| PREDICTED: mitochondrial thiami...   203   6e-50   Gallus gallus [bantam]
gi|56090443|ref|NP_001007675.1| mitochondrial thiamine pyrophosp...   203   7e-50   Rattus norvegicus [brown rat]
gi|507640412|ref|XP_004630156.1| PREDICTED: mitochondrial thiami...   202   1e-49   Octodon degus
gi|28386208|gb|AAH46767.1| Solute carrier family 25 (mitochondri...   202   1e-49   Mus musculus [mouse]
gi|426346754|ref|XP_004041036.1| PREDICTED: mitochondrial thiami...   202   1e-49   Gorilla gorilla gorilla [lowland gorilla]
gi|118784876|ref|XP_313991.3| AGAP005113-PA [Anopheles gambiae s...   202   1e-49   Anopheles gambiae str. PEST
gi|488544752|ref|XP_004463920.1| PREDICTED: mitochondrial thiami...   202   2e-49   
gi|186928856|ref|NP_068380.3| mitochondrial thiamine pyrophospha...   202   2e-49   Homo sapiens [man]
gi|149723307|ref|XP_001495959.1| PREDICTED: mitochondrial thiami...   201   2e-49   Equus caballus [domestic horse]
gi|505844569|ref|XP_004615775.1| PREDICTED: mitochondrial thiami...   201   2e-49   Sorex araneus [Eurasian shrew]
gi|471367363|ref|XP_004374211.1| PREDICTED: mitochondrial thiami...   201   2e-49   Trichechus manatus latirostris
gi|405962037|gb|EKC27751.1| Mitochondrial thiamine pyrophosphate...   201   2e-49   Crassostrea gigas
gi|22761199|dbj|BAC11492.1| unnamed protein product [Homo sapiens]    201   3e-49   Homo sapiens [man]
gi|62205304|gb|AAH93123.1| Zgc:111878 [Danio rerio] >gi|18289034...   201   4e-49   Danio rerio [leopard danio]
gi|307111556|gb|EFN59790.1| hypothetical protein CHLNCDRAFT_1872...   199   8e-49   Chlorella variabilis
gi|197098834|ref|NP_001127123.1| mitochondrial thiamine pyrophos...   199   9e-49   Pongo abelii [Orang-utan]
gi|507672988|ref|XP_004709204.1| PREDICTED: mitochondrial thiami...   199   1e-48   Echinops telfairi [lesser hedgehog tenrec]
gi|332260055|ref|XP_003279101.1| PREDICTED: mitochondrial thiami...   199   1e-48   
gi|241594085|ref|XP_002404245.1| oxodicarboxylate carrier protei...   199   1e-48   Ixodes scapularis [blacklegged tick]
gi|340367818|ref|XP_003382450.1| PREDICTED: mitochondrial thiami...   198   2e-48   
gi|307170658|gb|EFN62832.1| Mitochondrial deoxynucleotide carrie...   198   2e-48   Camponotus floridanus
gi|391327497|ref|XP_003738235.1| PREDICTED: mitochondrial thiami...   198   2e-48   Metaseiulus occidentalis
gi|166796534|gb|AAI59029.1| LOC548707 protein [Xenopus (Silurana...   198   2e-48   Xenopus tropicalis [western clawed frog]
gi|345312618|ref|XP_003429273.1| PREDICTED: LOW QUALITY PROTEIN:...   197   3e-48   
gi|45387845|ref|NP_991278.1| mitochondrial thiamine pyrophosphat...   197   3e-48   Danio rerio [leopard danio]
gi|348530824|ref|XP_003452910.1| PREDICTED: mitochondrial thiami...   197   4e-48   Oreochromis niloticus
gi|507113650|emb|CDF37268.1| unnamed protein product [Chondrus c...   197   4e-48   Chondrus crispus [Irish moss]
gi|332018547|gb|EGI59136.1| Mitochondrial thiamine pyrophosphate...   197   4e-48   Acromyrmex echinatior
gi|344291174|ref|XP_003417311.1| PREDICTED: mitochondrial thiami...   196   6e-48   Loxodonta africana [African bush elephant]
gi|499015295|ref|XP_004558462.1| PREDICTED: mitochondrial thiami...   196   8e-48   Maylandia zebra
gi|47214999|emb|CAG03139.1| unnamed protein product [Tetraodon n...   195   1e-47   Tetraodon nigroviridis
gi|242012221|ref|XP_002426832.1| mitochondrial deoxynucleotide c...   194   3e-47   Pediculus humanus corporis [human body lice]
gi|357603284|gb|EHJ63694.1| hypothetical protein KGM_12397 [Dana...   194   4e-47   Danaus plexippus [American monarch]
gi|195999134|ref|XP_002109435.1| hypothetical protein TRIADDRAFT...   193   7e-47   Trichoplax adhaerens
gi|256088366|ref|XP_002580310.1| mitochondrial carrier protein [...   192   8e-47   
gi|308810831|ref|XP_003082724.1| putative mitochondrial carrier ...   192   9e-47   Ostreococcus tauri
gi|254571751|ref|XP_002492985.1| Mitochondrial membrane transpor...   191   4e-46   Komagataella phaffii GS115
gi|182704671|sp|Q2HFL6.2|TPC1_CHAGB RecName: Full=Mitochondrial ...   189   7e-46   Chaetomium globosum CBS 148.51
gi|198429285|ref|XP_002131242.1| PREDICTED: mitochondrial thiami...   189   8e-46   Ciona intestinalis [sea vase]
gi|116180720|ref|XP_001220209.1| hypothetical protein CHGG_00988...   189   1e-45   Chaetomium globosum CBS 148.51
gi|308477077|ref|XP_003100753.1| hypothetical protein CRE_15507 ...   188   2e-45   Caenorhabditis remanei
gi|281208100|gb|EFA82278.1| mitochondrial substrate carrier fami...   188   2e-45   Polysphondylium pallidum PN500
gi|303278984|ref|XP_003058785.1| mitochondrial carrier family [M...   188   2e-45   Micromonas pusilla CCMP1545
gi|320582629|gb|EFW96846.1| Mitochondrial membrane transporter [...   187   3e-45   
gi|294657452|ref|XP_459760.2| DEHA2E10428p [Debaryomyces hanseni...   187   3e-45   Debaryomyces hansenii CBS767
gi|432868425|ref|XP_004071531.1| PREDICTED: mitochondrial thiami...   187   3e-45   Oryzias latipes [Japanese rice fish]
gi|255078766|ref|XP_002502963.1| mitochondrial carrier family [M...   187   4e-45   Micromonas commoda
gi|444727840|gb|ELW68318.1| Mitochondrial thiamine pyrophosphate...   185   2e-44   Tupaia chinensis
gi|91092070|ref|XP_970936.1| PREDICTED: similar to AGAP005113-PA...   184   2e-44   Tribolium castaneum [rust-red flour beetle]
gi|499005988|ref|XP_004535713.1| PREDICTED: mitochondrial thiami...   184   3e-44   Ceratitis capitata
gi|499015289|ref|XP_004558459.1| PREDICTED: mitochondrial thiami...   184   4e-44   
gi|392901138|ref|NP_001255632.1| Protein HPO-12, isoform a [Caen...   183   6e-44   Caenorhabditis elegans [roundworm]
gi|326437990|gb|EGD83560.1| hypothetical protein PTSG_04165 [Sal...   183   6e-44   Salpingoeca rosetta
gi|50307493|ref|XP_453726.1| hypothetical protein [Kluyveromyces...   183   6e-44   Kluyveromyces lactis NRRL Y-1140
gi|406606223|emb|CCH42405.1| Mitochondrial aspartate-glutamate t...   183   8e-44   Wickerhamomyces ciferrii
gi|226470538|emb|CAX70549.1| Mitochondrial deoxynucleotide carri...   182   9e-44   Schistosoma japonicum
gi|312371078|gb|EFR19342.1| hypothetical protein AND_22648 [Anop...   182   1e-43   
gi|341884174|gb|EGT40109.1| hypothetical protein CAEBREN_05011 [...   181   2e-43   Caenorhabditis brenneri
gi|195111332|ref|XP_002000233.1| GI22635 [Drosophila mojavensis]...   181   2e-43   Drosophila mojavensis
gi|478252789|gb|ENN73182.1| hypothetical protein YQE_10236, part...   181   3e-43   Dendroctonus ponderosae
gi|195119600|ref|XP_002004318.1| GI19679 [Drosophila mojavensis]...   181   3e-43   
gi|297273603|ref|XP_001094462.2| PREDICTED: mitochondrial thiami...   180   4e-43   
gi|156542576|ref|XP_001603742.1| PREDICTED: mitochondrial thiami...   180   4e-43   Nasonia vitripennis
gi|62640383|ref|XP_218743.3| PREDICTED: mitochondrial thiamine p...   180   4e-43   
gi|268536726|ref|XP_002633498.1| Hypothetical protein CBG06270 [...   180   5e-43   Caenorhabditis briggsae
gi|157121135|ref|XP_001659842.1| mitochondrial carrier protein, ...   179   1e-42   Aedes aegypti
gi|195389556|ref|XP_002053442.1| GJ23881 [Drosophila virilis] >g...   179   1e-42   Drosophila virilis
gi|344229752|gb|EGV61637.1| hypothetical protein CANTEDRAFT_1245...   178   2e-42   Candida tenuis ATCC 10573
gi|213402655|ref|XP_002172100.1| solute carrier family 25 member...   178   2e-42   Schizosaccharomyces japonicus yFS275
gi|195401749|ref|XP_002059474.1| GJ17180 [Drosophila virilis] >g...   178   3e-42   
gi|340721690|ref|XP_003399249.1| PREDICTED: mitochondrial thiami...   177   3e-42   
gi|7497312|pir||T32897 hypothetical protein C42C1.10 - Caenorhab...   177   4e-42
gi|110764672|ref|XP_001123132.1| PREDICTED: mitochondrial thiami...   177   4e-42   
gi|448517022|ref|XP_003867694.1| Tpc1 protein [Candida orthopsil...   177   4e-42   Candida orthopsilosis Co 90-125
gi|145353695|ref|XP_001421141.1| MC family transporter: deoxynuc...   177   4e-42   Ostreococcus lucimarinus CCE9901
gi|150865838|ref|XP_001385219.2| mitochondrial thiamine pyrophos...   177   4e-42   Scheffersomyces stipitis CBS 6054
gi|380016520|ref|XP_003692230.1| PREDICTED: mitochondrial thiami...   177   5e-42   
gi|194746235|ref|XP_001955586.1| GF16172 [Drosophila ananassae] ...   176   6e-42   Drosophila ananassae
gi|475373953|gb|EMT00582.1| Mitochondrial thiamine pyrophosphate...   176   9e-42   Aegilops tauschii
gi|158286811|ref|XP_308941.4| AGAP006806-PA [Anopheles gambiae s...   176   1e-41   Anopheles gambiae str. PEST
gi|170585906|ref|XP_001897723.1| Mitochondrial carrier protein [...   176   1e-41   Brugia malayi [agent of lymphatic filariasis]
gi|194902168|ref|XP_001980621.1| GG17254 [Drosophila erecta] >gi...   176   1e-41   Drosophila erecta
gi|195157678|ref|XP_002019723.1| GL12058 [Drosophila persimilis]...   175   1e-41   Drosophila persimilis
gi|321473771|gb|EFX84738.1| hypothetical protein DAPPUDRAFT_2229...   175   2e-41   Daphnia pulex
gi|498933319|ref|XP_004519607.1| PREDICTED: mitochondrial thiami...   175   2e-41   Ceratitis capitata
gi|198455229|ref|XP_002138027.1| GA26180 [Drosophila pseudoobscu...   175   2e-41   Drosophila pseudoobscura pseudoobscura
gi|297830844|ref|XP_002883304.1| hypothetical protein ARALYDRAFT...   175   2e-41   Arabidopsis lyrata subsp. lyrata
gi|448116088|ref|XP_004202970.1| Piso0_001842 [Millerozyma farin...   174   3e-41   Millerozyma farinosa CBS 7064
gi|45184859|ref|NP_982577.1| AAR036Wp [Ashbya gossypii ATCC 1089...   174   3e-41   Eremothecium gossypii ATCC 10895
gi|170036927|ref|XP_001846312.1| mitochondrial carrier protein [...   174   5e-41   Culex quinquefasciatus
gi|393908472|gb|EJD75074.1| hypothetical protein LOAG_17710 [Loa...   174   5e-41   Loa loa
gi|384250580|gb|EIE24059.1| mitochondrial substrate carrier prot...   173   5e-41   Coccomyxa subellipsoidea C-169
gi|195499911|ref|XP_002097149.1| GE24656 [Drosophila yakuba] >gi...   173   6e-41   Drosophila yakuba
gi|195571875|ref|XP_002103926.1| GD20692 [Drosophila simulans] >...   173   6e-41   
gi|195038279|ref|XP_001990587.1| GH19431 [Drosophila grimshawi] ...   173   6e-41   Drosophila grimshawi
gi|513214517|ref|XP_420126.3| PREDICTED: mitochondrial thiamine ...   173   7e-41   
gi|193700120|ref|XP_001943842.1| PREDICTED: mitochondrial thiami...   172   8e-41   
gi|195329985|ref|XP_002031689.1| GM26138 [Drosophila sechellia] ...   172   9e-41   Drosophila sechellia
gi|21356397|ref|NP_650034.1| thiamine pyrophosphate carrier prot...   172   9e-41   Drosophila melanogaster
gi|367015680|ref|XP_003682339.1| hypothetical protein TDEL_0F031...   172   1e-40   Torulaspora delbrueckii
gi|512933964|ref|XP_004932920.1| PREDICTED: mitochondrial thiami...   172   1e-40   Bombyx mori [silk moth]
gi|255725354|ref|XP_002547606.1| hypothetical protein CTRG_01913...   172   1e-40   Candida tropicalis MYA-3404
gi|159482741|ref|XP_001699426.1| mitochondrial substrate carrier...   172   2e-40   Chlamydomonas reinhardtii
gi|290984350|ref|XP_002674890.1| predicted protein [Naegleria gr...   172   2e-40   Naegleria gruberi strain NEG-M
gi|195029361|ref|XP_001987542.1| GH21976 [Drosophila grimshawi] ...   171   2e-40   
gi|157121143|ref|XP_001659846.1| mitochondrial citrate transport...   171   3e-40   
gi|254580405|ref|XP_002496188.1| ZYRO0C12518p [Zygosaccharomyces...   171   4e-40   
gi|470252874|ref|XP_004359534.1| mitochondrial substrate carrier...   171   4e-40   
gi|238882409|gb|EEQ46047.1| conserved hypothetical protein [Cand...   171   4e-40   
gi|68488653|ref|XP_711835.1| potential mitochondrial thiamine py...   170   4e-40   
gi|302854722|ref|XP_002958866.1| mitochondrial substrate carrier...   169   7e-40   
gi|448113434|ref|XP_004202350.1| Piso0_001842 [Millerozyma farin...   169   1e-39   
gi|410084140|ref|XP_003959647.1| hypothetical protein KAFR_0K015...   167   3e-39   
gi|241951686|ref|XP_002418565.1| mitochondrial thiamine pyrophos...   167   4e-39   
gi|195452036|ref|XP_002073185.1| GK13285 [Drosophila willistoni]...   167   5e-39   
gi|224109442|ref|XP_002315196.1| predicted protein [Populus tric...   167   5e-39   
gi|281209839|gb|EFA84007.1| EF-hand domain-containing protein [P...   167   5e-39   
gi|383847352|ref|XP_003699318.1| PREDICTED: mitochondrial thiami...   166   8e-39   
gi|474204421|gb|EMS58617.1| Mitochondrial thiamine pyrophosphate...   166   8e-39   
gi|239792250|dbj|BAH72488.1| ACYPI000861 [Acyrthosiphon pisum]        166   1e-38   
gi|223634722|sp|A5DIS9.3|TPC1_PICGU RecName: Full=Mitochondrial ...   165   2e-38   
gi|354543669|emb|CCE40390.1| hypothetical protein CPAR2_104260 [...   165   2e-38   
gi|198456216|ref|XP_001360257.2| GA15488 [Drosophila pseudoobscu...   164   5e-38   
gi|224101051|ref|XP_002312122.1| predicted protein [Populus tric...   164   5e-38   
gi|366993553|ref|XP_003676541.1| hypothetical protein NCAS_0E011...   164   5e-38   
gi|195426638|ref|XP_002061418.1| GK20736 [Drosophila willistoni]...   164   5e-38   
gi|195149445|ref|XP_002015668.1| GL10902 [Drosophila persimilis]...   163   7e-38   
gi|323309047|gb|EGA62276.1| Tpc1p [Saccharomyces cerevisiae Fost...   162   1e-37   
gi|344302862|gb|EGW33136.1| mitochondrial thiamine pyrophosphate...   162   1e-37   
gi|206558289|sp|A6ZV78.1|TPC1_YEAS7 RecName: Full=Mitochondrial ...   162   1e-37   
gi|357505723|ref|XP_003623150.1| Mitochondrial substrate carrier...   162   1e-37   
gi|398365651|ref|NP_011610.3| Tpc1p [Saccharomyces cerevisiae S2...   162   1e-37   
gi|242052141|ref|XP_002455216.1| hypothetical protein SORBIDRAFT...   162   2e-37   
gi|259146599|emb|CAY79856.1| Tpc1p [Saccharomyces cerevisiae EC1...   162   2e-37   
gi|51013669|gb|AAT93128.1| YGR096W [Saccharomyces cerevisiae]         161   2e-37   
gi|149245126|ref|XP_001527097.1| conserved hypothetical protein ...   161   2e-37   
gi|323348612|gb|EGA82856.1| Tpc1p [Saccharomyces cerevisiae Lalv...   161   2e-37   
gi|470251280|ref|XP_004358737.1| EF-hand domain-containing prote...   161   3e-37   
gi|502176829|ref|XP_004515948.1| PREDICTED: mitochondrial substr...   160   4e-37   
gi|195654101|gb|ACG46518.1| protein brittle-1 [Zea mays] >gi|223...   160   5e-37   
gi|115434474|ref|NP_001041995.1| Os01g0143100 [Oryza sativa Japo...   160   5e-37   
gi|54290185|dbj|BAD61073.1| putative peroxisomal Ca-dependent so...   160   5e-37   
gi|349578308|dbj|GAA23474.1| K7_Tpc1p [Saccharomyces cerevisiae ...   159   8e-37   
gi|386768626|ref|NP_001246511.1| thiamine pyrophosphate carrier ...   159   1e-36   
gi|402217222|gb|EJT97303.1| mitochondrial carrier, partial [Dacr...   159   1e-36   
gi|392901136|ref|NP_001255631.1| Protein HPO-12, isoform d [Caen...   159   1e-36   
gi|365760631|gb|EHN02339.1| Tpc1p [Saccharomyces cerevisiae x Sa...   159   1e-36   
gi|115465719|ref|NP_001056459.1| Os05g0585900 [Oryza sativa Japo...   159   1e-36   
gi|147770645|emb|CAN73411.1| hypothetical protein VITISV_024376 ...   159   1e-36   
gi|195353314|ref|XP_002043150.1| GM11781 [Drosophila sechellia] ...   158   2e-36   
gi|462401115|gb|EMJ06672.1| hypothetical protein PRUPE_ppa008053...   158   2e-36   
gi|348678089|gb|EGZ17906.1| hypothetical protein PHYSODRAFT_3462...   158   2e-36   
gi|325188655|emb|CCA23186.1| Mitochondrial Carrier (MC) Family p...   158   2e-36   
gi|401842316|gb|EJT44549.1| TPC1-like protein [Saccharomyces kud...   158   2e-36   
gi|365992046|ref|XP_003672851.1| hypothetical protein NDAI_0L012...   158   2e-36   
gi|224067958|ref|XP_002302618.1| predicted protein [Populus tric...   158   2e-36   
gi|412993539|emb|CCO14050.1| mitochondrial carrier protein [Bath...   158   3e-36   
gi|363748180|ref|XP_003644308.1| hypothetical protein Ecym_1248 ...   158   3e-36   
gi|195489852|ref|XP_002092913.1| GE11403 [Drosophila yakuba] >gi...   158   3e-36   
gi|401625680|gb|EJS43678.1| tpc1p [Saccharomyces arboricola H-6]      157   3e-36   
gi|125553505|gb|EAY99214.1| hypothetical protein OsI_21172 [Oryz...   157   3e-36   
gi|502096866|ref|XP_004490851.1| PREDICTED: mitochondrial substr...   157   4e-36   
gi|225440510|ref|XP_002272651.1| PREDICTED: mitochondrial substr...   157   4e-36   
gi|194886834|ref|XP_001976693.1| GG19879 [Drosophila erecta] >gi...   157   4e-36   
gi|301094902|ref|XP_002896554.1| Mitochondrial Carrier (MC) Fami...   157   5e-36   
gi|440632118|gb|ELR02037.1| hypothetical protein GMDG_05199 [Geo...   157   6e-36   
gi|22331775|ref|NP_190962.2| mitochondrial substrate carrier fam...   156   6e-36   
gi|470143858|ref|XP_004307584.1| PREDICTED: mitochondrial substr...   156   7e-36   
gi|51970652|dbj|BAD44018.1| mitochondrial carrier like protein [...   156   7e-36   
gi|356566581|ref|XP_003551509.1| PREDICTED: mitochondrial substr...   156   7e-36   
gi|260792432|ref|XP_002591219.1| hypothetical protein BRAFLDRAFT...   156   7e-36   
gi|30687297|ref|NP_181325.2| mitochondrial substrate carrier fam...   156   7e-36   
gi|508726087|gb|EOY17984.1| Mitochondrial substrate carrier fami...   156   7e-36   
gi|115452133|ref|NP_001049667.1| Os03g0267700 [Oryza sativa Japo...   156   7e-36   
gi|218192506|gb|EEC74933.1| hypothetical protein OsI_10895 [Oryz...   156   8e-36   
gi|482560173|gb|EOA24364.1| hypothetical protein CARUB_v10017609...   156   9e-36   
gi|357478753|ref|XP_003609662.1| Mitochondrial thiamine pyrophos...   156   9e-36   
gi|29893633|gb|AAP06887.1| putative peroxisomal Ca-dependent sol...   156   9e-36   
gi|242091523|ref|XP_002441594.1| hypothetical protein SORBIDRAFT...   156   9e-36   
gi|225426016|ref|XP_002273414.1| PREDICTED: mitochondrial substr...   156   1e-35   
gi|356560466|ref|XP_003548513.1| PREDICTED: mitochondrial substr...   156   1e-35   
gi|356506048|ref|XP_003521800.1| PREDICTED: mitochondrial substr...   156   1e-35   
gi|462414661|gb|EMJ19398.1| hypothetical protein PRUPE_ppa007790...   156   1e-35   
gi|225449356|ref|XP_002282149.1| PREDICTED: mitochondrial substr...   155   1e-35   
gi|300122538|emb|CBK23107.2| unnamed protein product [Blastocyst...   155   1e-35   
gi|356501103|ref|XP_003519368.1| PREDICTED: mitochondrial substr...   155   1e-35   
gi|297820130|ref|XP_002877948.1| mitochondrial substrate carrier...   155   1e-35   
gi|300123410|emb|CBK24683.2| unnamed protein product [Blastocyst...   155   2e-35   
gi|462414684|gb|EMJ19421.1| hypothetical protein PRUPE_ppa007904...   155   2e-35   
gi|488544758|ref|XP_004463923.1| PREDICTED: mitochondrial thiami...   155   2e-35   
gi|462405030|gb|EMJ10494.1| hypothetical protein PRUPE_ppa007764...   155   2e-35   
gi|502179244|ref|XP_004516398.1| PREDICTED: mitochondrial adenin...   155   2e-35   
gi|224130494|ref|XP_002320851.1| predicted protein [Populus tric...   155   2e-35   
gi|15228163|ref|NP_191123.1| mitochondrial substrate carrier fam...   155   2e-35   
gi|358339750|dbj|GAA47751.1| mitochondrial thiamine pyrophosphat...   154   2e-35   
gi|356504350|ref|XP_003520959.1| PREDICTED: mitochondrial substr...   154   2e-35   
gi|356551602|ref|XP_003544163.1| PREDICTED: mitochondrial substr...   154   2e-35   
gi|432853308|ref|XP_004067643.1| PREDICTED: mitochondrial coenzy...   154   3e-35   
gi|156364786|ref|XP_001626526.1| predicted protein [Nematostella...   154   3e-35   
gi|50288141|ref|XP_446499.1| hypothetical protein [Candida glabr...   154   3e-35   
gi|449530798|ref|XP_004172379.1| PREDICTED: mitochondrial thiami...   154   3e-35   
gi|212274375|ref|NP_001130208.1| uncharacterized protein LOC1001...   154   3e-35   
gi|224140313|ref|XP_002323527.1| predicted protein [Populus tric...   154   3e-35   
gi|482560069|gb|EOA24260.1| hypothetical protein CARUB_v10017501...   154   4e-35   
gi|302822380|ref|XP_002992848.1| hypothetical protein SELMODRAFT...   154   4e-35   
gi|508703876|gb|EOX95772.1| Adenine nucleotide transporter 1 [Th...   154   4e-35   
gi|255716868|ref|XP_002554715.1| KLTH0F11902p [Lachancea thermot...   154   4e-35   
gi|460400027|ref|XP_004245537.1| PREDICTED: mitochondrial adenin...   154   5e-35   
gi|340379892|ref|XP_003388459.1| PREDICTED: mitochondrial substr...   154   5e-35   
gi|194701118|gb|ACF84643.1| unknown [Zea mays] >gi|194708578|gb|...   154   5e-35   
gi|356520304|ref|XP_003528803.1| PREDICTED: mitochondrial substr...   153   6e-35   
gi|356573213|ref|XP_003554758.1| PREDICTED: mitochondrial substr...   153   7e-35   
gi|66808853|ref|XP_638149.1| EF-hand domain-containing protein [...   153   7e-35   
gi|470326706|ref|XP_004364767.1| EF-hand domain-containing prote...   153   7e-35   
gi|145348332|ref|XP_001418605.1| MC family transporter: aspartat...   153   8e-35   
gi|326495036|dbj|BAJ85614.1| predicted protein [Hordeum vulgare ...   153   8e-35   
gi|224053799|ref|XP_002297985.1| predicted protein [Populus tric...   153   9e-35   
gi|225454464|ref|XP_002280675.1| PREDICTED: mitochondrial substr...   152   9e-35   
gi|449464462|ref|XP_004149948.1| PREDICTED: mitochondrial substr...   152   1e-34   
gi|118489131|gb|ABK96372.1| unknown [Populus trichocarpa x Popul...   152   1e-34   
gi|429241177|ref|NP_596636.2| mitochondrial thiamine pyrophospha...   152   1e-34   
gi|460405220|ref|XP_004248074.1| PREDICTED: mitochondrial adenin...   152   1e-34   
gi|297816870|ref|XP_002876318.1| mitochondrial substrate carrier...   152   2e-34   
gi|15234063|ref|NP_192019.1| adenine nucleotide transporter 1 [A...   152   2e-34   
gi|326491547|dbj|BAJ94251.1| predicted protein [Hordeum vulgare ...   152   2e-34   
gi|7630014|emb|CAB88356.1| putative protein [Arabidopsis thaliana]    152   2e-34   
gi|302771323|ref|XP_002969080.1| hypothetical protein SELMODRAFT...   152   2e-34   
gi|356504352|ref|XP_003520960.1| PREDICTED: mitochondrial substr...   151   3e-34   
gi|460401791|ref|XP_004246399.1| PREDICTED: mitochondrial substr...   151   3e-34   
gi|196009075|ref|XP_002114403.1| hypothetical protein TRIADDRAFT...   151   3e-34   
gi|508715489|gb|EOY07386.1| Mitochondrial substrate carrier fami...   151   3e-34   
gi|449516015|ref|XP_004165043.1| PREDICTED: mitochondrial substr...   151   3e-34   
gi|470133702|ref|XP_004302699.1| PREDICTED: mitochondrial substr...   151   3e-34   
gi|255537727|ref|XP_002509930.1| Grave disease carrier protein, ...   151   3e-34   
gi|449448592|ref|XP_004142050.1| PREDICTED: mitochondrial substr...   151   3e-34   
gi|356506050|ref|XP_003521801.1| PREDICTED: mitochondrial substr...   150   4e-34   
gi|367001460|ref|XP_003685465.1| hypothetical protein TPHA_0D039...   150   4e-34   
gi|470125790|ref|XP_004298882.1| PREDICTED: mitochondrial adenin...   150   4e-34   
gi|21554682|gb|AAM63657.1| Ca-dependent solute carrier-like prot...   150   6e-34   
gi|348504363|ref|XP_003439731.1| PREDICTED: solute carrier famil...   149   9e-34   
gi|502159765|ref|XP_004511523.1| PREDICTED: mitochondrial adenin...   149   1e-33   
gi|444317801|ref|XP_004179558.1| hypothetical protein TBLA_0C022...   149   1e-33   
gi|449432098|ref|XP_004133837.1| PREDICTED: mitochondrial substr...   149   1e-33   
gi|470428641|ref|XP_004338112.1| Mitochondrial carrier protein [...   149   1e-33   
gi|83283981|gb|ABC01898.1| mitochondrial carrier-like protein [S...   149   2e-33   
gi|312381298|gb|EFR27076.1| hypothetical protein AND_06434 [Anop...   149   2e-33   
gi|470141969|ref|XP_004306695.1| PREDICTED: mitochondrial adenin...   149   2e-33   
gi|255583822|ref|XP_002532663.1| Grave disease carrier protein, ...   148   2e-33   
gi|357112946|ref|XP_003558266.1| PREDICTED: mitochondrial substr...   148   2e-33   
gi|224090807|ref|XP_002309090.1| predicted protein [Populus tric...   148   2e-33   
gi|460370731|ref|XP_004231203.1| PREDICTED: mitochondrial adenin...   148   2e-33   
gi|482556750|gb|EOA20942.1| hypothetical protein CARUB_v10001278...   148   2e-33   
gi|297814225|ref|XP_002874996.1| mitochondrial substrate carrier...   148   3e-33   
gi|156849145|ref|XP_001647453.1| hypothetical protein Kpol_1018p...   148   3e-33   
gi|307107810|gb|EFN56052.1| hypothetical protein CHLNCDRAFT_3534...   148   3e-33   
gi|452819072|gb|EME26170.1| mitochondrial carrier isoform 1 [Gal...   147   3e-33   
gi|350425074|ref|XP_003494003.1| PREDICTED: solute carrier famil...   147   3e-33   
gi|294464457|gb|ADE77740.1| unknown [Picea sitchensis]                147   3e-33   
gi|403214055|emb|CCK68556.1| hypothetical protein KNAG_0B01090 [...   147   3e-33   
gi|357132384|ref|XP_003567810.1| PREDICTED: mitochondrial substr...   147   3e-33   
gi|66801713|ref|XP_629781.1| mitochondrial substrate carrier fam...   147   4e-33   
gi|194756286|ref|XP_001960410.1| GF11531 [Drosophila ananassae] ...   147   5e-33   
gi|168044879|ref|XP_001774907.1| predicted protein [Physcomitrel...   147   5e-33   
gi|513227563|ref|XP_004948951.1| PREDICTED: mitochondrial coenzy...   147   6e-33   
gi|363743829|ref|XP_424684.3| PREDICTED: mitochondrial coenzyme ...   147   6e-33   
gi|301610073|ref|XP_002934585.1| PREDICTED: solute carrier famil...   147   6e-33   
gi|513227569|ref|XP_004948953.1| PREDICTED: mitochondrial coenzy...   147   6e-33   
gi|483504607|gb|EOA96611.1| Solute carrier family 25 member 42, ...   146   8e-33   
gi|499001312|ref|XP_004554948.1| PREDICTED: mitochondrial coenzy...   146   9e-33   
gi|513227577|ref|XP_004948955.1| PREDICTED: mitochondrial coenzy...   146   1e-32   
gi|482567143|gb|EOA31332.1| hypothetical protein CARUB_v10014505...   146   1e-32   
gi|410076098|ref|XP_003955631.1| hypothetical protein KAFR_0B019...   146   1e-32   
gi|380023330|ref|XP_003695476.1| PREDICTED: solute carrier famil...   145   1e-32   
gi|513227566|ref|XP_004948952.1| PREDICTED: mitochondrial coenzy...   145   1e-32   
gi|513214520|ref|XP_004946426.1| PREDICTED: mitochondrial thiami...   145   1e-32   
gi|471561271|gb|EMR63090.1| putative solute carrier family 25 me...   145   1e-32   
gi|255072651|ref|XP_002500000.1| mitochondrial carrier family [M...   145   2e-32   
gi|403215481|emb|CCK69980.1| hypothetical protein KNAG_0D02300 [...   145   2e-32   
gi|195376271|ref|XP_002046920.1| GJ12223 [Drosophila virilis] >g...   145   2e-32   
gi|328857679|gb|EGG06794.1| hypothetical protein MELLADRAFT_4829...   145   2e-32   
gi|357133784|ref|XP_003568503.1| PREDICTED: mitochondrial substr...   144   2e-32   
gi|340521058|gb|EGR51293.1| predicted protein [Trichoderma reese...   144   3e-32   
gi|334186271|ref|NP_001190650.1| adenine nucleotide transporter ...   144   3e-32   
gi|498963774|ref|XP_004525267.1| PREDICTED: calcium-binding mito...   144   3e-32   
gi|498963746|ref|XP_004525261.1| PREDICTED: calcium-binding mito...   144   3e-32   
gi|196005357|ref|XP_002112545.1| expressed hypothetical protein ...   144   3e-32   
gi|110750141|ref|XP_396993.3| PREDICTED: solute carrier family 2...   144   3e-32   
gi|195012817|ref|XP_001983753.1| GH16067 [Drosophila grimshawi] ...   144   3e-32   
gi|326934509|ref|XP_003213331.1| PREDICTED: solute carrier famil...   144   4e-32   
gi|66814198|ref|XP_641278.1| mitochondrial substrate carrier fam...   144   4e-32   
gi|156376739|ref|XP_001630516.1| predicted protein [Nematostella...   144   4e-32   
gi|254582661|ref|XP_002499062.1| ZYRO0E02728p [Zygosaccharomyces...   144   5e-32   
gi|511005932|gb|EPB87258.1| hypothetical protein HMPREF1544_0598...   144   5e-32   
gi|195435830|ref|XP_002065882.1| GK20580 [Drosophila willistoni]...   143   6e-32   
gi|508777703|gb|EOY24959.1| Adenine nucleotide transporter 1 iso...   143   6e-32   
gi|449670568|ref|XP_004207297.1| PREDICTED: mitochondrial coenzy...   143   6e-32   
gi|428167833|gb|EKX36786.1| hypothetical protein GUITHDRAFT_1170...   143   6e-32   
gi|255577969|ref|XP_002529856.1| Mitochondrial deoxynucleotide c...   143   7e-32   
gi|159470405|ref|XP_001693350.1| mitochondrial carrier protein [...   143   8e-32   
gi|168021361|ref|XP_001763210.1| predicted protein [Physcomitrel...   143   9e-32   
gi|348528947|ref|XP_003451977.1| PREDICTED: graves disease carri...   143   9e-32   
gi|498963779|ref|XP_004525268.1| PREDICTED: calcium-binding mito...   142   1e-31   
gi|297827335|ref|XP_002881550.1| hypothetical protein ARALYDRAFT...   142   1e-31   
gi|452819071|gb|EME26169.1| mitochondrial carrier isoform 2 [Gal...   142   1e-31   
gi|478263431|gb|ENN81792.1| hypothetical protein YQE_01800, part...   142   1e-31   
gi|118404422|ref|NP_001072712.1| mitochondrial coenzyme A transp...   142   1e-31   
gi|296082017|emb|CBI21022.3| unnamed protein product [Vitis vini...   142   1e-31   
gi|225430247|ref|XP_002285050.1| PREDICTED: protein brittle-1, c...   142   2e-31   
gi|158295958|ref|XP_557186.3| AGAP006508-PA [Anopheles gambiae s...   142   2e-31   
gi|195493829|ref|XP_002094581.1| GE20124 [Drosophila yakuba] >gi...   142   2e-31   
gi|498939956|ref|XP_004521321.1| PREDICTED: calcium-binding mito...   142   2e-31   
gi|259480046|tpe|CBF70821.1| TPA: mitochondrial carrier protein,...   142   2e-31   
gi|24663275|ref|NP_729802.1| CG32103, isoform B [Drosophila mela...   142   2e-31   
gi|67539262|ref|XP_663405.1| hypothetical protein AN5801.2 [Aspe...   142   2e-31   
gi|195589812|ref|XP_002084643.1| GD12723 [Drosophila simulans] >...   142   2e-31   
gi|194869832|ref|XP_001972530.1| GG13834 [Drosophila erecta] >gi...   142   2e-31   
gi|147772995|emb|CAN73822.1| hypothetical protein VITISV_005135 ...   141   2e-31   
gi|147772011|emb|CAN60251.1| hypothetical protein VITISV_039402 ...   141   2e-31   
gi|195327117|ref|XP_002030268.1| GM24660 [Drosophila sechellia] ...   141   2e-31   
gi|194747111|ref|XP_001955996.1| GF24982 [Drosophila ananassae] ...   141   3e-31   
gi|158295960|ref|XP_316535.3| AGAP006508-PB [Anopheles gambiae s...   141   3e-31   
gi|442631942|ref|NP_001261760.1| CG32103, isoform D [Drosophila ...   141   3e-31   
gi|330799732|ref|XP_003287896.1| hypothetical protein DICPUDRAFT...   141   3e-31   
gi|239046491|ref|NP_001132148.2| uncharacterized protein LOC1001...   141   3e-31   
gi|326493464|dbj|BAJ85193.1| predicted protein [Hordeum vulgare ...   141   3e-31   


>gi|384499628|gb|EIE90119.1| hypothetical protein RO3G_14830 [Rhizopus delemar RA 99-880]
          Length = 352

 Score =  309 bits (792), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 150/336 (44%), Positives = 228/336 (67%), Gaps = 18/336 (5%)

Query: 20  VAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKY 79
           + +S+L++ E  +CG +AG+ +RF  SPLDV+KIRLQLQ      PLS++   S    KY
Sbjct: 5   ITSSKLNANETALCGGIAGIATRFAISPLDVIKIRLQLQS----QPLSTKLLFSKQNAKY 60

Query: 80  NGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQN---- 135
           +G+ H+ K I++EEGIRGL+ GN++AEYLYL+YG  QF  Y+ M    +++   +     
Sbjct: 61  SGIFHSFKTIVQEEGIRGLFKGNVAAEYLYLTYGISQFYAYYHMDAFMEKVRIRKEVVSA 120

Query: 136 --------EKFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAV 187
                   ++  I  +L+PF+SG ++GS AT +TYPFDLLRTRFA QG  ++Y  L +A+
Sbjct: 121 VILIKFIFQRTQIAPSLKPFVSGMVAGSFATAITYPFDLLRTRFAVQGTSKVYKSLSHAI 180

Query: 188 QQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDL 247
             I  +EG +GFYRG+ +S++QI+PYMGL+F SYE L  + + L+DK I       TE++
Sbjct: 181 LDINEKEGIKGFYRGLGSSIIQIMPYMGLMFFSYEGLSSIIQNLKDKQIISDKYNKTENM 240

Query: 248 LSGAIAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYS--SSIFICIKQILRSDG 305
           + G+++GI+SKAGVFPLD+VRKRLQVQGP   +Y +S++P YS  +S   C+K I+ ++G
Sbjct: 241 ICGSLSGIISKAGVFPLDVVRKRLQVQGPRISEYVVSSIPTYSHQTSAISCMKHIVCTEG 300

Query: 306 IFGLYKGLMPALIKSAPVSAVTFFVYGYTKRLLEKL 341
            + L+KG++P L+K+ P  AV F V+ ++K  + ++
Sbjct: 301 FWALFKGIVPGLLKAGPSGAVYFLVFEFSKDCITRM 336



>gi|511009601|gb|EPB90839.1| hypothetical protein HMPREF1544_02256 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 336

 Score =  305 bits (781), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 149/327 (45%), Positives = 227/327 (69%), Gaps = 10/327 (3%)

Query: 20  VAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKY 79
           + +S+L++ E  +CG  AG+ +R   SPLDVVKIRLQ+QP          +H  G++K Y
Sbjct: 5   ITSSKLNANETALCGGFAGLTTRMAISPLDVVKIRLQVQPEPYTLKRIFTNHGRGSVK-Y 63

Query: 80  NGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFG 139
           +G++ A + I+ EEGIRGL+ GN++AE+LY++YGA QF  Y+ + +  K     QN+   
Sbjct: 64  SGIAQAFRTIVAEEGIRGLFKGNVAAEWLYVTYGASQFYAYYYLDSFLK----TQNQ--- 116

Query: 140 INKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGF 199
           I+ +++PF+SG ++GS AT  TYPFDLLRTRFA QG  ++Y  + +A+  I+ +EG+RGF
Sbjct: 117 ISPSIKPFISGMLAGSFATATTYPFDLLRTRFAMQGTNKVYNSIAHAISDIFEKEGFRGF 176

Query: 200 YRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKA 259
           YRG+  S+ QI+PYMGL+F SYE L  L + L+DK I   N + T+D++ G++AGI+SK 
Sbjct: 177 YRGLWPSITQIMPYMGLMFFSYEGLCSLTQALKDKRIISENHKRTDDMICGSLAGIISKT 236

Query: 260 GVFPLDLVRKRLQVQGPNRKDYFISNVPLYS--SSIFICIKQILRSDGIFGLYKGLMPAL 317
           GVFPLD+VRKRLQVQGP+  +Y +S +P Y+  +++  C+++I+ ++G+ GLYKG++P L
Sbjct: 237 GVFPLDVVRKRLQVQGPHLMEYVVSTIPSYAQQNTVVGCMRKIVYTEGVLGLYKGIVPGL 296

Query: 318 IKSAPVSAVTFFVYGYTKRLLEKLHSS 344
           +K+ P  AV F ++   K  +  L  S
Sbjct: 297 LKAGPSGAVYFLMFELAKDGITNLKES 323



 Score = 74.3 bits (181), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 60/225 (26%), Positives = 95/225 (42%), Gaps = 33/225 (14%)

Query: 135 NEKFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGE----KRI----------Y 180
           + K   N+T    L G  +G T  +   P D+++ R   Q E    KRI          Y
Sbjct: 7   SSKLNANETA---LCGGFAGLTTRMAISPLDVVKIRLQVQPEPYTLKRIFTNHGRGSVKY 63

Query: 181 IGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHN 240
            G+  A + I  +EG RG ++G  A+    + Y    F +Y +L    +           
Sbjct: 64  SGIAQAFRTIVAEEGIRGLFKGNVAAEWLYVTYGASQFYAYYYLDSFLKTQNQIS----- 118

Query: 241 LRATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQI 300
             + +  +SG +AG  + A  +P DL+R R  +QG N+         +Y+S I   I  I
Sbjct: 119 -PSIKPFISGMLAGSFATATTYPFDLLRTRFAMQGTNK---------VYNS-IAHAISDI 167

Query: 301 LRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGYTKRLLEKLHSSR 345
              +G  G Y+GL P++ +  P   + FF Y     L + L   R
Sbjct: 168 FEKEGFRGFYRGLWPSITQIMPYMGLMFFSYEGLCSLTQALKDKR 212



>gi|258575287|ref|XP_002541825.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237902091|gb|EEP76492.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 977

 Score =  280 bits (717), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 148/316 (46%), Positives = 203/316 (64%), Gaps = 15/316 (4%)

Query: 29  EIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKL 88
           ++   GA+AG+VSRF  +PLDVVKIRLQLQ     +PLS RH +      Y G    +K 
Sbjct: 674 QVVAAGAIAGLVSRFCVAPLDVVKIRLQLQIHSLSDPLSHRHIHGPV---YKGTISTLKA 730

Query: 89  IIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFL 148
           I+REEGI GLW GN+ AE LY+ YG +QF TY  +      + +       + +  + FL
Sbjct: 731 IVREEGITGLWKGNIPAELLYVFYGGIQFTTYRTVTQALHTLPTAHR----LPQPAESFL 786

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVV 208
           SGA++G  AT+ TYPFDLLRTRFAAQG  +IY  L +AV+ I+  EGY GF+RG +A+V 
Sbjct: 787 SGAVAGGIATLTTYPFDLLRTRFAAQGNIKIYPSLLSAVRTIHSHEGYPGFFRGASAAVA 846

Query: 209 QIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVR 268
           QI+PYMGL F +YE ++    +LE   + F     + D  +G IA +++K GVFPLDLVR
Sbjct: 847 QIVPYMGLFFATYESVRVPVAQLE---LPF----GSGDATAGVIASVLAKTGVFPLDLVR 899

Query: 269 KRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTF 328
           KRLQVQGP R  Y   N+P Y S ++  IK ++R  G+ GLY+GL  +LIK+AP SAVT 
Sbjct: 900 KRLQVQGPTRSRYIHQNIPEY-SGVWSTIKSVVRDGGVRGLYRGLTVSLIKAAPASAVTM 958

Query: 329 FVYGYTKRLLEKLHSS 344
           + Y    + L+++++ 
Sbjct: 959 WTYERVLKTLKEMNAD 974



>gi|511003113|gb|EPB84526.1| hypothetical protein HMPREF1544_08691 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 323

 Score =  277 bits (708), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 145/327 (44%), Positives = 204/327 (62%), Gaps = 11/327 (3%)

Query: 20  VAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKY 79
           V  + LSS E+  CG +AG+VSR V +PLDVVKIR+QLQ  R       +  N  T  KY
Sbjct: 5   VTDANLSSYELAFCGGMAGVVSRVVIAPLDVVKIRMQLQTHRTRFGFHQKP-NKNTAIKY 63

Query: 80  NGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFG 139
           N ++ A++ I++EEGIRGL+ GN+ AEYLYLSY AV+F  Y +++ + ++IDS +     
Sbjct: 64  NKITQALRTILKEEGIRGLYKGNMPAEYLYLSYSAVEFWAYKELEQIIEKIDSKRT---- 119

Query: 140 INKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGF 199
           +  TL+ F  G I+G  AT  TYPFDLLRTRFA    ++    +  A+  IY  EG  GF
Sbjct: 120 LPHTLKTFGCGMIAGCAATAATYPFDLLRTRFAVHRPQKQNTSVTRAMADIYNLEGAAGF 179

Query: 200 YRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKA 259
           YRG+  +++QI+PYMGL+F SY+   K F+ L D+ I   + + T D++SGA++G  SK 
Sbjct: 180 YRGLWPAIIQIMPYMGLLFSSYDIFAKGFKNLRDQQILSASYKPTHDMISGALSGFFSKI 239

Query: 260 GVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIK 319
            V+P DLVRKRLQ++G        +      SS + C+  I+R +G   LYKGL P+L+K
Sbjct: 240 VVYPFDLVRKRLQMEGSQ------ATSARLRSSWWGCLTNIVRQEGALSLYKGLAPSLLK 293

Query: 320 SAPVSAVTFFVYGYTKRLLEKLHSSRD 346
            AP +AVTF V+  TK +L      +D
Sbjct: 294 VAPANAVTFMVFEETKDVLLWFKEPKD 320



>gi|358373902|dbj|GAA90497.1| mitochondrial deoxynucleotide carrier protein [Aspergillus kawachii
           IFO 4308]
          Length = 341

 Score =  274 bits (701), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 149/344 (43%), Positives = 209/344 (60%), Gaps = 17/344 (4%)

Query: 6   EHKPQNQSPIAE--QAVAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPI 63
           EH P    P A+  Q    +Q +  ++ + G +AG+VSRF  +PLDVVKIRLQLQ     
Sbjct: 11  EHHPSTLPPNAQANQPSPTTQGTRRQVVLAGGIAGLVSRFCVAPLDVVKIRLQLQIHSLS 70

Query: 64  NPLSSRHHNSGTLKKYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQM 123
           +P S  HHN  T   Y G    ++ IIR+EGI GLW GN+ AE +Y+ YG +QF  Y   
Sbjct: 71  DPPS--HHNV-TGPIYKGTLSTMREIIRQEGITGLWKGNIPAELMYVCYGVIQFSAYRTT 127

Query: 124 QNLFKRIDSNQNEKFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGL 183
                ++D+     + +  +++ F++GA +G  AT  TYP DLLRTRFAAQG +R+Y  L
Sbjct: 128 TQALAQLDA-----YRLPPSVESFVAGATAGGLATASTYPLDLLRTRFAAQGTERVYTSL 182

Query: 184 RNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRA 243
            ++V+ I   EGY GF+RG +A+V QI+PYMGL F +YE L+    + +D          
Sbjct: 183 MSSVRDIARNEGYAGFFRGCSAAVGQIVPYMGLFFATYEALRPPLAQYQDLPF------G 236

Query: 244 TEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRS 303
           + D  +G IA + SK  +FPLDL+RKRLQVQGP R+ Y   N+P Y   +F  ++ ILR+
Sbjct: 237 SRDAAAGVIASVSSKTVMFPLDLIRKRLQVQGPTRQLYIHRNIPEY-QGVFNTMRLILRT 295

Query: 304 DGIFGLYKGLMPALIKSAPVSAVTFFVYGYTKRLLEKLHSSRDK 347
            GI GLY+GL  +L K+AP SAVT + Y  + RLL+ +  +  K
Sbjct: 296 QGIRGLYRGLTVSLFKAAPASAVTMWTYETSLRLLQDMEVATSK 339



>gi|303311549|ref|XP_003065786.1| Mitochondrial carrier protein [Coccidioides posadasii C735 delta
           SOWgp]
 gi|240105448|gb|EER23641.1| Mitochondrial carrier protein [Coccidioides posadasii C735 delta
           SOWgp]
 gi|320039663|gb|EFW21597.1| mitochondrial thiamine pyrophosphate carrier 1 [Coccidioides
           posadasii str. Silveira]
          Length = 319

 Score =  274 bits (701), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 157/343 (45%), Positives = 208/343 (60%), Gaps = 30/343 (8%)

Query: 1   MSQGYEH-KPQNQSPIAEQAVAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQP 59
           MS G EH K + Q     Q VAA           GA+AGMVSRF  +PLDVVKIRLQLQ 
Sbjct: 1   MSAGGEHLKDEGQR---YQVVAA-----------GAIAGMVSRFCVAPLDVVKIRLQLQI 46

Query: 60  GRPINPLSSRHHNSGTLKKYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLT 119
               +PLS   H +     Y G    +K I+REEGI GLW GN+ AE LY+ YGA+QF T
Sbjct: 47  HSLSDPLS---HKNIRGPVYKGTISTLKAIVREEGITGLWKGNIPAELLYIFYGAIQFTT 103

Query: 120 YHQMQNLFKRIDSNQNEKFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRI 179
           Y  +      +       + + +  + F+SGA +G   T  TYPFDLLRTRFAAQG  +I
Sbjct: 104 YRTVTQSLHTLP----PPYRLPQPAESFVSGATAGGIGTFATYPFDLLRTRFAAQGNDKI 159

Query: 180 YIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFH 239
           Y  L  A++ I+  EG RGF+RGV+A+V QI+PYMGL F +YE ++     L   H+ F 
Sbjct: 160 YPSLLTAIRTIHAHEGSRGFFRGVSAAVAQIVPYMGLFFATYESVRVPISAL---HLPF- 215

Query: 240 NLRATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQ 299
               + D  +G IA +++K GVFPLDLVRKRLQVQGP R  Y   N+P Y + +   +K 
Sbjct: 216 ---GSGDATAGVIASVIAKTGVFPLDLVRKRLQVQGPTRSRYIHQNIPEY-NGVLSTMKM 271

Query: 300 ILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGYTKRLLEKLH 342
           +LR  G+ GLY+GL  +LIK+AP SAVT + Y    ++L++++
Sbjct: 272 VLRDGGVRGLYRGLTVSLIKAAPASAVTMWTYERVLKILKEMN 314



>gi|119194097|ref|XP_001247652.1| hypothetical protein CIMG_01423 [Coccidioides immitis RS]
 gi|121770650|sp|Q1E7P0.1|TPC1_COCIM RecName: Full=Mitochondrial thiamine pyrophosphate carrier 1
 gi|392863103|gb|EAS36187.2| mitochondrial thiamine pyrophosphate carrier 1 [Coccidioides
           immitis RS]
          Length = 319

 Score =  273 bits (698), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 157/343 (45%), Positives = 207/343 (60%), Gaps = 30/343 (8%)

Query: 1   MSQGYEH-KPQNQSPIAEQAVAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQP 59
           MS G EH K + Q     Q VAA           GA+AGMVSRF  +PLDVVKIRLQLQ 
Sbjct: 1   MSAGGEHLKDEGQR---YQVVAA-----------GAIAGMVSRFCVAPLDVVKIRLQLQI 46

Query: 60  GRPINPLSSRHHNSGTLKKYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLT 119
               +PLS   H +     Y G    +K I REEGI GLW GN+ AE LY+ YGA+QF T
Sbjct: 47  HSLSDPLS---HKNIRGPVYKGTISTLKAIFREEGITGLWKGNIPAELLYIFYGAIQFTT 103

Query: 120 YHQMQNLFKRIDSNQNEKFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRI 179
           Y  +      +       + + +  + F+SGA +G   T  TYPFDLLRTRFAAQG  +I
Sbjct: 104 YRTVTQSLHTLP----PPYRLPQPAESFVSGATAGGIGTFTTYPFDLLRTRFAAQGNDKI 159

Query: 180 YIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFH 239
           Y  L  A++ I+  EG RGF+RGV+A+V QI+PYMGL F +YE ++     L   H+ F 
Sbjct: 160 YPSLLTAIRSIHAHEGSRGFFRGVSAAVAQIVPYMGLFFATYESVRVPISSL---HLPF- 215

Query: 240 NLRATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQ 299
               + D  +G IA +++K GVFPLDLVRKRLQVQGP R  Y   N+P Y + +   +K 
Sbjct: 216 ---GSGDATAGVIASVIAKTGVFPLDLVRKRLQVQGPTRSRYIHQNIPEY-NGVLSTMKM 271

Query: 300 ILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGYTKRLLEKLH 342
           +LR  G+ GLY+GL  +LIK+AP SAVT + Y    ++L++++
Sbjct: 272 VLRDGGVRGLYRGLTVSLIKAAPASAVTMWTYERVLKILKEIN 314



>gi|358400685|gb|EHK50011.1| hypothetical protein TRIATDRAFT_289386 [Trichoderma atroviride IMI
           206040]
          Length = 311

 Score =  271 bits (692), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 143/315 (45%), Positives = 202/315 (64%), Gaps = 17/315 (5%)

Query: 33  CGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIRE 92
            GA+AG+VSRF+ +PLDVVKIRLQLQP    +PL+           Y G  H IK I++ 
Sbjct: 8   AGAIAGLVSRFIVAPLDVVKIRLQLQPYSLSDPLAPLREAPA----YRGTVHTIKHILKH 63

Query: 93  EGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGAI 152
           EG+ GLW GN+ AE +Y+ Y A QF  Y     +F +    Q+ +  +  + + FL+GA+
Sbjct: 64  EGLTGLWKGNVPAELMYVCYSAAQFTAYRS-TTVFLQTAVPQHRR--LPDSAETFLAGAV 120

Query: 153 SGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIP 212
           SG+ AT VTYP DLLRTRFAAQG  R+Y  LR A+  I   EG+RGF+RG+  ++ QIIP
Sbjct: 121 SGAAATSVTYPLDLLRTRFAAQGRHRVYSSLRGALWDIKRDEGFRGFFRGLGPALAQIIP 180

Query: 213 YMGLVFGSYEFLKKLFRKLEDKHI-WFHNLRATEDLLSGAIAGIVSKAGVFPLDLVRKRL 271
           +MG+ F SYE L+    +L D H+ W      ++D  +G +A +++K  VFPLDLVRKR+
Sbjct: 181 FMGIFFASYEGLRL---QLSDLHLPW-----GSDDATAGIMASVMAKTAVFPLDLVRKRI 232

Query: 272 QVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVY 331
           QVQGP R  Y  +++P+Y+S+    I+ I +++G+ GLYKGL  +LIK+AP SA+T + Y
Sbjct: 233 QVQGPTRSKYVYNDIPVYTSA-GRAIRVIFQTEGLRGLYKGLPISLIKAAPASAITLWTY 291

Query: 332 GYTKRLLEKLHSSRD 346
             + RLL      +D
Sbjct: 292 ERSLRLLMSFDEDKD 306



>gi|240273463|gb|EER36983.1| mitochondrial deoxynucleotide carrier [Ajellomyces capsulatus H143]
 gi|325087363|gb|EGC40673.1| mitochondrial deoxynucleotide carrier [Ajellomyces capsulatus H88]
          Length = 324

 Score =  271 bits (692), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 155/343 (45%), Positives = 203/343 (59%), Gaps = 30/343 (8%)

Query: 1   MSQGYEHKPQNQSPIAEQAVAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPG 60
           MS G EH  +  + I  Q VAA           GA AG+VSRF  +PLDVVKIRLQLQ  
Sbjct: 1   MSAGGEHLNEEGNRI--QVVAA-----------GATAGLVSRFCVAPLDVVKIRLQLQIH 47

Query: 61  RPINPLSSRHHNSGTLKKYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTY 120
              +PLS R         Y G    +K I R+EGI GLW GN+ AE LY+ YG +QF +Y
Sbjct: 48  SLSDPLSHRDIKG---PIYKGTISTLKSIFRDEGITGLWKGNIPAELLYICYGGIQFSSY 104

Query: 121 HQMQNLFKRIDSNQNEKFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIY 180
             + +  + +         + + ++ F+SGA++G  AT  TYP DLLRTRFAAQG  RIY
Sbjct: 105 RAISSALRTLPHP------LPQPVESFVSGAVAGGIATTSTYPLDLLRTRFAAQGNDRIY 158

Query: 181 IGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHN 240
             LR +V  I   EG  GF+RG TA++ QI+PYMGL F  YE L+     LE        
Sbjct: 159 ASLRASVCDIARTEGTHGFFRGATAAIAQIVPYMGLFFAGYEALRSPIASLELPF----- 213

Query: 241 LRATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQI 300
              T D  +G +A +++K GVFPLDLVRKRLQVQGP R+ Y  +N+P+Y   ++  I+ I
Sbjct: 214 --GTGDAGAGVVASVIAKTGVFPLDLVRKRLQVQGPTRRRYIHTNIPVY-EGVYRTIRAI 270

Query: 301 LRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGYTKRLLEKLHS 343
           L S G  GLYKGL  +LIK+AP SAVT + Y +   LL++++ 
Sbjct: 271 LASQGPKGLYKGLTVSLIKAAPASAVTMWTYEHVLGLLKEMNC 313



>gi|225554425|gb|EEH02723.1| mitochondrial deoxynucleotide carrier [Ajellomyces capsulatus
           G186AR]
          Length = 323

 Score =  269 bits (688), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 193/316 (61%), Gaps = 17/316 (5%)

Query: 28  IEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIK 87
           I++   GA AG+VSRF  +PLDVVKIRLQLQ     +PLS R         Y G    +K
Sbjct: 15  IQVVAAGATAGLVSRFCVAPLDVVKIRLQLQIHSLSDPLSHRDIKG---PIYKGTISTLK 71

Query: 88  LIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPF 147
            I R+EGI GLW GN+ AE LY+ YG +QF +Y  + +  + +         + +  + F
Sbjct: 72  SIFRDEGITGLWKGNIPAELLYICYGGIQFSSYRAISSALRTLPHP------LPQPAESF 125

Query: 148 LSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASV 207
           +SGA++G  AT  TYP DLLRTRFAAQG  RIY  LR +V  I   EG  GF+RG TA++
Sbjct: 126 ISGAVAGGIATTSTYPLDLLRTRFAAQGNDRIYASLRASVCDIARTEGTHGFFRGATAAI 185

Query: 208 VQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLV 267
            QI+PYMGL F  YE L+     LE           T D  +G +A +++K GVFPLDLV
Sbjct: 186 AQIVPYMGLFFAGYEALRSPIASLELPF-------GTGDAGAGVVASVIAKTGVFPLDLV 238

Query: 268 RKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVT 327
           RKRLQVQGP R+ Y  +N+P+Y   ++  I+ IL S G  GLYKGL  +LIK+AP SAVT
Sbjct: 239 RKRLQVQGPTRRRYIHTNIPVY-EGVYRTIRAILASQGPKGLYKGLTVSLIKAAPASAVT 297

Query: 328 FFVYGYTKRLLEKLHS 343
            + Y +   LL++++ 
Sbjct: 298 MWTYEHVLGLLKEMNC 313



>gi|119481865|ref|XP_001260961.1| mitochondrial deoxynucleotide carrier protein, putative
           [Neosartorya fischeri NRRL 181]
 gi|189039954|sp|A1DI57.1|TPC1_NEOFI RecName: Full=Mitochondrial thiamine pyrophosphate carrier 1
 gi|119409115|gb|EAW19064.1| mitochondrial deoxynucleotide carrier protein, putative
           [Neosartorya fischeri NRRL 181]
          Length = 317

 Score =  269 bits (687), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 145/317 (45%), Positives = 197/317 (62%), Gaps = 18/317 (5%)

Query: 29  EIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKL 88
           ++ + G +AG+VSRF  +PLDVVKIRLQLQ     +P S   H       Y G    ++ 
Sbjct: 16  QVVLSGGIAGLVSRFCVAPLDVVKIRLQLQIHSLSDPAS---HRDVVGPIYKGTLSTMRA 72

Query: 89  IIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFL 148
           II++EGI GLW GN+ AE +Y+ YGA+QF  Y     +  ++D ++     +   L+ F+
Sbjct: 73  IIKQEGITGLWKGNIPAELMYVCYGALQFTAYRTTTQVLAQLDPHR-----LPPALESFV 127

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVV 208
           SGA++G  AT  TYP DLLRTRFAAQG +RIY  L  +VQ I   EG  GF+RG +A+V 
Sbjct: 128 SGAVAGGLATASTYPLDLLRTRFAAQGTERIYTSLLASVQDIARNEGPAGFFRGCSAAVG 187

Query: 209 QIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVR 268
           QI+PYMGL F +YE L+ +   LE+          + D  +G IA +++K GVFPLDLVR
Sbjct: 188 QIVPYMGLFFATYESLRPVLSGLENMPF------GSGDAAAGVIASVLAKTGVFPLDLVR 241

Query: 269 KRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTF 328
           KRLQVQGP R  Y   N+P Y   +F  I  I+R+ G+ GLY+GL  +LIK+AP SA+T 
Sbjct: 242 KRLQVQGPTRTLYVHRNIPEY-RGVFSTIAMIVRTQGVRGLYRGLTVSLIKAAPASAITM 300

Query: 329 FVYGYTKRLLEKLHSSR 345
           + Y   +R L+ LH  R
Sbjct: 301 WTY---ERSLKLLHDFR 314



>gi|154271308|ref|XP_001536507.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
 gi|189039952|sp|A6RF73.1|TPC1_AJECN RecName: Full=Mitochondrial thiamine pyrophosphate carrier 1
 gi|150409177|gb|EDN04627.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
          Length = 324

 Score =  269 bits (687), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 154/343 (44%), Positives = 203/343 (59%), Gaps = 30/343 (8%)

Query: 1   MSQGYEHKPQNQSPIAEQAVAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPG 60
           MS G EH  +  + I  Q VAA           GA AG+VSRF  +PLDVVKIRLQLQ  
Sbjct: 1   MSAGGEHLNEEGNRI--QVVAA-----------GATAGLVSRFCVAPLDVVKIRLQLQIH 47

Query: 61  RPINPLSSRHHNSGTLKKYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTY 120
              +PLS R         Y G    +K I R+EGI GLW GN+ AE LY+ YG +QF +Y
Sbjct: 48  SLSDPLSHRDIKG---PIYKGTISTLKSIFRDEGITGLWKGNIPAELLYICYGGIQFSSY 104

Query: 121 HQMQNLFKRIDSNQNEKFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIY 180
             + +  + +         + + ++ F+SGA++G  AT  TYP DLLRTRFAAQG  RIY
Sbjct: 105 RAISSALRTLPHP------LPQPVESFISGAVAGGIATTSTYPLDLLRTRFAAQGNDRIY 158

Query: 181 IGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHN 240
             LR +V+ I   EG  GF+RG TA++ QI+PYMGL F  YE L+     LE        
Sbjct: 159 ASLRVSVRDIARTEGPHGFFRGATAAIAQIVPYMGLFFAGYEALRSPIASLELPF----- 213

Query: 241 LRATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQI 300
              T D  +G +A +++K GVFPLDLVRKRLQVQGP R+ Y  +N+P+Y   ++  I+ I
Sbjct: 214 --GTGDAGAGVVASVIAKTGVFPLDLVRKRLQVQGPTRRRYIHTNIPVY-EGVYRTIRAI 270

Query: 301 LRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGYTKRLLEKLHS 343
           L S G  GLY+GL  +LIK+AP SAVT + Y +   LL+ ++ 
Sbjct: 271 LASQGPKGLYRGLTVSLIKAAPASAVTMWTYEHVLGLLKDMNC 313



>gi|146323026|ref|XP_755831.2| mitochondrial deoxynucleotide carrier protein [Aspergillus
           fumigatus Af293]
 gi|129558579|gb|EAL93793.2| mitochondrial deoxynucleotide carrier protein, putative
           [Aspergillus fumigatus Af293]
 gi|159129888|gb|EDP55002.1| mitochondrial deoxynucleotide carrier protein, putative
           [Aspergillus fumigatus A1163]
          Length = 341

 Score =  268 bits (685), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 142/310 (45%), Positives = 198/310 (63%), Gaps = 15/310 (4%)

Query: 29  EIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKL 88
           ++ + G +AG+VSRF  +PLDVVKIRLQLQ     +P +S H   G +  Y G    ++ 
Sbjct: 40  QVVLSGGIAGLVSRFCVAPLDVVKIRLQLQIHSLSDP-ASHHDVVGPI--YKGTLSTMRT 96

Query: 89  IIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFL 148
           II++EGI GLW GN+ AE +Y+ YGA+QF  Y     +  ++D ++     +   L+ F+
Sbjct: 97  IIKQEGITGLWKGNIPAELMYVCYGALQFTAYRTTTQILAQLDPHR-----LPPALESFV 151

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVV 208
           SGA++G  AT  TYP DLLRTRFAAQG +RIY  L  +V+ I   EG  GF+RG +A+V 
Sbjct: 152 SGAVAGGLATASTYPLDLLRTRFAAQGTERIYTSLLASVRDIARSEGPAGFFRGCSAAVG 211

Query: 209 QIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVR 268
           QI+PYMGL F +YE L+ +   LE+          + D  +G IA +++K+GVFPLDLVR
Sbjct: 212 QIVPYMGLFFATYESLRPVLSGLENMPF------GSGDAAAGVIASVLAKSGVFPLDLVR 265

Query: 269 KRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTF 328
           KRLQVQGP R  Y   N+P Y   +F  I  I+R+ G+ GLY+GL  +LIK+AP SA+T 
Sbjct: 266 KRLQVQGPTRTLYVHRNIPEY-RGVFSTIAMIVRTQGVRGLYRGLTVSLIKAAPASAITM 324

Query: 329 FVYGYTKRLL 338
           + Y  + +LL
Sbjct: 325 WTYERSLKLL 334



>gi|322708672|gb|EFZ00249.1| Mitochondrial thiamine pyrophosphate carrier 1 [Metarhizium
           anisopliae ARSEF 23]
          Length = 394

 Score =  268 bits (685), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 142/321 (44%), Positives = 201/321 (62%), Gaps = 17/321 (5%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           + +++   GA+AG+VSRF+ +PLDVVKIRLQLQP  P +PL+       T     G    
Sbjct: 88  TKLQVVSAGAIAGLVSRFIVAPLDVVKIRLQLQPYSPSDPLTPLR----TAPACRGTVAT 143

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQ 145
           ++ I+R EG+  LW GN+ AE LY+ Y A+QF TY       +     +     +    +
Sbjct: 144 LRHILRHEGLTALWKGNVPAELLYVCYAAIQFTTYRTTTLFLQTALPTR-----LPDAAE 198

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTA 205
            F++GA SG+ AT +TYP DLLRTRFAAQG +RIY  LR+AV+ I   EGYRGF+RG++ 
Sbjct: 199 SFIAGASSGALATSITYPLDLLRTRFAAQGRRRIYGSLRSAVRDIRRDEGYRGFFRGISP 258

Query: 206 SVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLD 265
           ++ QI+P+MG+ F +YE L+    +       F+     ED  +G +  +V+K  VFPLD
Sbjct: 259 ALGQIVPFMGIFFVTYEGLRIQLSR-------FNVPWGGEDATAGVVGSVVAKTAVFPLD 311

Query: 266 LVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSA 325
           LVRKR+QVQGP R  Y   ++P Y+S++   I  I R++G+ GLYKGL  +LIKSAP SA
Sbjct: 312 LVRKRIQVQGPTRARYVYGDIPEYTSALR-GIAAIARTEGLRGLYKGLPISLIKSAPASA 370

Query: 326 VTFFVYGYTKRLLEKLHSSRD 346
           VT + Y  + +LL  L +SR+
Sbjct: 371 VTVWTYERSLKLLMNLDASRE 391



>gi|182705188|sp|Q4X022.3|TPC1_ASPFU RecName: Full=Mitochondrial thiamine pyrophosphate carrier 1
          Length = 317

 Score =  268 bits (685), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 142/312 (45%), Positives = 198/312 (63%), Gaps = 15/312 (4%)

Query: 29  EIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKL 88
           ++ + G +AG+VSRF  +PLDVVKIRLQLQ     +P +S H   G +  Y G    ++ 
Sbjct: 16  QVVLSGGIAGLVSRFCVAPLDVVKIRLQLQIHSLSDP-ASHHDVVGPI--YKGTLSTMRT 72

Query: 89  IIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFL 148
           II++EGI GLW GN+ AE +Y+ YGA+QF  Y     +  ++D ++     +   L+ F+
Sbjct: 73  IIKQEGITGLWKGNIPAELMYVCYGALQFTAYRTTTQILAQLDPHR-----LPPALESFV 127

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVV 208
           SGA++G  AT  TYP DLLRTRFAAQG +RIY  L  +V+ I   EG  GF+RG +A+V 
Sbjct: 128 SGAVAGGLATASTYPLDLLRTRFAAQGTERIYTSLLASVRDIARSEGPAGFFRGCSAAVG 187

Query: 209 QIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVR 268
           QI+PYMGL F +YE L+ +   LE+          + D  +G IA +++K+GVFPLDLVR
Sbjct: 188 QIVPYMGLFFATYESLRPVLSGLENMPF------GSGDAAAGVIASVLAKSGVFPLDLVR 241

Query: 269 KRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTF 328
           KRLQVQGP R  Y   N+P Y   +F  I  I+R+ G+ GLY+GL  +LIK+AP SA+T 
Sbjct: 242 KRLQVQGPTRTLYVHRNIPEY-RGVFSTIAMIVRTQGVRGLYRGLTVSLIKAAPASAITM 300

Query: 329 FVYGYTKRLLEK 340
           + Y  + +LL  
Sbjct: 301 WTYERSLKLLRD 312



>gi|296805666|ref|XP_002843657.1| mitochondrial deoxynucleotide carrier [Arthroderma otae CBS 113480]
 gi|238844959|gb|EEQ34621.1| mitochondrial deoxynucleotide carrier [Arthroderma otae CBS 113480]
          Length = 318

 Score =  266 bits (681), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 143/318 (44%), Positives = 196/318 (61%), Gaps = 15/318 (4%)

Query: 29  EIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKL 88
           ++ + GA+AG+VSRF  +PLDVVKIRLQLQ     +PLS R         Y G    +  
Sbjct: 16  QVVVAGAIAGLVSRFCIAPLDVVKIRLQLQVHSLSDPLSHRDVKG---PIYKGTISTLVA 72

Query: 89  IIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFL 148
           I R+EGI GLW GN+ AE LY+ YG +QF  Y  +  L   +             ++ F+
Sbjct: 73  IARQEGITGLWKGNIPAEILYICYGGIQFTAYRSVTQLLHLLPPQHRAP----APVESFI 128

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVV 208
           SGA +G  AT  TYPFDLLRTRFAAQG  ++Y  L ++++ IY  EG  GF+RG++A+V 
Sbjct: 129 SGATAGGVATASTYPFDLLRTRFAAQGNDKVYHSLASSIRDIYRHEGPSGFFRGISAAVA 188

Query: 209 QIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVR 268
           Q++PYMGL F +YE L++    ++   + F     + D  +G IA +++K GVFPLDLVR
Sbjct: 189 QVVPYMGLFFAAYESLRQPISYVD---LPF----GSGDATAGIIASVMAKTGVFPLDLVR 241

Query: 269 KRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTF 328
           KRLQVQGP R  Y   N+P Y   +   I+ I+R+ GI GLY+GL  +LIK+AP SAVT 
Sbjct: 242 KRLQVQGPTRSRYVHMNIPEY-HGVVSTIQTIVRTQGIRGLYRGLTVSLIKAAPTSAVTM 300

Query: 329 FVYGYTKRLLEKLHSSRD 346
           + Y     +L++L S RD
Sbjct: 301 WTYERVMAVLKELDSDRD 318



>gi|425767863|gb|EKV06416.1| Mitochondrial deoxynucleotide carrier protein, putative
           [Penicillium digitatum PHI26]
 gi|425783794|gb|EKV21615.1| Mitochondrial deoxynucleotide carrier protein, putative
           [Penicillium digitatum Pd1]
          Length = 318

 Score =  266 bits (681), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 140/319 (43%), Positives = 196/319 (61%), Gaps = 16/319 (5%)

Query: 29  EIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKL 88
           ++ + G +AG++SRF  +PLDVVKIRLQLQ     +P S   H S     Y G    ++ 
Sbjct: 16  QVILAGGIAGLISRFCIAPLDVVKIRLQLQIHSLSDPAS---HQSVNGPIYKGTLSTLRT 72

Query: 89  IIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFL 148
           I+R+EGI GLW GN+ AE +Y+ YGA+QF TY        ++ S     + + + ++ F+
Sbjct: 73  IMRQEGITGLWKGNVPAEMMYVCYGAIQFTTYRGTTQALAQLGS-----YRLPQPVESFI 127

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVV 208
           SGA++G  AT VTYP DLLRTRFAAQG  R+Y  LR ++  I   EG  GF+RG +A+V 
Sbjct: 128 SGAMAGGCATGVTYPLDLLRTRFAAQGPDRVYGSLRASILDIARHEGAPGFFRGCSAAVA 187

Query: 209 QIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVR 268
           QI+PYMGL F +YE L+           W      + D  +G +A +++K GVFPLDLVR
Sbjct: 188 QIVPYMGLFFTTYEALRPAM-------TWDALPLGSGDAAAGVVASVLAKTGVFPLDLVR 240

Query: 269 KRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTF 328
           KRLQVQGP R  Y   N+P Y   +   I  I R+ G+ GLY+GL  +L+K+AP SAVT 
Sbjct: 241 KRLQVQGPTRTRYVHRNIPEY-KGVLQSIATIFRTHGVRGLYRGLTVSLLKAAPASAVTM 299

Query: 329 FVYGYTKRLLEKLHSSRDK 347
           + Y +  ++L++LH + D 
Sbjct: 300 WTYEHALKVLQELHVAVDN 318



>gi|384490150|gb|EIE81372.1| hypothetical protein RO3G_06077 [Rhizopus delemar RA 99-880]
          Length = 301

 Score =  265 bits (678), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 146/320 (45%), Positives = 201/320 (62%), Gaps = 30/320 (9%)

Query: 20  VAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKY 79
           +  + LSS ++  CG VAG+VSRFV +PLDVVKIR+QLQ        S    N+    KY
Sbjct: 5   ITDADLSSNQLAFCGGVAGVVSRFVIAPLDVVKIRMQLQTH------SVHVKNNKQPIKY 58

Query: 80  NGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFG 139
           + +   +K I++EEGIRGL+ GN+ AEYLYLSY  ++F +Y +++ L   I+SNQ +   
Sbjct: 59  SSILQTLKTIMKEEGIRGLYKGNMPAEYLYLSYTMIEFWSYKELEQL---IESNQKQ--- 112

Query: 140 INKTLQPFLSGAISGSTATIVTYPFDLLRTRFA-AQGEKRIYIGLRNAVQQIYVQEGYRG 198
           I +TL+ F  G I+GS AT  TYPFDLLRT+FA AQ   R+       +  IY +EGYRG
Sbjct: 113 IPETLKSFGCGMIAGSIATASTYPFDLLRTQFAIAQKNHRV----PQEIMNIYKKEGYRG 168

Query: 199 FYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSK 258
           FY+G+  +++QI+PYMGL+F SY+   K F+KL D        + T D++SGA++G+ SK
Sbjct: 169 FYKGLWPAIIQIMPYMGLLFSSYDIFAKGFKKLRDSERVSSAYKPTHDMMSGALSGMTSK 228

Query: 259 AGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALI 318
             V+P DLVRKRLQVQG        + +P Y+     C   + + +G   LYKGL P+LI
Sbjct: 229 IAVYPFDLVRKRLQVQG--------TPIPWYT-----CFYNVAKQEGARSLYKGLAPSLI 275

Query: 319 KSAPVSAVTFFVYGYTKRLL 338
           K AP +AVTF V+   K  L
Sbjct: 276 KVAPANAVTFMVFEEAKDFL 295



>gi|145250689|ref|XP_001396858.1| thiamine pyrophosphate carrier 1 [Aspergillus niger CBS 513.88]
 gi|189039953|sp|A2R5A0.1|TPC1_ASPNC RecName: Full=Mitochondrial thiamine pyrophosphate carrier 1
 gi|134082380|emb|CAK42395.1| unnamed protein product [Aspergillus niger]
 gi|350636284|gb|EHA24644.1| hypothetical protein ASPNIDRAFT_182498 [Aspergillus niger ATCC
           1015]
          Length = 321

 Score =  265 bits (678), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 141/319 (44%), Positives = 196/319 (61%), Gaps = 15/319 (4%)

Query: 29  EIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKL 88
           ++ + G +AG+VSRF  +PLDVVKIRLQLQ     +P+S   H   T   Y G    ++ 
Sbjct: 16  QVVLAGGIAGLVSRFCVAPLDVVKIRLQLQIHSLSDPIS---HRDVTGPIYKGTLSTMRD 72

Query: 89  IIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFL 148
           IIR+EGI GLW GN+ AE +Y+ YG +QF  Y        ++D+     + +  + + F+
Sbjct: 73  IIRQEGITGLWKGNIPAELMYVCYGVIQFSAYRTTTQALAQLDT-----YRLPPSAESFV 127

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVV 208
           +GA +G  AT  TYP DLLRTRFAAQG  R+Y  L ++V+ I   EGY GF+RG +A+V 
Sbjct: 128 AGATAGGLATASTYPLDLLRTRFAAQGTDRVYTSLMSSVRDIARNEGYAGFFRGCSAAVG 187

Query: 209 QIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVR 268
           QI+PYMGL F +YE L+    + +D          + D  +G IA + SK  +FPLDL+R
Sbjct: 188 QIVPYMGLFFATYEALRPPLAQYQDLPF------GSGDAAAGVIASVSSKTVMFPLDLIR 241

Query: 269 KRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTF 328
           KRLQVQGP R+ Y   N+P Y   +F  +K ILR+ GI GLY+GL  +L K+AP SAVT 
Sbjct: 242 KRLQVQGPTRQLYIHRNIPEY-QGVFNTMKLILRTQGIRGLYRGLTVSLFKAAPASAVTM 300

Query: 329 FVYGYTKRLLEKLHSSRDK 347
           + Y  + RLL+ +  +  K
Sbjct: 301 WTYETSLRLLQDMEVATSK 319



>gi|452987927|gb|EME87682.1| hypothetical protein MYCFIDRAFT_75527 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 324

 Score =  265 bits (677), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 140/315 (44%), Positives = 198/315 (62%), Gaps = 14/315 (4%)

Query: 29  EIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKL 88
           ++ + GA++G++SRF  +PLDV+KIRLQL      +PLS         +   G+S  ++ 
Sbjct: 15  QVVVAGAISGLISRFCIAPLDVIKIRLQLHYHSLADPLSQPFRP----RSSAGVSSVVRD 70

Query: 89  IIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFL 148
           I + EGI G W GN+ AE LYLSYGAVQFLTY        +I   +N +F I  + + F+
Sbjct: 71  IWQHEGITGFWKGNIPAEGLYLSYGAVQFLTYRSTTQALDKI--TENGRFSIPGSAKSFI 128

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVV 208
            GA++G+ AT +TYP DLLRTRFAAQG +R+Y GL  +V++I   EG  GF+RG+ A + 
Sbjct: 129 GGAVAGTAATTLTYPLDLLRTRFAAQGTERVYDGLIASVREITRNEGSAGFFRGLNAGIG 188

Query: 209 QIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVR 268
           QI+PYMGL F  YE LK     L    + F     + D ++G +A I+SK+ VFPLD VR
Sbjct: 189 QIVPYMGLFFALYESLKP---PLASVQLPF----GSGDAVAGVMASILSKSAVFPLDTVR 241

Query: 269 KRLQVQGPNRKDYFISN-VPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVT 327
           KRLQVQGP R+ Y   N +P+Y   +   ++ IL+ +G  GLY+GL  +L+K+AP SAVT
Sbjct: 242 KRLQVQGPTRQRYAGGNKIPVYERGVLSTLRMILKKEGTIGLYRGLSVSLVKAAPSSAVT 301

Query: 328 FFVYGYTKRLLEKLH 342
            + Y  T  +L++  
Sbjct: 302 MYAYERTLHMLQRFE 316



>gi|407918626|gb|EKG11895.1| Mitochondrial carrier protein [Macrophomina phaseolina MS6]
          Length = 336

 Score =  265 bits (677), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 145/309 (46%), Positives = 190/309 (61%), Gaps = 22/309 (7%)

Query: 33  CGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIRE 92
            GA+AG+VSRFV +PLDV+KIRLQLQ     +PLS  HH++     Y G    +K I+RE
Sbjct: 20  SGAIAGLVSRFVIAPLDVIKIRLQLQIHSLSDPLS--HHSARGGPIYKGTLGTLKHILRE 77

Query: 93  EGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLF-------KRIDSNQNEKFG---INK 142
           EG+ GLW GN+ AE LYL YG+VQFL Y              K  DS+  +      +  
Sbjct: 78  EGLTGLWKGNVPAEALYLCYGSVQFLAYRSTSTFLQSLSFPAKTTDSHGRQHATDRRLPD 137

Query: 143 TLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRG 202
           +   F SGA++G+ AT +TYP DLLRTRFAAQG  R+Y  L +++ +I   EG +GF+RG
Sbjct: 138 SFMTFASGAVAGTAATTITYPLDLLRTRFAAQGTSRVYASLLSSIAEIARAEGPQGFFRG 197

Query: 203 VTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVF 262
           + A++ QI+PYMGL F SYE LK +   L            + D  +G IA  VSK  VF
Sbjct: 198 LAAAIAQIVPYMGLFFLSYETLKPVSAALP---------FGSGDAAAGMIASAVSKTAVF 248

Query: 263 PLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAP 322
           PLD VRKRLQVQGP R  Y   N+P Y + +   +K ILR +G+ GLY+GL  +L+K+AP
Sbjct: 249 PLDTVRKRLQVQGPTRARYVHRNIPEY-AGVLETVKAILRREGMRGLYRGLTVSLLKAAP 307

Query: 323 VSAVTFFVY 331
            SAVT + Y
Sbjct: 308 TSAVTMWTY 316



 Score = 77.8 bits (190), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 92/211 (43%), Gaps = 34/211 (16%)

Query: 33  CGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIRE 92
            GAVAG  +  +  PLD+++ R   Q               GT + Y  +  +I  I R 
Sbjct: 144 SGAVAGTAATTITYPLDLLRTRFAAQ---------------GTSRVYASLLSSIAEIARA 188

Query: 93  EGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGAI 152
           EG +G + G  +A    + Y  + FL+Y  ++ +   +     +            +G I
Sbjct: 189 EGPQGFFRGLAAAIAQIVPYMGLFFLSYETLKPVSAALPFGSGDA----------AAGMI 238

Query: 153 SGSTATIVTYPFDLLRTRFAAQGEKRI---------YIGLRNAVQQIYVQEGYRGFYRGV 203
           + + +    +P D +R R   QG  R          Y G+   V+ I  +EG RG YRG+
Sbjct: 239 ASAVSKTAVFPLDTVRKRLQVQGPTRARYVHRNIPEYAGVLETVKAILRREGMRGLYRGL 298

Query: 204 TASVVQIIPYMGLVFGSYEFLKKLFRKLEDK 234
           T S+++  P   +   +YE + K+F  +E+K
Sbjct: 299 TVSLLKAAPTSAVTMWTYERVMKIFLAVEEK 329



>gi|115401756|ref|XP_001216466.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gi|121735549|sp|Q0CEN9.1|TPC1_ASPTN RecName: Full=Mitochondrial thiamine pyrophosphate carrier 1
 gi|114190407|gb|EAU32107.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 320

 Score =  265 bits (676), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 144/319 (45%), Positives = 196/319 (61%), Gaps = 16/319 (5%)

Query: 29  EIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKL 88
           ++ + G +AG+VSRF  +PLDVVKIRLQLQ     +P SS  + SG +  Y G    ++ 
Sbjct: 16  QVVLAGGIAGLVSRFCVAPLDVVKIRLQLQIHSLSDP-SSHRNVSGPI--YKGTISTMRA 72

Query: 89  IIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFL 148
           IIREEGI GLW GN+ AE +Y+ YG VQF TY        ++         + + ++ F+
Sbjct: 73  IIREEGITGLWKGNIPAELMYVCYGGVQFTTYRTTTQALAQLPHR------LPQPVESFV 126

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVV 208
           +GA +G  AT  TYP DLLRTRFAAQG +R+Y  L  +V+ I   EG  GF+RG +A+V 
Sbjct: 127 AGASAGGLATAATYPLDLLRTRFAAQGTERVYTSLLASVRDIARIEGPAGFFRGCSAAVG 186

Query: 209 QIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVR 268
           QI+PYMGL F +YE L+     ++D          + D L+G IA +++K GVFPLDLVR
Sbjct: 187 QIVPYMGLFFATYESLRPSLATVQDLPF------GSGDALAGMIASVLAKTGVFPLDLVR 240

Query: 269 KRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTF 328
           KRLQVQGP R  Y   N+P Y   +F  +  ILR+ G+ GLY+GL  +L K+AP SAVT 
Sbjct: 241 KRLQVQGPTRSRYIHRNIPEY-RGVFNTLALILRTQGVRGLYRGLTVSLFKAAPASAVTM 299

Query: 329 FVYGYTKRLLEKLHSSRDK 347
           + Y  T R L+ +  +  K
Sbjct: 300 WTYEETLRALQAMEVAAQK 318



>gi|389641881|ref|XP_003718573.1| mitochondrial thiamine pyrophosphate carrier 1 [Magnaporthe oryzae
           70-15]
 gi|187479896|sp|A4RF23.2|TPC1_MAGO7 RecName: Full=Mitochondrial thiamine pyrophosphate carrier 1
 gi|351641126|gb|EHA48989.1| mitochondrial thiamine pyrophosphate carrier 1 [Magnaporthe oryzae
           70-15]
          Length = 327

 Score =  264 bits (674), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 145/322 (45%), Positives = 190/322 (59%), Gaps = 12/322 (3%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           S +++ + GA AGM++RFV +PLDVVKIRLQLQ     +PLS R         Y G    
Sbjct: 14  SKLQVVVAGATAGMIARFVIAPLDVVKIRLQLQTHSLSDPLSQRAELLRGGPVYKGTLST 73

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQ 145
           ++ I R+EGI GLW GN+ AE LY++Y AVQF TY     L  R+     +   +    +
Sbjct: 74  MRHIARQEGITGLWKGNVPAELLYITYSAVQFATYRSAAQLLHRVAGEDRQ---LPAAAE 130

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQG--EKRIYIGLRNAVQQIYVQEGYRGFYRGV 203
            F++GA +G T+T VTYP DLLRTRFAAQG  + R+Y  LR AV  I+  EGYRGF+RG+
Sbjct: 131 SFVAGAAAGVTSTTVTYPLDLLRTRFAAQGSGDDRVYQSLRRAVADIWRDEGYRGFFRGI 190

Query: 204 TASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFP 263
             +V Q  P+MG+ F +YE L+     L+    W   L      L+   A  ++K  VFP
Sbjct: 191 GPAVGQTFPFMGIFFAAYESLRAPLADLK-LPFWGGQL-----ALASMTASTLAKTAVFP 244

Query: 264 LDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPV 323
           LDLVR+R+QVQGP R  Y   N+P Y  + F  I  I R++G  GLY+GL  +LIKSAP 
Sbjct: 245 LDLVRRRIQVQGPTRSKYVHKNIPEYKGT-FSTISTIARTEGFRGLYRGLTVSLIKSAPA 303

Query: 324 SAVTFFVYGYTKRLLEKLHSSR 345
           SAVT + Y    R L    S R
Sbjct: 304 SAVTMWTYERVLRALITFQSGR 325



>gi|470318824|gb|EMR10465.1| hypothetical protein PNEG_01179 [Pneumocystis murina B123]
          Length = 318

 Score =  264 bits (674), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 138/319 (43%), Positives = 199/319 (62%), Gaps = 17/319 (5%)

Query: 27  SIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAI 86
           SI+  I G ++G  +RF+ SP DV+KIR+QLQ   P+ PL  + HNS T   +  +   +
Sbjct: 17  SIKSAISGGISGFTTRFIISPFDVIKIRMQLQI-LPVFPL--KEHNS-TNYPFQRIIRLV 72

Query: 87  KLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQP 146
           K II +EGI  LW GN  ++ LY+SYG+ QF TY + +    RI   +    G     + 
Sbjct: 73  KQIIHQEGILALWKGNCFSQILYMSYGSCQFFTYAKCKFFLDRIFPEKTYNSG-----KT 127

Query: 147 FLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTAS 206
           F+SGAI+G+ AT  +YPFDLLRTRFAAQG  ++Y+ + ++++ +Y+ EG +GFYRG+ AS
Sbjct: 128 FVSGAIAGAVATTASYPFDLLRTRFAAQGVSKVYLSIPHSIKSVYISEGIKGFYRGINAS 187

Query: 207 VVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDL 266
           ++QI+PYMG VFG YE  K     +     W        D L+G ++G V K  VFPLDL
Sbjct: 188 ILQIVPYMGTVFGLYESSKTYLSNIGYSSSW-------TDALAGLVSGTVGKTIVFPLDL 240

Query: 267 VRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAV 326
           +RKRLQVQGP RK YF  ++P+Y+  I   I  I +S+G  GLYKG   +++++AP +A+
Sbjct: 241 IRKRLQVQGPTRKKYFYKDIPVYNKVIKTGI-IIFKSEGFLGLYKGWWISVLRAAPSTAI 299

Query: 327 TFFVYGYTKRLLEKLHSSR 345
           T +VY  +   + KL   R
Sbjct: 300 TLWVYQRSLNFINKLEEQR 318



>gi|156050337|ref|XP_001591130.1| hypothetical protein SS1G_07755 [Sclerotinia sclerotiorum 1980]
 gi|206557751|sp|A7ER02.1|TPC1_SCLS1 RecName: Full=Mitochondrial thiamine pyrophosphate carrier 1
 gi|154692156|gb|EDN91894.1| hypothetical protein SS1G_07755 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 322

 Score =  263 bits (673), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 141/315 (44%), Positives = 199/315 (63%), Gaps = 14/315 (4%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIR 91
           I GA AG+++RFV +PLDVVKIRLQLQ     +PLS R      +  Y G    IK I R
Sbjct: 19  IAGATAGLIARFVIAPLDVVKIRLQLQSHSASDPLSHRDLRGSLI--YKGTLPTIKRIFR 76

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGA 151
           EEG+  LW GN+ AE +Y+SY A+QF TY  +    +  D+    +  +    + F++GA
Sbjct: 77  EEGLSALWKGNVPAELMYVSYSAIQFTTYRSVTLALQ--DTVGEHR--MPAAAESFIAGA 132

Query: 152 ISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQII 211
            +G+ AT  TYP DLLRTRFAAQG +RIY  LR +++ I V EG RGF++G+ A V QII
Sbjct: 133 SAGAVATTATYPLDLLRTRFAAQGVERIYTSLRASIRDIAVNEGPRGFFQGLGAGVGQII 192

Query: 212 PYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVRKRL 271
           PYMG+ F +YE L+     L   H+ F     + D  +G +A +++K G+FP DL+RKRL
Sbjct: 193 PYMGIFFATYETLRVPLGTL---HMPF----GSGDATAGVLASVIAKTGIFPFDLIRKRL 245

Query: 272 QVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVY 331
           QVQGP R+ Y   N+P+Y + +F  ++ I++++G  GLY+GL  +L K+AP SAVT + Y
Sbjct: 246 QVQGPTRERYVHKNIPVY-NGVFRTMRHIIQNEGYRGLYRGLTVSLFKAAPASAVTMWTY 304

Query: 332 GYTKRLLEKLHSSRD 346
               RLL K   +++
Sbjct: 305 ERVLRLLLKWEKAQE 319



>gi|367019834|ref|XP_003659202.1| hypothetical protein MYCTH_2295918 [Myceliophthora thermophila ATCC
           42464]
 gi|347006469|gb|AEO53957.1| hypothetical protein MYCTH_2295918 [Myceliophthora thermophila ATCC
           42464]
          Length = 327

 Score =  263 bits (673), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 145/327 (44%), Positives = 196/327 (59%), Gaps = 21/327 (6%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           + +E+   GA AG+++RFV +PLDVVKIRLQLQ     +PLS R+   G +  Y G    
Sbjct: 13  TRLEVTAAGATAGLIARFVTAPLDVVKIRLQLQTHSLSDPLSHRNLQGGPI--YKGTLPT 70

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQ 145
           I  I+R EG+ GLW GN+ AE LY+ YGAVQF  Y     LF  + S   E   + ++ +
Sbjct: 71  ICHILRHEGLAGLWKGNVPAELLYVCYGAVQFTAYRS-TTLF--LHSAFGEG-ALPQSAE 126

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTA 205
            F++GA+ G  AT+ TYP DLLRTRFAAQG  R+Y GL  AV QI  +EG RGF+RG+  
Sbjct: 127 SFIAGAVGGGIATVATYPLDLLRTRFAAQGNDRVYTGLWRAVCQISREEGLRGFFRGLAP 186

Query: 206 SVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLD 265
            + QI+PYMG  F +YE L+     LE          ++   ++G +A +++K G FPLD
Sbjct: 187 GLAQIVPYMGFFFAAYETLRPPLSGLELPF-------SSGGAVAGTMASVLAKTGTFPLD 239

Query: 266 LVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSA 325
           LVRKR+QVQGP R  Y   N+P Y       ++ ILR +G+ GLY+GL  +L+K+AP SA
Sbjct: 240 LVRKRIQVQGPTRGRYVHKNIPEYYGGTIGAVRTILRMEGLRGLYRGLTVSLLKAAPTSA 299

Query: 326 VTFFVY--------GYTKRLLEKLHSS 344
           VT + Y        G   RL E+   S
Sbjct: 300 VTMWTYERALSFYSGLGNRLRERREDS 326



>gi|255930711|ref|XP_002556912.1| Pc12g00060 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211581531|emb|CAP79633.1| Pc12g00060 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 318

 Score =  263 bits (672), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 138/318 (43%), Positives = 194/318 (61%), Gaps = 16/318 (5%)

Query: 29  EIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKL 88
           ++ + G +AG++SRF  +PLDVVKIRLQLQ     +P S +  N      Y G    ++ 
Sbjct: 16  QVVLAGGIAGLISRFCIAPLDVVKIRLQLQIHSLSDPASHQRING---PVYKGTLSTMRT 72

Query: 89  IIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFL 148
           I+ +EGI GLW GN+ AE +Y+ YGA QF  Y         + S     + + + ++ FL
Sbjct: 73  IMTQEGITGLWKGNIPAEMMYVCYGATQFTAYRGTTQALAELGS-----YRLPQPVESFL 127

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVV 208
           SGA++G  AT VTYP DLLRTRFAAQG +R+Y  LR ++ +I   EG  GF+RG +A+V 
Sbjct: 128 SGAVAGGCATGVTYPLDLLRTRFAAQGPERVYGSLRASIVEIARHEGLPGFFRGCSAAVA 187

Query: 209 QIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVR 268
           QI+PYMGL F +YE L+           W      T D  +G +A +++K GVFPLDLVR
Sbjct: 188 QIVPYMGLFFTTYEALRPAM-------TWDALPLGTGDAAAGVVASVLAKTGVFPLDLVR 240

Query: 269 KRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTF 328
           KRLQVQGP R  Y   N+P Y   +   I  I+R+ G+ GLY+GL  +L+K+AP SAVT 
Sbjct: 241 KRLQVQGPTRTRYVHRNIPEY-KGVLKSISMIIRTQGVRGLYRGLTVSLLKAAPASAVTM 299

Query: 329 FVYGYTKRLLEKLHSSRD 346
           + Y +  ++L +L+ + D
Sbjct: 300 WTYEHALKVLRELNLATD 317



>gi|327305555|ref|XP_003237469.1| mitochondrial thiamine pyrophosphate carrier [Trichophyton rubrum
           CBS 118892]
 gi|326460467|gb|EGD85920.1| mitochondrial thiamine pyrophosphate carrier [Trichophyton rubrum
           CBS 118892]
          Length = 316

 Score =  263 bits (671), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 142/311 (45%), Positives = 191/311 (61%), Gaps = 15/311 (4%)

Query: 33  CGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIRE 92
            GA+AG+VSRF  +PLDVVKIRLQLQ     +PLS R         Y G   ++  I R+
Sbjct: 20  AGAIAGLVSRFCIAPLDVVKIRLQLQIHSLSDPLSHRDVKG---PIYKGTISSLVAIARQ 76

Query: 93  EGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGAI 152
           EGI GLW GN+ AE LY+ YG +QF  Y  +  L   +         +   ++ F+SGA 
Sbjct: 77  EGITGLWKGNIPAEILYICYGGIQFTAYRSVTQLLHLLPPQHR----VPSPVESFISGAT 132

Query: 153 SGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIP 212
           +G  AT  TYPFDLLRTRFAAQG  ++Y  L ++V+ IY  EG  GF+RGV+A+V Q++P
Sbjct: 133 AGGVATASTYPFDLLRTRFAAQGNNKVYNSLVSSVRDIYRYEGAGGFFRGVSAAVAQVVP 192

Query: 213 YMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVRKRLQ 272
           YMGL F +YE L+K    ++           + D  +G IA +++K GVFPLDLVRKRLQ
Sbjct: 193 YMGLFFAAYEALRKPISSVDLPF-------GSGDATAGMIASVMAKTGVFPLDLVRKRLQ 245

Query: 273 VQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYG 332
           VQGP R  Y   N+P Y   +   I+ I+R+ G+ GLY+GL  +LIK+AP SAVT + Y 
Sbjct: 246 VQGPTRSKYVHVNIPEY-HGVASTIQTIVRTQGVRGLYRGLTVSLIKAAPASAVTMWTYE 304

Query: 333 YTKRLLEKLHS 343
               +L++L S
Sbjct: 305 RVMAVLKELDS 315



>gi|315046672|ref|XP_003172711.1| mitochondrial deoxynucleotide carrier [Arthroderma gypseum CBS
           118893]
 gi|311343097|gb|EFR02300.1| mitochondrial deoxynucleotide carrier [Arthroderma gypseum CBS
           118893]
          Length = 316

 Score =  262 bits (669), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 152/343 (44%), Positives = 199/343 (58%), Gaps = 28/343 (8%)

Query: 1   MSQGYEHKPQNQSPIAEQAVAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPG 60
           MS G EH     +    Q VAA           GA+AG+VSRF  +PLDVVKIRLQLQ  
Sbjct: 1   MSAGGEHLKDEGN--RTQVVAA-----------GAIAGLVSRFCIAPLDVVKIRLQLQIH 47

Query: 61  RPINPLSSRHHNSGTLKKYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTY 120
              +PLS R         Y G    +  I R+EGI GLW GN+ AE LY+ YG +QF  Y
Sbjct: 48  SLSDPLSHRDVKG---PIYKGTVSTLFAIARQEGITGLWKGNIPAEILYICYGGIQFTAY 104

Query: 121 HQMQNLFKRIDSNQNEKFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIY 180
             +  L   +         I   ++ F+SGA +G  AT  TYPFDLLRTRFAAQG  ++Y
Sbjct: 105 RSVTQLLHLLPPQHR----IPGPVETFISGATAGGIATASTYPFDLLRTRFAAQGNNKVY 160

Query: 181 IGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHN 240
             L ++V+ IY  EG  GF+RGVTA+V Q++PYMGL F +YE L+K    ++        
Sbjct: 161 RSLVSSVRDIYCYEGAGGFFRGVTAAVAQVVPYMGLFFVAYEALRKPLSTVDLPF----- 215

Query: 241 LRATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQI 300
              + D  +G IA +++K GVFPLDLVRKRLQVQGP R  Y   N+P Y   +   I+ I
Sbjct: 216 --GSGDATAGMIASVLAKTGVFPLDLVRKRLQVQGPTRSKYVHVNIPEY-HGVVSTIRTI 272

Query: 301 LRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGYTKRLLEKLHS 343
           + + G+ GLY+GL  +LIK+AP SAVT + Y     +L++L S
Sbjct: 273 VATQGVRGLYRGLTVSLIKAAPASAVTMWTYERAMAVLKELDS 315



>gi|242761373|ref|XP_002340167.1| mitochondrial deoxynucleotide carrier protein, putative
           [Talaromyces stipitatus ATCC 10500]
 gi|218723363|gb|EED22780.1| mitochondrial deoxynucleotide carrier protein, putative
           [Talaromyces stipitatus ATCC 10500]
          Length = 314

 Score =  261 bits (668), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 138/304 (45%), Positives = 196/304 (64%), Gaps = 17/304 (5%)

Query: 29  EIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHN-SGTLKKYNGMSHAIK 87
           ++ I G +AG+VSRF  +PLDVVKIRLQLQ     +P+S  HH   G +  Y G    ++
Sbjct: 16  QVVIAGGIAGLVSRFCVAPLDVVKIRLQLQIHSLSDPVS--HHGIKGPI--YKGTLRTMQ 71

Query: 88  LIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPF 147
            I+REEGI GLW GN+SAE LY+ YG +QF+TY     + + +         +  T + F
Sbjct: 72  AIVREEGIAGLWKGNISAELLYVCYGGLQFVTYRTTTQILEELPRR------LPSTAESF 125

Query: 148 LSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASV 207
           +SGA++G  AT  TYP DLLRTRFAAQG ++IY  + ++++ I   EG RGF+RG +A+V
Sbjct: 126 VSGAVAGGIATASTYPLDLLRTRFAAQGNEKIYTSILDSIRDINRTEGPRGFFRGCSAAV 185

Query: 208 VQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLV 267
            QI+PYMGL F +YE L+    +L     +      + D  +G +A +++K GVFPLDLV
Sbjct: 186 AQIVPYMGLFFATYETLRLPLGELSTLLPF-----GSSDAAAGVLASVIAKTGVFPLDLV 240

Query: 268 RKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVT 327
           RKRLQVQGP+R  Y  +N+P Y + +   I  I+++ G+ GLY+GL  +L+K+AP SAVT
Sbjct: 241 RKRLQVQGPHRSRYVHNNIPEY-NGVTGTIVTIIQTQGVRGLYRGLTVSLVKAAPASAVT 299

Query: 328 FFVY 331
            + Y
Sbjct: 300 MWTY 303



>gi|212539133|ref|XP_002149722.1| mitochondrial deoxynucleotide carrier protein, putative
           [Talaromyces marneffei ATCC 18224]
 gi|210069464|gb|EEA23555.1| mitochondrial deoxynucleotide carrier protein, putative
           [Talaromyces marneffei ATCC 18224]
          Length = 314

 Score =  261 bits (667), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 142/305 (46%), Positives = 195/305 (63%), Gaps = 19/305 (6%)

Query: 29  EIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKK--YNGMSHAI 86
           ++ I G +AG+VSRF  +PLDVVKIRLQLQ    I+ LS    + G LK   Y G    +
Sbjct: 16  QVVIAGGIAGLVSRFCIAPLDVVKIRLQLQ----IHSLSDPTSHYG-LKGPVYKGTLRTM 70

Query: 87  KLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQP 146
           + I+REEGI GLW GN+SAE LY+ YG +QF  Y     L + + +       +  T + 
Sbjct: 71  QAIVREEGIAGLWKGNISAELLYVCYGGLQFAGYRTTTQLLQELPTR------LPPTAES 124

Query: 147 FLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTAS 206
           F+SGA++G  AT  TYP DLLRTRFAAQG +RIY  +  +++ I   EG RGF+RG +A+
Sbjct: 125 FVSGAVAGGIATATTYPLDLLRTRFAAQGNERIYASILGSIRDINRTEGPRGFFRGCSAA 184

Query: 207 VVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDL 266
           V+QI+PYMGL F +YE L+    ++     +      + D  +G +A +++K GVFPLDL
Sbjct: 185 VMQIVPYMGLFFATYETLRLPLGEMPSLLPF-----GSSDAAAGMLASVIAKTGVFPLDL 239

Query: 267 VRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAV 326
           VRKRLQVQGP+R  Y  +N+P Y S +   I  IL++ G+ GLY+GL  +LIK+AP SAV
Sbjct: 240 VRKRLQVQGPHRSRYVHTNIPEY-SGVVRTIVIILQTQGVRGLYRGLTVSLIKAAPASAV 298

Query: 327 TFFVY 331
           T + Y
Sbjct: 299 TMWTY 303



>gi|512198324|gb|EPE27159.1| Mitochondrial carrier [Glarea lozoyensis ATCC 20868]
          Length = 322

 Score =  261 bits (667), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 144/320 (45%), Positives = 197/320 (61%), Gaps = 16/320 (5%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           +  ++ I GA AG+++RFV +PLDVVKIRLQLQ      P S       T  KY G    
Sbjct: 13  TKTQVVIAGATAGLIARFVIAPLDVVKIRLQLQTHSLTKPPSPGALT--TSPKYRGTVST 70

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQ-NLFKRIDSNQNEKFGINKTL 144
           +K I REEGI GLW GN+ AE +Y+SY A+QF  Y  +   L K +  N+     +   +
Sbjct: 71  LKQIFREEGITGLWKGNIPAELMYVSYSAIQFTAYRSITLALQKTVGENK-----LPSAV 125

Query: 145 QPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVT 204
           + F++GA +G+ AT  TYP DLLRTRFAAQG ++IY  L +++Q I   EG RGF++G+ 
Sbjct: 126 ESFIAGASAGAVATTATYPLDLLRTRFAAQGTEKIYSSLLSSIQDIAKHEGPRGFFQGLG 185

Query: 205 ASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPL 264
           A + QIIPYMG+ F +YE L+     L   H+ F     + D  +G IA I++K  VFPL
Sbjct: 186 AGIGQIIPYMGIFFATYESLRLPMGTL---HLPF----GSGDASAGVIASIIAKTSVFPL 238

Query: 265 DLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVS 324
           DL+RKRLQVQGP R  YF   +P Y   +   ++ I+R +G+ GLY+GL  +L+K+AP S
Sbjct: 239 DLIRKRLQVQGPTRAKYFHKAIPAY-KGVSRTMQHIVREEGVRGLYRGLTVSLVKAAPAS 297

Query: 325 AVTFFVYGYTKRLLEKLHSS 344
           AVT + Y    R L KL S+
Sbjct: 298 AVTMWTYERVLRALLKLESN 317



>gi|225683197|gb|EEH21481.1| mitochondrial deoxynucleotide carrier [Paracoccidioides
           brasiliensis Pb03]
          Length = 309

 Score =  261 bits (666), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 141/312 (45%), Positives = 194/312 (62%), Gaps = 20/312 (6%)

Query: 29  EIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKL 88
           ++ + GA AG+VSRF  +PLDVVKIRLQLQ     +PLS R         Y G    +K 
Sbjct: 16  QVVVAGATAGLVSRFCIAPLDVVKIRLQLQIHSLSDPLSHRDVKG---PVYKGTLSTLKS 72

Query: 89  IIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFL 148
           I+R+EGI GLW GN+ AE LY+ YG +QF TY  +         +Q     + + +  F+
Sbjct: 73  IVRDEGITGLWKGNIPAELLYICYGGIQFTTYRAI---------SQTLPTHLPQPITTFI 123

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVV 208
           SGA++G  AT  TYP DLLRTRFAAQG  +IY  L  +V+ I   EG RGF+RG TA++ 
Sbjct: 124 SGAVAGGLATAATYPLDLLRTRFAAQGNDKIYTSLLTSVRDIARTEGCRGFFRGSTAAIG 183

Query: 209 QIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVR 268
           QIIPYMGL F +YE ++  F +L+           + D  +G +A I++K GVFPLDLVR
Sbjct: 184 QIIPYMGLFFATYESVRVPFAELQLP-------LGSGDAGAGTVASIIAKTGVFPLDLVR 236

Query: 269 KRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTF 328
           KRLQVQGP R  Y  +N+P+Y   ++  ++ I+   G+ G+Y+GL  +LIK+AP SAVT 
Sbjct: 237 KRLQVQGPTRGRYIHTNIPVY-YGVWRSMRDIVAQQGVRGVYRGLTVSLIKAAPASAVTM 295

Query: 329 FVYGYTKRLLEK 340
           + Y +   LL++
Sbjct: 296 WTYEHVLGLLKE 307



>gi|322696924|gb|EFY88710.1| Mitochondrial thiamine pyrophosphate carrier 1 [Metarhizium acridum
           CQMa 102]
          Length = 409

 Score =  261 bits (666), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 142/321 (44%), Positives = 199/321 (61%), Gaps = 17/321 (5%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           + +++   GA+AG+VSRF+ +PLDVVKIRLQLQP    +PL+           Y+G    
Sbjct: 103 TKLQVVSAGAIAGLVSRFIVAPLDVVKIRLQLQPYSLSDPLAPLRAAPA----YHGAVAT 158

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQ 145
           ++ I+R EG+  LW GN+ AE LY+ Y A+QF TY       +     +     +    +
Sbjct: 159 LRHILRHEGLTALWKGNVPAELLYVFYAAIQFTTYRTTTLFLQTALPTR-----LPDPAE 213

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTA 205
            F++GA SG+ AT +TYP DLLRTRFAAQG +RIY  LR+AV  I   EGYRGF+RG+  
Sbjct: 214 SFIAGASSGALATSITYPLDLLRTRFAAQGRRRIYGSLRSAVWDIKRDEGYRGFFRGICP 273

Query: 206 SVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLD 265
           ++ QI+P+MG+ F +YE L+            F+     ED  +G +  IV+K  VFPLD
Sbjct: 274 ALGQIVPFMGIFFVTYEGLRIQLSG-------FNMPWGGEDATAGVVGSIVAKTAVFPLD 326

Query: 266 LVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSA 325
           LVRKR+QVQGP R  Y  S++P Y+S++   I  I R++G+ GLYKGL  +LIKSAP SA
Sbjct: 327 LVRKRIQVQGPTRARYVYSDIPEYTSALR-GIAAIARTEGLRGLYKGLPISLIKSAPASA 385

Query: 326 VTFFVYGYTKRLLEKLHSSRD 346
           VT + Y  + +LL  L ++R+
Sbjct: 386 VTVWTYERSLKLLMNLDANRE 406



>gi|345566336|gb|EGX49279.1| hypothetical protein AOL_s00078g312 [Arthrobotrys oligospora ATCC
           24927]
          Length = 380

 Score =  260 bits (665), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 147/348 (42%), Positives = 201/348 (57%), Gaps = 55/348 (15%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIR 91
           I GAVAG+VSRF  +PLDVVKIRLQLQP R ++  ++    +GT+  YNG+   ++ I+R
Sbjct: 28  IAGAVAGVVSRFCIAPLDVVKIRLQLQP-RLLSQSTTPIPATGTI--YNGIYDTMRTIVR 84

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGA 151
           EEG+  LW GN+ AE LYL+YGA QF  Y Q Q+      S+      +  T+    SG 
Sbjct: 85  EEGVTALWKGNIPAELLYLTYGAAQFFFYAQTQSFL----SSSPLTSHLPTTMINTCSGG 140

Query: 152 ISGSTATIVTYPFDLLRTRFAAQ-----------------------GEKRIYIGLRNAVQ 188
           I+G  AT +TYPFDLLRTRFAA                        G KR+Y  LR+A+ 
Sbjct: 141 IAGGIATSITYPFDLLRTRFAASKGTTASTTTSSSSNNSNTGGNSVGNKRVYTSLRSAIT 200

Query: 189 QIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLED--------------- 233
            IY  EG RGFYRG  A+++QI+P+MGL FGSYE +K    +L +               
Sbjct: 201 GIYKDEGIRGFYRGGAAAIIQIVPHMGLFFGSYEGIKAGLLRLPNPITYLPPSLSSSSSS 260

Query: 234 -------KHIWFHNLR--ATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFIS 284
                   H    +L    + D +SG + G+++K GVFPLD +RKRLQVQGP R  Y   
Sbjct: 261 SNNTTSNNHPILQSLAGMGSVDAVSGVLGGVIAKTGVFPLDTIRKRLQVQGPTRTGYVNG 320

Query: 285 NVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYG 332
           ++P+Y   +  C ++++R +G  GLY+GL  +L+K+AP SAVT + YG
Sbjct: 321 DIPVY-EGVLRCGREVVRREGWRGLYRGLTVSLVKAAPASAVTMWTYG 367



>gi|154295049|ref|XP_001547962.1| hypothetical protein BC1G_13653 [Botryotinia fuckeliana B05.10]
 gi|206558273|sp|A6SL61.1|TPC1_BOTFB RecName: Full=Mitochondrial thiamine pyrophosphate carrier 1
 gi|347831735|emb|CCD47432.1| similar to mitochondrial deoxynucleotide carrier [Botryotinia
           fuckeliana T4]
 gi|472236423|gb|EMR81358.1| putative mitochondrial deoxynucleotide carrier protein [Botryotinia
           fuckeliana BcDW1]
          Length = 322

 Score =  260 bits (664), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 139/318 (43%), Positives = 196/318 (61%), Gaps = 20/318 (6%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIR 91
           I GA AG+++RFV +PLDVVKIRLQLQ     +PLS R      +  Y G    IK I R
Sbjct: 19  IAGATAGLIARFVIAPLDVVKIRLQLQSHSASDPLSQRDLRGSPI--YKGTIPTIKRIFR 76

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINK---TLQPFL 148
           EEG+  LW GN+ AE +Y+SY A+QF TY       + +     + FG ++     + F+
Sbjct: 77  EEGLAALWKGNVPAELMYVSYSAIQFTTY-------RSVTLGLQDAFGEHRLPAAAESFI 129

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVV 208
           +GA +G+ AT  TYP DLLRTRFAAQG +R+Y  LR++++ I + EG RGF++G+ A V 
Sbjct: 130 AGASAGAVATTATYPLDLLRTRFAAQGIERVYTSLRSSIRDIAISEGPRGFFQGLGAGVG 189

Query: 209 QIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVR 268
           QI+PYMG+ F +YE L+     L            + D  +G IA +++K G+FP DL+R
Sbjct: 190 QIVPYMGIFFATYESLRLPMGTLNMPF-------GSADASAGVIASVIAKTGIFPFDLIR 242

Query: 269 KRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTF 328
           KRLQVQGP R+ Y   N+P+Y + +F  ++ IL ++G  GLY+GL  +L KSAP SAVT 
Sbjct: 243 KRLQVQGPTRERYVHKNIPVY-NGVFQTMRHILHNEGYRGLYRGLTVSLFKSAPASAVTM 301

Query: 329 FVYGYTKRLLEKLHSSRD 346
           + Y     +L K   S++
Sbjct: 302 WTYERVLGILLKWEKSQE 319



>gi|239608403|gb|EEQ85390.1| mitochondrial thiamine pyrophosphate carrier 1 [Ajellomyces
           dermatitidis ER-3]
          Length = 328

 Score =  259 bits (663), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 139/304 (45%), Positives = 188/304 (61%), Gaps = 11/304 (3%)

Query: 39  MVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIREEGIRGL 98
           +VSRF  +PLDVVKIRLQLQ     +PLS R         Y G    +K I R+EGI GL
Sbjct: 26  LVSRFCIAPLDVVKIRLQLQVHSLSDPLSHRDIKG---PVYKGTLSTLKSIFRDEGITGL 82

Query: 99  WNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGAISGSTAT 158
           W GN+ AE LY+ YG +QF +Y  + +  + +         I +  + F+SGA++G  AT
Sbjct: 83  WKGNIPAELLYVCYGGIQFSSYRAVSSALRALPPLPLLPHPIPQPAESFISGAVAGGLAT 142

Query: 159 IVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVF 218
             TYP DLLRTRFAAQG  +IY  LR +V+ I   EG RGF+RG TA++ QIIPYMGL F
Sbjct: 143 ASTYPLDLLRTRFAAQGNDKIYASLRASVRDIARTEGPRGFFRGATAAIAQIIPYMGLFF 202

Query: 219 GSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQGPNR 278
            +YE ++      E  +        T D  +G +A +++K GVFPLDLVRKRLQVQGP R
Sbjct: 203 AAYEAVRNPIAGWELPY-------GTGDAGAGVVASVIAKTGVFPLDLVRKRLQVQGPTR 255

Query: 279 KDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGYTKRLL 338
             Y  +N+P+Y   +   I+ IL + G+ GLY+GL  +LIK+AP SAVT + Y +   LL
Sbjct: 256 ARYIHTNIPVY-EGVLRTIRDILAAQGVRGLYRGLTVSLIKAAPASAVTMWTYEHVLGLL 314

Query: 339 EKLH 342
           ++++
Sbjct: 315 KEMN 318



>gi|261203123|ref|XP_002628775.1| mitochondrial thiamine pyrophosphate carrier 1 [Ajellomyces
           dermatitidis SLH14081]
 gi|239586560|gb|EEQ69203.1| mitochondrial thiamine pyrophosphate carrier 1 [Ajellomyces
           dermatitidis SLH14081]
 gi|327349603|gb|EGE78460.1| mitochondrial thiamine pyrophosphate carrier 1 [Ajellomyces
           dermatitidis ATCC 18188]
          Length = 328

 Score =  259 bits (663), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 139/304 (45%), Positives = 188/304 (61%), Gaps = 11/304 (3%)

Query: 39  MVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIREEGIRGL 98
           +VSRF  +PLDVVKIRLQLQ     +PLS R         Y G    +K I R+EGI GL
Sbjct: 26  LVSRFCIAPLDVVKIRLQLQIHSLSDPLSHRDIKG---PVYKGTLSTLKSIFRDEGITGL 82

Query: 99  WNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGAISGSTAT 158
           W GN+ AE LY+ YG +QF +Y  + +  + +         I +  + F+SGA++G  AT
Sbjct: 83  WKGNIPAELLYVCYGGIQFSSYRAVSSALRALPPLPLLPHPIPQPAESFISGAVAGGLAT 142

Query: 159 IVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVF 218
             TYP DLLRTRFAAQG  +IY  LR +V+ I   EG RGF+RG TA++ QIIPYMGL F
Sbjct: 143 ASTYPLDLLRTRFAAQGNDKIYASLRASVRDIARTEGPRGFFRGATAAIAQIIPYMGLFF 202

Query: 219 GSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQGPNR 278
            +YE ++      E  +        T D  +G +A +++K GVFPLDLVRKRLQVQGP R
Sbjct: 203 AAYEAVRNPIAGWELPY-------GTGDAGAGVVASVIAKTGVFPLDLVRKRLQVQGPTR 255

Query: 279 KDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGYTKRLL 338
             Y  +N+P+Y   +   I+ IL + G+ GLY+GL  +LIK+AP SAVT + Y +   LL
Sbjct: 256 ARYIHTNIPVY-EGVLRTIRDILAAQGVRGLYRGLTVSLIKAAPASAVTMWTYEHVLGLL 314

Query: 339 EKLH 342
           ++++
Sbjct: 315 KEMN 318



>gi|350296127|gb|EGZ77104.1| mitochondrial thiamine pyrophosphate carrier 1 [Neurospora
           tetrasperma FGSC 2509]
          Length = 333

 Score =  259 bits (663), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 140/322 (43%), Positives = 199/322 (61%), Gaps = 12/322 (3%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNS--GTLKKYNGMS 83
           S +++   GA AG++SRFV +PLDVVKIRLQLQ     +PL  +      G    Y G  
Sbjct: 13  SRLQVTAAGATAGLISRFVIAPLDVVKIRLQLQHHSLSDPLIHQRGAEIIGGGPVYKGTL 72

Query: 84  HAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQM-QNLFKRIDSNQNEKFGINK 142
             I+ I+R EG+ GLW GN+ AE LY+SY AVQF TY  + Q L      +QN++  +  
Sbjct: 73  PTIRHILRTEGLTGLWKGNIPAELLYVSYAAVQFTTYRSITQFLQAAFPKDQNKQ--LPP 130

Query: 143 TLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRG 202
           +++ F++GA +G  AT VTYP DLLRTRFAAQG +R+Y  L  A++ IY  EG  G++RG
Sbjct: 131 SVESFIAGASAGGVATAVTYPLDLLRTRFAAQGTERVYPSLVQALKTIYASEGVTGYFRG 190

Query: 203 VTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVF 262
           +   + QIIPYMG  F  YE L+    KLE  +       +++  ++G +A +++K G F
Sbjct: 191 LGPGLAQIIPYMGTFFCVYETLRPRLSKLELPY-------SSDSAVAGVLASVMAKTGTF 243

Query: 263 PLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAP 322
           PLDLVRKR+QVQGP R  Y   N+P+Y   +   +  I+R +G+ GLY+GL  +L K+AP
Sbjct: 244 PLDLVRKRIQVQGPTRGMYVHKNIPVYDGGMVKTVATIVRREGVRGLYRGLTVSLFKAAP 303

Query: 323 VSAVTFFVYGYTKRLLEKLHSS 344
            SAVT + Y    +L  +L ++
Sbjct: 304 ASAVTMWTYERALKLYIRLGAA 325



>gi|226288326|gb|EEH43838.1| mitochondrial deoxynucleotide carrier [Paracoccidioides
           brasiliensis Pb18]
          Length = 320

 Score =  259 bits (663), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 139/303 (45%), Positives = 189/303 (62%), Gaps = 20/303 (6%)

Query: 29  EIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKL 88
           ++ + GA AG+VSRF  +PLDVVKIRLQLQ     +PLS R         Y G    +K 
Sbjct: 16  QVVVAGATAGLVSRFCIAPLDVVKIRLQLQIHSLSDPLSHRDVKG---PVYKGTLSTLKS 72

Query: 89  IIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFL 148
           I+R+EGI GLW GN+ AE LY+ YG +QF TY  +         +Q     + + +  F+
Sbjct: 73  IVRDEGITGLWKGNIPAELLYICYGGIQFTTYRAI---------SQTLPTHLPQPITTFI 123

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVV 208
           SGA++G  AT  TYP DLLRTRFAAQG  +IY  L  +V+ I   EG RGF+RG TA++ 
Sbjct: 124 SGAVAGGLATAATYPLDLLRTRFAAQGNDKIYTSLLTSVRDIARTEGCRGFFRGSTAAIG 183

Query: 209 QIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVR 268
           QIIPYMGL F +YE ++  F +L+           + D  +G +A I++K GVFPLDLVR
Sbjct: 184 QIIPYMGLFFATYESVRVPFAELQLP-------LGSGDAGAGTVASIIAKTGVFPLDLVR 236

Query: 269 KRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTF 328
           KRLQVQGP R  Y  +N+P+Y   ++  ++ I+   G+ G+Y+GL  +LIK+AP SAVT 
Sbjct: 237 KRLQVQGPTRGRYIHTNIPVY-YGVWRSMRDIVAQQGVRGVYRGLTVSLIKAAPASAVTM 295

Query: 329 FVY 331
           + Y
Sbjct: 296 WTY 298



 Score = 75.5 bits (184), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 59/219 (26%), Positives = 95/219 (43%), Gaps = 42/219 (19%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIR 91
           I GAVAG ++     PLD+++ R   Q               G  K Y  +  +++ I R
Sbjct: 123 ISGAVAGGLATAATYPLDLLRTRFAAQ---------------GNDKIYTSLLTSVRDIAR 167

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSG- 150
            EG RG + G+ +A    + Y  + F TY  ++  F  +               P  SG 
Sbjct: 168 TEGCRGFFRGSTAAIGQIIPYMGLFFATYESVRVPFAELQ-------------LPLGSGD 214

Query: 151 AISGSTATIVT----YPFDLLRTRFAAQGEKR---------IYIGLRNAVQQIYVQEGYR 197
           A +G+ A+I+     +P DL+R R   QG  R         +Y G+  +++ I  Q+G R
Sbjct: 215 AGAGTVASIIAKTGVFPLDLVRKRLQVQGPTRGRYIHTNIPVYYGVWRSMRDIVAQQGVR 274

Query: 198 GFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHI 236
           G YRG+T S+++  P   +   +YE        +   HI
Sbjct: 275 GVYRGLTVSLIKAAPASAVTMWTYEHGVGGGGVIVFAHI 313



>gi|295672187|ref|XP_002796640.1| mitochondrial deoxynucleotide carrier [Paracoccidioides sp.
           'lutzii' Pb01]
 gi|226283620|gb|EEH39186.1| mitochondrial deoxynucleotide carrier [Paracoccidioides sp.
           'lutzii' Pb01]
          Length = 309

 Score =  259 bits (662), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 142/315 (45%), Positives = 195/315 (61%), Gaps = 26/315 (8%)

Query: 29  EIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKL 88
           ++ + GA AG+VSRF  +PLDVVKIRLQLQ     +PLS R         Y G    +K 
Sbjct: 16  QVVVAGATAGLVSRFCIAPLDVVKIRLQLQIHSLSDPLSHRDVKG---PVYKGTLSTLKS 72

Query: 89  IIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFL 148
           I+R+EGI GLW GN+ AE LY+ YG +QF TY  +         +Q     + + +  F+
Sbjct: 73  IVRDEGITGLWKGNIPAELLYICYGGIQFTTYRAI---------SQTLPTYLPQPITTFI 123

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVV 208
           SGA++G  AT  TYP DLLRTRFAAQG  +IY  L  +++ I   EGYRGF+RG TA++ 
Sbjct: 124 SGAVAGGLATAATYPLDLLRTRFAAQGNDKIYTSLLMSLRDIARTEGYRGFFRGSTAAIG 183

Query: 209 QIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLR---ATEDLLSGAIAGIVSKAGVFPLD 265
           QIIPYMGL F +YE +          H+ F  L+    + D  +G +A I++K GVFPLD
Sbjct: 184 QIIPYMGLFFATYESV----------HVPFAELQLPLGSGDAGAGIVASIIAKTGVFPLD 233

Query: 266 LVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSA 325
           LVRKRLQVQGP R  Y  +N+P+Y   ++  ++ I+   G+ G+Y+GL  +LIK+AP SA
Sbjct: 234 LVRKRLQVQGPTRGRYIHTNIPVY-YGVWRSMRDIVAQQGVRGVYRGLTVSLIKAAPASA 292

Query: 326 VTFFVYGYTKRLLEK 340
           VT + Y +   LL++
Sbjct: 293 VTMWTYEHVLGLLKE 307



>gi|85091387|ref|XP_958877.1| hypothetical protein NCU07384 [Neurospora crassa OR74A]
 gi|74662555|sp|Q7S2H8.1|TPC1_NEUCR RecName: Full=Mitochondrial thiamine pyrophosphate carrier 1
 gi|28920266|gb|EAA29641.1| hypothetical protein NCU07384 [Neurospora crassa OR74A]
          Length = 333

 Score =  259 bits (661), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 141/322 (43%), Positives = 198/322 (61%), Gaps = 12/322 (3%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPL--SSRHHNSGTLKKYNGMS 83
           S +++   GA AG++SRFV +PLDVVKIRLQLQ     +PL    R    G    Y G  
Sbjct: 13  SRLQVTAAGATAGLISRFVIAPLDVVKIRLQLQHHSLSDPLLHQRRAEIIGGGPVYKGTL 72

Query: 84  HAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQM-QNLFKRIDSNQNEKFGINK 142
             I+ I+R EG+ GLW GN+ AE LY+SY AVQF TY  + Q L      +QN++  +  
Sbjct: 73  PTIRHILRTEGLTGLWKGNIPAELLYVSYAAVQFTTYRSITQFLQAAFPKDQNKQ--LPP 130

Query: 143 TLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRG 202
           +++ F++GA +G  AT VTYP DLLRTRFAAQG +R+Y  L  A++ IY  EG  G++RG
Sbjct: 131 SVESFIAGASAGGVATAVTYPLDLLRTRFAAQGVERVYPSLVQALKTIYASEGVTGYFRG 190

Query: 203 VTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVF 262
           +   + QIIPYMG  F  YE L+    KLE  +       ++   ++G +A +++K G F
Sbjct: 191 LGPGLAQIIPYMGTFFCVYETLRPRLSKLELPY-------SSGSAVAGVLASVMAKTGTF 243

Query: 263 PLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAP 322
           PLDLVRKR+QVQGP R  Y   N+P+Y   +   +  I+R +G+ GLY+GL  +L K+AP
Sbjct: 244 PLDLVRKRIQVQGPTRGMYVHKNIPVYDGGMVKTVATIVRREGVRGLYRGLTVSLFKAAP 303

Query: 323 VSAVTFFVYGYTKRLLEKLHSS 344
            SAVT + Y    +L  +L ++
Sbjct: 304 ASAVTMWTYERALKLYIRLGAA 325



>gi|169763072|ref|XP_001727436.1| thiamine pyrophosphate carrier 1 [Aspergillus oryzae RIB40]
 gi|121801694|sp|Q2UCW8.1|TPC1_ASPOR RecName: Full=Mitochondrial thiamine pyrophosphate carrier 1
 gi|83770464|dbj|BAE60597.1| unnamed protein product [Aspergillus oryzae RIB40]
 gi|391866617|gb|EIT75886.1| solute carrier protein [Aspergillus oryzae 3.042]
          Length = 318

 Score =  258 bits (660), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 137/318 (43%), Positives = 192/318 (60%), Gaps = 15/318 (4%)

Query: 29  EIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKL 88
           ++ + G +AG+VSRF  +PLDVVKIRLQLQ     +P S   H +     Y G    I+ 
Sbjct: 16  QVVLAGGIAGLVSRFCVAPLDVVKIRLQLQIHSLSDPTS---HQNIKGPVYKGTLPTIRS 72

Query: 89  IIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFL 148
           I+REEGI GLW GN+ AE +Y+ YGA+QF  Y        ++D      + +    + F+
Sbjct: 73  IVREEGITGLWKGNIPAELMYVCYGAIQFAAYRTTTQALSQLD-----PYRLPPPAESFV 127

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVV 208
           +GA +G  AT  TYP DLLRTRFAAQG +R+Y  L  +V+ I   EG +GF+RG +A+V 
Sbjct: 128 AGATAGGLATASTYPLDLLRTRFAAQGTERVYTSLYASVRDIAQNEGPKGFFRGCSAAVG 187

Query: 209 QIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVR 268
           QI+PYMGL F +YE L+ +   L D          + D  +G +A +++K GVFPLDLVR
Sbjct: 188 QIVPYMGLFFATYESLRPVMSGLHDLPF------GSGDAAAGVVASVLAKTGVFPLDLVR 241

Query: 269 KRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTF 328
           KRLQVQGP R  Y   N+P Y   ++  +  I+R+ G+ GLY+GL  +L K+AP SAVT 
Sbjct: 242 KRLQVQGPTRSKYVHRNIPEY-QGVYNTMAMIVRTQGMRGLYRGLTVSLFKAAPASAVTM 300

Query: 329 FVYGYTKRLLEKLHSSRD 346
           + Y  +   L +L  + +
Sbjct: 301 WTYEKSLHYLRELEVASE 318



>gi|340521293|gb|EGR51528.1| predicted protein [Trichoderma reesei QM6a]
          Length = 322

 Score =  258 bits (658), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 141/316 (44%), Positives = 197/316 (62%), Gaps = 15/316 (4%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           S +++   GA+AG+VSRFV +PLDVVKIRLQLQP    +PL+           Y G  H 
Sbjct: 13  SKLQVVTAGAIAGLVSRFVVAPLDVVKIRLQLQPYSLSDPLAPLREAPA----YRGTVHT 68

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQ 145
           IK I++ EG+ GLW GN+ AE +Y+ Y AVQF  Y     +F +     N +  +  + +
Sbjct: 69  IKHILKHEGLTGLWKGNVPAELMYVCYSAVQFTAYRST-TVFLQTALPDNRR--LPDSAE 125

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTA 205
            F++GA+SG+ AT  TYP DLLRTRFAAQG +R+Y  LR A+  I   EG RGF+RG+  
Sbjct: 126 TFIAGAVSGAAATGATYPLDLLRTRFAAQGRQRVYSSLRGALWDIRRDEGLRGFFRGLAP 185

Query: 206 SVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLD 265
           ++ QI+P+MG+ F SYE L+     L     W      + D  +G  A +++K  VFPLD
Sbjct: 186 ALGQIVPFMGIFFASYEGLRLRLGHLHLP--W-----GSGDATAGIAASVLAKTAVFPLD 238

Query: 266 LVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSA 325
           LVRKR+QVQGP R  Y  S++P+Y+S++   ++ I  ++G  GLYKGL  +LIK+AP SA
Sbjct: 239 LVRKRIQVQGPTRSRYVYSDIPVYTSAVR-ALRAIYVTEGFRGLYKGLPISLIKAAPASA 297

Query: 326 VTFFVYGYTKRLLEKL 341
           VT + Y  + +LL  L
Sbjct: 298 VTLWTYERSLKLLMSL 313



>gi|336464044|gb|EGO52284.1| hypothetical protein NEUTE1DRAFT_132977 [Neurospora tetrasperma
           FGSC 2508]
          Length = 333

 Score =  257 bits (657), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 138/309 (44%), Positives = 193/309 (62%), Gaps = 12/309 (3%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNS--GTLKKYNGMS 83
           S +++   GA AG++SRFV +PLDVVKIRLQLQ     +PL  +      G    Y G  
Sbjct: 13  SRLQVTAAGATAGLISRFVIAPLDVVKIRLQLQHHSLSDPLIHQRGAEIIGGGPVYKGTL 72

Query: 84  HAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQM-QNLFKRIDSNQNEKFGINK 142
             I+ I+R EG+ GLW GN+ AE LY+SY AVQF TY  + Q L      +QN+   +  
Sbjct: 73  PTIRHILRTEGLTGLWKGNIPAELLYVSYAAVQFTTYRSITQFLQAAFPKDQNKH--LPP 130

Query: 143 TLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRG 202
           +++ F++GA +G  AT VTYP DLLRTRFAAQG +R+Y  L  A++ IYV EG  G++RG
Sbjct: 131 SVESFIAGASAGGVATAVTYPLDLLRTRFAAQGVERVYPSLLQALKTIYVSEGVTGYFRG 190

Query: 203 VTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVF 262
           +   + QIIPYMG  F  YE L+    +LE  +       ++   ++G +A +++K G F
Sbjct: 191 LGPGLAQIIPYMGTFFCVYETLRPRLSQLELPY-------SSGSAVAGVLASVMAKTGTF 243

Query: 263 PLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAP 322
           PLDLVRKR+QVQGP R  Y   N+P+Y   +   +  I+R +G+ GLY+GL  +L+K+AP
Sbjct: 244 PLDLVRKRIQVQGPTRGMYVHKNIPVYDGRMVKTVATIVRREGVRGLYRGLTVSLVKAAP 303

Query: 323 VSAVTFFVY 331
            SAVT + Y
Sbjct: 304 ASAVTMWTY 312



>gi|121716068|ref|XP_001275643.1| mitochondrial deoxynucleotide carrier protein, putative
           [Aspergillus clavatus NRRL 1]
 gi|119403800|gb|EAW14217.1| mitochondrial deoxynucleotide carrier protein, putative
           [Aspergillus clavatus NRRL 1]
          Length = 321

 Score =  257 bits (657), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 145/341 (42%), Positives = 201/341 (58%), Gaps = 28/341 (8%)

Query: 1   MSQGYEHKPQNQSPIAEQAVAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPG 60
           MS G EH     +P   Q V           + G +AG+VSRF  +PLDVVKIRLQLQ  
Sbjct: 1   MSAGGEHLKDEGTP--RQVV-----------LAGGIAGLVSRFCVAPLDVVKIRLQLQIH 47

Query: 61  RPINPLSSRHHNSGTLKKYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTY 120
              +P +S  H +G +  Y G    ++ I+++EGI GLW GN+ AE +Y+ YGAVQF  Y
Sbjct: 48  SLSDP-ASHKHVTGPI--YKGTLATMRAILKQEGITGLWKGNIPAELMYVCYGAVQFAAY 104

Query: 121 HQMQNLFKRIDSNQNEKFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIY 180
                    +  ++     +    + F++GA++G  AT  TYP DLLRTRFAAQG +R+Y
Sbjct: 105 RTTTQALAHLHPHR-----LPPAAESFVAGAVAGGLATASTYPLDLLRTRFAAQGSERVY 159

Query: 181 IGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHN 240
             L  +V+ I   EG  GF+RG +A+V QI+P+MGL F +YE L+    + E   +    
Sbjct: 160 TSLLASVRLIARTEGAAGFFRGCSAAVGQIVPFMGLFFATYETLRPAIVQYEGLPL---- 215

Query: 241 LRATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQI 300
              T D  +G IA + +K GVFPLDLVRKRLQVQGP R  Y   N+P Y   +F  I  I
Sbjct: 216 --GTGDAAAGVIASVFAKTGVFPLDLVRKRLQVQGPTRTMYVHRNIPEY-GGVFNSIALI 272

Query: 301 LRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGYTKRLLEKL 341
           LR+ G  GLY+GL  +L+K+AP SA+T + Y  + +LL+++
Sbjct: 273 LRTQGFRGLYQGLTVSLLKAAPASAITMWTYERSLKLLQEM 313



>gi|67901164|ref|XP_680838.1| hypothetical protein AN7569.2 [Aspergillus nidulans FGSC A4]
 gi|74656948|sp|Q5AVW1.1|TPC1_EMENI RecName: Full=Mitochondrial thiamine pyrophosphate carrier 1
 gi|40742959|gb|EAA62149.1| hypothetical protein AN7569.2 [Aspergillus nidulans FGSC A4]
 gi|259483889|tpe|CBF79646.1| TPA: Mitochondrial thiamine pyrophosphate carrier 1
           [Source:UniProtKB/Swiss-Prot;Acc:Q5AVW1] [Aspergillus
           nidulans FGSC A4]
          Length = 328

 Score =  254 bits (650), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 142/324 (43%), Positives = 201/324 (62%), Gaps = 16/324 (4%)

Query: 29  EIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKL 88
           ++ + G +AG++SRF  +PLDVVKIRLQLQ     +P +S  H +G +  Y G    IK 
Sbjct: 16  QVVLAGGIAGLISRFCIAPLDVVKIRLQLQIHSLSDP-TSHAHITGPV--YKGTLSTIKT 72

Query: 89  IIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFL 148
           I+REEG+ GLW GN+ AE LY+ YG +QF TY     L  ++D ++     + + ++ F+
Sbjct: 73  ILREEGLTGLWKGNIPAELLYVCYGGIQFTTYRTTTQLLAQLDPHR-----LPQPIESFI 127

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQ--GEKRIYIGLRNAVQQIYVQEGYRGFYRGVTAS 206
           SGA+ G  AT  TYP DLLRTRFAAQ  G+ R+Y  L  +++ I   EG  GF+RG +A+
Sbjct: 128 SGALGGGIATAATYPLDLLRTRFAAQGSGDNRVYESLFASLRDIAKTEGTVGFFRGCSAA 187

Query: 207 VVQIIPYMGLVFGSYEFLKKLFRKL-EDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLD 265
           V QI+PYMGL F +YE L+ +     E   I       + D  +G +A +++K GVFPLD
Sbjct: 188 VGQIVPYMGLFFATYEALRPVMATAPELSPIPLPP--GSGDAAAGIVASVLAKTGVFPLD 245

Query: 266 LVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSA 325
           LVRKRLQVQGP R  Y   N+P Y   +F  +  I R+ G+ GLY+GL  +L+K+AP SA
Sbjct: 246 LVRKRLQVQGPTRALYVHRNIPEY-RGVFNTMGLIFRTQGLRGLYRGLTVSLVKAAPASA 304

Query: 326 VTFFVYGYTKRLL--EKLHSSRDK 347
           VT + Y    +LL   ++ + RD+
Sbjct: 305 VTMWTYERALKLLREHEIAAGRDE 328



>gi|429854577|gb|ELA29581.1| mitochondrial deoxynucleotide carrier [Colletotrichum
           gloeosporioides Nara gc5]
          Length = 316

 Score =  253 bits (645), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 148/312 (47%), Positives = 196/312 (62%), Gaps = 15/312 (4%)

Query: 36  VAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIREEGI 95
            AG+ +RFV +PLDVVKIRLQLQ     +PLS +    G +  Y G  + +KLII  EG+
Sbjct: 18  TAGLFARFVIAPLDVVKIRLQLQSHSLSDPLSIQTARGGPV--YKGTLNTMKLIIANEGV 75

Query: 96  RGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGAISGS 155
            GLW GN+ AE +Y+ Y AVQF TY     L + I  N+     +    Q F++GA +G+
Sbjct: 76  TGLWKGNVPAELMYVCYSAVQFTTYRTTAQLLQSISDNR-----LPNAAQSFIAGATAGA 130

Query: 156 TATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPYMG 215
            AT  TYP DLLRTRFAAQG +R+Y GLR+AV  IY  EG RGF+RG+   V QI+PYMG
Sbjct: 131 AATTATYPLDLLRTRFAAQGNERVYTGLRHAVTDIYRDEGPRGFFRGLGPGVAQIVPYMG 190

Query: 216 LVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQG 275
           + F  YE L+     L D H+ +    AT    +G +A ++SK  VFPLDLVRKR+QVQG
Sbjct: 191 IFFALYEGLRL---PLGDLHLPWGGGDAT----AGVMASVMSKTAVFPLDLVRKRIQVQG 243

Query: 276 PNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGYTK 335
           P R  Y   N+P Y  ++   ++ I  S+GI GLY+GL  +LIK+AP SAVT + Y    
Sbjct: 244 PTRSRYVHKNIPEYPGAVR-AMRMIFASEGIRGLYRGLTVSLIKAAPGSAVTVWTYERVL 302

Query: 336 RLLEKLHSSRDK 347
           R+L +L +S +K
Sbjct: 303 RVLMRLENSDEK 314



>gi|171687561|ref|XP_001908721.1| hypothetical protein [Podospora anserina S mat+]
 gi|170943742|emb|CAP69394.1| unnamed protein product [Podospora anserina S mat+]
          Length = 326

 Score =  251 bits (640), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 143/306 (46%), Positives = 194/306 (63%), Gaps = 13/306 (4%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           + +++   GA AG+VSRFV +PLDVVKIRLQLQ     +PLS+R+ +   +  Y G    
Sbjct: 14  TRLQVTAAGATAGVVSRFVIAPLDVVKIRLQLQTHSLSDPLSTRNLHGSPI--YKGTLPT 71

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQ 145
           +  I R EG+ GLW GNL AE LYL Y AVQF TY Q   L   + S   E   +  + +
Sbjct: 72  LLSIFRSEGLTGLWKGNLPAELLYLCYFAVQFTTYRQTTLL---LHSTLGEST-LPPSAE 127

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTA 205
            F+SGA +G+T T  TYP DLLRTRFAAQG  +IY G   A++QI+ QEGY+GF+RG+  
Sbjct: 128 SFISGAAAGATGTTATYPLDLLRTRFAAQGNDKIYKGFLPAIRQIHHQEGYKGFFRGLAP 187

Query: 206 SVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLD 265
           ++ QIIP+MG  F  YE L+    KLE          ++   L+G IA +++K G FPLD
Sbjct: 188 ALGQIIPFMGTFFAVYETLRPKLSKLELPF-------SSGGALTGTIASVIAKTGTFPLD 240

Query: 266 LVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSA 325
           LVRKR+QVQGP R  Y   N+P Y+   F  +++I+  +G+ GLY+GL  +L+K+AP SA
Sbjct: 241 LVRKRIQVQGPTRGGYVHKNIPEYTHGTFGTMREIVAREGVRGLYRGLTVSLVKAAPASA 300

Query: 326 VTFFVY 331
           VT + Y
Sbjct: 301 VTMWTY 306



>gi|501756255|emb|CCG85136.1| Mitochondrial thiamine pyrophosphate carrier 1 [Taphrina deformans
           PYCC 5710]
          Length = 307

 Score =  251 bits (640), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 142/310 (45%), Positives = 194/310 (62%), Gaps = 26/310 (8%)

Query: 29  EIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKL 88
           E  +CG  AG+V+RF  +PLDV+KIRLQLQ             +SG L  Y G  H  + 
Sbjct: 9   ETVVCGGTAGLVARFFIAPLDVLKIRLQLQ-----------SSSSGQL--YRGTVHGFRT 55

Query: 89  IIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFL 148
           I++EEG+R LW GN+ AE LY++Y A QFLTY    +  + +  +        +    F+
Sbjct: 56  IVQEEGVRALWKGNVPAELLYVTYSATQFLTYKTTNDASRALCPSS-----WPEATHAFI 110

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVV 208
           +GA +G+ AT VTYPFDLLRTRFAAQ     Y  LR AV ++   EG RG YRG+ AS+ 
Sbjct: 111 AGAGAGAVATTVTYPFDLLRTRFAAQRNSGPYKSLRKAVAEVVRTEGLRGMYRGLYASIT 170

Query: 209 QIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVR 268
           QI+PYMGL+FG+YE L+K    L   + W       ++ ++G +AG  SK GVFPLD++R
Sbjct: 171 QIVPYMGLLFGTYEPLRKGMSGLGMPNGW-------DNAVAGFLAGTFSKTGVFPLDVIR 223

Query: 269 KRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTF 328
           KRLQVQGP R  Y  +++P+YSSS+  C   IL+ +G+ G YKGL  +L+KSAP SA+T 
Sbjct: 224 KRLQVQGPTRTAYVFNDIPVYSSSL-SCATTILQREGVRGFYKGLTVSLLKSAPSSAITL 282

Query: 329 FVYGYTKRLL 338
           + +  + RLL
Sbjct: 283 WTFEQSSRLL 292



>gi|326476071|gb|EGE00081.1| mitochondrial thiamine pyrophosphate carrier [Trichophyton
           tonsurans CBS 112818]
          Length = 316

 Score =  250 bits (639), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 142/311 (45%), Positives = 190/311 (61%), Gaps = 15/311 (4%)

Query: 33  CGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIRE 92
            GA+AG+VSRF  +PLDVVKIRLQLQ     +PLS R         Y G    +  I R+
Sbjct: 20  AGAIAGLVSRFCIAPLDVVKIRLQLQIHSLSDPLSHRDVKGPV---YKGTISTLVAIARQ 76

Query: 93  EGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGAI 152
           EGI GLW GN+ AE LY+ YG +QF  Y  +  L   +         +   ++ F+SGA 
Sbjct: 77  EGIAGLWKGNIPAEILYICYGGIQFTAYRSVTQLLHLLPPQHR----VPSPVESFISGAA 132

Query: 153 SGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIP 212
           +G  AT  TYPFDLLRTRFAAQG  ++Y  L ++V+ IY  EG  GF+RGV+A+V Q++P
Sbjct: 133 AGGVATASTYPFDLLRTRFAAQGNNKVYNSLVSSVRDIYRYEGAGGFFRGVSAAVAQVVP 192

Query: 213 YMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVRKRLQ 272
           YMGL F +YE L+K    ++           + D  +G IA +++K GVFPLDLVRKRLQ
Sbjct: 193 YMGLFFAAYEALRKPISSVDLPF-------GSGDATAGMIASVMAKTGVFPLDLVRKRLQ 245

Query: 273 VQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYG 332
           VQGP R  Y   N+P Y   +   I+ I+R+ G+ GLY+GL  +LIK+AP SAVT + Y 
Sbjct: 246 VQGPTRSKYVHVNIPEY-HGVASTIRTIVRTQGVRGLYRGLTVSLIKAAPASAVTMWTYE 304

Query: 333 YTKRLLEKLHS 343
               +L++L S
Sbjct: 305 RVMAVLKELDS 315



>gi|494824799|gb|EON62053.1| mitochondrial thiamine pyrophosphate carrier 1 [Coniosporium
           apollinis CBS 100218]
          Length = 331

 Score =  249 bits (636), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 135/305 (44%), Positives = 183/305 (60%), Gaps = 16/305 (5%)

Query: 33  CGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIRE 92
            GA+AG+VSRF  +PLDV+KIRLQLQ     +PL+    N   +  Y+G  H +K I+R 
Sbjct: 20  AGAIAGLVSRFCIAPLDVIKIRLQLQTHSLSDPLAHALANGSPI--YSGTLHTLKHILRT 77

Query: 93  EGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQN------LFKRIDSNQNEKFGINKTLQP 146
           EG+ GLW GN+ AE LYL+YG+VQF TY           LF+R   +   +         
Sbjct: 78  EGLTGLWKGNVPAELLYLAYGSVQFSTYRLTSRYLSTVPLFRRSHPHPRTQKETRDAAIS 137

Query: 147 FLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTAS 206
           F++GA +G+ AT  TYP DLLRTRFAAQG +R+Y  L  ++++I   EG  GF+RG+ A 
Sbjct: 138 FVAGAFAGTVATTATYPLDLLRTRFAAQGSERVYASLAASIREITRHEGLPGFFRGLGAG 197

Query: 207 VVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDL 266
           V  I+PYMGL F  YE LK    +L            + D ++G +A + +K  V+PLD 
Sbjct: 198 VTGIVPYMGLFFAVYETLKLPLSELSLPF-------GSSDAVAGTVASVTAKTVVYPLDT 250

Query: 267 VRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAV 326
           VRKRLQVQGP R  Y   N+P +   +   IK +L  +G+ GLY+GL  +LIK+AP SAV
Sbjct: 251 VRKRLQVQGPTRGRYVHRNIPEF-RGVLGTIKAVLAREGMRGLYRGLGVSLIKAAPASAV 309

Query: 327 TFFVY 331
           T + Y
Sbjct: 310 TMWTY 314



>gi|358379859|gb|EHK17538.1| hypothetical protein TRIVIDRAFT_214109 [Trichoderma virens Gv29-8]
          Length = 308

 Score =  248 bits (634), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 137/310 (44%), Positives = 188/310 (60%), Gaps = 25/310 (8%)

Query: 33  CGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIRE 92
            GA+AG+VSRF+ +PLDVVKIRLQLQP    +PL+           Y G    IK I+R 
Sbjct: 8   AGAIAGLVSRFIVAPLDVVKIRLQLQPYSLSDPLAPLREAPA----YRGTVDTIKHILRH 63

Query: 93  EGIRGLWNGNLSAEYLYLSYGAVQFLTYHQ----MQNLFKRIDSNQNEKFGINKTLQPFL 148
           EG+ GLW GN+ AE +Y+ Y AVQF TY      +QN       +  E F          
Sbjct: 64  EGVTGLWKGNVPAELMYVCYSAVQFTTYRSTTVFLQNALPTRMPDSAETFVAGAVSGAAA 123

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVV 208
           +G         VTYP DLLRTRFAAQG  R+Y  LR A+  IY  EG +GF+RG+  ++ 
Sbjct: 124 TG---------VTYPLDLLRTRFAAQGRHRVYSSLRGALWDIYRDEGLKGFFRGLGPALG 174

Query: 209 QIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVR 268
           QIIP+MG+ F SYE L     +L+  H+  H    + D  +G +A +V+K  VFPLDLVR
Sbjct: 175 QIIPFMGIFFASYEGL-----RLQLGHL--HLPWGSGDATAGIVASVVAKTAVFPLDLVR 227

Query: 269 KRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTF 328
           KR+QVQGP R  Y  +++P+Y+S++   ++ I R++G+ GLYKGL  +L+K+AP SA+T 
Sbjct: 228 KRIQVQGPTRSKYVYNDIPVYTSAVR-GLRSIYRTEGLRGLYKGLPISLVKAAPASAITL 286

Query: 329 FVYGYTKRLL 338
           + Y  + +LL
Sbjct: 287 WTYERSLKLL 296



>gi|302922605|ref|XP_003053501.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256734442|gb|EEU47788.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 311

 Score =  248 bits (634), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 147/315 (46%), Positives = 195/315 (61%), Gaps = 19/315 (6%)

Query: 33  CGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIRE 92
            GA+AG+VSRFV +PLDVVKIRLQLQP    +PL+           Y G    ++ I++ 
Sbjct: 8   AGAIAGLVSRFVVAPLDVVKIRLQLQPFSLSDPLAPLREAPA----YRGAFATLQHILKH 63

Query: 93  EGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGAI 152
           EGI GLW GN+ AE LY+ YGAVQF TY       +     +     +    + F++GA 
Sbjct: 64  EGITGLWKGNVPAELLYVCYGAVQFTTYRSTTVFLQTAFPTR-----LPDAAESFIAGAA 118

Query: 153 SGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIP 212
           SG+ AT VTYP DLLRTRFAAQG  RIY  LR+A+  I   EG+RGF+RG+   + QI+P
Sbjct: 119 SGAAATGVTYPLDLLRTRFAAQGRHRIYRSLRSAIWDIQRDEGWRGFFRGIGPGLGQIVP 178

Query: 213 YMGLVFGSYEFLKKLFRKLEDKHI-WFHNLRATEDLLSGAIAGIVSKAGVFPLDLVRKRL 271
           +MGL F SYE L+     LE  H+ W      + D  +G +A I++K  VFPLDLVRKR+
Sbjct: 179 FMGLFFVSYESLRT---SLEGLHMPW-----GSGDATAGMMASILAKTAVFPLDLVRKRI 230

Query: 272 QVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVY 331
           QVQGP+R  Y   N+P YS++    I+ ILR++G  GLYKGL  +LIK+AP SAVT + Y
Sbjct: 231 QVQGPSRNRYVYENIPEYSTARG-AIRSILRTEGFRGLYKGLPISLIKAAPASAVTLWTY 289

Query: 332 GYTKRLLEKLHSSRD 346
             T + +   +S  +
Sbjct: 290 EQTMQFMLGWNSGAE 304



>gi|408387832|gb|EKJ67537.1| hypothetical protein FPSE_12282 [Fusarium pseudograminearum CS3096]
          Length = 322

 Score =  248 bits (633), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 147/329 (44%), Positives = 202/329 (61%), Gaps = 21/329 (6%)

Query: 18  QAVAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQP-GRPINPLSSRHHNSGTL 76
           QA   +Q S  ++   G +AG+VSRFV +PLDVVKIRLQLQP   P   ++ R+  +   
Sbjct: 4   QAYHHNQGSKFQVVAAGGIAGLVSRFVVAPLDVVKIRLQLQPYSLPDQVVALRNGPA--- 60

Query: 77  KKYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNE 136
             Y G    +K I++ EG+ GLW GN+ AE LY+ YGAVQF  Y       +    ++  
Sbjct: 61  --YRGAFATLKHILKHEGLTGLWKGNVPAELLYVCYGAVQFTAYRSTTVFLRTAFPSR-- 116

Query: 137 KFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGY 196
              +    + F++GA SG+ AT VTYP DLLRTRFAAQG+ R+Y  LR+A+  I   EG+
Sbjct: 117 ---LPDAAESFIAGAASGAAATSVTYPLDLLRTRFAAQGQHRVYRSLRSAIWDIKRDEGW 173

Query: 197 RGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHI-WFHNLRATEDLLSGAIAGI 255
           RGF+RG+   + QI+P+MG+ F +YE L+     LE  H+ W      + D  +G  A +
Sbjct: 174 RGFFRGIGPGLAQIMPFMGIFFVTYESLRS---SLEGLHMPW-----GSGDATAGMCASV 225

Query: 256 VSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMP 315
           +SK  VFPLDLVRKR+QVQGP R  Y   N+P YS++    IK ILR++G  GLYKGL  
Sbjct: 226 ISKTAVFPLDLVRKRIQVQGPARSQYVYGNIPEYSTARG-AIKTILRTEGFRGLYKGLTI 284

Query: 316 ALIKSAPVSAVTFFVYGYTKRLLEKLHSS 344
           +L+KSAP SAVT + Y  + +++    SS
Sbjct: 285 SLLKSAPASAVTLWTYEQSLKVMLNWDSS 313



>gi|326484040|gb|EGE08050.1| mitochondrial deoxynucleotide carrier [Trichophyton equinum CBS
           127.97]
          Length = 316

 Score =  248 bits (633), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 141/311 (45%), Positives = 189/311 (60%), Gaps = 15/311 (4%)

Query: 33  CGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIRE 92
            GA+AG+VSRF  +PLDVVKIRLQLQ     +PLS R         Y G    +  I R+
Sbjct: 20  AGAIAGLVSRFCIAPLDVVKIRLQLQIHSLSDPLSHRDVKGPV---YKGTISTLVAIARQ 76

Query: 93  EGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGAI 152
           EGI GLW GN+ AE LY+ YG +QF  Y  +  L   +         +   ++ F+SGA 
Sbjct: 77  EGIAGLWKGNIPAEILYICYGGIQFTAYRSVTQLLHLLPPQHR----VPSPVESFISGAA 132

Query: 153 SGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIP 212
           +G  AT  TYPFDLLRTRFAAQG  ++Y  L ++V+ IY  EG  GF+RGV+A+V Q++P
Sbjct: 133 AGGVATASTYPFDLLRTRFAAQGNNKVYNSLVSSVRDIYRYEGAGGFFRGVSAAVAQVVP 192

Query: 213 YMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVRKRLQ 272
           YMGL   +YE L+K    ++           + D  +G IA +++K GVFPLDLVRKRLQ
Sbjct: 193 YMGLFLAAYEALRKPINSVDLPF-------GSGDATAGMIASVMAKTGVFPLDLVRKRLQ 245

Query: 273 VQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYG 332
           VQGP R  Y   N+P Y   +   I+ I+R+ G+ GLY+GL  +LIK+AP SAVT + Y 
Sbjct: 246 VQGPTRSKYVHVNIPEY-HGVASTIRTIVRTQGVRGLYRGLTVSLIKAAPASAVTMWTYE 304

Query: 333 YTKRLLEKLHS 343
               +L++L S
Sbjct: 305 RVMAVLKELDS 315



>gi|402217544|gb|EJT97624.1| mitochondrial carrier [Dacryopinax sp. DJM-731 SS1]
          Length = 328

 Score =  247 bits (630), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 154/338 (45%), Positives = 204/338 (60%), Gaps = 32/338 (9%)

Query: 14  PIAEQAVAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNS 73
           P A     A   S+ ++ + G+V+G+ +RFV +PLDVVKIRLQLQ         S   + 
Sbjct: 18  PRAAGKENADTSSNWDLVVAGSVSGVTTRFVIAPLDVVKIRLQLQ---------SHARSD 68

Query: 74  GTLKKYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSN 133
            TL  Y G+      I+REEGI GLW GN+ AE LYL+YGA QF TY  +          
Sbjct: 69  TTLPVYRGLVQTTATILREEGITGLWKGNIPAELLYLTYGAAQFYTYRTIHLSLT----- 123

Query: 134 QNEKFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQG--EKRIYIGLRNAVQQIY 191
                GIN++ Q F++G  +G+ A  VTYPFDLLRTRFAAQG  + RIY  L NAV+ IY
Sbjct: 124 ---GLGINRSAQDFVAGGAAGAVAAFVTYPFDLLRTRFAAQGSGDLRIYTSLANAVRTIY 180

Query: 192 VQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKK-LFRKLEDKHIWFHNLRATEDLLSG 250
            +EG  GF+RGVTA V Q+IPYMGL F +YE  +  L R  E   + F      E  ++G
Sbjct: 181 AKEGVPGFFRGVTAGVGQVIPYMGLFFATYEPTRAFLTRHNEAGALSFSGY---ESAVAG 237

Query: 251 AIAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLY 310
             A  V+K GVFPLDL+RKRLQVQGP R+ Y   ++ +Y       ++ I++ +GI GLY
Sbjct: 238 GFASTVAKTGVFPLDLIRKRLQVQGPTREKYLQKDIAVYEG-----MRTIVQREGIRGLY 292

Query: 311 KGLMPALIKSAPVSAVTFFVYGYTKRLLEKLHSSR-DK 347
           +GL  +LIK+AP SA+T + Y   + +L  L S+R DK
Sbjct: 293 RGLGVSLIKAAPNSAITMWSY---EVVLRALKSARGDK 327



>gi|440473758|gb|ELQ42536.1| mitochondrial deoxynucleotide carrier [Magnaporthe oryzae Y34]
 gi|440488938|gb|ELQ68623.1| mitochondrial deoxynucleotide carrier [Magnaporthe oryzae P131]
          Length = 309

 Score =  246 bits (627), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 142/318 (44%), Positives = 182/318 (57%), Gaps = 15/318 (4%)

Query: 30  IGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLI 89
           +GIC A       FV +PLDVVKIRLQLQ     +PLS R         Y G    ++ I
Sbjct: 3   LGICRA---RNYSFVIAPLDVVKIRLQLQTHSLSDPLSQRAELLRGGPVYKGTLSTMRHI 59

Query: 90  IREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLS 149
            R+EGI GLW GN+ AE LY++Y AVQF TY     L  R+     +   +    + F++
Sbjct: 60  ARQEGITGLWKGNVPAELLYITYSAVQFATYRSAAQLLHRVAGEDRQ---LPAAAESFVA 116

Query: 150 GAISGSTATIVTYPFDLLRTRFAAQG--EKRIYIGLRNAVQQIYVQEGYRGFYRGVTASV 207
           GA +G T+T VTYP DLLRTRFAAQG  + R+Y  LR AV  I+  EGYRGF+RG+  +V
Sbjct: 117 GAAAGVTSTTVTYPLDLLRTRFAAQGSGDDRVYQSLRRAVADIWRDEGYRGFFRGIGPAV 176

Query: 208 VQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLV 267
            Q  P+MG+ F +YE L+     L+    W   L      L+   A  ++K  VFPLDLV
Sbjct: 177 GQTFPFMGIFFAAYESLRAPLADLK-LPFWGGQL-----ALASMTASTLAKTAVFPLDLV 230

Query: 268 RKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVT 327
           R+R+QVQGP R  Y   N+P Y  + F  I  I R++G  GLY+GL  +LIKSAP SAVT
Sbjct: 231 RRRIQVQGPTRSKYVHKNIPEYKGT-FSTISTIARTEGFRGLYRGLTVSLIKSAPASAVT 289

Query: 328 FFVYGYTKRLLEKLHSSR 345
            + Y    R L    S R
Sbjct: 290 MWTYERVLRALITFQSGR 307



>gi|46108312|ref|XP_381214.1| hypothetical protein FG01038.1 [Fusarium graminearum PH-1]
          Length = 364

 Score =  246 bits (627), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 143/320 (44%), Positives = 198/320 (61%), Gaps = 19/320 (5%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           S +++   G +AG+VSRFV +PLDV+KIRLQLQP    + L S+         Y G    
Sbjct: 54  SKVQVVAAGGIAGLVSRFVVAPLDVIKIRLQLQP----HSLPSQVAALRNGPAYRGAFAT 109

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQ 145
           +K I++ EG+ GLW GN+ AE LY+ YGAVQF  Y       +    ++     +  + +
Sbjct: 110 LKHILKHEGLTGLWKGNVPAELLYVCYGAVQFTAYRSTTVFLRTAFPSR-----LPDSAE 164

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTA 205
            F++GA SG+ AT VTYP DLLRTRFAAQG+ R+Y  LR+A+  I   EG+RGF+RG+  
Sbjct: 165 SFIAGAASGAAATSVTYPLDLLRTRFAAQGQHRVYQSLRSAIWDIKRDEGWRGFFRGIGP 224

Query: 206 SVVQIIPYMGLVFGSYEFLKKLFRKLEDKHI-WFHNLRATEDLLSGAIAGIVSKAGVFPL 264
            + QI+P+MG+ F +YE L+     LE  H+ W      + D  +G  A ++SK  VFPL
Sbjct: 225 GLAQIMPFMGIFFVTYESLRS---SLEGLHMPW-----GSGDATAGMCASVISKTVVFPL 276

Query: 265 DLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVS 324
           DLVRKR+QVQGP R  Y   N+P YS++    IK ILR++G  GLYKGL  +L+KSAP S
Sbjct: 277 DLVRKRIQVQGPARSQYVYGNIPEYSTARG-AIKTILRTEGFRGLYKGLTISLLKSAPAS 335

Query: 325 AVTFFVYGYTKRLLEKLHSS 344
           AVT + Y  + +++    SS
Sbjct: 336 AVTLWTYEQSLKVMLDWDSS 355



>gi|430812153|emb|CCJ30426.1| unnamed protein product [Pneumocystis jirovecii]
          Length = 324

 Score =  244 bits (624), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 131/317 (41%), Positives = 187/317 (58%), Gaps = 17/317 (5%)

Query: 31  GICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLII 90
            I G ++G  +R   SP DVVKIRLQL+      P S     +  +  Y+G+  ++K II
Sbjct: 22  AISGGISGFSARLFISPFDVVKIRLQLKT----YPSSYSKELNHKILPYHGIISSVKHII 77

Query: 91  REEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSG 150
            +EGI  LW GN SA+ LY+ YGA QF TY + ++L   I   +    G     + F+SG
Sbjct: 78  HQEGIFALWKGNCSAQILYMVYGATQFFTYAKCKSLLDNIFPEKKYNSG-----KSFISG 132

Query: 151 AISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQI 210
           AI G+  TI +YPFDLLRTRFAAQG+ +IY+ +  +++ IY+ EG RGFYRG+  S+VQI
Sbjct: 133 AIGGALGTIASYPFDLLRTRFAAQGKSKIYLSIPQSIRSIYISEGIRGFYRGINVSLVQI 192

Query: 211 IPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVRKR 270
           +PYMG+V G YE  K    K      W        D   G ++G + K  VFPLD++RK 
Sbjct: 193 MPYMGIVLGIYESSKVYIPKTGHFSYW-------GDAFLGIVSGTIGKTIVFPLDVIRKC 245

Query: 271 LQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFFV 330
           LQVQGP R  YF  ++P+Y+  +   I  I +++G  GLYKG   +++K+AP +A+TF+ 
Sbjct: 246 LQVQGPTRTKYFYEDIPIYNRIMKTGI-IIFKTEGFLGLYKGWWVSILKAAPSTAITFWT 304

Query: 331 YGYTKRLLEKLHSSRDK 347
           Y  +   +  L    +K
Sbjct: 305 YEKSLNFINTLEQKNNK 321



>gi|378733175|gb|EHY59634.1| mitochondrial thiamine pyrophosphate carrier 1 [Exophiala
           dermatitidis NIH/UT8656]
          Length = 331

 Score =  244 bits (624), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 147/307 (47%), Positives = 191/307 (62%), Gaps = 25/307 (8%)

Query: 29  EIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKL 88
           ++ I G VAG+VSRF  +PLDVVKIRLQLQP    +PLS           Y G+   ++ 
Sbjct: 16  QVVIAGGVAGLVSRFCIAPLDVVKIRLQLQPHSLSDPLSCDGIKGPI---YKGVFSTLRA 72

Query: 89  IIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYH---QMQNLFKRIDSNQNEKFGINKTLQ 145
           I+R+EGIR LW GN+ AE +Y+ YG VQF  Y    Q+Q+L  R             +++
Sbjct: 73  IVRQEGIRALWKGNIPAELMYVCYGGVQFTAYRSITQLQSLLPRRPP---------PSVE 123

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTA 205
            F+SGA +G+ AT  TYPFDLLRTRFAAQG +R+Y GL  AV+ I   EG+RGF+RG++A
Sbjct: 124 SFISGAGAGAAATTATYPFDLLRTRFAAQGPQRVYNGLLFAVRDISRNEGFRGFFRGLSA 183

Query: 206 SVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLR-ATEDLLSGAIAGIVSKAGVFPL 264
           +V QI+PYMGL F SYEFL         +HI    L   + D  +G  A I +K  VFPL
Sbjct: 184 AVGQIVPYMGLFFSSYEFLH--------QHIGGKTLPFGSGDATAGIFASIFAKTAVFPL 235

Query: 265 DLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVS 324
           DL+RKRLQVQGP R  Y  SN+P Y+  I   +  I + +G  G Y+GL  +LIK+AP S
Sbjct: 236 DLIRKRLQVQGPTRTKYIHSNIPEYNGVIR-GLAAIWKREGYRGWYRGLTVSLIKAAPAS 294

Query: 325 AVTFFVY 331
           AVT + Y
Sbjct: 295 AVTMWTY 301



>gi|336274066|ref|XP_003351787.1| hypothetical protein SMAC_00332 [Sordaria macrospora k-hell]
 gi|380096068|emb|CCC06115.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 333

 Score =  244 bits (622), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 133/309 (43%), Positives = 184/309 (59%), Gaps = 12/309 (3%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNS--GTLKKYNGMS 83
           S +++   GA AG++SRFV +PLDVVKIRLQLQ     +P+  +      G    Y G  
Sbjct: 13  SRLQVTAAGATAGLISRFVIAPLDVVKIRLQLQHHSLSDPVIHQRGPEIVGGGPIYKGTL 72

Query: 84  HAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFK-RIDSNQNEKFGINK 142
             I+ I+R EG+ GLW GN+ AE LY+SY A QF TY  +    +     +QN++  +  
Sbjct: 73  PTIRHILRTEGLTGLWKGNIPAELLYVSYAAAQFTTYRSITQFLQVTFPKDQNKQ--LPA 130

Query: 143 TLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRG 202
           +++ F++GA +G  AT  TYP DLLRTRFAAQG +R+Y  L  A++ IYV EG  G++RG
Sbjct: 131 SVESFVAGASAGGLATAATYPLDLLRTRFAAQGVERVYPSLYQAIKNIYVSEGLSGYFRG 190

Query: 203 VTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVF 262
           +   + QIIPYMG+ F  YEFL+   + LE        +      +        +K G F
Sbjct: 191 LGPGLAQIIPYMGMFFCVYEFLRPSLQNLELPFSSGGAVAGVVASVV-------AKTGTF 243

Query: 263 PLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAP 322
           PLDLVRKR+QVQGP R  Y   N+P+Y   I   +  I+R +G+ GLY+GL  +L K+AP
Sbjct: 244 PLDLVRKRIQVQGPTRSLYVHKNIPVYDGGIVKTVGTIVRREGVRGLYRGLTVSLFKAAP 303

Query: 323 VSAVTFFVY 331
            SAVT + Y
Sbjct: 304 ASAVTMWTY 312



>gi|342887899|gb|EGU87327.1| hypothetical protein FOXB_02203 [Fusarium oxysporum Fo5176]
          Length = 323

 Score =  244 bits (622), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 144/307 (46%), Positives = 194/307 (63%), Gaps = 19/307 (6%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           S +++   GA+AG+VSRFV +PLDVVKIRLQLQP    +P+++  +       Y G    
Sbjct: 13  SRVQVVAAGAIAGLVSRFVVAPLDVVKIRLQLQPHSLSDPVAALRNAPA----YRGAFET 68

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQ 145
           +K I++ EG+ GLW GN+ AE +Y+ YGAVQF TY     LF R          +    +
Sbjct: 69  LKHILKHEGLTGLWKGNVPAELMYVCYGAVQFTTYRS-ATLFLRTAFPTR----LPDAAE 123

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTA 205
            F++GA SG+ AT +TYP DLLRTRFAAQG  R+Y  LR+AV  I   EG+RGF+RG+  
Sbjct: 124 SFIAGAASGAAATTITYPLDLLRTRFAAQGRHRVYQSLRSAVWDIKRDEGWRGFFRGIGP 183

Query: 206 SVVQIIPYMGLVFGSYEFLKKLFRKLEDKHI-WFHNLRATEDLLSGAIAGIVSKAGVFPL 264
            + QIIP+MG+ F +YE L+     LE  H+ W      + D  +G  A I+SK  VFPL
Sbjct: 184 GLGQIIPFMGIFFVTYESLRT---SLEGLHMPW-----GSGDATAGMCASILSKTAVFPL 235

Query: 265 DLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVS 324
           DLVRKR+QVQGP R+ Y   N+P Y+++    +  ILR++G  GLYKGL  +L+KSAP S
Sbjct: 236 DLVRKRIQVQGPARRQYVYQNIPEYATARSALLS-ILRTEGFRGLYKGLTISLLKSAPAS 294

Query: 325 AVTFFVY 331
           AVT + Y
Sbjct: 295 AVTLWTY 301



>gi|310790775|gb|EFQ26308.1| hypothetical protein GLRG_01452 [Glomerella graminicola M1.001]
          Length = 322

 Score =  244 bits (622), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 141/322 (43%), Positives = 198/322 (61%), Gaps = 15/322 (4%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           S +++   GA AG+ +RFV +PLDVVKIRLQLQ     +PLS +  N G +  Y G  + 
Sbjct: 13  SRLQVVTAGATAGLFARFVIAPLDVVKIRLQLQTHSLSDPLSVQSANGGPV--YKGTLNT 70

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQ 145
           I+ I+  EGI GLW GN+ AE +Y+ Y AVQF+TY       +    N+     +    +
Sbjct: 71  IRHILANEGITGLWKGNVPAELMYVCYSAVQFMTYRSTAQFLQTTFDNR-----LPSAAE 125

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTA 205
            F++GA +G+ AT  TYP DLLRTRFAAQG  R+Y  LR AV  IY  EG RG++RG+  
Sbjct: 126 SFIAGAAAGAAATTTTYPLDLLRTRFAAQGNDRVYKSLRTAVADIYRDEGPRGYFRGLGP 185

Query: 206 SVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLD 265
            V QI+PYMG+ F  YE L+     L D H+ +    AT    +G +A ++SK  +FPLD
Sbjct: 186 GVAQIVPYMGIFFALYEGLRL---PLGDLHLPWGGGDAT----AGVVASVMSKTAIFPLD 238

Query: 266 LVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSA 325
           LVRKR+QVQGP R  Y   N+P Y  ++   ++ IL ++G  GLY+GL  +L+K+AP SA
Sbjct: 239 LVRKRIQVQGPTRSRYVHKNIPEYPGAVR-AMRIILANEGARGLYRGLTVSLLKAAPGSA 297

Query: 326 VTFFVYGYTKRLLEKLHSSRDK 347
           +T + Y    ++L++L  S +K
Sbjct: 298 ITVWTYERMLKVLQRLDGSDEK 319



>gi|340923797|gb|EGS18700.1| putative thiamine pyrophosphate protein [Chaetomium thermophilum
           var. thermophilum DSM 1495]
          Length = 329

 Score =  243 bits (621), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 142/316 (44%), Positives = 190/316 (60%), Gaps = 13/316 (4%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPL-SSRHHNSGTLKKYNGMSH 84
           S +++ + GA AG++SRFV +PLDVVKIRLQLQP    +PL SSR         Y G   
Sbjct: 15  SRLQVTLAGATAGLISRFVIAPLDVVKIRLQLQPHSLSDPLLSSRLDQLRGGPIYKGTLR 74

Query: 85  AIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTL 144
            ++ I+R EG+ GLW GN+ AE LY+ Y AVQF TY     L + +     E+  + +  
Sbjct: 75  TMQHIVRHEGLPGLWKGNVPAELLYVCYSAVQFTTYRTTTQLLRAV----FEQDSLPQAA 130

Query: 145 QPFLSGAISGSTATIVTYPFDLLRTRFAAQG-EKRIYIGLRNAVQQIYVQEGYRGFYRGV 203
           + F+ GA  G+ AT VTYP DLLRTRFAAQG + R+Y  LR A++QIY  EG RGF+RG+
Sbjct: 131 ESFVCGATGGAAATAVTYPLDLLRTRFAAQGNDDRVYPNLRRAIRQIYRDEGLRGFFRGL 190

Query: 204 TASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFP 263
              V QI+PYMG  F  YE L+ +   L+          ++   ++G IA + +K   FP
Sbjct: 191 GPGVAQIVPYMGCFFAFYETLRPVLGPLDLPF-------SSGTAVAGTIASVAAKTVTFP 243

Query: 264 LDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPV 323
           LDLVRKR+QVQGP R  Y   N+P Y        + ILR +G+ GLY+GL  +L+K+AP 
Sbjct: 244 LDLVRKRIQVQGPTRGRYVHKNIPEYKGGAVGTFRTILRMEGMRGLYRGLTVSLVKAAPA 303

Query: 324 SAVTFFVYGYTKRLLE 339
           SAVT + Y    R  E
Sbjct: 304 SAVTMWTYERALRFYE 319



>gi|449297377|gb|EMC93395.1| hypothetical protein BAUCODRAFT_125259 [Baudoinia compniacensis
           UAMH 10762]
          Length = 318

 Score =  243 bits (620), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 142/317 (44%), Positives = 198/317 (62%), Gaps = 16/317 (5%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           +  ++ + GA+AG++SRF  +PLDV+KIRLQLQ     +PLS+       L+   G+   
Sbjct: 13  TRTQVVLAGAIAGLISRFCIAPLDVLKIRLQLQYHSLADPLST------PLRPSAGVLQV 66

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQ 145
            + I+R EGI G W GN+ AE LYLSYGAVQFL Y      F  ++  Q  +  I   L+
Sbjct: 67  ARDILRHEGITGFWKGNVPAEGLYLSYGAVQFLAYRTTNQTFDALEETQGVQ--IPGALR 124

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTA 205
            F++GA++G+ AT  TYP DLLRTRFAAQG  R+Y GL  +++ I   EG  GF+RG++A
Sbjct: 125 SFIAGAVAGTAATTATYPLDLLRTRFAAQGTDRVYDGLLASIRDITRHEGPAGFFRGLSA 184

Query: 206 SVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLD 265
            + Q++PYMGL F  YE LK     L   H+ F     + D ++G  A ++SK+ VFPLD
Sbjct: 185 GIGQVVPYMGLFFALYEGLKA---PLAAVHLPF----GSGDAVAGITASMLSKSAVFPLD 237

Query: 266 LVRKRLQVQGPNRKDYF-ISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVS 324
            VRKRLQ+QGPNR  Y   S +P+Y   +   ++ IL+ +G  GLY+GL  +LIK+AP S
Sbjct: 238 TVRKRLQIQGPNRDRYVGGSRMPVYGGGVVHTLRMILKREGWRGLYRGLGVSLIKAAPAS 297

Query: 325 AVTFFVYGYTKRLLEKL 341
           AVT + Y  T  +L+ L
Sbjct: 298 AVTMWTYERTLHILQDL 314



>gi|477535973|gb|ENH87470.1| mitochondrial deoxynucleotide carrier [Colletotrichum orbiculare
           MAFF 240422]
          Length = 321

 Score =  243 bits (619), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 142/322 (44%), Positives = 196/322 (60%), Gaps = 15/322 (4%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           S +++   GA AG+++RFV +PLDVVKIRLQLQ     +PLS      G +  Y G  + 
Sbjct: 13  SRLQVVTAGATAGLLARFVIAPLDVVKIRLQLQTHSLSDPLSIPSAEGGPV--YKGTLNT 70

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQ 145
           IK I+  EG+ GLW GN+ AE LY+ Y AVQF TY     L +    ++     +    +
Sbjct: 71  IKHILANEGLTGLWKGNVPAELLYVCYSAVQFTTYRSTAQLLQSAFDDK-----LPHAAE 125

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTA 205
            F+SGA +G+ AT  TYP DLLRTRFAAQG +RIY  LR+AV  IY  EG RGF+RG+  
Sbjct: 126 SFISGAAAGAAATTATYPLDLLRTRFAAQGNERIYNNLRHAVTDIYRDEGARGFFRGLGP 185

Query: 206 SVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLD 265
            V QI+PYMG+ F  YE L+     L+    W        D  +G +A ++SK  VFPLD
Sbjct: 186 GVAQIVPYMGIFFALYEGLRLPLGNLQLP--W-----GGGDATAGVVASVLSKTAVFPLD 238

Query: 266 LVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSA 325
           LVRKR+QVQGP R  Y   N+P Y  ++   ++ I  ++G+ GLY+GL  +LIK+AP SA
Sbjct: 239 LVRKRIQVQGPTRSRYVHKNIPEYPGAVH-AMRIIFANEGVRGLYRGLTVSLIKAAPGSA 297

Query: 326 VTFFVYGYTKRLLEKLHSSRDK 347
           +T + Y    R++ +L +S ++
Sbjct: 298 ITVWTYERVLRIMMRLENSDEQ 319



>gi|453088134|gb|EMF16175.1| mitochondrial deoxynucleotide carrier [Mycosphaerella populorum
           SO2202]
          Length = 321

 Score =  241 bits (615), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 138/322 (42%), Positives = 193/322 (59%), Gaps = 13/322 (4%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           + I++ + GAV+G++SRF  +PLDVVKIRLQL      +PL+     +       G++  
Sbjct: 13  TRIQVVLAGAVSGLISRFCIAPLDVVKIRLQLHYHSLADPLARPIRAASP----TGVASV 68

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQ 145
           ++ I R EG+ G W GN+ AE LYLSYGAVQFL Y         +   ++    +  T  
Sbjct: 69  VRDIWRHEGLTGFWRGNIPAEGLYLSYGAVQFLAYRSTAQALNEL--AEHGGVALPGTAT 126

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTA 205
            F+SGA++G+ AT  TYP DLLRTRFAAQG +RIY GL  +V+ I  +EG+ GF+RG+ A
Sbjct: 127 SFISGAVAGTAATTATYPLDLLRTRFAAQGTERIYDGLIGSVRDIARREGFVGFFRGLNA 186

Query: 206 SVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLD 265
            + Q++PYMGL F  YE LK  F  ++           + D L+G  A I+SK  VFPLD
Sbjct: 187 GIGQVVPYMGLFFSLYEVLKPPFAAIQLPF-------GSGDALAGVTASILSKIAVFPLD 239

Query: 266 LVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSA 325
            VRKRLQVQGP+R  Y    VP+Y + +   ++ I+  +G  GLY+GL  +L+K+AP SA
Sbjct: 240 TVRKRLQVQGPSRSRYVGGRVPVYDNGVLSTLRMIMVKEGTVGLYRGLTVSLVKAAPSSA 299

Query: 326 VTFFVYGYTKRLLEKLHSSRDK 347
           VT + Y     L+  +   RD 
Sbjct: 300 VTMWAYERALHLMMTVKQERDS 321



>gi|471559942|gb|EMR62197.1| putative mitochondrial deoxynucleotide carrier protein [Eutypa lata
           UCREL1]
          Length = 341

 Score =  240 bits (613), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 140/314 (44%), Positives = 189/314 (60%), Gaps = 15/314 (4%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLK---KYNGM 82
           S +++ + G  AG++SRFV +PLDVVKIRLQLQ     +PL+  H   G  +    Y G 
Sbjct: 13  SRLQVVVAGGTAGLISRFVVAPLDVVKIRLQLQTHSLSDPLT--HAGDGRPRGSPAYKGT 70

Query: 83  SHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRI----DSNQNEKF 138
              ++ I+  EGI GLW GN+ AE LY+SY AVQF  Y     L  R     D++Q    
Sbjct: 71  LRTMRNIVASEGITGLWKGNVPAELLYVSYAAVQFTAYRSASMLLHRTLGGDDNHQRGHH 130

Query: 139 GINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRG 198
            +    + FL GA +G+  T  TYP DLLRTRFAAQG  R+Y  LR AV+ I   EG RG
Sbjct: 131 ILPYGAESFLCGATAGAAGTAATYPLDLLRTRFAAQGNDRVYASLRRAVRDIARDEGVRG 190

Query: 199 FYRGVTASVVQIIPYMGLVFGSYEFLK-KLFRKLEDKHIWFHNLRATEDLLSGAIAGIVS 257
           F+RG+  ++ QI+PYMGL F SYE L+  L R  +   + F     + D  +G +A + +
Sbjct: 191 FFRGLAPALAQIMPYMGLFFASYEALRVPLGRHRDHLGLPF----GSGDATAGVLASVTA 246

Query: 258 KAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPAL 317
           K  VFPLDLVRKR+QVQGP R  Y   N+P  S ++   +++I+R  G+ GLY+GL  +L
Sbjct: 247 KTAVFPLDLVRKRIQVQGPTRGRYVHKNIPEASGTLH-TMREIVRVSGVRGLYRGLTVSL 305

Query: 318 IKSAPVSAVTFFVY 331
            K+AP SAVT + Y
Sbjct: 306 FKAAPNSAVTMWTY 319



>gi|451853642|gb|EMD66935.1| hypothetical protein COCSADRAFT_33856 [Bipolaris sorokiniana
           ND90Pr]
          Length = 321

 Score =  239 bits (610), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 135/303 (44%), Positives = 189/303 (62%), Gaps = 13/303 (4%)

Query: 29  EIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKL 88
           ++ I GAVAG+VSRFV +PLDV+KIRLQLQ     +P S RH        Y G    +K 
Sbjct: 16  QVVIAGAVAGLVSRFVIAPLDVIKIRLQLQIHSLSDPFSVRHVQGPV---YKGTLGTLKQ 72

Query: 89  IIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFL 148
           I+REEG+ GLW GN+ AE +YL+YG+VQF  Y  + ++ + +       + +  ++  F+
Sbjct: 73  ILREEGLTGLWKGNIPAELMYLTYGSVQFSAYTYVSHILEALP----PPYTLPGSVTNFI 128

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVV 208
           SGA +G+ AT +TYP DLLRTRFAAQG +R+Y  +  +++ I   EG  GF+RG+ A V 
Sbjct: 129 SGASAGAAATTLTYPLDLLRTRFAAQGTERVYTSIVASLRHIAQHEGPTGFFRGLGAGVS 188

Query: 209 QIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVR 268
           QI+PYMGL F SYE LK +           H    + D ++G IA I+SK  V+PLD  R
Sbjct: 189 QIVPYMGLFFASYESLKPITAASP-----IHLPLGSSDAVAGVIASILSKTAVYPLDTTR 243

Query: 269 KRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTF 328
           KRLQVQGP R+ Y   N+P Y + +   +  I + +G  G+Y+GL  +L+K+AP SAVT 
Sbjct: 244 KRLQVQGPTRERYVHRNIPTY-TGVVSTLAHIWKHEGRRGMYRGLTVSLLKAAPASAVTM 302

Query: 329 FVY 331
           + Y
Sbjct: 303 WTY 305



>gi|396471117|ref|XP_003838794.1| similar to mitochondrial thiamine pyrophosphate carrier 1
           [Leptosphaeria maculans JN3]
 gi|312215363|emb|CBX95315.1| similar to mitochondrial thiamine pyrophosphate carrier 1
           [Leptosphaeria maculans JN3]
          Length = 314

 Score =  239 bits (610), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 137/303 (45%), Positives = 186/303 (61%), Gaps = 13/303 (4%)

Query: 29  EIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKL 88
           ++ + GAVAG+VSRFV +PLDV+KIRLQLQ     +PLS    N      Y G    +K 
Sbjct: 8   QVVVAGAVAGLVSRFVIAPLDVIKIRLQLQIHSLSDPLSVSKVNGPV---YKGTLGTLKQ 64

Query: 89  IIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFL 148
           I+REEGI GLW GN+ AE +YL+YG+ QF  Y  + +L + I       + +  +   F+
Sbjct: 65  ILREEGITGLWKGNIPAELMYLTYGSAQFSAYTYVSHLLETIP----PPYTLPGSATSFI 120

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVV 208
           SGA +G+ AT  TYP DLLRTRFAAQG  R+Y  +  +V+QI   EG  GF+RG+ A V 
Sbjct: 121 SGAAAGAAATTATYPLDLLRTRFAAQGTDRVYPSILASVKQIAQHEGPYGFFRGLGAGVS 180

Query: 209 QIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVR 268
           QI+PYMGL F SYE LK +                + D ++G +A ++SK  V+PLD  R
Sbjct: 181 QIVPYMGLFFSSYESLKPIMANCP-----LPLPLGSSDAVAGVVASVLSKTAVYPLDTTR 235

Query: 269 KRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTF 328
           KRLQVQGP R+ Y   N+P+Y + +   I  I + +G  GLY+GL  +L+K+AP SAVT 
Sbjct: 236 KRLQVQGPTRERYVHRNIPMY-TGVLSTISHIWKHEGRRGLYRGLTVSLLKAAPASAVTM 294

Query: 329 FVY 331
           + Y
Sbjct: 295 WTY 297



>gi|296412099|ref|XP_002835765.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295629555|emb|CAZ79922.1| unnamed protein product [Tuber melanosporum]
          Length = 334

 Score =  239 bits (610), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 133/318 (41%), Positives = 190/318 (59%), Gaps = 20/318 (6%)

Query: 22  ASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQP------GRPINPLSSRHHNSGT 75
           +  LSS+          +  RFV +PLDV+KIRLQLQP             S+       
Sbjct: 14  SCSLSSLPFLPQADTCSLTPRFVIAPLDVIKIRLQLQPIPTSTPTIQTTTPSALASAPPP 73

Query: 76  LKKYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQN 135
              Y G+   +  I+REE I GLW GN+ AE LY++YGA QFLTY  +           +
Sbjct: 74  PPLYRGILPTLLRILREETITGLWKGNIPAELLYITYGAAQFLTYRHLTTTL------DS 127

Query: 136 EKFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQ--GEKRIYIGLRNAVQQIYVQ 193
             + +  +L+ F+SG ++G+ AT ++YPFDLLRTRFAAQ  G++RIY  + ++++QI   
Sbjct: 128 PFYALPPSLKYFVSGGLAGAAATTLSYPFDLLRTRFAAQANGDRRIYTSILHSIRQIRRS 187

Query: 194 EGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIA 253
           EGY GF+RG  A V QI+PYMGLVF ++E  KK    L DK     +   T D +SG +A
Sbjct: 188 EGYAGFFRGWGAGVTQIVPYMGLVFMTHEATKKF---LGDK---LDSNSKTLDAVSGGLA 241

Query: 254 GIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGL 313
           G+V+K G FPLDL+RKRLQVQGP R  Y + +     + +    + +LR +G+ GLY+GL
Sbjct: 242 GVVAKTGTFPLDLIRKRLQVQGPTRTRYLLGDRLPVHTGVLGTARDVLRVEGVRGLYRGL 301

Query: 314 MPALIKSAPVSAVTFFVY 331
           + +L+K+AP+SA T + +
Sbjct: 302 VVSLVKAAPLSAATMWSF 319



>gi|402086530|gb|EJT81428.1| hypothetical protein GGTG_01408 [Gaeumannomyces graminis var.
           tritici R3-111a-1]
          Length = 337

 Score =  238 bits (608), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 141/325 (43%), Positives = 192/325 (59%), Gaps = 12/325 (3%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTL---KKYNGM 82
           S +++ + GA AGMV+RFV +PLDVVKIRLQLQ     +PLS R    G       Y G 
Sbjct: 13  SRLQVVVAGATAGMVARFVIAPLDVVKIRLQLQTHSLSDPLSLRDLRRGGAVVGPVYKGT 72

Query: 83  SHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINK 142
              ++ I+R EG+ GLW GN+ AE LY++Y A+QF  Y  +  L KR+      +  +  
Sbjct: 73  ISTMRQIVRAEGLTGLWKGNVPAELLYIAYSAIQFTAYRSVAQLLKRVGDETGGRR-LPP 131

Query: 143 TLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRG 202
             + F++GA +G  AT  TYP DLLRTRFAAQG  R+Y  LR AV  I+  EG RGF+RG
Sbjct: 132 AAESFVAGAAAGVAATTATYPLDLLRTRFAAQGVDRVYPSLRRAVADIWRDEGPRGFFRG 191

Query: 203 VTASVVQIIPYMGLVFGSYEFLKKLF---RKLEDKHIWFHNLRATEDLLSGAIAGIVSKA 259
           ++ +V Q +P+MG+ F +YE L+      R L    +W       +  L+   A  V+K 
Sbjct: 192 LSPAVGQTVPFMGIFFAAYESLRAPLSDARLLPPSFLW-----GGQLALASIAASAVAKT 246

Query: 260 GVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIK 319
            VFPLDLVR+R+QVQGP R  Y   N+P Y       +  ILR++G+ GLY+GL  +L+K
Sbjct: 247 AVFPLDLVRRRIQVQGPTRSRYVHRNIPEYRRGALHTVSVILRAEGVRGLYRGLTVSLLK 306

Query: 320 SAPVSAVTFFVYGYTKRLLEKLHSS 344
           +AP SAVT + Y    R L +L  S
Sbjct: 307 AAPASAVTMWTYERVLRTLIQLEQS 331



>gi|452002017|gb|EMD94476.1| hypothetical protein COCHEDRAFT_1153756 [Bipolaris maydis C5]
 gi|477584088|gb|ENI01182.1| hypothetical protein COCC4DRAFT_148481 [Bipolaris maydis ATCC
           48331]
          Length = 321

 Score =  238 bits (607), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 134/303 (44%), Positives = 189/303 (62%), Gaps = 13/303 (4%)

Query: 29  EIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKL 88
           ++ I GAVAG+VSRFV +PLDV+KIRLQLQ     +P S RH        Y G    +K 
Sbjct: 16  QVVIAGAVAGLVSRFVIAPLDVIKIRLQLQIHSLSDPFSVRHVQGPV---YKGTLGTLKQ 72

Query: 89  IIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFL 148
           I+REEG+ GLW GN+ AE +YL+YG+VQF  Y  + ++ + +       + +  ++  F+
Sbjct: 73  ILREEGLTGLWKGNIPAELMYLTYGSVQFSAYTYVSHILEALP----PPYTLPGSVTNFI 128

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVV 208
           SGA +G+ AT +TYP DLLRTRFAAQG +R+Y  +  +++ I   EG  GF+RG+ A V 
Sbjct: 129 SGASAGAAATTLTYPLDLLRTRFAAQGTERVYTSIVASLRHIAQHEGPTGFFRGLGAGVS 188

Query: 209 QIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVR 268
           QI+PYMGL F SYE LK +           H    + D ++G +A I+SK  V+PLD  R
Sbjct: 189 QIVPYMGLFFASYESLKPITAASP-----IHLPLGSSDAVAGVMASILSKTAVYPLDTTR 243

Query: 269 KRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTF 328
           KRLQVQGP R+ Y   N+P Y + +   +  I + +G  G+Y+GL  +L+K+AP SAVT 
Sbjct: 244 KRLQVQGPTRERYVHRNIPTY-TGVVSTLANIWKHEGRRGMYRGLTVSLLKAAPASAVTM 302

Query: 329 FVY 331
           + Y
Sbjct: 303 WTY 305



>gi|330934819|ref|XP_003304722.1| hypothetical protein PTT_17371 [Pyrenophora teres f. teres 0-1]
 gi|311318604|gb|EFQ87223.1| hypothetical protein PTT_17371 [Pyrenophora teres f. teres 0-1]
          Length = 322

 Score =  237 bits (605), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 136/306 (44%), Positives = 187/306 (61%), Gaps = 13/306 (4%)

Query: 29  EIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKL 88
           ++ + GAVAG+VSRFV +PLDV+KIRLQLQ     +P S+R+        Y G    +K 
Sbjct: 16  QVVVAGAVAGLVSRFVIAPLDVIKIRLQLQVHSLSDPFSARNVKGPV---YKGTLGTLKQ 72

Query: 89  IIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFL 148
           I+R+EGI GLW GN+ AE +YL+YG+ QF  Y  M +L   I         ++     F+
Sbjct: 73  ILRQEGITGLWKGNIPAELMYLTYGSAQFSAYRYMSHLLDAIPPPYTPPGSVSN----FI 128

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVV 208
           SGA +G+ AT  TYP DLLRTRFAAQG +R+Y  +  +++QI  QEG  GF+RG+ A + 
Sbjct: 129 SGATAGAVATTATYPLDLLRTRFAAQGPERVYTSIVTSLKQIAQQEGPTGFFRGLGAGIS 188

Query: 209 QIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVR 268
           QI+PYMGL F SYE LK +                + D ++G IA ++SK  V+PLD  R
Sbjct: 189 QIVPYMGLFFASYESLKPITATSS-----IPLPLGSSDAVAGVIASVLSKTAVYPLDTTR 243

Query: 269 KRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTF 328
           KRLQVQGP R+ Y   N+P Y + +   +  I + +G  GLY+GL  +L+K+AP SAVT 
Sbjct: 244 KRLQVQGPTRERYVHRNIPTY-NGVIRTLGHIWKHEGRRGLYRGLTVSLLKAAPASAVTM 302

Query: 329 FVYGYT 334
           + Y  T
Sbjct: 303 WTYERT 308



>gi|452848385|gb|EME50317.1| hypothetical protein DOTSEDRAFT_165457 [Dothistroma septosporum
           NZE10]
          Length = 330

 Score =  237 bits (605), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 138/324 (42%), Positives = 200/324 (61%), Gaps = 17/324 (5%)

Query: 29  EIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKL 88
           ++ + GA++G+++RF  +PLDV+KIRLQL     ++PLS+    + T     G+   ++ 
Sbjct: 16  QVVLAGAISGLIARFCIAPLDVIKIRLQLHYHSLVDPLSTPLRQNPT---PTGIYLIVQD 72

Query: 89  IIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFL 148
           I R EGI G W GN+ AE LYL Y AVQFLTY  +     +++ ++  K  +N T++ F+
Sbjct: 73  IWRNEGITGFWKGNVPAEGLYLGYAAVQFLTYRSVSQALDKVEEDRGVK--VNGTVKSFI 130

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVV 208
           +GA++G+ AT  TYP DLLRTRFAAQG +R+Y  L ++++ I   EG  G+++G+ A + 
Sbjct: 131 AGAVAGTAATTTTYPLDLLRTRFAAQGTQRVYTSLVSSIRDISRHEGISGWFKGLNAGIG 190

Query: 209 QIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVR 268
           QI+PYMGL F  YE LK     L    + F     + D ++G IA I+SK  VFPLD VR
Sbjct: 191 QIVPYMGLFFALYESLKP---PLSTMQLPF----GSGDAVAGIIASILSKTAVFPLDTVR 243

Query: 269 KRLQVQGPNRKDYFISN-VPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVT 327
           KRLQVQGP RK Y     +P+Y   +   +  ILR +G  GLY+GL  +L+K+AP SAVT
Sbjct: 244 KRLQVQGPTRKRYIGGERIPVYERGVVGTLGMILRREGTVGLYRGLTVSLVKAAPSSAVT 303

Query: 328 FFVY----GYTKRLLEKLHSSRDK 347
            + Y    G   R+ EK  +  D+
Sbjct: 304 MWAYERALGVIMRMGEKNEAGADR 327



>gi|189203267|ref|XP_001937969.1| mitochondrial deoxynucleotide carrier [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187985068|gb|EDU50556.1| mitochondrial deoxynucleotide carrier [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 322

 Score =  237 bits (604), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 135/303 (44%), Positives = 187/303 (61%), Gaps = 13/303 (4%)

Query: 29  EIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKL 88
           ++ + GAVAG+VSRFV +PLDV+KIRLQLQ     +P S R+        Y G    +K 
Sbjct: 16  QVVVAGAVAGLVSRFVIAPLDVIKIRLQLQVHSLSDPFSVRNVKGPV---YKGTLGTLKQ 72

Query: 89  IIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFL 148
           I+R+EGI GLW GN+ AE +YL+YG+ QF  Y  M +L + I +       ++     F+
Sbjct: 73  ILRQEGITGLWKGNIPAELMYLTYGSAQFSAYTYMSHLLESIPAPYTPPGSVSN----FI 128

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVV 208
           SGA +G+ AT  TYP DLLRTRFAAQG +R+Y  +  +++QI  QEG  GF+RG+ A + 
Sbjct: 129 SGATAGAAATTATYPLDLLRTRFAAQGPERVYTSILTSLKQIAQQEGPTGFFRGLGAGIS 188

Query: 209 QIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVR 268
           QI+PYMGL F SYE LK +                + D ++G IA ++SK  V+PLD  R
Sbjct: 189 QIVPYMGLFFASYESLKPITATSP-----IPLPLGSSDAVAGVIASVLSKTAVYPLDTTR 243

Query: 269 KRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTF 328
           KRLQVQGP R+ Y   N+P Y + +   +  I + +G  GLY+GL  +L+K+AP SAVT 
Sbjct: 244 KRLQVQGPTRERYVHRNIPTY-NGVIRTLGHIWKHEGRRGLYRGLTVSLLKAAPASAVTM 302

Query: 329 FVY 331
           + Y
Sbjct: 303 WTY 305



>gi|367044038|ref|XP_003652399.1| hypothetical protein THITE_2087527 [Thielavia terrestris NRRL 8126]
 gi|346999661|gb|AEO66063.1| hypothetical protein THITE_2087527 [Thielavia terrestris NRRL 8126]
          Length = 332

 Score =  236 bits (602), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 134/312 (42%), Positives = 187/312 (59%), Gaps = 16/312 (5%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           S +++   GA AG++SRFV +PLDVVKIRLQLQ     +P S R    G +  Y G    
Sbjct: 13  SRLQVTAAGATAGLISRFVIAPLDVVKIRLQLQTHSLSDPRSHRDLQGGPI--YKGTLRT 70

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGIN---- 141
           ++ I+  EG+ GLW GN+ AE +Y+ Y AVQF+TY     L +     +    G      
Sbjct: 71  MRQILASEGVTGLWKGNVPAELMYVCYSAVQFVTYRTTTQLLRAALGGEGAGGGGAGGGA 130

Query: 142 --KTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGF 199
             ++ + F++GA  G+ AT  TYP DLLRTRFAAQG  R+Y  LR AV QI   EG RGF
Sbjct: 131 LPQSAESFIAGAAGGAAATAATYPLDLLRTRFAAQGNDRVYGSLRRAVLQIRRDEGLRGF 190

Query: 200 YRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKA 259
           +RG+   + QI+PYMG+ F  YE L+     L+           +   ++G +A +++K 
Sbjct: 191 FRGLGPGLAQIVPYMGVFFAVYETLRPHLSGLDLPF-------GSGGAVAGTVASVLAKT 243

Query: 260 GVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIK 319
           G FPLDLVRKR+QVQGP R+ Y   N+P Y  ++   ++ ILR +G+ GLY+GL  +L+K
Sbjct: 244 GTFPLDLVRKRIQVQGPTRRRYVHKNIPEYKGTVG-AVRTILRQEGLRGLYRGLTVSLVK 302

Query: 320 SAPVSAVTFFVY 331
           +AP SAVT + Y
Sbjct: 303 AAPASAVTMWTY 314



 Score = 73.9 bits (180), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 91/202 (45%), Gaps = 45/202 (22%)

Query: 62  PINPLSSRHHNSGTLKKYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYH 121
           P++ L +R    G  + Y  +  A+  I R+EG+RG + G        L  G  Q + Y 
Sbjct: 154 PLDLLRTRFAAQGNDRVYGSLRRAVLQIRRDEGLRGFFRG--------LGPGLAQIVPY- 204

Query: 122 QMQNLFKRIDSNQNEKFGINKTLQPFLSG---------AISGSTATIV----TYPFDLLR 168
               +F          F + +TL+P LSG         A++G+ A+++    T+P DL+R
Sbjct: 205 --MGVF----------FAVYETLRPHLSGLDLPFGSGGAVAGTVASVLAKTGTFPLDLVR 252

Query: 169 TRFAAQGEKRI---------YIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFG 219
            R   QG  R          Y G   AV+ I  QEG RG YRG+T S+V+  P   +   
Sbjct: 253 KRIQVQGPTRRRYVHKNIPEYKGTVGAVRTILRQEGLRGLYRGLTVSLVKAAPASAVTMW 312

Query: 220 SYEFLKKLFRKLEDKHIWFHNL 241
           +YE     +  L ++  W  +L
Sbjct: 313 TYERALLFYTGLAER--WEQSL 332



>gi|482812184|gb|EOA88916.1| hypothetical protein SETTUDRAFT_168136 [Setosphaeria turcica Et28A]
          Length = 322

 Score =  236 bits (602), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 138/310 (44%), Positives = 192/310 (61%), Gaps = 13/310 (4%)

Query: 29  EIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKL 88
           ++ I GAVAG+VSRFV +PLDV+KIRLQLQ     +PLS RH    T   Y G    +K 
Sbjct: 16  QVVIAGAVAGLVSRFVIAPLDVIKIRLQLQIHSLSDPLSIRHVTGPT---YKGTLGTLKH 72

Query: 89  IIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFL 148
           I+REEG+ GLW GN+ AE +YL+YG+ QF  Y  + ++ + I       + +  ++  F+
Sbjct: 73  ILREEGLTGLWKGNIPAELMYLTYGSAQFSAYTYVSHILEAIP----PPYALPGSVTNFI 128

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVV 208
           SGA +G+ AT +TYP DLLRTRFAAQG  R+Y  L  +++ I   EG  GF+RG+ A + 
Sbjct: 129 SGASAGAAATTITYPLDLLRTRFAAQGIDRVYTSLPASIRHIAQHEGPTGFFRGLGAGIS 188

Query: 209 QIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVR 268
           QI+PYMGL F SYE LK +          F     + D ++G IA I+SK  V+PLD  R
Sbjct: 189 QIVPYMGLFFASYESLKPITAASP-----FPLPLGSSDAVAGVIASILSKTAVYPLDTTR 243

Query: 269 KRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTF 328
           KRLQVQGP R+ Y   N+P Y + +   +  I + +G  G+Y+GL  +L+K+AP SAVT 
Sbjct: 244 KRLQVQGPMREHYVHRNIPTY-TGVVSTLAHIWKYEGRRGMYRGLTVSLLKAAPASAVTM 302

Query: 329 FVYGYTKRLL 338
           + Y  T  ++
Sbjct: 303 WTYERTMGIM 312



>gi|485919250|gb|EOD45634.1| putative mitochondrial deoxynucleotide carrier protein
           [Neofusicoccum parvum UCRNP2]
          Length = 334

 Score =  235 bits (599), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 137/307 (44%), Positives = 187/307 (60%), Gaps = 18/307 (5%)

Query: 33  CGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIRE 92
            GA+AG+VSRFV +PLDV+KIRLQLQ     +PLS      G +  Y G    +K I+RE
Sbjct: 20  AGAIAGLVSRFVIAPLDVIKIRLQLQVHSLSDPLSHASIRGGPI--YKGTLGTLKHILRE 77

Query: 93  EGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRID--------SNQNEKFGINKTL 144
           EG+ GLW GN+ AE LYL YG++QFL Y    +  + +          +++++  +    
Sbjct: 78  EGLTGLWKGNVPAEALYLCYGSMQFLAYRSASSFLQSLTLPPSPSSAGDKHDRRLLPDAA 137

Query: 145 QPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVT 204
             FL+GA +G+ AT  TYP DLLRTRFAAQG +R+Y  L ++V+ I   EG RGF+RG  
Sbjct: 138 TTFLAGAFAGTAATTATYPLDLLRTRFAAQGHERVYASLSSSVRDIARAEGPRGFFRGAG 197

Query: 205 ASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPL 264
           A+V QI+PYMGL F +YE LK +             L +  D  +G  A +++K  VFPL
Sbjct: 198 AAVAQIVPYMGLFFLAYETLKPVAAATP--------LGSGGDAAAGMAASVLAKTAVFPL 249

Query: 265 DLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVS 324
           D VRKRLQVQGP R  Y   N+P+Y   +   +  I+R +G  GLY+GL  +L+K+AP S
Sbjct: 250 DTVRKRLQVQGPTRARYVHRNIPVYDGGVLRTVAAIVRREGARGLYRGLTVSLLKAAPTS 309

Query: 325 AVTFFVY 331
           AVT + Y
Sbjct: 310 AVTMWTY 316



>gi|169603169|ref|XP_001795006.1| hypothetical protein SNOG_04593 [Phaeosphaeria nodorum SN15]
 gi|160706339|gb|EAT88353.2| hypothetical protein SNOG_04593 [Phaeosphaeria nodorum SN15]
          Length = 316

 Score =  234 bits (598), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 137/303 (45%), Positives = 189/303 (62%), Gaps = 13/303 (4%)

Query: 29  EIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKL 88
           E+ + GA AG+VSRFV +PLDV+KIRLQLQ      P S R  N      Y G    +K 
Sbjct: 11  EVVVAGAAAGLVSRFVIAPLDVIKIRLQLQIHSLSEPTSYRGLNGPV---YKGTLGTLKQ 67

Query: 89  IIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFL 148
           I+R+EG+ GLW GN+ AE LYL+YG+VQF  Y  +  +   I +     + +  +   F+
Sbjct: 68  ILRDEGVTGLWKGNIPAELLYLTYGSVQFSAYTNISQMLDTIPA----PYTLPSSANSFI 123

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVV 208
           SGA +G+ AT VTYP DLLRTRFAAQG+ R+Y  +  +++ I   EG  GF+RG+ A V 
Sbjct: 124 SGAGAGAAATTVTYPLDLLRTRFAAQGKDRVYTSIVASLKSIAQHEGPTGFFRGLGAGVS 183

Query: 209 QIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVR 268
           QI+PYMGL F SYE LK +   + D  +       + D ++G +A +VSK  V+PLD  R
Sbjct: 184 QIVPYMGLFFASYESLKPV---MADSPLPLP--LGSSDAVAGVVASVVSKTAVYPLDTTR 238

Query: 269 KRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTF 328
           KRLQVQGPNR  Y   N+P Y S + + ++ I + +G  G+Y+GL  +L+K+AP SAVT 
Sbjct: 239 KRLQVQGPNRARYVHRNIPTY-SGVLMTLQHIWKHEGRRGMYRGLTVSLLKAAPASAVTM 297

Query: 329 FVY 331
           + Y
Sbjct: 298 WTY 300



>gi|121920754|sp|Q0UUH1.3|TPC1_PHANO RecName: Full=Mitochondrial thiamine pyrophosphate carrier 1
          Length = 321

 Score =  233 bits (595), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 136/303 (44%), Positives = 189/303 (62%), Gaps = 13/303 (4%)

Query: 29  EIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKL 88
           ++ + GA AG+VSRFV +PLDV+KIRLQLQ      P S R  N      Y G    +K 
Sbjct: 16  QVVVAGAAAGLVSRFVIAPLDVIKIRLQLQIHSLSEPTSYRGLNGPV---YKGTLGTLKQ 72

Query: 89  IIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFL 148
           I+R+EG+ GLW GN+ AE LYL+YG+VQF  Y  +  +   I +     + +  +   F+
Sbjct: 73  ILRDEGVTGLWKGNIPAELLYLTYGSVQFSAYTNISQMLDTIPA----PYTLPSSANSFI 128

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVV 208
           SGA +G+ AT VTYP DLLRTRFAAQG+ R+Y  +  +++ I   EG  GF+RG+ A V 
Sbjct: 129 SGAGAGAAATTVTYPLDLLRTRFAAQGKDRVYTSIVASLKSIAQHEGPTGFFRGLGAGVS 188

Query: 209 QIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVR 268
           QI+PYMGL F SYE LK +   + D  +       + D ++G +A +VSK  V+PLD  R
Sbjct: 189 QIVPYMGLFFASYESLKPV---MADSPLPLP--LGSSDAVAGVVASVVSKTAVYPLDTTR 243

Query: 269 KRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTF 328
           KRLQVQGPNR  Y   N+P Y S + + ++ I + +G  G+Y+GL  +L+K+AP SAVT 
Sbjct: 244 KRLQVQGPNRARYVHRNIPTY-SGVLMTLQHIWKHEGRRGMYRGLTVSLLKAAPASAVTM 302

Query: 329 FVY 331
           + Y
Sbjct: 303 WTY 305



>gi|346979278|gb|EGY22730.1| mitochondrial deoxynucleotide carrier [Verticillium dahliae
           VdLs.17]
          Length = 330

 Score =  232 bits (592), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 137/318 (43%), Positives = 188/318 (59%), Gaps = 15/318 (4%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           S +++   GA AG+VSRFV +PLDVVKIRLQLQ     +PLS      G +  Y G    
Sbjct: 13  SKLQVVTAGATAGLVSRFVIAPLDVVKIRLQLQSHSLSDPLSHPAAQGGPI--YKGTLST 70

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKR--IDSNQNEKFGINKT 143
           ++ I+R EG+ GLW GN+ AE +YL YG +QF  Y     L +         +   +   
Sbjct: 71  LRHILRSEGLPGLWKGNVPAELMYLCYGGIQFTAYRAATQLLRGGGAHGGTEDDRHLPHA 130

Query: 144 LQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGV 203
           ++ F++GA +G+ AT  TYP DLLRTRFAAQG  R+Y  LR AV +IY  EG RG     
Sbjct: 131 VESFVAGAAAGAAATTATYPLDLLRTRFAAQGNDRVYASLRGAVAEIYRDEGPRGSSAAS 190

Query: 204 TASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFP 263
              V QI+PYMG+ F +YE L+     LE    W        D  +G +A +++K  VFP
Sbjct: 191 GPGVAQIVPYMGMFFAAYEGLRLHLGALELP--W-----GGGDATAGVLASVLAKTAVFP 243

Query: 264 LDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPV 323
           LDLVRKR+QVQGP R  Y   N+P Y  ++   ++ ILR +G+ G+Y+GL+ +L+K+AP 
Sbjct: 244 LDLVRKRIQVQGPTRARYVHKNIPEYQGALG-ALRTILRVEGVRGMYRGLVVSLVKAAPG 302

Query: 324 SAVTFFVYGYTKRLLEKL 341
           SAVT + Y   +R+L  L
Sbjct: 303 SAVTVWTY---ERMLNWL 317



>gi|470289124|ref|XP_004342772.1| mitochondrial thiamine pyrophosphate carrier 1 [Capsaspora
           owczarzaki ATCC 30864]
 gi|320166140|gb|EFW43039.1| mitochondrial thiamine pyrophosphate carrier 1 [Capsaspora
           owczarzaki ATCC 30864]
          Length = 525

 Score =  232 bits (591), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 130/322 (40%), Positives = 187/322 (58%), Gaps = 16/322 (4%)

Query: 25  LSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSH 84
           L++ E  I GAVAG V+R   +PLDV+KIR QLQ    + P + +        KY G+  
Sbjct: 213 LTTTESAISGAVAGAVARCAIAPLDVLKIRFQLQ----LEPAAGK-------AKYTGILQ 261

Query: 85  AIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTL 144
           A++LI+REEGI  LW GNL+AE LY++YGA QF  +H  +++   +             L
Sbjct: 262 ALRLIVREEGISALWKGNLTAELLYMAYGASQFAFFHSYKSMILTLQYGHMPVGERGTEL 321

Query: 145 QP---FLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYR 201
            P   F+ GA++G  AT+V++PFD +RTR A+QGE R+Y  L +A Q I + +G RGFY+
Sbjct: 322 DPVSSFVGGALAGMLATVVSFPFDTMRTRLASQGEPRVYRSLFHAAQMIALNDGLRGFYK 381

Query: 202 GVTASVVQIIPYMGLVFGSYEFLKKLFRK-LEDKHIWFHNLRATEDLLSGAIAGIVSKAG 260
           G+   V+QI PYMGL F  YE  K+ FR  L  +H    NL   +    GA+AG +SK  
Sbjct: 382 GLVPGVIQIFPYMGLQFCFYESSKRTFRWILNPEHPQHVNLSQLQVTACGAVAGALSKFT 441

Query: 261 VFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKS 320
           V PLD+V+KRLQVQG     +       Y   +   ++ +L  +G+ G +KG +P+++KS
Sbjct: 442 VLPLDIVKKRLQVQGFEEPRFRFGRQQTY-LGMRNAMQIMLAQEGVRGFFKGGLPSVLKS 500

Query: 321 APVSAVTFFVYGYTKRLLEKLH 342
            P +A+TF VY +        H
Sbjct: 501 MPSTAITFAVYEWMCTWFANRH 522



 Score = 99.8 bits (247), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 61/232 (26%), Positives = 110/232 (47%), Gaps = 30/232 (12%)

Query: 14  PIAEQAVAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNS 73
           P+ E+      +SS    + GA+AGM++  V+ P D ++ RL  Q               
Sbjct: 313 PVGERGTELDPVSSF---VGGALAGMLATVVSFPFDTMRTRLASQ--------------- 354

Query: 74  GTLKKYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSN 133
           G  + Y  + HA ++I   +G+RG + G +        Y  +QF  Y   +  F+ I + 
Sbjct: 355 GEPRVYRSLFHAAQMIALNDGLRGFYKGLVPGVIQIFPYMGLQFCFYESSKRTFRWILNP 414

Query: 134 QNEKFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQG---------EKRIYIGLR 184
           ++ +      LQ    GA++G+ +     P D+++ R   QG          ++ Y+G+R
Sbjct: 415 EHPQHVNLSQLQVTACGAVAGALSKFTVLPLDIVKKRLQVQGFEEPRFRFGRQQTYLGMR 474

Query: 185 NAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHI 236
           NA+Q +  QEG RGF++G   SV++ +P   + F  YE++   F    ++H+
Sbjct: 475 NAMQIMLAQEGVRGFFKGGLPSVLKSMPSTAITFAVYEWMCTWF---ANRHV 523



>gi|389740924|gb|EIM82114.1| mitochondrial carrier [Stereum hirsutum FP-91666 SS1]
          Length = 331

 Score =  231 bits (589), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 137/333 (41%), Positives = 189/333 (56%), Gaps = 39/333 (11%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHH---NSGTLKK-YNGMSHAIK 87
           I GA AG+VSRF  +PLDVVKIRLQLQ         +R H   N G     Y       +
Sbjct: 19  IAGATAGVVSRFCIAPLDVVKIRLQLQ---------TRSHPQLNPGDKPPIYRSTLSTFR 69

Query: 88  LIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPF 147
            I++ EGI   W GN+ AE+LYL YGAVQF TY    +    +         +  +    
Sbjct: 70  TILKHEGITAFWKGNIPAEFLYLGYGAVQFTTYRTTSSFLTSLT------LPLPSSANSL 123

Query: 148 LSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASV 207
           +SG+I+G  +T+ TYP DLLRTRFAAQG++++Y  L + +  IY QEG +GF+RG+ A +
Sbjct: 124 ISGSIAGVASTLATYPLDLLRTRFAAQGKQKVYTSLASGIANIYTQEGVKGFFRGLGAGM 183

Query: 208 VQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAG-----------IV 256
           + I+P MGL F  YE L      L D H       +T  +L+  I G           I+
Sbjct: 184 MSIVPNMGLFFLFYETLHP---PLVDGHPDQRPKSSTHKILTSLIPGSAHASAGLLSSIL 240

Query: 257 SKAGVFPLDLVRKRLQVQGPNRKDYFISNV-PLYSSSIFI--CIKQILRSDGIFGLYKGL 313
           SK  +FPLDL+RKRLQVQGP R+ Y    + P Y   + I   +K+ILR +G+ GLY+GL
Sbjct: 241 SKTSIFPLDLIRKRLQVQGPTRQLYAHGPIMPRYDDGLGIRGTVKEILRREGVRGLYRGL 300

Query: 314 MPALIKSAPVSAVTFFVYGYTKRLLEKLHSSRD 346
             +L+K+AP SA+T +VY +   ++E L   R+
Sbjct: 301 GISLVKAAPSSAITMWVYEW---VMEGLRRERE 330



>gi|380482016|emb|CCF41502.1| mitochondrial thiamine pyrophosphate carrier 1 [Colletotrichum
           higginsianum]
          Length = 312

 Score =  230 bits (586), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 139/315 (44%), Positives = 189/315 (60%), Gaps = 23/315 (7%)

Query: 37  AGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIREEGIR 96
           AG+ +RFV +PLDVVKIRLQLQ     +PLS +    G +  Y G  + ++ I+  EGI 
Sbjct: 15  AGLFARFVIAPLDVVKIRLQLQTHSLSDPLSVQSAKGGPV--YKGTLNTMRHILMNEGIT 72

Query: 97  GLWNGNLSAEYLYLSYGAVQFLTYHQ----MQNLFKRIDSNQNEKFGINKTLQPFLSGAI 152
           GLW GN+ AE +Y+ Y AVQF TY      +Q  F +   N  E F         ++GA 
Sbjct: 73  GLWKGNVPAELMYVCYSAVQFTTYRSTAQFLQTAFDKRLPNAAESF---------IAGAA 123

Query: 153 SGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIP 212
           +G+ AT  TYP DLLRTRFAAQG  R+Y  LR AV  IY  EG RG++RG+   V QI+P
Sbjct: 124 AGAAATTATYPLDLLRTRFAAQGNDRVYKSLRTAVADIYRDEGPRGYFRGLGPGVAQIVP 183

Query: 213 YMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVRKRLQ 272
           YMG+ F  YE L+     L D H+ +    AT    +G +A ++SK  VFPLDLVRKR+Q
Sbjct: 184 YMGIFFALYEGLRL---PLGDLHLPWGGGDAT----AGVVASVMSKTAVFPLDLVRKRIQ 236

Query: 273 VQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYG 332
           VQGP R  Y   N+P Y  ++   ++ I  ++G+ GLY+GL  +L K+AP SA+T + Y 
Sbjct: 237 VQGPTRSRYVHKNIPEYPGAVR-AMRIIFVNEGVRGLYRGLTVSLFKAAPGSAITVWTYE 295

Query: 333 YTKRLLEKLHSSRDK 347
              R+L+KL    ++
Sbjct: 296 RVLRMLQKLEGPGEQ 310



>gi|406863764|gb|EKD16811.1| hypothetical protein MBM_05280 [Marssonina brunnea f. sp.
           'multigermtubi' MB_m1]
          Length = 330

 Score =  229 bits (585), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 135/337 (40%), Positives = 194/337 (57%), Gaps = 29/337 (8%)

Query: 24  QLSSIEIGICGAVAGMVSR---------------FVASPLDVVKIRLQLQPGRPINPLSS 68
           Q S  ++ + GA AG+++R               FV +PLDVVKIRLQLQ     +PL+ 
Sbjct: 3   QGSKSQVVVAGATAGLIARYLSSPSFKSHPHHPRFVIAPLDVVKIRLQLQTHSLSDPLT- 61

Query: 69  RHHNSGTLKKYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFK 128
            H +      Y G    ++ I++ EG+ GLW GN+ AE +Y+SY A+QF TY  +    +
Sbjct: 62  -HLDLRGSPIYKGTLPTLRHILKHEGLTGLWKGNIPAELMYMSYSAIQFTTYRAVSAALQ 120

Query: 129 RIDSNQNEKFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQ 188
               +  E+  +    + F++GA +G+ AT  TYP DLLRTRFAAQG +RIY  L  +++
Sbjct: 121 ----SAFEEHKLPAAAESFVAGASAGAVATTATYPLDLLRTRFAAQGTERIYTSLATSIR 176

Query: 189 QIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLL 248
            I   EG RGF+RG+ A V QI+PYMG+ F  YE L+     L+           + D  
Sbjct: 177 DIAAHEGSRGFFRGLGAGVGQIVPYMGIFFSIYEMLRVPMGALQLPF-------GSGDAT 229

Query: 249 SGAIAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFG 308
           +G +A ++SK  VFPLDL+RKRLQVQGP R  Y   N+P Y   +   +  I+R++G  G
Sbjct: 230 AGVVASVLSKTAVFPLDLIRKRLQVQGPTRSRYVHKNIPEY-KGVLRTMADIVRNEGRRG 288

Query: 309 LYKGLMPALIKSAPVSAVTFFVYGYTKRLLEKLHSSR 345
           LY+GL  +L KSAP SAVT + Y    R+L ++ + +
Sbjct: 289 LYRGLTVSLFKSAPASAVTMWTYERVLRILIQMEAEK 325



>gi|398412006|ref|XP_003857335.1| hypothetical protein MYCGRDRAFT_98528 [Zymoseptoria tritici IPO323]
 gi|339477220|gb|EGP92311.1| hypothetical protein MYCGRDRAFT_98528 [Zymoseptoria tritici IPO323]
          Length = 320

 Score =  228 bits (582), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 138/301 (45%), Positives = 186/301 (61%), Gaps = 14/301 (4%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIR 91
           I GAV+G++SRF  +PLDVVKIRLQL      +PLS       + +   G+    + I+R
Sbjct: 19  IAGAVSGLISRFCIAPLDVVKIRLQLHYHSLADPLS----QPISRRTPTGIYVVARNILR 74

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGA 151
            EGI G W GN+ AE LYLSYGAVQFL Y        ++   +     I    + F++GA
Sbjct: 75  HEGITGFWKGNIPAEGLYLSYGAVQFLAYRSTSQALDKL--AEKSDVHIPGAAKSFVAGA 132

Query: 152 ISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQII 211
           I+G+ AT  TYP DLLRTRFAAQG +R+Y GL  +++ I   EG  GF+RG++A + QI+
Sbjct: 133 IAGTAATTATYPLDLLRTRFAAQGTERVYDGLLGSIRDITRTEGAAGFFRGLSAGIGQIV 192

Query: 212 PYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVRKRL 271
           PYMG+ F  YE LK    +L   ++ F     + D L+G  A ++SK+ VFPLD VRKRL
Sbjct: 193 PYMGMFFAMYEGLKP---QLATVNLPF----GSGDALAGISASVLSKSIVFPLDTVRKRL 245

Query: 272 QVQGPNRKDYFISN-VPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFFV 330
           QVQGP+R  Y     +P+Y   +   +K ILR +G  GLY+GL  +LIK+AP SAVT + 
Sbjct: 246 QVQGPSRSRYVGGERIPVYERGVVNTLKTILRREGAVGLYRGLTVSLIKAAPSSAVTMWA 305

Query: 331 Y 331
           Y
Sbjct: 306 Y 306



>gi|346322162|gb|EGX91761.1| Mitochondrial substrate carrier [Cordyceps militaris CM01]
          Length = 320

 Score =  228 bits (582), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 135/307 (43%), Positives = 188/307 (61%), Gaps = 17/307 (5%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           + I++   GA+AG+VSRFV +PLDV+KIRLQLQP R   P  S        + Y G    
Sbjct: 11  TQIQVISAGAIAGLVSRFVIAPLDVLKIRLQLQP-RQFQPKRSTAPAPAD-RTYQGTYAT 68

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQ 145
           ++ I+R EG+   W GN+ AE LY+ Y A QF  Y  +  LF  + +    K  +    +
Sbjct: 69  LRHILRHEGVTAFWKGNVPAELLYVCYAASQFTAYRSV-TLF--LQTRLPVK--LPDAAE 123

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTA 205
            FL+GA +G+ AT +TYP DLLRTRFAAQG  ++Y GL  AV  IY  EG RGF+RG+  
Sbjct: 124 SFLAGATAGAGATAMTYPLDLLRTRFAAQGTHKVYRGLVGAVVSIYQDEGPRGFFRGIAP 183

Query: 206 SVVQIIPYMGLVFGSYEFLKKLFRKLEDKHI-WFHNLRATEDLLSGAIAGIVSKAGVFPL 264
           ++ QI+PYMG+ F +YE LK    ++ D+ + W      T D  +G    +++K  VFPL
Sbjct: 184 TLAQIVPYMGIFFVTYEGLKA---RMADRQLPW-----GTGDATAGIAGSVIAKTAVFPL 235

Query: 265 DLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVS 324
           DLVRKR+QVQGP R  Y   ++P Y +++   ++ I+  +G  GLYKGL  +LIK+AP S
Sbjct: 236 DLVRKRIQVQGPTRTRYVYGDIPEYKTTLG-ALRTIIAREGFRGLYKGLPISLIKAAPGS 294

Query: 325 AVTFFVY 331
           AVT + Y
Sbjct: 295 AVTVWTY 301



>gi|512191328|gb|EPE07089.1| mitochondrial deoxynucleotide carrier [Ophiostoma piceae UAMH
           11346]
          Length = 334

 Score =  228 bits (581), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 137/314 (43%), Positives = 190/314 (60%), Gaps = 17/314 (5%)

Query: 29  EIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKL 88
           E+ I G  AG+++RF  +PLDVVKIRLQLQ     +PLS R+ N G +  Y G    ++ 
Sbjct: 11  EVVIAGGTAGLIARFFVAPLDVVKIRLQLQTHSLSDPLSQRNINGGPI--YKGTLRTMRH 68

Query: 89  IIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKT--LQP 146
           I+R EGI GLW GN+ AE LY+ Y A QF  Y        +I    ++  GI  T  L  
Sbjct: 69  IVRHEGITGLWKGNVPAELLYVCYSATQFTAYRAATVSLAQI----HDALGIPATPPLDS 124

Query: 147 FLSGAISGSTATIVTYPFDLLRTRFAAQGEK--RIYIGLRNAVQQIYVQEGYRGFYRGVT 204
           F++GA +G+ AT  TYP DLLRTRFAAQG    R+Y  LR AV+ I   EG  GF+RG+ 
Sbjct: 125 FVAGASAGAAATAATYPLDLLRTRFAAQGNDADRVYTSLRGAVRDIARDEGATGFFRGLG 184

Query: 205 ASVVQIIPYMGLVFGSYEFLKKLFRKLEDK-------HIWFHNLRATEDLLSGAIAGIVS 257
            +++QI PYMG  F  YE LK +  ++++         +   N   T D  +G +A +++
Sbjct: 185 PALIQIAPYMGAFFTFYEGLKPITNRIQNDVFRSGKSELLGGNGLGTADAAAGIMAAVMA 244

Query: 258 KAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPAL 317
           K  VFPLDLVRKR+QVQGP R  Y   N+P+Y   +   +  ILR++G+ GLY+GL+ +L
Sbjct: 245 KTFVFPLDLVRKRIQVQGPTRSRYVHKNIPVYDRGVARALATILRTEGVRGLYRGLIVSL 304

Query: 318 IKSAPVSAVTFFVY 331
            K+AP +A+T + Y
Sbjct: 305 FKAAPANAITMWTY 318



>gi|400603144|gb|EJP70742.1| Mitochondrial carrier protein [Beauveria bassiana ARSEF 2860]
          Length = 324

 Score =  227 bits (579), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 132/302 (43%), Positives = 181/302 (59%), Gaps = 17/302 (5%)

Query: 33  CGAVAGMVSRFVASPLDVVKIRLQLQPGRPINP---LSSRHHNSGTLKKYNGMSHAIKLI 89
            GA+AG+VSRF+ +PLDV+KIRLQLQP R   P    S     +     Y G    ++ I
Sbjct: 18  AGAIAGLVSRFIIAPLDVIKIRLQLQP-RQFTPRLAASPPATLTSAQNTYQGTFATLRHI 76

Query: 90  IREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLS 149
           +R EG+   W GN+ AE +Y+ Y A QF  Y  +  L +           +    + F+S
Sbjct: 77  LRHEGVTAFWKGNVPAELMYVCYAASQFTAYRSVTLLLQ-----SKLPIKLPDAAESFIS 131

Query: 150 GAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQ 209
           GA +G+TAT +TYP DLLRTRFAAQG  ++Y GL  A+  IY  EG RGF+RG+  ++ Q
Sbjct: 132 GATAGATATAMTYPLDLLRTRFAAQGTTKVYRGLLGAIGSIYKDEGARGFFRGIAPTLAQ 191

Query: 210 IIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVRK 269
           I+PYMG+ F +YE LK   R  + +  W      T D  +G    I++K  VFPLDLVRK
Sbjct: 192 IVPYMGIFFVTYEGLK--VRIADMQMPW-----GTGDATAGIAGSIIAKTAVFPLDLVRK 244

Query: 270 RLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFF 329
           R+QVQGP R  Y  S++P Y +++   ++ I+  +G  GLYKGL  +LIK+AP SAVT +
Sbjct: 245 RIQVQGPTRTRYVYSDIPEYKTTLG-ALRTIVAREGFRGLYKGLPISLIKAAPGSAVTVW 303

Query: 330 VY 331
            Y
Sbjct: 304 TY 305



>gi|301107378|ref|XP_002902771.1| Mitochondrial Carrier (MC) Family [Phytophthora infestans T30-4]
 gi|262097889|gb|EEY55941.1| Mitochondrial Carrier (MC) Family [Phytophthora infestans T30-4]
          Length = 336

 Score =  225 bits (574), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 127/328 (38%), Positives = 191/328 (58%), Gaps = 22/328 (6%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           S+ E  + GAV+G  +R VA+PLD++KIR Q+Q         S H  +    KY G+  A
Sbjct: 11  STTEAALAGAVSGGATRLVAAPLDLLKIRFQVQTA------PSGHIEA----KYAGLLQA 60

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQ 145
           ++ I  EEG+R  W GNL+A  L++ Y A+QF +Y ++   +++  S  +   GI  ++ 
Sbjct: 61  VRSIYAEEGLRSFWRGNLAASGLWVGYSALQFASYRELTRCWEQ--SGSSNALGIPASVV 118

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTA 205
             L+GA +G+TATIVTYP DL RT FA+QG  + +  +R+ V   +  +G RGFY G+ A
Sbjct: 119 AALNGATAGATATIVTYPLDLFRTAFASQGMPKRFPTMRSLVVHTWTTQGVRGFYSGLGA 178

Query: 206 SVVQIIPYMGLVFGSYEFLKKLFRKLEDKH------IWFHNLRATEDLLSGAIAGIVSKA 259
           +V QI+PYMGL F  Y  L ++ +K  +K        W           SGA+AG+VSK 
Sbjct: 179 TVFQIVPYMGLSFSIYAALSEIAKKHRNKQEEGRTGAWMPLTTVLSYAGSGAVAGLVSKL 238

Query: 260 GVFPLDLVRKRLQVQG-PNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALI 318
            V+PLD V+KR+Q++  P    Y +  +P+YSSS + C   +L+ +GI GLYKG +P+L+
Sbjct: 239 AVYPLDTVKKRMQMRHVPRCTTYGV--IPMYSSS-WSCFVDVLQREGIRGLYKGTVPSLL 295

Query: 319 KSAPVSAVTFFVYGYTKRLLEKLHSSRD 346
           KS   ++ TF  Y  T  +L  +    D
Sbjct: 296 KSVVAASTTFATYELTLEVLRHVSPRED 323



>gi|238488929|ref|XP_002375702.1| mitochondrial deoxynucleotide carrier protein, putative
           [Aspergillus flavus NRRL3357]
 gi|220698090|gb|EED54430.1| mitochondrial deoxynucleotide carrier protein, putative
           [Aspergillus flavus NRRL3357]
          Length = 289

 Score =  225 bits (574), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 115/268 (42%), Positives = 162/268 (60%), Gaps = 12/268 (4%)

Query: 79  YNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKF 138
           Y G    I+ I+REEGI GLW GN+ AE +Y+ YGA+QF  Y        ++D      +
Sbjct: 34  YKGTLPTIRSIVREEGITGLWKGNIPAELMYVCYGAIQFAAYRTTTQALSQLD-----PY 88

Query: 139 GINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRG 198
            +    + F++GA +G  AT  TYP DLLRTRFAAQG +R+Y  L  +V+ I   EG +G
Sbjct: 89  RLPPPAESFVAGATAGGLATASTYPLDLLRTRFAAQGTERVYTSLYASVRDIAQNEGPKG 148

Query: 199 FYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSK 258
           F+RG +A+V QI+PYMGL F +YE L+ +   L D          + D  +G +A +++K
Sbjct: 149 FFRGCSAAVGQIVPYMGLFFATYESLRPVMSGLHDLPF------GSGDAAAGVVASVLAK 202

Query: 259 AGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALI 318
            GVFPLDLVRKRLQVQGP R  Y   N+P Y   ++  +  I+R+ G+ GLY+GL  +L 
Sbjct: 203 TGVFPLDLVRKRLQVQGPTRSKYVHRNIPEY-QGVYNTMAMIVRTQGMRGLYRGLTVSLF 261

Query: 319 KSAPVSAVTFFVYGYTKRLLEKLHSSRD 346
           K+AP SAVT + Y  +   L +L  + +
Sbjct: 262 KAAPASAVTMWTYEKSLHYLRELEVASE 289



>gi|500256431|gb|EON99687.1| putative mitochondrial deoxynucleotide carrier protein [Togninia
           minima UCRPA7]
          Length = 291

 Score =  225 bits (574), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 135/325 (41%), Positives = 183/325 (56%), Gaps = 46/325 (14%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           + +++   GA AG++SRF+ +PLDVVKIRLQLQ     +PL+ R    G +  Y G    
Sbjct: 4   TRLQVVTSGATAGLISRFIVAPLDVVKIRLQLQTHSLSDPLTHRDVRGGPI--YKGTLPT 61

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFG---INK 142
           IK I+  EG+ GLW GN+ AE +Y+ Y A+QF  Y  M  L +R        FG   I +
Sbjct: 62  IKQILANEGLTGLWKGNVPAELMYICYSAIQFSAYRSMAQLLQR-------TFGEGRIPQ 114

Query: 143 TLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRG 202
           + + F+SGA +G+ AT  TYP DLLRTRFAAQG  R+Y  LR A+  I   EG+RGF+RG
Sbjct: 115 SAESFISGAAAGAAATATTYPLDLLRTRFAAQGNDRVYTSLRAAIVSISKDEGFRGFFRG 174

Query: 203 VTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVF 262
           +   + QI+P+MG+ F  YE L+                                   VF
Sbjct: 175 LGPGLGQIVPFMGIFFSVYEMLRL-------------------------------PLAVF 203

Query: 263 PLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAP 322
           PLDLVRKR+QVQGP R  Y   N+P Y+      +  IL+++G  GLY+GL  +LIK+AP
Sbjct: 204 PLDLVRKRIQVQGPTRNRYVHKNIPEYNMGAVKTLTTILKTEGARGLYRGLTVSLIKAAP 263

Query: 323 VSAVTFFVYGYTKRLLEKLHSSRDK 347
            SA+T + Y   +R+L  L S  DK
Sbjct: 264 ASAITVWTY---ERMLNLLISMDDK 285



>gi|348671157|gb|EGZ10978.1| hypothetical protein PHYSODRAFT_304672 [Phytophthora sojae]
          Length = 340

 Score =  221 bits (564), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 123/331 (37%), Positives = 190/331 (57%), Gaps = 24/331 (7%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           S+ E    GAV+G  +R +A+PLD++KIR Q+QP     P+++ H  +    KY G+  A
Sbjct: 15  STTEAAFAGAVSGGATRLLAAPLDLIKIRFQVQPA----PIANGHAEA----KYAGLLQA 66

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQ 145
           ++ I  EEG+R  W GNL+A  L++ Y A+QF +Y  +   ++R      +   +   + 
Sbjct: 67  VRSIYAEEGLRSFWRGNLAASGLWIGYSALQFGSYRVLTRCWER----DGDSAAVPSAVI 122

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTA 205
              +GA++G TAT +TYP DL RT FA QG  + +  + +    ++  +G RGFY G+ A
Sbjct: 123 SATNGAVAGVTATFITYPLDLFRTAFAGQGMPKRFPTMHSLAMHMWTTQGVRGFYSGLGA 182

Query: 206 SVVQIIPYMGLVFGSYEFLKKLFRKLE------DKHIWFHNLRATEDLLSGAIAGIVSKA 259
           ++ QI PYMGL FG Y  L ++  K        D   W    +A   + SGA+AG+VSK 
Sbjct: 183 TIFQIAPYMGLSFGIYSSLNEVAVKYRNEQEEGDPDAWMSLSKALSYVGSGAVAGLVSKL 242

Query: 260 GVFPLDLVRKRLQVQG-PNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALI 318
            V+P D V+KR+Q++  P  + Y +  +P+YSSS + C   +LR +GI GLYKG +P+L+
Sbjct: 243 AVYPFDTVKKRMQMRHVPRCQTYGV--IPVYSSS-WACFLDVLRQEGIRGLYKGTVPSLL 299

Query: 319 KSAPVSAVTFFVYGYTKRLLEKL--HSSRDK 347
           KS   ++ TF  Y  T  +L  L  H  R++
Sbjct: 300 KSVVAASSTFATYELTLEVLRHLSMHDDREE 330



>gi|449450672|ref|XP_004143086.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like
           [Cucumis sativus]
          Length = 340

 Score =  221 bits (563), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 127/325 (39%), Positives = 189/325 (58%), Gaps = 23/325 (7%)

Query: 34  GAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLK---KYNGMSHAIKLII 90
           GA+AG VSR V SPLDV+KIR Q+Q    + P +S      +L    KY GM  A K I 
Sbjct: 22  GAIAGCVSRTVTSPLDVIKIRFQVQ----LEPTTSWALVQRSLSGPSKYTGMVQATKDIF 77

Query: 91  REEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQP---F 147
           +EEG+ G W GN+ A  + + Y A+QF   H+++       +  + K   +K L P   +
Sbjct: 78  KEEGLPGFWRGNVPALLMVMPYTAIQFTVLHRLKTY-----AAGSSKTEAHKQLSPSLSY 132

Query: 148 LSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASV 207
           +SGA++G  ATI +YPFDLLRT  A+QGE +IY  +R+A   I    G+RG Y G++ ++
Sbjct: 133 ISGALAGCAATIGSYPFDLLRTILASQGEPKIYPTMRSAFIDIIRTRGFRGMYAGLSPTL 192

Query: 208 VQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLS-------GAIAGIVSKAG 260
           V+I+PY GL FG+Y+  K+       +H   + L  TED LS       G  AG  +K  
Sbjct: 193 VEIVPYAGLQFGTYDTFKRWTSSWNLRHYPNYGLGNTEDDLSSFQLFLCGLAAGTCAKLV 252

Query: 261 VFPLDLVRKRLQVQGPNRKDYFISNVPLYS-SSIFICIKQILRSDGIFGLYKGLMPALIK 319
             PLD+V+KR Q++G  R   + + V  ++  ++F  +++IL+ +G  GLYKG++P+ +K
Sbjct: 253 CHPLDVVKKRFQIEGLQRHPRYGARVEQHAYRNMFDALRRILKKEGTAGLYKGIIPSTVK 312

Query: 320 SAPVSAVTFFVYGYTKRLLEKLHSS 344
           +AP  AVTF  Y  T   LE + +S
Sbjct: 313 AAPAGAVTFVAYEITSDWLESILTS 337



 Score = 86.3 bits (212), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/207 (28%), Positives = 91/207 (43%), Gaps = 35/207 (16%)

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRI--------------YIGLRNAVQQIYVQE 194
           +GAI+G  +  VT P D+++ RF  Q E                 Y G+  A + I+ +E
Sbjct: 21  AGAIAGCVSRTVTSPLDVIKIRFQVQLEPTTSWALVQRSLSGPSKYTGMVQATKDIFKEE 80

Query: 195 GYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAG 254
           G  GF+RG   +++ ++PY  + F     LK  +     K      L  +   +SGA+AG
Sbjct: 81  GLPGFWRGNVPALLMVMPYTAIQFTVLHRLKT-YAAGSSKTEAHKQLSPSLSYISGALAG 139

Query: 255 IVSKAGVFPLDLVRKRLQVQG-----PNRKDYFISNVPLYSSSIFICIKQILRSDGIFGL 309
             +  G +P DL+R  L  QG     P  +  FI                I+R+ G  G+
Sbjct: 140 CAATIGSYPFDLLRTILASQGEPKIYPTMRSAFI---------------DIIRTRGFRGM 184

Query: 310 YKGLMPALIKSAPVSAVTFFVYGYTKR 336
           Y GL P L++  P + + F  Y   KR
Sbjct: 185 YAGLSPTLVEIVPYAGLQFGTYDTFKR 211



 Score = 79.3 bits (194), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 66/237 (27%), Positives = 105/237 (44%), Gaps = 40/237 (16%)

Query: 7   HKPQNQSPIAEQAVAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPL 66
           H+ +  +  + +  A  QLS     I GA+AG  +   + P D+++  L  Q G P    
Sbjct: 108 HRLKTYAAGSSKTEAHKQLSPSLSYISGALAGCAATIGSYPFDLLRTILASQ-GEP---- 162

Query: 67  SSRHHNSGTLKKYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNL 126
                     K Y  M  A   IIR  G RG++ G        + Y  +QF TY    + 
Sbjct: 163 ----------KIYPTMRSAFIDIIRTRGFRGMYAGLSPTLVEIVPYAGLQFGTY----DT 208

Query: 127 FKRIDSNQN----EKFGINKT------LQPFLSGAISGSTATIVTYPFDLLRTRFAAQG- 175
           FKR  S+ N      +G+  T       Q FL G  +G+ A +V +P D+++ RF  +G 
Sbjct: 209 FKRWTSSWNLRHYPNYGLGNTEDDLSSFQLFLCGLAAGTCAKLVCHPLDVVKKRFQIEGL 268

Query: 176 ----------EKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYE 222
                     E+  Y  + +A+++I  +EG  G Y+G+  S V+  P   + F +YE
Sbjct: 269 QRHPRYGARVEQHAYRNMFDALRRILKKEGTAGLYKGIIPSTVKAAPAGAVTFVAYE 325



>gi|212723136|ref|NP_001132898.1| uncharacterized protein LOC100194395 [Zea mays]
 gi|194695698|gb|ACF81933.1| unknown [Zea mays]
 gi|195626132|gb|ACG34896.1| mitochondrial deoxynucleotide carrier [Zea mays]
 gi|413951383|gb|AFW84032.1| deoxynucleotide carrier [Zea mays]
          Length = 336

 Score =  221 bits (563), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 128/316 (40%), Positives = 190/316 (60%), Gaps = 23/316 (7%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSS----RHHNSGTLKKYNGMSHAIK 87
           + GA++G +SR V SPLDV+KIR Q+Q    + P +S    R    G   KY G+  A K
Sbjct: 18  LAGAISGGISRTVTSPLDVIKIRFQVQ----LEPTTSWGILRRDVYGP-SKYTGLLQATK 72

Query: 88  LIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPF 147
            I+REEG+ G W GN+ A ++Y+ Y A+QF   H+++  F    S   +   ++  L  +
Sbjct: 73  DILREEGLPGFWRGNVPALFMYMPYTAIQFTVLHKLKT-FASGSSRTEDHLDLSPYLS-Y 130

Query: 148 LSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASV 207
           +SGAI+G TATI +YPFDLLRT  A+QGE ++Y  +R+A   I    G +G Y G++ ++
Sbjct: 131 VSGAIAGCTATIGSYPFDLLRTILASQGEPKVYPNMRSAFIDIIKTRGVQGLYSGLSPTL 190

Query: 208 VQIIPYMGLVFGSYEFLKK---LFRKLEDKHIWF----HNLRATEDLLSGAIAGIVSKAG 260
           V+IIPY GL FGSY+  K+    + + +  H+ F     ++ + +  L G  AG  SKA 
Sbjct: 191 VEIIPYAGLQFGSYDTFKRSMMTWNRYKYSHLSFGSEDDSVSSFQLFLCGFAAGTFSKAA 250

Query: 261 VFPLDLVRKRLQVQGPNRKDYFISNVPLYSSS---IFICIKQILRSDGIFGLYKGLMPAL 317
             PLD+V+KR Q++G  R   +    P+ SS+   ++  +K+I+  +G  GLYKGL P+L
Sbjct: 251 CHPLDVVKKRFQIEGLKRHPRY--GAPIESSTYKGMYHALKEIVVKEGFGGLYKGLFPSL 308

Query: 318 IKSAPVSAVTFFVYGY 333
           +KSAP  AVTF VY Y
Sbjct: 309 VKSAPAGAVTFVVYEY 324



 Score = 85.9 bits (211), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 67/219 (30%), Positives = 97/219 (44%), Gaps = 41/219 (18%)

Query: 140 INKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRI--------------YIGLRN 185
           + + L   L+GAISG  +  VT P D+++ RF  Q E                 Y GL  
Sbjct: 10  MRRALVDSLAGAISGGISRTVTSPLDVIKIRFQVQLEPTTSWGILRRDVYGPSKYTGLLQ 69

Query: 186 AVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFR---KLEDKHIWFHNLR 242
           A + I  +EG  GF+RG   ++   +PY  + F     LK       + ED H+   +L 
Sbjct: 70  ATKDILREEGLPGFWRGNVPALFMYMPYTAIQFTVLHKLKTFASGSSRTED-HL---DLS 125

Query: 243 ATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQG-----PNRKDYFISNVPLYSSSIFICI 297
                +SGAIAG  +  G +P DL+R  L  QG     PN +  FI              
Sbjct: 126 PYLSYVSGAIAGCTATIGSYPFDLLRTILASQGEPKVYPNMRSAFI-------------- 171

Query: 298 KQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGYTKR 336
             I+++ G+ GLY GL P L++  P + + F  Y   KR
Sbjct: 172 -DIIKTRGVQGLYSGLSPTLVEIIPYAGLQFGSYDTFKR 209



>gi|413951382|gb|AFW84031.1| hypothetical protein ZEAMMB73_394006 [Zea mays]
          Length = 333

 Score =  221 bits (562), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 128/316 (40%), Positives = 190/316 (60%), Gaps = 23/316 (7%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSS----RHHNSGTLKKYNGMSHAIK 87
           + GA++G +SR V SPLDV+KIR Q+Q    + P +S    R    G   KY G+  A K
Sbjct: 18  LAGAISGGISRTVTSPLDVIKIRFQVQ----LEPTTSWGILRRDVYGP-SKYTGLLQATK 72

Query: 88  LIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPF 147
            I+REEG+ G W GN+ A ++Y+ Y A+QF   H+++  F    S   +   ++  L  +
Sbjct: 73  DILREEGLPGFWRGNVPALFMYMPYTAIQFTVLHKLKT-FASGSSRTEDHLDLSPYLS-Y 130

Query: 148 LSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASV 207
           +SGAI+G TATI +YPFDLLRT  A+QGE ++Y  +R+A   I    G +G Y G++ ++
Sbjct: 131 VSGAIAGCTATIGSYPFDLLRTILASQGEPKVYPNMRSAFIDIIKTRGVQGLYSGLSPTL 190

Query: 208 VQIIPYMGLVFGSYEFLKK---LFRKLEDKHIWF----HNLRATEDLLSGAIAGIVSKAG 260
           V+IIPY GL FGSY+  K+    + + +  H+ F     ++ + +  L G  AG  SKA 
Sbjct: 191 VEIIPYAGLQFGSYDTFKRSMMTWNRYKYSHLSFGSEDDSVSSFQLFLCGFAAGTFSKAA 250

Query: 261 VFPLDLVRKRLQVQGPNRKDYFISNVPLYSSS---IFICIKQILRSDGIFGLYKGLMPAL 317
             PLD+V+KR Q++G  R   +    P+ SS+   ++  +K+I+  +G  GLYKGL P+L
Sbjct: 251 CHPLDVVKKRFQIEGLKRHPRY--GAPIESSTYKGMYHALKEIVVKEGFGGLYKGLFPSL 308

Query: 318 IKSAPVSAVTFFVYGY 333
           +KSAP  AVTF VY Y
Sbjct: 309 VKSAPAGAVTFVVYEY 324



 Score = 85.9 bits (211), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 67/219 (30%), Positives = 97/219 (44%), Gaps = 41/219 (18%)

Query: 140 INKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRI--------------YIGLRN 185
           + + L   L+GAISG  +  VT P D+++ RF  Q E                 Y GL  
Sbjct: 10  MRRALVDSLAGAISGGISRTVTSPLDVIKIRFQVQLEPTTSWGILRRDVYGPSKYTGLLQ 69

Query: 186 AVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFR---KLEDKHIWFHNLR 242
           A + I  +EG  GF+RG   ++   +PY  + F     LK       + ED H+   +L 
Sbjct: 70  ATKDILREEGLPGFWRGNVPALFMYMPYTAIQFTVLHKLKTFASGSSRTED-HL---DLS 125

Query: 243 ATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQG-----PNRKDYFISNVPLYSSSIFICI 297
                +SGAIAG  +  G +P DL+R  L  QG     PN +  FI              
Sbjct: 126 PYLSYVSGAIAGCTATIGSYPFDLLRTILASQGEPKVYPNMRSAFI-------------- 171

Query: 298 KQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGYTKR 336
             I+++ G+ GLY GL P L++  P + + F  Y   KR
Sbjct: 172 -DIIKTRGVQGLYSGLSPTLVEIIPYAGLQFGSYDTFKR 209



>gi|50556494|ref|XP_505655.1| YALI0F20262p [Yarrowia lipolytica]
 gi|74659654|sp|Q6C107.1|TPC1_YARLI RecName: Full=Mitochondrial thiamine pyrophosphate carrier 1
 gi|49651525|emb|CAG78464.1| YALI0F20262p [Yarrowia lipolytica CLIB122]
          Length = 336

 Score =  221 bits (562), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 140/327 (42%), Positives = 190/327 (58%), Gaps = 36/327 (11%)

Query: 23  SQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGM 82
           S +SS E  +CG +AGMVSRF  +PLDVVKIRLQLQ         SR+        Y G+
Sbjct: 9   SDISSTESMLCGGIAGMVSRFCIAPLDVVKIRLQLQKD------GSRY--------YRGI 54

Query: 83  SHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINK 142
              ++ I+R+EG+  LW GN+ AE LY+ YGA QF+TYH +  +    +    EK+ I+ 
Sbjct: 55  FQTMQQIVRDEGVTALWKGNIPAELLYVFYGATQFVTYHHVNQVINAYNETA-EKWKISS 113

Query: 143 TLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRI----YIGLRNAVQQIYVQEGYRG 198
             Q F++GA +G+ ATI TYPFDL RT FAAQG K      Y  L    + IY  EG  G
Sbjct: 114 GAQSFIAGATAGAGATIATYPFDLFRTLFAAQGAKNCNVKNYTSLFQTFKLIYKTEGPLG 173

Query: 199 FYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNL--------RATEDLLSG 250
           F+RGV++S++ I PYMGL F SY  +K       +KH   H+L        +  ++  +G
Sbjct: 174 FFRGVSSSIISIAPYMGLFFASYGRVKDSLDAFSNKH---HDLLVSYNLPTKGWQEATAG 230

Query: 251 AIAGIVSKAGVFPLDLVRKRLQVQGPNRKDY-FISNVP-----LYSSSIFICIKQILRSD 304
             AG  SKA VFPLD +RKRLQ QG     Y  +S  P     L S + F+  ++I+ ++
Sbjct: 231 LCAGTASKALVFPLDTIRKRLQTQGRMDVSYKELSGKPGVQRLLDSYNPFVMARRIIVAE 290

Query: 305 GIFGLYKGLMPALIKSAPVSAVTFFVY 331
           G  GLYKG + +LIKSAP SA+T + +
Sbjct: 291 GCRGLYKGFLVSLIKSAPTSAITMYTF 317



>gi|168027181|ref|XP_001766109.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162682752|gb|EDQ69168.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 327

 Score =  220 bits (560), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 127/322 (39%), Positives = 195/322 (60%), Gaps = 18/322 (5%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRH------HNSGTLKKY 79
           SS    + GAVAG ++R V SPLDV+KIR Q+Q    + P SSR+       ++  + KY
Sbjct: 11  SSTMDAVAGAVAGGIARTVVSPLDVIKIRFQIQ----LEPTSSRNIFSKGGASASVMSKY 66

Query: 80  NGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFG 139
            G+  A  +I+REEG+RGLW GN+ A  L + Y A+QF+      +L     S Q  +  
Sbjct: 67  TGVMQAAHVIVREEGVRGLWRGNIPALLLQMPYTAIQFVVKSNADSLVA--GSPQAAR-- 122

Query: 140 INKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGF 199
            +K L  FL G+++G+ ATI +YPFDLLRT  A+QGE ++Y  +R+ +  IY ++G  GF
Sbjct: 123 -HKGLMSFLGGSLAGTAATIGSYPFDLLRTVLASQGEPKVYPNMRSVMVDIYKRKGVTGF 181

Query: 200 YRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLED-KHIWFHN-LRATEDLLSGAIAGIVS 257
           Y G+T ++++I+PY GL FG Y+ L++    L   K    H  L +T++   G  AG+ +
Sbjct: 182 YAGLTPTLMEIVPYAGLQFGFYDSLRRWALTLNPLKEDGEHTPLSSTQNFWCGFGAGLFA 241

Query: 258 KAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYS-SSIFICIKQILRSDGIFGLYKGLMPA 316
           K    PLD+++KR QV+G  R   + + +   +   +   I++IL  +G+ GLYKG +P+
Sbjct: 242 KLCCHPLDVIKKRYQVEGLMRDIRYGARIEEKAYKGVGDAIRRILAEEGLKGLYKGTLPS 301

Query: 317 LIKSAPVSAVTFFVYGYTKRLL 338
           ++K+AP SA+TF+VY  TK  L
Sbjct: 302 IVKAAPNSALTFYVYESTKHWL 323



>gi|399166827|emb|CCE32348.1| related to TPC1-mitochondrial transport protein [Claviceps purpurea
           20.1]
          Length = 322

 Score =  219 bits (557), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 128/301 (42%), Positives = 181/301 (60%), Gaps = 16/301 (5%)

Query: 43  FVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIREEGIRGLWNGN 102
           F+ +PLDVVKIRLQLQP    +P +   H++     Y G +  ++ I++ EG+  LW GN
Sbjct: 31  FIIAPLDVVKIRLQLQPYSLYDPFAPSSHSA---PAYLGTAATVRHILKHEGLTALWKGN 87

Query: 103 LSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGAISGSTATIVTY 162
           + AE +Y+ Y A+QF TY     L +     +     +    + F++GA SG+ AT +TY
Sbjct: 88  VPAELMYVCYAALQFSTYRTTTMLLQTALPTR-----LPDAAESFIAGASSGALATAITY 142

Query: 163 PFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYE 222
           P DLLRTRFAAQG  RIY  LR A+  I+  EG RGF+RG+   + QI+PYMGL F SYE
Sbjct: 143 PLDLLRTRFAAQGRTRIYSSLRGAIGDIWRDEGGRGFFRGIGPGLAQIVPYMGLFFVSYE 202

Query: 223 FLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQGPNRKDYF 282
            L+     L     W      + D  +G +A +++K  VFPLDLVRKR+QVQGP R  Y 
Sbjct: 203 GLRVRLAGLNMP--W-----GSGDATAGVMASVLAKTVVFPLDLVRKRIQVQGPTRGKYV 255

Query: 283 ISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGYTKRLLEKLH 342
             ++P YSS++   +  I+R +G  GLYKGL  +L+KSAP  AVT + Y  + +++  L 
Sbjct: 256 YGDIPEYSSTLR-ALASIVRGEGFRGLYKGLPISLVKSAPAGAVTVWTYEQSLKVMMGLE 314

Query: 343 S 343
           +
Sbjct: 315 A 315



>gi|302821417|ref|XP_002992371.1| hypothetical protein SELMODRAFT_135271 [Selaginella moellendorffii]
 gi|300139787|gb|EFJ06521.1| hypothetical protein SELMODRAFT_135271 [Selaginella moellendorffii]
          Length = 327

 Score =  218 bits (554), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 127/319 (39%), Positives = 185/319 (57%), Gaps = 23/319 (7%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNS-----GTLKKYNGMSHAI 86
           + GAVAG +SR + +PLDV+KIR Q+Q    + P S R         G + KY G++ A+
Sbjct: 18  VAGAVAGGISRTIVAPLDVIKIRFQVQ----LEPTSRRLSQGSSSFPGGVSKYTGIAQAM 73

Query: 87  KLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQP 146
           + I REEGI GLW GN+ A  L + Y A+QF+     ++ F         K G    +  
Sbjct: 74  RDIFREEGIPGLWRGNVPALLLVMPYTAIQFVALQGFRSTF--------SKGGDVSPVLS 125

Query: 147 FLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTAS 206
           ++SGA +G  ATI +YPFDLLRT  A+QGE +IY  +R+A   I    G+RG Y G+T S
Sbjct: 126 YVSGAAAGCAATIGSYPFDLLRTILASQGEPKIYRSMRHAFVDILQTRGFRGLYAGLTPS 185

Query: 207 VVQIIPYMGLVFGSYEFLKKL--FRKL---EDKHIWFHNLRATEDLLSGAIAGIVSKAGV 261
           +V+IIPY GL FGSY+  K+    R+L   + + +    L   +    G  AG  SK   
Sbjct: 186 LVEIIPYAGLQFGSYDTFKRWAHVRRLRLDQWRGVDRPELSGMQHFWCGLAAGTFSKTCC 245

Query: 262 FPLDLVRKRLQVQGPNRKDYFISNVPLYS-SSIFICIKQILRSDGIFGLYKGLMPALIKS 320
            PLD+V+KR QV+G  R   + + + L +  S+   I++I++ +G+ GLYKG  P++IK+
Sbjct: 246 HPLDVVKKRFQVEGLARHPRYGARIELKAYKSMVDAIRRIVQQEGLAGLYKGTYPSVIKA 305

Query: 321 APVSAVTFFVYGYTKRLLE 339
           AP +A+TF VY    + LE
Sbjct: 306 APAAAITFVVYEKASKWLE 324



>gi|302768663|ref|XP_002967751.1| hypothetical protein SELMODRAFT_88777 [Selaginella moellendorffii]
 gi|300164489|gb|EFJ31098.1| hypothetical protein SELMODRAFT_88777 [Selaginella moellendorffii]
          Length = 327

 Score =  217 bits (553), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 127/319 (39%), Positives = 185/319 (57%), Gaps = 23/319 (7%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNS-----GTLKKYNGMSHAI 86
           + GAVAG +SR + +PLDV+KIR Q+Q    + P S R         G + KY G++ A+
Sbjct: 18  VAGAVAGGISRTIVAPLDVIKIRFQVQ----LEPTSRRLSQGSSSLPGGVSKYTGIAQAM 73

Query: 87  KLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQP 146
           + I REEGI GLW GN+ A  L + Y A+QF+     ++ F         K G    +  
Sbjct: 74  RDIFREEGIPGLWRGNVPALLLVMPYTAIQFVALQGFRSTF--------SKGGDVSPVLS 125

Query: 147 FLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTAS 206
           ++SGA +G  ATI +YPFDLLRT  A+QGE +IY  +R+A   I    G+RG Y G+T S
Sbjct: 126 YVSGAAAGCAATIGSYPFDLLRTILASQGEPKIYRSMRHAFVDILQTRGFRGLYAGLTPS 185

Query: 207 VVQIIPYMGLVFGSYEFLKKL--FRKL---EDKHIWFHNLRATEDLLSGAIAGIVSKAGV 261
           +V+IIPY GL FGSY+  K+    R+L   + + +    L   +    G  AG  SK   
Sbjct: 186 LVEIIPYAGLQFGSYDTFKRWAHVRRLRLDQWRGVDRPELSGMQHFWCGLAAGTFSKTCC 245

Query: 262 FPLDLVRKRLQVQGPNRKDYFISNVPLYS-SSIFICIKQILRSDGIFGLYKGLMPALIKS 320
            PLD+V+KR QV+G  R   + + + L +  S+   I++I++ +G+ GLYKG  P++IK+
Sbjct: 246 HPLDVVKKRFQVEGLARHPRYGARIELKAYKSMIDAIRRIVQQEGLAGLYKGTYPSVIKA 305

Query: 321 APVSAVTFFVYGYTKRLLE 339
           AP +A+TF VY    + LE
Sbjct: 306 APAAAITFVVYEKASKWLE 324



>gi|115442059|ref|NP_001045309.1| Os01g0934200 [Oryza sativa Japonica Group]
 gi|57899589|dbj|BAD87168.1| putative mitochondrial deoxynucleotide carrier [Oryza sativa
           Japonica Group]
 gi|57899618|dbj|BAD87245.1| putative mitochondrial deoxynucleotide carrier [Oryza sativa
           Japonica Group]
 gi|113534840|dbj|BAF07223.1| Os01g0934200 [Oryza sativa Japonica Group]
 gi|215697719|dbj|BAG91713.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|218189681|gb|EEC72108.1| hypothetical protein OsI_05080 [Oryza sativa Indica Group]
 gi|222619823|gb|EEE55955.1| hypothetical protein OsJ_04667 [Oryza sativa Japonica Group]
          Length = 336

 Score =  217 bits (553), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 122/311 (39%), Positives = 180/311 (57%), Gaps = 13/311 (4%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIR 91
           + GA++G +SR V SPLDV+KIR Q+Q   P         +     KY G+  A K I+R
Sbjct: 18  LAGAISGGISRTVTSPLDVIKIRFQVQL-EPTTSWGVLRRDVYGPSKYTGLLQASKDILR 76

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGA 151
           EEG+ G W GN+ A  +Y+ Y A+QF   H+++  F    S   +   ++  L  ++SGA
Sbjct: 77  EEGLPGFWRGNVPALLMYMPYTAIQFTVLHKLKT-FASGSSKTEDHLHLSPYLS-YVSGA 134

Query: 152 ISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQII 211
           I+G  AT+ +YPFDLLRT  A+QGE ++Y  +R+A   I    G+RG Y G+T ++V+II
Sbjct: 135 IAGCAATVGSYPFDLLRTILASQGEPKVYPDMRSAFLDIMKTRGFRGLYAGLTPTLVEII 194

Query: 212 PYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATED--------LLSGAIAGIVSKAGVFP 263
           PY GL FGSY+  K+      +++ + H    +ED         L G  AG  SKA   P
Sbjct: 195 PYAGLQFGSYDTFKRSMMTW-NRYRYSHLNSGSEDDSVSSFQLFLCGFAAGTFSKAACHP 253

Query: 264 LDLVRKRLQVQGPNRKDYFISNVPLYS-SSIFICIKQILRSDGIFGLYKGLMPALIKSAP 322
           LD+V+KR Q++G  R   + + +   +   ++  +K+I+  +G  GLYKGL P+L+KSAP
Sbjct: 254 LDVVKKRFQIEGLKRHPRYGARIESSTYKGMYHALKEIVAKEGFGGLYKGLFPSLVKSAP 313

Query: 323 VSAVTFFVYGY 333
             AVTF  Y Y
Sbjct: 314 AGAVTFVAYEY 324



 Score = 85.1 bits (209), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 67/226 (29%), Positives = 100/226 (44%), Gaps = 41/226 (18%)

Query: 133 NQNEKFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRI------------- 179
           ++ E   + + L   L+GAISG  +  VT P D+++ RF  Q E                
Sbjct: 3   SEEEPSQMRRALVDALAGAISGGISRTVTSPLDVIKIRFQVQLEPTTSWGVLRRDVYGPS 62

Query: 180 -YIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLF---RKLEDKH 235
            Y GL  A + I  +EG  GF+RG   +++  +PY  + F     LK       K ED H
Sbjct: 63  KYTGLLQASKDILREEGLPGFWRGNVPALLMYMPYTAIQFTVLHKLKTFASGSSKTED-H 121

Query: 236 IWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQG-----PNRKDYFISNVPLYS 290
           +   +L      +SGAIAG  +  G +P DL+R  L  QG     P+ +  F+       
Sbjct: 122 L---HLSPYLSYVSGAIAGCAATVGSYPFDLLRTILASQGEPKVYPDMRSAFL------- 171

Query: 291 SSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGYTKR 336
                    I+++ G  GLY GL P L++  P + + F  Y   KR
Sbjct: 172 --------DIMKTRGFRGLYAGLTPTLVEIIPYAGLQFGSYDTFKR 209



>gi|326524836|dbj|BAK04354.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 332

 Score =  216 bits (551), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 122/316 (38%), Positives = 181/316 (57%), Gaps = 13/316 (4%)

Query: 33  CGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIRE 92
            GA++G +SR V SPLDV+KIR Q+Q   P         +     KY G+  A K I+RE
Sbjct: 21  AGAISGGISRTVTSPLDVIKIRFQVQL-EPTATWGVLRRDVYGPSKYTGLMQATKDILRE 79

Query: 93  EGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGAI 152
           EG+ G W GN+ A ++Y+ Y A+QF   H+++  F    S   +   ++  L  ++SGAI
Sbjct: 80  EGLPGFWRGNVPALFMYMPYTAIQFTVLHKLKT-FASGSSRTEDHLHLSPYLS-YVSGAI 137

Query: 153 SGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIP 212
           +GS AT+ +YPFDLLRT  A+QGE ++Y  +R+A+  I    G RG Y G+T ++V+IIP
Sbjct: 138 AGSAATVGSYPFDLLRTILASQGEPKVYPNMRSALVDIVQTRGVRGLYAGLTPTLVEIIP 197

Query: 213 YMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATED------LLSGAIAGIVSKAGVFPLDL 266
           Y GL FGSY+  K   R +   + + + +   +        L G  AG  SKA   PLD+
Sbjct: 198 YAGLQFGSYDTFK---RSMMSWNRYRYGIEEDDSASSFQLFLCGFAAGTFSKAACHPLDV 254

Query: 267 VRKRLQVQGPNRKDYFISNVPLYS-SSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSA 325
           V+KR Q++G  R   + + +   +   ++  + +I+  +G  GLYKGL P+++KSAP  A
Sbjct: 255 VKKRFQIEGLKRHPRYGAQIESSTYKGMYHALTEIVVKEGFGGLYKGLFPSVVKSAPAGA 314

Query: 326 VTFFVYGYTKRLLEKL 341
           VTF  Y Y    LE L
Sbjct: 315 VTFVAYEYISDWLESL 330



 Score = 79.7 bits (195), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/221 (28%), Positives = 91/221 (41%), Gaps = 35/221 (15%)

Query: 135 NEKFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRI--------------Y 180
            E   + + L    +GAISG  +  VT P D+++ RF  Q E                 Y
Sbjct: 7   EEPSQMRRALVDTAAGAISGGISRTVTSPLDVIKIRFQVQLEPTATWGVLRRDVYGPSKY 66

Query: 181 IGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHN 240
            GL  A + I  +EG  GF+RG   ++   +PY  + F     LK             H 
Sbjct: 67  TGLMQATKDILREEGLPGFWRGNVPALFMYMPYTAIQFTVLHKLKTFASGSSRTEDHLH- 125

Query: 241 LRATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQG-----PNRKDYFISNVPLYSSSIFI 295
           L      +SGAIAG  +  G +P DL+R  L  QG     PN +   +            
Sbjct: 126 LSPYLSYVSGAIAGSAATVGSYPFDLLRTILASQGEPKVYPNMRSALV------------ 173

Query: 296 CIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGYTKR 336
               I+++ G+ GLY GL P L++  P + + F  Y   KR
Sbjct: 174 ---DIVQTRGVRGLYAGLTPTLVEIIPYAGLQFGSYDTFKR 211



>gi|356556120|ref|XP_003546375.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like
           [Glycine max]
          Length = 328

 Score =  216 bits (549), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 121/312 (38%), Positives = 182/312 (58%), Gaps = 11/312 (3%)

Query: 34  GAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIREE 93
           GA++G +SR + SPLDV+KIR Q+Q   P +  +    +  T  KY GM  A K I REE
Sbjct: 18  GAISGGISRTITSPLDVIKIRFQVQL-EPTSSWTLLCKDLSTPSKYTGMLQATKDIFREE 76

Query: 94  GIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGAIS 153
           GIRG W GN+ A  + + Y A+QF   H+++  F    SN      ++  L  ++SGA++
Sbjct: 77  GIRGFWRGNVPALLMVMPYTAIQFTVLHKLKT-FASGSSNTENYINLSPYLS-YMSGALA 134

Query: 154 GSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPY 213
           G  AT+ +YPFDLLRT  A+QGE ++Y  +R A+  I    G+RG Y G++ ++V+IIPY
Sbjct: 135 GCAATVGSYPFDLLRTILASQGEPKVYPNMRTALVDILQTRGFRGLYAGLSPTLVEIIPY 194

Query: 214 MGLVFGSYEFLKKLFRKLEDKHIWFHN-----LRATEDLLSGAIAGIVSKAGVFPLDLVR 268
            GL FG+Y+  K+    +   H  + N     L + +  L G  AG  +K    PLD+V+
Sbjct: 195 AGLQFGTYDTFKRW--TMAWNHRQYSNPTAESLSSFQLFLCGLAAGTCAKLVCHPLDVVK 252

Query: 269 KRLQVQGPNRKDYFISNVPLYS-SSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVT 327
           KR Q++G  R   + + V   +  ++   +K+IL+ +G  GLYKG++P+ +K+AP  AVT
Sbjct: 253 KRFQIEGLQRHPRYGARVEHRAYKNMLDAVKRILQMEGWAGLYKGIVPSTVKAAPAGAVT 312

Query: 328 FFVYGYTKRLLE 339
           F  Y  T   LE
Sbjct: 313 FVAYELTVDWLE 324



 Score = 88.6 bits (218), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 59/202 (29%), Positives = 92/202 (45%), Gaps = 25/202 (12%)

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRI--------------YIGLRNAVQQIYVQE 194
           +GAISG  +  +T P D+++ RF  Q E                 Y G+  A + I+ +E
Sbjct: 17  AGAISGGISRTITSPLDVIKIRFQVQLEPTSSWTLLCKDLSTPSKYTGMLQATKDIFREE 76

Query: 195 GYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAG 254
           G RGF+RG   +++ ++PY  + F     LK       +   +  NL      +SGA+AG
Sbjct: 77  GIRGFWRGNVPALLMVMPYTAIQFTVLHKLKTFASGSSNTENYI-NLSPYLSYMSGALAG 135

Query: 255 IVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLM 314
             +  G +P DL+R  L  QG           P    ++   +  IL++ G  GLY GL 
Sbjct: 136 CAATVGSYPFDLLRTILASQGE----------PKVYPNMRTALVDILQTRGFRGLYAGLS 185

Query: 315 PALIKSAPVSAVTFFVYGYTKR 336
           P L++  P + + F  Y   KR
Sbjct: 186 PTLVEIIPYAGLQFGTYDTFKR 207



>gi|462419515|gb|EMJ23778.1| hypothetical protein PRUPE_ppa008444mg [Prunus persica]
          Length = 331

 Score =  216 bits (549), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 121/314 (38%), Positives = 180/314 (57%), Gaps = 11/314 (3%)

Query: 34  GAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIREE 93
           G +AG +SR V SPLDV+KIR Q+Q   P    +    N     KY GM  A + I REE
Sbjct: 17  GLIAGGISRTVTSPLDVIKIRFQVQL-EPTTSWALLRKNLSQPSKYTGMLQATRDIFREE 75

Query: 94  GIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGAIS 153
           G+ G W GN+ A  + + Y A+QF   HQ++  F    S   +   ++  L  ++SGA++
Sbjct: 76  GLPGFWRGNVPALLMVMPYTAIQFAVLHQLKT-FAAGSSKTEDHIYLSPYLS-YISGALA 133

Query: 154 GSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPY 213
           G  AT+ +YPFDLLRT  A+QGE ++Y  +R A+ +I    G+RG Y G++ ++V+IIPY
Sbjct: 134 GCAATVGSYPFDLLRTLLASQGEPKVYPTMRTALVEIVKTRGFRGLYAGLSPTLVEIIPY 193

Query: 214 MGLVFGSYEFLKKLFRKLEDKHIWFHNLRATED-------LLSGAIAGIVSKAGVFPLDL 266
            GL FG+Y+  K+             NL++ ED        L G  AG  +K    PLD+
Sbjct: 194 AGLQFGTYDTFKRWTMTWNLYRSSNTNLQSREDGLSSFQLFLCGLAAGTCAKLVCHPLDV 253

Query: 267 VRKRLQVQGPNRKDYFISNVPLYS-SSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSA 325
           V+KR Q++G  R   + + V   +  ++F  +++IL+ +G  GLYKG++P+ +K+AP  A
Sbjct: 254 VKKRFQIEGLQRHPRYGARVEHRAYRNMFDALRRILQKEGWAGLYKGIVPSTVKAAPAGA 313

Query: 326 VTFFVYGYTKRLLE 339
           VTF  Y YT   LE
Sbjct: 314 VTFVAYEYTSDWLE 327



 Score = 84.3 bits (207), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 60/205 (29%), Positives = 94/205 (45%), Gaps = 31/205 (15%)

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRI--------------YIGLRNAVQQIYVQE 194
           +G I+G  +  VT P D+++ RF  Q E                 Y G+  A + I+ +E
Sbjct: 16  AGLIAGGISRTVTSPLDVIKIRFQVQLEPTTSWALLRKNLSQPSKYTGMLQATRDIFREE 75

Query: 195 GYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLF---RKLEDKHIWFHNLRATEDLLSGA 251
           G  GF+RG   +++ ++PY  + F     LK       K ED HI+   L      +SGA
Sbjct: 76  GLPGFWRGNVPALLMVMPYTAIQFAVLHQLKTFAAGSSKTED-HIY---LSPYLSYISGA 131

Query: 252 IAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYK 311
           +AG  +  G +P DL+R  L  QG           P    ++   + +I+++ G  GLY 
Sbjct: 132 LAGCAATVGSYPFDLLRTLLASQGE----------PKVYPTMRTALVEIVKTRGFRGLYA 181

Query: 312 GLMPALIKSAPVSAVTFFVYGYTKR 336
           GL P L++  P + + F  Y   KR
Sbjct: 182 GLSPTLVEIIPYAGLQFGTYDTFKR 206



>gi|414878825|tpg|DAA55956.1| TPA: hypothetical protein ZEAMMB73_316859 [Zea mays]
          Length = 334

 Score =  215 bits (548), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 125/322 (38%), Positives = 188/322 (58%), Gaps = 19/322 (5%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSS----RHHNSGTLKKYNGMSHAIK 87
           + GA++G +SR V SPLDV+KIR Q+Q    + P +S    R    G   KY G+  A K
Sbjct: 18  LAGAISGGISRTVTSPLDVIKIRFQVQ----LEPTTSWGILRRDIYGP-SKYTGLLQATK 72

Query: 88  LIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPF 147
            I+REEG+ G W GN+ A  +Y+ Y A+QF   H+++  F    S   +   ++  L  +
Sbjct: 73  DILREEGLPGFWRGNVPALLMYMPYTAIQFTVLHKLKT-FASGSSKTEDHLHLSPYLS-Y 130

Query: 148 LSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASV 207
           +SGA++G  ATI +YPFDLLRT  A+QGE +IY  +R+A   I    G +G Y G++ ++
Sbjct: 131 VSGALAGCAATIGSYPFDLLRTILASQGEPKIYPNMRSAFVDIIKTRGVQGLYSGLSPTL 190

Query: 208 VQIIPYMGLVFGSYEFLKK---LFRKLEDKHIWF----HNLRATEDLLSGAIAGIVSKAG 260
           V+IIPY GL FGSY+  K+    + + +  H+ F     ++ + +  L G  AG  SKA 
Sbjct: 191 VEIIPYAGLQFGSYDTFKRSMMTWNRYKYSHLNFGSEDDSVSSFQLFLCGFAAGTFSKAA 250

Query: 261 VFPLDLVRKRLQVQGPNRKDYFISNVPLYS-SSIFICIKQILRSDGIFGLYKGLMPALIK 319
             PLD+V+KR Q++G  R   + + +   +   ++  +K+I+  +G  GLYKGL P+L+K
Sbjct: 251 CHPLDVVKKRFQIEGLKRHPRYGARIESSTYKGMYHALKEIVAKEGFGGLYKGLFPSLVK 310

Query: 320 SAPVSAVTFFVYGYTKRLLEKL 341
           SAP  AVTF  Y Y    LE +
Sbjct: 311 SAPAGAVTFVAYEYISDWLESI 332



 Score = 85.5 bits (210), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 66/219 (30%), Positives = 98/219 (44%), Gaps = 41/219 (18%)

Query: 140 INKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRI--------------YIGLRN 185
           + + L   L+GAISG  +  VT P D+++ RF  Q E                 Y GL  
Sbjct: 10  MRRALVDSLAGAISGGISRTVTSPLDVIKIRFQVQLEPTTSWGILRRDIYGPSKYTGLLQ 69

Query: 186 AVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLF---RKLEDKHIWFHNLR 242
           A + I  +EG  GF+RG   +++  +PY  + F     LK       K ED H+   +L 
Sbjct: 70  ATKDILREEGLPGFWRGNVPALLMYMPYTAIQFTVLHKLKTFASGSSKTED-HL---HLS 125

Query: 243 ATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQG-----PNRKDYFISNVPLYSSSIFICI 297
                +SGA+AG  +  G +P DL+R  L  QG     PN +  F+              
Sbjct: 126 PYLSYVSGALAGCAATIGSYPFDLLRTILASQGEPKIYPNMRSAFV-------------- 171

Query: 298 KQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGYTKR 336
             I+++ G+ GLY GL P L++  P + + F  Y   KR
Sbjct: 172 -DIIKTRGVQGLYSGLSPTLVEIIPYAGLQFGSYDTFKR 209



>gi|502085304|ref|XP_004487886.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Cicer
           arietinum]
          Length = 333

 Score =  215 bits (548), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 128/326 (39%), Positives = 185/326 (56%), Gaps = 33/326 (10%)

Query: 34  GAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKK---YNGMSHAIKLII 90
           GA++G +SR V SPLDV+KIR Q+Q    + P SS +  S  L K   Y GM  A K I 
Sbjct: 21  GAISGAISRTVTSPLDVIKIRFQVQ----LEPTSSWNSLSRDLSKPSKYTGMFQATKDIF 76

Query: 91  REEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLS- 149
           REEGIRG W GN+ A  + + Y A+QF   H+ + +       +N    IN  L P+LS 
Sbjct: 77  REEGIRGFWRGNVPALLMVMPYTAIQFTVLHKFKTIASGSSKTENH---IN--LSPYLSY 131

Query: 150 --GAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASV 207
             GA++G  AT+ +YPFDLLRT  A+QGE ++Y  +R+A   I    G++G Y G++ ++
Sbjct: 132 ISGAVAGCAATVGSYPFDLLRTILASQGEPKVYPNMRSAFIDILRNRGFQGLYSGLSPTL 191

Query: 208 VQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFH-----NLRATEDL------LSGAIAGIV 256
           V+I+PY GL FG+Y+  K+          W H     N  A E L      L G  AG  
Sbjct: 192 VEIVPYAGLQFGTYDTFKRW------AMAWNHVQSSTNTAAEESLSSFQLFLCGLAAGTC 245

Query: 257 SKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYS-SSIFICIKQILRSDGIFGLYKGLMP 315
           +K    PLD+V+KR Q++G  R   + + V   +  ++F  +++IL+ +G  GLYKG++P
Sbjct: 246 AKLVCHPLDVVKKRFQIEGLQRHPRYGARVEHRAYRNMFDGLRRILQMEGWAGLYKGIVP 305

Query: 316 ALIKSAPVSAVTFFVYGYTKRLLEKL 341
           + +K+AP  AVTF  Y  T   LE +
Sbjct: 306 STVKAAPAGAVTFVAYELTSDWLESI 331



 Score = 97.1 bits (240), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 70/227 (30%), Positives = 104/227 (45%), Gaps = 44/227 (19%)

Query: 131 DSNQNEKFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRI----------- 179
           +++Q ++  IN T     SGAISG+ +  VT P D+++ RF  Q E              
Sbjct: 7   ETSQWKQAMINST-----SGAISGAISRTVTSPLDVIKIRFQVQLEPTSSWNSLSRDLSK 61

Query: 180 ---YIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLF--RKLEDK 234
              Y G+  A + I+ +EG RGF+RG   +++ ++PY  + F      K +       + 
Sbjct: 62  PSKYTGMFQATKDIFREEGIRGFWRGNVPALLMVMPYTAIQFTVLHKFKTIASGSSKTEN 121

Query: 235 HIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQG-----PNRKDYFISNVPLY 289
           HI   NL      +SGA+AG  +  G +P DL+R  L  QG     PN +  FI      
Sbjct: 122 HI---NLSPYLSYISGAVAGCAATVGSYPFDLLRTILASQGEPKVYPNMRSAFI------ 172

Query: 290 SSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGYTKR 336
                     ILR+ G  GLY GL P L++  P + + F  Y   KR
Sbjct: 173 ---------DILRNRGFQGLYSGLSPTLVEIVPYAGLQFGTYDTFKR 210



>gi|224123216|ref|XP_002330367.1| predicted protein [Populus trichocarpa]
 gi|222871571|gb|EEF08702.1| predicted protein [Populus trichocarpa]
          Length = 329

 Score =  215 bits (548), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 120/316 (37%), Positives = 181/316 (57%), Gaps = 11/316 (3%)

Query: 34  GAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIREE 93
           GA+AG +SR V SPLDV+KIR Q+Q   P         N     KY GM  A K I REE
Sbjct: 16  GAIAGGISRTVTSPLDVIKIRFQVQL-EPTYSWDLVRRNMTAPSKYTGMLQATKDIFREE 74

Query: 94  GIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGAIS 153
           G+ G W GN+ A  + + Y A+QF   H+++  F    S   +   ++  L  ++SGA++
Sbjct: 75  GLPGFWRGNVPALLMVMPYTAIQFAVLHKLKT-FAAGSSKTEDHIHLSPYLS-YISGALA 132

Query: 154 GSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPY 213
           G TAT+ +YPFDLLRT  A+QGE ++Y  +R+A   I    G+RG Y G++ ++V+I+PY
Sbjct: 133 GCTATVGSYPFDLLRTILASQGEPKVYPTMRSAFVDITRTRGFRGLYAGLSPTLVEIVPY 192

Query: 214 MGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLS-------GAIAGIVSKAGVFPLDL 266
            GL FG+Y+  K+             +  +T+D LS       G  AG  +K    PLD+
Sbjct: 193 AGLQFGTYDTFKRWTMGWNHDRSSTTSFISTDDSLSSFQLFVCGLAAGTCAKLVCHPLDV 252

Query: 267 VRKRLQVQGPNRKDYFISNVPLYS-SSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSA 325
           V+KR Q++G  R   + + V  ++  ++F  + +IL+ +G  GLYKG++P+ +K+AP  A
Sbjct: 253 VKKRFQIEGLQRHPRYGARVEHHAYKNMFDALSRILQMEGWAGLYKGIVPSTVKAAPAGA 312

Query: 326 VTFFVYGYTKRLLEKL 341
           VTF  Y +T   LE +
Sbjct: 313 VTFLAYEFTSDWLESI 328



 Score = 86.3 bits (212), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/219 (29%), Positives = 96/219 (43%), Gaps = 41/219 (18%)

Query: 140 INKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRI--------------YIGLRN 185
           + + L    +GAI+G  +  VT P D+++ RF  Q E                 Y G+  
Sbjct: 6   LKRALIDATAGAIAGGISRTVTSPLDVIKIRFQVQLEPTYSWDLVRRNMTAPSKYTGMLQ 65

Query: 186 AVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLF---RKLEDKHIWFHNLR 242
           A + I+ +EG  GF+RG   +++ ++PY  + F     LK       K ED HI   +L 
Sbjct: 66  ATKDIFREEGLPGFWRGNVPALLMVMPYTAIQFAVLHKLKTFAAGSSKTED-HI---HLS 121

Query: 243 ATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQG-----PNRKDYFISNVPLYSSSIFICI 297
                +SGA+AG  +  G +P DL+R  L  QG     P  +  F+              
Sbjct: 122 PYLSYISGALAGCTATVGSYPFDLLRTILASQGEPKVYPTMRSAFV-------------- 167

Query: 298 KQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGYTKR 336
             I R+ G  GLY GL P L++  P + + F  Y   KR
Sbjct: 168 -DITRTRGFRGLYAGLSPTLVEIVPYAGLQFGTYDTFKR 205



>gi|502151096|ref|XP_004508276.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Cicer
           arietinum]
          Length = 329

 Score =  215 bits (547), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 127/327 (38%), Positives = 188/327 (57%), Gaps = 34/327 (10%)

Query: 34  GAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSS----RHHNSGTL-KKYNGMSHAIKL 88
           GA++G +SR V SPLDV+KIR Q+Q    + P SS    R   + T+  KY GM  A K 
Sbjct: 17  GAISGGISRTVTSPLDVIKIRFQVQ----LEPTSSWALLRKDLATTVPSKYTGMFQASKD 72

Query: 89  IIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFL 148
           I+REEG++G W GN+ A  + + Y A+QF   H+++        ++N     + +L P+L
Sbjct: 73  ILREEGLQGFWRGNVPALLMVMPYTAIQFTVLHKLKTFASGSSKSEN-----HTSLSPYL 127

Query: 149 S---GAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTA 205
           S   GA++G  AT+ +YPFDLLRT  A+QGE +IY  +R+A   I    G+ G Y G++ 
Sbjct: 128 SYVSGAVAGCAATVGSYPFDLLRTILASQGEPKIYPNMRSAFVDIVQTRGFTGLYAGLSP 187

Query: 206 SVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFH--NLRAT-ED-------LLSGAIAGI 255
           ++V+IIPY GL FG+Y+  K+          W H  N   T ED        L G  AG 
Sbjct: 188 TLVEIIPYAGLQFGTYDTFKRW------ASAWNHSRNFNTTAEDSPSSFQLFLCGLAAGT 241

Query: 256 VSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYS-SSIFICIKQILRSDGIFGLYKGLM 314
            +K    PLD+V+KR Q++G  R   + + V   + S++F  +++I++S+G  GLYKG++
Sbjct: 242 CAKLVCHPLDVVKKRFQIEGLQRHPRYGARVEYRAYSNMFDAVQRIIQSEGWAGLYKGII 301

Query: 315 PALIKSAPVSAVTFFVYGYTKRLLEKL 341
           P+ +K+AP  AVTF  Y      LE L
Sbjct: 302 PSTVKAAPAGAVTFVAYELVSDWLESL 328



 Score = 87.0 bits (214), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 63/219 (28%), Positives = 96/219 (43%), Gaps = 37/219 (16%)

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRI----------------YIGLRNAVQQIYV 192
           +GAISG  +  VT P D+++ RF  Q E                   Y G+  A + I  
Sbjct: 16  AGAISGGISRTVTSPLDVIKIRFQVQLEPTSSWALLRKDLATTVPSKYTGMFQASKDILR 75

Query: 193 QEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAI 252
           +EG +GF+RG   +++ ++PY  + F     LK  F     K     +L      +SGA+
Sbjct: 76  EEGLQGFWRGNVPALLMVMPYTAIQFTVLHKLKT-FASGSSKSENHTSLSPYLSYVSGAV 134

Query: 253 AGIVSKAGVFPLDLVRKRLQVQG-----PNRKDYFISNVPLYSSSIFICIKQILRSDGIF 307
           AG  +  G +P DL+R  L  QG     PN +  F+                I+++ G  
Sbjct: 135 AGCAATVGSYPFDLLRTILASQGEPKIYPNMRSAFV---------------DIVQTRGFT 179

Query: 308 GLYKGLMPALIKSAPVSAVTFFVYGYTKRLLEKLHSSRD 346
           GLY GL P L++  P + + F  Y   KR     + SR+
Sbjct: 180 GLYAGLSPTLVEIIPYAGLQFGTYDTFKRWASAWNHSRN 218



 Score = 84.0 bits (206), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 63/218 (28%), Positives = 93/218 (42%), Gaps = 37/218 (16%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIR 91
           + GAVAG  +   + P D+++  L  Q G P              K Y  M  A   I++
Sbjct: 130 VSGAVAGCAATVGSYPFDLLRTILASQ-GEP--------------KIYPNMRSAFVDIVQ 174

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKT-------L 144
             G  GL+ G        + Y  +QF TY    + FKR  S  N     N T        
Sbjct: 175 TRGFTGLYAGLSPTLVEIIPYAGLQFGTY----DTFKRWASAWNHSRNFNTTAEDSPSSF 230

Query: 145 QPFLSGAISGSTATIVTYPFDLLRTRFAAQG-----------EKRIYIGLRNAVQQIYVQ 193
           Q FL G  +G+ A +V +P D+++ RF  +G           E R Y  + +AVQ+I   
Sbjct: 231 QLFLCGLAAGTCAKLVCHPLDVVKKRFQIEGLQRHPRYGARVEYRAYSNMFDAVQRIIQS 290

Query: 194 EGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKL 231
           EG+ G Y+G+  S V+  P   + F +YE +      L
Sbjct: 291 EGWAGLYKGIIPSTVKAAPAGAVTFVAYELVSDWLESL 328



>gi|62859815|ref|NP_001015953.1| solute carrier family 25 (mitochondrial thiamine pyrophosphate
           carrier), member 19 [Xenopus (Silurana) tropicalis]
 gi|89271944|emb|CAJ81766.1| solute carrier family 25 (mitochondrial deoxynucleotide carrier),
           member 19 [Xenopus (Silurana) tropicalis]
          Length = 324

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 124/315 (39%), Positives = 184/315 (58%), Gaps = 32/315 (10%)

Query: 25  LSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSH 84
           LSS E+ + G+++G+V+R + SPLDV+KIR QLQ    I  LSS     GT  KY+G+  
Sbjct: 13  LSSSEVAMAGSLSGLVTRALISPLDVIKIRFQLQ----IESLSSH----GTQGKYHGILQ 64

Query: 85  AIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTL 144
           A+ LI+REEG+ G W G++ A+ L +SYGAVQF+++  +  LF            ++ +L
Sbjct: 65  AVGLILREEGLPGFWKGHVPAQLLSVSYGAVQFVSFEMLTELFH-----------VSTSL 113

Query: 145 QP------FLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRG 198
            P      FL G ++  +AT+   P D LRTRFAAQGE ++Y  LRNA+  ++  EG   
Sbjct: 114 DPRSPAVHFLCGGLAACSATLAVQPLDTLRTRFAAQGEPKVYRNLRNAIFTMFRTEGPVA 173

Query: 199 FYRGVTASVVQIIPYMGLVFGSYEFLKKLFR--KLEDKHIWFHNLRATEDLLSGAIAGIV 256
           FYRG+  +++ + PY GL F SY  LK+ +    L+D+        +  +LL G+ AG++
Sbjct: 174 FYRGLFPTLLAVFPYAGLQFSSYNLLKRTWNLVLLKDQ----TQKDSLRNLLCGSGAGVI 229

Query: 257 SKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPA 316
           SK   +P DL +KRLQV G  +       V  Y   +  C  QI + +G  G +KGL P+
Sbjct: 230 SKTVTYPFDLFKKRLQVGGFEQARAHFGKVRTY-HGLVDCACQIWKEEGFRGFFKGLAPS 288

Query: 317 LIKSAPVSAVTFFVY 331
           L+K+A  + +TFF Y
Sbjct: 289 LLKAAFSTGLTFFSY 303



 Score = 85.5 bits (210), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/210 (29%), Positives = 93/210 (44%), Gaps = 37/210 (17%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIR 91
           +CG +A   +     PLD ++ R   Q G P              K Y  + +AI  + R
Sbjct: 123 LCGGLAACSATLAVQPLDTLRTRFAAQ-GEP--------------KVYRNLRNAIFTMFR 167

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKR-----IDSNQNEKFGINKTLQP 146
            EG    + G          Y  +QF +Y    NL KR     +  +Q +K     +L+ 
Sbjct: 168 TEGPVAFYRGLFPTLLAVFPYAGLQFSSY----NLLKRTWNLVLLKDQTQK----DSLRN 219

Query: 147 FLSGAISGSTATIVTYPFDLLRTRF---------AAQGEKRIYIGLRNAVQQIYVQEGYR 197
            L G+ +G  +  VTYPFDL + R          A  G+ R Y GL +   QI+ +EG+R
Sbjct: 220 LLCGSGAGVISKTVTYPFDLFKKRLQVGGFEQARAHFGKVRTYHGLVDCACQIWKEEGFR 279

Query: 198 GFYRGVTASVVQIIPYMGLVFGSYEFLKKL 227
           GF++G+  S+++     GL F SYE    L
Sbjct: 280 GFFKGLAPSLLKAAFSTGLTFFSYELFCSL 309



>gi|116788977|gb|ABK25070.1| unknown [Picea sitchensis]
          Length = 329

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 127/327 (38%), Positives = 188/327 (57%), Gaps = 31/327 (9%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTL--KKYNGMSHAIKLI 89
           + GA AG +SR V SPLDV+KIR Q+Q    + P        G L   KY G+  A K I
Sbjct: 15  LAGAKAGGISRTVTSPLDVIKIRFQVQ----LEPTVRLLSPGGVLGVSKYTGIFQATKDI 70

Query: 90  IREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLS 149
           +REEG+ GLW GN+ A  + + Y A+QF   H+ +       S + E    +  L P+LS
Sbjct: 71  LREEGMLGLWRGNVPALLMVMPYTAIQFSVLHKFKTFVA--GSGKAED---HARLSPYLS 125

Query: 150 ---GAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTAS 206
              G ++GS AT+ +YPFDLLRT  A+QGE ++Y  LR+A  +I   +G RG Y G++ +
Sbjct: 126 YVSGGLAGSAATVGSYPFDLLRTLLASQGEPKVYPNLRSAFLEITRTKGIRGLYAGLSPT 185

Query: 207 VVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRAT-----------EDLLSGAIAGI 255
           +V+I+PY GL FGSY+  K+  +          N R T           +  L G  AG 
Sbjct: 186 LVEIVPYAGLQFGSYDTFKRWIKTWNQA-----NPRQTGSESEESLSSVQLFLCGLAAGT 240

Query: 256 VSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYS-SSIFICIKQILRSDGIFGLYKGLM 314
           V+K    PLD+V+KR QV+G  R   + + V   + + ++  +++IL+++G+ GLYKG++
Sbjct: 241 VAKIACHPLDVVKKRFQVEGLQRHPRYGARVEEKTYTGMWDAVRRILQAEGLAGLYKGIV 300

Query: 315 PALIKSAPVSAVTFFVYGYTKRLLEKL 341
           P++IK+AP  AVTF VY YT   L+ +
Sbjct: 301 PSVIKAAPAGAVTFVVYEYTSDWLDSI 327



 Score = 80.1 bits (196), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 61/228 (26%), Positives = 97/228 (42%), Gaps = 40/228 (17%)

Query: 141 NKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRI-------------YIGLRNAV 187
            + L   L+GA +G  +  VT P D+++ RF  Q E  +             Y G+  A 
Sbjct: 8   RRALVDALAGAKAGGISRTVTSPLDVIKIRFQVQLEPTVRLLSPGGVLGVSKYTGIFQAT 67

Query: 188 QQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFR---KLEDKHIWFHNLRAT 244
           + I  +EG  G +RG   +++ ++PY  + F      K       K ED       L   
Sbjct: 68  KDILREEGMLGLWRGNVPALLMVMPYTAIQFSVLHKFKTFVAGSGKAEDH----ARLSPY 123

Query: 245 EDLLSGAIAGIVSKAGVFPLDLVRKRLQVQG-----PNRKDYFISNVPLYSSSIFICIKQ 299
              +SG +AG  +  G +P DL+R  L  QG     PN +  F+               +
Sbjct: 124 LSYVSGGLAGSAATVGSYPFDLLRTLLASQGEPKVYPNLRSAFL---------------E 168

Query: 300 ILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGYTKRLLEKLHSSRDK 347
           I R+ GI GLY GL P L++  P + + F  Y   KR ++  + +  +
Sbjct: 169 ITRTKGIRGLYAGLSPTLVEIVPYAGLQFGSYDTFKRWIKTWNQANPR 216



>gi|357126690|ref|XP_003565020.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like
           [Brachypodium distachyon]
          Length = 332

 Score =  214 bits (545), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 119/312 (38%), Positives = 179/312 (57%), Gaps = 19/312 (6%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIR 91
           + GA++G +SR V SPLDV+KIR Q+Q   P     +   +     KY G+  A K I+R
Sbjct: 18  LAGAISGGISRTVTSPLDVIKIRFQVQL-EPTASWGALRRDVYGPSKYTGLMQATKDILR 76

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGA 151
           EEG+ G W GN+ A ++Y+ Y A+QF   H+++  F    S   +   ++  L  ++SGA
Sbjct: 77  EEGLPGFWRGNVPALFMYMPYTAIQFTVLHKLKT-FASGSSRTEDHLHLSPYLS-YVSGA 134

Query: 152 ISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQII 211
           ++G  AT+ +YPFDLLRT  A+QGE ++Y  +R+A+  I    G RG Y G+T ++V+II
Sbjct: 135 LAGCAATVGSYPFDLLRTILASQGEPKVYPNMRSALVDIIQTRGVRGLYAGLTPTLVEII 194

Query: 212 PYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATED---------LLSGAIAGIVSKAGVF 262
           PY GL FGSY+  K+          W      +E+          L G  AG  SKA   
Sbjct: 195 PYAGLQFGSYDTFKRSMMS------WNRYRYGSEEDDSASSFQLFLCGFAAGTFSKAACH 248

Query: 263 PLDLVRKRLQVQGPNRKDYFISNVPLYS-SSIFICIKQILRSDGIFGLYKGLMPALIKSA 321
           PLD+V+KR Q++G  R   + + +   +   ++  +K+I+  +G+ GLYKGL P+++KSA
Sbjct: 249 PLDVVKKRFQIEGLKRHPRYGARIESSTYQGMYHALKEIVVKEGVGGLYKGLFPSVVKSA 308

Query: 322 PVSAVTFFVYGY 333
           P  AVTF  Y Y
Sbjct: 309 PAGAVTFVAYEY 320



 Score = 81.6 bits (200), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 62/221 (28%), Positives = 92/221 (41%), Gaps = 35/221 (15%)

Query: 135 NEKFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRI--------------Y 180
            E   + + +   L+GAISG  +  VT P D+++ RF  Q E                 Y
Sbjct: 5   EEPSQMRRAMVDTLAGAISGGISRTVTSPLDVIKIRFQVQLEPTASWGALRRDVYGPSKY 64

Query: 181 IGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHN 240
            GL  A + I  +EG  GF+RG   ++   +PY  + F     LK             H 
Sbjct: 65  TGLMQATKDILREEGLPGFWRGNVPALFMYMPYTAIQFTVLHKLKTFASGSSRTEDHLH- 123

Query: 241 LRATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQG-----PNRKDYFISNVPLYSSSIFI 295
           L      +SGA+AG  +  G +P DL+R  L  QG     PN +   +            
Sbjct: 124 LSPYLSYVSGALAGCAATVGSYPFDLLRTILASQGEPKVYPNMRSALV------------ 171

Query: 296 CIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGYTKR 336
               I+++ G+ GLY GL P L++  P + + F  Y   KR
Sbjct: 172 ---DIIQTRGVRGLYAGLTPTLVEIIPYAGLQFGSYDTFKR 209



 Score = 76.3 bits (186), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 98/210 (46%), Gaps = 36/210 (17%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIR 91
           + GA+AG  +   + P D+++  L  Q G P              K Y  M  A+  II+
Sbjct: 131 VSGALAGCAATVGSYPFDLLRTILASQ-GEP--------------KVYPNMRSALVDIIQ 175

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQN------EKFGINKTLQ 145
             G+RGL+ G        + Y  +QF +Y    + FKR   + N      E+     + Q
Sbjct: 176 TRGVRGLYAGLTPTLVEIIPYAGLQFGSY----DTFKRSMMSWNRYRYGSEEDDSASSFQ 231

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEKR-----------IYIGLRNAVQQIYVQE 194
            FL G  +G+ +    +P D+++ RF  +G KR            Y G+ +A+++I V+E
Sbjct: 232 LFLCGFAAGTFSKAACHPLDVVKKRFQIEGLKRHPRYGARIESSTYQGMYHALKEIVVKE 291

Query: 195 GYRGFYRGVTASVVQIIPYMGLVFGSYEFL 224
           G  G Y+G+  SVV+  P   + F +YE++
Sbjct: 292 GVGGLYKGLFPSVVKSAPAGAVTFVAYEYI 321



>gi|504166517|ref|XP_004593115.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Ochotona
           princeps]
          Length = 318

 Score =  214 bits (544), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 121/311 (38%), Positives = 182/311 (58%), Gaps = 22/311 (7%)

Query: 24  QLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMS 83
            +S  E+ + G+++G+V+R + SPLDV+KIR QLQ    I  LS  H + G   KY+G+ 
Sbjct: 12  NISKSEVAVAGSLSGLVTRALISPLDVIKIRFQLQ----IERLS--HSDPGA--KYHGIV 63

Query: 84  HAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKT 143
            A + I ++EG+R  W G++ A+ L + YGAVQFL++  +  L  R  ++   +F ++  
Sbjct: 64  QATRRIWQDEGLRAFWKGHVPAQLLSIGYGAVQFLSFELLTELVHRATAHDPREFSVH-- 121

Query: 144 LQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGV 203
              F+ G +S  TAT+  +P D+LRTRFAAQGE R+Y  LR+AV  ++  EG   FY+G+
Sbjct: 122 ---FVCGGLSACTATLAVHPVDVLRTRFAAQGEPRVYKTLRDAVVTMHRTEGPLAFYKGL 178

Query: 204 TASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATE---DLLSGAIAGIVSKAG 260
           T +++ I PY G  F  Y  LK        + +   N +  E   +LL G  AG+VSK  
Sbjct: 179 TPTLIAIFPYAGFQFSCYSALKS-----ASEWVMPANGKQNENLRNLLCGCGAGVVSKTL 233

Query: 261 VFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKS 320
            +PLDL +KRLQV G  R       V  Y   +  C++Q+LR +G  G +KGL P+L+K+
Sbjct: 234 TYPLDLFKKRLQVGGFERARASFGQVRCY-RGLLDCMRQVLREEGGPGCFKGLSPSLLKA 292

Query: 321 APVSAVTFFVY 331
           A  + + FF Y
Sbjct: 293 ALSTGLVFFWY 303



>gi|327265025|ref|XP_003217309.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like
           [Anolis carolinensis]
          Length = 440

 Score =  214 bits (544), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 123/326 (37%), Positives = 184/326 (56%), Gaps = 18/326 (5%)

Query: 22  ASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNG 81
            S LS+ EI   G+ +G+V+R + SP DV+KIR QLQ    I  LSSR+  +    KY G
Sbjct: 10  CSSLSTGEIASAGSASGLVTRALISPFDVLKIRFQLQ----IEQLSSRNPQA----KYYG 61

Query: 82  MSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGIN 141
           +  A   I +EEG R  W G++ A+ L ++YGAVQF+++  +  L     S     F ++
Sbjct: 62  IWQAFWTIHQEEGPRAFWKGHVPAQLLSITYGAVQFVSFELLTKLVHHATSYDARDFAVH 121

Query: 142 KTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYR 201
                F+ G +S   AT+   P D LRTR AAQGE +IY  LR+AV  +Y +EG R FYR
Sbjct: 122 -----FVCGGMSACAATVTVQPLDTLRTRLAAQGEPKIYKNLRHAVVSMYQREGLRNFYR 176

Query: 202 GVTASVVQIIPYMGLVFGSYEFLKKLFRKL-EDKHIWFHNLRATEDLLSGAIAGIVSKAG 260
           G++ +++ ++PY G  F  Y  LKKL+  +   + +   N++   + + G+ AG++SK  
Sbjct: 177 GLSPTIIAVVPYAGFQFSFYSLLKKLYNWIVPSEEMKKGNIK---NFVCGSCAGVLSKTL 233

Query: 261 VFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKS 320
            +P DL +KRLQV G  +       V  Y + +  C +QI R +G+ G +KGL P+L+K+
Sbjct: 234 TYPFDLFKKRLQVGGFEQARASFGQVRTY-AGLLDCAQQIARDEGLRGFFKGLSPSLLKA 292

Query: 321 APVSAVTFFVYGYTKRLLEKLHSSRD 346
           A  +  TFF Y     LL  L  S +
Sbjct: 293 AFSTGFTFFWYELFCGLLSTLKDSEE 318



>gi|508714588|gb|EOY06485.1| Mitochondrial substrate carrier family protein [Theobroma cacao]
          Length = 330

 Score =  213 bits (543), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 121/319 (37%), Positives = 187/319 (58%), Gaps = 18/319 (5%)

Query: 34  GAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSS----RHHNSGTLKKYNGMSHAIKLI 89
           GA++G +SR V SPLDV+KIR Q+Q    + P SS    R    G+  KY GM  A K I
Sbjct: 17  GAISGGISRTVTSPLDVIKIRFQVQ----LEPTSSWALLRRDLPGS-SKYTGMFQATKDI 71

Query: 90  IREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLS 149
           +REEG+ G W GN+ A  + + Y A+QF+  H+++  F    S   +   I+  L  ++S
Sbjct: 72  LREEGLPGFWRGNVPALLMVMPYTAIQFVVLHKLKT-FASGSSKSADHINISPYLS-YIS 129

Query: 150 GAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQ 209
           GA++G  AT+ +YPFDLLRT  A+QGE ++Y  +R+A   I    G++G Y G++ ++V+
Sbjct: 130 GALAGCAATVGSYPFDLLRTILASQGEPKVYPNMRSAFFDIIRTRGFKGLYAGLSPTLVE 189

Query: 210 IIPYMGLVFGSYEFLKKL------FRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFP 263
           IIPY GL FG+Y+  K+        R          +L + +  + G  AG  +K    P
Sbjct: 190 IIPYAGLQFGTYDTFKRWTMSWNRLRSSNTSSTMDDSLSSFQLFICGLAAGTCAKLVCHP 249

Query: 264 LDLVRKRLQVQGPNRKDYFISNVPLYS-SSIFICIKQILRSDGIFGLYKGLMPALIKSAP 322
           LD+V+KR Q++G  R   + + V  ++  ++F  +++IL+ +G  GLYKG++P+ IK+AP
Sbjct: 250 LDVVKKRFQIEGLQRHPKYGARVEHHAYMNMFDALRRILQLEGWHGLYKGIVPSTIKAAP 309

Query: 323 VSAVTFFVYGYTKRLLEKL 341
             AVTF  Y +T   LE +
Sbjct: 310 AGAVTFVAYEFTSDWLESI 328



 Score = 85.1 bits (209), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 62/207 (29%), Positives = 90/207 (43%), Gaps = 35/207 (16%)

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGE--------------KRIYIGLRNAVQQIYVQE 194
           +GAISG  +  VT P D+++ RF  Q E                 Y G+  A + I  +E
Sbjct: 16  AGAISGGISRTVTSPLDVIKIRFQVQLEPTSSWALLRRDLPGSSKYTGMFQATKDILREE 75

Query: 195 GYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAG 254
           G  GF+RG   +++ ++PY  + F     LK  F     K     N+      +SGA+AG
Sbjct: 76  GLPGFWRGNVPALLMVMPYTAIQFVVLHKLKT-FASGSSKSADHINISPYLSYISGALAG 134

Query: 255 IVSKAGVFPLDLVRKRLQVQG-----PNRKDYFISNVPLYSSSIFICIKQILRSDGIFGL 309
             +  G +P DL+R  L  QG     PN +  F                 I+R+ G  GL
Sbjct: 135 CAATVGSYPFDLLRTILASQGEPKVYPNMRSAFF---------------DIIRTRGFKGL 179

Query: 310 YKGLMPALIKSAPVSAVTFFVYGYTKR 336
           Y GL P L++  P + + F  Y   KR
Sbjct: 180 YAGLSPTLVEIIPYAGLQFGTYDTFKR 206



>gi|320592384|gb|EFX04823.1| mitochondrial dicarboxylate carrier protein [Grosmannia clavigera
           kw1407]
          Length = 325

 Score =  213 bits (543), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 134/318 (42%), Positives = 191/318 (60%), Gaps = 11/318 (3%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           S +++ I G  AG+++RF+ +PLDVVKIRLQLQ     +P S  + + G    Y G    
Sbjct: 13  SKLQVVIAGGTAGLIARFLVAPLDVVKIRLQLQTHSLSDPRSQLNLHGG--PTYKGTLPT 70

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQ 145
           ++ II  EG+ GLW GN+ AE +Y+ Y A+QF  Y     L ++          +  +++
Sbjct: 71  MRHIIAHEGLTGLWKGNVPAELMYVCYSAIQFTAYRTATLLVQQAAGGPGV---LPPSIE 127

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEK-RIYIGLRNAVQQIYVQEGYRGFYRGVT 204
            F+SGA +G+ AT  TYP DLLRTRFAAQG K R+Y  LR+AV++I   EG RGF+RG+ 
Sbjct: 128 SFVSGAAAGAAATTATYPLDLLRTRFAAQGSKDRVYTNLRHAVREIARDEGLRGFFRGLG 187

Query: 205 ASVVQIIPYMGLVFGSYEFLKK-LFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFP 263
            +++QI P+MG  F  YE L+  L R      + F    A       A+A + +K  VFP
Sbjct: 188 PAILQIAPFMGTFFAVYEGLRAPLLRAHLADRLPFGGGDAAAG----AVAAVAAKTAVFP 243

Query: 264 LDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPV 323
           LDLVRKR+QVQGP R  Y   N+P+Y  S+   +++I R +GI GLY+GL  +L+K+AP 
Sbjct: 244 LDLVRKRIQVQGPTRGRYVHKNIPVYDGSVGRTLRKIARREGIRGLYRGLTVSLLKAAPA 303

Query: 324 SAVTFFVYGYTKRLLEKL 341
           S +T + Y     LL +L
Sbjct: 304 STITVWTYERVLHLLMRL 321



>gi|334322913|ref|XP_001377722.2| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like
           [Monodelphis domestica]
          Length = 441

 Score =  213 bits (543), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 116/307 (37%), Positives = 184/307 (59%), Gaps = 18/307 (5%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           S +E+ + G+ AG+V+R + SPLDV+KIR QLQ    +  LSSR   +    KY+G+ HA
Sbjct: 14  SKVEVALAGSAAGLVTRALISPLDVIKIRFQLQ----VENLSSRDPRA----KYHGILHA 65

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQ 145
           ++ I++EEG+   W G+  A+ L + YGAVQF+T+ ++  L     +++ + +GI+    
Sbjct: 66  MRQILKEEGLTAFWKGHFPAQILSMGYGAVQFVTFERLTEL-----AHRTKPYGISDFSV 120

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTA 205
            F+ G +S   AT+   P D+LRTRFAAQGE +IY  LR+ ++ +Y  EG   FY+G+  
Sbjct: 121 HFVCGGLSACAATLSLQPVDVLRTRFAAQGEPKIYRNLRHGMKMMYKTEGPLAFYKGLPP 180

Query: 206 SVVQIIPYMGLVFGSYEFLKKLFR-KLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPL 264
           +++ I PY G  F  Y  LK+++   +        N++   +LL G+ AG++SK   +PL
Sbjct: 181 TIIAIFPYAGFQFSFYRMLKQVYEWAMPGDRKKNANIK---NLLCGSGAGVISKILTYPL 237

Query: 265 DLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVS 324
           DL +KRLQV G          V  Y  S+  C ++IL+ +G  G +KGL P+L+K+A  +
Sbjct: 238 DLFKKRLQVDGFEEARATFGQVRKY-ESLLDCARKILQEEGARGFFKGLTPSLLKAAMST 296

Query: 325 AVTFFVY 331
            + FF+Y
Sbjct: 297 GLIFFMY 303



 Score = 82.4 bits (202), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 52/206 (25%), Positives = 90/206 (43%), Gaps = 27/206 (13%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIR 91
           +CG ++   +     P+DV++ R   Q               G  K Y  + H +K++ +
Sbjct: 123 VCGGLSACAATLSLQPVDVLRTRFAAQ---------------GEPKIYRNLRHGMKMMYK 167

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGA 151
            EG    + G          Y   QF  Y  ++ +++       +K   N  ++  L G+
Sbjct: 168 TEGPLAFYKGLPPTIIAIFPYAGFQFSFYRMLKQVYEWAMPGDRKK---NANIKNLLCGS 224

Query: 152 ISGSTATIVTYPFDLLRTRF---------AAQGEKRIYIGLRNAVQQIYVQEGYRGFYRG 202
            +G  + I+TYP DL + R          A  G+ R Y  L +  ++I  +EG RGF++G
Sbjct: 225 GAGVISKILTYPLDLFKKRLQVDGFEEARATFGQVRKYESLLDCARKILQEEGARGFFKG 284

Query: 203 VTASVVQIIPYMGLVFGSYEFLKKLF 228
           +T S+++     GL+F  YE    LF
Sbjct: 285 LTPSLLKAAMSTGLIFFMYELFCNLF 310



>gi|475664328|gb|EMT62123.1| Mitochondrial thiamine pyrophosphate carrier 1 [Fusarium oxysporum
           f. sp. cubense race 4]
 gi|477507544|gb|ENH60838.1| Mitochondrial thiamine pyrophosphate carrier 1 [Fusarium oxysporum
           f. sp. cubense race 1]
          Length = 293

 Score =  213 bits (541), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 133/314 (42%), Positives = 182/314 (57%), Gaps = 52/314 (16%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           S +++   GA+AG+VSRFV +PLDVVKIRLQLQP    +P+++  +       Y G    
Sbjct: 16  SRVQVVAAGAIAGLVSRFVVAPLDVVKIRLQLQPHSLSDPVAALRNAPA----YRGAFET 71

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQ 145
           +K I++ EG+ GLW GN+ AE +                                     
Sbjct: 72  LKHILKHEGLTGLWKGNVPAELI------------------------------------- 94

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTA 205
            F++GA SG+ AT +TYP DLLRTRFAAQG  R+Y  LR+AV  I   EG+RGF+RG+  
Sbjct: 95  -FIAGAASGAAATTITYPLDLLRTRFAAQGRHRVYQSLRSAVWDIKRDEGWRGFFRGIGP 153

Query: 206 SVVQIIPYMGLVFGSYEFLKKLFRKLEDKHI-WFHNLRATEDLLSGAIAGIVSKAGVFPL 264
            + QIIP+MG+ F +YE L+     LE  H+ W      + D  +G  A I+SK  VFPL
Sbjct: 154 GLGQIIPFMGIFFVTYESLRT---SLEGLHMPW-----GSGDATAGMCASILSKTAVFPL 205

Query: 265 DLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVS 324
           DLVRKR+QVQGP R+ Y   N+P Y+++    +  ILR++G  GLYKGL  +L+KSAP S
Sbjct: 206 DLVRKRIQVQGPARRQYVYQNIPEYATARSALL-SILRTEGFRGLYKGLTISLLKSAPAS 264

Query: 325 AVTFFVYGYTKRLL 338
           AVT + Y  +  L+
Sbjct: 265 AVTLWTYEQSLNLM 278



>gi|414878826|tpg|DAA55957.1| TPA: hypothetical protein ZEAMMB73_316859 [Zea mays]
          Length = 336

 Score =  213 bits (541), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 123/314 (39%), Positives = 185/314 (58%), Gaps = 19/314 (6%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSS----RHHNSGTLKKYNGMSHAIK 87
           + GA++G +SR V SPLDV+KIR Q+Q    + P +S    R    G   KY G+  A K
Sbjct: 18  LAGAISGGISRTVTSPLDVIKIRFQVQ----LEPTTSWGILRRDIYGP-SKYTGLLQATK 72

Query: 88  LIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPF 147
            I+REEG+ G W GN+ A  +Y+ Y A+QF   H+++  F    S   +   ++  L  +
Sbjct: 73  DILREEGLPGFWRGNVPALLMYMPYTAIQFTVLHKLKT-FASGSSKTEDHLHLSPYLS-Y 130

Query: 148 LSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASV 207
           +SGA++G  ATI +YPFDLLRT  A+QGE +IY  +R+A   I    G +G Y G++ ++
Sbjct: 131 VSGALAGCAATIGSYPFDLLRTILASQGEPKIYPNMRSAFVDIIKTRGVQGLYSGLSPTL 190

Query: 208 VQIIPYMGLVFGSYEFLKK---LFRKLEDKHIWF----HNLRATEDLLSGAIAGIVSKAG 260
           V+IIPY GL FGSY+  K+    + + +  H+ F     ++ + +  L G  AG  SKA 
Sbjct: 191 VEIIPYAGLQFGSYDTFKRSMMTWNRYKYSHLNFGSEDDSVSSFQLFLCGFAAGTFSKAA 250

Query: 261 VFPLDLVRKRLQVQGPNRKDYFISNVPLYS-SSIFICIKQILRSDGIFGLYKGLMPALIK 319
             PLD+V+KR Q++G  R   + + +   +   ++  +K+I+  +G  GLYKGL P+L+K
Sbjct: 251 CHPLDVVKKRFQIEGLKRHPRYGARIESSTYKGMYHALKEIVAKEGFGGLYKGLFPSLVK 310

Query: 320 SAPVSAVTFFVYGY 333
           SAP  AVTF  Y Y
Sbjct: 311 SAPAGAVTFVAYEY 324



 Score = 85.5 bits (210), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 66/219 (30%), Positives = 98/219 (44%), Gaps = 41/219 (18%)

Query: 140 INKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRI--------------YIGLRN 185
           + + L   L+GAISG  +  VT P D+++ RF  Q E                 Y GL  
Sbjct: 10  MRRALVDSLAGAISGGISRTVTSPLDVIKIRFQVQLEPTTSWGILRRDIYGPSKYTGLLQ 69

Query: 186 AVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFR---KLEDKHIWFHNLR 242
           A + I  +EG  GF+RG   +++  +PY  + F     LK       K ED H+   +L 
Sbjct: 70  ATKDILREEGLPGFWRGNVPALLMYMPYTAIQFTVLHKLKTFASGSSKTED-HL---HLS 125

Query: 243 ATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQG-----PNRKDYFISNVPLYSSSIFICI 297
                +SGA+AG  +  G +P DL+R  L  QG     PN +  F+              
Sbjct: 126 PYLSYVSGALAGCAATIGSYPFDLLRTILASQGEPKIYPNMRSAFV-------------- 171

Query: 298 KQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGYTKR 336
             I+++ G+ GLY GL P L++  P + + F  Y   KR
Sbjct: 172 -DIIKTRGVQGLYSGLSPTLVEIIPYAGLQFGSYDTFKR 209



>gi|356529708|ref|XP_003533430.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like
           [Glycine max]
          Length = 328

 Score =  212 bits (540), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 121/315 (38%), Positives = 183/315 (58%), Gaps = 13/315 (4%)

Query: 34  GAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIREE 93
           GA++G +SR V SPLDV+KIR Q+Q   P +  +    +  T  KY GM  A K I REE
Sbjct: 18  GAISGGISRTVTSPLDVIKIRFQVQL-EPTSSWTLLRKDLSTPSKYTGMLQASKDIFREE 76

Query: 94  GIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLS---G 150
           GI G W GN+ A  + + Y A+QF   H+++         +N    IN  L P+LS   G
Sbjct: 77  GIWGFWRGNVPALLMVMPYTAIQFTVLHKLKTFAAGSSKTENH---IN--LSPYLSYMSG 131

Query: 151 AISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQI 210
           A++G  AT+ +YPFDLLRT  A+QGE ++Y  +R A+  I    G+RG Y G++ ++V+I
Sbjct: 132 ALAGCAATVGSYPFDLLRTILASQGEPKVYPNMRAALVDILQTRGFRGLYAGLSPTLVEI 191

Query: 211 IPYMGLVFGSYEFLKKL---FRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLV 267
           IPY GL FG+Y+  K+    + + +  +    +L + +  L G  AG  +K    PLD+V
Sbjct: 192 IPYAGLQFGTYDTFKRWTMAWNQRQYSNPTAESLSSFQLFLCGLAAGTCAKLVCHPLDVV 251

Query: 268 RKRLQVQGPNRKDYFISNVPLYS-SSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAV 326
           +KR Q++G  R   + + V   +  ++   +K+IL+ +G  GLYKG++P+ +K+AP  AV
Sbjct: 252 KKRFQIEGLQRHPRYGARVEHRAYKNMLDAMKRILQMEGWAGLYKGILPSTVKAAPAGAV 311

Query: 327 TFFVYGYTKRLLEKL 341
           TF  Y  T   LE +
Sbjct: 312 TFVAYELTVDWLESI 326



 Score = 85.9 bits (211), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 61/204 (29%), Positives = 92/204 (45%), Gaps = 29/204 (14%)

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRI--------------YIGLRNAVQQIYVQE 194
           +GAISG  +  VT P D+++ RF  Q E                 Y G+  A + I+ +E
Sbjct: 17  AGAISGGISRTVTSPLDVIKIRFQVQLEPTSSWTLLRKDLSTPSKYTGMLQASKDIFREE 76

Query: 195 GYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLF--RKLEDKHIWFHNLRATEDLLSGAI 252
           G  GF+RG   +++ ++PY  + F     LK         + HI   NL      +SGA+
Sbjct: 77  GIWGFWRGNVPALLMVMPYTAIQFTVLHKLKTFAAGSSKTENHI---NLSPYLSYMSGAL 133

Query: 253 AGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKG 312
           AG  +  G +P DL+R  L  QG           P    ++   +  IL++ G  GLY G
Sbjct: 134 AGCAATVGSYPFDLLRTILASQGE----------PKVYPNMRAALVDILQTRGFRGLYAG 183

Query: 313 LMPALIKSAPVSAVTFFVYGYTKR 336
           L P L++  P + + F  Y   KR
Sbjct: 184 LSPTLVEIIPYAGLQFGTYDTFKR 207



>gi|470121545|ref|XP_004296825.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like
           [Fragaria vesca subsp. vesca]
          Length = 330

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 118/314 (37%), Positives = 181/314 (57%), Gaps = 11/314 (3%)

Query: 34  GAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIREE 93
           G +AG +SR V SPLDV+KIR Q+Q   P +  +    N     KY GM  A + I REE
Sbjct: 17  GLIAGGISRTVTSPLDVIKIRFQVQL-EPTSSWALVRRNLTEPSKYTGMFQATRDIFREE 75

Query: 94  GIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGAIS 153
           G+ G W GN+ A  + + Y A+QF   H+++  F    S   +   ++  L  ++SGA++
Sbjct: 76  GLPGFWRGNVPALLMVMPYTAIQFTVLHKLKT-FAAGSSKSEDHVHLSPYLS-YISGALA 133

Query: 154 GSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPY 213
           G  AT+ +YPFDLLRT  A+QGE ++Y  +R+A  +I    G+RG Y G++ ++V+I+PY
Sbjct: 134 GCAATVGSYPFDLLRTLLASQGEPKVYPTMRSAFVEIVKTRGFRGLYAGLSPTLVEIVPY 193

Query: 214 MGLVFGSYEFLKKLFRKLEDKHIWFHNLRATED-------LLSGAIAGIVSKAGVFPLDL 266
            GL FG+Y+  K+    L        +L  TE+        L G  AG  +K    PLD+
Sbjct: 194 AGLQFGTYDTFKRWTMMLNQFRSSSEDLYGTENSLTSFQLFLCGLAAGTCAKLVCHPLDV 253

Query: 267 VRKRLQVQGPNRKDYFISNVPLYS-SSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSA 325
           V+KR Q++G  R   + + V   + S++   +++I++ +G  GLYKG++P+ +K+AP  A
Sbjct: 254 VKKRFQIEGLQRHPRYGARVEHRAYSNMVDALRRIVQKEGWAGLYKGIVPSTVKAAPAGA 313

Query: 326 VTFFVYGYTKRLLE 339
           VTF  Y YT   LE
Sbjct: 314 VTFVAYEYTSDWLE 327



 Score = 83.2 bits (204), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 100/223 (44%), Gaps = 44/223 (19%)

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQ--------------GEKRIYIGLRNAVQQIYVQE 194
           +G I+G  +  VT P D+++ RF  Q               E   Y G+  A + I+ +E
Sbjct: 16  AGLIAGGISRTVTSPLDVIKIRFQVQLEPTSSWALVRRNLTEPSKYTGMFQATRDIFREE 75

Query: 195 GYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLF---RKLEDKHIWFHNLRATEDLLSGA 251
           G  GF+RG   +++ ++PY  + F     LK       K ED H+   +L      +SGA
Sbjct: 76  GLPGFWRGNVPALLMVMPYTAIQFTVLHKLKTFAAGSSKSED-HV---HLSPYLSYISGA 131

Query: 252 IAGIVSKAGVFPLDLVRKRLQVQG-----PNRKDYFISNVPLYSSSIFICIKQILRSDGI 306
           +AG  +  G +P DL+R  L  QG     P  +  F+               +I+++ G 
Sbjct: 132 LAGCAATVGSYPFDLLRTLLASQGEPKVYPTMRSAFV---------------EIVKTRGF 176

Query: 307 FGLYKGLMPALIKSAPVSAVTFFVYGYTKR---LLEKLHSSRD 346
            GLY GL P L++  P + + F  Y   KR   +L +  SS +
Sbjct: 177 RGLYAGLSPTLVEIVPYAGLQFGTYDTFKRWTMMLNQFRSSSE 219



>gi|363814342|ref|NP_001242812.1| uncharacterized protein LOC100805353 [Glycine max]
 gi|255637169|gb|ACU18915.1| unknown [Glycine max]
          Length = 327

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 118/313 (37%), Positives = 181/313 (57%), Gaps = 13/313 (4%)

Query: 34  GAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIREE 93
           GA++G +SR V SPLDV+KIR Q+Q   P +  +    +     KY GM  A K I+REE
Sbjct: 17  GAISGGISRTVTSPLDVIKIRFQVQL-EPTSSWALLRKDLAAASKYTGMFQATKDILREE 75

Query: 94  GIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGAIS 153
           G++G W GN+ A  + + Y A+QF   H+++  F    S       ++  L  +LSGA++
Sbjct: 76  GVQGFWRGNVPALLMVMPYTAIQFTVLHKLKT-FASGSSKSENHINLSPCLS-YLSGALA 133

Query: 154 GSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPY 213
           G  AT+ +YPFDLLRT  A+QGE ++Y  +R+A   I    G++G Y G++ ++V+IIPY
Sbjct: 134 GCAATLGSYPFDLLRTILASQGEPKVYPNMRSAFMDIIHTRGFQGLYSGLSPTLVEIIPY 193

Query: 214 MGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDL------LSGAIAGIVSKAGVFPLDLV 267
            GL FG+Y+ LK+       +   + N  A ++L      L G  AG  +K    PLD+V
Sbjct: 194 AGLQFGTYDTLKRWGMAWNHR---YSNTSAEDNLSSFQLFLCGLAAGTCAKLVCHPLDVV 250

Query: 268 RKRLQVQGPNRKDYFISNVPLYS-SSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAV 326
           +KR Q++G  R   + + V   +  ++   +++I R +G  GLYKG++P+ +K+AP  AV
Sbjct: 251 KKRFQIEGLQRHPRYGARVEHRAYRNMPDAMQRIFRLEGWAGLYKGIIPSTVKAAPAGAV 310

Query: 327 TFFVYGYTKRLLE 339
           TF  Y  T   LE
Sbjct: 311 TFVAYELTSDWLE 323



 Score = 88.6 bits (218), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 92/209 (44%), Gaps = 39/209 (18%)

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRI--------------YIGLRNAVQQIYVQE 194
           +GAISG  +  VT P D+++ RF  Q E                 Y G+  A + I  +E
Sbjct: 16  AGAISGGISRTVTSPLDVIKIRFQVQLEPTSSWALLRKDLAAASKYTGMFQATKDILREE 75

Query: 195 GYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLF--RKLEDKHIWFHNLRATEDLLSGAI 252
           G +GF+RG   +++ ++PY  + F     LK         + HI   NL      LSGA+
Sbjct: 76  GVQGFWRGNVPALLMVMPYTAIQFTVLHKLKTFASGSSKSENHI---NLSPCLSYLSGAL 132

Query: 253 AGIVSKAGVFPLDLVRKRLQVQG-----PNRKDYFISNVPLYSSSIFICIKQILRSDGIF 307
           AG  +  G +P DL+R  L  QG     PN +  F+                I+ + G  
Sbjct: 133 AGCAATLGSYPFDLLRTILASQGEPKVYPNMRSAFM---------------DIIHTRGFQ 177

Query: 308 GLYKGLMPALIKSAPVSAVTFFVYGYTKR 336
           GLY GL P L++  P + + F  Y   KR
Sbjct: 178 GLYSGLSPTLVEIIPYAGLQFGTYDTLKR 206



>gi|339259078|ref|XP_003369725.1| conserved hypothetical protein [Trichinella spiralis]
 gi|316965951|gb|EFV50587.1| conserved hypothetical protein [Trichinella spiralis]
          Length = 337

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 119/329 (36%), Positives = 181/329 (55%), Gaps = 9/329 (2%)

Query: 18  QAVAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLK 77
           Q     +L+S E  I G V+G+ +R +  P DV+KIR QLQ    + P+  +HH  G   
Sbjct: 7   QTKEDERLTSAEYSIAGCVSGIFARALCQPFDVLKIRFQLQ----LEPIR-KHHAHG--- 58

Query: 78  KYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEK 137
           KY G+  A   II+EEG + LW G++ A+ L L+YG +QFL+Y  +     R+   +   
Sbjct: 59  KYFGLFQAANTIIKEEGWKSLWKGHMPAQGLSLTYGLIQFLSYELLTEKAFRVIPEEWSS 118

Query: 138 FGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYR 197
              ++ L  F  GA+SG+ A  V  PFD++RTR  AQGE +I+   R+A + ++  EG+ 
Sbjct: 119 SAQSRILVSFSCGALSGTLANTVALPFDVIRTRLVAQGEPKIFHNSRHAAKMMFKNEGFA 178

Query: 198 GFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVS 257
            FYRG+T +++QI PY GL+F  YE  +  + K    HI       T+ ++ G  AG+ +
Sbjct: 179 SFYRGLTPALLQIAPYSGLIFSFYELSQTFWNKFIFDHISNSTNDVTKAIVCGGAAGVAA 238

Query: 258 KAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPAL 317
           K+ ++PLD+++KRLQV G  +          YS  +  CI   +  +G  GLYKG +P++
Sbjct: 239 KSLLYPLDVLKKRLQVVGFEQARTSFGRTFHYSGFVH-CIISTVVQEGYTGLYKGFLPSI 297

Query: 318 IKSAPVSAVTFFVYGYTKRLLEKLHSSRD 346
           +K+A  SA  FF Y  T  L        D
Sbjct: 298 LKAAASSACGFFFYEQTCNLFRSSRKRND 326



>gi|354466489|ref|XP_003495706.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like
           [Cricetulus griseus]
 gi|344236248|gb|EGV92351.1| Mitochondrial thiamine pyrophosphate carrier [Cricetulus griseus]
          Length = 318

 Score =  211 bits (537), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 124/311 (39%), Positives = 183/311 (58%), Gaps = 26/311 (8%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGR--PINPLSSRHHNSGTLKKYNGMS 83
           S +E+ + G+V+G V+R + SPLDV+KIR QLQ  R  P +P +          KY+G+ 
Sbjct: 14  SKLEVAVAGSVSGFVTRALISPLDVIKIRFQLQIERLCPSDPKA----------KYHGIL 63

Query: 84  HAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKT 143
            AIK I++EEG    W G++ A+ L + YGAVQFLT+ ++  L  RI+  +  +F  +  
Sbjct: 64  QAIKQILQEEGPAAFWKGHVPAQILSVGYGAVQFLTFEELTELLHRINLYETRQFSAH-- 121

Query: 144 LQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGV 203
              F+ G +S   AT+  +P D+LRTR AAQGE +IY  LR+AV  +Y  EG   FY+G+
Sbjct: 122 ---FVCGGLSAGAATLAVHPVDVLRTRLAAQGEPKIYSNLRDAVSTMYRTEGPLVFYKGL 178

Query: 204 TASVVQIIPYMGLVFGSYEFLKKLFRKL---EDKHIWFHNLRATEDLLSGAIAGIVSKAG 260
           T +V+ I PY GL F  Y  LK+++  +   + K     NL+   +LL G  +G++SK  
Sbjct: 179 TPTVIAIFPYAGLQFSCYRSLKQVYDWVIPPDGKQT--GNLK---NLLCGCGSGVISKTL 233

Query: 261 VFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKS 320
            +PLDL +KRLQV G  R       V  Y   + +  KQ+L+ +G  GL+KGL P+L+K+
Sbjct: 234 TYPLDLFKKRLQVGGFERARSAFGEVRSYRGLLDL-TKQVLQDEGTQGLFKGLSPSLLKA 292

Query: 321 APVSAVTFFVY 331
           A  +   FF Y
Sbjct: 293 ALSTGFMFFWY 303



>gi|465950371|gb|EMP23805.1| Mitochondrial thiamine pyrophosphate carrier [Chelonia mydas]
          Length = 321

 Score =  211 bits (536), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 119/320 (37%), Positives = 179/320 (55%), Gaps = 16/320 (5%)

Query: 25  LSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSH 84
           +S++E+ + G+ +G V+R + SP+DV+KIR QLQ    I  LS R+     L KY G+  
Sbjct: 13  ISAVEVAVAGSASGFVTRALISPVDVIKIRFQLQ----IEQLSPRN----PLAKYYGILQ 64

Query: 85  AIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTL 144
               I  EEG    W G++ A+ L +SYGAVQF+T+  +  L     S     +     +
Sbjct: 65  TAHRICHEEGPTAFWKGHVPAQLLSVSYGAVQFVTFECLTELVHNATS-----YNTRNCI 119

Query: 145 QPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVT 204
             F+ G ++  TAT+   P D LRTRFAAQGE ++Y  LR+AV  +Y  EG   FYRG+T
Sbjct: 120 VHFVCGGLAACTATMTVQPLDTLRTRFAAQGEPKVYRNLRHAVVTMYQTEGPLTFYRGLT 179

Query: 205 ASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPL 264
            +++ + PY GL F  Y  L++L++ +        N    ++L+ G+ AG++SK   +P 
Sbjct: 180 PTIIAVFPYAGLQFSVYNLLQQLYKWMMPSE--GRNAGNVKNLVCGSCAGVISKTLTYPF 237

Query: 265 DLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVS 324
           DL +KRLQV G  +       V  Y   +  C  QI+R +G  GL+KGL P+L+K+A  +
Sbjct: 238 DLFKKRLQVGGFEQARAAFGQVRTY-KGLMDCAGQIVREEGPVGLFKGLSPSLLKAALST 296

Query: 325 AVTFFVYGYTKRLLEKLHSS 344
             TFF Y +   LL  L ++
Sbjct: 297 GFTFFWYEFFCNLLYALKNT 316



>gi|395826864|ref|XP_003786634.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Otolemur
           garnettii]
          Length = 321

 Score =  211 bits (536), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 125/315 (39%), Positives = 178/315 (56%), Gaps = 33/315 (10%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           S +E+ + G+V+G+V+R + SPLDV+KIR QLQ    I  LS  H+N G   KY G+  A
Sbjct: 14  SKVEVAVAGSVSGLVTRALISPLDVIKIRFQLQ----IERLS--HNNPGA--KYRGIRQA 65

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQ 145
           I  I++EEG    W G++ A+ L + +GAVQFL++  +  L  R +   N +F ++    
Sbjct: 66  IMQILQEEGPTAFWKGHIPAQLLSIGFGAVQFLSFEMLTELVHRANMYNNHEFSMH---- 121

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTA 205
            F+ G +S   AT+  +P D+LRTRFAAQGE R+Y  L+ AV  ++  EG   FY+G+  
Sbjct: 122 -FICGGLSAGMATLTVHPVDVLRTRFAAQGEPRVYKTLQEAVVTMFRTEGPLVFYKGLNP 180

Query: 206 SVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATED---------LLSGAIAGIV 256
           +++ I PY GL F  Y  LK+ +        W   L  T D         LL G+ AG++
Sbjct: 181 TLIAIFPYAGLQFSCYNSLKQAYE-------W---LMPTTDGKKSGNFKNLLCGSGAGVI 230

Query: 257 SKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPA 316
           SK   +PLDL +KRLQV G          V  Y   +  C KQIL+ +G  GL+KGL P+
Sbjct: 231 SKTLTYPLDLFKKRLQVGGFEHARVAFGQVRHY-RGLVDCAKQILKEEGSLGLFKGLTPS 289

Query: 317 LIKSAPVSAVTFFVY 331
           L+KSA  +   FF Y
Sbjct: 290 LLKSALSTGFMFFWY 304



>gi|224107339|ref|XP_002314452.1| predicted protein [Populus trichocarpa]
 gi|222863492|gb|EEF00623.1| predicted protein [Populus trichocarpa]
          Length = 339

 Score =  211 bits (536), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 119/322 (36%), Positives = 181/322 (56%), Gaps = 23/322 (7%)

Query: 34  GAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIREE 93
           GA+AG +SR V SPLDV+KIR Q+Q   P +  +    N     KY GM  A K I REE
Sbjct: 25  GAIAGGISRTVTSPLDVIKIRFQVQL-EPTSLWALVRSNVTAPSKYTGMLQATKDIFREE 83

Query: 94  GIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGAIS 153
           G+ G W GN+ A  + + Y A+QF   H+++  F    S   +   ++  L  + SGA++
Sbjct: 84  GLPGFWRGNVPALLMVMPYTAIQFAVLHKLKT-FAAGSSKTEDHIQLSPYLS-YASGALA 141

Query: 154 GSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPY 213
           G  AT+ +YPFDLLRT  A+QGE ++Y  +R+A   I    G+RG Y G++ ++V+I+PY
Sbjct: 142 GCAATVGSYPFDLLRTILASQGEPKVYPTMRSAFVDIVRTRGFRGLYAGLSPTLVEIVPY 201

Query: 214 MGLVFGSYEFLKKLFRKLEDKHIWFH-------------NLRATEDLLSGAIAGIVSKAG 260
            GL FG+Y+  K+          W H             NL + +  + G  AG  +K  
Sbjct: 202 AGLQFGTYDTFKRW------TMAWNHHKSSSTSSISTDDNLSSFQLFICGLAAGTCAKLV 255

Query: 261 VFPLDLVRKRLQVQGPNRKDYFISNVPLYS-SSIFICIKQILRSDGIFGLYKGLMPALIK 319
             PLD+V+KR Q++G  R   +   V   +  ++F  +++IL+++G  GLYKG++P+ +K
Sbjct: 256 CHPLDVVKKRFQIEGLQRHPKYGGRVEHRAYRNMFDALRRILQTEGWAGLYKGIVPSTVK 315

Query: 320 SAPVSAVTFFVYGYTKRLLEKL 341
           +AP  AVTF  Y +T   LE +
Sbjct: 316 AAPAGAVTFVAYEFTSDWLESI 337



 Score = 85.9 bits (211), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 65/219 (29%), Positives = 95/219 (43%), Gaps = 41/219 (18%)

Query: 140 INKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRI--------------YIGLRN 185
           I + L    +GAI+G  +  VT P D+++ RF  Q E                 Y G+  
Sbjct: 15  IKRALIDATAGAIAGGISRTVTSPLDVIKIRFQVQLEPTSLWALVRSNVTAPSKYTGMLQ 74

Query: 186 AVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLF---RKLEDKHIWFHNLR 242
           A + I+ +EG  GF+RG   +++ ++PY  + F     LK       K ED HI    L 
Sbjct: 75  ATKDIFREEGLPGFWRGNVPALLMVMPYTAIQFAVLHKLKTFAAGSSKTED-HI---QLS 130

Query: 243 ATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQG-----PNRKDYFISNVPLYSSSIFICI 297
                 SGA+AG  +  G +P DL+R  L  QG     P  +  F+              
Sbjct: 131 PYLSYASGALAGCAATVGSYPFDLLRTILASQGEPKVYPTMRSAFV-------------- 176

Query: 298 KQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGYTKR 336
             I+R+ G  GLY GL P L++  P + + F  Y   KR
Sbjct: 177 -DIVRTRGFRGLYAGLSPTLVEIVPYAGLQFGTYDTFKR 214



>gi|460366721|ref|XP_004229228.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like
           [Solanum lycopersicum]
          Length = 331

 Score =  210 bits (535), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 122/324 (37%), Positives = 186/324 (57%), Gaps = 31/324 (9%)

Query: 34  GAVAGMVSRFVASPLDVVKIRLQLQPGRPINP-----LSSRHHNSGTLKKYNGMSHAIKL 88
           GA++G +SR V SPLDV+KIR Q+Q    + P     L +R     +  KY GM  A K 
Sbjct: 17  GAISGGISRTVTSPLDVIKIRFQVQ----LEPTTQWALLTRTVCGNSNSKYTGMLQASKD 72

Query: 89  IIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFL 148
           I+REEG+ G W GN+ A  + + Y A+QF   H++++ F    S   +   ++  L  ++
Sbjct: 73  ILREEGLPGFWRGNVPALLMVMPYTAIQFAVLHKLKS-FASGSSKSEDHVNLSPYLS-YI 130

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVV 208
           SGA++G  AT+ +YPFDLLRT  A+QGE ++Y  +R A   I+   G RG Y G+T ++V
Sbjct: 131 SGALAGCAATVGSYPFDLLRTILASQGEPKVYPNMRAASVDIFRTRGIRGLYSGLTPTLV 190

Query: 209 QIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDL------------LSGAIAGIV 256
           +I+PY GL FG+Y+  K+          W H LR++  +            + G  AG  
Sbjct: 191 EIVPYAGLQFGTYDTFKRWMMA------WNH-LRSSNAIHGDEQVSSFQLFICGLAAGTC 243

Query: 257 SKAGVFPLDLVRKRLQVQGPNRKDYFISNV-PLYSSSIFICIKQILRSDGIFGLYKGLMP 315
           +KA   PLD+V+KR Q++G  R   + + + P    +++  +++IL  +G  GLYKG++P
Sbjct: 244 AKAVCHPLDVVKKRFQIEGLQRHPRYGAQLKPHAYKNMYDGLRRILIEEGWAGLYKGIVP 303

Query: 316 ALIKSAPVSAVTFFVYGYTKRLLE 339
           ++IK+AP  AVTF  Y YT   LE
Sbjct: 304 SVIKAAPAGAVTFVAYEYTSDWLE 327



 Score = 89.0 bits (219), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 66/209 (31%), Positives = 95/209 (45%), Gaps = 33/209 (15%)

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGEKRI----------------YIGLRNAVQQIYV 192
           +GAISG  +  VT P D+++ RF  Q E                   Y G+  A + I  
Sbjct: 16  AGAISGGISRTVTSPLDVIKIRFQVQLEPTTQWALLTRTVCGNSNSKYTGMLQASKDILR 75

Query: 193 QEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLF---RKLEDKHIWFHNLRATEDLLS 249
           +EG  GF+RG   +++ ++PY  + F     LK       K ED H+   NL      +S
Sbjct: 76  EEGLPGFWRGNVPALLMVMPYTAIQFAVLHKLKSFASGSSKSED-HV---NLSPYLSYIS 131

Query: 250 GAIAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGL 309
           GA+AG  +  G +P DL+R  L  QG  +      N+   S  IF       R+ GI GL
Sbjct: 132 GALAGCAATVGSYPFDLLRTILASQGEPK---VYPNMRAASVDIF-------RTRGIRGL 181

Query: 310 YKGLMPALIKSAPVSAVTFFVYGYTKRLL 338
           Y GL P L++  P + + F  Y   KR +
Sbjct: 182 YSGLTPTLVEIVPYAGLQFGTYDTFKRWM 210



>gi|291413456|ref|XP_002722987.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like
           [Oryctolagus cuniculus]
          Length = 318

 Score =  210 bits (534), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 121/315 (38%), Positives = 179/315 (56%), Gaps = 32/315 (10%)

Query: 25  LSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSH 84
           +S IE+ + G+V+G+V+R + SPLDV+KIR QLQ    I  LS R   +    KY+ +  
Sbjct: 13  ISKIEVAVAGSVSGLVTRALISPLDVIKIRFQLQ----IERLSRRDPGA----KYHSILQ 64

Query: 85  AIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTL 144
           A + I+REEG    W G++ A+ L + YGAVQFL++  +  L  R  ++   +F ++   
Sbjct: 65  ATRQILREEGPTAFWKGHIPAQLLSVGYGAVQFLSFELLTELVHRATAHDAREFSVH--- 121

Query: 145 QPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVT 204
             F+ G +S   AT+  +P D+LRTRFAAQGE R+Y  LR+AV  ++  EG   FY+G+T
Sbjct: 122 --FVCGGLSACMATLTVHPVDVLRTRFAAQGEPRVYRTLRDAVVTMHRTEGPSVFYKGLT 179

Query: 205 ASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWF--------HNLRATEDLLSGAIAGIV 256
            +++ I PY G  F  Y FLK           W          NLR   +LL G  AG+V
Sbjct: 180 PTLIAIFPYAGFQFSCYSFLK-------SASDWVVPASGKQNENLR---NLLCGCGAGVV 229

Query: 257 SKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPA 316
           SK   +PLDL +KRLQV G  +       V  Y   ++ C +++L+ +G  G +KGL P+
Sbjct: 230 SKTLTYPLDLFKKRLQVGGFEQARATFGQVRRY-RGLWDCAQRVLQEEGAQGFFKGLAPS 288

Query: 317 LIKSAPVSAVTFFVY 331
           L+K+A  + + FF Y
Sbjct: 289 LLKAALSTGLVFFWY 303



>gi|66773796|sp|Q5IS35.1|TPC_MACFA RecName: Full=Mitochondrial thiamine pyrophosphate carrier;
           AltName: Full=Solute carrier family 25 member 19
 gi|56122360|gb|AAV74331.1| mitochondrial solute carrier family 25 member 19 [Macaca
           fascicularis]
 gi|355568915|gb|EHH25196.1| hypothetical protein EGK_08976 [Macaca mulatta]
 gi|355754375|gb|EHH58340.1| hypothetical protein EGM_08166 [Macaca fascicularis]
          Length = 320

 Score =  210 bits (534), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 189/331 (57%), Gaps = 29/331 (8%)

Query: 4   GYEHKPQNQSPIAEQAVAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPI 63
           GY+ KP  ++            + +++ + G+V+G+V+R + SP DV+KIR QLQ  R  
Sbjct: 3   GYDPKPDGRNN-----------TKLQVAVAGSVSGLVTRALISPFDVIKIRFQLQHER-- 49

Query: 64  NPLSSRHHNSGTLKKYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQM 123
             LS R  N+    KY+G+  A + I++EEG+   W G++ A+ L + YGAVQFL++  +
Sbjct: 50  --LSRRDPNA----KYHGIFQASRQILQEEGLTAFWKGHIPAQILSIGYGAVQFLSFEML 103

Query: 124 QNLFKRIDSNQNEKFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGL 183
             L  R       +F ++     F+ G ++  TAT+  +P D+LRTRFAAQGE ++Y  L
Sbjct: 104 TELVHRGSVYDAREFSVH-----FVCGGLAACTATLTVHPVDVLRTRFAAQGEPKVYNTL 158

Query: 184 RNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFR-KLEDKHIWFHNLR 242
           R+AV  +Y  EG + FY+G+  +++ I PY GL F  Y  LK L++  +  +     NL 
Sbjct: 159 RHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAMPAEGKKNENL- 217

Query: 243 ATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILR 302
             ++LL G+ AG++SK   +PLDL +KRLQV G          V  Y   +  C KQ+L+
Sbjct: 218 --QNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRY-KGLMDCAKQVLQ 274

Query: 303 SDGIFGLYKGLMPALIKSAPVSAVTFFVYGY 333
            +G  G +KGL P+L+K+A  +   FF Y +
Sbjct: 275 KEGALGFFKGLSPSLLKAALSTGFMFFWYEF 305



 Score = 92.0 bits (227), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 58/209 (27%), Positives = 97/209 (46%), Gaps = 27/209 (12%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIR 91
           +CG +A   +     P+DV++ R   Q G P              K YN + HA+  + R
Sbjct: 123 VCGGLAACTATLTVHPVDVLRTRFAAQ-GEP--------------KVYNTLRHAVGTMYR 167

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGA 151
            EG +  + G          Y  +QF  Y  +++L+K     + +K   N+ LQ  L G+
Sbjct: 168 SEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAMPAEGKK---NENLQNLLCGS 224

Query: 152 ISGSTATIVTYPFDLLRTRF---------AAQGEKRIYIGLRNAVQQIYVQEGYRGFYRG 202
            +G  +  +TYP DL + R          AA G+ R Y GL +  +Q+  +EG  GF++G
Sbjct: 225 GAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKG 284

Query: 203 VTASVVQIIPYMGLVFGSYEFLKKLFRKL 231
           ++ S+++     G +F  YEF   +F  +
Sbjct: 285 LSPSLLKAALSTGFMFFWYEFFCNVFHCM 313



>gi|482549474|gb|EOA13668.1| hypothetical protein CARUB_v10026741mg [Capsella rubella]
          Length = 338

 Score =  210 bits (534), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 121/320 (37%), Positives = 183/320 (57%), Gaps = 17/320 (5%)

Query: 33  CGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLK---KYNGMSHAIKLI 89
            GAV+G VSR V SPLDV+KIR Q+Q    + P +S     G L    KY GM  A K I
Sbjct: 23  AGAVSGGVSRTVTSPLDVIKIRFQVQ----LEPTTSWGLVRGNLSGASKYTGMVQATKDI 78

Query: 90  IREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLS 149
            REEG RG W GN+ A  + + Y ++QF   H++++ F    +   +   ++  L  F+S
Sbjct: 79  FREEGFRGFWRGNVPALLMVMPYTSIQFTVLHKLKS-FASGSTKTEDHIHLSPYLS-FVS 136

Query: 150 GAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQ 209
           GA++G  AT+ +YPFDLLRT  A+QGE ++Y  +R+A   I    G RG Y G+T ++V+
Sbjct: 137 GALAGCAATLGSYPFDLLRTILASQGEPKVYPTMRSAFVDIIQSRGIRGMYNGLTPTLVE 196

Query: 210 IIPYMGLVFGSYEFLKKLFRKLEDKHIWFH-------NLRATEDLLSGAIAGIVSKAGVF 262
           I+PY GL FG+Y+  K+        ++          NL + +  + G  AG  +K    
Sbjct: 197 IVPYAGLQFGTYDMFKRWMMDWNRYNLSSKTPINVDTNLSSFQLFVCGLGAGTSAKLVCH 256

Query: 263 PLDLVRKRLQVQGPNRKDYFISNVPLYS-SSIFICIKQILRSDGIFGLYKGLMPALIKSA 321
           PLD+V+KR Q++G  R   + + V   +  ++   ++QI+ S+G  GLYKG++P+ +K+A
Sbjct: 257 PLDVVKKRFQIEGLQRHPRYGARVERRAYRNMLDGLRQIMISEGWHGLYKGIVPSTVKAA 316

Query: 322 PVSAVTFFVYGYTKRLLEKL 341
           P  AVTF  Y +T   LE +
Sbjct: 317 PAGAVTFVAYEFTSDWLESI 336



 Score = 94.0 bits (232), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 66/221 (29%), Positives = 101/221 (45%), Gaps = 41/221 (18%)

Query: 140 INKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRI--------------YIGLRN 185
           I + L    +GA+SG  +  VT P D+++ RF  Q E                 Y G+  
Sbjct: 14  IKRALIDASAGAVSGGVSRTVTSPLDVIKIRFQVQLEPTTSWGLVRGNLSGASKYTGMVQ 73

Query: 186 AVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFR---KLEDKHIWFHNLR 242
           A + I+ +EG+RGF+RG   +++ ++PY  + F     LK       K ED HI   +L 
Sbjct: 74  ATKDIFREEGFRGFWRGNVPALLMVMPYTSIQFTVLHKLKSFASGSTKTED-HI---HLS 129

Query: 243 ATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQG-----PNRKDYFISNVPLYSSSIFICI 297
                +SGA+AG  +  G +P DL+R  L  QG     P  +  F+              
Sbjct: 130 PYLSFVSGALAGCAATLGSYPFDLLRTILASQGEPKVYPTMRSAFV-------------- 175

Query: 298 KQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGYTKRLL 338
             I++S GI G+Y GL P L++  P + + F  Y   KR +
Sbjct: 176 -DIIQSRGIRGMYNGLTPTLVEIVPYAGLQFGTYDMFKRWM 215



>gi|449019328|dbj|BAM82730.1| probable mitochondrial carrier protein [Cyanidioschyzon merolae
           strain 10D]
          Length = 338

 Score =  209 bits (533), Expect = 7e-52,   Method: Compositional matrix adjust.
 Identities = 123/334 (36%), Positives = 186/334 (55%), Gaps = 34/334 (10%)

Query: 22  ASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNG 81
           A +L   +  + GAVAG  SRF  +PLDV+KIR QLQ  + +              +Y  
Sbjct: 6   AERLEPWKDLLAGAVAGCASRFAVAPLDVLKIRFQLQHEQRVLQAWGLGDAPAVHARYTS 65

Query: 82  MSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGIN 141
           +S A   II+EEG   L+ GN+ A  +   Y AVQF T++Q++  + ++        G N
Sbjct: 66  VSQAFGRIIKEEGWTALYKGNVPALAMVAPYAAVQFGTFYQLRQWWNQLSE------GDN 119

Query: 142 KTLQPFLS-------GAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQE 194
           ++LQ ++        GA+SG  A++  YP DLLRTR A Q E R+Y GL +AV+ I+ +E
Sbjct: 120 RSLQRYMGATPSVIFGALSGLVASVTVYPLDLLRTRMAVQSEPRLYTGLVDAVRTIWRKE 179

Query: 195 GYRGFYRGVTASVVQIIPYMGLVFGSYEFL------KKLFRKLE-----DKHIWFHNLRA 243
           G RGFY G+  +V++I+PY+ L F  YE L      K L ++        +H     +R+
Sbjct: 180 GLRGFYAGLGPTVIEIVPYVALQFYIYEHLRHYQARKNLAQRSSGSGALSEH---EAVRS 236

Query: 244 TEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRS 303
           +E  L GA+ G  +K    PLD  RKR+QVQ        I++ P    +   C+ +I R+
Sbjct: 237 SESFLIGALTGTTAKWCTLPLDNARKRMQVQS-------ITDGPRVYRNTVDCLWRITRA 289

Query: 304 DGIFGLYKGLMPALIKSAPVSAVTFFVYGYTKRL 337
           +G+ GL++G +P+L+K+AP S V FFVY + K+L
Sbjct: 290 EGVRGLFRGAVPSLLKAAPASGVAFFVYEWMKKL 323



 Score = 88.2 bits (217), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 60/207 (28%), Positives = 100/207 (48%), Gaps = 25/207 (12%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIR 91
           I GA++G+V+     PLD+++ R+ +Q                  + Y G+  A++ I R
Sbjct: 133 IFGALSGLVASVTVYPLDLLRTRMAVQ---------------SEPRLYTGLVDAVRTIWR 177

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQM------QNLFKRID-SNQNEKFGINKTL 144
           +EG+RG + G        + Y A+QF  Y  +      +NL +R   S    +    ++ 
Sbjct: 178 KEGLRGFYAGLGPTVIEIVPYVALQFYIYEHLRHYQARKNLAQRSSGSGALSEHEAVRSS 237

Query: 145 QPFLSGAISGSTATIVTYPFDLLRTRFAAQG---EKRIYIGLRNAVQQIYVQEGYRGFYR 201
           + FL GA++G+TA   T P D  R R   Q      R+Y    + + +I   EG RG +R
Sbjct: 238 ESFLIGALTGTTAKWCTLPLDNARKRMQVQSITDGPRVYRNTVDCLWRITRAEGVRGLFR 297

Query: 202 GVTASVVQIIPYMGLVFGSYEFLKKLF 228
           G   S+++  P  G+ F  YE++KKL+
Sbjct: 298 GAVPSLLKAAPASGVAFFVYEWMKKLW 324



>gi|356521873|ref|XP_003529575.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like
           [Glycine max]
          Length = 331

 Score =  209 bits (532), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 122/328 (37%), Positives = 183/328 (55%), Gaps = 35/328 (10%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRH-------HNSGTLKKYNGMSH 84
           + GA++G +SR V SPLDV+KIR Q+Q    + P SS           +    KY GM  
Sbjct: 15  LAGAISGGISRTVTSPLDVIKIRFQVQ----LEPTSSWALLRKDLASATAAASKYTGMLQ 70

Query: 85  AIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTL 144
           A K I+REEG++G W GN+ A  + + Y A+QF   H+++         +N    IN  L
Sbjct: 71  ATKDILREEGVQGFWRGNVPALLMVMPYTAIQFTVLHKLKTFASGSSKTENH---IN--L 125

Query: 145 QPFLS---GAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYR 201
            P+LS   GA++G  AT+ +YPFDLLRT  A+QGE ++Y  +R+A   I    G++G Y 
Sbjct: 126 SPYLSYISGALAGCAATVGSYPFDLLRTILASQGEPKVYPNMRSAFMDIVHTRGFQGLYS 185

Query: 202 GVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFH---------NLRATEDLLSGAI 252
           G++ ++V+IIPY GL FG+Y+  K+          W H         NL + +  L G  
Sbjct: 186 GLSPTLVEIIPYAGLQFGTYDTFKRW------GMAWNHRYSNTAAEDNLSSFQLFLCGLA 239

Query: 253 AGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYS-SSIFICIKQILRSDGIFGLYK 311
           AG  +K    PLD+V+KR Q++G  R   + + V   +  ++   +++IL+ +G  GLYK
Sbjct: 240 AGTCAKLVCHPLDVVKKRFQIEGLQRHPRYGARVEHRAYRNMLDAMQRILQLEGWAGLYK 299

Query: 312 GLMPALIKSAPVSAVTFFVYGYTKRLLE 339
           G++P+ +K+AP  AVTF  Y  T   LE
Sbjct: 300 GIIPSTVKAAPAGAVTFVAYELTSDWLE 327



>gi|296203170|ref|XP_002748776.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform 1
           [Callithrix jacchus]
          Length = 320

 Score =  209 bits (532), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 123/331 (37%), Positives = 187/331 (56%), Gaps = 29/331 (8%)

Query: 4   GYEHKPQNQSPIAEQAVAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPI 63
           GY+ KP  ++            +  ++ + G+V+G+V+R + SP DV+KIR QLQ  R  
Sbjct: 3   GYDPKPDGRNN-----------TRFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHER-- 49

Query: 64  NPLSSRHHNSGTLKKYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQM 123
             LS +  N+    KY+G+  AI+ I++EEG    W G++ A+ L + YGAVQFL++  +
Sbjct: 50  --LSHKDPNA----KYHGILQAIRRILQEEGPTAFWKGHIPAQILSIGYGAVQFLSFEML 103

Query: 124 QNLFKRIDSNQNEKFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGL 183
             L  R      ++F ++     F+ G +S   AT+  +P D+LRTRFAAQGE ++Y  L
Sbjct: 104 TELVHRGSLYDAQEFSVH-----FVCGGLSACMATLTVHPVDVLRTRFAAQGEPKVYNTL 158

Query: 184 RNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFR-KLEDKHIWFHNLR 242
           R+AV  +Y  EG   FY+G+T +V+ I PY GL F  Y  LK ++   +  +     NL+
Sbjct: 159 RHAVGTMYRNEGPLVFYKGLTPTVIAIFPYAGLQFSCYSSLKHMYEWAMPTEGKKNENLK 218

Query: 243 ATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILR 302
              +LL G+ AGI+SK   +PLDL +KRLQV G          V  Y   +  C KQ+L+
Sbjct: 219 ---NLLCGSGAGIISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRKY-KGLVDCTKQVLQ 274

Query: 303 SDGIFGLYKGLMPALIKSAPVSAVTFFVYGY 333
            +G  G +KGL P+L+K+A  +   FF Y +
Sbjct: 275 EEGTLGFFKGLSPSLLKAALSTGFMFFWYEF 305



 Score = 87.0 bits (214), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 54/209 (25%), Positives = 97/209 (46%), Gaps = 27/209 (12%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIR 91
           +CG ++  ++     P+DV++ R   Q G P              K YN + HA+  + R
Sbjct: 123 VCGGLSACMATLTVHPVDVLRTRFAAQ-GEP--------------KVYNTLRHAVGTMYR 167

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGA 151
            EG    + G          Y  +QF  Y  ++++++     + +K   N+ L+  L G+
Sbjct: 168 NEGPLVFYKGLTPTVIAIFPYAGLQFSCYSSLKHMYEWAMPTEGKK---NENLKNLLCGS 224

Query: 152 ISGSTATIVTYPFDLLRTRF---------AAQGEKRIYIGLRNAVQQIYVQEGYRGFYRG 202
            +G  +  +TYP DL + R          AA G+ R Y GL +  +Q+  +EG  GF++G
Sbjct: 225 GAGIISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRKYKGLVDCTKQVLQEEGTLGFFKG 284

Query: 203 VTASVVQIIPYMGLVFGSYEFLKKLFRKL 231
           ++ S+++     G +F  YEF   +F  +
Sbjct: 285 LSPSLLKAALSTGFMFFWYEFFCNVFHCM 313



>gi|483522006|gb|EOB06890.1| Mitochondrial deoxynucleotide carrier, partial [Anas platyrhynchos]
          Length = 293

 Score =  209 bits (532), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 118/310 (38%), Positives = 175/310 (56%), Gaps = 26/310 (8%)

Query: 40  VSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIREEGIRGLW 99
           V+R + SPLDV+KIR QLQ    I  LSSR   +    KY+G+  A++ I +EEG+   W
Sbjct: 1   VTRVLVSPLDVIKIRFQLQ----IEQLSSRTPGA----KYHGILQAVQRIFQEEGLGAFW 52

Query: 100 NGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGAISGSTATI 159
            G++ A++L + YGAVQF+ +  +  L   + S     +    +   F+ G ++  TAT+
Sbjct: 53  KGHVPAQFLSVGYGAVQFMAFESLTKLVHNVTS-----YNARDSFVHFICGGLAACTATV 107

Query: 160 VTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFG 219
              P D LRTRFAAQGE ++Y  LR+AV  +Y  EG R FYRG+T +++ I PY GL F 
Sbjct: 108 AVQPVDTLRTRFAAQGEPKVYHNLRHAVVTMYQTEGPRTFYRGLTPTIIAIFPYAGLQFS 167

Query: 220 SYEFLKKLFRKLEDKHIWFHNLRATE-----DLLSGAIAGIVSKAGVFPLDLVRKRLQVQ 274
            Y  LK+L         W       E     +L+ G+ AGI+SK   +P DL++KRLQV 
Sbjct: 168 FYNTLKQLSE-------WMIPAEGKEGGNVKNLVCGSCAGIISKTLTYPFDLIKKRLQVG 220

Query: 275 GPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGYT 334
           G  R       V +Y   +  C++Q++R +G+ G +KGL P+L+K+A  + + FF Y   
Sbjct: 221 GFERARAAFGQVRMY-RGLLDCLRQVMREEGLGGFFKGLSPSLLKAAVSTGLVFFSYELF 279

Query: 335 KRLLEKLHSS 344
             LL  L ++
Sbjct: 280 CSLLCALKNT 289



 Score = 88.2 bits (217), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 101/211 (47%), Gaps = 27/211 (12%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIR 91
           ICG +A   +     P+D ++ R   Q G P              K Y+ + HA+  + +
Sbjct: 96  ICGGLAACTATVAVQPVDTLRTRFAAQ-GEP--------------KVYHNLRHAVVTMYQ 140

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGA 151
            EG R  + G          Y  +QF  Y+ ++ L + +   + ++ G  K L   + G+
Sbjct: 141 TEGPRTFYRGLTPTIIAIFPYAGLQFSFYNTLKQLSEWMIPAEGKEGGNVKNL---VCGS 197

Query: 152 ISGSTATIVTYPFDLLRTRF---------AAQGEKRIYIGLRNAVQQIYVQEGYRGFYRG 202
            +G  +  +TYPFDL++ R          AA G+ R+Y GL + ++Q+  +EG  GF++G
Sbjct: 198 CAGIISKTLTYPFDLIKKRLQVGGFERARAAFGQVRMYRGLLDCLRQVMREEGLGGFFKG 257

Query: 203 VTASVVQIIPYMGLVFGSYEFLKKLFRKLED 233
           ++ S+++     GLVF SYE    L   L++
Sbjct: 258 LSPSLLKAAVSTGLVFFSYELFCSLLCALKN 288



>gi|15239754|ref|NP_199708.1| mitochondrial substrate carrier family protein [Arabidopsis
           thaliana]
 gi|10177187|dbj|BAB10321.1| mitochondrial carrier protein-like [Arabidopsis thaliana]
 gi|26449838|dbj|BAC42042.1| putative mitochondrial carrier protein [Arabidopsis thaliana]
 gi|30017309|gb|AAP12888.1| At5g48970 [Arabidopsis thaliana]
 gi|332008368|gb|AED95751.1| Mitochondrial substrate carrier family protein [Arabidopsis
           thaliana]
          Length = 339

 Score =  209 bits (531), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 124/321 (38%), Positives = 186/321 (57%), Gaps = 19/321 (5%)

Query: 33  CGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLK---KYNGMSHAIKLI 89
            GA++G VSR V SPLDV+KIR Q+Q    + P +S     G L    KY GM  A K I
Sbjct: 24  AGAISGGVSRSVTSPLDVIKIRFQVQ----LEPTTSWGLVRGNLSGASKYTGMVQATKDI 79

Query: 90  IREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLS 149
            REEG RG W GN+ A  + + Y ++QF   H++++ F    +   +   ++  L  F+S
Sbjct: 80  FREEGFRGFWRGNVPALLMVMPYTSIQFTVLHKLKS-FASGSTKTEDHIHLSPYLS-FVS 137

Query: 150 GAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQ 209
           GA++G  AT+ +YPFDLLRT  A+QGE ++Y  +R+A   I    G RG Y G+T ++V+
Sbjct: 138 GALAGCAATLGSYPFDLLRTILASQGEPKVYPTMRSAFVDIIQSRGIRGLYNGLTPTLVE 197

Query: 210 IIPYMGLVFGSYEFLKKLFR-----KLEDKHIWFH---NLRATEDLLSGAIAGIVSKAGV 261
           I+PY GL FG+Y+  K+        KL  K I  +   NL + +  + G  AG  +K   
Sbjct: 198 IVPYAGLQFGTYDMFKRWMMDWNRYKLSSK-IPINVDTNLSSFQLFICGLGAGTSAKLVC 256

Query: 262 FPLDLVRKRLQVQGPNRKDYFISNVPLYS-SSIFICIKQILRSDGIFGLYKGLMPALIKS 320
            PLD+V+KR Q++G  R   + + V   +  ++   ++QI+ S+G  GLYKG++P+ +K+
Sbjct: 257 HPLDVVKKRFQIEGLQRHPRYGARVERRAYRNMLDGLRQIMISEGWHGLYKGIVPSTVKA 316

Query: 321 APVSAVTFFVYGYTKRLLEKL 341
           AP  AVTF  Y +T   LE +
Sbjct: 317 APAGAVTFVAYEFTSDWLESI 337



 Score = 95.1 bits (235), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 69/227 (30%), Positives = 103/227 (45%), Gaps = 41/227 (18%)

Query: 134 QNEKFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRI-------------- 179
            +E   I + L    +GAISG  +  VT P D+++ RF  Q E                 
Sbjct: 9   DDEPGQIKRALIDASAGAISGGVSRSVTSPLDVIKIRFQVQLEPTTSWGLVRGNLSGASK 68

Query: 180 YIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFR---KLEDKHI 236
           Y G+  A + I+ +EG+RGF+RG   +++ ++PY  + F     LK       K ED HI
Sbjct: 69  YTGMVQATKDIFREEGFRGFWRGNVPALLMVMPYTSIQFTVLHKLKSFASGSTKTED-HI 127

Query: 237 WFHNLRATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQG-----PNRKDYFISNVPLYSS 291
              +L      +SGA+AG  +  G +P DL+R  L  QG     P  +  F+        
Sbjct: 128 ---HLSPYLSFVSGALAGCAATLGSYPFDLLRTILASQGEPKVYPTMRSAFV-------- 176

Query: 292 SIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGYTKRLL 338
                   I++S GI GLY GL P L++  P + + F  Y   KR +
Sbjct: 177 -------DIIQSRGIRGLYNGLTPTLVEIVPYAGLQFGTYDMFKRWM 216



>gi|225432282|ref|XP_002272682.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Vitis
           vinifera]
 gi|297736865|emb|CBI26066.3| unnamed protein product [Vitis vinifera]
          Length = 330

 Score =  208 bits (530), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 118/308 (38%), Positives = 176/308 (57%), Gaps = 10/308 (3%)

Query: 41  SRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIREEGIRGLWN 100
           SR V SPLDV+KIR Q+Q   P    +    +     KY GM  A K I REEG+ G W 
Sbjct: 24  SRTVTSPLDVIKIRFQVQL-EPTTSWALLRRDVHGQSKYTGMLQATKDIFREEGLPGFWR 82

Query: 101 GNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGAISGSTATIV 160
           GN+ A  + + Y A+QF   H+++  F    S   +   ++  L  F+SGA++G  AT+ 
Sbjct: 83  GNVPALLMVMPYTAIQFTVLHKLKT-FAAGSSKSEDHIHLSPYLS-FVSGALAGCAATVG 140

Query: 161 TYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGS 220
           +YPFDLLRT  A+QGE ++Y  +R+A   I    G++G Y G++ ++V+IIPY GL FG+
Sbjct: 141 SYPFDLLRTLLASQGEPKVYPKMRSAFLDIIRTRGFQGLYAGLSPTLVEIIPYAGLQFGT 200

Query: 221 YEFLKKLFRKLEDKHIWFHNLRATEDL------LSGAIAGIVSKAGVFPLDLVRKRLQVQ 274
           Y+  K+             NL  T+ +      L G  AG  +KA   PLD+V+KR Q++
Sbjct: 201 YDMFKRWTMAWNQYRSSNANLTGTDSISSFQLFLCGFAAGTCAKAVCHPLDVVKKRFQIE 260

Query: 275 GPNRKDYFISNVPLYS-SSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGY 333
           G  R   + + V   + ++++  ++QIL  +G  GLYKG++P++IKSAP  AVTF  Y +
Sbjct: 261 GLPRDPKYGARVEHRAYTNMYDALRQILLVEGWAGLYKGIVPSIIKSAPAGAVTFVAYEF 320

Query: 334 TKRLLEKL 341
           T   LE +
Sbjct: 321 TSDWLESM 328



>gi|348550447|ref|XP_003461043.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Cavia
           porcellus]
          Length = 318

 Score =  208 bits (530), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 121/307 (39%), Positives = 180/307 (58%), Gaps = 18/307 (5%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           S  E+ + G+++G+V+R + SPLDV+KIR QLQ    I  LS    +S    KY+G+  A
Sbjct: 14  SKFEVAMAGSMSGLVTRLLISPLDVIKIRFQLQ----IERLS----HSDPKAKYHGILQA 65

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQ 145
            K I++EEG    W G++ A+ L + YGAVQFL++  +  L  R +  +  +F  +    
Sbjct: 66  AKQILQEEGPTAFWKGHIPAQLLSIGYGAVQFLSFELLTELVHRANMYETHEFSAH---- 121

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTA 205
            F+ G +S  TAT+  +P D+LRTRFAAQGE R+Y  L++AV  +Y  EG   FY+G+  
Sbjct: 122 -FVCGGLSACTATLAVHPVDVLRTRFAAQGEPRVYKTLQDAVVTMYRTEGPLVFYKGLAP 180

Query: 206 SVVQIIPYMGLVFGSYEFLKKLFR-KLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPL 264
           +++ I PY GL F  Y+ LK+ +   +        NL+   +LL G+ AGI+SK   +PL
Sbjct: 181 TLIAIFPYAGLQFSCYKSLKRAYDWAIPADGKQTGNLK---NLLCGSGAGIISKTLTYPL 237

Query: 265 DLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVS 324
           DL++KRLQV G          V  Y   +  C KQ+L+ +GI G +KGL P+L+K+A  +
Sbjct: 238 DLIKKRLQVGGFEHARAGFGQVRSY-RGLLDCTKQVLQEEGIQGFFKGLSPSLLKAALST 296

Query: 325 AVTFFVY 331
              FF Y
Sbjct: 297 GFVFFWY 303



>gi|328770648|gb|EGF80689.1| hypothetical protein BATDEDRAFT_24503 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 298

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 121/301 (40%), Positives = 167/301 (55%), Gaps = 40/301 (13%)

Query: 31  GICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLII 90
            I GA++G+++RF  +PLDV+KIRLQLQ       +  + H++    KY  +  A +LII
Sbjct: 18  AISGAISGVMARFATAPLDVIKIRLQLQ--TTTTKVFEKGHSNYHKPKYQSIFQAGRLII 75

Query: 91  REEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSG 150
           +EEGI                     FL  H                  I +    F++G
Sbjct: 76  KEEGILD------------------SFLATH------------------IPQQAHTFIAG 99

Query: 151 AISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQI 210
           AISG  +T+ TYP DLLRTRFA Q     Y  L  A++ I+V+EG  GFYRG+  ++VQI
Sbjct: 100 AISGCVSTVSTYPLDLLRTRFAVQ-RNNFYPSLTKAIKNIFVKEGISGFYRGMLPTLVQI 158

Query: 211 IPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRAT-EDLLSGAIAGIVSKAGVFPLDLVRK 269
           IP MGL+F S+    KLF+ LE K    +   +   ++  GA+AG+V+K  V P D++RK
Sbjct: 159 IPQMGLIFESHRIFVKLFKHLETKAPTVYKWTSGYSEIFCGAMAGVVTKVVVMPFDVIRK 218

Query: 270 RLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFF 329
           R QVQGP R    + NVP Y   I     QI++ +G+  LYKG++P L K+AP SAVTFF
Sbjct: 219 RYQVQGPMRNAIVVDNVPRYHRGIVHTACQIVKHEGVLALYKGIVPCLAKAAPGSAVTFF 278

Query: 330 V 330
           V
Sbjct: 279 V 279



>gi|431908779|gb|ELK12371.1| Mitochondrial thiamine pyrophosphate carrier [Pteropus alecto]
          Length = 320

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 120/324 (37%), Positives = 184/324 (56%), Gaps = 18/324 (5%)

Query: 25  LSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSH 84
           +S+ E+ + G+V+G+V+R + SPLDV+KIR QLQ    I  LS    N+    KY+G+  
Sbjct: 13  ISNFEVAVAGSVSGLVTRALISPLDVIKIRFQLQ----IERLSRSDPNA----KYHGILQ 64

Query: 85  AIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTL 144
           A + I++EEG    W G++ A+ L + YGAVQFL++  +  L  R        F ++   
Sbjct: 65  AGRQILQEEGPTAFWKGHIPAQLLSIGYGAVQFLSFEMLTELVHRASVYDARDFSVH--- 121

Query: 145 QPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVT 204
             F+ G +S   AT+  +P D+LRTRFAAQGE R+Y  LR+AV  +Y  EG   FY+G+ 
Sbjct: 122 --FVCGGLSACAATLAVHPVDVLRTRFAAQGEPRVYKTLRDAVATMYRTEGPLVFYKGLN 179

Query: 205 ASVVQIIPYMGLVFGSYEFLKKLFR-KLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFP 263
            +++ I PY G  F  Y  LK ++   +  +     NL+   +LL G+ AG++SK   +P
Sbjct: 180 PTLIAIFPYAGFQFSFYNSLKHMYEWAMPAEGKKNGNLK---NLLCGSGAGVISKTLTYP 236

Query: 264 LDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPV 323
           LDL +KRLQV G  +       V  Y   +  C KQ+L+ +G  G YKGL P+L+K+A  
Sbjct: 237 LDLFKKRLQVGGFEQARVTFGQVRSY-RGLLDCAKQVLQEEGARGFYKGLSPSLLKAALS 295

Query: 324 SAVTFFVYGYTKRLLEKLHSSRDK 347
           + + FF Y +   L   + ++  +
Sbjct: 296 TGLVFFWYEFFCNLFHHMRTANSQ 319



>gi|403280562|ref|XP_003931785.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform 1
           [Saimiri boliviensis boliviensis]
 gi|403280564|ref|XP_003931786.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform 2
           [Saimiri boliviensis boliviensis]
          Length = 320

 Score =  207 bits (528), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 122/331 (36%), Positives = 185/331 (55%), Gaps = 29/331 (8%)

Query: 4   GYEHKPQNQSPIAEQAVAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPI 63
           GY+ KP  ++            +  ++ + G+V+G V+R + SP DV+KIR QLQ  R  
Sbjct: 3   GYDPKPDGRNN-----------TRFQVAVAGSVSGFVTRALISPFDVIKIRFQLQHER-- 49

Query: 64  NPLSSRHHNSGTLKKYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQM 123
             LS R  N+    KY+G+  AI+ I++EEG    W G++ A+ L + YGAVQFL++  +
Sbjct: 50  --LSRRDPNA----KYHGILQAIRQILQEEGPTAFWKGHIPAQILSIGYGAVQFLSFEML 103

Query: 124 QNLFKRIDSNQNEKFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGL 183
             L  R       +F ++     F+ G +S   AT+  +P D+LRTRFAAQGE ++Y  L
Sbjct: 104 TELVHRGSVYDAREFSVH-----FMCGGLSACMATLTVHPVDVLRTRFAAQGEPKVYNTL 158

Query: 184 RNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFR-KLEDKHIWFHNLR 242
           R+AV  +Y  EG   FY+G+T +++ I PY GL F  Y  LK ++   +  +     NL+
Sbjct: 159 RHAVGTMYRNEGPLVFYKGLTPTLIAIFPYAGLQFSCYSSLKHMYEWAMPAEGKKNENLK 218

Query: 243 ATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILR 302
              +LL G+ AG++SK   +PLDL +KRLQV G          V  Y   +  C KQ+L+
Sbjct: 219 ---NLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRKY-KGLVDCTKQVLQ 274

Query: 303 SDGIFGLYKGLMPALIKSAPVSAVTFFVYGY 333
            +G  G +KGL P+L+K+A  +   FF Y +
Sbjct: 275 EEGTLGFFKGLSPSLLKAALSTGFMFFWYEF 305



 Score = 86.3 bits (212), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 54/209 (25%), Positives = 97/209 (46%), Gaps = 27/209 (12%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIR 91
           +CG ++  ++     P+DV++ R   Q G P              K YN + HA+  + R
Sbjct: 123 MCGGLSACMATLTVHPVDVLRTRFAAQ-GEP--------------KVYNTLRHAVGTMYR 167

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGA 151
            EG    + G          Y  +QF  Y  ++++++     + +K   N+ L+  L G+
Sbjct: 168 NEGPLVFYKGLTPTLIAIFPYAGLQFSCYSSLKHMYEWAMPAEGKK---NENLKNLLCGS 224

Query: 152 ISGSTATIVTYPFDLLRTRF---------AAQGEKRIYIGLRNAVQQIYVQEGYRGFYRG 202
            +G  +  +TYP DL + R          AA G+ R Y GL +  +Q+  +EG  GF++G
Sbjct: 225 GAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRKYKGLVDCTKQVLQEEGTLGFFKG 284

Query: 203 VTASVVQIIPYMGLVFGSYEFLKKLFRKL 231
           ++ S+++     G +F  YEF   +F  +
Sbjct: 285 LSPSLLKAALSTGFMFFWYEFFCNVFHCM 313



>gi|18402984|ref|NP_566683.1| mitochondrial thiamin diphosphate carrier protein [Arabidopsis
           thaliana]
 gi|19347718|gb|AAL85968.1| unknown protein [Arabidopsis thaliana]
 gi|21593478|gb|AAM65445.1| mitochondrial carrier protein-like [Arabidopsis thaliana]
 gi|21689713|gb|AAM67478.1| unknown protein [Arabidopsis thaliana]
 gi|332642983|gb|AEE76504.1| Mitochondrial substrate carrier family protein [Arabidopsis
           thaliana]
          Length = 335

 Score =  207 bits (528), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 121/320 (37%), Positives = 180/320 (56%), Gaps = 22/320 (6%)

Query: 33  CGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLK-KYNGMSHAIKLIIR 91
            G VAG +SR V SPLDV+KIR Q+Q    + P ++       LK KYNG+    K I R
Sbjct: 21  AGGVAGAISRMVTSPLDVIKIRFQVQ----LEPTATWALKDSQLKPKYNGLFRTTKDIFR 76

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLS-- 149
           EEG+ G W GN+ A  + + Y ++QF   H++++        +N     +  L P+LS  
Sbjct: 77  EEGLSGFWRGNVPALLMVVPYTSIQFAVLHKVKSFAAGSSKAEN-----HAQLSPYLSYI 131

Query: 150 -GAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVV 208
            GA++G  AT+ +YPFDLLRT  A+QGE ++Y  +R+A   I    G +G Y G++ +++
Sbjct: 132 SGALAGCAATVGSYPFDLLRTVLASQGEPKVYPNMRSAFLSIVQTRGIKGLYAGLSPTLI 191

Query: 209 QIIPYMGLVFGSYEFLKKLFRKLEDKH--------IWFHNLRATEDLLSGAIAGIVSKAG 260
           +IIPY GL FG+Y+  K+       ++            +L + +  L G  +G VSK  
Sbjct: 192 EIIPYAGLQFGTYDTFKRWSMVYNKRYRSSSSSSTNPSDSLSSFQLFLCGLASGTVSKLV 251

Query: 261 VFPLDLVRKRLQVQGPNRKDYFISNVPLYS-SSIFICIKQILRSDGIFGLYKGLMPALIK 319
             PLD+V+KR QV+G  R   + + V L +  ++F  + QILRS+G  GLYKG++P+ IK
Sbjct: 252 CHPLDVVKKRFQVEGLQRHPKYGARVELNAYKNMFDGLGQILRSEGWHGLYKGIVPSTIK 311

Query: 320 SAPVSAVTFFVYGYTKRLLE 339
           +AP  AVTF  Y       E
Sbjct: 312 AAPAGAVTFVAYELASDWFE 331



 Score = 77.0 bits (188), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 63/245 (25%), Positives = 106/245 (43%), Gaps = 41/245 (16%)

Query: 7   HKPQNQSPIAEQAVAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPL 66
           HK ++ +  + +A   +QLS     I GA+AG  +   + P D+++  L  Q G P    
Sbjct: 106 HKVKSFAAGSSKAENHAQLSPYLSYISGALAGCAATVGSYPFDLLRTVLASQ-GEP---- 160

Query: 67  SSRHHNSGTLKKYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNL 126
                     K Y  M  A   I++  GI+GL+ G        + Y  +QF TY    + 
Sbjct: 161 ----------KVYPNMRSAFLSIVQTRGIKGLYAGLSPTLIEIIPYAGLQFGTY----DT 206

Query: 127 FKRIDSNQNEKFGIN-----------KTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQG 175
           FKR     N+++  +            + Q FL G  SG+ + +V +P D+++ RF  +G
Sbjct: 207 FKRWSMVYNKRYRSSSSSSTNPSDSLSSFQLFLCGLASGTVSKLVCHPLDVVKKRFQVEG 266

Query: 176 EKR-----------IYIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFL 224
            +R            Y  + + + QI   EG+ G Y+G+  S ++  P   + F +YE  
Sbjct: 267 LQRHPKYGARVELNAYKNMFDGLGQILRSEGWHGLYKGIVPSTIKAAPAGAVTFVAYELA 326

Query: 225 KKLFR 229
              F 
Sbjct: 327 SDWFE 331



>gi|156346263|ref|XP_001621491.1| hypothetical protein NEMVEDRAFT_v1g195684 [Nematostella vectensis]
 gi|156207481|gb|EDO29391.1| predicted protein [Nematostella vectensis]
          Length = 339

 Score =  207 bits (528), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 119/323 (36%), Positives = 171/323 (52%), Gaps = 8/323 (2%)

Query: 25  LSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSH 84
           L++ + GICG+VAG  +R +A PLDV+KIR QLQ      P + +     T  KY G+  
Sbjct: 13  LTTAQCGICGSVAGAFTRLIAQPLDVLKIRFQLQVEPTFQP-TFQITTKVTTGKYTGVWQ 71

Query: 85  AIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTL 144
           A KL+  EEG   LW G++ A+ L + YG  QF  +         I     EK    K  
Sbjct: 72  AGKLVFEEEGFAALWKGHVPAQALSVVYGYFQFTCFEAFTKAAYFISPRTMEK--KYKPA 129

Query: 145 QPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVT 204
             F+ GA SG  A ++  P D++RTR  AQGE +IY  L  A + +Y  EG   F++G+T
Sbjct: 130 THFMCGAFSGCAAAVMAQPLDVIRTRLVAQGEPKIYNSLLQAARVMYKGEGPTVFFKGLT 189

Query: 205 ASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPL 264
            S++QI PY GL FGSY  LK ++  + D  +        E L  GA++G++SKA + P 
Sbjct: 190 PSLLQIFPYSGLQFGSYSLLKTIWDHVFDIKV----TDVIESLTCGALSGMISKAVILPF 245

Query: 265 DLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVS 324
           D+++KR+QVQG          V  Y   +  C + IL+ +G  GL+KGL P+ +K+A   
Sbjct: 246 DIIKKRIQVQGFEEARQSFGRVQQY-DGVKDCFRTILKEEGAMGLFKGLAPSTLKAAVTV 304

Query: 325 AVTFFVYGYTKRLLEKLHSSRDK 347
            + F  Y     L  KL    D+
Sbjct: 305 GIMFCTYEQCLHLFRKLIHKGDR 327



>gi|297795621|ref|XP_002865695.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata
           subsp. lyrata]
 gi|297311530|gb|EFH41954.1| mitochondrial substrate carrier family protein [Arabidopsis lyrata
           subsp. lyrata]
          Length = 338

 Score =  207 bits (528), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 120/321 (37%), Positives = 184/321 (57%), Gaps = 19/321 (5%)

Query: 33  CGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLK---KYNGMSHAIKLI 89
            GA++G VSR   SPLDV+KIR Q+Q    + P +S     G L    KY GM  A K I
Sbjct: 23  AGAISGGVSRTFTSPLDVIKIRFQVQ----LEPTTSWGLVRGNLSGASKYTGMVQATKDI 78

Query: 90  IREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLS 149
            REEG RG W GN+ A  + + Y ++QF   H++++ F    +   +   ++  L  F+S
Sbjct: 79  FREEGFRGFWRGNVPALLMVMPYTSIQFTVLHKLKS-FASGSTKSEDHIHLSPYLS-FVS 136

Query: 150 GAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQ 209
           GA++G  AT+ +YPFDLLRT  A+QGE ++Y  +R+A   I    G RG Y G+T ++V+
Sbjct: 137 GALAGCAATLGSYPFDLLRTILASQGEPKVYPTMRSAFVDIIQSRGIRGLYNGLTPTLVE 196

Query: 210 IIPYMGLVFGSYEFLKKLFRKLEDKHIWFH--------NLRATEDLLSGAIAGIVSKAGV 261
           I+PY GL FG+Y+  K+      +++I           NL + +  + G  AG  +K   
Sbjct: 197 IVPYAGLQFGTYDMFKRWMMDW-NRYILSSKNPINVDTNLSSLQLFVCGLGAGTSAKLVC 255

Query: 262 FPLDLVRKRLQVQGPNRKDYFISNVPLYS-SSIFICIKQILRSDGIFGLYKGLMPALIKS 320
            PLD+V+KR Q++G  R   + + V   +  ++   ++QI+ S+G  GLYKG++P+ +K+
Sbjct: 256 HPLDVVKKRFQIEGLQRHPRYGARVERRAYRNMLDGLRQIMISEGWHGLYKGIVPSTVKA 315

Query: 321 APVSAVTFFVYGYTKRLLEKL 341
           AP  AVTF  Y +T   LE +
Sbjct: 316 APAGAVTFVAYEFTSDWLESI 336



 Score = 92.4 bits (228), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 67/221 (30%), Positives = 100/221 (45%), Gaps = 41/221 (18%)

Query: 140 INKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRI--------------YIGLRN 185
           I + L    +GAISG  +   T P D+++ RF  Q E                 Y G+  
Sbjct: 14  IKRALIDASAGAISGGVSRTFTSPLDVIKIRFQVQLEPTTSWGLVRGNLSGASKYTGMVQ 73

Query: 186 AVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFR---KLEDKHIWFHNLR 242
           A + I+ +EG+RGF+RG   +++ ++PY  + F     LK       K ED HI   +L 
Sbjct: 74  ATKDIFREEGFRGFWRGNVPALLMVMPYTSIQFTVLHKLKSFASGSTKSED-HI---HLS 129

Query: 243 ATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQG-----PNRKDYFISNVPLYSSSIFICI 297
                +SGA+AG  +  G +P DL+R  L  QG     P  +  F+              
Sbjct: 130 PYLSFVSGALAGCAATLGSYPFDLLRTILASQGEPKVYPTMRSAFV-------------- 175

Query: 298 KQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGYTKRLL 338
             I++S GI GLY GL P L++  P + + F  Y   KR +
Sbjct: 176 -DIIQSRGIRGLYNGLTPTLVEIVPYAGLQFGTYDMFKRWM 215



>gi|9294686|dbj|BAB03052.1| mitochondrial carrier protein-like [Arabidopsis thaliana]
          Length = 346

 Score =  207 bits (528), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 120/312 (38%), Positives = 179/312 (57%), Gaps = 22/312 (7%)

Query: 33  CGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLK-KYNGMSHAIKLIIR 91
            G VAG +SR V SPLDV+KIR Q+Q    + P ++       LK KYNG+    K I R
Sbjct: 32  AGGVAGAISRMVTSPLDVIKIRFQVQ----LEPTATWALKDSQLKPKYNGLFRTTKDIFR 87

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLS-- 149
           EEG+ G W GN+ A  + + Y ++QF   H++++        +N     +  L P+LS  
Sbjct: 88  EEGLSGFWRGNVPALLMVVPYTSIQFAVLHKVKSFAAGSSKAEN-----HAQLSPYLSYI 142

Query: 150 -GAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVV 208
            GA++G  AT+ +YPFDLLRT  A+QGE ++Y  +R+A   I    G +G Y G++ +++
Sbjct: 143 SGALAGCAATVGSYPFDLLRTVLASQGEPKVYPNMRSAFLSIVQTRGIKGLYAGLSPTLI 202

Query: 209 QIIPYMGLVFGSYEFLKKLFRKLEDKH--------IWFHNLRATEDLLSGAIAGIVSKAG 260
           +IIPY GL FG+Y+  K+       ++            +L + +  L G  +G VSK  
Sbjct: 203 EIIPYAGLQFGTYDTFKRWSMVYNKRYRSSSSSSTNPSDSLSSFQLFLCGLASGTVSKLV 262

Query: 261 VFPLDLVRKRLQVQGPNRKDYFISNVPLYS-SSIFICIKQILRSDGIFGLYKGLMPALIK 319
             PLD+V+KR QV+G  R   + + V L +  ++F  + QILRS+G  GLYKG++P+ IK
Sbjct: 263 CHPLDVVKKRFQVEGLQRHPKYGARVELNAYKNMFDGLGQILRSEGWHGLYKGIVPSTIK 322

Query: 320 SAPVSAVTFFVY 331
           +AP  AVTF  Y
Sbjct: 323 AAPAGAVTFVAY 334



 Score = 86.3 bits (212), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 61/205 (29%), Positives = 94/205 (45%), Gaps = 33/205 (16%)

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQGE------------KRIYIGLRNAVQQIYVQEGY 196
           +G ++G+ + +VT P D+++ RF  Q E            K  Y GL    + I+ +EG 
Sbjct: 32  AGGVAGAISRMVTSPLDVIKIRFQVQLEPTATWALKDSQLKPKYNGLFRTTKDIFREEGL 91

Query: 197 RGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIV 256
            GF+RG   +++ ++PY  + F     +K  F     K      L      +SGA+AG  
Sbjct: 92  SGFWRGNVPALLMVVPYTSIQFAVLHKVKS-FAAGSSKAENHAQLSPYLSYISGALAGCA 150

Query: 257 SKAGVFPLDLVRKRLQVQG-----PNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYK 311
           +  G +P DL+R  L  QG     PN +  F+S               I+++ GI GLY 
Sbjct: 151 ATVGSYPFDLLRTVLASQGEPKVYPNMRSAFLS---------------IVQTRGIKGLYA 195

Query: 312 GLMPALIKSAPVSAVTFFVYGYTKR 336
           GL P LI+  P + + F  Y   KR
Sbjct: 196 GLSPTLIEIIPYAGLQFGTYDTFKR 220



 Score = 76.6 bits (187), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 63/245 (25%), Positives = 106/245 (43%), Gaps = 41/245 (16%)

Query: 7   HKPQNQSPIAEQAVAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPL 66
           HK ++ +  + +A   +QLS     I GA+AG  +   + P D+++  L  Q G P    
Sbjct: 117 HKVKSFAAGSSKAENHAQLSPYLSYISGALAGCAATVGSYPFDLLRTVLASQ-GEP---- 171

Query: 67  SSRHHNSGTLKKYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNL 126
                     K Y  M  A   I++  GI+GL+ G        + Y  +QF TY    + 
Sbjct: 172 ----------KVYPNMRSAFLSIVQTRGIKGLYAGLSPTLIEIIPYAGLQFGTY----DT 217

Query: 127 FKRIDSNQNEKFGIN-----------KTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQG 175
           FKR     N+++  +            + Q FL G  SG+ + +V +P D+++ RF  +G
Sbjct: 218 FKRWSMVYNKRYRSSSSSSTNPSDSLSSFQLFLCGLASGTVSKLVCHPLDVVKKRFQVEG 277

Query: 176 EKR-----------IYIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFL 224
            +R            Y  + + + QI   EG+ G Y+G+  S ++  P   + F +YE  
Sbjct: 278 LQRHPKYGARVELNAYKNMFDGLGQILRSEGWHGLYKGIVPSTIKAAPAGAVTFVAYELA 337

Query: 225 KKLFR 229
              F 
Sbjct: 338 SDWFE 342



>gi|507543491|ref|XP_004655735.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Jaculus
           jaculus]
          Length = 344

 Score =  207 bits (526), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 123/307 (40%), Positives = 172/307 (56%), Gaps = 18/307 (5%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           S  E+ + G+V+G V+R + SPLDV+KIR QLQ    I  LSS    +    KY+G+  A
Sbjct: 14  SKFEVALAGSVSGFVTRALISPLDVIKIRFQLQ----IERLSSSDPKA----KYHGIFQA 65

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQ 145
            K I++EEG    W G++ A+ L + YGAVQFL++ Q+  L  R       +F  +    
Sbjct: 66  SKQILKEEGPAAFWKGHIPAQILSIGYGAVQFLSFEQLTELAHRTSLYDAHEFSAH---- 121

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTA 205
            F+ G +S   AT+  +P D+LRTR AAQGE +IY  LR AV  +Y  EG   FY+G+  
Sbjct: 122 -FVCGGLSACMATLAVHPVDVLRTRLAAQGEPKIYKTLREAVMTMYRTEGPLVFYKGLAP 180

Query: 206 SVVQIIPYMGLVFGSYEFLKKLFR-KLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPL 264
           +V+ I PY GL F  Y FLK  +   L        NLR+   LL G  AG++SK   +PL
Sbjct: 181 TVIAIFPYAGLQFSCYRFLKHAYDWVLPGDGKQKGNLRS---LLCGCGAGVISKTLTYPL 237

Query: 265 DLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVS 324
           DL +KRLQV G  +       V  Y   +  C KQ+L+ +G  G +KGL P+L+K+A  +
Sbjct: 238 DLFKKRLQVAGFEQARSTFGQVRSY-RGLMDCTKQVLQDEGTQGFFKGLSPSLLKAALST 296

Query: 325 AVTFFVY 331
              FF +
Sbjct: 297 GFMFFFF 303



>gi|57099337|ref|XP_540430.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Canis
           lupus familiaris]
          Length = 318

 Score =  207 bits (526), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 121/313 (38%), Positives = 174/313 (55%), Gaps = 26/313 (8%)

Query: 24  QLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMS 83
            +SS E+ + G+V+G+V+R + SPLDV+KIR QLQ    I  LS     S    KY+G+ 
Sbjct: 12  NISSFEVAVAGSVSGLVTRVMISPLDVIKIRFQLQ----IERLS----RSDPGAKYHGIL 63

Query: 84  HAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKT 143
            A + I++EEG    W G++ A+ L + YGAVQFL++  +  L  R        F ++  
Sbjct: 64  QAGRQILQEEGPTAFWKGHVPAQLLSIGYGAVQFLSFELLTELVHRATKYDARDFSVH-- 121

Query: 144 LQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGV 203
              F+ G +S S AT+  +P D+LRTRFAAQGE ++Y  LR AV  +Y  EG   FY+G+
Sbjct: 122 ---FVCGGLSASAATLAVHPVDVLRTRFAAQGEPKVYKTLREAVVTMYRTEGPLVFYKGL 178

Query: 204 TASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWF-----HNLRATEDLLSGAIAGIVSK 258
             +++ I PY G  F  Y  LK +       H W       N    ++LL G+ AG++SK
Sbjct: 179 NPTLIAIFPYAGFQFSFYSALKHV-------HEWVIPTEGANSENLKNLLCGSGAGVISK 231

Query: 259 AGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALI 318
              +PLDL +KRLQV G  R       V  Y   +  C +Q+LR +G  G +KGL P+L+
Sbjct: 232 TLTYPLDLFKKRLQVGGFERARATFGQVRSY-KGLLDCARQVLREEGPRGFFKGLSPSLL 290

Query: 319 KSAPVSAVTFFVY 331
           K+A  +   FF Y
Sbjct: 291 KAALATGFVFFWY 303



>gi|449479356|ref|XP_002190516.2| PREDICTED: mitochondrial thiamine pyrophosphate carrier
           [Taeniopygia guttata]
          Length = 322

 Score =  206 bits (524), Expect = 8e-51,   Method: Compositional matrix adjust.
 Identities = 123/322 (38%), Positives = 184/322 (57%), Gaps = 16/322 (4%)

Query: 22  ASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNG 81
           A+ +S++E    G+ +G+V+R + SPLDV+KIR QLQ    I  LSSR+  +    KY+G
Sbjct: 8   ATCVSTVEAAAAGSASGLVTRVLVSPLDVLKIRFQLQ----IEQLSSRNPTA----KYHG 59

Query: 82  MSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGIN 141
           +  A++ I  EEG+   W G++ A++L + +GAVQF+ +  +  L  +  S     F   
Sbjct: 60  ILQAVQRIFGEEGLTAFWKGHVPAQFLSIGFGAVQFMAFESLTELVHKATS-----FTAR 114

Query: 142 KTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYR 201
            +    + G ++  TAT+  +P D LRTRFAAQGE +IY+ LR+AV  +Y  EG R FYR
Sbjct: 115 DSFVHLVCGGLAACTATVAVHPVDTLRTRFAAQGEPKIYLSLRHAVVTMYQTEGPRTFYR 174

Query: 202 GVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGV 261
           G+T +++ I PY GL F  Y  L++  +          N    ++L+ G+ AG+VSK+  
Sbjct: 175 GLTPTLIAIFPYAGLQFFFYNILQQFSKWAIPAEA--KNRANIKNLVCGSCAGVVSKSLT 232

Query: 262 FPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSA 321
           +PLD+V+KRLQV G          V  Y      C+ QI+R +G  G +KGL P+L+K+A
Sbjct: 233 YPLDVVKKRLQVGGFEHARAAFGQVRTY-GGFLDCMTQIMREEGPGGFFKGLSPSLLKAA 291

Query: 322 PVSAVTFFVYGYTKRLLEKLHS 343
             S + FF Y     LL  L S
Sbjct: 292 FSSGLIFFWYELFCGLLCALKS 313



>gi|255964670|gb|ACU44652.1| solute carrier family 25 member 19 [Sus scrofa]
          Length = 318

 Score =  206 bits (524), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 122/323 (37%), Positives = 182/323 (56%), Gaps = 22/323 (6%)

Query: 25  LSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSH 84
           +S++E+ + G+V+G+V+R + SPLDV+KIR QLQ    I  LS    N+    KY+G+  
Sbjct: 13  ISNLEVAVAGSVSGLVTRAMISPLDVIKIRFQLQ----IERLSRSDPNA----KYHGILQ 64

Query: 85  AIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTL 144
           A + I++EEG    W G++ A+ L + YGAVQFL++  +  L  R        F ++   
Sbjct: 65  AGRQILQEEGPTAFWKGHIPAQLLSIGYGAVQFLSFEVLTELVHRASVRDARDFSVH--- 121

Query: 145 QPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVT 204
             F+ G +S   AT+  +P D+LRTR+AAQGE R+Y  LR+AV  +Y  EG   FY+G+T
Sbjct: 122 --FVCGGLSACVATLTMHPLDVLRTRYAAQGEPRVYRALRDAVVTMYRTEGPAVFYKGLT 179

Query: 205 ASVVQIIPYMGLVFGSYEFLKKLFRKL---EDKHIWFHNLRATEDLLSGAIAGIVSKAGV 261
            +++ I PY G  F  Y  LK +       EDK     N +   +LL G+ AG++SK   
Sbjct: 180 PTLLAIFPYAGFQFAFYSSLKHVGEWAMPSEDKTD--GNFK---NLLCGSGAGVISKTLT 234

Query: 262 FPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSA 321
           +PLDL +KRLQV G  +       V  Y   +  C +Q+LR +G  G +KGL P+L+K+A
Sbjct: 235 YPLDLFKKRLQVGGFEQARASFGQVRSY-KGLLDCARQVLREEGAQGFFKGLSPSLLKAA 293

Query: 322 PVSAVTFFVYGYTKRLLEKLHSS 344
             +   FF Y     L  +L  +
Sbjct: 294 LSTGFVFFWYELVCNLFHRLRKA 316



>gi|260792436|ref|XP_002591221.1| hypothetical protein BRAFLDRAFT_287708 [Branchiostoma floridae]
 gi|229276424|gb|EEN47232.1| hypothetical protein BRAFLDRAFT_287708 [Branchiostoma floridae]
          Length = 322

 Score =  206 bits (524), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 115/326 (35%), Positives = 184/326 (56%), Gaps = 18/326 (5%)

Query: 24  QLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMS 83
           +LS+ E  + G V+G ++R   +PLDV+KIR QLQ    + P+    H      KY  + 
Sbjct: 11  ELSATEYAVAGGVSGFLTRAACNPLDVIKIRFQLQ----VEPIKKSQHGG----KYQSIP 62

Query: 84  HAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQM-QNLFKRIDSNQNEKFGINK 142
            A+  + REEGI   W G++ A+ L L YGAVQF  +  + +  ++++    +   G  K
Sbjct: 63  QAVVTLFREEGITAFWKGHVPAQLLSLIYGAVQFAVFELLTKQAWEQLPPEASS--GPWK 120

Query: 143 TLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRG 202
               F+ G +S   AT    P D+LRTRF++QGE ++Y  L  AV  ++ + G R FYRG
Sbjct: 121 PALHFMCGGLSAMAATCACQPVDVLRTRFSSQGEPKVYRSLPQAVSSMWREGGPRAFYRG 180

Query: 203 VTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVF 262
           ++ ++VQI PY G  F ++      ++ L        +  A + L+ GA +G+VSK  V+
Sbjct: 181 LSPTLVQIFPYAGFQFATFAMFTSAWKYLPQS---ISDKGAVKTLVCGAGSGVVSKTLVY 237

Query: 263 PLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAP 322
           PLD+V+KRLQVQG +        V  Y+  +  C++ +LR +G  GL+KGL P+L+K+A 
Sbjct: 238 PLDVVKKRLQVQGFDHARRSFGQVREYTGLVH-CVRCMLREEGARGLFKGLSPSLLKAAC 296

Query: 323 VSAVTFFVY---GYTKRLLEKLHSSR 345
            S++ FF+Y    +  RL  ++++ R
Sbjct: 297 ASSLIFFLYEQCCHALRLSHRMYTYR 322



>gi|312373981|gb|EFR21641.1| hypothetical protein AND_16672 [Anopheles darlingi]
          Length = 307

 Score =  206 bits (523), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 117/303 (38%), Positives = 171/303 (56%), Gaps = 19/303 (6%)

Query: 31  GICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLII 90
           GI G  AG ++RF+  PLDV+KIR QLQ    + PLS  H  S    KY  ++ + +L+ 
Sbjct: 13  GIAGGAAGCITRFICQPLDVLKIRFQLQ----VEPLSEEHMTS----KYRTIAQSTRLVY 64

Query: 91  REEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSG 150
           REEG+R  W G+  A+ L + YG  QF +Y +  ++ + ID+     F  +   + F+ G
Sbjct: 65  REEGLRAFWKGHNPAQVLSIIYGVAQFSSYERFNHVLRTIDT-----FERHHNARNFICG 119

Query: 151 AISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQI 210
           A SG+ AT++T P D++RTR  +Q   R Y      ++ IY+ EG RG YRG+  SV+QI
Sbjct: 120 ATSGTVATVITLPLDVVRTRLISQDPGRGYRSSVQGLKLIYLHEGVRGLYRGLGPSVLQI 179

Query: 211 IPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVRKR 270
            P  G  F  Y     +FR+  +       L A E  + G +AGI +K  V+PLDL +KR
Sbjct: 180 APLTGGQFMFYNIFGSMFRQYFNISTS-ETLPAIELFICGGLAGICTKLLVYPLDLAKKR 238

Query: 271 LQVQG--PNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTF 328
           LQ+QG   +R+ Y          ++F C+  I R +G+ GLYKGL PAL+K+  +SA  F
Sbjct: 239 LQIQGFAKSRQTY---GRHFVCDNMFHCLYSIARQEGLIGLYKGLYPALLKACFMSAFYF 295

Query: 329 FVY 331
            +Y
Sbjct: 296 AIY 298



>gi|410981684|ref|XP_003997196.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Felis
           catus]
          Length = 318

 Score =  206 bits (523), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 123/315 (39%), Positives = 177/315 (56%), Gaps = 32/315 (10%)

Query: 25  LSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSH 84
           +SS E+ + G+V+G+V+R + SPLDV+KIR QLQ    I  LS     S    KY+G+  
Sbjct: 13  ISSSEVAVAGSVSGLVTRVMISPLDVIKIRFQLQ----IERLS----RSDPGAKYHGILQ 64

Query: 85  AIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTL 144
           A + I+ EEG    W G++ A+ L + YGAVQFL++  +  L  R        F ++   
Sbjct: 65  AARQILLEEGPTAFWKGHIPAQLLSIGYGAVQFLSFELLTELVHRASKYDARDFSVH--- 121

Query: 145 QPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVT 204
             F+ G +S STAT+  +P D+LRTRFAAQGE ++Y  LR+AV  +Y  EG   FY+G+ 
Sbjct: 122 --FVCGGLSASTATLAVHPVDVLRTRFAAQGEPKVYKTLRDAVVTMYRTEGPLVFYKGLN 179

Query: 205 ASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWF--------HNLRATEDLLSGAIAGIV 256
            +++ I PY G  F  Y  LK +       H W          NL+   +LL G+ AG++
Sbjct: 180 PTLIAIFPYAGFQFSFYNALKHV-------HEWVMPAEGRKNENLK---NLLCGSGAGVI 229

Query: 257 SKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPA 316
           SKA  +PLDL +KRLQV G  +       V  Y   +  C +Q+LR +G  G +KGL P+
Sbjct: 230 SKALTYPLDLFKKRLQVGGFEQARASFGQVRSY-KGLLDCARQVLREEGPRGFFKGLSPS 288

Query: 317 LIKSAPVSAVTFFVY 331
           L+K+A  +   FF Y
Sbjct: 289 LLKAALSTGFVFFWY 303



>gi|395533041|ref|XP_003768572.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier
           [Sarcophilus harrisii]
          Length = 323

 Score =  205 bits (522), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 124/338 (36%), Positives = 188/338 (55%), Gaps = 33/338 (9%)

Query: 4   GYEHKPQNQSPIAEQAVAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPI 63
           GY+ KP  +           + S +++ + G+ +G+V+R + SPLDV+KIR QLQ    +
Sbjct: 3   GYDPKPNRK-----------KNSKVDVAVAGSASGLVTRALISPLDVIKIRFQLQ----V 47

Query: 64  NPLSSRHHNSGTLKKYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQM 123
             LSS   ++    KY G+  A + I++EEG+   W G++ A+ L + YGAVQF+T+  +
Sbjct: 48  EHLSSSDPHA----KYYGIIQAARQILKEEGLTAFWKGHIPAQILSIGYGAVQFVTFELL 103

Query: 124 QNLFKRIDSNQNEKFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGL 183
             L  R   +    F ++     F+ G +S  TAT+   P D+LRTRFAAQGE +IY  L
Sbjct: 104 TELVHRTMRHDPRDFSVH-----FVCGGLSACTATLAVQPVDVLRTRFAAQGEPKIYRNL 158

Query: 184 RNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFR---KLEDKHIWFHN 240
           R+ V  +Y  EG   FYRG+  +++ I PY G  F  Y  LK+++     ++ K     N
Sbjct: 159 RHGVMMMYKTEGPLAFYRGLPPTLIAIFPYAGFQFSFYSALKQVYEWAIPVDGKKN--AN 216

Query: 241 LRATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQI 300
           L+   +LL G+ AG++SK   +PLDL +KRLQV G  +       V  Y   +  CIK+I
Sbjct: 217 LK---NLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEKAREPFGQVRKY-QGLLDCIKKI 272

Query: 301 LRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGYTKRLL 338
            + +G  G +KGL P+L+KSA  + + FF Y     LL
Sbjct: 273 FQEEGTQGFFKGLTPSLLKSAMSTGLVFFWYELFCHLL 310



>gi|114052681|ref|NP_001039352.1| mitochondrial thiamine pyrophosphate carrier [Bos taurus]
 gi|119368661|sp|Q29RM1.1|TPC_BOVIN RecName: Full=Mitochondrial thiamine pyrophosphate carrier;
           AltName: Full=Solute carrier family 25 member 19
 gi|88954396|gb|AAI14116.1| Solute carrier family 25 (mitochondrial thiamine pyrophosphate
           carrier), member 19 [Bos taurus]
 gi|296476076|tpg|DAA18191.1| TPA: mitochondrial thiamine pyrophosphate carrier [Bos taurus]
          Length = 318

 Score =  205 bits (522), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 119/309 (38%), Positives = 177/309 (57%), Gaps = 18/309 (5%)

Query: 24  QLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMS 83
            +S++E+ + G+V+G+V+R + SPLDV+KIR QLQ    I  LS    N+    KY+G+ 
Sbjct: 12  DISNVEVAVAGSVSGLVTRVLISPLDVIKIRFQLQ----IERLSRSDPNA----KYHGIL 63

Query: 84  HAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKT 143
            A + I++EEG    W G++ A+ L + YGAVQFL++  +  L  R        F ++  
Sbjct: 64  QAGRQILQEEGPTAFWKGHIPAQLLSIGYGAVQFLSFEALTELVHRASVRDARDFSVH-- 121

Query: 144 LQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGV 203
              FL G +S   AT+  +P D+LRTRFAAQGE R+Y  LR+AV  +Y  EG   FY+G+
Sbjct: 122 ---FLCGGLSACVATLAVHPVDVLRTRFAAQGEPRVYKTLRDAVVTMYRTEGPLVFYKGL 178

Query: 204 TASVVQIIPYMGLVFGSYEFLKKLFR-KLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVF 262
             +++ I PY G  F  Y  LK+ +   L  +     N +   +LL G+ AG++SK   +
Sbjct: 179 NPTLIAIFPYAGFQFSIYSSLKRAYEWALPAEGKKNGNFK---NLLCGSGAGVISKTLTY 235

Query: 263 PLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAP 322
           PLDL +KRLQV G  +       V  Y   +  C  Q+LR +G  G +KGL P+L+K+A 
Sbjct: 236 PLDLFKKRLQVGGFEQARASFGQVRSY-KGLLDCAGQVLREEGAQGCFKGLSPSLLKAAL 294

Query: 323 VSAVTFFVY 331
            + + FF Y
Sbjct: 295 STGLVFFWY 303



>gi|478517147|ref|XP_004432808.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier
           [Ceratotherium simum simum]
          Length = 318

 Score =  205 bits (521), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 118/312 (37%), Positives = 174/312 (55%), Gaps = 26/312 (8%)

Query: 25  LSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSH 84
           +S+ E+ + G+V+G+V+R + SPLD++KIR QLQ    I  LS    N+    KY+G+  
Sbjct: 13  ISNFEVAVAGSVSGLVTRALISPLDIIKIRFQLQ----IERLSCSDPNA----KYHGILQ 64

Query: 85  AIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTL 144
           A + I++EEG    W G++ A+ L + YGAVQFL++  +  L  R   +    F ++   
Sbjct: 65  AGRQILQEEGPTAFWKGHIPAQLLSIGYGAVQFLSFELLTELVHRASVHDARDFSVH--- 121

Query: 145 QPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVT 204
             F+ G +S   AT+  +P D+LRTRFAAQGE R+Y  LR+AV  +Y  EG   FY+G+ 
Sbjct: 122 --FVCGGLSACVATLAVHPVDVLRTRFAAQGEPRVYKSLRDAVVTMYRTEGPLVFYKGLN 179

Query: 205 ASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATED-----LLSGAIAGIVSKA 259
            +++ I PY G  F  Y  LK  +        W       +D     LL G+ AG++SK 
Sbjct: 180 PTLLAIFPYAGFQFSFYSSLKHAYE-------WVMPAEGRKDGNLKNLLCGSGAGVISKT 232

Query: 260 GVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIK 319
             +PLDL +KRLQV G  +       V  Y   +  C KQ+LR +G  G +KGL P+L+K
Sbjct: 233 LTYPLDLFKKRLQVGGFEQARAAFGQVRSY-KGLLDCAKQVLREEGAQGFFKGLSPSLLK 291

Query: 320 SAPVSAVTFFVY 331
           +A  +   FF Y
Sbjct: 292 AALSTGFVFFWY 303



>gi|511849296|ref|XP_004749004.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform X1
           [Mustela putorius furo]
 gi|511849298|ref|XP_004749005.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform X2
           [Mustela putorius furo]
 gi|511849300|ref|XP_004749006.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform X3
           [Mustela putorius furo]
 gi|511986195|ref|XP_004810873.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform X1
           [Mustela putorius furo]
 gi|511986197|ref|XP_004810874.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform X2
           [Mustela putorius furo]
 gi|511986199|ref|XP_004810875.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform X3
           [Mustela putorius furo]
 gi|511986201|ref|XP_004810876.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform X4
           [Mustela putorius furo]
 gi|511986203|ref|XP_004810877.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform X5
           [Mustela putorius furo]
 gi|511986205|ref|XP_004810878.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform X6
           [Mustela putorius furo]
          Length = 318

 Score =  205 bits (521), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 121/315 (38%), Positives = 175/315 (55%), Gaps = 32/315 (10%)

Query: 25  LSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSH 84
           +SS E+ + G+V+G+V+R + SPLDV+KIR QLQ          R   S    KY+G+  
Sbjct: 13  ISSFEVAVAGSVSGLVTRVMISPLDVIKIRFQLQ--------IERLSRSDPGAKYHGILQ 64

Query: 85  AIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTL 144
           A + I++EEG    W G++ A+ L + YGAVQFL++  +  L  R  +     F ++   
Sbjct: 65  AGRQILQEEGPTAFWKGHVPAQLLSIGYGAVQFLSFELLTELVHRATTYDARDFSVH--- 121

Query: 145 QPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVT 204
             F+ G +S S AT+   P D+LRTRFAAQGE ++Y  LR+AV  +Y  EG   FY+G+ 
Sbjct: 122 --FVCGGLSASAATLAVQPVDVLRTRFAAQGEPKVYKTLRDAVVTMYRTEGPLVFYKGLN 179

Query: 205 ASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWF--------HNLRATEDLLSGAIAGIV 256
            +++ I PY G  F  Y  LK L       H W          NL+   +LL G+ AG++
Sbjct: 180 PTLIAIFPYAGFQFSFYNALKHL-------HEWVLPAEGRKNENLK---NLLCGSGAGVI 229

Query: 257 SKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPA 316
           SK   +PLDL +KRLQV G  +       V  Y   +  C +Q+LR +G  GL+KGL P+
Sbjct: 230 SKTLTYPLDLFKKRLQVGGFEQARATFGQVRSY-RGLLDCAQQVLREEGPTGLFKGLSPS 288

Query: 317 LIKSAPVSAVTFFVY 331
           L+K+A  +   FF Y
Sbjct: 289 LLKAALSTGFVFFWY 303



>gi|170037007|ref|XP_001846352.1| mitochondrial deoxynucleotide carrier [Culex quinquefasciatus]
 gi|167879980|gb|EDS43363.1| mitochondrial deoxynucleotide carrier [Culex quinquefasciatus]
          Length = 362

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 120/317 (37%), Positives = 175/317 (55%), Gaps = 20/317 (6%)

Query: 27  SIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAI 86
           S   GI G  A  V+RF+  PLDV+KIR QLQ    + PLS  H  S    KY  +  + 
Sbjct: 9   SSNTGIAGGFAACVTRFICQPLDVLKIRFQLQ----VEPLSEDHMTS----KYRTIVQST 60

Query: 87  KLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQP 146
           +L+ +EEG+R  W G+  A+ L + YG  QF +Y     L +R  +     F  +  ++ 
Sbjct: 61  RLVYQEEGLRAFWKGHNPAQVLSIIYGVSQFSSYEHCNALLRRFAT-----FEEHHNVRN 115

Query: 147 FLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTAS 206
           F+ GA+SG+ AT++T P D++RTR  +Q   R Y      ++ IY+QEG RG YRG++ S
Sbjct: 116 FMCGALSGTVATVITLPLDVVRTRLISQDRNRGYKNSVQGLRMIYMQEGIRGMYRGLSPS 175

Query: 207 VVQIIPYMGLVFGSYEFLKKLFRKL--EDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPL 264
           V+QI P  G  F  Y     LFRK    +  +    L A E L+ G +AGI +K  V+PL
Sbjct: 176 VLQIAPLTGGQFMFYNIFGSLFRKYFKSEATVKGEPLPAIELLICGGLAGICTKLMVYPL 235

Query: 265 DLVRKRLQVQG--PNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAP 322
           DL +KR+Q+QG   +R+ +    V     S+  C+  I++ +G  GLYKGL PAL+K+  
Sbjct: 236 DLAKKRMQIQGFAKSRQTFGRHFV---CGSMANCMYNIVKQEGFVGLYKGLHPALLKACF 292

Query: 323 VSAVTFFVYGYTKRLLE 339
           +SA  F +Y      L+
Sbjct: 293 MSAFYFAIYDEMPSFLD 309



 Score = 81.6 bits (200), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 61/206 (29%), Positives = 96/206 (46%), Gaps = 25/206 (12%)

Query: 148 LSGAISGSTATIVTYPFDLLRTRFAAQ----GEKRIYIGLRNAVQQ---IYVQEGYRGFY 200
           ++G  +      +  P D+L+ RF  Q     E  +    R  VQ    +Y +EG R F+
Sbjct: 14  IAGGFAACVTRFICQPLDVLKIRFQLQVEPLSEDHMTSKYRTIVQSTRLVYQEEGLRAFW 73

Query: 201 RGVTASVVQIIPYMGLVFGSYEFLKKLFRKLE--DKHIWFHNLRATEDLLSGAIAGIVSK 258
           +G   + V  I Y    F SYE    L R+    ++H   HN+R   + + GA++G V+ 
Sbjct: 74  KGHNPAQVLSIIYGVSQFSSYEHCNALLRRFATFEEH---HNVR---NFMCGALSGTVAT 127

Query: 259 AGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALI 318
               PLD+VR RL  Q  NR          Y +S+   ++ I   +GI G+Y+GL P+++
Sbjct: 128 VITLPLDVVRTRLISQDRNRG---------YKNSV-QGLRMIYMQEGIRGMYRGLSPSVL 177

Query: 319 KSAPVSAVTFFVYGYTKRLLEKLHSS 344
           + AP++   F  Y     L  K   S
Sbjct: 178 QIAPLTGGQFMFYNIFGSLFRKYFKS 203



>gi|440895189|gb|ELR47450.1| Mitochondrial thiamine pyrophosphate carrier [Bos grunniens mutus]
          Length = 318

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 119/309 (38%), Positives = 177/309 (57%), Gaps = 18/309 (5%)

Query: 24  QLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMS 83
            +S++E+ + G+V+G+V+R + SPLDV+KIR QLQ    I  LS    N+    KY+G+ 
Sbjct: 12  DISNVEVAVAGSVSGLVTRVLISPLDVIKIRFQLQ----IERLSRSDPNA----KYHGIL 63

Query: 84  HAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKT 143
            A + I++EEG    W G++ A+ L + YGAVQFL++  +  L  R        F ++  
Sbjct: 64  QAGRQILQEEGPTAFWKGHIPAQLLSIGYGAVQFLSFEVLTELVHRASVRDARDFSVH-- 121

Query: 144 LQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGV 203
              FL G +S   AT+  +P D+LRTRFAAQGE R+Y  LR+AV  +Y  EG   FY+G+
Sbjct: 122 ---FLCGGLSACVATLAVHPVDVLRTRFAAQGEPRVYKTLRDAVVTMYRTEGPLVFYKGL 178

Query: 204 TASVVQIIPYMGLVFGSYEFLKKLFR-KLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVF 262
             +++ I PY G  F  Y  LK+ +   L  +     N +   +LL G+ AG++SK   +
Sbjct: 179 NPTLIAIFPYAGFQFSIYSSLKRAYEWALPAEGKKNGNFK---NLLCGSGAGVISKTLTY 235

Query: 263 PLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAP 322
           PLDL +KRLQV G  +       V  Y   +  C  Q+LR +G  G +KGL P+L+K+A 
Sbjct: 236 PLDLFKKRLQVGGFEQARASFGQVRSY-KGLLDCAGQVLREEGAQGCFKGLSPSLLKAAL 294

Query: 323 VSAVTFFVY 331
            + + FF Y
Sbjct: 295 STGLVFFWY 303



>gi|21313024|ref|NP_080347.1| mitochondrial thiamine pyrophosphate carrier isoform 1 [Mus
           musculus]
 gi|356991183|ref|NP_001239313.1| mitochondrial thiamine pyrophosphate carrier isoform 1 [Mus
           musculus]
 gi|21759094|sp|Q9DAM5.1|TPC_MOUSE RecName: Full=Mitochondrial thiamine pyrophosphate carrier;
           AltName: Full=Solute carrier family 25 member 19
 gi|12838427|dbj|BAB24199.1| unnamed protein product [Mus musculus]
 gi|17390372|gb|AAH18167.1| Solute carrier family 25 (mitochondrial thiamine pyrophosphate
           carrier), member 19 [Mus musculus]
 gi|74196719|dbj|BAE43100.1| unnamed protein product [Mus musculus]
          Length = 318

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 120/309 (38%), Positives = 178/309 (57%), Gaps = 22/309 (7%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           S +E+ + G+V+G V+R + SPLDV+KIR QLQ    I  L     N+    KY+G+  A
Sbjct: 14  SKLEVAVAGSVSGFVTRALISPLDVIKIRFQLQ----IERLCPSDPNA----KYHGIFQA 65

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQ 145
            K I++EEG R  W G++ A+ L + YGAVQFL + ++  L  + +  Q  +F  +    
Sbjct: 66  AKQILQEEGPRAFWKGHVPAQILSIGYGAVQFLAFEELTELLYQANLYQTHQFSAH---- 121

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTA 205
            F+ G +S  TAT+  +P D+LRTR AAQGE +IY  LR A++ +Y  EG   FY+G+T 
Sbjct: 122 -FVCGGLSAGTATLTVHPVDVLRTRLAAQGEPKIYNNLREAIRTMYKTEGPFVFYKGLTP 180

Query: 206 SVVQIIPYMGLVFGSYEFLKKLFRKL---EDKHIWFHNLRATEDLLSGAIAGIVSKAGVF 262
           +V+ I PY GL F  Y  LK+ +  L   + K     NL+   +LL G  +G++SK   +
Sbjct: 181 TVIAIFPYAGLQFSCYRSLKRAYDWLIPPDGKQT--GNLK---NLLCGCGSGVISKTFTY 235

Query: 263 PLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAP 322
           PLDL++KRLQV G          V  Y   +    +Q+L+ +G  G +KGL P+L+K+A 
Sbjct: 236 PLDLIKKRLQVGGFEHARSAFGQVRSY-RGLLDLTQQVLQEEGTRGFFKGLSPSLMKAAL 294

Query: 323 VSAVTFFVY 331
            +   FF Y
Sbjct: 295 STGFMFFWY 303



 Score = 81.6 bits (200), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 57/214 (26%), Positives = 95/214 (44%), Gaps = 29/214 (13%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIR 91
           +CG ++   +     P+DV++ RL  Q G P              K YN +  AI+ + +
Sbjct: 123 VCGGLSAGTATLTVHPVDVLRTRLAAQ-GEP--------------KIYNNLREAIRTMYK 167

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGA 151
            EG    + G          Y  +QF  Y  ++  +  +     ++ G    L+  L G 
Sbjct: 168 TEGPFVFYKGLTPTVIAIFPYAGLQFSCYRSLKRAYDWLIPPDGKQTG---NLKNLLCGC 224

Query: 152 ISGSTATIVTYPFDLLRTRF---------AAQGEKRIYIGLRNAVQQIYVQEGYRGFYRG 202
            SG  +   TYP DL++ R          +A G+ R Y GL +  QQ+  +EG RGF++G
Sbjct: 225 GSGVISKTFTYPLDLIKKRLQVGGFEHARSAFGQVRSYRGLLDLTQQVLQEEGTRGFFKG 284

Query: 203 VTASVVQIIPYMGLVFGSYEFLKKLFRKL--EDK 234
           ++ S+++     G +F  YE    LF  +  ED+
Sbjct: 285 LSPSLMKAALSTGFMFFWYELFCNLFHCIRREDR 318



>gi|256838113|ref|NP_001157986.1| mitochondrial thiamine pyrophosphate carrier [Sus scrofa]
 gi|255964668|gb|ACU44651.1| solute carrier family 25 member 19 [Sus scrofa]
          Length = 318

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 122/323 (37%), Positives = 181/323 (56%), Gaps = 22/323 (6%)

Query: 25  LSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSH 84
           +S++E+ + G+V+G+V+R + SPLDV+KIR QLQ    I  LS    N+    KY+G+  
Sbjct: 13  ISNLEVAVAGSVSGLVTRAMISPLDVIKIRFQLQ----IERLSRSDPNA----KYHGILQ 64

Query: 85  AIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTL 144
           A + I++EEG    W G++ A+ L + YGAVQFL++  +  L  R        F ++   
Sbjct: 65  AGRQILQEEGPTAFWKGHIPAQLLSIGYGAVQFLSFEVLTELVHRASVRDARDFSVH--- 121

Query: 145 QPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVT 204
             F+ G +S   AT+  +P D+LRTR+AAQGE R+Y  LR+AV  +Y  EG   FY+G+T
Sbjct: 122 --FVCGGLSACVATLTMHPLDVLRTRYAAQGEPRVYRALRDAVVTMYRTEGPAVFYKGLT 179

Query: 205 ASVVQIIPYMGLVFGSYEFLKKLFR---KLEDKHIWFHNLRATEDLLSGAIAGIVSKAGV 261
            +++ I PY G  F  Y  LK +       EDK     N +   +LL G+ AG++SK   
Sbjct: 180 PTLLAIFPYAGFQFAFYSSLKHVGEWAMPSEDKTD--GNFK---NLLCGSGAGVISKTLT 234

Query: 262 FPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSA 321
           +PLDL +KRLQV G  +       V  Y   +  C +Q+LR +G  G +KGL P+L+K+A
Sbjct: 235 YPLDLFKKRLQVGGFEQARASFGQVRSY-KGLLDCARQVLREEGAQGFFKGLSPSLLKAA 293

Query: 322 PVSAVTFFVYGYTKRLLEKLHSS 344
             +   FF Y     L   L  +
Sbjct: 294 LSTGFMFFWYELVCNLFHHLRKA 316



>gi|301768969|ref|XP_002919889.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like
           [Ailuropoda melanoleuca]
 gi|281350033|gb|EFB25617.1| hypothetical protein PANDA_008567 [Ailuropoda melanoleuca]
          Length = 318

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 122/315 (38%), Positives = 175/315 (55%), Gaps = 32/315 (10%)

Query: 25  LSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSH 84
           +SS E+ + G+V+G+V+R + SPLDV+KIR QLQ    I  LS     S    KY G+  
Sbjct: 13  ISSFEVAVAGSVSGLVTRVMVSPLDVIKIRFQLQ----IERLS----RSDPSAKYYGILQ 64

Query: 85  AIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTL 144
           A + I++EEG+   W G++ A+ L + YGAVQFL++  +  L  R        F ++   
Sbjct: 65  AGRQILQEEGLAAFWKGHVPAQLLSIGYGAVQFLSFELLTELVHRATEYDARDFSVH--- 121

Query: 145 QPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVT 204
             F  G +S S AT+   P D+LRTRFAAQGE ++Y  LR+AV  +Y  EG   FY+G+ 
Sbjct: 122 --FACGGLSASAATLAVQPVDVLRTRFAAQGEPKVYKTLRDAVVTMYRTEGPLVFYKGLN 179

Query: 205 ASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWF--------HNLRATEDLLSGAIAGIV 256
            +++ I PY G  F  Y  LK +       H W          NL+   +LL G+ AG++
Sbjct: 180 PTLIAIFPYAGFQFSFYSALKHV-------HEWVLPAQGRKNENLK---NLLCGSGAGVI 229

Query: 257 SKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPA 316
           SK   +PLDL++KRLQV G  R       V  Y   +  C +Q+LR +G  G +KGL P+
Sbjct: 230 SKTLTYPLDLLKKRLQVGGFERARATFGQVRSY-RGLLHCAQQVLREEGPTGFFKGLSPS 288

Query: 317 LIKSAPVSAVTFFVY 331
           L+K+A  +   FF Y
Sbjct: 289 LLKAALSTGFVFFWY 303



>gi|390360830|ref|XP_784294.3| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like
           [Strongylocentrotus purpuratus]
          Length = 323

 Score =  204 bits (519), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 111/310 (35%), Positives = 182/310 (58%), Gaps = 15/310 (4%)

Query: 24  QLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMS 83
           QL+ ++ GI GA +G  +R    PLDV+KIR QLQ   P+              KY+ + 
Sbjct: 15  QLTKLDYGIAGAASGAFTRVCLQPLDVLKIRFQLQE-EPVK-------RGVPTAKYHSIF 66

Query: 84  HAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNL-FKRIDSNQNEKFGINK 142
            A   IIREEG+  +W G++ A+ L + +G  QF+T+  +  + +  + S+     G+ K
Sbjct: 67  QAAGSIIREEGLSSMWKGHVPAQALSIIFGVAQFVTFEGLTYMAYPLLPSDLTT--GVYK 124

Query: 143 TLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRG 202
            +  F+ G +SG  A++V+ P D+LRTR  +QGE ++Y  + +A+Q +Y++ G R FY+G
Sbjct: 125 PVYHFMCGGVSGCMASLVSLPVDVLRTRLVSQGEPKVYKSISHALQSMYMEAGVRTFYKG 184

Query: 203 VTASVVQIIPYMGLVFGSYEFLKKLFRKLEDK-HIWFHNLRATEDLLSGAIAGIVSKAGV 261
           +T +++ + P  GL FG Y    ++++K +D+ HI  H L   + LL G +AG+ +K+GV
Sbjct: 185 LTPTMMLLFPQTGLQFGFYALFTRMWKKAQDRTHI--HQLSGFQSLLCGGLAGVCAKSGV 242

Query: 262 FPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSA 321
           +PLD+++KRLQVQG         +V  Y+  +  CI  I + +G+ GL+KGL P+L+KS 
Sbjct: 243 YPLDVIKKRLQVQGFEEARRPFGHVTHYTGFLH-CIATIAKQEGMKGLFKGLSPSLLKSF 301

Query: 322 PVSAVTFFVY 331
               + F  Y
Sbjct: 302 FSVGLNFAAY 311



>gi|218783548|ref|NP_001136362.1| mitochondrial thiamine pyrophosphate carrier [Ovis aries]
 gi|213688916|gb|ACJ53941.1| SLC25A19 [Ovis aries]
          Length = 318

 Score =  204 bits (519), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 119/309 (38%), Positives = 177/309 (57%), Gaps = 18/309 (5%)

Query: 24  QLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMS 83
            +S++E+ + G+V+G+V+R + SPLDV+KIR QLQ    I  LS    N+    KY+G+ 
Sbjct: 12  NISNLEVAVAGSVSGLVTRVLISPLDVIKIRFQLQ----IERLSRSDPNA----KYHGIL 63

Query: 84  HAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKT 143
            A + I++EEG    W G++ A+ L + YGAVQFL++  +  L  R        F ++  
Sbjct: 64  QAGRQILQEEGPTAFWKGHIPAQLLSIGYGAVQFLSFEVLTELVHRASVRDARDFSVH-- 121

Query: 144 LQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGV 203
              FL G +S   AT+  +P D+LRTRFAAQGE R+Y  LR+AV  +Y  EG   FY+G+
Sbjct: 122 ---FLCGGLSACVATLAVHPVDVLRTRFAAQGEPRVYKTLRDAVVTMYRTEGPLVFYKGL 178

Query: 204 TASVVQIIPYMGLVFGSYEFLKKLFR-KLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVF 262
             +++ I PY G  F  Y  LK+ +   L  +     N +   +LL G+ AG++SK   +
Sbjct: 179 NPTLIAIFPYAGFQFSIYSSLKRAYEWALPAEGKKNGNFK---NLLCGSGAGVISKTLTY 235

Query: 263 PLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAP 322
           PLDL +KRLQV G  +       V  Y   +  C  Q+LR +G  G +KGL P+L+K+A 
Sbjct: 236 PLDLFKKRLQVGGFEQARASFGQVRSY-KGLLDCAGQVLREEGAQGCFKGLSPSLLKAAL 294

Query: 323 VSAVTFFVY 331
            + + FF Y
Sbjct: 295 STGLVFFWY 303



>gi|472349397|ref|XP_004394399.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform 1
           [Odobenus rosmarus divergens]
          Length = 318

 Score =  204 bits (519), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 120/312 (38%), Positives = 176/312 (56%), Gaps = 26/312 (8%)

Query: 25  LSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSH 84
           +SS E+ + G+V+G+V+R + SPLDV+KIR QLQ    I  LS     S    KY+G+  
Sbjct: 13  ISSFEVAVAGSVSGLVTRVMVSPLDVIKIRFQLQ----IERLS----RSDPGAKYHGILQ 64

Query: 85  AIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTL 144
           A + I++EEG    W G++ A+ L + YGAVQFL++  +  L  +  +     F ++   
Sbjct: 65  AGRQILQEEGPTAFWKGHVPAQLLSIGYGAVQFLSFELLTELVHKATTYDACDFSVH--- 121

Query: 145 QPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVT 204
             F+ G +S S AT+  +P D+LRTRFAAQGE ++Y  LR+AV  +Y  EG   FY+G+ 
Sbjct: 122 --FVCGGLSASAATLAVHPVDVLRTRFAAQGEPKVYKTLRDAVVTMYRTEGPLVFYKGLN 179

Query: 205 ASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWF-----HNLRATEDLLSGAIAGIVSKA 259
            +++ I PY G  F  Y  LK +       H W       N     +LL G+ AG++SK 
Sbjct: 180 PTLIAIFPYAGFQFSFYSALKHV-------HKWVLPAEGRNNEHLRNLLCGSGAGVLSKT 232

Query: 260 GVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIK 319
             +PLDL +KRLQV G  R       V  Y   +  C +Q+L+ +G  GL+KGL P+L+K
Sbjct: 233 LTYPLDLFKKRLQVGGFERARVTFGQVRSY-RGLLDCAQQVLQEEGPTGLFKGLSPSLLK 291

Query: 320 SAPVSAVTFFVY 331
           +A  +   FF Y
Sbjct: 292 AAFSTGFVFFWY 303



>gi|466036884|ref|XP_004275520.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Orcinus
           orca]
          Length = 318

 Score =  204 bits (519), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 118/312 (37%), Positives = 174/312 (55%), Gaps = 26/312 (8%)

Query: 25  LSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSH 84
           +S++E+ + G+V+G+V+R + SPLDV+KIR QLQ    I  LS    N+    KY+G+  
Sbjct: 13  VSNLEVAVAGSVSGLVTRVLISPLDVIKIRFQLQ----IERLSRSDPNA----KYHGILQ 64

Query: 85  AIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTL 144
           A + I++EEG    W G++ A+ L + YGAVQFL++  +  L  R        F ++   
Sbjct: 65  AGRQILQEEGPTAFWKGHIPAQLLSIGYGAVQFLSFEVLTELVHRASVRDARDFSVH--- 121

Query: 145 QPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVT 204
             F+ G +S   AT+  +P D+LRTRFAAQGE R+Y  LRNAV  +Y  EG   FY+G+ 
Sbjct: 122 --FVCGGLSACVATLAVHPVDVLRTRFAAQGEPRVYKTLRNAVVTMYRTEGPLVFYKGLN 179

Query: 205 ASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRAT-----EDLLSGAIAGIVSKA 259
            +++ I PY G  F  Y  LK  +        W            ++LL G+ AG++SK 
Sbjct: 180 PTLIAIFPYAGFQFSFYSSLKHAYE-------WAMPAEGKKNGNFKNLLCGSGAGVISKT 232

Query: 260 GVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIK 319
             +PLDL +KRLQV G  +       V  Y   +  C +Q+LR +G  G +KGL P+L+K
Sbjct: 233 LTYPLDLFKKRLQVGGFEQARASFGQVRSY-KGLLDCARQVLREEGAQGCFKGLAPSLLK 291

Query: 320 SAPVSAVTFFVY 331
           +A  +   FF Y
Sbjct: 292 AALSTGFVFFWY 303



>gi|470605014|ref|XP_004313688.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Tursiops
           truncatus]
          Length = 318

 Score =  204 bits (519), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 118/312 (37%), Positives = 174/312 (55%), Gaps = 26/312 (8%)

Query: 25  LSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSH 84
           +S++E+ + G+V+G+V+R + SPLDV+KIR QLQ    I  LS    N+    KY+G+  
Sbjct: 13  VSNLEVAVAGSVSGLVTRVLISPLDVIKIRFQLQ----IERLSRSDPNA----KYHGILQ 64

Query: 85  AIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTL 144
           A + I++EEG    W G++ A+ L + YGAVQFL++  +  L  R        F ++   
Sbjct: 65  AGRQILQEEGPTAFWKGHIPAQLLSIGYGAVQFLSFEVLTELVHRASVRDARDFSVH--- 121

Query: 145 QPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVT 204
             F+ G +S   AT+  +P D+LRTRFAAQGE R+Y  LRNAV  +Y  EG   FY+G+ 
Sbjct: 122 --FVCGGLSACVATLAVHPVDVLRTRFAAQGEPRVYKTLRNAVVTMYRTEGPLVFYKGLN 179

Query: 205 ASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRAT-----EDLLSGAIAGIVSKA 259
            +++ I PY G  F  Y  LK  +        W            ++LL G+ AG++SK 
Sbjct: 180 PTLIAIFPYAGFQFSFYSSLKHAYE-------WAMPAEGKKNGNFKNLLCGSGAGVISKT 232

Query: 260 GVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIK 319
             +PLDL +KRLQV G  +       V  Y   +  C +Q+LR +G  G +KGL P+L+K
Sbjct: 233 LTYPLDLFKKRLQVGGFEQARASFGQVRSY-KGLLDCARQVLREEGAQGCFKGLAPSLLK 291

Query: 320 SAPVSAVTFFVY 331
           +A  +   FF Y
Sbjct: 292 AALSTGFVFFWY 303



>gi|513214514|ref|XP_004946425.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform X3
           [Gallus gallus]
          Length = 449

 Score =  204 bits (518), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 121/324 (37%), Positives = 184/324 (56%), Gaps = 18/324 (5%)

Query: 22  ASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNG 81
           A  +S++E    G+ +G V+R + SPLDV+KIR QLQ    I  LSS+   +    KY+G
Sbjct: 135 AKCVSTVEAAAAGSASGFVTRVLISPLDVIKIRFQLQ----IERLSSKTPGA----KYHG 186

Query: 82  MSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGIN 141
           +  A++ I +EEG+   W G++ A+ L + YGAVQF+ +  +  L   + S     +   
Sbjct: 187 ILQAVRCIFQEEGMLAFWKGHVPAQLLSVGYGAVQFMAFESLTKLVHNVTS-----YNAR 241

Query: 142 KTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYR 201
            +   F+ G +S  TAT+   P D LRTRFAAQGE ++Y  L +AV  +Y  EG R FYR
Sbjct: 242 NSFVHFICGGLSACTATVAVQPVDTLRTRFAAQGEPKVYHNLHHAVVTMYQTEGPRTFYR 301

Query: 202 GVTASVVQIIPYMGLVFGSYEFLKKLF-RKLEDKHIWFHNLRATEDLLSGAIAGIVSKAG 260
           G+T +V+ + PY G  F  Y  L++   R + D+     N++   +L+ G+ AGI+SK  
Sbjct: 302 GLTPTVIAVFPYAGFQFSFYNILQQFSERMIPDEGKEGGNVK---NLVCGSCAGIISKTL 358

Query: 261 VFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKS 320
            +P DLV+KRLQV G          V +Y   +  CI+QI++ +G  G +KGL P+L+K+
Sbjct: 359 TYPFDLVKKRLQVGGFEHARAAFGQVRIY-RGLLDCIRQIMQEEGPGGFFKGLSPSLLKA 417

Query: 321 APVSAVTFFVYGYTKRLLEKLHSS 344
           A  + + FF Y     LL  L ++
Sbjct: 418 AVSTGLIFFTYELFCSLLCALKNA 441



>gi|512890925|ref|XP_004896960.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform X1
           [Heterocephalus glaber]
 gi|512998315|ref|XP_004860714.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform X1
           [Heterocephalus glaber]
 gi|351707859|gb|EHB10778.1| Mitochondrial thiamine pyrophosphate carrier [Heterocephalus
           glaber]
          Length = 318

 Score =  204 bits (518), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 121/307 (39%), Positives = 174/307 (56%), Gaps = 18/307 (5%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           S  E+ + G+V+G+V+R + SPLDV+KIR QLQ    I  LS    +     KY+G+  A
Sbjct: 14  SKFEVAVAGSVSGLVTRVLISPLDVIKIRFQLQ----IERLS----HGDPKAKYHGILQA 65

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQ 145
            + I REEG    W G++ A+ L + YGAVQFL++  +  L  R +     +F  +    
Sbjct: 66  SRQIFREEGPTAFWKGHIPAQLLSVGYGAVQFLSFQLLTELVHRANVYDTHEFSAH---- 121

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTA 205
            F+ G +S   AT+  +P D+LRTRFAAQGE R+Y  L++AV  +Y  EG   FY+G+  
Sbjct: 122 -FVCGGLSACAATLTIHPVDVLRTRFAAQGEPRVYKTLQDAVVTMYRTEGPLVFYKGLAP 180

Query: 206 SVVQIIPYMGLVFGSYEFLKKLFR-KLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPL 264
           +++ I PY GL F  Y  LK  +   +        NL+   +LL G+ AGI+SK   +PL
Sbjct: 181 TLIAIFPYAGLQFSCYRSLKHAYDWAIPADGKQTGNLK---NLLCGSGAGIISKTLTYPL 237

Query: 265 DLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVS 324
           DL +KRLQV G          V  Y + +  CIKQ+LR +G  G +KGL P+L+K+A  +
Sbjct: 238 DLFKKRLQVGGFEHARAAFGQVRSY-TGLLDCIKQVLREEGGRGFFKGLSPSLLKAAIST 296

Query: 325 AVTFFVY 331
              FF Y
Sbjct: 297 GFVFFWY 303



>gi|255551717|ref|XP_002516904.1| Mitochondrial deoxynucleotide carrier, putative [Ricinus communis]
 gi|223543992|gb|EEF45518.1| Mitochondrial deoxynucleotide carrier, putative [Ricinus communis]
          Length = 331

 Score =  204 bits (518), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 119/322 (36%), Positives = 183/322 (56%), Gaps = 23/322 (7%)

Query: 34  GAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTL---KKYNGMSHAIKLII 90
           GA++G +SR V SPLDV+KIR Q+Q    + P SS     G +    KY GM  A K I 
Sbjct: 17  GAISGAISRTVTSPLDVIKIRFQVQ----LEPTSSWALVRGNMIGQSKYTGMLQAAKDIF 72

Query: 91  REEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLS- 149
           REEG+ G W GN+ A  + + Y A+QF   H+++ +      ++N     +  L P+LS 
Sbjct: 73  REEGLPGFWRGNVPALLMVMPYTAIQFTVLHKLKTVAAGSSKSEN-----HIQLSPYLSY 127

Query: 150 --GAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASV 207
             GA++G  AT+ +YPFDLLRT  A+QGE ++Y  +R A   I    G++G Y G++ ++
Sbjct: 128 ISGALAGCAATVGSYPFDLLRTILASQGEPKVYPTMRYAFIDIIRTRGFKGLYAGLSPTL 187

Query: 208 VQIIPYMGLVFGSYEFLKKLFRKLE------DKHIWFHNLRATEDL-LSGAIAGIVSKAG 260
           V+IIPY GL FG+Y+  K+                +  N  ++  L + G  AG  +K  
Sbjct: 188 VEIIPYAGLQFGTYDTFKRWMMAWNCRRSSSTSSTYIDNSPSSFQLFVCGLAAGTCAKLV 247

Query: 261 VFPLDLVRKRLQVQGPNRKDYFISNVPLYS-SSIFICIKQILRSDGIFGLYKGLMPALIK 319
             PLD+V+KR Q++G  R   + + V   +  ++   +++IL+++G  GLYKG++P+ IK
Sbjct: 248 CHPLDVVKKRFQIEGLQRHPKYGARVEHRAYRNMADALRRILQAEGWAGLYKGILPSTIK 307

Query: 320 SAPVSAVTFFVYGYTKRLLEKL 341
           +AP  AVTF  Y +T   LE +
Sbjct: 308 AAPAGAVTFVAYEFTSDWLESI 329



 Score = 87.0 bits (214), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 63/215 (29%), Positives = 100/215 (46%), Gaps = 29/215 (13%)

Query: 140 INKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGE--------------KRIYIGLRN 185
           I + L    +GAISG+ +  VT P D+++ RF  Q E              +  Y G+  
Sbjct: 7   IKRALIDTTAGAISGAISRTVTSPLDVIKIRFQVQLEPTSSWALVRGNMIGQSKYTGMLQ 66

Query: 186 AVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLF--RKLEDKHIWFHNLRA 243
           A + I+ +EG  GF+RG   +++ ++PY  + F     LK +       + HI    L  
Sbjct: 67  AAKDIFREEGLPGFWRGNVPALLMVMPYTAIQFTVLHKLKTVAAGSSKSENHI---QLSP 123

Query: 244 TEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRS 303
               +SGA+AG  +  G +P DL+R  L  QG  +         +Y +  +  I  I+R+
Sbjct: 124 YLSYISGALAGCAATVGSYPFDLLRTILASQGEPK---------VYPTMRYAFI-DIIRT 173

Query: 304 DGIFGLYKGLMPALIKSAPVSAVTFFVYGYTKRLL 338
            G  GLY GL P L++  P + + F  Y   KR +
Sbjct: 174 RGFKGLYAGLSPTLVEIIPYAGLQFGTYDTFKRWM 208



>gi|507979399|ref|XP_004693552.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Condylura
           cristata]
          Length = 319

 Score =  204 bits (518), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 119/322 (36%), Positives = 180/322 (55%), Gaps = 16/322 (4%)

Query: 25  LSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSH 84
           +SS+E+   G+V+G+V+R + SPLDV+KIR QLQ    I  LS     S    KY+G+  
Sbjct: 13  ISSLEVVAAGSVSGLVTRALISPLDVIKIRFQLQ----IERLS----QSDPSAKYHGILQ 64

Query: 85  AIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTL 144
           A + I+REEG    W G++ A+ L + YGAVQFL++  +  L  R  +    +F ++   
Sbjct: 65  ACRQILREEGPAAFWKGHVPAQLLSVGYGAVQFLSFELLTELAHRAHTGGARQFSVH--- 121

Query: 145 QPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVT 204
             F+ G +S   AT+  +P D+LRTRFAAQGE ++Y  LR AV  +   EG   FYRG+ 
Sbjct: 122 --FVCGGLSACAATLAVHPVDVLRTRFAAQGEPKVYPSLRVAVVTMCRTEGPTVFYRGLA 179

Query: 205 ASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPL 264
            +++ I PY G  F  Y  LK+ +  +             ++LL G+ AG++SK   +PL
Sbjct: 180 PTLMAIFPYAGFQFSFYSSLKQAYEWVLPAEGQGQTNGYLKNLLCGSGAGVISKTLTYPL 239

Query: 265 DLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVS 324
           DL++KRLQV G  +       V  Y   +  C +Q+L+ +G  G +KGL P+L+K+A  +
Sbjct: 240 DLIKKRLQVGGFEQARATFGQVRSY-RGLLDCARQVLQEEGALGFFKGLSPSLLKAALST 298

Query: 325 AVTFFVYGYTKRLLEKLHSSRD 346
            + FF Y +   L    H+  D
Sbjct: 299 GLVFFWYEFFCNLFH--HAKAD 318



>gi|170063406|ref|XP_001867091.1| conserved hypothetical protein [Culex quinquefasciatus]
 gi|167881035|gb|EDS44418.1| conserved hypothetical protein [Culex quinquefasciatus]
          Length = 340

 Score =  203 bits (517), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 118/309 (38%), Positives = 172/309 (55%), Gaps = 20/309 (6%)

Query: 27  SIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAI 86
           S   GI G  A  V+RF+  PLDV+KIR QLQ    + PLS  H  S    KY  +  + 
Sbjct: 9   SSNTGIAGGFAACVTRFICQPLDVLKIRFQLQ----VEPLSEDHMTS----KYRTIVQST 60

Query: 87  KLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQP 146
           +L+ +EEG+R  W G+  A+ L + YG  QF +Y     L +R  +     F  +  ++ 
Sbjct: 61  RLVYQEEGLRAFWKGHNPAQVLSIIYGVSQFSSYEHCNALLRRFAT-----FEEHHNVRN 115

Query: 147 FLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTAS 206
           F+ GA+SG+ AT++T P D++RTR  +Q   R Y      ++ IY+QEG RG YRG++ S
Sbjct: 116 FMCGALSGTVATVITLPLDVVRTRLISQDRNRGYKNSVQGLRMIYMQEGIRGMYRGLSPS 175

Query: 207 VVQIIPYMGLVFGSYEFLKKLFRKL--EDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPL 264
           V+QI P  G  F  Y     LFRK    +  +    L A E L+ G +AGI +K  V+PL
Sbjct: 176 VLQIAPLTGGQFMFYNIFGSLFRKYFKSEATVKGEPLPAIELLICGGLAGICTKLMVYPL 235

Query: 265 DLVRKRLQVQG--PNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAP 322
           DL +KR+Q+QG   +R+ +          S+  C+  I++ +G  GLYKGL PAL+K+  
Sbjct: 236 DLAKKRMQIQGFAKSRQTF---GRHFVCGSMANCMYNIVKQEGFVGLYKGLHPALLKACF 292

Query: 323 VSAVTFFVY 331
           +SA  F +Y
Sbjct: 293 MSAFYFAIY 301



 Score = 81.3 bits (199), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 99/213 (46%), Gaps = 25/213 (11%)

Query: 141 NKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQ----GEKRIYIGLRNAVQQ---IYVQ 193
           +K+    ++G  +      +  P D+L+ RF  Q     E  +    R  VQ    +Y +
Sbjct: 7   DKSSNTGIAGGFAACVTRFICQPLDVLKIRFQLQVEPLSEDHMTSKYRTIVQSTRLVYQE 66

Query: 194 EGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLE--DKHIWFHNLRATEDLLSGA 251
           EG R F++G   + V  I Y    F SYE    L R+    ++H   HN+R   + + GA
Sbjct: 67  EGLRAFWKGHNPAQVLSIIYGVSQFSSYEHCNALLRRFATFEEH---HNVR---NFMCGA 120

Query: 252 IAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYK 311
           ++G V+     PLD+VR RL  Q  NR          Y +S+   ++ I   +GI G+Y+
Sbjct: 121 LSGTVATVITLPLDVVRTRLISQDRNRG---------YKNSV-QGLRMIYMQEGIRGMYR 170

Query: 312 GLMPALIKSAPVSAVTFFVYGYTKRLLEKLHSS 344
           GL P++++ AP++   F  Y     L  K   S
Sbjct: 171 GLSPSVLQIAPLTGGQFMFYNIFGSLFRKYFKS 203



>gi|410902324|ref|XP_003964644.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like
           [Takifugu rubripes]
          Length = 328

 Score =  203 bits (517), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 120/306 (39%), Positives = 168/306 (54%), Gaps = 17/306 (5%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           S  E  + G+ AGMV+R + SP DV+KIR QLQ    I P+SSR        KY G+  A
Sbjct: 14  SPKEAALAGSAAGMVTRALISPFDVLKIRFQLQ----IEPVSSRCPGG----KYWGVFQA 65

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQ 145
            + I+ EEG    W G++ A+ L + YGAVQF ++  +  +        ++  G++    
Sbjct: 66  SRRIVSEEGFSAFWKGHIPAQLLSIGYGAVQFTSFEFLTKVVHETMPYDSQTSGVH---- 121

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTA 205
            F+ G ++  +AT+V  P D LRTRFAAQGE ++Y  LR AV  +   EG   FYRG++ 
Sbjct: 122 -FVCGGLAACSATVVCQPLDTLRTRFAAQGEPKVYSNLRQAVAMMCSTEGASTFYRGLSP 180

Query: 206 SVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLD 265
           +++ + PY GL F  Y F K+L            NLR+   LL G  AGI+SK   +PLD
Sbjct: 181 TLLAVFPYAGLQFFFYNFFKRLLDPPPTAADSGGNLRS---LLCGGGAGIISKTITYPLD 237

Query: 266 LVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSA 325
           L +KRLQV G          V  Y   +  C+ QI + +G  GL+KGL P+LIK+A  + 
Sbjct: 238 LFKKRLQVGGFEEARVQFGQVRCY-RGLVDCVIQIAKEEGARGLFKGLKPSLIKAALSTG 296

Query: 326 VTFFVY 331
            TFF Y
Sbjct: 297 FTFFWY 302



>gi|350539009|ref|NP_001233547.1| mitochondrial thiamine pyrophosphate carrier [Pan troglodytes]
 gi|397484370|ref|XP_003813350.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform 1
           [Pan paniscus]
 gi|397484372|ref|XP_003813351.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform 2
           [Pan paniscus]
 gi|397484374|ref|XP_003813352.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform 3
           [Pan paniscus]
 gi|397484376|ref|XP_003813353.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform 4
           [Pan paniscus]
 gi|343959222|dbj|BAK63468.1| mitochondrial deoxynucleotide carrier [Pan troglodytes]
          Length = 320

 Score =  203 bits (517), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 119/331 (35%), Positives = 186/331 (56%), Gaps = 29/331 (8%)

Query: 4   GYEHKPQNQSPIAEQAVAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPI 63
           GY+ KP  ++            +  ++ + G+V+G+V+R + SP DV+KIR QLQ  R  
Sbjct: 3   GYDPKPDGRNN-----------TKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHER-- 49

Query: 64  NPLSSRHHNSGTLKKYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQM 123
             LS    N+    KY+G+  A + I++EEG    W G++ A+ L + YGAVQFL++  +
Sbjct: 50  --LSRSDPNA----KYHGILQASRQILQEEGPTAFWKGHVPAQILSIGYGAVQFLSFEML 103

Query: 124 QNLFKRIDSNQNEKFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGL 183
             L  R      ++F ++     F+ G ++   AT+  +P D+LRTRFAAQGE ++Y  L
Sbjct: 104 TELVHRGSVYDAQEFSVH-----FVCGGLAACMATLTVHPVDVLRTRFAAQGEPKVYNTL 158

Query: 184 RNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFR-KLEDKHIWFHNLR 242
           R+AV  +Y  EG + FY+G+  +++ I PY GL F  Y  LK L++  +  +     NL 
Sbjct: 159 RHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKKNENL- 217

Query: 243 ATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILR 302
             ++LL G+ AG++SK   +PLDL +KRLQV G          V  Y   +  C KQ+L+
Sbjct: 218 --QNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRKY-KGLMDCAKQVLQ 274

Query: 303 SDGIFGLYKGLMPALIKSAPVSAVTFFVYGY 333
            +G  G +KGL P+L+K+A  +   FF Y +
Sbjct: 275 KEGALGFFKGLSPSLLKAALSTGFMFFSYEF 305



 Score = 95.1 bits (235), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 99/209 (47%), Gaps = 27/209 (12%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIR 91
           +CG +A  ++     P+DV++ R   Q G P              K YN + HA+  + R
Sbjct: 123 VCGGLAACMATLTVHPVDVLRTRFAAQ-GEP--------------KVYNTLRHAVGTMYR 167

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGA 151
            EG +  + G          Y  +QF  Y  +++L+K     + +K   N+ LQ  L G+
Sbjct: 168 SEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKK---NENLQNLLCGS 224

Query: 152 ISGSTATIVTYPFDLLRTRF---------AAQGEKRIYIGLRNAVQQIYVQEGYRGFYRG 202
            +G  +  +TYP DL + R          AA G+ R Y GL +  +Q+  +EG  GF++G
Sbjct: 225 GAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRKYKGLMDCAKQVLQKEGALGFFKG 284

Query: 203 VTASVVQIIPYMGLVFGSYEFLKKLFRKL 231
           ++ S+++     G +F SYEF   +F  +
Sbjct: 285 LSPSLLKAALSTGFMFFSYEFFCNVFHCM 313



>gi|513214885|ref|XP_004946427.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform X5
           [Gallus gallus]
          Length = 322

 Score =  203 bits (517), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 121/324 (37%), Positives = 184/324 (56%), Gaps = 18/324 (5%)

Query: 22  ASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNG 81
           A  +S++E    G+ +G V+R + SPLDV+KIR QLQ    I  LSS+   +    KY+G
Sbjct: 8   AKCVSTVEAAAAGSASGFVTRVLISPLDVIKIRFQLQ----IERLSSKTPGA----KYHG 59

Query: 82  MSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGIN 141
           +  A++ I +EEG+   W G++ A+ L + YGAVQF+ +  +  L   + S     +   
Sbjct: 60  ILQAVRCIFQEEGMLAFWKGHVPAQLLSVGYGAVQFMAFESLTKLVHNVTS-----YNAR 114

Query: 142 KTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYR 201
            +   F+ G +S  TAT+   P D LRTRFAAQGE ++Y  L +AV  +Y  EG R FYR
Sbjct: 115 NSFVHFICGGLSACTATVAVQPVDTLRTRFAAQGEPKVYHNLHHAVVTMYQTEGPRTFYR 174

Query: 202 GVTASVVQIIPYMGLVFGSYEFLKKLF-RKLEDKHIWFHNLRATEDLLSGAIAGIVSKAG 260
           G+T +V+ + PY G  F  Y  L++   R + D+     N++   +L+ G+ AGI+SK  
Sbjct: 175 GLTPTVIAVFPYAGFQFSFYNILQQFSERMIPDEGKEGGNVK---NLVCGSCAGIISKTL 231

Query: 261 VFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKS 320
            +P DLV+KRLQV G          V +Y   +  CI+QI++ +G  G +KGL P+L+K+
Sbjct: 232 TYPFDLVKKRLQVGGFEHARAAFGQVRIY-RGLLDCIRQIMQEEGPGGFFKGLSPSLLKA 290

Query: 321 APVSAVTFFVYGYTKRLLEKLHSS 344
           A  + + FF Y     LL  L ++
Sbjct: 291 AVSTGLIFFTYELFCSLLCALKNA 314



>gi|56090443|ref|NP_001007675.1| mitochondrial thiamine pyrophosphate carrier [Rattus norvegicus]
 gi|50926131|gb|AAH79002.1| Solute carrier family 25 (mitochondrial thiamine pyrophosphate
           carrier), member 19 [Rattus norvegicus]
 gi|149054785|gb|EDM06602.1| rCG35015, isoform CRA_a [Rattus norvegicus]
          Length = 318

 Score =  203 bits (516), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 119/311 (38%), Positives = 180/311 (57%), Gaps = 26/311 (8%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGR--PINPLSSRHHNSGTLKKYNGMS 83
           S +E+ + G+V+G V+R + SPLDV+KIR QLQ  R  P +P +          KY+G+ 
Sbjct: 14  SKLEVAVAGSVSGFVTRALISPLDVIKIRFQLQLERVCPSDPNA----------KYHGIL 63

Query: 84  HAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKT 143
            A K I++EEG R  W G++ A+ L + YGAVQFL + ++  L  + +  Q  +F  +  
Sbjct: 64  QAAKQILQEEGPRAFWKGHVPAQILSIGYGAVQFLAFEELTELLYQANLYQTHQFSAH-- 121

Query: 144 LQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGV 203
              F+ G +S  TAT+  +P D+LRTR AAQGE +IY  LR A++ +Y  EG   FY+G+
Sbjct: 122 ---FVCGGLSAGTATLTVHPVDVLRTRLAAQGEPKIYSNLREAIRTMYRTEGPFVFYKGL 178

Query: 204 TASVVQIIPYMGLVFGSYEFLKKLFRKL---EDKHIWFHNLRATEDLLSGAIAGIVSKAG 260
           T +V+ I PY GL F  Y  LK+ +  +   + K     NL+   +LL G  +G++SK  
Sbjct: 179 TPTVIAIFPYAGLQFSCYRSLKRAYDWIMPPDGKQT--GNLK---NLLCGCGSGVISKTL 233

Query: 261 VFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKS 320
            +PLDL +KRLQV+G          V  Y   + +  +Q+L+ +G  G +KGL P+L+K+
Sbjct: 234 TYPLDLFKKRLQVRGFEHARSAFGQVRSYRGLLDLA-QQVLQHEGTRGFFKGLSPSLMKA 292

Query: 321 APVSAVTFFVY 331
           A  +   FF Y
Sbjct: 293 ALSTGFMFFWY 303



 Score = 81.3 bits (199), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 58/214 (27%), Positives = 94/214 (43%), Gaps = 29/214 (13%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIR 91
           +CG ++   +     P+DV++ RL  Q G P              K Y+ +  AI+ + R
Sbjct: 123 VCGGLSAGTATLTVHPVDVLRTRLAAQ-GEP--------------KIYSNLREAIRTMYR 167

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGA 151
            EG    + G          Y  +QF  Y  ++  +  I     ++ G    L+  L G 
Sbjct: 168 TEGPFVFYKGLTPTVIAIFPYAGLQFSCYRSLKRAYDWIMPPDGKQTG---NLKNLLCGC 224

Query: 152 ISGSTATIVTYPFDLLRTRF---------AAQGEKRIYIGLRNAVQQIYVQEGYRGFYRG 202
            SG  +  +TYP DL + R          +A G+ R Y GL +  QQ+   EG RGF++G
Sbjct: 225 GSGVISKTLTYPLDLFKKRLQVRGFEHARSAFGQVRSYRGLLDLAQQVLQHEGTRGFFKG 284

Query: 203 VTASVVQIIPYMGLVFGSYEFLKKLFR--KLEDK 234
           ++ S+++     G +F  YE    LF   + ED+
Sbjct: 285 LSPSLMKAALSTGFMFFWYELFCNLFHCIRREDR 318



>gi|507640412|ref|XP_004630156.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Octodon
           degus]
          Length = 318

 Score =  202 bits (515), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 119/317 (37%), Positives = 178/317 (56%), Gaps = 18/317 (5%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           S  E+ + G+V+G+V+R + SPLDV+KIR QLQ    I  LS    N+    KY+G+  A
Sbjct: 14  SKFEVAVAGSVSGLVTRVLISPLDVIKIRFQLQ----IEHLSRSDPNA----KYHGILQA 65

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQ 145
            K I++EEG    W G++ A+ L + YGAVQFL++  +  L  +    +  +F  +    
Sbjct: 66  GKRILQEEGPAAFWKGHIPAQLLSIGYGAVQFLSFQLLTELVHQASVYETHEFSAH---- 121

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTA 205
            F+ G +S   AT+  +P D+LRTRFAAQGE R+Y  L++AV  +Y  EG   FY+G+  
Sbjct: 122 -FVCGGLSACAATLAVHPVDVLRTRFAAQGEPRVYKTLQDAVVTMYRTEGPLVFYKGLAP 180

Query: 206 SVVQIIPYMGLVFGSYEFLKKLFR-KLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPL 264
           +++ I PY GL F  Y+ LK+ +   +        NL+   +LL G+ AG++SK   +PL
Sbjct: 181 TLIAIFPYAGLQFSCYKSLKRAYDWAIPADGKQTGNLK---NLLCGSGAGLISKTLTYPL 237

Query: 265 DLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVS 324
           DL +KRLQV G          V  Y   +  C KQ+L  +G  G +KGL P+L+K+A  +
Sbjct: 238 DLFKKRLQVGGFEHARAAFGQVRSY-RGLLDCTKQVLHEEGTHGFFKGLSPSLLKAALST 296

Query: 325 AVTFFVYGYTKRLLEKL 341
              FF Y +   L   +
Sbjct: 297 GFVFFWYEFFCNLFHCM 313



>gi|28386208|gb|AAH46767.1| Solute carrier family 25 (mitochondrial thiamine pyrophosphate
           carrier), member 19 [Mus musculus]
          Length = 318

 Score =  202 bits (514), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 119/309 (38%), Positives = 177/309 (57%), Gaps = 22/309 (7%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           S +E+ + G+V+G V+R + SPLDV+KIR QLQ    I  L     N+    KY+G+  A
Sbjct: 14  SKLEVAVAGSVSGFVTRALISPLDVIKIRFQLQ----IERLCPSDPNA----KYHGIFQA 65

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQ 145
            K I++EEG R  W G++ A+ L + YGAVQFL + ++  L  + +  Q  +F  +    
Sbjct: 66  AKQILQEEGPRAFWKGHVPAQILSIGYGAVQFLAFEELTELLYQANLYQTHQFSAH---- 121

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTA 205
            F+ G +S  TAT+  +P D+LRTR AAQGE +IY  LR A++ +Y  EG   FY+ +T 
Sbjct: 122 -FVCGGLSAGTATLTVHPVDVLRTRLAAQGEPKIYNNLREAIRTMYKTEGPFVFYKALTP 180

Query: 206 SVVQIIPYMGLVFGSYEFLKKLFRKL---EDKHIWFHNLRATEDLLSGAIAGIVSKAGVF 262
           +V+ I PY GL F  Y  LK+ +  L   + K     NL+   +LL G  +G++SK   +
Sbjct: 181 TVIAIFPYAGLQFSCYRSLKRAYDWLIPPDGKQT--GNLK---NLLCGCGSGVISKTFTY 235

Query: 263 PLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAP 322
           PLDL++KRLQV G          V  Y   +    +Q+L+ +G  G +KGL P+L+K+A 
Sbjct: 236 PLDLIKKRLQVGGFEHARSAFGQVRSY-RGLLDLTQQVLQEEGTRGFFKGLSPSLMKAAL 294

Query: 323 VSAVTFFVY 331
            +   FF Y
Sbjct: 295 STGFMFFWY 303



 Score = 79.3 bits (194), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/214 (26%), Positives = 94/214 (43%), Gaps = 29/214 (13%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIR 91
           +CG ++   +     P+DV++ RL  Q G P              K YN +  AI+ + +
Sbjct: 123 VCGGLSAGTATLTVHPVDVLRTRLAAQ-GEP--------------KIYNNLREAIRTMYK 167

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGA 151
            EG    +            Y  +QF  Y  ++  +  +     ++ G    L+  L G 
Sbjct: 168 TEGPFVFYKALTPTVIAIFPYAGLQFSCYRSLKRAYDWLIPPDGKQTG---NLKNLLCGC 224

Query: 152 ISGSTATIVTYPFDLLRTRF---------AAQGEKRIYIGLRNAVQQIYVQEGYRGFYRG 202
            SG  +   TYP DL++ R          +A G+ R Y GL +  QQ+  +EG RGF++G
Sbjct: 225 GSGVISKTFTYPLDLIKKRLQVGGFEHARSAFGQVRSYRGLLDLTQQVLQEEGTRGFFKG 284

Query: 203 VTASVVQIIPYMGLVFGSYEFLKKLFRKL--EDK 234
           ++ S+++     G +F  YE    LF  +  ED+
Sbjct: 285 LSPSLMKAALSTGFMFFWYELFCNLFHCIRREDR 318



>gi|426346754|ref|XP_004041036.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform 1
           [Gorilla gorilla gorilla]
 gi|426346756|ref|XP_004041037.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform 2
           [Gorilla gorilla gorilla]
 gi|426346758|ref|XP_004041038.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform 3
           [Gorilla gorilla gorilla]
 gi|426346760|ref|XP_004041039.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform 4
           [Gorilla gorilla gorilla]
          Length = 320

 Score =  202 bits (514), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 121/333 (36%), Positives = 185/333 (55%), Gaps = 33/333 (9%)

Query: 4   GYEHKPQNQSPIAEQAVAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPI 63
           GY+ KP  ++            +  ++ + G+V+G+V+R + SP DV+KIR QLQ  R  
Sbjct: 3   GYDPKPDGRNN-----------TKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHER-- 49

Query: 64  NPLSSRHHNSGTLKKYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQM 123
             LS    N+    KY+G+  A + I++EEG    W G++ A+ L + YGAVQFL++  +
Sbjct: 50  --LSRSDPNA----KYHGILQASRQILQEEGPTAFWKGHVPAQILSIGYGAVQFLSFEML 103

Query: 124 QNLFKRIDSNQNEKFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGL 183
             L  R       +F ++     F+ G ++   AT+  +P D+LRTRFAAQGE ++Y  L
Sbjct: 104 TELVHRGSVYDAREFSVH-----FVCGGLAACMATLTVHPVDVLRTRFAAQGEPKVYNTL 158

Query: 184 RNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFR---KLEDKHIWFHN 240
           R+AV  +Y  EG + FY+G+  +++ I PY GL F  Y  LK L++     E K     N
Sbjct: 159 RHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAVPAEGKKN--EN 216

Query: 241 LRATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQI 300
           L   ++LL G+ AG++SK   +PLDL +KRLQV G          V  Y   +  C KQ+
Sbjct: 217 L---QNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRY-KGLMDCAKQV 272

Query: 301 LRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGY 333
           L+ +G  G +KGL P+L+K+A  +   FF Y +
Sbjct: 273 LQKEGALGFFKGLSPSLLKAALSTGFMFFSYEF 305



 Score = 94.7 bits (234), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 99/209 (47%), Gaps = 27/209 (12%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIR 91
           +CG +A  ++     P+DV++ R   Q G P              K YN + HA+  + R
Sbjct: 123 VCGGLAACMATLTVHPVDVLRTRFAAQ-GEP--------------KVYNTLRHAVGTMYR 167

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGA 151
            EG +  + G          Y  +QF  Y  +++L+K     + +K   N+ LQ  L G+
Sbjct: 168 SEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAVPAEGKK---NENLQNLLCGS 224

Query: 152 ISGSTATIVTYPFDLLRTRF---------AAQGEKRIYIGLRNAVQQIYVQEGYRGFYRG 202
            +G  +  +TYP DL + R          AA G+ R Y GL +  +Q+  +EG  GF++G
Sbjct: 225 GAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKG 284

Query: 203 VTASVVQIIPYMGLVFGSYEFLKKLFRKL 231
           ++ S+++     G +F SYEF   +F  +
Sbjct: 285 LSPSLLKAALSTGFMFFSYEFFCNVFHCM 313



>gi|118784876|ref|XP_313991.3| AGAP005113-PA [Anopheles gambiae str. PEST]
 gi|116128253|gb|EAA09401.3| AGAP005113-PA [Anopheles gambiae str. PEST]
          Length = 330

 Score =  202 bits (513), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 119/317 (37%), Positives = 179/317 (56%), Gaps = 37/317 (11%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           +S   GI G  AG ++RF+  PLDV+KIR QLQ    + PLS +H  S    KY  +  +
Sbjct: 8   TSSNSGIAGGFAGCITRFICQPLDVLKIRFQLQ----VEPLSEQHVTS----KYRTIVQS 59

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQ 145
            +L+ REEG+R  W G+  A+ L + YG  QF +Y +  +L + +D+ +  + G N    
Sbjct: 60  TRLVYREEGLRAFWKGHNPAQVLSIIYGVAQFSSYERFNHLLRTVDTFERHQSGRN---- 115

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTA 205
            F+ GA+SG+ AT++T P D++RTR  +Q   R Y      ++ IY  EG RG YRG+  
Sbjct: 116 -FVCGALSGTFATVITLPLDVVRTRLISQDPGRGYRSSVQGLKLIYRHEGVRGLYRGLGP 174

Query: 206 SVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDL------LSGAIAGIVSKA 259
           SV+QI P  G  F  Y     +FR+       + N+ A+E L      + G +AG+ +K 
Sbjct: 175 SVLQIAPLTGGQFMFYNIFGSMFRQ-------YFNISASETLPAIELFICGGMAGLCTKL 227

Query: 260 GVFPLDLVRKRLQVQG--PNRKDY---FISNVPLYSSSIFICIKQILRSDGIFGLYKGLM 314
            V+PLDL +KRLQ+QG   +R+ Y   F+ +      ++F C+  I + +G  GLYKGL 
Sbjct: 228 LVYPLDLAKKRLQIQGFAKSRQTYGRHFVCD------NMFNCLYNIAKQEGPIGLYKGLY 281

Query: 315 PALIKSAPVSAVTFFVY 331
           PAL+K+  +SA  F +Y
Sbjct: 282 PALLKACFMSAFYFAIY 298



>gi|488544752|ref|XP_004463920.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform 1
           [Dasypus novemcinctus]
 gi|488544754|ref|XP_004463921.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform 2
           [Dasypus novemcinctus]
 gi|488544756|ref|XP_004463922.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform 3
           [Dasypus novemcinctus]
          Length = 326

 Score =  202 bits (513), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 118/327 (36%), Positives = 179/327 (54%), Gaps = 26/327 (7%)

Query: 25  LSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSH 84
           +S  E+ + G+++G+V+R + SPLDV+KIR QLQ    I  LS    N+    KY+G+  
Sbjct: 13  ISKFEVAVAGSMSGLVTRALISPLDVIKIRFQLQ----IEHLSHSDPNA----KYHGILQ 64

Query: 85  AIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTL 144
           A + I++EEG    W G++ A+ L + YGAVQFL++  +  L  R       +F ++   
Sbjct: 65  AGRQILQEEGPMAFWKGHIPAQLLSIGYGAVQFLSFELLTELVHRAHKYDAREFSVH--- 121

Query: 145 QPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVT 204
             F+ G +S   +++  +P D+LRTRFAAQGE ++Y  LR AV  +Y  EG   FYRG+ 
Sbjct: 122 --FVCGGLSACMSSLAVHPVDVLRTRFAAQGEPKVYKTLREAVVTMYRTEGPLVFYRGLN 179

Query: 205 ASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRAT-----EDLLSGAIAGIVSKA 259
            +++ I PY G  F  Y   K ++        W    +       ++LL GA AG++SK 
Sbjct: 180 PTLIAIFPYAGFQFSFYSSFKHVYE-------WVMPTKGKKNGNFKNLLCGAGAGVISKT 232

Query: 260 GVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIK 319
             +PLDL +KRLQ++G  +       V  Y + +  C KQIL+ +G  G +KGL P+L+K
Sbjct: 233 LTYPLDLFKKRLQIRGFEQARATFGQVRSY-TGLVDCAKQILQEEGAQGFFKGLSPSLLK 291

Query: 320 SAPVSAVTFFVYGYTKRLLEKLHSSRD 346
           SA  + + FF Y     L   L    D
Sbjct: 292 SAFSTGLMFFWYELFCNLFHHLRRQTD 318



>gi|186928856|ref|NP_068380.3| mitochondrial thiamine pyrophosphate carrier [Homo sapiens]
 gi|186928858|ref|NP_001119593.1| mitochondrial thiamine pyrophosphate carrier [Homo sapiens]
 gi|186928860|ref|NP_001119594.1| mitochondrial thiamine pyrophosphate carrier [Homo sapiens]
 gi|20137652|sp|Q9HC21.1|TPC_HUMAN RecName: Full=Mitochondrial thiamine pyrophosphate carrier;
           AltName: Full=Mitochondrial uncoupling protein 1;
           AltName: Full=Solute carrier family 25 member 19
 gi|10441012|gb|AAG16903.1|AF182404_1 mitochondrial uncoupling protein 1 [Homo sapiens]
 gi|12654491|gb|AAH01075.1| Solute carrier family 25 (mitochondrial thiamine pyrophosphate
           carrier), member 19 [Homo sapiens]
 gi|12655374|emb|CAC27560.1| thiamine pyrophosphate carrier [Homo sapiens]
 gi|13477293|gb|AAH05120.1| Solute carrier family 25 (mitochondrial thiamine pyrophosphate
           carrier), member 19 [Homo sapiens]
 gi|13940227|emb|CAC37793.1| deoxynucleotide carrier [Homo sapiens]
 gi|57997187|emb|CAI46136.1| hypothetical protein [Homo sapiens]
 gi|119609673|gb|EAW89267.1| solute carrier family 25 (mitochondrial deoxynucleotide carrier),
           member 19, isoform CRA_a [Homo sapiens]
 gi|119609674|gb|EAW89268.1| solute carrier family 25 (mitochondrial deoxynucleotide carrier),
           member 19, isoform CRA_a [Homo sapiens]
 gi|119609675|gb|EAW89269.1| solute carrier family 25 (mitochondrial deoxynucleotide carrier),
           member 19, isoform CRA_a [Homo sapiens]
 gi|123984681|gb|ABM83686.1| solute carrier family 25 (mitochondrial deoxynucleotide carrier),
           member 19 [synthetic construct]
 gi|123998680|gb|ABM86983.1| solute carrier family 25 (mitochondrial deoxynucleotide carrier),
           member 19 [synthetic construct]
 gi|193783634|dbj|BAG53545.1| unnamed protein product [Homo sapiens]
          Length = 320

 Score =  202 bits (513), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 117/331 (35%), Positives = 182/331 (54%), Gaps = 29/331 (8%)

Query: 4   GYEHKPQNQSPIAEQAVAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPI 63
           GY+ KP  ++            +  ++ + G+V+G+V+R + SP DV+KIR QLQ     
Sbjct: 3   GYDPKPDGRNN-----------TKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQ----- 46

Query: 64  NPLSSRHHNSGTLKKYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQM 123
                R   S    KY+G+  A + I++EEG    W G++ A+ L + YGAVQFL++  +
Sbjct: 47  ---HERLSRSDPSAKYHGILQASRQILQEEGPTAFWKGHVPAQILSIGYGAVQFLSFEML 103

Query: 124 QNLFKRIDSNQNEKFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGL 183
             L  R       +F ++     F+ G ++   AT+  +P D+LRTRFAAQGE ++Y  L
Sbjct: 104 TELVHRGSVYDAREFSVH-----FVCGGLAACMATLTVHPVDVLRTRFAAQGEPKVYNTL 158

Query: 184 RNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFR-KLEDKHIWFHNLR 242
           R+AV  +Y  EG + FY+G+  +++ I PY GL F  Y  LK L++  +  +     NL 
Sbjct: 159 RHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKKNENL- 217

Query: 243 ATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILR 302
             ++LL G+ AG++SK   +PLDL +KRLQV G          V  Y   +  C KQ+L+
Sbjct: 218 --QNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRY-KGLMDCAKQVLQ 274

Query: 303 SDGIFGLYKGLMPALIKSAPVSAVTFFVYGY 333
            +G  G +KGL P+L+K+A  +   FF Y +
Sbjct: 275 KEGALGFFKGLSPSLLKAALSTGFMFFSYEF 305



 Score = 94.7 bits (234), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 99/209 (47%), Gaps = 27/209 (12%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIR 91
           +CG +A  ++     P+DV++ R   Q G P              K YN + HA+  + R
Sbjct: 123 VCGGLAACMATLTVHPVDVLRTRFAAQ-GEP--------------KVYNTLRHAVGTMYR 167

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGA 151
            EG +  + G          Y  +QF  Y  +++L+K     + +K   N+ LQ  L G+
Sbjct: 168 SEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKK---NENLQNLLCGS 224

Query: 152 ISGSTATIVTYPFDLLRTRF---------AAQGEKRIYIGLRNAVQQIYVQEGYRGFYRG 202
            +G  +  +TYP DL + R          AA G+ R Y GL +  +Q+  +EG  GF++G
Sbjct: 225 GAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKG 284

Query: 203 VTASVVQIIPYMGLVFGSYEFLKKLFRKL 231
           ++ S+++     G +F SYEF   +F  +
Sbjct: 285 LSPSLLKAALSTGFMFFSYEFFCNVFHCM 313



>gi|149723307|ref|XP_001495959.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Equus
           caballus]
          Length = 318

 Score =  201 bits (512), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 116/313 (37%), Positives = 174/313 (55%), Gaps = 26/313 (8%)

Query: 24  QLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMS 83
            +S+ E+ + G+V+G+V+R + SPLD++KIR QLQ    I  LS    N+    KY+G+ 
Sbjct: 12  NISNFEVAVAGSVSGLVTRVLISPLDIIKIRFQLQ----IERLSRSDPNA----KYHGIL 63

Query: 84  HAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKT 143
            A + I++EEG    W G++ A+ L + YGAVQFL++  +  L  R   +    F ++  
Sbjct: 64  QAGRQILQEEGPTAFWKGHIPAQLLSIGYGAVQFLSFELLTELVHRASVHDARDFSVH-- 121

Query: 144 LQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGV 203
              F+ G +S   AT+  +P D+LRTRFAAQGE R+Y  LR+AV  +Y  EG   FY+G+
Sbjct: 122 ---FVCGGLSACVATLAVHPVDVLRTRFAAQGEPRVYKTLRDAVVTMYRTEGPLVFYKGL 178

Query: 204 TASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATED-----LLSGAIAGIVSK 258
             +++ I PY G  F  Y  LK  +        W       +D     LL G+ AG++SK
Sbjct: 179 NPTMLAIFPYAGFQFSFYSSLKHAYE-------WVMPAEGRKDGNLKNLLCGSGAGVISK 231

Query: 259 AGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALI 318
              +PLDL +KRLQV G  +       V  Y   +  C +++LR +G  G +KGL P+L+
Sbjct: 232 TLTYPLDLFKKRLQVGGFEQARATFGQVRSY-KGLLDCARRVLREEGAQGFFKGLSPSLL 290

Query: 319 KSAPVSAVTFFVY 331
           K+A  +   FF Y
Sbjct: 291 KAALSTGFVFFWY 303



>gi|505844569|ref|XP_004615775.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Sorex
           araneus]
          Length = 318

 Score =  201 bits (512), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 118/321 (36%), Positives = 182/321 (56%), Gaps = 18/321 (5%)

Query: 25  LSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSH 84
           +SS ++   G++AG+++R + SP+DV+KIR QLQ    +  LS R   +    KY+G+  
Sbjct: 13  VSSAQVAAAGSMAGLITRALISPMDVIKIRFQLQ----VERLSPRDPRA----KYHGILQ 64

Query: 85  AIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQN-EKFGINKT 143
           A + I+REEG R  W G++ A+ L + YG VQF+++  +  L ++     N  KF ++  
Sbjct: 65  AARQILREEGPRAFWKGHVPAQLLSVGYGGVQFMSFETLTELVQKRGGELNPSKFSVH-- 122

Query: 144 LQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGV 203
              FL G +S   AT+   P D+LRTR AAQGE ++Y  L +AV  +Y  EG   FYRG+
Sbjct: 123 ---FLCGGLSACVATLAVQPVDVLRTRLAAQGEPKVYRTLLDAVVTMYRTEGPLVFYRGL 179

Query: 204 TASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFP 263
             +++ I PY G  F  Y  LK+ +  L  +     NL+   +L+ G+ AG++SK   +P
Sbjct: 180 QPTLLAIFPYAGFQFSFYSSLKQAYEWLLPRDSSNGNLK---NLICGSGAGVISKTLTYP 236

Query: 264 LDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPV 323
           LDL +KRLQV+G          V  Y + +  C +Q+LR +G  G +KGL P+L+K+A  
Sbjct: 237 LDLFKKRLQVRGFEHARTNFGQVRRY-TGLRDCARQVLREEGPRGFFKGLSPSLLKAAMS 295

Query: 324 SAVTFFVYGYTKRLLEKLHSS 344
           +   FF Y +   L   L+ S
Sbjct: 296 TGFVFFWYEFICSLFHCLNRS 316



>gi|471367363|ref|XP_004374211.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Trichechus
           manatus latirostris]
          Length = 318

 Score =  201 bits (512), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 118/308 (38%), Positives = 179/308 (58%), Gaps = 18/308 (5%)

Query: 25  LSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSH 84
           +S +E+ + G+V+G+V+R + SPLDV+KIR QLQ    I  LS    +S    KY+G+  
Sbjct: 13  ISKVEVAVAGSVSGLVTRALVSPLDVIKIRFQLQ----IERLS----HSDPSAKYHGILQ 64

Query: 85  AIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTL 144
           A + I++EEG    W G++ A+ L + YGAVQFL++  +  L  R        F ++   
Sbjct: 65  AGRQILQEEGPAAFWKGHIPAQLLSIGYGAVQFLSFDLLTELVHRASVYNARDFSMH--- 121

Query: 145 QPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVT 204
             F+ G +S   AT+  +P D+LRTRFAAQGE R+Y  LR+AV  +Y  EG   FY+G++
Sbjct: 122 --FVCGGLSACVATLAMHPLDVLRTRFAAQGEPRVYKTLRDAVVTMYRTEGPLVFYKGLS 179

Query: 205 ASVVQIIPYMGLVFGSYEFLKKLFR-KLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFP 263
            +++ I PY G  F  Y  LK+ +   +  +     NL+   +LL G+ AG++SK   +P
Sbjct: 180 PTLIAIFPYAGFQFSFYSSLKQAYEWAMPAEGKTNGNLK---NLLCGSGAGVISKTLTYP 236

Query: 264 LDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPV 323
           LDL +KRLQV G  +       V  Y   +  C KQ+L+ +G  G +KGL P+L+K+A  
Sbjct: 237 LDLFKKRLQVGGFEQARVTFGQVRSY-RGLVDCAKQVLQEEGSQGFFKGLSPSLLKAALS 295

Query: 324 SAVTFFVY 331
           + + FF Y
Sbjct: 296 TGLVFFWY 303



>gi|405962037|gb|EKC27751.1| Mitochondrial thiamine pyrophosphate carrier [Crassostrea gigas]
          Length = 322

 Score =  201 bits (511), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 127/324 (39%), Positives = 182/324 (56%), Gaps = 20/324 (6%)

Query: 23  SQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGM 82
           + LSS E  + GAV G VSR +  PLDV+KIR QLQ    + PL     +     KY  +
Sbjct: 10  THLSSTEQALAGAVTGTVSRALFQPLDVLKIRFQLQ----VEPLRKVESS-----KYWSI 60

Query: 83  SHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINK 142
           S A + IIREEG+  LW G++ A+ L + YG VQF+++     +   I       F  +K
Sbjct: 61  SQATQTIIREEGVTALWKGHVPAQLLSVIYGVVQFVSFEAATKVAWNILPEGVYNF--HK 118

Query: 143 TLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRG 202
            L   + G I+G  +TIV  P D++RTR  +QG ++IY  + + V  I   EG RG Y+G
Sbjct: 119 PLTYSVCGGIAGCVSTIVVQPVDVIRTRLISQGNQKIYSSMLSGVLTITRTEGARGLYKG 178

Query: 203 VTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATE---DLLSGAIAGIVSKA 259
           +  ++ QI P +GL FG Y  LK +++K  DK    HN   +E    L+ G+ AG++SK 
Sbjct: 179 LLPAMSQIAPQIGLQFGFYALLKDVWQKFVDK----HNGETSETNGSLVCGSGAGVLSKI 234

Query: 260 GVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIF-GLYKGLMPALI 318
            ++PLD+V+KRLQVQG ++       V  Y   +  C+  I   +GI  G YKGL P+L 
Sbjct: 235 IIYPLDVVKKRLQVQGFDKARAEFGGVRHY-QGMKHCLYTIAMEEGIIHGFYKGLAPSLW 293

Query: 319 KSAPVSAVTFFVYGYTKRLLEKLH 342
           K+A VS  +F+VY    +LLE  H
Sbjct: 294 KAALVSGSSFYVYEKVCQLLELRH 317



>gi|22761199|dbj|BAC11492.1| unnamed protein product [Homo sapiens]
          Length = 320

 Score =  201 bits (510), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 117/331 (35%), Positives = 182/331 (54%), Gaps = 29/331 (8%)

Query: 4   GYEHKPQNQSPIAEQAVAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPI 63
           GY+ KP  ++            +  ++ + G+V+G+V+R + SP DV+KIR QLQ     
Sbjct: 3   GYDPKPDGRNN-----------TKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQ----- 46

Query: 64  NPLSSRHHNSGTLKKYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQM 123
                R   S    KY+G+  A + I++EEG    W G++ A+ L + YGAVQFL++  +
Sbjct: 47  ---HERLSRSDPSAKYHGILQASRQILQEEGPTAFWKGHVPAQILSIGYGAVQFLSFEML 103

Query: 124 QNLFKRIDSNQNEKFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGL 183
             L  R       +F ++     F+ G ++   AT+  +P D+LRTRFAAQGE ++Y  L
Sbjct: 104 TELVHRGSVYDALEFSVH-----FVCGGLAACMATLTVHPVDVLRTRFAAQGEPKVYNTL 158

Query: 184 RNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFR-KLEDKHIWFHNLR 242
           R+AV  +Y  EG + FY+G+  +++ I PY GL F  Y  LK L++  +  +     NL 
Sbjct: 159 RHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKKNENL- 217

Query: 243 ATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILR 302
             ++LL G+ AG++SK   +PLDL +KRLQV G          V  Y   +  C KQ+L+
Sbjct: 218 --QNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRY-KGLMDCAKQVLQ 274

Query: 303 SDGIFGLYKGLMPALIKSAPVSAVTFFVYGY 333
            +G  G +KGL P+L+K+A  +   FF Y +
Sbjct: 275 KEGALGFFKGLSPSLLKAALSTGFMFFSYEF 305



 Score = 94.7 bits (234), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 99/209 (47%), Gaps = 27/209 (12%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIR 91
           +CG +A  ++     P+DV++ R   Q G P              K YN + HA+  + R
Sbjct: 123 VCGGLAACMATLTVHPVDVLRTRFAAQ-GEP--------------KVYNTLRHAVGTMYR 167

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGA 151
            EG +  + G          Y  +QF  Y  +++L+K     + +K   N+ LQ  L G+
Sbjct: 168 SEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKK---NENLQNLLCGS 224

Query: 152 ISGSTATIVTYPFDLLRTRF---------AAQGEKRIYIGLRNAVQQIYVQEGYRGFYRG 202
            +G  +  +TYP DL + R          AA G+ R Y GL +  +Q+  +EG  GF++G
Sbjct: 225 GAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKG 284

Query: 203 VTASVVQIIPYMGLVFGSYEFLKKLFRKL 231
           ++ S+++     G +F SYEF   +F  +
Sbjct: 285 LSPSLLKAALSTGFMFFSYEFFCNVFHCM 313



>gi|62205304|gb|AAH93123.1| Zgc:111878 [Danio rerio]
 gi|182890348|gb|AAI64105.1| Zgc:111878 protein [Danio rerio]
          Length = 313

 Score =  201 bits (510), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 116/309 (37%), Positives = 171/309 (55%), Gaps = 19/309 (6%)

Query: 25  LSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSH 84
           L+  E  + G+ AG+V+R + SPLDVVKIR QLQ    I  +S R        KY G+  
Sbjct: 13  LAPEEAALAGSAAGIVTRALISPLDVVKIRFQLQ----IEKVSWRSRQG----KYWGLWQ 64

Query: 85  AIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTL 144
           A + I+ EEG+   W G++ A+ L + YGAVQF ++  +  L  +     ++  G++   
Sbjct: 65  ATRCILTEEGLPAFWKGHIPAQLLSVCYGAVQFASFEVLTELVHKKTPYNSQTAGVH--- 121

Query: 145 QPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVT 204
             F+ G ++  +AT+   P D LRTRFAAQGE +IY  LR+A+  +   EG   FYRG+T
Sbjct: 122 --FICGGLAACSATVACQPLDTLRTRFAAQGEPKIYRNLRHAIGTMLRSEGPFTFYRGLT 179

Query: 205 ASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPL 264
            ++V + PY GL F  Y  LKKL    + K     +      L+SG+ AG++SK   +P 
Sbjct: 180 PTLVAVFPYAGLQFFFYNILKKLLEHQDTK-----SKAGLHSLISGSCAGVISKTLTYPF 234

Query: 265 DLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVS 324
           DL++KRLQV G          V  Y   +  C+ +I R +G  G +KGL P+L+K+A  +
Sbjct: 235 DLIKKRLQVGGFEEARLKFGEVRTYHGFV-DCVLRIGREEGPRGFFKGLSPSLLKAALST 293

Query: 325 AVTFFVYGY 333
             TFF Y +
Sbjct: 294 GFTFFWYEF 302



 Score = 80.9 bits (198), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 60/201 (29%), Positives = 91/201 (45%), Gaps = 25/201 (12%)

Query: 150 GAISGSTATIVT----YPFDLLRTRFAAQGEKRI-------YIGLRNAVQQIYVQEGYRG 198
            A++GS A IVT     P D+++ RF  Q EK         Y GL  A + I  +EG   
Sbjct: 18  AALAGSAAGIVTRALISPLDVVKIRFQLQIEKVSWRSRQGKYWGLWQATRCILTEEGLPA 77

Query: 199 FYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSK 258
           F++G   + +  + Y  + F S+E L +L  K       +++  A    + G +A   + 
Sbjct: 78  FWKGHIPAQLLSVCYGAVQFASFEVLTELVHKKTP----YNSQTAGVHFICGGLAACSAT 133

Query: 259 AGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALI 318
               PLD +R R   QG           P    ++   I  +LRS+G F  Y+GL P L+
Sbjct: 134 VACQPLDTLRTRFAAQGE----------PKIYRNLRHAIGTMLRSEGPFTFYRGLTPTLV 183

Query: 319 KSAPVSAVTFFVYGYTKRLLE 339
              P + + FF Y   K+LLE
Sbjct: 184 AVFPYAGLQFFFYNILKKLLE 204



>gi|307111556|gb|EFN59790.1| hypothetical protein CHLNCDRAFT_18725 [Chlorella variabilis]
          Length = 354

 Score =  199 bits (507), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 116/337 (34%), Positives = 189/337 (56%), Gaps = 15/337 (4%)

Query: 6   EHKPQNQSPIAEQAVAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINP 65
           + K +   P  +Q++A  +  +      GA+AG V+RFV  PLDV+KIRLQ+Q    + P
Sbjct: 5   KKKGREPDPDEQQSLAPLEAHAALTACAGALAGAVARFVVGPLDVLKIRLQVQ----LEP 60

Query: 66  LSSRHHNSGTLKKYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQN 125
           +++    +     Y  M  A+  I++EEGI+GLW G +  + L + Y AVQF+   Q ++
Sbjct: 61  IAAGAQTA----HYTSMRQALVTIVKEEGIKGLWRGTVPGQLLTVPYTAVQFVALQQCKH 116

Query: 126 LFKRIDSNQNEKFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRN 185
           L ++     +  +   ++  PF+SGA++G+ AT+ +YPFDLLRT  AAQGE  +Y  +  
Sbjct: 117 LARQAGLQDSPHW---QSAVPFVSGAVAGAAATMASYPFDLLRTTLAAQGEPPVYASMTE 173

Query: 186 AVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHN---LR 242
           A + I    G RG YRG+  +V++I+PY  L FG Y+     + ++  +    H      
Sbjct: 174 AARGIVRSNGVRGLYRGLGVTVLEIMPYAALQFGLYDAFNNTYDRIRAQLDPAHAGDPPS 233

Query: 243 ATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNV-PLYSSSIFICIKQIL 301
           + +  + G  AG+++K G  PLD+ +KR QV G  R   +   V P    ++   ++ I 
Sbjct: 234 SMQAFVCGMAAGMLAKLGTHPLDVAKKRFQVAGLQRSTRYGQRVAPEAVRTLRQVVRDIA 293

Query: 302 RSDGIFGLYKGLMPALIKSAPVSAVTFFVYGYTKRLL 338
             +G+ GL+KG MP+++K+AP +AVTF  Y +  R L
Sbjct: 294 MKEGMPGLFKGAMPSILKAAPSAAVTFAAYDFFMRWL 330



 Score = 79.0 bits (193), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 102/207 (49%), Gaps = 23/207 (11%)

Query: 149 SGAISGSTATIVTYPFDLLRTRF-------AAQGEKRIYIGLRNAVQQIYVQEGYRGFYR 201
           +GA++G+ A  V  P D+L+ R        AA  +   Y  +R A+  I  +EG +G +R
Sbjct: 32  AGALAGAVARFVVGPLDVLKIRLQVQLEPIAAGAQTAHYTSMRQALVTIVKEEGIKGLWR 91

Query: 202 GVTASVVQIIPYMGLVFGSYEFLKKLFRK--LEDKHIWFHNLRATEDLLSGAIAGIVSKA 259
           G     +  +PY  + F + +  K L R+  L+D   W    ++    +SGA+AG  +  
Sbjct: 92  GTVPGQLLTVPYTAVQFVALQQCKHLARQAGLQDSPHW----QSAVPFVSGAVAGAAATM 147

Query: 260 GVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIK 319
             +P DL+R  L  QG           P+Y+S +    + I+RS+G+ GLY+GL   +++
Sbjct: 148 ASYPFDLLRTTLAAQG---------EPPVYAS-MTEAARGIVRSNGVRGLYRGLGVTVLE 197

Query: 320 SAPVSAVTFFVYGYTKRLLEKLHSSRD 346
             P +A+ F +Y       +++ +  D
Sbjct: 198 IMPYAALQFGLYDAFNNTYDRIRAQLD 224



>gi|197098834|ref|NP_001127123.1| mitochondrial thiamine pyrophosphate carrier [Pongo abelii]
 gi|66773797|sp|Q5NVC1.1|TPC_PONAB RecName: Full=Mitochondrial thiamine pyrophosphate carrier;
           AltName: Full=Solute carrier family 25 member 19
 gi|56403915|emb|CAI29742.1| hypothetical protein [Pongo abelii]
          Length = 320

 Score =  199 bits (506), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 120/333 (36%), Positives = 184/333 (55%), Gaps = 33/333 (9%)

Query: 4   GYEHKPQNQSPIAEQAVAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPI 63
           GY+ KP  ++            +  ++ + G+V+G+V+R + SP DV+KIR QLQ  R  
Sbjct: 3   GYDPKPDGRNN-----------TKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQHER-- 49

Query: 64  NPLSSRHHNSGTLKKYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQM 123
             LS    N+    KY+G+  A + I++EEG    W G++ A+ L + YGAVQFL++  +
Sbjct: 50  --LSRSDPNA----KYHGILQASRQILQEEGPTAFWKGHIPAQILSIGYGAVQFLSFEML 103

Query: 124 QNLFKRIDSNQNEKFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGL 183
             L  R       +F ++     F+ G ++   AT+  +P D+LRTRFAAQGE ++Y  L
Sbjct: 104 TELVHRGSVYDAREFSVH-----FVCGGLAACMATLTVHPVDVLRTRFAAQGEPKVYNTL 158

Query: 184 RNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFR---KLEDKHIWFHN 240
            +AV  +Y  EG + FY+G+  +++ I PY GL F  Y  LK L++     E K     N
Sbjct: 159 CHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKKN--EN 216

Query: 241 LRATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQI 300
           L   ++LL G+ AG++SK   +PLDL +KRLQV G          V  Y   +  C KQ+
Sbjct: 217 L---QNLLCGSGAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRY-KGLMDCAKQV 272

Query: 301 LRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGY 333
           L+ +G  G +KGL P+L+K+A  +   FF Y +
Sbjct: 273 LQKEGALGFFKGLSPSLLKAALSTGFMFFWYEF 305



 Score = 93.2 bits (230), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 58/209 (27%), Positives = 98/209 (46%), Gaps = 27/209 (12%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIR 91
           +CG +A  ++     P+DV++ R   Q G P              K YN + HA+  + R
Sbjct: 123 VCGGLAACMATLTVHPVDVLRTRFAAQ-GEP--------------KVYNTLCHAVGTMYR 167

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGA 151
            EG +  + G          Y  +QF  Y  +++L+K     + +K   N+ LQ  L G+
Sbjct: 168 SEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAIPAEGKK---NENLQNLLCGS 224

Query: 152 ISGSTATIVTYPFDLLRTRF---------AAQGEKRIYIGLRNAVQQIYVQEGYRGFYRG 202
            +G  +  +TYP DL + R          AA G+ R Y GL +  +Q+  +EG  GF++G
Sbjct: 225 GAGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRRYKGLMDCAKQVLQKEGALGFFKG 284

Query: 203 VTASVVQIIPYMGLVFGSYEFLKKLFRKL 231
           ++ S+++     G +F  YEF   +F  +
Sbjct: 285 LSPSLLKAALSTGFMFFWYEFFCNVFHCM 313



>gi|507672988|ref|XP_004709204.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Echinops
           telfairi]
          Length = 319

 Score =  199 bits (506), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 119/323 (36%), Positives = 177/323 (54%), Gaps = 31/323 (9%)

Query: 17  EQAVAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTL 76
           + +     +S  ++ + G+++G V+R + SPLDV+KIR QLQ  R      SRH      
Sbjct: 5   DPSTDCKNISKFQVAVAGSLSGFVTRALISPLDVIKIRFQLQIER-----LSRHDPQA-- 57

Query: 77  KKYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNE 136
            KY+G+  A + I++EEG    W G++ A+ L + YGAVQFL++  +  L  R       
Sbjct: 58  -KYHGIMQAGRKILQEEGPAAFWKGHIPAQILSIGYGAVQFLSFELLTELMHRASRYDAR 116

Query: 137 KFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGY 196
            F ++     FL G +S   AT+   P D+LRTRFAAQGE R+Y  L++A+  +Y  EG 
Sbjct: 117 DFSVH-----FLCGGLSACAATLTVQPMDVLRTRFAAQGEPRVYKTLQDAMVTMYRTEGP 171

Query: 197 RGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATE--------DLL 248
             FY+G+  +++ I PY G  F  Y  LK+ +        W   + ATE        +LL
Sbjct: 172 LVFYKGLQPTLLAIFPYAGFQFSFYSSLKQAYE-------W--AVPATEGKTNGNIKNLL 222

Query: 249 SGAIAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFG 308
            G+ AG++SK   +PLDLV+KRLQV G          V  Y S +  C KQ+L+ +G  G
Sbjct: 223 CGSGAGVISKTLTYPLDLVKKRLQVGGFEHARATFGQVRSY-SGLLDCAKQVLQDEGSQG 281

Query: 309 LYKGLMPALIKSAPVSAVTFFVY 331
            +KGL P+L+K+A  + + FF Y
Sbjct: 282 FFKGLSPSLLKAALSTGLMFFWY 304



>gi|332260055|ref|XP_003279101.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform 1
           [Nomascus leucogenys]
 gi|332260057|ref|XP_003279102.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier isoform 2
           [Nomascus leucogenys]
          Length = 320

 Score =  199 bits (506), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 114/311 (36%), Positives = 174/311 (55%), Gaps = 22/311 (7%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           +  ++ + G+V+G+V+R + SP DV+KIR QLQ          R   S    KY+G+  A
Sbjct: 14  TKFQVAVAGSVSGLVTRALISPFDVIKIRFQLQ--------HERLSRSDPSAKYHGILQA 65

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQ 145
            + I++EEG    W G++ A+ L + YGAVQFL++  +  L  R       +F ++    
Sbjct: 66  SRQILQEEGPTAFWKGHIPAQILSIGYGAVQFLSFEMLTELVHRGSVYDAREFSVH---- 121

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTA 205
            F  G ++   AT+  +P D+LRTRFAAQGE ++Y  LR+AV  +Y  EG + FY+G+  
Sbjct: 122 -FACGGLAACMATLTVHPVDVLRTRFAAQGEPKVYNTLRHAVGTMYRSEGPQVFYKGLAP 180

Query: 206 SVVQIIPYMGLVFGSYEFLKKLFR---KLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVF 262
           +++ I PY GL F  Y  LK +++     E K     NL   ++LL G+ AG++SK   +
Sbjct: 181 TLIAIFPYAGLQFSCYSSLKHVYKWAIPAEGKKN--ENL---QNLLCGSGAGVISKTLTY 235

Query: 263 PLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAP 322
           PLDL +KRLQV G          V  Y   +  C KQ+L+ +G  G +KGL P+L+K+A 
Sbjct: 236 PLDLFKKRLQVGGFEHARAAFGQVRQY-KGLMDCAKQVLQKEGALGFFKGLSPSLLKAAL 294

Query: 323 VSAVTFFVYGY 333
            +   FF Y +
Sbjct: 295 STGFMFFWYEF 305



 Score = 90.1 bits (222), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 57/208 (27%), Positives = 97/208 (46%), Gaps = 27/208 (12%)

Query: 33  CGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIRE 92
           CG +A  ++     P+DV++ R   Q G P              K YN + HA+  + R 
Sbjct: 124 CGGLAACMATLTVHPVDVLRTRFAAQ-GEP--------------KVYNTLRHAVGTMYRS 168

Query: 93  EGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGAI 152
           EG +  + G          Y  +QF  Y  +++++K     + +K   N+ LQ  L G+ 
Sbjct: 169 EGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHVYKWAIPAEGKK---NENLQNLLCGSG 225

Query: 153 SGSTATIVTYPFDLLRTRF---------AAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGV 203
           +G  +  +TYP DL + R          AA G+ R Y GL +  +Q+  +EG  GF++G+
Sbjct: 226 AGVISKTLTYPLDLFKKRLQVGGFEHARAAFGQVRQYKGLMDCAKQVLQKEGALGFFKGL 285

Query: 204 TASVVQIIPYMGLVFGSYEFLKKLFRKL 231
           + S+++     G +F  YEF   +F  +
Sbjct: 286 SPSLLKAALSTGFMFFWYEFFCNVFHCM 313



>gi|241594085|ref|XP_002404245.1| oxodicarboxylate carrier protein, putative [Ixodes scapularis]
 gi|215502317|gb|EEC11811.1| oxodicarboxylate carrier protein, putative [Ixodes scapularis]
          Length = 313

 Score =  199 bits (505), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 120/327 (36%), Positives = 178/327 (54%), Gaps = 22/327 (6%)

Query: 20  VAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKY 79
            A   L+S++  I GA++G V+RF+  P DVVKIR QLQ    + P+ S H  +    KY
Sbjct: 6   TAKDSLTSVDHAIAGAISGFVTRFICQPFDVVKIRFQLQ----LEPIKSSHPTA----KY 57

Query: 80  NGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFG 139
             + H    I+REEGI   W G++ A+ L + YG VQF +Y   + L KR DS    +  
Sbjct: 58  TSILHGTLCILREEGITAFWKGHVPAQMLSVVYGGVQFSSY---EYLLKRSDSTLGREAV 114

Query: 140 I--NKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYR 197
           I  + T+  F  G  SG  +T V +PFD++RTR  AQ E + Y  +  AV+ ++ QEG R
Sbjct: 115 IRWSNTVH-FACGFTSGCVSTAVAHPFDVIRTRLVAQLEPKTYTSISQAVRLMWRQEGPR 173

Query: 198 GFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRK-LEDKHIWFHNLRATEDLLSGAIAGIV 256
            FYRG+  +++QI P  G  FG Y F   L+   LED      N+  T  +  GA++GIV
Sbjct: 174 SFYRGMLPTLLQIGPLSGFQFGFYHFFTHLWTVLLEDD----ANVTGTRSVACGALSGIV 229

Query: 257 SKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPA 316
           SK  V+PLDL++KRLQ      +     N   Y+  +  C++ I   +G  G +KG +P+
Sbjct: 230 SKTLVYPLDLIKKRLQASASFSRPRL--NFGRYNGFLH-CVRCIFVQEGFLGYFKGYLPS 286

Query: 317 LIKSAPVSAVTFFVYGYTKRLLEKLHS 343
           ++K+   ++  F  Y     +L+  HS
Sbjct: 287 VLKAMATTSSYFASYEAACEMLKYRHS 313



>gi|340367818|ref|XP_003382450.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like
           [Amphimedon queenslandica]
          Length = 309

 Score =  198 bits (503), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 118/310 (38%), Positives = 177/310 (57%), Gaps = 28/310 (9%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLS-SRHHNSGTLKKYNGMSHAIKLII 90
           + GAV+G+ +R + +PLDV+KIR QLQ    + P+  S HH S    KY G++ AI  II
Sbjct: 6   VAGAVSGVTARIITTPLDVIKIRFQLQ----LEPIRLSVHHVS----KYRGITQAIYKII 57

Query: 91  REEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGI-NKTLQPFLS 149
            EEGI+ LW G +    +Y  YG+VQF       + F R      ++ GI N  ++ F+S
Sbjct: 58  AEEGIQALWKGTIPGLLMYAVYGSVQF-------SCFDRAAIVLKDQMGIDNNIVRDFVS 110

Query: 150 GAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQ 209
           G I GS A+ V  P D++RTR A QGE + Y  +R+A+  +Y + G R FYRG+T +++ 
Sbjct: 111 GFIGGSIASFVVQPLDVIRTRLAGQGEPKHYKNIRSAISLMYKERGLRTFYRGLTPAILL 170

Query: 210 IIPYMGLVFGSYEFLKKLFRKLEDKHI------WFHNLRATEDLLSGAIAGIVSKAGVFP 263
           I P  GL FG Y     L+R+ +  +         H     + ++ GA+AG+ SK    P
Sbjct: 171 IGPQAGLHFGFYSLYNHLWRRYKSSNKEKKDEGLLHGNAGMQSIVCGALAGVSSKTICLP 230

Query: 264 LDLVRKRLQVQGPNRKDYFISNVPLYS--SSIFICIKQILRSDGIFGLYKGLMPALIKSA 321
           LD+V+KRL+V+G  +       V  Y   S IF+   +I R + +FG YKG +P+LIK++
Sbjct: 231 LDVVKKRLEVRGFEKARASFGRVGQYKGMSDIFV---KIWREEKVFGFYKGALPSLIKAS 287

Query: 322 PVSAVTFFVY 331
              +V+F+VY
Sbjct: 288 LTVSVSFYVY 297



>gi|307170658|gb|EFN62832.1| Mitochondrial deoxynucleotide carrier [Camponotus floridanus]
          Length = 307

 Score =  198 bits (503), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 117/316 (37%), Positives = 187/316 (59%), Gaps = 32/316 (10%)

Query: 23  SQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGM 82
           + +S+++  I GA +G ++RF+  PLDV+KIR QLQ    + P+S  H     + KYN +
Sbjct: 7   TAVSNLDHAIAGAASGFITRFLCQPLDVIKIRFQLQ----VEPISKAH-----ISKYNSV 57

Query: 83  SHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINK 142
             A  LI +EEGI  LW G++ A+ L ++YG  QF +Y+    + + +   + EK+  N 
Sbjct: 58  PQAFLLIFKEEGISALWKGHIPAQLLSVTYGMAQFYSYNVFMQMMQSVP--RIEKW--NH 113

Query: 143 TLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEK-RIYIGLRNAVQQIYVQEGYRGFYR 201
           ++  F++GA +GS ATIV++PFD +RTR  AQ    ++Y G+ ++   I  QE  + F+ 
Sbjct: 114 SMH-FIAGAGAGSIATIVSFPFDTIRTRLVAQSNNHQVYKGVLHSCSTILRQESPKVFFS 172

Query: 202 GVTASVVQIIPYMGLVFGSYEFLKKLFRK-LEDKHIWFHNLRATEDLLSGAIAGIVSKAG 260
           G+  +++QI P+ GL F  YEF    ++K   D +  F+N      +LSG+IAG ++K  
Sbjct: 173 GLLPTLLQIAPHTGLQFAFYEFFTNFYKKYTSDTNTNFNN-----SMLSGSIAGFIAKTI 227

Query: 261 VFPLDLVRKRLQVQG--PNRK---DYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMP 315
           V+P DL RKRLQ+QG    RK    +F  N       +  C++  ++ + I GL+KGL+P
Sbjct: 228 VYPFDLARKRLQIQGFQHGRKGFGKFFQCN------GLLDCLRVTVKEERIQGLFKGLVP 281

Query: 316 ALIKSAPVSAVTFFVY 331
           + IK+A  SA+ F +Y
Sbjct: 282 SQIKAAATSALHFTMY 297



>gi|391327497|ref|XP_003738235.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like
           [Metaseiulus occidentalis]
          Length = 310

 Score =  198 bits (503), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 117/312 (37%), Positives = 180/312 (57%), Gaps = 35/312 (11%)

Query: 22  ASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNG 81
           A   SS+   + G V+G ++R +  P DV+KIR QLQ    ++P++ +  ++    KY+G
Sbjct: 15  AKDTSSVYF-VAGCVSGFLTRCICQPFDVLKIRFQLQ----LDPITVKCDSA----KYSG 65

Query: 82  MSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQN-LF-KRIDSNQNEKFG 139
           +  A +LI+REEGI   W G+L A+ L + YG +QF  Y   +N LF  R D N N    
Sbjct: 66  IKQASRLILREEGITAFWKGHLPAQTLSVVYGGIQFYGYEFSKNWLFPDRNDFNSN---- 121

Query: 140 INKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGF 199
                  F+SGA+ G TA  V +P D++RTR  AQGE + Y G+ +A++ +  +EG R F
Sbjct: 122 -------FISGALGGGTAMAVAHPLDVIRTRLIAQGEPKTYNGMFDAMRTMKRREGPRAF 174

Query: 200 YRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKA 259
           Y+G+ ++++Q+ PY G  F  Y F + L   LED         A  +LLSGA++G  SK+
Sbjct: 175 YKGLLSNLLQVTPYNGACFAFYHFFRGL---LEDVPY------APANLLSGALSGFASKS 225

Query: 260 GVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIK 319
            V+P DL++KRLQVQG   + +   +     + +  C K +L S+G+ G +KG +PA +K
Sbjct: 226 LVYPFDLIKKRLQVQGFMDRSHRFGHY----NGLMNCAKSVLASEGMKGFFKGYVPACMK 281

Query: 320 SAPVSAVTFFVY 331
           +  +SA  F  Y
Sbjct: 282 AMAMSACQFTFY 293



 Score = 82.4 bits (202), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 85/197 (43%), Gaps = 31/197 (15%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIR 91
           I GA+ G  +  VA PLDV++ RL  Q G P              K YNGM  A++ + R
Sbjct: 123 ISGALGGGTAMAVAHPLDVIRTRLIAQ-GEP--------------KTYNGMFDAMRTMKR 167

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGA 151
            EG R  + G LS       Y    F  YH  + L + +                 LSGA
Sbjct: 168 REGPRAFYKGLLSNLLQVTPYNGACFAFYHFFRGLLEDVPYAPAN----------LLSGA 217

Query: 152 ISGSTATIVTYPFDLLRTRFAAQG----EKRI--YIGLRNAVQQIYVQEGYRGFYRGVTA 205
           +SG  +  + YPFDL++ R   QG      R   Y GL N  + +   EG +GF++G   
Sbjct: 218 LSGFASKSLVYPFDLIKKRLQVQGFMDRSHRFGHYNGLMNCAKSVLASEGMKGFFKGYVP 277

Query: 206 SVVQIIPYMGLVFGSYE 222
           + ++ +      F  YE
Sbjct: 278 ACMKAMAMSACQFTFYE 294



 Score = 79.0 bits (193), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 93/203 (45%), Gaps = 27/203 (13%)

Query: 147 FLSGAISGSTATIVTYPFDLLRTRFAAQ-------GEKRIYIGLRNAVQQIYVQEGYRGF 199
           F++G +SG     +  PFD+L+ RF  Q        +   Y G++ A + I  +EG   F
Sbjct: 23  FVAGCVSGFLTRCICQPFDVLKIRFQLQLDPITVKCDSAKYSGIKQASRLILREEGITAF 82

Query: 200 YRGVTASVVQIIPYMGLVFGSYEFLKK-LFRKLEDKHIWFHNLRATEDLLSGAIAGIVSK 258
           ++G   +    + Y G+ F  YEF K  LF    D +          + +SGA+ G  + 
Sbjct: 83  WKGHLPAQTLSVVYGGIQFYGYEFSKNWLFPDRNDFN---------SNFISGALGGGTAM 133

Query: 259 AGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALI 318
           A   PLD++R RL  QG           P   + +F  ++ + R +G    YKGL+  L+
Sbjct: 134 AVAHPLDVIRTRLIAQGE----------PKTYNGMFDAMRTMKRREGPRAFYKGLLSNLL 183

Query: 319 KSAPVSAVTFFVYGYTKRLLEKL 341
           +  P +   F  Y + + LLE +
Sbjct: 184 QVTPYNGACFAFYHFFRGLLEDV 206



>gi|166796534|gb|AAI59029.1| LOC548707 protein [Xenopus (Silurana) tropicalis]
          Length = 295

 Score =  198 bits (503), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 116/294 (39%), Positives = 168/294 (57%), Gaps = 32/294 (10%)

Query: 46  SPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIREEGIRGLWNGNLSA 105
           SPLDV+KIR QLQ    I  LSS     GT  KY+G+  A+ LI+REEG+ G W G++ A
Sbjct: 5   SPLDVIKIRFQLQ----IESLSSH----GTQGKYHGILQAVGLILREEGLPGFWKGHVPA 56

Query: 106 EYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQP------FLSGAISGSTATI 159
           + L +SYGAVQF+++  +  LF            ++ +L P      FL G ++  +AT+
Sbjct: 57  QLLSVSYGAVQFVSFEMLTELFH-----------VSTSLDPRSPAVHFLCGGLAACSATL 105

Query: 160 VTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFG 219
              P D LRTRFAAQGE ++Y  LRNA+  ++  EG   FYRG+  +++ + PY GL F 
Sbjct: 106 AVQPLDTLRTRFAAQGEPKVYRNLRNAIFTMFRTEGPVAFYRGLFPTLLAVFPYAGLQFS 165

Query: 220 SYEFLKKLFR--KLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQGPN 277
           SY  LK+ +    L+D+        +  +LL G+ AG++SK   +P DL +KRLQV G  
Sbjct: 166 SYNLLKRTWNLVLLKDQ----TQKDSLRNLLCGSGAGVISKTVTYPFDLFKKRLQVGGFE 221

Query: 278 RKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVY 331
           +       V  Y   +  C  QI + +G  G +KGL P+L+K+A  + +TFF Y
Sbjct: 222 QARAHFGKVRTYHGLV-DCACQIWKEEGFRGFFKGLAPSLLKAAFSTGLTFFSY 274



 Score = 85.9 bits (211), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/210 (29%), Positives = 93/210 (44%), Gaps = 37/210 (17%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIR 91
           +CG +A   +     PLD ++ R   Q G P              K Y  + +AI  + R
Sbjct: 94  LCGGLAACSATLAVQPLDTLRTRFAAQ-GEP--------------KVYRNLRNAIFTMFR 138

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKR-----IDSNQNEKFGINKTLQP 146
            EG    + G          Y  +QF +Y    NL KR     +  +Q +K     +L+ 
Sbjct: 139 TEGPVAFYRGLFPTLLAVFPYAGLQFSSY----NLLKRTWNLVLLKDQTQK----DSLRN 190

Query: 147 FLSGAISGSTATIVTYPFDLLRTRF---------AAQGEKRIYIGLRNAVQQIYVQEGYR 197
            L G+ +G  +  VTYPFDL + R          A  G+ R Y GL +   QI+ +EG+R
Sbjct: 191 LLCGSGAGVISKTVTYPFDLFKKRLQVGGFEQARAHFGKVRTYHGLVDCACQIWKEEGFR 250

Query: 198 GFYRGVTASVVQIIPYMGLVFGSYEFLKKL 227
           GF++G+  S+++     GL F SYE    L
Sbjct: 251 GFFKGLAPSLLKAAFSTGLTFFSYELFCSL 280



>gi|345312618|ref|XP_003429273.1| PREDICTED: LOW QUALITY PROTEIN: mitochondrial thiamine
           pyrophosphate carrier-like [Ornithorhynchus anatinus]
          Length = 330

 Score =  197 bits (502), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 113/309 (36%), Positives = 178/309 (57%), Gaps = 22/309 (7%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           S +E+   G+++G+++R + SPLDV+KIR QLQ    I  LS R   +    KY G+  A
Sbjct: 14  SKLEVAAAGSLSGLITRALVSPLDVIKIRFQLQ----IESLSPRDPQA----KYYGIVQA 65

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQ 145
           I+ +++EEG    W G++ A+ L +SYGAVQF+T+ ++  L  +  S     F ++    
Sbjct: 66  IRQMLQEEGPAAFWKGHIPAQLLSISYGAVQFVTFERLTELAHQTTSFDARDFSVH---- 121

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTA 205
            F+ G ++  TAT+   P D LRTRFAAQGE +IY  LR AV  +Y +EG   FYRG+  
Sbjct: 122 -FVCGGLAACTATLTVQPLDTLRTRFAAQGEPKIYQNLRQAVGSMYWKEGPLAFYRGLVP 180

Query: 206 SVVQIIPYMGLVFGSYEFLKKLFR---KLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVF 262
           +++ + PY G  F  Y  L++++     ++ K     NL+   +LL G+ AG++SK   +
Sbjct: 181 TLLAVFPYAGFQFSFYRALQQVYEWAVPVDGKRN--GNLK---NLLCGSGAGVLSKTFTY 235

Query: 263 PLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAP 322
           PLDL +KRLQV G  +       V  Y +    C +++++ +G    +KGL P+L+K+A 
Sbjct: 236 PLDLFKKRLQVGGFEQARATFGQVRTY-TGFLDCARRVVQEEGPRSFFKGLDPSLLKAAL 294

Query: 323 VSAVTFFVY 331
            +   FF Y
Sbjct: 295 STGFIFFCY 303



>gi|45387845|ref|NP_991278.1| mitochondrial thiamine pyrophosphate carrier [Danio rerio]
 gi|37595384|gb|AAQ94578.1| solute carrier family 25 member 19 [Danio rerio]
          Length = 313

 Score =  197 bits (502), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 115/309 (37%), Positives = 170/309 (55%), Gaps = 19/309 (6%)

Query: 25  LSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSH 84
           L+  E  + G+ AG+V+R + SPLDVVKIR QLQ    I  +S R        KY G+  
Sbjct: 13  LAPEEAALAGSAAGIVTRALISPLDVVKIRFQLQ----IEKVSWRSRQG----KYWGLWQ 64

Query: 85  AIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTL 144
           A + I+ EEG+   W G++ A+ L + YGAVQF ++  +  L  +     ++  G++   
Sbjct: 65  ATRCILTEEGLPAFWKGHIPAQLLSVCYGAVQFASFEVLTELVHKKTPYNSQTAGVH--- 121

Query: 145 QPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVT 204
             F+ G ++  +AT+   P D LRTRFAAQGE +IY  LR+A+  +    G   FYRG+T
Sbjct: 122 --FICGGLAACSATVACQPLDTLRTRFAAQGEPKIYRNLRHAIGTMLRSGGPFTFYRGLT 179

Query: 205 ASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPL 264
            ++V + PY GL F  Y  LKKL    + K     +      L+SG+ AG++SK   +P 
Sbjct: 180 PTLVAVFPYAGLQFFFYNILKKLLEHQDTK-----SKAGLHSLISGSCAGVISKTLTYPF 234

Query: 265 DLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVS 324
           DL++KRLQV G          V  Y   +  C+ +I R +G  G +KGL P+L+K+A  +
Sbjct: 235 DLIKKRLQVGGFEEARLKFGEVRTYHGFV-DCVLRIGREEGPRGFFKGLSPSLLKAALST 293

Query: 325 AVTFFVYGY 333
             TFF Y +
Sbjct: 294 GFTFFWYEF 302



 Score = 79.3 bits (194), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 60/200 (30%), Positives = 90/200 (45%), Gaps = 25/200 (12%)

Query: 151 AISGSTATIVT----YPFDLLRTRFAAQGEKRI-------YIGLRNAVQQIYVQEGYRGF 199
           A++GS A IVT     P D+++ RF  Q EK         Y GL  A + I  +EG   F
Sbjct: 19  ALAGSAAGIVTRALISPLDVVKIRFQLQIEKVSWRSRQGKYWGLWQATRCILTEEGLPAF 78

Query: 200 YRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKA 259
           ++G   + +  + Y  + F S+E L +L  K       +++  A    + G +A   +  
Sbjct: 79  WKGHIPAQLLSVCYGAVQFASFEVLTELVHKKTP----YNSQTAGVHFICGGLAACSATV 134

Query: 260 GVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIK 319
              PLD +R R   QG           P    ++   I  +LRS G F  Y+GL P L+ 
Sbjct: 135 ACQPLDTLRTRFAAQGE----------PKIYRNLRHAIGTMLRSGGPFTFYRGLTPTLVA 184

Query: 320 SAPVSAVTFFVYGYTKRLLE 339
             P + + FF Y   K+LLE
Sbjct: 185 VFPYAGLQFFFYNILKKLLE 204



>gi|348530824|ref|XP_003452910.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like
           [Oreochromis niloticus]
          Length = 328

 Score =  197 bits (501), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 118/331 (35%), Positives = 179/331 (54%), Gaps = 20/331 (6%)

Query: 17  EQAVAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTL 76
           +  V ++ LS  E    G+ AGMV+R + SP DV+KIR QLQ    I  +SS+       
Sbjct: 5   DPGVQSAPLSPEEAAFAGSAAGMVTRALISPFDVIKIRFQLQ----IERVSSKTPEG--- 57

Query: 77  KKYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNE 136
            KY G+  A + I  EEG+   W G++ A+ L + YGAVQF ++  +  L        ++
Sbjct: 58  -KYYGIFQATRRIHSEEGLSAFWKGHIPAQLLSICYGAVQFASFEFLTELVHEKTPYDSQ 116

Query: 137 KFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGY 196
             G++     F+ G ++  +AT+V  P D LRTRFAAQGE ++Y  LR+AV  ++  EG 
Sbjct: 117 TAGVH-----FVCGGLAACSATVVCQPLDTLRTRFAAQGEPKVYRNLRHAVSTMWRSEGT 171

Query: 197 RGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIV 256
             FYRG++ +++ + PY GL F  Y   KKL            NL++   L+ G+ AG++
Sbjct: 172 LTFYRGLSPTLLAVFPYAGLQFFFYNIFKKLLAPRPKAGNSGGNLKS---LVCGSGAGMI 228

Query: 257 SKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPA 316
           SK   +P DL +KRLQV G          V  Y   +  C+ QI + +G  G +KGL P+
Sbjct: 229 SKTITYPFDLFKKRLQVGGFEAARAHFGQVRSY-RGLLDCMVQIAKEEGFRGFFKGLSPS 287

Query: 317 LIKSAPVSAVTFFVYGYTKRLLEKLHSSRDK 347
           L+K+A  +  TFF Y +    L  +H+ ++K
Sbjct: 288 LVKAALSTGFTFFWYEF---FLNAMHNFKEK 315



>gi|507113650|emb|CDF37268.1| unnamed protein product [Chondrus crispus]
          Length = 423

 Score =  197 bits (501), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 117/317 (36%), Positives = 174/317 (54%), Gaps = 37/317 (11%)

Query: 23  SQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGM 82
           + L+  +  +CGA+AG  +R + +PLDV+KIR Q+Q              +  L +Y  M
Sbjct: 133 TNLTPFQDLLCGALAGCSARMMVAPLDVLKIRFQIQ------------SETRGLYRYASM 180

Query: 83  SHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINK 142
           S A++ I+  EG+R  W GN+ A  +   Y +VQ  +++Q++ L             I +
Sbjct: 181 SSAVRSILAHEGLRAFWKGNVPALLMVTPYASVQLASFYQLKQL----------ALNIPE 230

Query: 143 TLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRG 202
             +  L GAISG+ AT+ TYP DLLRTRFAAQ E R Y  +R AV  IY  +G RGFY G
Sbjct: 231 PYKSLLFGAISGAGATLCTYPMDLLRTRFAAQSEPRSYNSIRQAVSVIYNTQGLRGFYAG 290

Query: 203 VTASVVQIIPYMGLVFGSYEFLKK--LFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAG 260
           +  ++V+I+PY+ L F  YE +K   L R   D      +L+  E L+ GA++G  SK  
Sbjct: 291 LGPTLVEIVPYVSLHFTWYEGMKGQVLKRTRSD------SLKPAESLVVGAVSGTASKLF 344

Query: 261 VFPLDLVRKRLQVQGPNRKDYFIS--NVPLYSSSIFICIKQILRSDGIFGLYKGLMPALI 318
             PLD  +K +QV+     D F+   N       I   + +I R +G+ G ++G  P+L+
Sbjct: 345 TLPLDNAKKLMQVE-----DQFLGKRNTSSPYRGIAHVLSRIWRREGLRGWFRGTAPSLV 399

Query: 319 KSAPVSAVTFFVYGYTK 335
           K+AP SA+TF VY  T+
Sbjct: 400 KAAPNSAITFTVYEMTR 416



 Score = 88.2 bits (217), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 59/208 (28%), Positives = 100/208 (48%), Gaps = 23/208 (11%)

Query: 144 LQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKR---IYIGLRNAVQQIYVQEGYRGFY 200
            Q  L GA++G +A ++  P D+L+ RF  Q E R    Y  + +AV+ I   EG R F+
Sbjct: 138 FQDLLCGALAGCSARMMVAPLDVLKIRFQIQSETRGLYRYASMSSAVRSILAHEGLRAFW 197

Query: 201 RGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAG 260
           +G   +++ + PY  +   S+  LK+L   + + +         + LL GAI+G  +   
Sbjct: 198 KGNVPALLMVTPYASVQLASFYQLKQLALNIPEPY---------KSLLFGAISGAGATLC 248

Query: 261 VFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKS 320
            +P+DL+R R   Q          + P   +SI   +  I  + G+ G Y GL P L++ 
Sbjct: 249 TYPMDLLRTRFAAQ----------SEPRSYNSIRQAVSVIYNTQGLRGFYAGLGPTLVEI 298

Query: 321 APVSAVTFFVY-GYTKRLLEKLHSSRDK 347
            P  ++ F  Y G   ++L++  S   K
Sbjct: 299 VPYVSLHFTWYEGMKGQVLKRTRSDSLK 326



>gi|332018547|gb|EGI59136.1| Mitochondrial thiamine pyrophosphate carrier [Acromyrmex
           echinatior]
          Length = 308

 Score =  197 bits (501), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 117/318 (36%), Positives = 186/318 (58%), Gaps = 26/318 (8%)

Query: 28  IEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIK 87
           ++  I GA +G ++R +  PLDV+KIR QLQ    + P+S R+H S    KY  +S A+ 
Sbjct: 12  LDHAIAGAASGFITRLLCQPLDVIKIRFQLQ----VEPIS-RYHVS----KYKSISQAVL 62

Query: 88  LIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPF 147
           LI+REEG   LW G++ A+ + ++YG  QF +Y+    + +R+   Q E++     +  F
Sbjct: 63  LILREEGSTALWKGHIPAQLISITYGMSQFYSYNVFLKMLQRVP--QIEEW---HHMTHF 117

Query: 148 LSGAISGSTATIVTYPFDLLRTRFAAQGEK-RIYIGLRNAVQQIYVQEGYRGFYRGVTAS 206
           ++GA +G   TI+++PFD +RTR  AQ    R+Y G+ ++   I  QE  R F+ G+  +
Sbjct: 118 VAGAGAGCVGTIISFPFDTMRTRLVAQSNNHRVYNGILHSCSSILRQESPRVFFFGLLPT 177

Query: 207 VVQIIPYMGLVFGSYEFLKKLFRK-LEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLD 265
           ++QI P  GL F  YE  K L+++ + D  I FHN      +LSG+ AG V+K  V+P D
Sbjct: 178 LLQIAPQTGLQFTFYELFKGLYKRYISDTDIGFHN-----SMLSGSAAGFVAKTIVYPFD 232

Query: 266 LVRKRLQVQG--PNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPV 323
           L +KRLQ+QG    RK++         + +  C+K  ++ +G+ GL+KGL+P+ IK+A  
Sbjct: 233 LAKKRLQIQGFQHGRKEF---GKFFQCNGLLDCLKVTVKEEGVQGLFKGLVPSQIKAATT 289

Query: 324 SAVTFFVYGYTKRLLEKL 341
           +A+ F  Y     LL+ L
Sbjct: 290 TALHFTTYEQVLLLLKML 307



>gi|344291174|ref|XP_003417311.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like
           [Loxodonta africana]
          Length = 318

 Score =  196 bits (499), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 117/308 (37%), Positives = 176/308 (57%), Gaps = 18/308 (5%)

Query: 25  LSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSH 84
           +S  E+ + G+V+G+V+R + SPLDV+KIR QLQ    I  LS     S    KY+G+  
Sbjct: 13  ISKFEVAVAGSVSGLVTRALVSPLDVIKIRFQLQ----IERLS----RSDPSAKYHGILQ 64

Query: 85  AIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTL 144
           A + I++EEG    W G++ A+ L + YGAVQFL++  +  L  R          ++   
Sbjct: 65  AGRQILQEEGPAAFWKGHIPAQLLSIGYGAVQFLSFELLTELVHRASVYDARDVSVH--- 121

Query: 145 QPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVT 204
             F+ G +S   AT+  +P D+LRTRFAAQGE +IY  LR+AV  +Y  EG   FY+G+ 
Sbjct: 122 --FVCGGLSACAATLAVHPVDVLRTRFAAQGEPKIYKTLRDAVVTMYRTEGPLVFYKGLN 179

Query: 205 ASVVQIIPYMGLVFGSYEFLKKLFR-KLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFP 263
            +++ I PY G  F  Y  LK+++   +  +     NL+   +LL G+ AG++SK   +P
Sbjct: 180 PTLIAIFPYAGFQFSFYSSLKQVYEWAVPAEGKTNGNLK---NLLCGSGAGVISKTLTYP 236

Query: 264 LDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPV 323
           LDL +KRLQV G  +       V  Y   +  C KQ+L+ +G  G +KGL P+L+K+A  
Sbjct: 237 LDLFKKRLQVGGFEQARATFGQVRSY-RGLLDCAKQVLQEEGSRGFFKGLSPSLLKAALS 295

Query: 324 SAVTFFVY 331
           + + FF Y
Sbjct: 296 TGLVFFWY 303



>gi|499015295|ref|XP_004558462.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like
           isoform X4 [Maylandia zebra]
          Length = 328

 Score =  196 bits (498), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 117/331 (35%), Positives = 180/331 (54%), Gaps = 20/331 (6%)

Query: 17  EQAVAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTL 76
           +  V  + LS  E    G+ AGMV+R + SP DV+KIR QLQ    I  +SS+       
Sbjct: 5   DPGVQGAPLSPKEAAFAGSAAGMVTRALISPFDVIKIRFQLQ----IERVSSKTPQG--- 57

Query: 77  KKYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNE 136
            KY G+  A + I  EEG+   W G++ A+ L + YGAVQF ++  +  L  +     ++
Sbjct: 58  -KYYGIFQATRCIHLEEGLSAFWKGHIPAQLLSICYGAVQFASFEFLTELVHQKTLYDSQ 116

Query: 137 KFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGY 196
             G++     F+ G ++  +AT+V  P D LRTRFAAQGE ++Y  LR+AV  ++  EG 
Sbjct: 117 TAGVH-----FVCGGLAACSATVVCQPLDTLRTRFAAQGEPKVYRNLRHAVSTMWRSEGT 171

Query: 197 RGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIV 256
             FYRG++ +++ + PY GL F  Y   KKL     +      NL++   L+ G+ AG++
Sbjct: 172 LTFYRGLSPTLMAVFPYAGLQFFFYNIFKKLLAPQPEAGNSGGNLKS---LVCGSGAGMI 228

Query: 257 SKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPA 316
           SK   +P DL +KRLQV G          V  Y   +  C+ QI + +G  G +KGL P+
Sbjct: 229 SKTITYPFDLFKKRLQVGGFEAARAHFGQVRSY-RGLLDCMVQIAKEEGFRGFFKGLSPS 287

Query: 317 LIKSAPVSAVTFFVYGYTKRLLEKLHSSRDK 347
           L+K+A  +  TFF Y +    +  +H+ ++K
Sbjct: 288 LVKAALSTGFTFFWYEF---FVNAMHNFKEK 315



>gi|47214999|emb|CAG03139.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 334

 Score =  195 bits (496), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 122/353 (34%), Positives = 181/353 (51%), Gaps = 50/353 (14%)

Query: 4   GYEHKPQNQSPIAEQAVAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPI 63
           GY    Q   P  +QA  A           G+ AGMV+R + SPLDV+KIR QLQ    I
Sbjct: 3   GYNPGAQGAGPSPKQAALA-----------GSAAGMVTRALVSPLDVLKIRFQLQ----I 47

Query: 64  NPLSSRHHNSGTLKKYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQM 123
            P+SS         KY G+  A + I+ EEG+   W G++ A+ L + YGAVQF ++  +
Sbjct: 48  EPVSSLRPGG----KYWGVRQASRRILSEEGLSAFWKGHVPAQLLSICYGAVQFTSFEFL 103

Query: 124 QNLFKRIDSNQNEKFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGL 183
             +        +   G++     F  G ++  +AT+V  P D LRTRFAAQGE ++Y  L
Sbjct: 104 TKVVHETTPYDSRTSGVH-----FACGGLAACSATVVCQPLDTLRTRFAAQGEPKVYSNL 158

Query: 184 RNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRA 243
           R+AV  +   EG   FYRG++ +++ + PY GL F SY   ++L            NLR+
Sbjct: 159 RHAVSTMCSTEGALTFYRGLSPTLLAVFPYAGLQFFSYNIFRRLLAPPPTAPDSGGNLRS 218

Query: 244 TEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQGPNRKD------------------YFISN 285
              LL GA AG++SK   +PLDL +KRLQV G                       + + N
Sbjct: 219 ---LLCGAAAGMISKTVTYPLDLFKKRLQVGGFEAARVQFGRVGALLALVSFSFFFHLPN 275

Query: 286 VPLYS-----SSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGY 333
           V  ++     + +  C+ Q+ + +G+ GL+KGL P+L+K+A  +  TFF Y +
Sbjct: 276 VDFHAQVRSYAGLLDCLVQVAQEEGLRGLFKGLSPSLLKAALSTGFTFFWYEF 328



>gi|242012221|ref|XP_002426832.1| mitochondrial deoxynucleotide carrier, putative [Pediculus humanus
           corporis]
 gi|212511045|gb|EEB14094.1| mitochondrial deoxynucleotide carrier, putative [Pediculus humanus
           corporis]
          Length = 321

 Score =  194 bits (493), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 108/318 (33%), Positives = 183/318 (57%), Gaps = 19/318 (5%)

Query: 25  LSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSH 84
           L+  E G+ GA +G+V+RF+  PLDV+KIR QLQ   P+     +  NS    KY  +  
Sbjct: 14  LTGWEFGLAGASSGIVTRFLCQPLDVLKIRFQLQT-TPV-----KIKNSA---KYKSILQ 64

Query: 85  AIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTL 144
            +K++  EEG+  LW G+ +A+ L + +GAVQF +Y  + +   +  +N++    +   +
Sbjct: 65  TVKIMTAEEGLSSLWKGHNAAQLLSMVFGAVQFSSYELLYDFSSKAWNNKSP---LANHI 121

Query: 145 QPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVT 204
                G ++G  AT+V++PFD++RT    QGE ++Y G+ +A  +IY +EG  G+ +G+T
Sbjct: 122 LHCGCGCVAGVLATVVSFPFDVIRTHLVFQGEPKLYKGVMDAALKIYQKEGLSGYKKGMT 181

Query: 205 ASVVQIIPYMGLVFGSYEFLKKLFR----KLEDKHIWFHNLRATEDLLSGAIAGIVSKAG 260
           A++ Q  P  GLVF   E  ++++     KL  K     ++ A+  +++  +AGI +K  
Sbjct: 182 AAIYQTAPMSGLVFSFKEMFREIWLWSIGKLNSKQT--SSISASGIVITNFLAGICAKTV 239

Query: 261 VFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKS 320
           V+PLDL +KRLQ+QG +R       + +  SS+  C    ++ +G FGL+KGL P+L+K+
Sbjct: 240 VYPLDLTKKRLQIQGFDRNKGCYKEI-IKCSSVIQCFMLTIKKEGFFGLFKGLFPSLMKA 298

Query: 321 APVSAVTFFVYGYTKRLL 338
              + + F  Y Y   L+
Sbjct: 299 GASTVIYFTTYEYACELM 316



>gi|357603284|gb|EHJ63694.1| hypothetical protein KGM_12397 [Danaus plexippus]
          Length = 321

 Score =  194 bits (492), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 118/331 (35%), Positives = 191/331 (57%), Gaps = 28/331 (8%)

Query: 23  SQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGM 82
           S+LS  +  + G +A  V+R +A PLDV+KIR QLQ   PI   S          KY+ +
Sbjct: 9   SKLSISQSAVAGGLASAVTRAIAQPLDVLKIRFQLQL-EPIQEGS----------KYSSI 57

Query: 83  SHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSN--QNEKFGI 140
           + A+K I+++EG+  LW+G++ A++L +SYG  QF T+ ++  +++ IDS   +N K  I
Sbjct: 58  TQAVKSIVKDEGVLTLWSGHVPAQFLSISYGIAQFSTFEKLTQIYRNIDSEFYRNYKHSI 117

Query: 141 NKTLQPFLSGAISGSTATIVTYPFDLLRTRF-AAQGEKRIYIGLRNAVQQIYVQEGYRGF 199
           N     F +GAI+ S AT++++PFD +RTR  A Q   ++Y G  NA   I   EG    
Sbjct: 118 N-----FSNGAIAASIATLISFPFDTVRTRLIAEQKTNKVYKGFINAFTNIVKTEGSAAL 172

Query: 200 YRGVTASVVQIIPYMGLVFGSYE-FLKKLFRKLE----DKHIWFHNLRAT--EDLLSGAI 252
           ++G+  ++ QI P+ G+ F  Y+ F + +   LE     K+I    + +T   +LL+G I
Sbjct: 173 FKGLAPTLAQIAPHAGIQFTVYKLFTESILNGLEFFQRRKNIG-SVIESTLIANLLAGGI 231

Query: 253 AGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKG 312
           AG++SK  ++P D+V+KRLQ+QG  +   F     +Y +    CIK  + ++G   LYKG
Sbjct: 232 AGLISKTAIYPFDVVKKRLQIQGFQQHREFFGR-QMYCNGTLHCIKLTITNEGFLALYKG 290

Query: 313 LMPALIKSAPVSAVTFFVYGYTKRLLEKLHS 343
             P+++K+  VSA+ F VY   K  + ++ S
Sbjct: 291 YGPSILKAIFVSALHFAVYDEIKYFILRIQS 321



>gi|195999134|ref|XP_002109435.1| hypothetical protein TRIADDRAFT_53464 [Trichoplax adhaerens]
 gi|190587559|gb|EDV27601.1| hypothetical protein TRIADDRAFT_53464 [Trichoplax adhaerens]
          Length = 344

 Score =  193 bits (490), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 114/307 (37%), Positives = 177/307 (57%), Gaps = 20/307 (6%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIR 91
           I G  AG+++RF+ SPLDV+KIR QLQ       L S         KY G+  ++  II 
Sbjct: 37  IAGGFAGLITRFLTSPLDVIKIRFQLQ-------LESTFKTQKQNSKYFGIYQSMIKIIS 89

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQP----F 147
           EEG+  LW G ++ + L ++YG VQF++Y    N  K++    +++  I   LQP    F
Sbjct: 90  EEGLLALWKGQMAGQLLSITYGGVQFMSY----NFSKKVIYELHQQ-NIISPLQPNVVSF 144

Query: 148 LSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASV 207
           + G+I+G TA+ V +P D+LRTRF AQGE + YI  ++A+ ++   EG R FY+G++ ++
Sbjct: 145 VCGSIAGLTASTVAHPLDVLRTRFVAQGEPKYYISYKHALAKMGKDEGIRSFYKGLSPTL 204

Query: 208 VQIIPYMGLVFGSYEFLKKLFRKLE---DKHIWFHNLRATEDLLSGAIAGIVSKAGVFPL 264
           + I+P  GL F  YEF  +  R+            N    +  +SG  AGI SK+ ++PL
Sbjct: 205 LCIVPQTGLQFAFYEFFIRELRRYSVATSNGKGNLNKNGVDITVSGGAAGIFSKSIIYPL 264

Query: 265 DLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVS 324
           D+ +KRL+V G  +       V  Y +S+  C  +I  ++G+ G YKGL P+L+K+A  S
Sbjct: 265 DVAKKRLEVNGFVKPREKFGQVDKY-NSLKDCFLKIWSTEGLAGFYKGLSPSLVKAALSS 323

Query: 325 AVTFFVY 331
           ++ FF+Y
Sbjct: 324 SLMFFLY 330



 Score = 75.1 bits (183), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 91/205 (44%), Gaps = 18/205 (8%)

Query: 144 LQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRI--------YIGLRNAVQQIYVQEG 195
           L   ++G  +G     +T P D+++ RF  Q E           Y G+  ++ +I  +EG
Sbjct: 33  LHDAIAGGFAGLITRFLTSPLDVIKIRFQLQLESTFKTQKQNSKYFGIYQSMIKIISEEG 92

Query: 196 YRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGI 255
               ++G  A  +  I Y G+ F SY F KK+  +L  ++I           + G+IAG+
Sbjct: 93  LLALWKGQMAGQLLSITYGGVQFMSYNFSKKVIYELHQQNIISPLQPNVVSFVCGSIAGL 152

Query: 256 VSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMP 315
            +     PLD++R R   QG           P Y  S    + ++ + +GI   YKGL P
Sbjct: 153 TASTVAHPLDVLRTRFVAQGE----------PKYYISYKHALAKMGKDEGIRSFYKGLSP 202

Query: 316 ALIKSAPVSAVTFFVYGYTKRLLEK 340
            L+   P + + F  Y +  R L +
Sbjct: 203 TLLCIVPQTGLQFAFYEFFIRELRR 227



>gi|256088366|ref|XP_002580310.1| mitochondrial carrier protein [Schistosoma mansoni]
 gi|353230178|emb|CCD76349.1| mitochondrial carrier protein-related [Schistosoma mansoni]
          Length = 339

 Score =  192 bits (489), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 119/338 (35%), Positives = 187/338 (55%), Gaps = 28/338 (8%)

Query: 25  LSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSH 84
           LS  E  + G+V+G V+R V  PLDV+KIR QLQ    + P+     +     KY G+  
Sbjct: 11  LSKNEYLLAGSVSGFVARAVVQPLDVIKIRFQLQ----MEPIEVSRTS-----KYQGLLQ 61

Query: 85  AIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDS---NQNEKFGIN 141
           A++ I +EEG    W G++ A+   +++ +VQFLT+  + +  + ++S   + N+ FG+ 
Sbjct: 62  AVRCISKEEGAIAFWKGHVPAQMQSVTFTSVQFLTFEVILSWLREVNSLLISDNKIFGLP 121

Query: 142 KTLQP---FLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRG 198
            T +P   FL G  +GS A IVT P D+LRTRF AQGE + Y  + +A   I  +EG +G
Sbjct: 122 ITYKPVGNFLCGCGAGSLAAIVTQPLDVLRTRFIAQGEPKTYGSMSHAAVSIITREGAQG 181

Query: 199 FYRGVTASVVQIIPYMGLVFGSYEFLKKLFRK--------LEDKHIWFHN----LRATED 246
           F+RG+  S++ I P  G+ F  Y  L ++  +        L DK   FH+    +   + 
Sbjct: 182 FFRGLVPSLLLIAPQTGIQFTIYHSLNQMINQGKYYLHPNLIDKSSQFHSGNRPVGPVQS 241

Query: 247 LLSGAIAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGI 306
           L+SG +AGI SK  ++PLD+V+KR+QV+G          +P+ +  ++ C+ +I + +G 
Sbjct: 242 LISGGLAGIGSKCVIYPLDMVKKRMQVRGFEEARAQFGRIPIRNDGLYRCLLEIWQMEGA 301

Query: 307 FGLYKGLMPALIKSAPVSAVTFFVYGYTKR-LLEKLHS 343
              +KGL P L+KS    +  F VY    R LL + HS
Sbjct: 302 AAFFKGLRPTLLKSFVSISCRFTVYEQICRFLLYQKHS 339



>gi|308810831|ref|XP_003082724.1| putative mitochondrial carrier protein (ISS) [Ostreococcus tauri]
 gi|116061193|emb|CAL56581.1| putative mitochondrial carrier protein (ISS) [Ostreococcus tauri]
          Length = 703

 Score =  192 bits (489), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 105/302 (34%), Positives = 165/302 (54%), Gaps = 24/302 (7%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIR 91
           + GA+AG  +R   +PLDV+KIR+Q+Q                +  KY G++HA++ I+R
Sbjct: 31  LAGAIAGATARACVAPLDVIKIRMQVQ------------LEEASTGKYRGLAHAVRTIVR 78

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGA 151
           EEG RG+W G   A  L++ Y A+QF T     +     +  + E       L  F+ GA
Sbjct: 79  EEGARGMWAGTAPALMLWVPYTAIQFATLGVFNDAAAARERRRGETEATRSPLVGFVGGA 138

Query: 152 ISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGY-RGFYRGVTASVVQI 210
           ++G+ AT++TYPFD++RT  A+QG  ++Y  + +A + +    G  RG Y G++ ++ +I
Sbjct: 139 VAGTVATVLTYPFDVMRTLLASQGHPKVYENVLDAARGVVRARGARRGLYAGLSVTLAEI 198

Query: 211 IPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVRKR 270
           IP   + FGSY  LK            F ++    D   G +AG  ++  V PLD+V+KR
Sbjct: 199 IPASAVQFGSYAALKTR----------FPDVFGENDFACGFVAGTAARLVVHPLDVVKKR 248

Query: 271 LQVQGPNRKDYFISNVPLYSSSIF-ICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFF 329
            Q+ G  R   + + V       F   ++ I +++G+ G YKGL P+LIKSAP SA+TF 
Sbjct: 249 FQIAGFTRSLAYGARVDAAGYVNFAAAVRTIAKTEGVRGFYKGLTPSLIKSAPASAITFA 308

Query: 330 VY 331
           V+
Sbjct: 309 VF 310



>gi|254571751|ref|XP_002492985.1| Mitochondrial membrane transporter [Komagataella pastoris GS115]
 gi|238032783|emb|CAY70806.1| Mitochondrial membrane transporter [Komagataella pastoris GS115]
 gi|328353001|emb|CCA39399.1| Calcium-binding mitochondrial carrier protein SCaMC-1 [Komagataella
           pastoris CBS 7435]
          Length = 306

 Score =  191 bits (484), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 114/313 (36%), Positives = 176/313 (56%), Gaps = 37/313 (11%)

Query: 33  CGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIRE 92
            G+V+GMV+R V +PLDV+KIRLQL+         S +++   + +YNG+   +K II  
Sbjct: 21  AGSVSGMVARAVTAPLDVIKIRLQLE---------SYYNSHAKVPQYNGIIPTLKKIIAT 71

Query: 93  EG-IRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGA 151
           EG I+ LW GN+ AE +Y+ YGA QF  Y  +     + ++  N  F +  +L   + G+
Sbjct: 72  EGGIKRLWKGNIPAEIMYMLYGATQFTCYSTVNTFLTQTENRHN--FKVPVSLHSLILGS 129

Query: 152 ISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQII 211
           +SG  +T+V+YPFD+LRTR A+   K  +  +      +   EG + FY G+  +V  + 
Sbjct: 130 VSGVFSTLVSYPFDVLRTRLASNRSKH-FASMFGCSIDMLKHEGIKSFYSGIGTAVSGVS 188

Query: 212 PYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVRKRL 271
             MGL F +YEFL+ L     D H   ++  A  + +SG +AGI++K+  FPLDL+R+RL
Sbjct: 189 LSMGLTFFAYEFLRNL-----DSH---YDELAFIEPISGFMAGIIAKSSTFPLDLIRRRL 240

Query: 272 QVQ----GPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVT 327
           QV     G  R+ +   +            K+I   +G+ G Y GL PAL+K+AP +A++
Sbjct: 241 QVHRKWLGHERETFMTIS------------KKIFIREGLRGFYSGLTPALLKTAPTTAIS 288

Query: 328 FFVYGYTKRLLEK 340
            + Y Y  R LEK
Sbjct: 289 IWTYEYVVRGLEK 301



>gi|182704671|sp|Q2HFL6.2|TPC1_CHAGB RecName: Full=Mitochondrial thiamine pyrophosphate carrier 1
          Length = 325

 Score =  189 bits (481), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 115/307 (37%), Positives = 167/307 (54%), Gaps = 14/307 (4%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           S +++   GA AG+V+RFV +PLDVVKIRLQLQ     +PLS R  + G +  Y G    
Sbjct: 13  SRLQVTAAGATAGLVARFVIAPLDVVKIRLQLQTHSLSDPLSHRDLHGGPI--YKGTLPT 70

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQ 145
           ++ I+R EGI GLW GN+ AE LY+ Y A+QF TY     L  +          +  + +
Sbjct: 71  LRHILRSEGITGLWKGNVPAELLYVCYSAIQFTTYRTTTLLLHQTLGEGT----LPPSAE 126

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEK-RIYIGLRNAVQQIYVQEGYRGFYRGVT 204
            F++GAI G TAT  TYP D         G++ R+   +        V+    GF+    
Sbjct: 127 SFVAGAIGGGTATAATYPLDPAAHALRRPGQRSRVCESVARRGPDWVVRRAPVGFFGVWD 186

Query: 205 ASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPL 264
            +  QIIPYM   F +YE L+    +LE          ++   ++  +A +++K+  FPL
Sbjct: 187 RAWAQIIPYMSFFFATYETLRPHLSELELPF-------SSSSAVARTMASVMAKSRTFPL 239

Query: 265 DLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVS 324
           DLVRKR+QVQ P R  Y   N+P Y       ++ IL+ +G+ GLY+GL  +L+K+AP S
Sbjct: 240 DLVRKRIQVQSPTRGRYVHKNIPEYYGGTVGALRTILQREGLRGLYRGLTVSLLKAAPAS 299

Query: 325 AVTFFVY 331
           AVT + Y
Sbjct: 300 AVTMWTY 306



>gi|198429285|ref|XP_002131242.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Ciona
           intestinalis]
          Length = 303

 Score =  189 bits (481), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 111/301 (36%), Positives = 164/301 (54%), Gaps = 21/301 (6%)

Query: 31  GICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLII 90
           GI G   G ++R +  P+DVVKIR QLQPG   + L           KYNG+  A+K I 
Sbjct: 16  GIAGVFGGQITRALVCPIDVVKIRFQLQPGTVRSEL-----------KYNGLIQAVKTIW 64

Query: 91  REEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSG 150
           +EE I G + G++ A+ L + YG VQF ++  +      I  +  +   +   +  F  G
Sbjct: 65  KEESIYGFYKGHVPAQLLSMVYGGVQFASFEYITKAANEIIPHSKDDHSVRSVVH-FGCG 123

Query: 151 AISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQI 210
            +SG+  T+ + PFD++RTRFAAQ E + Y  + +A++ +YV EG   F++G+T ++ QI
Sbjct: 124 CLSGAICTLTSQPFDVVRTRFAAQKEPKQYRTVTSAIKGMYVGEGLSSFFKGLTPALSQI 183

Query: 211 IPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVRKR 270
           IPY G  F     L+ L+R+         N       + G  AG++SK  V+P+D+V+KR
Sbjct: 184 IPYSGFTFCFNSLLQGLWRECS------FNEGPVSHTICGGGAGLMSKCIVYPMDVVKKR 237

Query: 271 LQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFFV 330
           LQVQG +     IS V  Y +    CI  I + +G+ G YKGL  A IKS   SA+ F  
Sbjct: 238 LQVQGFSEAT--ISEVVTY-NGFRDCISTIKKQEGVRGFYKGLHVAAIKSTCTSALIFLT 294

Query: 331 Y 331
           Y
Sbjct: 295 Y 295



>gi|116180720|ref|XP_001220209.1| hypothetical protein CHGG_00988 [Chaetomium globosum CBS 148.51]
 gi|88185285|gb|EAQ92753.1| hypothetical protein CHGG_00988 [Chaetomium globosum CBS 148.51]
          Length = 349

 Score =  189 bits (480), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 115/307 (37%), Positives = 167/307 (54%), Gaps = 14/307 (4%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           S +++   GA AG+V+RFV +PLDVVKIRLQLQ     +PLS R  + G +  Y G    
Sbjct: 37  SRLQVTAAGATAGLVARFVIAPLDVVKIRLQLQTHSLSDPLSHRDLHGGPI--YKGTLPT 94

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQ 145
           ++ I+R EGI GLW GN+ AE LY+ Y A+QF TY     L  +          +  + +
Sbjct: 95  LRHILRSEGITGLWKGNVPAELLYVCYSAIQFTTYRTTTLLLHQTLGEGT----LPPSAE 150

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEK-RIYIGLRNAVQQIYVQEGYRGFYRGVT 204
            F++GAI G TAT  TYP D         G++ R+   +        V+    GF+    
Sbjct: 151 SFVAGAIGGGTATAATYPLDPAAHALRRPGQRSRVCESVARRGPDWVVRRAPVGFFGVWD 210

Query: 205 ASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPL 264
            +  QIIPYM   F +YE L+    +LE          ++   ++  +A +++K+  FPL
Sbjct: 211 RAWAQIIPYMSFFFATYETLRPHLSELELPF-------SSSSAVARTMASVMAKSRTFPL 263

Query: 265 DLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVS 324
           DLVRKR+QVQ P R  Y   N+P Y       ++ IL+ +G+ GLY+GL  +L+K+AP S
Sbjct: 264 DLVRKRIQVQSPTRGRYVHKNIPEYYGGTVGALRTILQREGLRGLYRGLTVSLLKAAPAS 323

Query: 325 AVTFFVY 331
           AVT + Y
Sbjct: 324 AVTMWTY 330



>gi|308477077|ref|XP_003100753.1| hypothetical protein CRE_15507 [Caenorhabditis remanei]
 gi|308264565|gb|EFP08518.1| hypothetical protein CRE_15507 [Caenorhabditis remanei]
          Length = 313

 Score =  188 bits (478), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 114/323 (35%), Positives = 171/323 (52%), Gaps = 23/323 (7%)

Query: 25  LSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSH 84
           L+S E    G  +G+V+R +  PLDV+KIR QLQ   PI     R   SG   KY G+  
Sbjct: 13  LTSAEYSEAGLASGIVTRMIIQPLDVLKIRFQLQE-EPI-----RGRKSG---KYKGVMQ 63

Query: 85  AIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTL 144
           ++ LI REEG +  W G++ A+ L  +YG VQF ++  +     R   + ++     ++ 
Sbjct: 64  SVFLITREEGAQAFWKGHIPAQGLSATYGLVQFSSFEWLSRHAARFIPSDDQSV---RST 120

Query: 145 QPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKR-IYIGLRNAVQQIYVQEGYRGFYRGV 203
             F+ GA+SG  A     P D++RTR  AQ     +Y G  +AV+ I+ +EG  G++RG 
Sbjct: 121 SDFMCGALSGCLAMTAAMPLDVIRTRLVAQKSGHAVYTGTMHAVRHIWEKEGIAGYFRGW 180

Query: 204 TASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFP 263
             SVVQI P+ G+ F  Y     L+         F    +T  L SGA+AG V+K  ++P
Sbjct: 181 VPSVVQIAPFTGMQFALYNCFMDLWP--------FTGYESTGALFSGAMAGTVAKTVLYP 232

Query: 264 LDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPV 323
           LD+VR RLQ+ G +R  +       YS  +F  I  ++R++  +GL+KGL P+ IK+A  
Sbjct: 233 LDMVRHRLQMNGFDRAGF--GKTSNYSQGLFKTIMMVVRNESWYGLFKGLWPSQIKAAAN 290

Query: 324 SAVTFFVYGYTKRLLEKLHSSRD 346
           S   F  Y     L+ K  ++ D
Sbjct: 291 SGCAFLFYEMFCDLIRKNKNTDD 313



>gi|281208100|gb|EFA82278.1| mitochondrial substrate carrier family protein [Polysphondylium
           pallidum PN500]
          Length = 332

 Score =  188 bits (478), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 120/336 (35%), Positives = 180/336 (53%), Gaps = 55/336 (16%)

Query: 33  CGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIRE 92
            G+++G  +R + +PLDV+KIRLQLQ        S     S +  +Y G+ + +  I RE
Sbjct: 20  AGSISGATTRMIVAPLDVIKIRLQLQK-------SGGSATSTSPPQYRGVFNTLGKITRE 72

Query: 93  EGIRGLWNGNLSAEYLYLSYGAVQFLTYHQM------QNLFKRIDSNQNEKFGINKTLQP 146
           EGIR LW GNLSAE+L++SY   QF  Y+        +N     +SNQ+ K     T   
Sbjct: 73  EGIRALWKGNLSAEFLWISYATAQFSLYNSFVHSLDQENYLAHQNSNQHYK---PPTYIS 129

Query: 147 FLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTAS 206
            L+GA +GS AT ++YPFD LRT   AQ +   ++ +   V+QIY  +GY GFY+G+T+S
Sbjct: 130 LLAGATAGSIATAISYPFDTLRTNIVAQHQ---HVTIPQCVRQIYHTKGYIGFYKGITSS 186

Query: 207 VVQIIPYMGLVFGSYEFLKKLF-----RKLEDKH------IWFHNLRATED--------L 247
           V+QIIP + L F SYE+LK L+      K + +H         +++R   +        L
Sbjct: 187 VLQIIPQISLQFASYEWLKNLYIHIAIAKEQHQHAKNNNNNNNNSIRTPRELSKDPIIQL 246

Query: 248 LSGAIAGIVSKAGVFPLDLVRKRLQVQ--GPNRKDYFISNVPLYSSSIFICIKQILRSDG 305
           LSG  +G +SK  V P D+V+KR+QV   G   K                CI  + +++G
Sbjct: 247 LSGGSSGAISKFIVLPFDVVKKRMQVAPGGITLKQ---------------CISDMFKNEG 291

Query: 306 IFGLYKGLMPALIKSAPVSAVTFFVYGYTKRLLEKL 341
               YKG +P++IK+   ++++F  Y   K LL  +
Sbjct: 292 WRAFYKGGVPSMIKAGAAASLSFTFYEQAKTLLTDM 327



>gi|303278984|ref|XP_003058785.1| mitochondrial carrier family [Micromonas pusilla CCMP1545]
 gi|226459945|gb|EEH57240.1| mitochondrial carrier family [Micromonas pusilla CCMP1545]
          Length = 406

 Score =  188 bits (477), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 124/328 (37%), Positives = 179/328 (54%), Gaps = 25/328 (7%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLS-------SRHHNSGTLKK 78
           S+    + GA AGMVSR   +PLDVVKIR+Q+Q    + P+        +    +G   K
Sbjct: 89  STFTQAMAGAFAGMVSRVAVAPLDVVKIRMQVQ----VEPVGFSGLNANAAATATGGGGK 144

Query: 79  YNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKF 138
           Y G++   + I+REEG+RGLW G + A +L++ Y A+QF    +    F+++ S   +  
Sbjct: 145 YRGIAQCARTILREEGLRGLWAGTVPALFLWVPYTAIQFAALGE----FRKVASAAGQN- 199

Query: 139 GINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRG 198
                   F  GAI+G+TAT+ TYPFD++RT  AAQG  R+Y  L +A   I    G RG
Sbjct: 200 -PTSPAMSFAGGAIAGATATVATYPFDVMRTVLAAQGSPRVYASLADAAAGIVRDRGVRG 258

Query: 199 FYRGVTASVVQIIPYMGLVFGSYEFLKKLFR-----KLEDKHIWFHNLRATEDLLSGAIA 253
            Y GV  ++++IIP   + FGSY  +K+        K E  H    +L    +   G  A
Sbjct: 259 LYAGVGVTLIEIIPASAIQFGSYAAMKRTAMRWEHGKEETDHGQQPSLSGFANGACGFGA 318

Query: 254 GIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSS---SIFICIKQILRSDGIFGLY 310
           G+V++  + PLD+V+KR QV G  R   +   V +      SI   +++IL  +G+ G Y
Sbjct: 319 GVVARLIIHPLDVVKKRFQVAGLARSLRYGERVAMDGEAFKSIAGAMRRILAKEGVGGFY 378

Query: 311 KGLMPALIKSAPVSAVTFFVYGYTKRLL 338
           KGL P LIKSAP SA+TF VY    RL+
Sbjct: 379 KGLTPGLIKSAPASAITFAVYEAVLRLM 406



>gi|320582629|gb|EFW96846.1| Mitochondrial membrane transporter [Ogataea parapolymorpha DL-1]
          Length = 289

 Score =  187 bits (476), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 108/314 (34%), Positives = 170/314 (54%), Gaps = 47/314 (14%)

Query: 34  GAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIREE 93
           GAV+G+V+R V +P+D++KIRLQL  G+                +Y G+   ++ I+  E
Sbjct: 21  GAVSGLVARMVIAPIDIIKIRLQLNGGQ---------------DRYRGIIQTVRTILHNE 65

Query: 94  GIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGAIS 153
           GIR  W GNL AE +YL YGA QF TY  +  L    D+ +  +  +  ++     GA+S
Sbjct: 66  GIRAFWKGNLPAEIMYLIYGATQFATYSTLNQLVS--DTEKTLELKVPGSVHAVTIGALS 123

Query: 154 GSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPY 213
           G  +T+++YPFD+LRTR AA+ E   +       +++Y ++G R F+RG+  S+  +   
Sbjct: 124 GCVSTVMSYPFDVLRTRLAAK-ENPYFTSFLAEAKEMYAKDGIRAFFRGIQLSMGYVSLS 182

Query: 214 MGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVRKRLQV 273
           MG+ FG Y F K             H      +  +G +AG +SK  V+PLDLV++R  +
Sbjct: 183 MGVSFGVYSFYKD------------HMANTPLEPAAGLVAGTISKTFVYPLDLVKRRKHM 230

Query: 274 QGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGY 333
               R   F++            ++ IL ++GI G Y GL PALIK+AP +AV+F+ Y +
Sbjct: 231 AHEGR---FVAT-----------MRNILATEGIRGAYHGLTPALIKAAPTAAVSFWCYEW 276

Query: 334 TKRLLEKLHSSRDK 347
           T   ++ L  ++DK
Sbjct: 277 T---VDWLMRAKDK 287



>gi|294657452|ref|XP_459760.2| DEHA2E10428p [Debaryomyces hansenii CBS767]
 gi|218512112|sp|Q6BPW0.3|TPC1_DEBHA RecName: Full=Mitochondrial thiamine pyrophosphate carrier 1
 gi|199432702|emb|CAG87999.2| DEHA2E10428p [Debaryomyces hansenii CBS767]
          Length = 316

 Score =  187 bits (476), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 109/325 (33%), Positives = 175/325 (53%), Gaps = 28/325 (8%)

Query: 23  SQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGM 82
           S++S  E  I G+++G ++R + +PLD +KIRLQLQ          + +++     Y G 
Sbjct: 19  SKVSPYEALIAGSLSGAIARGIIAPLDTIKIRLQLQI---------QGYDT-----YKGA 64

Query: 83  SHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINK 142
           S     I + EG++ LW GN+ AE LY+ YGA+QF +Y  +       + N    F I+ 
Sbjct: 65  SKTFVSICKNEGVKALWKGNVPAEILYILYGAIQFTSYSALSKALSEFEKNNRNLFTISN 124

Query: 143 TLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRG 202
           +    ++G+ SG  +T  TYPFDLLRTR AA  E   ++ + + ++ IY   G  GF +G
Sbjct: 125 STHSLIAGSGSGLASTFFTYPFDLLRTRLAANSEAH-FLSMSSTIKSIYEMHGIGGFCKG 183

Query: 203 VTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVF 262
           +T  ++ +    GL+F SYE  ++     +D   +            G IAG  +K   F
Sbjct: 184 LTPGLLSVASSTGLMFWSYELAREFSNNYKDVIPFLEG-------FCGFIAGATAKGLTF 236

Query: 263 PLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAP 322
           PLD +RKR+Q+    R D   +++     +I +C K IL+++GIFG YKG   +++KSAP
Sbjct: 237 PLDTLRKRIQMLSKTR-DIDQNSIK----AIQLC-KTILKNEGIFGFYKGFSISILKSAP 290

Query: 323 VSAVTFFVYGYTKRLLEKLHSSRDK 347
            SA++ F Y Y+   +++  S   K
Sbjct: 291 TSAISLFTYEYSLSAIKEFTSKHKK 315



>gi|432868425|ref|XP_004071531.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like
           [Oryzias latipes]
          Length = 324

 Score =  187 bits (476), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 112/323 (34%), Positives = 174/323 (53%), Gaps = 17/323 (5%)

Query: 23  SQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGM 82
           + +S  E  + G+ AGMV+R + SP DVVKIR QLQ    I  +S+         KY G+
Sbjct: 11  AAISPKEAVLAGSAAGMVTRALISPFDVVKIRFQLQ----IERVSALRPEG----KYAGL 62

Query: 83  SHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINK 142
             A + I  EEG+   W G++ A+ L + YGAVQF ++  +  +  ++    ++  G++ 
Sbjct: 63  FQAFRCIYSEEGLSAFWKGHVPAQLLSICYGAVQFTSFEVLTKMVYKLTPYDSQSAGVH- 121

Query: 143 TLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRG 202
               F  G ++  +AT+V  P D LRTRFA+QGE ++Y  LR+AV  ++  EG   F+RG
Sbjct: 122 ----FFCGGLAACSATVVCQPLDTLRTRFASQGEPKVYRNLRHAVSTMWRTEGPLTFFRG 177

Query: 203 VTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVF 262
           ++ ++V + PY GL F  Y   KK             +L++   L+ G+ AG++SK   +
Sbjct: 178 LSPTLVAVYPYAGLQFFFYNVSKKWLGPPSKGGDSGGSLKS---LVCGSGAGVISKTITY 234

Query: 263 PLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAP 322
           P DL +KRLQV G          V  Y S +  C+ QI + +G  G +KGL P+L+K+A 
Sbjct: 235 PFDLFKKRLQVGGFEAARARFGQVRRY-SGLMDCMFQIAKEEGFRGFFKGLSPSLVKAAL 293

Query: 323 VSAVTFFVYGYTKRLLEKLHSSR 345
            +  TFF Y +   L+  +   R
Sbjct: 294 STGFTFFWYEFFINLIHNVERRR 316



>gi|255078766|ref|XP_002502963.1| mitochondrial carrier family [Micromonas sp. RCC299]
 gi|226518229|gb|ACO64221.1| mitochondrial carrier family [Micromonas sp. RCC299]
          Length = 407

 Score =  187 bits (475), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 119/335 (35%), Positives = 175/335 (52%), Gaps = 39/335 (11%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIR 91
           + GA AG VSR   +PLDVVKIR+Q+Q    + P+     N     KY G+      I++
Sbjct: 86  MAGAFAGGVSRVAVAPLDVVKIRMQVQ----VEPV----LNGVAGGKYRGIVQCATTILK 137

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQP--FLS 149
           EEG RGLW G + A +L++ Y A+QF +  +    F+R    +  + G + T  P  FL 
Sbjct: 138 EEGARGLWAGTVPALFLWVPYTAIQFASLGE----FRR----RAREAGRDPTAPPWAFLG 189

Query: 150 GAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQ 209
           GAI+G++AT+ TYPFD++RT  AAQG  R+Y  L  A   I    G  G Y G   ++++
Sbjct: 190 GAIAGASATVCTYPFDVMRTVLAAQGSPRVYHSLAQAATGIVRDRGVAGLYAGCGVTLIE 249

Query: 210 IIPYMGLVFGSYEFLKKLFRK----LEDKHIWFHNLRATE----------------DLLS 249
           IIP   + FG+Y  L+ L  +     +D  I  +     E                +   
Sbjct: 250 IIPASAIQFGAYAALRNLATRGGVYGDDGEIESNRGGGGERKKMDEAGERRIDPATNAAC 309

Query: 250 GAIAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNV-PLYSSSIFICIKQILRSDGIFG 308
           G  AG V++  + PLD+V+KR QV G  R   +   V P   ++    +  IL+ +G+ G
Sbjct: 310 GFGAGTVARLIIHPLDVVKKRFQVAGLARSLRYGERVAPAAYANFASAVGAILKKEGVAG 369

Query: 309 LYKGLMPALIKSAPVSAVTFFVYGYTKRLLEKLHS 343
            YKGL+P +IKSAP SA+TF VY  T   L  +++
Sbjct: 370 FYKGLLPGVIKSAPASAITFAVYEATMVALSAMNA 404



>gi|444727840|gb|ELW68318.1| Mitochondrial thiamine pyrophosphate carrier [Tupaia chinensis]
          Length = 368

 Score =  185 bits (469), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 121/371 (32%), Positives = 182/371 (49%), Gaps = 68/371 (18%)

Query: 25  LSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSH 84
           ++  E+ + G+V+G+V+R + SPLDV+KIR QLQ    I  LS    N+    KY+G+  
Sbjct: 13  VTKFEVAVAGSVSGLVTRVLISPLDVIKIRFQLQ----IERLSRSDPNA----KYHGILQ 64

Query: 85  AIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQ---------------------------- 116
           A + I++EEG    W G++ A+ L +SYGAVQ                            
Sbjct: 65  AARQILQEEGPAAFWKGHIPAQLLSISYGAVQLSQPLHRPEAYGADVPLLFRLRLAQRCC 124

Query: 117 ----------------------FLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGAISG 154
                                 FL++  +  L  R  +   ++F ++     F+ G +S 
Sbjct: 125 VRPGPPEECRGPALILFSPVSQFLSFEFLTELVHRGSAYNAQEFSVH-----FVCGGLSA 179

Query: 155 STATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPYM 214
             AT+  +P D+LRTRFAAQGE R+Y  LR AV  +Y  EG   FY+G+  +++ I PY 
Sbjct: 180 CMATLAVHPVDVLRTRFAAQGEPRVYKTLREAVMTMYRTEGPWVFYKGLNPTLIAIFPYA 239

Query: 215 GLVFGSYEFLKKLFR-KLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVRKRLQV 273
           G  F  Y  LK  F   +  +     NL+   +LL G+ AG++SK   +PLDL +KRLQV
Sbjct: 240 GFQFSCYNSLKHAFEWAMPTQGKKNENLK---NLLCGSGAGVISKTLTYPLDLFKKRLQV 296

Query: 274 QGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGY 333
            G  +       V  Y   +  C KQ+LR +G  G +KGL P+L+K+A  +   FF Y +
Sbjct: 297 GGFEQARAAFGQVRSY-RGLRDCAKQVLREEGAQGFFKGLSPSLLKAALSTGFMFFWYEF 355

Query: 334 TKRLLEKLHSS 344
              L   +  +
Sbjct: 356 FCNLFHCMKKA 366



>gi|91092070|ref|XP_970936.1| PREDICTED: similar to AGAP005113-PA [Tribolium castaneum]
 gi|270004683|gb|EFA01131.1| hypothetical protein TcasGA2_TC010344 [Tribolium castaneum]
          Length = 311

 Score =  184 bits (468), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 109/328 (33%), Positives = 178/328 (54%), Gaps = 34/328 (10%)

Query: 21  AASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYN 80
           ++ +LS ++  I G  +G ++R +  PLDV+KIR QLQ    + P+   +     + KY 
Sbjct: 7   SSHKLSQLDFVIAGGGSGFITRMLCQPLDVLKIRFQLQ----VEPILKSN-----VSKYQ 57

Query: 81  GMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGI 140
            + HA  LI++EEG++ LW G++ A+ L +SYG  QF ++  +     RI+        +
Sbjct: 58  SVFHAANLIVKEEGVKALWKGHVPAQLLSISYGVAQFWSFEVLTKQVSRIN--------L 109

Query: 141 NKTLQP---FLSGAISGSTATIVTYPFDLLRTRFAAQGEKR-IYIGLRNAVQQIYVQEGY 196
           + T  P   F  GA++G  AT+ ++PFD++RTR  AQ E R +Y G+  A   I   EG+
Sbjct: 110 SPTFSPMVNFTCGALAGCYATLASFPFDVVRTRLVAQSENRKVYSGILQAFTSILKNEGF 169

Query: 197 RGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIV 256
              YRG+  + +Q+ P+ G  F  Y+    +++ L +      N   T  L+SG++AG+ 
Sbjct: 170 FVLYRGIWPTFLQVAPHAGAQFMCYKLFDNIYKHLINS----QNTTLTSSLVSGSLAGLC 225

Query: 257 SKAGVFPLDLVRKRLQVQG--PNRKDY--FISNVPLYSSSIFICIKQILRSDGIFGLYKG 312
           +K  V+P DL +KRLQ+QG    R ++  F     L       C+ +I + +G  GL+KG
Sbjct: 226 AKTVVYPFDLAKKRLQIQGFEQGRAEFGQFFKCQGLND-----CLIRIYKVEGPSGLFKG 280

Query: 313 LMPALIKSAPVSAVTFFVYGYTKRLLEK 340
           L P+LIK+   +A+ F  Y    + L K
Sbjct: 281 LSPSLIKAVVTTALHFSSYELICKALAK 308



 Score = 76.6 bits (187), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 58/209 (27%), Positives = 93/209 (44%), Gaps = 27/209 (12%)

Query: 148 LSGAISGSTATIVTYPFDLLRTRFAAQGEKRI------YIGLRNAVQQIYVQEGYRGFYR 201
           ++G  SG    ++  P D+L+ RF  Q E  +      Y  + +A   I  +EG +  ++
Sbjct: 18  IAGGGSGFITRMLCQPLDVLKIRFQLQVEPILKSNVSKYQSVFHAANLIVKEEGVKALWK 77

Query: 202 GVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRAT----EDLLSGAIAGIVS 257
           G   + +  I Y    F S+E L K   ++        NL  T     +   GA+AG  +
Sbjct: 78  GHVPAQLLSISYGVAQFWSFEVLTKQVSRI--------NLSPTFSPMVNFTCGALAGCYA 129

Query: 258 KAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPAL 317
               FP D+VR RL  Q  NRK Y         S I      IL+++G F LY+G+ P  
Sbjct: 130 TLASFPFDVVRTRLVAQSENRKVY---------SGILQAFTSILKNEGFFVLYRGIWPTF 180

Query: 318 IKSAPVSAVTFFVYGYTKRLLEKLHSSRD 346
           ++ AP +   F  Y     + + L +S++
Sbjct: 181 LQVAPHAGAQFMCYKLFDNIYKHLINSQN 209



>gi|499005988|ref|XP_004535713.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like
           [Ceratitis capitata]
          Length = 345

 Score =  184 bits (467), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 112/309 (36%), Positives = 174/309 (56%), Gaps = 25/309 (8%)

Query: 34  GAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIREE 93
           GA++G ++R +  P DV+KIR QLQ    + PLS   H  G   KY  +  A KLI REE
Sbjct: 42  GAISGALTRTITQPFDVLKIRFQLQ----VEPLSP--HKKG---KYTSLWQASKLIYREE 92

Query: 94  GIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKR---IDSNQNEKFGINKTLQPFLSG 150
           G+RGL+ G+ + +++ + Y   QF +Y Q++ + +    + S+ N        +  FL+G
Sbjct: 93  GMRGLFKGHNAGQFMSVVYSVGQFWSYEQIRAIMRDRPFMSSHMN--------IMNFLAG 144

Query: 151 AISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQI 210
             +G  ATI + PFD++RTR  AQ   + Y  + +AV  I+  EG RG++RG+  ++VQI
Sbjct: 145 GFAGCVATIFSIPFDVIRTRIVAQDPGQGYRSMLHAVPMIWRTEGIRGYFRGLQPTLVQI 204

Query: 211 IPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLL-SGAIAGIVSKAGVFPLDLVRK 269
           +P +G    ++ F KK    L+   +  + L  T  LL +G  AG+ SKA V+PLD ++K
Sbjct: 205 VPLVGF---NFMFYKKFNEMLQHTPLAHNELLPTWVLLCTGGAAGVASKAVVYPLDFIKK 261

Query: 270 RLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFF 329
           RLQVQG  +              +F CI+  ++ +G+ G YKG+ P LIKS  ++A  F 
Sbjct: 262 RLQVQGFEQHRTKFGRTQR-CRGVFHCIELTMKDEGVRGFYKGMYPTLIKSGLMTAFYFT 320

Query: 330 VYGYTKRLL 338
           +Y   K +L
Sbjct: 321 IYDRCKLIL 329



 Score = 84.7 bits (208), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 60/214 (28%), Positives = 96/214 (44%), Gaps = 20/214 (9%)

Query: 132 SNQNEKFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGE------KRIYIGLRN 185
           S  ++       L    +GAISG+    +T PFD+L+ RF  Q E      K  Y  L  
Sbjct: 24  SAHDDYTSTRAQLNQIYAGAISGALTRTITQPFDVLKIRFQLQVEPLSPHKKGKYTSLWQ 83

Query: 186 AVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATE 245
           A + IY +EG RG ++G  A     + Y    F SYE ++ + R   D+     ++    
Sbjct: 84  ASKLIYREEGMRGLFKGHNAGQFMSVVYSVGQFWSYEQIRAIMR---DRPFMSSHMNIM- 139

Query: 246 DLLSGAIAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDG 305
           + L+G  AG V+     P D++R R+  Q P +             S+   +  I R++G
Sbjct: 140 NFLAGGFAGCVATIFSIPFDVIRTRIVAQDPGQG----------YRSMLHAVPMIWRTEG 189

Query: 306 IFGLYKGLMPALIKSAPVSAVTFFVYGYTKRLLE 339
           I G ++GL P L++  P+    F  Y     +L+
Sbjct: 190 IRGYFRGLQPTLVQIVPLVGFNFMFYKKFNEMLQ 223



>gi|499015289|ref|XP_004558459.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like
           isoform X1 [Maylandia zebra]
 gi|499015291|ref|XP_004558460.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like
           isoform X2 [Maylandia zebra]
 gi|499015293|ref|XP_004558461.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like
           isoform X3 [Maylandia zebra]
          Length = 361

 Score =  184 bits (466), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 124/359 (34%), Positives = 182/359 (50%), Gaps = 43/359 (11%)

Query: 17  EQAVAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTL 76
           +  V  + LS  E    G+ AGMV+R + SP DV+KIR QLQ    I  +SS+       
Sbjct: 5   DPGVQGAPLSPKEAAFAGSAAGMVTRALISPFDVIKIRFQLQ----IERVSSKTPQG--- 57

Query: 77  KKYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQF--------------LTYHQ 122
            KY G+  A + I  EEG+   W G++ A+ L + YGAVQ               +T + 
Sbjct: 58  -KYYGIFQATRCIHLEEGLSAFWKGHIPAQLLSICYGAVQVQPANCELQAKWNNCITLNN 116

Query: 123 MQNLFKRIDSN-QNEKFGI------NKTLQP-------FLSGAISGSTATIVTYPFDLLR 168
           + N    I SN Q   F         KTL         F+ G ++  +AT+V  P D LR
Sbjct: 117 LNNTVAFIVSNLQFASFEFLTELVHQKTLYDSQTAGVHFVCGGLAACSATVVCQPLDTLR 176

Query: 169 TRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLF 228
           TRFAAQGE ++Y  LR+AV  ++  EG   FYRG++ +++ + PY GL F  Y   KKL 
Sbjct: 177 TRFAAQGEPKVYRNLRHAVSTMWRSEGTLTFYRGLSPTLMAVFPYAGLQFFFYNIFKKLL 236

Query: 229 RKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPL 288
               +      NL++   L+ G+ AG++SK   +P DL +KRLQV G          V  
Sbjct: 237 APQPEAGNSGGNLKS---LVCGSGAGMISKTITYPFDLFKKRLQVGGFEAARAHFGQVRS 293

Query: 289 YSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGYTKRLLEKLHSSRDK 347
           Y   +  C+ QI + +G  G +KGL P+L+K+A  +  TFF Y +    +  +H+ ++K
Sbjct: 294 Y-RGLLDCMVQIAKEEGFRGFFKGLSPSLVKAALSTGFTFFWYEF---FVNAMHNFKEK 348



>gi|392901138|ref|NP_001255632.1| Protein HPO-12, isoform a [Caenorhabditis elegans]
 gi|126468478|emb|CAM36351.1| Protein HPO-12, isoform a [Caenorhabditis elegans]
          Length = 313

 Score =  183 bits (465), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 110/308 (35%), Positives = 162/308 (52%), Gaps = 23/308 (7%)

Query: 25  LSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSH 84
           L+S E    G  +G+V+R +  PLDV+KIR QLQ   PI     R   SG   KY G+  
Sbjct: 13  LTSAEYSEAGLASGIVTRMIIQPLDVLKIRFQLQE-EPI-----RGKKSG---KYKGVMQ 63

Query: 85  AIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTL 144
           +I LI REEG    W G++ A+ L  +YG VQF ++  +     ++    N+     ++ 
Sbjct: 64  SIFLITREEGAHAFWKGHIPAQGLSATYGLVQFSSFEWLSQQAAKVIPADNQSV---RST 120

Query: 145 QPFLSGAISGSTATIVTYPFDLLRTRFAAQ-GEKRIYIGLRNAVQQIYVQEGYRGFYRGV 203
             F  GA+SG  A     P D++RTR  AQ     +Y G  +AV+ I+ +EG  G++RG 
Sbjct: 121 SDFACGALSGCLAMTAAMPLDVIRTRLVAQKAGHAVYTGTMHAVKHIWEKEGIAGYFRGW 180

Query: 204 TASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFP 263
             SVVQI P+ G+ F  Y     L+         F+   +   L SGA+AG V+K  ++P
Sbjct: 181 VPSVVQIAPFTGMQFALYNCFMDLWP--------FNGYESAGALFSGAMAGTVAKTVLYP 232

Query: 264 LDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPV 323
           LD+VR RLQ+ G  R  +       YS  +F  I  +++++  +GL+KGL P+ IK+A  
Sbjct: 233 LDMVRHRLQMNGFERAGF--GKTSNYSQGLFKTIGMVVKNESWYGLFKGLWPSQIKAAAN 290

Query: 324 SAVTFFVY 331
           S   F  Y
Sbjct: 291 SGCAFLFY 298



>gi|326437990|gb|EGD83560.1| hypothetical protein PTSG_04165 [Salpingoeca sp. ATCC 50818]
          Length = 308

 Score =  183 bits (465), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 108/307 (35%), Positives = 177/307 (57%), Gaps = 20/307 (6%)

Query: 40  VSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIREEGIRGLW 99
           +SRFV +P DVVKIRLQLQ    +  +S   H+S  L +Y  + H ++ + + EG+   W
Sbjct: 17  ISRFVVTPFDVVKIRLQLQ----VEEVS---HSS--LGRYRSLQHCVRDMYKHEGMASFW 67

Query: 100 NGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGAISGSTATI 159
            G+ +++ L +SY AVQF  +  ++++        +++  +      F++G+ + + AT+
Sbjct: 68  KGHTASQLLSISYAAVQFPVFEGVRDMLTTEQQRLSKEGDVRAN---FVAGSAAATVATV 124

Query: 160 VTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFG 219
            TYP D++RTR  +QGE ++Y  + +++  +   EG    YRG+  ++V +IPY+G  F 
Sbjct: 125 CTYPLDIVRTRMVSQGEPKVYRHVLHSLTSMIQHEGIGSLYRGLAPTLVAVIPYIGTSFS 184

Query: 220 SYEFLKKLFRKLEDKHIWFHNLRAT-EDLLSGAIAGIVSKAGVFPLDLVRKRLQVQ--GP 276
            Y   K+    L   H    N+ +T E  L+GAI+G+VSK  V P+D+V+KR QV   G 
Sbjct: 185 VYIGAKRALAALS--HDGQRNISSTFEKALAGAISGVVSKTLVHPIDIVKKRFQVMDFGH 242

Query: 277 NRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGYTKR 336
            R  +       Y SS +  +  ILR +G+ GL+KGL P+L+K+ P S +TF VY   ++
Sbjct: 243 ARDKFGFGATVRYESS-WHGLVSILRQEGVRGLFKGLTPSLVKAVPSSIITFLVYDSLRQ 301

Query: 337 LLEKLHS 343
           LL  +HS
Sbjct: 302 LL--IHS 306



>gi|50307493|ref|XP_453726.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|74660468|sp|Q6CQR3.1|TPC1_KLULA RecName: Full=Mitochondrial thiamine pyrophosphate carrier 1
 gi|49642860|emb|CAH00822.1| KLLA0D15015p [Kluyveromyces lactis]
          Length = 317

 Score =  183 bits (464), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 110/314 (35%), Positives = 172/314 (54%), Gaps = 34/314 (10%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIR 91
           I G+V+G+ +R   +P+D VKIR QLQP +                KY G++  ++ I++
Sbjct: 23  IAGSVSGVFARMATAPMDTVKIRYQLQPVQE--------------DKYKGIASTVRTIMK 68

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGA 151
           EEG+R LW GN+ A  +Y+ YGAVQF +Y    N++    S +  +F  ++  Q    GA
Sbjct: 69  EEGLRALWKGNIPATAMYVVYGAVQFGSYSWFNNVW----SAKFPRF--SQQGQTLTVGA 122

Query: 152 ISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQII 211
           ++G T+++V+YP DLLRTR  A         +    +Q+++ EG RGF+ G++ ++  + 
Sbjct: 123 LAGMTSSVVSYPLDLLRTRLIANRTSH-RTSVAEECRQMWLNEGVRGFFTGISTAMTTVT 181

Query: 212 PYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVRKRL 271
               ++F +YE +  +    E K  W   + A+    SG IAG VSK  VFP+D +R+R+
Sbjct: 182 LSTAIMFLTYETVNIVCENHE-KEFWSRPVSAS----SGIIAGFVSKTMVFPIDTLRRRM 236

Query: 272 QVQGPNRKDYFISNVPL------YSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSA 325
           QV    R  +F +  P       Y SS  I I +ILR +G+  LY+GL   L KS P +A
Sbjct: 237 QVMNSKRTVHF-TKFPAVYHEYRYKSSTAI-IYKILRQEGVSALYRGLTMGLCKSVPTTA 294

Query: 326 VTFFVYGYTKRLLE 339
           ++ FVY  T  L +
Sbjct: 295 ISLFVYERTMDLFD 308



>gi|406606223|emb|CCH42405.1| Mitochondrial aspartate-glutamate transporter AGC1 [Wickerhamomyces
           ciferrii]
          Length = 260

 Score =  183 bits (464), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 106/294 (36%), Positives = 167/294 (56%), Gaps = 39/294 (13%)

Query: 44  VASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIREEGIRGLWNGNL 103
             +PLDVVKIRLQLQ              SG   KY G+ H +K+I +EEG+  LW GN+
Sbjct: 2   CTAPLDVVKIRLQLQV-------------SGN--KYQGILHTVKVIAKEEGMLALWKGNV 46

Query: 104 SAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGAISGSTATIVTYP 163
            A  +Y+ YGA QF +Y    N+   + +  N  + I      F+ G+++G T+TI++YP
Sbjct: 47  PAAVMYILYGAAQFSSYSMYNNILSDLQTQYN--YHIGPASHSFILGSLAGCTSTIISYP 104

Query: 164 FDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEF 223
           FDLLRTRFA + +   +  L   V  I+ +EG  GF++GV A +V I  Y GL+F SYE 
Sbjct: 105 FDLLRTRFANEPK---FSKLSTTVSNIFKEEGALGFFKGVNAGMVSISLYTGLMFWSYE- 160

Query: 224 LKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFI 283
           + ++  +   K+      +   + L G  AG+ +K+ VFPLDL+RKRLQV     +++  
Sbjct: 161 ISRMVSQSSQKY------QPILEPLCGLSAGVFAKSVVFPLDLIRKRLQVNKAKNQNFIK 214

Query: 284 SNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGYTKRL 337
           + +            ++++ +G+ GLYKG + ++IKSAP +A++ + Y +  R+
Sbjct: 215 AGL------------KVVKVEGVKGLYKGFLASIIKSAPTTAISIWTYEHFLRV 256



>gi|226470538|emb|CAX70549.1| Mitochondrial deoxynucleotide carrier [Schistosoma japonicum]
 gi|226487096|emb|CAX75413.1| Mitochondrial deoxynucleotide carrier [Schistosoma japonicum]
 gi|226487098|emb|CAX75414.1| Mitochondrial deoxynucleotide carrier [Schistosoma japonicum]
          Length = 339

 Score =  182 bits (463), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 111/335 (33%), Positives = 179/335 (53%), Gaps = 27/335 (8%)

Query: 23  SQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGM 82
           + LS+ E  + G+V+G V+R V  PLDV+KIR QLQ    + P+     +     KY G+
Sbjct: 9   TSLSTNEYLLAGSVSGFVARAVVQPLDVIKIRFQLQ----MEPIEISRTS-----KYQGL 59

Query: 83  SHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDS---NQNEKFG 139
             A++ I +EEG    W G++ A+   +++ +VQFL++  + +     +S   + N+  G
Sbjct: 60  IQAVRCISKEEGTIAFWKGHVPAQIQSMAFTSVQFLSFEVILSWLHENNSLLISDNKILG 119

Query: 140 INKTLQP---FLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGY 196
           +  T +P   FL G  +G  A ++T P D+LRTRF AQGE + Y  + +A   I  +EG 
Sbjct: 120 LPITYKPVGNFLCGCGAGFVAAVMTQPLDVLRTRFIAQGEPKTYGSMSHAAACIISREGA 179

Query: 197 RGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFRK--------LEDKHIWFHNLR----AT 244
           RGF+RG+  S++ I P  G+ F  Y  + ++  +        L DK   FH+        
Sbjct: 180 RGFFRGIVPSLLLIAPQTGIQFAIYHSVNQMINQGRDYLDPNLIDKASQFHSCNRPIGPI 239

Query: 245 EDLLSGAIAGIVSKAGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSD 304
           + L+SG +AGI SK  ++PLD+V+KR+QV+G          +P  +  ++ C+ +I + +
Sbjct: 240 QSLISGGLAGIGSKCMIYPLDMVKKRMQVRGFEEARVQFGKIPNRNGGLYRCLIEIWQME 299

Query: 305 GIFGLYKGLMPALIKSAPVSAVTFFVYGYTKRLLE 339
           G    +KGL P L+KS    +  F VY    R L 
Sbjct: 300 GAAAFFKGLRPTLLKSFVSISCRFTVYEQICRFLH 334



>gi|312371078|gb|EFR19342.1| hypothetical protein AND_22648 [Anopheles darlingi]
          Length = 311

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 111/306 (36%), Positives = 167/306 (54%), Gaps = 25/306 (8%)

Query: 31  GICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLII 90
           G+ G + G ++RF+  PLDV+KIRLQLQ    + P+++    + T  KY  ++ ++  I 
Sbjct: 13  GLAGGLTGCITRFICQPLDVLKIRLQLQ----VEPIAT----TSTRSKYRSIAQSVACIY 64

Query: 91  REEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSG 150
           REEG+   W G+  A+ L L+YG  QF  Y +   L + +   +    G N     F+ G
Sbjct: 65  REEGLLAFWKGHNPAQLLSLTYGVAQFSFYERFNVLLREVPLLEGHDRGRN-----FICG 119

Query: 151 AISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQ---IYVQEGYRGFYRGVTASV 207
           A SGS A +V  P D++RTR  +Q   R   G RNA Q    IY QEG RG YRG+  ++
Sbjct: 120 ACSGSFAAMVIMPLDVIRTRLVSQDPGR---GYRNAGQGLLLIYRQEGIRGLYRGIGPAM 176

Query: 208 VQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLV 267
           +QI P  G  F  Y     + ++++        L   E  + G +AG+ +K  V+PLDL 
Sbjct: 177 LQIAPLTGGQFMFYNLFGTVAKRVQGLPTE-AQLPPGELFVCGGLAGLCTKLLVYPLDLA 235

Query: 268 RKRLQVQG--PNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSA 325
           +KRLQ+QG   +R+ Y           +F C+ Q+ R +G+ GLYKGL+P+L+K+   SA
Sbjct: 236 KKRLQIQGFAGSRQTY---GEHFVCRHMFHCLAQVGRREGMRGLYKGLLPSLLKAGFTSA 292

Query: 326 VTFFVY 331
             F +Y
Sbjct: 293 FYFTIY 298



>gi|341884174|gb|EGT40109.1| hypothetical protein CAEBREN_05011 [Caenorhabditis brenneri]
 gi|341900869|gb|EGT56804.1| hypothetical protein CAEBREN_03949 [Caenorhabditis brenneri]
          Length = 313

 Score =  181 bits (460), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 112/323 (34%), Positives = 168/323 (52%), Gaps = 23/323 (7%)

Query: 25  LSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSH 84
           L+S E    G  +G+V+R +  PLDV+KIR QLQ   PI     R   SG   KY G+  
Sbjct: 13  LTSTEYSEAGLASGIVTRMIIQPLDVLKIRFQLQE-EPI-----RGKKSG---KYKGVLQ 63

Query: 85  AIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTL 144
           ++ LI REEG +  W G++ A+ L  +YG VQF ++  +         + ++     ++ 
Sbjct: 64  SVLLITREEGAQAFWKGHIPAQGLSATYGLVQFSSFEWLSRHAANYIPSDDQSV---RST 120

Query: 145 QPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKR-IYIGLRNAVQQIYVQEGYRGFYRGV 203
             F+ GA+SG  A     P D++RTR  AQ     +Y G  +AV+ I+ +EG  G++RG 
Sbjct: 121 SDFVCGALSGCLAMTAAMPLDVIRTRLVAQKSGHAVYSGTMHAVRHIWEKEGVPGYFRGW 180

Query: 204 TASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFP 263
             SVVQI P+ G+ F  Y     L+         F    +T  L SGA+AG V+K  ++P
Sbjct: 181 IPSVVQIAPFTGMQFALYNCFMDLWP--------FTGYESTGALFSGAMAGTVAKTVLYP 232

Query: 264 LDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPV 323
           LD+VR RLQ+ G  R  +       YS  +F  I  ++R++  +GL+KGL P+ IK+A  
Sbjct: 233 LDMVRHRLQMNGFERAGF--GKTSNYSQGLFKTITMVVRNESWYGLFKGLWPSQIKAAAN 290

Query: 324 SAVTFFVYGYTKRLLEKLHSSRD 346
           S   F  Y     L+ +   + D
Sbjct: 291 SGCAFLFYEMFCDLIRRNKYTED 313



>gi|195111332|ref|XP_002000233.1| GI22635 [Drosophila mojavensis]
 gi|193916827|gb|EDW15694.1| GI22635 [Drosophila mojavensis]
          Length = 339

 Score =  181 bits (460), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 110/316 (34%), Positives = 175/316 (55%), Gaps = 22/316 (6%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQ--PGRPINPL---SSRHHNSGTLKKYNGMSHAI 86
           I G ++  ++R    PLDV+KIR QLQ  P +   P    SS+        KY  +  A+
Sbjct: 33  IAGGLSAAITRSTCQPLDVLKIRFQLQVEPFKAAAPSVQSSSKTDLPLHSSKYTSILQAV 92

Query: 87  KLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQP 146
           + I REEG+   W G+  A+ L + YG  QF TY Q+  L K+ +  ++ +      L  
Sbjct: 93  RTIYREEGLLAFWKGHNPAQVLSIMYGICQFWTYEQLSLLAKQTNYLKDHQH-----LSN 147

Query: 147 FLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTAS 206
           F+ GA +G+ A I++ P D++RTR  AQ   + Y     AV  I  QEG RG YRG++++
Sbjct: 148 FMCGASAGAAAVIISTPLDVIRTRLIAQDTSKGYRNATRAVTAIVRQEGIRGMYRGLSSA 207

Query: 207 VVQIIPYMGLVFGSYEFLKK---LFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFP 263
           ++QI P MG  F +Y    +    F +++D+      L     L+ GA +G++SK  V+P
Sbjct: 208 LLQIAPLMGTNFMAYRLFSESACKFFEVDDR----TKLPTWTLLMLGASSGMLSKTIVYP 263

Query: 264 LDLVRKRLQVQG--PNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSA 321
            DLV+KRLQ+QG   NR+ +      L  + ++ C++  +R +G+ GLYKG+ P L+KS+
Sbjct: 264 FDLVKKRLQIQGFEQNRQTF---GQTLKCNGVWDCLQLTVRQEGVRGLYKGVAPTLLKSS 320

Query: 322 PVSAVTFFVYGYTKRL 337
             +A+ F +Y   K++
Sbjct: 321 MTTALYFSIYDKLKQV 336



>gi|478252789|gb|ENN73182.1| hypothetical protein YQE_10236, partial [Dendroctonus ponderosae]
          Length = 314

 Score =  181 bits (458), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 107/313 (34%), Positives = 181/313 (57%), Gaps = 27/313 (8%)

Query: 24  QLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMS 83
           +LS  +  + G  +G  +R    PLDV+KIR QLQ    + P+S   H +    KY  + 
Sbjct: 10  RLSQFDFMVAGGGSGCFTRATCQPLDVLKIRFQLQ----VEPISYGAHTA----KYRSVV 61

Query: 84  HAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKT 143
            A++LI++EEG R  W G++ A++L +SYG  QF +Y   + L + +D     +  +  +
Sbjct: 62  QAVRLILKEEGARAFWKGHIPAQWLSISYGVGQFWSY---ELLVRNVD-----RLNVLPS 113

Query: 144 LQP---FLSGAISGSTATIVTYPFDLLRTRFAAQGE-KRIYIGLRNAVQQIYVQEGYRGF 199
           + P   F  G+I+GS AT+V++PFD++RTRF AQ E K++Y  + +AV QI   E     
Sbjct: 114 MTPLVNFTCGSIAGSVATLVSFPFDVVRTRFVAQSENKKVYHNILSAVIQICRTESPLVL 173

Query: 200 YRGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKA 259
           +RG+  +V+QI P+ G  F  Y     L++   +  I +  L  +  L +G++AG+ +K 
Sbjct: 174 FRGLWPTVLQIGPHAGAQFTCYRLFDDLYKYALN--IEYTTL--SSSLFAGSLAGLCAKT 229

Query: 260 GVFPLDLVRKRLQVQG-PNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALI 318
            ++P DLV+KR+Q+QG  + +++F  +       +  C++++ RS+G  G +KGL P+LI
Sbjct: 230 IIYPFDLVKKRMQIQGFAHAREHFGEH--FTCKGLIDCLQKVYRSEGHKGFFKGLSPSLI 287

Query: 319 KSAPVSAVTFFVY 331
           K+   +A+ F  Y
Sbjct: 288 KAICTTALHFSSY 300



 Score = 80.1 bits (196), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 59/205 (28%), Positives = 95/205 (46%), Gaps = 36/205 (17%)

Query: 33  CGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIRE 92
           CG++AG V+  V+ P DVV+ R   Q              S   K Y+ +  A+  I R 
Sbjct: 122 CGSIAGSVATLVSFPFDVVRTRFVAQ--------------SENKKVYHNILSAVIQICRT 167

Query: 93  EG----IRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFL 148
           E      RGLW   L        +   QF  Y    +L+K   +   E   ++ +L    
Sbjct: 168 ESPLVLFRGLWPTVLQIG----PHAGAQFTCYRLFDDLYKY--ALNIEYTTLSSSL---F 218

Query: 149 SGAISGSTATIVTYPFDLLRTRFAAQG---------EKRIYIGLRNAVQQIYVQEGYRGF 199
           +G+++G  A  + YPFDL++ R   QG         E     GL + +Q++Y  EG++GF
Sbjct: 219 AGSLAGLCAKTIIYPFDLVKKRMQIQGFAHAREHFGEHFTCKGLIDCLQKVYRSEGHKGF 278

Query: 200 YRGVTASVVQIIPYMGLVFGSYEFL 224
           ++G++ S+++ I    L F SYE +
Sbjct: 279 FKGLSPSLIKAICTTALHFSSYEMI 303



>gi|195119600|ref|XP_002004318.1| GI19679 [Drosophila mojavensis]
 gi|193909386|gb|EDW08253.1| GI19679 [Drosophila mojavensis]
          Length = 327

 Score =  181 bits (458), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 112/310 (36%), Positives = 171/310 (55%), Gaps = 28/310 (9%)

Query: 34  GAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIREE 93
           G V+G ++RFVA P DV+KIR QLQ    + PL  R + S    KY GM  A   I REE
Sbjct: 7   GGVSGALTRFVAHPFDVLKIRFQLQ----VEPLKKRSNVS----KYAGMLQAFSSIFREE 58

Query: 94  GIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFG-INKTLQPFLSGAI 152
           G+RG+W G+L A+ + ++Y  VQF +Y Q+        +    KFG  N  L  F+ G +
Sbjct: 59  GLRGIWKGHLPAQMMSITYALVQFWSYEQLHT------AALQYKFGRDNVHLSYFMCGGL 112

Query: 153 SGSTATIVTYPFDLLRTRFAAQGEKRIYIGLR--NAVQQIYVQEGYRGFYRGVTASVVQI 210
           +G   T+V  PFD++RTR  A         L+  + V +++  EG RG   G+  ++VQI
Sbjct: 113 AGCVGTVVAQPFDVVRTRVVAADPGTTAGTLKPFSGVHKVFKNEGLRGVSSGMMMTLVQI 172

Query: 211 IPYMGLVFGSYEFLKKLFRKL-----EDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLD 265
            P +G  F  Y+FL  L  K+     E+KH+    +      ++GAI+G+++K  ++P D
Sbjct: 173 YPLVGANFVIYKFLNHLTFKIISLIREEKHVR-REIPGPLLFMNGAISGVLAKVLIYPAD 231

Query: 266 LVRKRLQVQG--PNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPV 323
           L++KR  +     +RK + ++  PL   +I +CI+  L  +G+ G YKG+ P L KS  +
Sbjct: 232 LIKKRTMLSHFQEDRKSFGVN--PL-CDTIMLCIRSTLEKEGMRGFYKGMWPTLFKSGVM 288

Query: 324 SAVTFFVYGY 333
           SA  F +Y Y
Sbjct: 289 SACYFTIYDY 298



>gi|297273603|ref|XP_001094462.2| PREDICTED: mitochondrial thiamine pyrophosphate carrier [Macaca
           mulatta]
          Length = 408

 Score =  180 bits (457), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 103/273 (37%), Positives = 161/273 (58%), Gaps = 28/273 (10%)

Query: 4   GYEHKPQNQSPIAEQAVAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPI 63
           GY+ KP  ++            + +++ + G+V+G+V+R + SP DV+KIR QLQ  R  
Sbjct: 3   GYDPKPDGRN-----------NTKLQVAVAGSVSGLVTRALISPFDVIKIRFQLQHER-- 49

Query: 64  NPLSSRHHNSGTLKKYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQM 123
             LS R  N+    KY+G+  A + I++EEG+   W G++ A+ L + YGAVQFL++  +
Sbjct: 50  --LSRRDPNA----KYHGIFQASRQILQEEGLTAFWKGHIPAQILSIGYGAVQFLSFEML 103

Query: 124 QNLFKRIDSNQNEKFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGL 183
             L  R       +F ++     F+ G ++  TAT+  +P D+LRTRFAAQGE ++Y  L
Sbjct: 104 TELVHRGSVYDAREFSVH-----FVCGGLAACTATLTVHPVDVLRTRFAAQGEPKVYNTL 158

Query: 184 RNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKKLFR-KLEDKHIWFHNLR 242
           R+AV  +Y  EG + FY+G+  +++ I PY GL F  Y  LK L++  +  +     NL 
Sbjct: 159 RHAVGTMYRSEGPQVFYKGLAPTLIAIFPYAGLQFSCYSSLKHLYKWAMPAEGKKNENL- 217

Query: 243 ATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQG 275
             ++LL G+ AG++SK   +PLDL +KRLQV G
Sbjct: 218 --QNLLCGSGAGVISKTLTYPLDLFKKRLQVGG 248



>gi|156542576|ref|XP_001603742.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like
           [Nasonia vitripennis]
          Length = 316

 Score =  180 bits (457), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 118/323 (36%), Positives = 175/323 (54%), Gaps = 34/323 (10%)

Query: 31  GICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLII 90
            I GA +G ++RF+  PLDVVKIR QLQ   PI   SS         KY+ M    +LI 
Sbjct: 13  AIAGAASGCLTRFICQPLDVVKIRFQLQV-EPIKKHSS--------SKYHSMLQTFRLIA 63

Query: 91  REEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSG 150
           +EE    LW G++ A+ L + YG  QF  Y  +    ++ D   ++     KT+  FLSG
Sbjct: 64  KEESFYALWKGHVPAQLLSVIYGTSQFYVYIIVNQHLEKFDFLSDK----TKTVH-FLSG 118

Query: 151 AISGSTATIVTYPFDLLRTRFAAQG-EKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQ 209
           A++G  AT+ ++P D +RTR  AQ  + + Y G  ++   IY  E  +GF+RG+  +++Q
Sbjct: 119 ALAGCFATVTSFPLDTVRTRLIAQSSQNKAYKGTIHSCTTIYKTESPKGFFRGLLPTLLQ 178

Query: 210 IIPYMGLVFGSYEFLKK---LFRKLEDKHIWFHNLRA--TEDLLSGAIAGIVSKAGVFPL 264
           I P+ GL FG+YE +K    L    ED H   H+ +      L++G +AG+V+K  V+PL
Sbjct: 179 IAPHAGLQFGTYELVKDIKFLPANNEDSH---HHKKVGIINSLVAGCLAGLVAKTIVYPL 235

Query: 265 DLVRKRLQVQG--PNRK---DYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIK 319
           DL RKRLQ+QG    RK    +F  N       +  C+    + +GI GL+KGL P+  K
Sbjct: 236 DLARKRLQIQGFEHGRKGFGGFFRCN------GLVNCLVLTTKQEGIRGLFKGLGPSQFK 289

Query: 320 SAPVSAVTFFVYGYTKRLLEKLH 342
           +A ++A+ F  Y     L+   H
Sbjct: 290 AALMTALHFTFYEQALNLIRDNH 312



>gi|62640383|ref|XP_218743.3| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like
           [Rattus norvegicus]
 gi|109462060|ref|XP_001056406.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like
           [Rattus norvegicus]
          Length = 313

 Score =  180 bits (457), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 113/313 (36%), Positives = 172/313 (54%), Gaps = 35/313 (11%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGR--PINPLSSRHHNSGTLKKYNGMS 83
           S +E+ + G+V+G V+R + SPLDV+KIR QLQ  R  P +P +          KY+G+ 
Sbjct: 14  SKLEVAVAGSVSGFVTRALISPLDVIKIRFQLQLERVCPSDPDA----------KYHGIF 63

Query: 84  HAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKT 143
            A K II+EEG R  W G++ A+ L + YGAVQFL + ++  L  + +  Q  +F  +  
Sbjct: 64  QAAKQIIQEEGPRAFWKGHVPAQILSIGYGAVQFLAFEELTVLLYQANLYQTHQFSAH-- 121

Query: 144 LQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGV 203
              F+ G +S  TAT+  +P D+LRTR AAQGE      LR A+  +Y  EG   FY+G+
Sbjct: 122 ---FVCGGLSAGTATLTVHPVDVLRTRLAAQGEP----NLREAIITMYRTEGPFVFYKGL 174

Query: 204 TASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFH--NLRAT---EDLLSGAIAGIVSK 258
           T +V+ I PY GL F         +R L+  + W    + + T   ++LL G  +G++SK
Sbjct: 175 TPTVIAIFPYAGLQF--------CYRSLKRTYDWVMPPDRKQTGNLKNLLCGCGSGVISK 226

Query: 259 AGVFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALI 318
              +PLDL +  LQV+G          V  Y   + +  +Q+L+ +   G +KGL P+L+
Sbjct: 227 TLTYPLDLFKNHLQVRGFEYARSAFGQVRSYRGLLDLA-RQVLQHEDTRGFFKGLSPSLM 285

Query: 319 KSAPVSAVTFFVY 331
           K+A  +   FF Y
Sbjct: 286 KAALSTGFMFFWY 298



>gi|268536726|ref|XP_002633498.1| Hypothetical protein CBG06270 [Caenorhabditis briggsae]
          Length = 648

 Score =  180 bits (457), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 108/298 (36%), Positives = 162/298 (54%), Gaps = 23/298 (7%)

Query: 25  LSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSH 84
           L+S E    G  +G+V+R +  PLDV+KIR QLQ   PI     R   SG   KY G+  
Sbjct: 13  LTSAEYSEAGLASGIVTRMIIQPLDVLKIRFQLQE-EPI-----RGRKSG---KYKGVMQ 63

Query: 85  AIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTL 144
           ++ LI REEG +  W G++ A+ L  +YG VQF ++  +     +I  + ++     ++ 
Sbjct: 64  SVFLITREEGAKAFWKGHIPAQGLSATYGLVQFSSFEWLSRQAAKIVPSDDQSI---RST 120

Query: 145 QPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKR-IYIGLRNAVQQIYVQEGYRGFYRGV 203
             F+ GA+SG  A     P D++RTR  AQ     +Y G  +AV+ I+ +EG  G++RG 
Sbjct: 121 SDFMCGALSGCLAMTAAMPLDVIRTRLVAQKSGHAVYTGTMHAVKHIWEKEGIPGYFRGW 180

Query: 204 TASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFP 263
             SVVQI P+ G+ F  Y     L+         F    +T  LLSGA+AG V+K  ++P
Sbjct: 181 IPSVVQIAPFTGMQFALYNCFMDLWP--------FTGYESTGALLSGAMAGTVAKTVLYP 232

Query: 264 LDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSA 321
           LD+VR RLQ+ G  R  +       YS  +F  I  +++ +  +GL+KGL P+ IK+A
Sbjct: 233 LDMVRHRLQMNGFERAGF--GKTSNYSQGLFKTIVMVVKHESWYGLFKGLWPSQIKAA 288



>gi|157121135|ref|XP_001659842.1| mitochondrial carrier protein, putative [Aedes aegypti]
 gi|108874706|gb|EAT38931.1| AAEL009218-PA [Aedes aegypti]
          Length = 313

 Score =  179 bits (454), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 113/319 (35%), Positives = 174/319 (54%), Gaps = 30/319 (9%)

Query: 31  GICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLII 90
            + G + G+++RF+  PLDV+KIRLQLQ    + P+S R      + KY  ++ ++  I 
Sbjct: 13  ALAGGLTGVITRFICQPLDVLKIRLQLQ----VEPISKRSE----ISKYRSVAQSVSCIY 64

Query: 91  REEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSG 150
           REEG+   W G+  A+ L L YG  QF  Y +   + + ++  +      N     F+ G
Sbjct: 65  REEGLFAFWKGHNPAQILSLVYGVAQFSFYERFNLVLRDLELLKGHDRARN-----FVCG 119

Query: 151 AISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQI 210
           A SGS A +   P D++RTR  +Q   + Y     AV  IY  EG RG YRG+  +++QI
Sbjct: 120 ACSGSFAALTIMPLDVIRTRVISQDPGKGYRNGFQAVSTIYRVEGVRGLYRGLGPALLQI 179

Query: 211 IPYMGLVFGSYEFLKKLFRKLEDKHIWFH-NLRATEDLLSGAIAGIVSKAGVFPLDLVRK 269
            P  G  F  Y     L +++E  H+  + +L  TE  + G  AG+ +K  V+PLDL++K
Sbjct: 180 APLTGGQFMFYNMFGTLVKQIE--HLPENASLPPTELFICGGFAGLCTKLLVYPLDLIKK 237

Query: 270 RLQVQG--PNRKDY---FISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVS 324
           RLQ+QG   NR+ +   F++N       +  C+ Q+ R +G+ GLYKGL P+L+K+A  +
Sbjct: 238 RLQIQGFSQNRQTFGKHFVAN------HMLQCLYQVCRDEGLRGLYKGLNPSLLKAAFTT 291

Query: 325 AVTFFVYGYTKRLLEKLHS 343
           A  F +Y    RLL   +S
Sbjct: 292 AFYFAIY---DRLLLAFNS 307



>gi|195389556|ref|XP_002053442.1| GJ23881 [Drosophila virilis]
 gi|194151528|gb|EDW66962.1| GJ23881 [Drosophila virilis]
          Length = 346

 Score =  179 bits (453), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 116/346 (33%), Positives = 186/346 (53%), Gaps = 36/346 (10%)

Query: 9   PQNQSPIAE--QAVAASQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPL 66
           P   +P+++  +  A  QL  I   + G +A  ++R    PLDV+KIR QLQ    + P 
Sbjct: 17  PPTSTPVSQRRKHSAREQLQQI---VAGGMAAAITRSTCQPLDVLKIRFQLQ----VEPF 69

Query: 67  SSRHHN-------SGTL---KKYNGMSHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQ 116
            +  HN       S TL    KY  +  A++ I REEG+   W G+  A+ L + YG  Q
Sbjct: 70  RTTEHNVVLPGHKSDTLLQSSKYTSIIQAVRTIYREEGLLAFWKGHNPAQVLSIMYGICQ 129

Query: 117 FLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGE 176
           F TY Q+  + K     Q      +  L  F+ GA +G+ A I++ P D++RTR  AQ  
Sbjct: 130 FWTYEQLSLVAK-----QTNYLKDHTHLSNFMCGAAAGAAAVIISTPLDVIRTRLIAQDT 184

Query: 177 KRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQIIPYMGLVFGSYEFLKK---LFRKLED 233
            + Y     A+  I  QEG RG YRG++++++QI P MG  F +Y    +    F +++D
Sbjct: 185 SKGYRNATRAITDIMRQEGPRGMYRGLSSALLQIAPLMGTNFMAYRLFSESACTFFEVDD 244

Query: 234 KHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQG--PNRKDYFISNVPLYSS 291
           +      L     L+ GA +G++SK  V+P DL++KRLQ+QG   NR+ +      L  +
Sbjct: 245 R----SKLPTWTLLVLGASSGMLSKTIVYPFDLIKKRLQIQGFEQNRQTF---GRTLQCN 297

Query: 292 SIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVYGYTKRL 337
            ++ C++  +R +G++GLYKG+ P L+KS+  +A+ F +Y   K++
Sbjct: 298 GVWDCLQLTVRQEGVWGLYKGVAPTLLKSSLTTALYFSIYDKLKQV 343



>gi|344229752|gb|EGV61637.1| hypothetical protein CANTEDRAFT_124576 [Candida tenuis ATCC 10573]
 gi|344229753|gb|EGV61638.1| mitochondrial carrier [Candida tenuis ATCC 10573]
          Length = 294

 Score =  178 bits (452), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 104/308 (33%), Positives = 169/308 (54%), Gaps = 35/308 (11%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIR 91
           + G+++G V+R + +PLD VKIRLQLQ              +  LK Y G+SH  K I+R
Sbjct: 22  VAGSISGAVARAITAPLDTVKIRLQLQ--------------TAPLKDYLGVSHTFKNIVR 67

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGA 151
            EG+ GLW GN+ AE +Y+ YGA QF +Y  +     +   N       ++     + GA
Sbjct: 68  NEGVIGLWKGNVPAEIMYILYGATQFTSYSILNKALTQAQDNV-PILRFSRPTHSLIVGA 126

Query: 152 ISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQII 211
            +G ++T++TYPFDLLRTR AA   K + + +  +++QI   +G+ GF+ G+  +++ + 
Sbjct: 127 GAGVSSTLITYPFDLLRTRLAANSSKEL-LSMARSIRQIGRHDGFSGFFLGIRPALLSVA 185

Query: 212 PYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVRKRL 271
              GL+F +YE  ++  +         +N     + + G  AG  +K+  FPLD +RKR+
Sbjct: 186 SNTGLMFWTYELARQYSKT--------YNTIPFIEGICGFFAGAAAKSITFPLDTIRKRM 237

Query: 272 QVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVY 331
           Q++  +     IS+           I+ IL  +GIFGLYKG   ++ K+AP SA++ +VY
Sbjct: 238 QMKRFSVGANTISS-----------IRDILLREGIFGLYKGFGISIFKTAPTSALSIYVY 286

Query: 332 GYTKRLLE 339
            Y+  +L 
Sbjct: 287 EYSLSVLH 294



>gi|213402655|ref|XP_002172100.1| solute carrier family 25 member 42 [Schizosaccharomyces japonicus
           yFS275]
 gi|212000147|gb|EEB05807.1| solute carrier family 25 member 42 [Schizosaccharomyces japonicus
           yFS275]
          Length = 279

 Score =  178 bits (451), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 113/316 (35%), Positives = 162/316 (51%), Gaps = 50/316 (15%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIR 91
           + GA+   + R   +PLDV+KIR+Q+                      + +       +R
Sbjct: 14  VAGALGSGICRLFVAPLDVMKIRMQVTQ--------------------DSLRTTFLRTLR 53

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGA 151
            EG+ G W GNLSAE+LYL+YG+ +F  + Q     KR+  +   K  ++  L  F+ GA
Sbjct: 54  GEGLLGFWRGNLSAEFLYLAYGSCEFFAFSQT----KRLSLDHATK--VHPRLMDFMCGA 107

Query: 152 ISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRGVTASVVQII 211
           ++GS AT V+YPFD +RTRFAAQ   R +I LR  +  +  + G   FY G+  SVVQI 
Sbjct: 108 LAGSFATAVSYPFDTMRTRFAAQ-THRPHI-LRTVLHTLKTR-GIADFYPGLGVSVVQIA 164

Query: 212 PYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVRKRL 271
           PY+G  F +Y F      +L+               L G IAG  SK   FP D +++ L
Sbjct: 165 PYIGCFFTTYRFCDDTLSRLDT---------GPRSFLCGIIAGATSKTLTFPADTLKRNL 215

Query: 272 QVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVY 331
           Q           SN+     + + C++ ILR+DGI GLY+GL  +L K AP SA+T F Y
Sbjct: 216 QAH---------SNI---YHNTWQCLRGILRADGIRGLYRGLAMSLTKVAPGSAITMFFY 263

Query: 332 GYTKRLLEKLHSSRDK 347
             T +LLE+L  +  K
Sbjct: 264 EETMKLLEQLDPTTRK 279



>gi|195401749|ref|XP_002059474.1| GJ17180 [Drosophila virilis]
 gi|194142480|gb|EDW58886.1| GJ17180 [Drosophila virilis]
          Length = 350

 Score =  178 bits (451), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 109/315 (34%), Positives = 168/315 (53%), Gaps = 28/315 (8%)

Query: 32  ICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIR 91
           I G V+G ++RFV  P DV+KIR QLQ    + PL  +  NS    KY+GM HA   I R
Sbjct: 5   IGGGVSGAITRFVTQPFDVLKIRFQLQ----VEPLKRKSLNS----KYSGMLHAFSSIYR 56

Query: 92  EEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQPFLSGA 151
           EEG+RG+W G+++A+ + ++Y  VQF +Y Q+        + Q + F  +  L  F+ G 
Sbjct: 57  EEGLRGVWKGHMAAQMMSITYALVQFWSYEQLHQA-----AYQTKFFNDHPHLSYFMCGG 111

Query: 152 ISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLR--NAVQQIYVQEGYRGFYRGVTASVVQ 209
           ++G   TI+  PFD++RTR  A     +   L+  + V +I+ +EG RG   G+  +++Q
Sbjct: 112 LAGCMGTILAQPFDVIRTRVVAADPGSLAGSLKPVSGVGKIFKKEGIRGISSGMMMTLIQ 171

Query: 210 IIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATED-------LLSGAIAGIVSKAGVF 262
           I P +G  F  Y+F  +L   L     +FH     +          +GAIAG++SK  V+
Sbjct: 172 IYPLVGANFVIYKFCNRLAITLNG---YFHGDPTPKHTIPGALLFFNGAIAGVLSKMLVY 228

Query: 263 PLDLVRKRLQVQG-PNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSA 321
           P DL++KR  +    + +  F SN      +I  C++     +G  G YKG++P L KS 
Sbjct: 229 PADLIKKRTMLSHFQHDRKTFGSNPN--CDTIMHCMRTTFEKEGWLGFYKGMLPTLYKSG 286

Query: 322 PVSAVTFFVYGYTKR 336
            +SA  F +Y Y  R
Sbjct: 287 VMSAFYFTIYDYFNR 301



 Score = 76.3 bits (186), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 56/197 (28%), Positives = 92/197 (46%), Gaps = 19/197 (9%)

Query: 148 LSGAISGSTATIVTYPFDLLRTRFAAQGE--KRI-----YIGLRNAVQQIYVQEGYRGFY 200
           + G +SG+    VT PFD+L+ RF  Q E  KR      Y G+ +A   IY +EG RG +
Sbjct: 5   IGGGVSGAITRFVTQPFDVLKIRFQLQVEPLKRKSLNSKYSGMLHAFSSIYREEGLRGVW 64

Query: 201 RGVTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAG 260
           +G  A+ +  I Y  + F SYE L +   + +    +F++       + G +AG +    
Sbjct: 65  KGHMAAQMMSITYALVQFWSYEQLHQAAYQTK----FFNDHPHLSYFMCGGLAGCMGTIL 120

Query: 261 VFPLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKS 320
             P D++R R+    P      +  V          + +I + +GI G+  G+M  LI+ 
Sbjct: 121 AQPFDVIRTRVVAADPGSLAGSLKPVS--------GVGKIFKKEGIRGISSGMMMTLIQI 172

Query: 321 APVSAVTFFVYGYTKRL 337
            P+    F +Y +  RL
Sbjct: 173 YPLVGANFVIYKFCNRL 189



>gi|340721690|ref|XP_003399249.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like
           [Bombus terrestris]
          Length = 304

 Score =  177 bits (450), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 104/310 (33%), Positives = 167/310 (53%), Gaps = 36/310 (11%)

Query: 26  SSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHA 85
           +++E  I G V+G V+RF   P DVVKIR QLQ    + P+++ H     + KY+ +  A
Sbjct: 10  NNLEHAIAGGVSGFVTRFACQPFDVVKIRFQLQ----VEPIANHH-----VSKYHSLLQA 60

Query: 86  IKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQ 145
             LI +EEGI   W G++ A+ L + YG  QF  +  +                  K   
Sbjct: 61  FYLIFKEEGISAFWKGHVPAQLLSVIYGTSQFHNFSLLNEW---------------KYST 105

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEKR-IYIGLRNAVQQIYVQEGYRGFYRGVT 204
            F++GA +G  AT +++PFD LRTR  AQ     +Y G+ ++   I   E  + F+ G+ 
Sbjct: 106 KFVAGAGAGFIATTISFPFDTLRTRLVAQSNNHVVYKGIFHSCSCIIRHESPKAFFYGLL 165

Query: 205 ASVVQIIPYMGLVFGSYEFLKKLFRK-LEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFP 263
            +V+QI+P+ GL F  Y F   +++K  ++    F N      ++SG+ AG+++K  V+P
Sbjct: 166 PTVLQIVPHTGLQFAFYAFFSDMYKKYYKETDTSFFN-----SIISGSTAGLLAKTAVYP 220

Query: 264 LDLVRKRLQVQG--PNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSA 321
            DL RKRLQ+QG    RK +           +  C+K  +R +GI GL+KGL+P+ +K++
Sbjct: 221 FDLSRKRLQIQGFKNGRKGF---GTFFECKGLIDCLKLTIRKEGIKGLFKGLVPSQLKAS 277

Query: 322 PVSAVTFFVY 331
             +A+ F +Y
Sbjct: 278 MTTALHFTIY 287



>gi|7497312|pir||T32897 hypothetical protein C42C1.10 - Caenorhabditis elegans
          Length = 650

 Score =  177 bits (449), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 108/301 (35%), Positives = 160/301 (53%), Gaps = 23/301 (7%)

Query: 25  LSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSH 84
           L+S E    G  +G+V+R +  PLDV+KIR QLQ   PI     R   SG   KY G+  
Sbjct: 13  LTSAEYSEAGLASGIVTRMIIQPLDVLKIRFQLQE-EPI-----RGKKSG---KYKGVMQ 63

Query: 85  AIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTL 144
           +I LI REEG    W G++ A+ L  +YG VQF ++  +     ++    N+     ++ 
Sbjct: 64  SIFLITREEGAHAFWKGHIPAQGLSATYGLVQFSSFEWLSQQAAKVIPADNQSV---RST 120

Query: 145 QPFLSGAISGSTATIVTYPFDLLRTRFAAQ-GEKRIYIGLRNAVQQIYVQEGYRGFYRGV 203
             F  GA+SG  A     P D++RTR  AQ     +Y G  +AV+ I+ +EG  G++RG 
Sbjct: 121 SDFACGALSGCLAMTAAMPLDVIRTRLVAQKAGHAVYTGTMHAVKHIWEKEGIAGYFRGW 180

Query: 204 TASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFP 263
             SVVQI P+ G+ F  Y     L+         F+   +   L SGA+AG V+K  ++P
Sbjct: 181 VPSVVQIAPFTGMQFALYNCFMDLWP--------FNGYESAGALFSGAMAGTVAKTVLYP 232

Query: 264 LDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAPV 323
           LD+VR RLQ+ G  R  +       YS  +F  I  +++++  +GL+KGL P+ IK+A  
Sbjct: 233 LDMVRHRLQMNGFERAGF--GKTSNYSQGLFKTIGMVVKNESWYGLFKGLWPSQIKAAAN 290

Query: 324 S 324
           S
Sbjct: 291 S 291



>gi|110764672|ref|XP_001123132.1| PREDICTED: mitochondrial thiamine pyrophosphate carrier-like [Apis
           mellifera]
          Length = 296

 Score =  177 bits (449), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 110/326 (33%), Positives = 179/326 (54%), Gaps = 45/326 (13%)

Query: 27  SIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAI 86
           +++  I GAV+G V+RF   PLDV+KIR QLQ    + P+++ H     + KY+    A 
Sbjct: 11  NLDHAIAGAVSGFVTRFACQPLDVIKIRFQLQ----VEPIANYH-----VSKYHSFLQAF 61

Query: 87  KLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNE-KFGINKTLQ 145
            LI++EEGI   W G++ A+ L + YG                  + QNE K+  N    
Sbjct: 62  YLILKEEGITAFWKGHIPAQLLSIVYG------------------TTQNEWKYSTN---- 99

Query: 146 PFLSGAISGSTATIVTYPFDLLRTRFAAQGEK-RIYIGLRNAVQQIYVQEGYRGFYRGVT 204
            F++GA +G  ATIV++PFD +RTR  AQ     IY G+ ++   I   E  + F+ G+ 
Sbjct: 100 -FIAGASAGFLATIVSFPFDTIRTRLVAQSNNYTIYKGILHSCSCIIQHESPKVFFYGLL 158

Query: 205 ASVVQIIPYMGLVFGSYEFLKKLFRK-LEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFP 263
            +++QI+P+ GL F  Y ++   ++K   + +I F+N      ++SG++AG+++K  ++P
Sbjct: 159 PTLLQIVPHTGLQFAFYGYVNDKYKKYYNETNISFYN-----SMISGSVAGLLAKTAIYP 213

Query: 264 LDLVRKRLQVQG--PNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSA 321
            DL RKRLQ+QG    RK +           +  C+K  ++ +GI GL+KGL+P+ +K+ 
Sbjct: 214 FDLSRKRLQIQGFRNGRKGF---GTFFECKGLIDCLKLTIKEEGIKGLFKGLVPSQLKAT 270

Query: 322 PVSAVTFFVYGYTKRLLEKLHSSRDK 347
             +A+ + VY  T   L+ L S   K
Sbjct: 271 MTTALHYTVYEQTLIALKALRSDISK 296



>gi|448517022|ref|XP_003867694.1| Tpc1 protein [Candida orthopsilosis Co 90-125]
 gi|380352033|emb|CCG22257.1| Tpc1 protein [Candida orthopsilosis]
          Length = 302

 Score =  177 bits (449), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 105/312 (33%), Positives = 173/312 (55%), Gaps = 33/312 (10%)

Query: 23  SQLSSIEIGICGAVAGMVSRFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGM 82
           S +S  E  + G++AG VSR + +PLD +KIRLQL+              + +  +   +
Sbjct: 14  SNVSPYEALLAGSIAGGVSRAITAPLDTIKIRLQLE--------------TRSFHQRQSI 59

Query: 83  SHAIKLIIREEGIRGLWNGNLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINK 142
           S  +K +++ EG+  LW GN+ AE LY+ YG VQF +Y  + +   R++  Q+ +F ++ 
Sbjct: 60  STVVKSLLKNEGVIALWKGNVPAEILYILYGGVQFTSYSILSSNLSRLE--QHYRFSLSP 117

Query: 143 TLQPFLSGAISGSTATIVTYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGYRGFYRG 202
            +   + GA +G  +T+ TYPFDLLRTR  A  E+ + + +R+A+QQI   EG  G + G
Sbjct: 118 AIHSMVVGAGAGLASTLATYPFDLLRTRLVANKERDL-VSMRSAIQQILKSEGISGMFAG 176

Query: 203 VTASVVQIIPYMGLVFGSYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVF 262
           +  +++ +    GL+F SYE  +   ++       + N+   E  + G IAG+ SK   F
Sbjct: 177 IRPAIISVASTTGLMFWSYELARSFSQE-------YRNIPFIEG-ICGFIAGVTSKGITF 228

Query: 263 PLDLVRKRLQVQGPNRKDYFISNVPLYSSSIFICIKQILRSDGIFGLYKGLMPALIKSAP 322
           PLD +RKR QV         +  + L+    F  IKQ    +G+ GLYKG   +++K+AP
Sbjct: 229 PLDTLRKRCQVYAVVHGTKPVGAMRLF----FDIIKQ----EGVLGLYKGYGVSILKTAP 280

Query: 323 VSAVTFFVYGYT 334
            SA++ ++Y +T
Sbjct: 281 TSALSLWMYEFT 292



>gi|145353695|ref|XP_001421141.1| MC family transporter: deoxynucleotide [Ostreococcus lucimarinus
           CCE9901]
 gi|145357210|ref|XP_001422814.1| MC family transporter: deoxynucleotide [Ostreococcus lucimarinus
           CCE9901]
 gi|144581377|gb|ABO99434.1| MC family transporter: deoxynucleotide [Ostreococcus lucimarinus
           CCE9901]
 gi|144583058|gb|ABP01173.1| MC family transporter: deoxynucleotide [Ostreococcus lucimarinus
           CCE9901]
          Length = 284

 Score =  177 bits (449), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 105/293 (35%), Positives = 161/293 (54%), Gaps = 28/293 (9%)

Query: 42  RFVASPLDVVKIRLQLQPGRPINPLSSRHHNSGTLKKYNGMSHAIKLIIREEGIRGLWNG 101
           R   +PLDV+KIRLQ+Q  R            G   KY G++ A + I+REEG R +W G
Sbjct: 14  RVCVAPLDVIKIRLQVQVER------------GASGKYRGLADATRTILREEGGRAMWAG 61

Query: 102 NLSAEYLYLSYGAVQFLTYHQMQNLFKRIDSNQNEKFGINKTLQ-PFLSGAISGSTATIV 160
            + A  L++ Y A+QF   ++ +   +     +  K G    L   F+ GA +GS AT+ 
Sbjct: 62  TVPALLLWVPYTAIQFTVLNKFKEAARE---RERAKPGSTAGLPVSFIGGAAAGSVATVA 118

Query: 161 TYPFDLLRTRFAAQGEKRIYIGLRNAVQQIYVQEGY-RGFYRGVTASVVQIIPYMGLVFG 219
           TYPFD++RT  A+QG  ++Y  + +A   +  + G  +G Y GV+ ++ +I+P   + FG
Sbjct: 119 TYPFDVIRTLLASQGHPKVYNNVFDAALGVVRERGVAKGLYAGVSVTLAEIVPASAVQFG 178

Query: 220 SYEFLKKLFRKLEDKHIWFHNLRATEDLLSGAIAGIVSKAGVFPLDLVRKRLQVQGPNRK 279
           SY  LK    ++  ++          D   G  AG +++  + PLD+V+KR QV G +R 
Sbjct: 179 SYAALKSNLPEVFGEN----------DFACGFAAGTIARLVIHPLDVVKKRFQVAGFSRS 228

Query: 280 DYFISNVPLYS-SSIFICIKQILRSDGIFGLYKGLMPALIKSAPVSAVTFFVY 331
             +   V   +  S F  ++ I RS+G+ G YKGLMP+LIKSAP SA+TF V+
Sbjct: 229 LAYGQRVDAGAYKSFFAAVRTIARSEGVGGFYKGLMPSLIKSAPASAITFSVF 281