BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10157_c0_seq1-m.60 5prime_partial 83-1921(-) 613 (-)
         (612 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|384487518|gb|EIE79698.1| hypothetical protein RO3G_04403 [Rhi...   716   0.0     Rhizopus delemar RA 99-880
gi|384489656|gb|EIE80878.1| hypothetical protein RO3G_05583 [Rhi...   713   0.0     Rhizopus delemar RA 99-880
gi|393218270|gb|EJD03758.1| coatomer subunit gamma [Fomitiporia ...   684   0.0     Fomitiporia mediterranea MF3/22
gi|511001329|gb|EPB82812.1| hypothetical protein HMPREF1544_1042...   681   0.0     Mucor circinelloides f. circinelloides 1006PhL
gi|321257910|ref|XP_003193747.1| coatomer gamma subunit (Gamma-c...   680   0.0     Cryptococcus gattii WM276
gi|342320945|gb|EGU12883.1| Coatomer subunit gamma [Rhodotorula ...   676   0.0     Rhodotorula toruloides ATCC 204091
gi|336364818|gb|EGN93172.1| hypothetical protein SERLA73DRAFT_11...   676   0.0     Serpula lacrymans var. lacrymans S7.3
gi|449551339|gb|EMD42303.1| hypothetical protein CERSUDRAFT_1108...   676   0.0     Gelatoporia subvermispora B
gi|501310786|dbj|GAC99544.1| clathrin binding protein [Pseudozym...   675   0.0     Pseudozyma hubeiensis SY62
gi|358056622|dbj|GAA97462.1| hypothetical protein E5Q_04141 [Mix...   675   0.0     Mixia osmundae IAM 14324
gi|472582634|gb|EMS20312.1| coatomer protein complex, subunit ga...   674   0.0     Rhodotorula toruloides NP11
gi|443896681|dbj|GAC74025.1| vesicle coat complex COPI, gamma su...   672   0.0     Moesziomyces antarcticus T-34
gi|403161790|ref|XP_003322109.2| hypothetical protein PGTG_03646...   672   0.0     Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|403416958|emb|CCM03658.1| predicted protein [Fibroporia radic...   672   0.0     Fibroporia radiculosa
gi|402219892|gb|EJT99964.1| coatomer gamma subunit [Dacryopinax ...   670   0.0     Dacryopinax primogenitus
gi|71004498|ref|XP_756915.1| hypothetical protein UM00768.1 [Ust...   669   0.0     
gi|392597822|gb|EIW87144.1| coatomer subunit gamma [Coniophora p...   667   0.0     Coniophora puteana RWD-64-598 SS2
gi|409051967|gb|EKM61443.1| hypothetical protein PHACADRAFT_1805...   663   0.0     Phanerochaete carnosa HHB-10118-sp
gi|388855134|emb|CCF51265.1| probable coatomer gamma-2 subunit [...   662   0.0     Ustilago hordei
gi|58266952|ref|XP_570632.1| hypothetical protein [Cryptococcus ...   661   0.0     Cryptococcus neoformans var. neoformans JEC21
gi|323508323|emb|CBQ68194.1| probable coatomer gamma-2 subunit [...   660   0.0     Sporisorium reilianum SRZ2
gi|134110724|ref|XP_775826.1| hypothetical protein CNBD2360 [Cry...   660   0.0     Cryptococcus neoformans var. neoformans B-3501A
gi|388582420|gb|EIM22725.1| Coatomer, gamma subunit [Wallemia se...   657   0.0     Wallemia mellicola CBS 633.66
gi|405120097|gb|AFR94868.1| coatomer subunit gamma [Cryptococcus...   656   0.0     Cryptococcus neoformans var. grubii H99
gi|328768580|gb|EGF78626.1| hypothetical protein BATDEDRAFT_3562...   655   0.0     Batrachochytrium dendrobatidis JAM81
gi|389751550|gb|EIM92623.1| coatomer subunit gamma [Stereum hirs...   653   0.0     Stereum hirsutum FP-91666 SS1
gi|393244690|gb|EJD52202.1| coatomer subunit gamma [Auricularia ...   649   0.0     Auricularia subglabra TFB-10046 SS5
gi|328853690|gb|EGG02827.1| hypothetical protein MELLADRAFT_4477...   647   0.0     Melampsora larici-populina 98AG31
gi|426201286|gb|EKV51209.1| hypothetical protein AGABI2DRAFT_189...   646   0.0     Agaricus bisporus var. bisporus H97
gi|390605026|gb|EIN14417.1| coatomer gamma subunit [Punctularia ...   644   0.0     Punctularia strigosozonata HHB-11173 SS5
gi|401885452|gb|EJT49568.1| coatomer gamma subunit (Gamma-coat p...   643   0.0     Trichosporon asahii var. asahii CBS 2479
gi|406694910|gb|EKC98227.1| coatomer gamma subunit (Gamma-coat p...   643   0.0     Trichosporon asahii var. asahii CBS 8904
gi|169845138|ref|XP_001829289.1| coatomer subunit gamma [Coprino...   643   0.0     Coprinopsis cinerea okayama7#130
gi|392580335|gb|EIW73462.1| hypothetical protein TREMEDRAFT_7097...   642   0.0     Tremella mesenterica DSM 1558
gi|302694773|ref|XP_003037065.1| hypothetical protein SCHCODRAFT...   639   0.0     Schizophyllum commune H4-8
gi|407918611|gb|EKG11881.1| Clathrin/coatomer adaptor adaptin-li...   636   e-180   Macrophomina phaseolina MS6
gi|409083656|gb|EKM84013.1| hypothetical protein AGABI1DRAFT_110...   635   e-179   Agaricus bisporus var. burnettii JB137-S8
gi|121710672|ref|XP_001272952.1| Coatomer subunit  gamma, putati...   632   e-178   Aspergillus clavatus NRRL 1
gi|353244874|emb|CCA76018.1| probable coatomer gamma-2 subunit [...   631   e-178   Serendipita indica DSM 11827
gi|425768436|gb|EKV06959.1| Coatomer subunit gamma [Penicillium ...   629   e-178   Penicillium digitatum Pd1
gi|395334857|gb|EJF67233.1| coatomer subunit gamma [Dichomitus s...   625   e-177   Dichomitus squalens LYAD-421 SS1
gi|70989083|ref|XP_749391.1| Coatomer subunit  gamma [Aspergillu...   622   e-176   Aspergillus fumigatus Af293
gi|398388215|ref|XP_003847569.1| hypothetical protein MYCGRDRAFT...   622   e-176   Zymoseptoria tritici IPO323
gi|485929790|gb|EOD53085.1| putative coatomer subunit protein [N...   622   e-175   Neofusicoccum parvum UCRNP2
gi|226293466|gb|EEH48886.1| coatomer subunit gamma-1 [Paracoccid...   622   e-175   Paracoccidioides brasiliensis Pb18
gi|225684072|gb|EEH22356.1| coatomer subunit gamma-2 [Paracoccid...   622   e-175   Paracoccidioides brasiliensis Pb03
gi|119498135|ref|XP_001265825.1| Coatomer subunit gamma, putativ...   622   e-175   Aspergillus fischeri NRRL 181
gi|449302536|gb|EMC98545.1| hypothetical protein BAUCODRAFT_3259...   620   e-175   Baudoinia panamericana UAMH 10762
gi|115386136|ref|XP_001209609.1| hypothetical protein ATEG_06923...   620   e-175   Aspergillus terreus NIH2624
gi|259482623|tpe|CBF77281.1| TPA: Coatomer subunit gamma, putati...   620   e-175   Aspergillus nidulans FGSC A4
gi|67536754|ref|XP_662151.1| hypothetical protein AN4547.2 [Aspe...   620   e-175   Aspergillus nidulans FGSC A4
gi|378733028|gb|EHY59487.1| hypothetical protein HMPREF1120_0747...   619   e-174   Exophiala dermatitidis NIH/UT8656
gi|453080009|gb|EMF08061.1| coatomer subunit gamma [Mycosphaerel...   617   e-174   Sphaerulina musiva SO2202
gi|169775119|ref|XP_001822027.1| coatomer subunit gamma [Aspergi...   617   e-174   Aspergillus oryzae RIB40
gi|391873061|gb|EIT82136.1| vesicle coat complex COPI, gamma sub...   616   e-174   Aspergillus oryzae 3.042
gi|511008243|gb|EPB89512.1| hypothetical protein HMPREF1544_0359...   616   e-174   Mucor circinelloides f. circinelloides 1006PhL
gi|384495301|gb|EIE85792.1| hypothetical protein RO3G_10502 [Rhi...   615   e-173   Rhizopus delemar RA 99-880
gi|408388175|gb|EKJ67865.1| hypothetical protein FPSE_12013 [Fus...   615   e-173   Fusarium pseudograminearum CS3096
gi|295664865|ref|XP_002792984.1| coatomer subunit gamma-1 [Parac...   614   e-173   Paracoccidioides lutzii Pb01
gi|255934848|ref|XP_002558451.1| Pc12g16530 [Penicillium chrysog...   613   e-173   Penicillium rubens Wisconsin 54-1255
gi|392570970|gb|EIW64142.1| coatomer subunit gamma [Trametes ver...   612   e-173   Trametes versicolor FP-101664 SS1
gi|327308708|ref|XP_003239045.1| coatomer subunit gamma [Trichop...   612   e-172   Trichophyton rubrum CBS 118892
gi|500255686|gb|EON99024.1| putative coatomer subunit gamma prot...   612   e-172   Phaeoacremonium minimum UCRPA7
gi|296815002|ref|XP_002847838.1| coatomer subunit gamma-2 [Arthr...   612   e-172   Arthroderma otae CBS 113480
gi|325089078|gb|EGC42388.1| coatomer gamma subunit [Ajellomyces ...   610   e-172   Histoplasma capsulatum H88
gi|240280667|gb|EER44171.1| coatomer subunit gamma-1 [Ajellomyce...   610   e-172   Histoplasma capsulatum H143
gi|452836712|gb|EME38655.1| hypothetical protein DOTSEDRAFT_1804...   608   e-171   Dothistroma septosporum NZE10
gi|340975620|gb|EGS22735.1| coatomer subunit gamma-like protein ...   608   e-171   Chaetomium thermophilum var. thermophilum DSM 1495
gi|302497501|ref|XP_003010751.1| hypothetical protein ARB_03453 ...   608   e-171   Arthroderma benhamiae CBS 112371
gi|326477801|gb|EGE01811.1| coatomer subunit gamma [Trichophyton...   608   e-171   Trichophyton equinum CBS 127.97
gi|326474812|gb|EGD98821.1| coatomer subunit gamma [Trichophyton...   607   e-171   Trichophyton tonsurans CBS 112818
gi|452987266|gb|EME87022.1| hypothetical protein MYCFIDRAFT_5614...   607   e-171   Cercospora fijiensis CIRAD86
gi|315054085|ref|XP_003176417.1| coatomer subunit gamma-2 [Arthr...   607   e-171   Microsporum gypseum CBS 118893
gi|402072343|gb|EJT68175.1| coatomer subunit gamma [Gaeumannomyc...   606   e-171   Gaeumannomyces graminis var. tritici R3-111a-1
gi|380492433|emb|CCF34606.1| hypothetical protein CH063_06566 [C...   606   e-171   Colletotrichum higginsianum
gi|342876647|gb|EGU78230.1| hypothetical protein FOXB_11256 [Fus...   606   e-171   Fusarium oxysporum Fo5176
gi|347833364|emb|CCD49061.1| similar to coatomer subunit gamma-2...   606   e-171   Botrytis cinerea T4
gi|261203897|ref|XP_002629162.1| coatomer subunit gamma [Ajellom...   606   e-171   Blastomyces gilchristii SLH14081
gi|154322170|ref|XP_001560400.1| hypothetical protein BC1G_01232...   606   e-171   Botrytis cinerea B05.10
gi|477518812|gb|ENH71012.1| Putative coatomer subunit gamma [Fus...   605   e-170   Fusarium oxysporum f. sp. cubense race 1
gi|389647045|ref|XP_003721154.1| coatomer subunit gamma [Magnapo...   604   e-170   Magnaporthe oryzae 70-15
gi|46129310|ref|XP_389016.1| hypothetical protein FG08840.1 [Fus...   604   e-170   
gi|470319067|gb|EMR10691.1| hypothetical protein PNEG_00842 [Pne...   603   e-170   Pneumocystis murina B123
gi|358393479|gb|EHK42880.1| hypothetical protein TRIATDRAFT_1496...   603   e-170   Trichoderma atroviride IMI 206040
gi|429852937|gb|ELA28048.1| coatomer subunit [Colletotrichum glo...   603   e-170   Colletotrichum gloeosporioides Nara gc5
gi|477535413|gb|ENH86936.1| coatomer subunit [Colletotrichum orb...   602   e-169   Colletotrichum orbiculare MAFF 240422
gi|336463523|gb|EGO51763.1| hypothetical protein NEUTE1DRAFT_707...   602   e-169   Neurospora tetrasperma FGSC 2508
gi|242785576|ref|XP_002480623.1| Coatomer subunit  gamma, putati...   601   e-169   Talaromyces stipitatus ATCC 10500
gi|350297256|gb|EGZ78233.1| Coatomer, gamma subunit [Neurospora ...   600   e-169   Neurospora tetrasperma FGSC 2509
gi|340519786|gb|EGR50024.1| coatamer complex, gamma subunit [Tri...   600   e-169   Trichoderma reesei QM6a
gi|85115358|ref|XP_964857.1| hypothetical protein NCU01992 [Neur...   600   e-169   Neurospora crassa OR74A
gi|358385002|gb|EHK22599.1| Adaptor protein complex [Trichoderma...   600   e-169   Trichoderma virens Gv29-8
gi|350635716|gb|EHA24077.1| hypothetical protein ASPNIDRAFT_5619...   600   e-169   Aspergillus niger ATCC 1015
gi|145238068|ref|XP_001391681.1| coatomer subunit gamma [Aspergi...   600   e-169   Aspergillus niger CBS 513.88
gi|322709613|gb|EFZ01189.1| putative coatomer gamma-2 subunit [M...   599   e-169   Metarhizium robertsii ARSEF 23
gi|310791155|gb|EFQ26684.1| hypothetical protein GLRG_02504 [Glo...   599   e-169   Colletotrichum graminicola M1.001
gi|336264720|ref|XP_003347136.1| hypothetical protein SMAC_05435...   599   e-169   Sordaria macrospora k-hell
gi|302921242|ref|XP_003053248.1| predicted protein [Nectria haem...   598   e-168   Nectria haematococca mpVI 77-13-4
gi|358368668|dbj|GAA85284.1| coatomer subunit gamma [Aspergillus...   597   e-168   Aspergillus kawachii IFO 4308
gi|322701444|gb|EFY93194.1| putative coatomer gamma-2 subunit [M...   597   e-168   Metarhizium acridum CQMa 102
gi|512188859|gb|EPE04628.1| coatomer subunit gamma-2 [Ophiostoma...   595   e-167   Ophiostoma piceae UAMH 11346
gi|399165326|emb|CCE33776.1| related to coatomer gamma-2 subunit...   594   e-167   Claviceps purpurea 20.1
gi|406862589|gb|EKD15639.1| hypothetical protein MBM_06267 [Mars...   593   e-167   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|38567064|emb|CAE76361.1| related to coatomer gamma-2 subunit ...   593   e-167   Neurospora crassa
gi|330919728|ref|XP_003298734.1| hypothetical protein PTT_09529 ...   592   e-166   Pyrenophora teres f. teres 0-1
gi|430812778|emb|CCJ29818.1| unnamed protein product [Pneumocyst...   592   e-166   Pneumocystis jirovecii
gi|212543053|ref|XP_002151681.1| Coatomer subunit  gamma, putati...   591   e-166   Talaromyces marneffei ATCC 18224
gi|471559289|gb|EMR61729.1| putative coatomer subunit gamma prot...   591   e-166   Eutypa lata UCREL1
gi|367041998|ref|XP_003651379.1| hypothetical protein THITE_2111...   590   e-166   Thielavia terrestris NRRL 8126
gi|169595076|ref|XP_001790962.1| hypothetical protein SNOG_00271...   590   e-166   Parastagonospora nodorum SN15
gi|171685111|ref|XP_001907497.1| hypothetical protein [Podospora...   590   e-166   Podospora anserina S mat+
gi|400600740|gb|EJP68408.1| coatomer gamma-2 subunit [Beauveria ...   590   e-166   Beauveria bassiana ARSEF 2860
gi|189201912|ref|XP_001937292.1| coatomer subunit gamma [Pyrenop...   587   e-165   Pyrenophora tritici-repentis Pt-1C-BFP
gi|346977584|gb|EGY21036.1| coatomer subunit gamma-2 [Verticilli...   585   e-164   Verticillium dahliae VdLs.17
gi|116193677|ref|XP_001222651.1| conserved hypothetical protein ...   584   e-164   Chaetomium globosum CBS 148.51
gi|320589422|gb|EFX01883.1| coatamer subunit protein [Grosmannia...   584   e-164   Grosmannia clavigera kw1407
gi|346326535|gb|EGX96131.1| Coatomer subunit gamma, putative [Co...   584   e-164   Cordyceps militaris CM01
gi|367021802|ref|XP_003660186.1| hypothetical protein MYCTH_2298...   584   e-164   Myceliophthora thermophila ATCC 42464
gi|482808732|gb|EOA85617.1| hypothetical protein SETTUDRAFT_1696...   582   e-163   Setosphaeria turcica Et28A
gi|396469416|ref|XP_003838400.1| similar to coatomer subunit gam...   579   e-163   Leptosphaeria maculans JN3
gi|156060825|ref|XP_001596335.1| hypothetical protein SS1G_02555...   578   e-162   Sclerotinia sclerotiorum 1980 UF-70
gi|258568144|ref|XP_002584816.1| hypothetical protein UREG_05505...   577   e-162   Uncinocarpus reesii 1704
gi|512196368|gb|EPE25205.1| ARM repeat-containing protein [Glare...   577   e-162   Glarea lozoyensis ATCC 20868
gi|451852072|gb|EMD65367.1| hypothetical protein COCSADRAFT_3047...   577   e-162   Bipolaris sorokiniana ND90Pr
gi|170085681|ref|XP_001874064.1| coatomer protein [Laccaria bico...   575   e-161   Laccaria bicolor S238N-H82
gi|225560789|gb|EEH09070.1| coatomer subunit gamma-1 [Ajellomyce...   575   e-161   Histoplasma capsulatum G186AR
gi|156382581|ref|XP_001632631.1| predicted protein [Nematostella...   573   e-161   Nematostella vectensis
gi|451997606|gb|EMD90071.1| hypothetical protein COCHEDRAFT_1178...   573   e-161   Bipolaris maydis C5
gi|440637226|gb|ELR07145.1| hypothetical protein GMDG_02413 [Geo...   570   e-160   Pseudogymnoascus destructans 20631-21
gi|494831148|gb|EON67640.1| hypothetical protein W97_06783 [Coni...   568   e-159   Coniosporium apollinis CBS 100218
gi|119194875|ref|XP_001248041.1| hypothetical protein CIMG_01812...   568   e-159   Coccidioides immitis RS
gi|303310891|ref|XP_003065457.1| conserved hypothetical protein ...   566   e-159   Coccidioides posadasii C735 delta SOWgp
gi|390343290|ref|XP_784737.3| PREDICTED: coatomer subunit gamma-...   563   e-158   Strongylocentrotus purpuratus [purple urchin]
gi|449689859|ref|XP_002154548.2| PREDICTED: coatomer subunit gam...   562   e-157   Hydra vulgaris
gi|405961297|gb|EKC27123.1| Coatomer subunit gamma-2 [Crassostre...   560   e-157   Crassostrea gigas
gi|345566084|gb|EGX49031.1| hypothetical protein AOL_s00079g252 ...   559   e-157   Arthrobotrys oligospora ATCC 24927
gi|505756737|gb|EOR00878.1| Coatomer subunit gamma [Wallemia ich...   559   e-156   Wallemia ichthyophaga EXF-994
gi|466080713|ref|XP_004284385.1| PREDICTED: coatomer subunit gam...   554   e-155   Orcinus orca [Orca]
gi|488581129|ref|XP_004476000.1| PREDICTED: coatomer subunit gam...   554   e-155   Dasypus novemcinctus
gi|296414628|ref|XP_002837000.1| hypothetical protein [Tuber mel...   554   e-155   Tuber melanosporum Mel28
gi|512847549|ref|XP_004886277.1| PREDICTED: coatomer subunit gam...   553   e-155   
gi|470603560|ref|XP_004313094.1| PREDICTED: coatomer subunit gam...   553   e-155   Tursiops truncatus [Atlantic bottle-nosed dolphin]
gi|512847546|ref|XP_004886276.1| PREDICTED: coatomer subunit gam...   553   e-155   
gi|507562957|ref|XP_004665164.1| PREDICTED: coatomer subunit gam...   553   e-155   Jaculus jaculus
gi|432090076|gb|ELK23672.1| Coatomer subunit gamma [Myotis davidii]   553   e-155   Myotis davidii
gi|1706000|sp|P53620.1|COPG1_BOVIN RecName: Full=Coatomer subuni...   553   e-155   Bos taurus [bovine]
gi|157817775|ref|NP_001100399.1| coatomer subunit gamma-2 [Rattu...   553   e-155   Rattus norvegicus [brown rat]
gi|26346320|dbj|BAC36811.1| unnamed protein product [Mus musculus]    552   e-155   Mus musculus [mouse]
gi|83715992|ref|NP_001032904.1| coatomer subunit gamma-1 [Bos ta...   552   e-154   Bos taurus [bovine]
gi|291393350|ref|XP_002713207.1| PREDICTED: coatomer protein com...   552   e-154   Oryctolagus cuniculus [European rabbit]
gi|149728227|ref|XP_001488579.1| PREDICTED: coatomer subunit gam...   552   e-154   Equus caballus [domestic horse]
gi|507976351|ref|XP_004692390.1| PREDICTED: coatomer subunit gam...   552   e-154   Condylura cristata
gi|148681777|gb|EDL13724.1| coatomer protein complex, subunit ga...   552   e-154   Mus musculus [mouse]
gi|511827870|ref|XP_004738683.1| PREDICTED: coatomer subunit gam...   551   e-154   
gi|301764543|ref|XP_002917686.1| PREDICTED: coatomer subunit gam...   551   e-154   Ailuropoda melanoleuca
gi|443727134|gb|ELU14014.1| hypothetical protein CAPTEDRAFT_1628...   551   e-154   Capitella teleta
gi|344275959|ref|XP_003409778.1| PREDICTED: coatomer subunit gam...   551   e-154   Loxodonta africana [African bush elephant]
gi|449465393|ref|XP_004150412.1| PREDICTED: coatomer subunit gam...   551   e-154   Cucumis sativus [cucumbers]
gi|18858453|ref|NP_571069.1| coatomer subunit gamma-2 [Danio rer...   551   e-154   Danio rerio [leopard danio]
gi|281347012|gb|EFB22596.1| hypothetical protein PANDA_006034 [A...   551   e-154   Ailuropoda melanoleuca
gi|114589077|ref|XP_001141317.1| PREDICTED: coatomer subunit gam...   551   e-154   
gi|8567340|ref|NP_059506.1| coatomer subunit gamma-2 [Mus muscul...   551   e-154   Mus musculus [mouse]
gi|471355682|ref|XP_004368444.1| PREDICTED: coatomer subunit gam...   551   e-154   Trichechus manatus latirostris
gi|504137882|ref|XP_004581396.1| PREDICTED: coatomer subunit gam...   551   e-154   Ochotona princeps [southern American pika]
gi|66910281|gb|AAH96860.1| Copg2 protein [Danio rerio] >gi|18289...   551   e-154   Danio rerio [leopard danio]
gi|11559929|ref|NP_057212.1| coatomer subunit gamma-1 [Homo sapi...   551   e-154   Homo sapiens [man]
gi|119599676|gb|EAW79270.1| coatomer protein complex, subunit ga...   551   e-154   Homo sapiens [man]
gi|432943073|ref|XP_004083090.1| PREDICTED: coatomer subunit gam...   551   e-154   Oryzias latipes [Japanese rice fish]
gi|32425777|gb|AAH20498.2| COPG protein, partial [Homo sapiens]       551   e-154   Homo sapiens [man]
gi|348514957|ref|XP_003445006.1| PREDICTED: coatomer subunit gam...   551   e-154   Oreochromis niloticus
gi|397484719|ref|XP_003813516.1| PREDICTED: coatomer subunit gam...   551   e-154   
gi|10434610|dbj|BAB14315.1| unnamed protein product [Homo sapiens]    551   e-154   Homo sapiens [man]
gi|119599675|gb|EAW79269.1| coatomer protein complex, subunit ga...   551   e-154   Homo sapiens [man]
gi|119599674|gb|EAW79268.1| coatomer protein complex, subunit ga...   551   e-154   Homo sapiens [man]
gi|354482843|ref|XP_003503605.1| PREDICTED: coatomer subunit gam...   551   e-154   Cricetulus griseus [Chinese hamsters]
gi|350539577|ref|NP_001233167.1| coatomer subunit gamma-2 [Sus s...   550   e-154   Sus scrofa [pigs]
gi|109134349|ref|NP_036265.3| coatomer subunit gamma-2 [Homo sap...   550   e-154   Homo sapiens [man]
gi|403256803|ref|XP_003921038.1| PREDICTED: coatomer subunit gam...   550   e-154   Saimiri boliviensis boliviensis
gi|126723233|ref|NP_001075917.1| coatomer subunit gamma-2 [Bos t...   550   e-154   Bos taurus [bovine]
gi|48257296|gb|AAH17443.2| COPG2 protein, partial [Homo sapiens]      550   e-154   Homo sapiens [man]
gi|73984948|ref|XP_533723.2| PREDICTED: coatomer subunit gamma [...   550   e-154   Canis lupus familiaris [dogs]
gi|148666818|gb|EDK99234.1| coatomer protein complex, subunit ga...   550   e-154   Mus musculus [mouse]
gi|355748018|gb|EHH52515.1| hypothetical protein EGM_12967, part...   550   e-154   Macaca fascicularis [crab eating macaque]
gi|8567338|ref|NP_059505.1| coatomer subunit gamma-1 isoform 1 [...   550   e-154   Mus musculus [mouse]
gi|426228031|ref|XP_004008118.1| PREDICTED: coatomer subunit gam...   550   e-154   
gi|395847161|ref|XP_003796252.1| PREDICTED: coatomer subunit gam...   550   e-154   Otolemur garnettii
gi|355560998|gb|EHH17684.1| hypothetical protein EGK_14141, part...   550   e-154   Macaca mulatta [rhesus macaque]
gi|14250257|gb|AAH08553.1| Copg protein, partial [Mus musculus]       550   e-154   Mus musculus [mouse]
gi|193806152|sp|Q9PUE4.2|COPG2_DANRE RecName: Full=Coatomer subu...   549   e-154   Danio rerio [leopard danio]
gi|213513461|ref|NP_001133706.1| Coatomer subunit gamma-2 [Salmo...   549   e-154   Salmo salar
gi|19354315|gb|AAH24896.1| Coatomer protein complex, subunit gam...   549   e-154   Mus musculus [mouse]
gi|73532768|ref|NP_001026992.1| coatomer subunit gamma-1 [Rattus...   549   e-154   Rattus norvegicus [brown rat]
gi|351705713|gb|EHB08632.1| Coatomer subunit gamma-2 [Heteroceph...   549   e-153   Heterocephalus glaber [naked mole rat]
gi|74139818|dbj|BAE31753.1| unnamed protein product [Mus musculu...   549   e-153   Mus musculus [mouse]
gi|512874469|ref|XP_004893442.1| PREDICTED: coatomer subunit gam...   549   e-153   
gi|410918755|ref|XP_003972850.1| PREDICTED: coatomer subunit gam...   548   e-153   Takifugu rubripes [tiger puffer]
gi|344242096|gb|EGV98199.1| Coatomer subunit gamma-2 [Cricetulus...   548   e-153   Cricetulus griseus [Chinese hamsters]
gi|158256818|dbj|BAF84382.1| unnamed protein product [Homo sapiens]   548   e-153   Homo sapiens [man]
gi|354470721|ref|XP_003497593.1| PREDICTED: coatomer subunit gam...   548   e-153   
gi|498974185|ref|XP_004548319.1| PREDICTED: coatomer subunit gam...   548   e-153   Maylandia zebra
gi|359475304|ref|XP_003631645.1| PREDICTED: coatomer subunit gam...   548   e-153   Vitis vinifera
gi|507705407|ref|XP_004645653.1| PREDICTED: coatomer subunit gam...   548   e-153   Octodon degus
gi|505839315|ref|XP_004613186.1| PREDICTED: coatomer subunit gam...   548   e-153   Sorex araneus [Eurasian shrew]
gi|478537735|ref|XP_004442980.1| PREDICTED: coatomer subunit gam...   548   e-153   Ceratotherium simum simum [southern square-lipped rhinoceros]
gi|193784830|dbj|BAG53983.1| unnamed protein product [Homo sapiens]   547   e-153   Homo sapiens [man]
gi|326910990|ref|XP_003201846.1| PREDICTED: coatomer subunit gam...   547   e-153   
gi|354482845|ref|XP_003503606.1| PREDICTED: coatomer subunit gam...   547   e-153   
gi|508706148|gb|EOX98044.1| Coatomer gamma-2 subunit / gamma-2 c...   546   e-153   Theobroma cacao [chocolate]
gi|26353514|dbj|BAC40387.1| unnamed protein product [Mus musculus]    546   e-153   Mus musculus [mouse]
gi|45361156|ref|NP_989174.1| coatomer protein complex, subunit g...   546   e-153   Xenopus tropicalis [western clawed frog]
gi|82177624|sp|Q9I8E6.1|COPG2_FUGRU RecName: Full=Coatomer subun...   546   e-153   Takifugu rubripes [tiger puffer]
gi|193786513|dbj|BAG51296.1| unnamed protein product [Homo sapiens]   546   e-153   Homo sapiens [man]
gi|507931738|ref|XP_004677112.1| PREDICTED: coatomer subunit gam...   546   e-153   Condylura cristata
gi|355564530|gb|EHH21030.1| hypothetical protein EGK_04006 [Maca...   546   e-153   Macaca mulatta [rhesus macaque]
gi|193785992|dbj|BAG50968.1| unnamed protein product [Homo sapiens]   546   e-153   Homo sapiens [man]
gi|148235681|ref|NP_001083575.1| coatomer protein complex, subun...   546   e-153   Xenopus laevis [clawed frog]
gi|149411654|ref|XP_001511377.1| PREDICTED: coatomer subunit gam...   546   e-152   Ornithorhynchus anatinus [duck-billed platypus]
gi|449271822|gb|EMC82040.1| Coatomer subunit gamma, partial [Col...   546   e-152   Columba livia [carrier pigeon]
gi|345324772|ref|XP_003430857.1| PREDICTED: coatomer subunit gam...   545   e-152   Ornithorhynchus anatinus [duck-billed platypus]
gi|356538767|ref|XP_003537872.1| PREDICTED: coatomer subunit gam...   545   e-152   Glycine max [soybeans]
gi|164656585|ref|XP_001729420.1| hypothetical protein MGL_3455 [...   545   e-152   Malassezia globosa CBS 7966
gi|224105405|ref|XP_002313799.1| predicted protein [Populus tric...   545   e-152   Populus trichocarpa [western balsam poplar]
gi|507667552|ref|XP_004707875.1| PREDICTED: coatomer subunit gam...   545   e-152   Echinops telfairi [lesser hedgehog tenrec]
gi|224066105|ref|XP_002198012.1| PREDICTED: coatomer subunit gam...   545   e-152   Taeniopygia guttata
gi|466021139|ref|XP_004272238.1| PREDICTED: coatomer subunit gam...   545   e-152   Orcinus orca [Orca]
gi|505801263|ref|XP_004608312.1| PREDICTED: coatomer subunit gam...   544   e-152   Sorex araneus [Eurasian shrew]
gi|224092677|ref|XP_002187860.1| PREDICTED: coatomer subunit gam...   544   e-152   Taeniopygia guttata
gi|345779909|ref|XP_532421.3| PREDICTED: coatomer subunit gamma-...   544   e-152   
gi|118081889|ref|XP_414981.2| PREDICTED: coatomer subunit gamma-...   544   e-152   Gallus gallus [bantam]
gi|410952887|ref|XP_003983109.1| PREDICTED: coatomer subunit gam...   544   e-152   
gi|326910988|ref|XP_003201845.1| PREDICTED: coatomer subunit gam...   544   e-152   Meleagris gallopavo [common turkey]
gi|126340699|ref|XP_001367114.1| PREDICTED: coatomer subunit gam...   543   e-152   Monodelphis domestica
gi|332261819|ref|XP_003279964.1| PREDICTED: coatomer subunit gam...   543   e-152   Nomascus leucogenys [White-cheeked Gibbon]
gi|356508418|ref|XP_003522954.1| PREDICTED: coatomer subunit gam...   543   e-152   Glycine max [soybeans]
gi|410951822|ref|XP_003982592.1| PREDICTED: coatomer subunit gam...   543   e-152   Felis catus [cat]
gi|502130920|ref|XP_004500815.1| PREDICTED: coatomer subunit gam...   543   e-152   Cicer arietinum [garbanzo]
gi|301755308|ref|XP_002913488.1| PREDICTED: coatomer subunit gam...   543   e-152   Ailuropoda melanoleuca
gi|355786374|gb|EHH66557.1| hypothetical protein EGM_03573 [Maca...   543   e-152   Macaca fascicularis [crab eating macaque]
gi|395539415|ref|XP_003771666.1| PREDICTED: coatomer subunit gam...   542   e-151   
gi|71895411|ref|NP_001025768.1| coatomer subunit gamma [Gallus g...   542   e-151   Gallus gallus [bantam]
gi|471399394|ref|XP_004382736.1| PREDICTED: coatomer subunit gam...   541   e-151   Trichechus manatus latirostris
gi|511834340|ref|XP_004741802.1| PREDICTED: coatomer subunit gam...   541   e-151   
gi|507554973|ref|XP_004661259.1| PREDICTED: coatomer subunit gam...   541   e-151   Jaculus jaculus
gi|431911700|gb|ELK13848.1| Coatomer subunit gamma-2, partial [P...   540   e-151   Pteropus alecto
gi|511834338|ref|XP_004741801.1| PREDICTED: coatomer subunit gam...   540   e-151   Mustela putorius furo [black ferret]
gi|224077826|ref|XP_002305424.1| predicted protein [Populus tric...   540   e-151   Populus trichocarpa [western balsam poplar]
gi|356545247|ref|XP_003541056.1| PREDICTED: coatomer subunit gam...   540   e-151   Glycine max [soybeans]
gi|465994215|gb|EMP39438.1| Coatomer subunit gamma-2 [Chelonia m...   540   e-151   Chelonia mydas [green seaturtle]
gi|511941670|ref|XP_004789617.1| PREDICTED: coatomer subunit gam...   540   e-151   
gi|56118472|ref|NP_001008019.1| coatomer subunit gamma-2 [Xenopu...   540   e-151   Xenopus tropicalis [western clawed frog]
gi|511834342|ref|XP_004741803.1| PREDICTED: coatomer subunit gam...   540   e-151   Mustela putorius furo [black ferret]
gi|327288292|ref|XP_003228862.1| PREDICTED: coatomer subunit gam...   540   e-151   
gi|357467249|ref|XP_003603909.1| Coatomer subunit gamma [Medicag...   540   e-151   Medicago truncatula
gi|414883922|tpg|DAA59936.1| TPA: hypothetical protein ZEAMMB73_...   539   e-151   Zea mays [maize]
gi|212723038|ref|NP_001132662.1| uncharacterized protein LOC1001...   539   e-151   Zea mays [maize]
gi|449462244|ref|XP_004148851.1| PREDICTED: coatomer subunit gam...   539   e-151   Cucumis sativus [cucumbers]
gi|327288290|ref|XP_003228861.1| PREDICTED: coatomer subunit gam...   539   e-151   Anolis carolinensis [Carolina anole]
gi|348553983|ref|XP_003462805.1| PREDICTED: coatomer subunit gam...   539   e-150   Cavia porcellus [guinea pig]
gi|460370036|ref|XP_004230861.1| PREDICTED: coatomer subunit gam...   539   e-150   Solanum lycopersicum
gi|219888335|gb|ACL54542.1| unknown [Zea mays]                        539   e-150   Zea mays [maize]
gi|472356813|ref|XP_004398041.1| PREDICTED: coatomer subunit gam...   538   e-150   Odobenus rosmarus divergens
gi|390475389|ref|XP_002758715.2| PREDICTED: coatomer subunit gam...   538   e-150   
gi|470464760|ref|XP_004341555.1| coatomer subunit gamma, putativ...   538   e-150   Acanthamoeba castellanii str. Neff
gi|296531454|ref|NP_001171865.1| coatomer subunit gamma-2 [Sacco...   538   e-150   Saccoglossus kowalevskii
gi|356517094|ref|XP_003527225.1| PREDICTED: coatomer subunit gam...   537   e-150   Glycine max [soybeans]
gi|302420159|ref|XP_003007910.1| coatomer subunit gamma-2 [Verti...   537   e-150   Verticillium alfalfae VaMs.102
gi|332261817|ref|XP_003279963.1| PREDICTED: coatomer subunit gam...   537   e-150   Nomascus leucogenys [White-cheeked Gibbon]
gi|504165159|ref|XP_004592596.1| PREDICTED: coatomer subunit gam...   536   e-150   Ochotona princeps [southern American pika]
gi|326927948|ref|XP_003210149.1| PREDICTED: coatomer subunit gam...   536   e-150   Meleagris gallopavo [common turkey]
gi|255536821|ref|XP_002509477.1| coatomer gamma subunit, putativ...   535   e-149   Ricinus communis
gi|242043286|ref|XP_002459514.1| hypothetical protein SORBIDRAFT...   535   e-149   Sorghum bicolor [broomcorn]
gi|483524916|gb|EOB08720.1| Coatomer subunit gamma-2, partial [A...   534   e-149   Anas platyrhynchos [duck]
gi|444706725|gb|ELW48049.1| Coatomer subunit gamma-2 [Tupaia chi...   534   e-149   Tupaia chinensis
gi|431913717|gb|ELK15207.1| Coatomer subunit gamma [Pteropus ale...   533   e-149   Pteropus alecto
gi|462395717|gb|EMJ01516.1| hypothetical protein PRUPE_ppa001186...   533   e-149   Prunus persica
gi|42567389|ref|NP_195171.2| coatomer subunit gamma [Arabidopsis...   533   e-149   Arabidopsis thaliana [mouse-ear cress]
gi|470126235|ref|XP_004299096.1| PREDICTED: coatomer subunit gam...   533   e-149   
gi|110741159|dbj|BAE98672.1| Nonclathrin coat protein gamma - li...   533   e-149   Arabidopsis thaliana [mouse-ear cress]
gi|218199265|gb|EEC81692.1| hypothetical protein OsI_25286 [Oryz...   532   e-148   Oryza sativa Indica Group [Indian rice]
gi|320583477|gb|EFW97690.1| coatomer gamma subunit (Gamma-coat) ...   532   e-148   
gi|115471065|ref|NP_001059131.1| Os07g0201100 [Oryza sativa Japo...   532   e-148   
gi|395516761|ref|XP_003762555.1| PREDICTED: coatomer subunit gam...   532   e-148   
gi|502149179|ref|XP_004507423.1| PREDICTED: coatomer subunit gam...   531   e-148   
gi|357111232|ref|XP_003557418.1| PREDICTED: coatomer subunit gam...   531   e-148   
gi|357111230|ref|XP_003557417.1| PREDICTED: coatomer subunit gam...   531   e-148   
gi|148222563|ref|NP_001086117.1| coatomer subunit gamma-2 [Xenop...   530   e-148   
gi|474151042|gb|EMS56973.1| Coatomer subunit gamma-2 [Triticum u...   530   e-148   
gi|357473217|ref|XP_003606893.1| Coatomer subunit gamma [Medicag...   530   e-148   
gi|326521136|dbj|BAJ96771.1| predicted protein [Hordeum vulgare ...   530   e-148   
gi|126336253|ref|XP_001367011.1| PREDICTED: coatomer subunit gam...   530   e-148   
gi|326503000|dbj|BAJ99125.1| predicted protein [Hordeum vulgare ...   529   e-148   
gi|168015439|ref|XP_001760258.1| predicted protein [Physcomitrel...   528   e-147   
gi|168056664|ref|XP_001780339.1| predicted protein [Physcomitrel...   528   e-147   
gi|167516914|ref|XP_001742798.1| hypothetical protein [Monosiga ...   527   e-147   
gi|340372835|ref|XP_003384949.1| PREDICTED: coatomer subunit gam...   527   e-147   
gi|465794043|emb|CCU98945.1| unnamed protein product [Malassezia...   526   e-147   
gi|19114283|ref|NP_593371.1| coatomer gamma subunit Sec21 (predi...   526   e-147   
gi|475513660|gb|EMT05643.1| Coatomer subunit gamma-2 [Aegilops t...   525   e-146   
gi|470303177|ref|XP_004347858.1| coatomer subunit gamma-2 [Capsa...   525   e-146   
gi|154278078|ref|XP_001539863.1| hypothetical protein HCAG_05330...   525   e-146   
gi|311341|emb|CAA49616.1| gamma-COP [Bos taurus]                      524   e-146   
gi|501755431|emb|CCG81350.1| Coatomer subunit gamma [Taphrina de...   524   e-146   
gi|297832552|ref|XP_002884158.1| hypothetical protein ARALYDRAFT...   522   e-145   
gi|326515256|dbj|BAK03541.1| predicted protein [Hordeum vulgare ...   521   e-145   
gi|361129379|gb|EHL01287.1| putative coatomer subunit gamma [Gla...   521   e-145   
gi|482551787|gb|EOA15980.1| hypothetical protein CARUB_v10004095...   521   e-145   
gi|297802520|ref|XP_002869144.1| hypothetical protein ARALYDRAFT...   520   e-145   
gi|403268803|ref|XP_003926456.1| PREDICTED: coatomer subunit gam...   518   e-144   
gi|168004211|ref|XP_001754805.1| predicted protein [Physcomitrel...   518   e-144   
gi|47207293|emb|CAG07279.1| unnamed protein product [Tetraodon n...   517   e-144   
gi|195444296|ref|XP_002069802.1| GK11719 [Drosophila willistoni]...   515   e-143   
gi|482565304|gb|EOA29493.1| hypothetical protein CARUB_v10012945...   515   e-143   
gi|91090890|ref|XP_973414.1| PREDICTED: similar to RE62270p [Tri...   514   e-143   
gi|508706149|gb|EOX98045.1| Coatomer gamma-2 subunit / gamma-2 c...   513   e-143   
gi|312080777|ref|XP_003142745.1| coatomer gamma subunit [Loa loa...   513   e-143   
gi|302830478|ref|XP_002946805.1| hypothetical protein VOLCADRAFT...   512   e-142   
gi|170576383|ref|XP_001893606.1| coatomer gamma subunit [Brugia ...   511   e-142   
gi|260810700|ref|XP_002600091.1| hypothetical protein BRAFLDRAFT...   511   e-142   
gi|213403976|ref|XP_002172760.1| coatomer gamma subunit Sec21 [S...   511   e-142   
gi|326505076|dbj|BAK02925.1| predicted protein [Hordeum vulgare ...   510   e-142   
gi|3641837|emb|CAA18824.1| Nonclathrin coat protein gamma-like p...   509   e-142   
gi|146286093|sp|Q8H852.2|COPG1_ORYSJ RecName: Full=Coatomer subu...   508   e-141   
gi|115451685|ref|NP_001049443.1| Os03g0227000 [Oryza sativa Japo...   508   e-141   
gi|327266031|ref|XP_003217810.1| PREDICTED: coatomer subunit gam...   507   e-141   
gi|159465992|ref|XP_001691193.1| gamma-cop [Chlamydomonas reinha...   506   e-140   
gi|307106833|gb|EFN55078.1| hypothetical protein CHLNCDRAFT_3154...   506   e-140   
gi|402864847|ref|XP_003896658.1| PREDICTED: LOW QUALITY PROTEIN:...   506   e-140   
gi|474033607|gb|EMS53044.1| Coatomer subunit gamma-1 [Triticum u...   506   e-140   
gi|330792653|ref|XP_003284402.1| hypothetical protein DICPUDRAFT...   505   e-140   
gi|194764949|ref|XP_001964590.1| GF22968 [Drosophila ananassae] ...   505   e-140   
gi|195144010|ref|XP_002012989.1| GL23633 [Drosophila persimilis]...   504   e-140   
gi|349732358|gb|AEQ05569.1| RE13603p1 [Drosophila melanogaster]       504   e-140   
gi|390177523|ref|XP_003736402.1| GA13624, isoform B [Drosophila ...   504   e-140   
gi|220942608|gb|ACL83847.1| gammaCop-PB [synthetic construct]         504   e-140   
gi|24651660|ref|NP_733432.1| gamma-coatomer protein, isoform B [...   504   e-140   
gi|125774017|ref|XP_001358267.1| GA13624, isoform A [Drosophila ...   504   e-140   
gi|475584352|gb|EMT19755.1| Coatomer subunit gamma-1 [Aegilops t...   504   e-140   
gi|442622072|ref|NP_001263145.1| gamma-coatomer protein, isoform...   504   e-140   
gi|195354454|ref|XP_002043712.1| GM16430 [Drosophila sechellia] ...   504   e-140   
gi|17864148|ref|NP_524608.1| gamma-coatomer protein, isoform A [...   504   e-140   
gi|6179938|gb|AAF05719.1|AF191563_1 coatomer protein gamma subun...   504   e-140   
gi|281362913|ref|NP_001163784.1| gamma-coatomer protein, isoform...   504   e-140   
gi|21064641|gb|AAM29550.1| RE62270p [Drosophila melanogaster]         503   e-140   
gi|242036409|ref|XP_002465599.1| hypothetical protein SORBIDRAFT...   502   e-139   
gi|196004014|ref|XP_002111874.1| hypothetical protein TRIADDRAFT...   501   e-139   
gi|194904877|ref|XP_001981077.1| GG11813 [Drosophila erecta] >gi...   501   e-139   
gi|254573046|ref|XP_002493632.1| Gamma subunit of coatomer, a he...   501   e-139   
gi|195505467|ref|XP_002099517.1| GE10946 [Drosophila yakuba] >gi...   500   e-139   
gi|312377540|gb|EFR24350.1| hypothetical protein AND_11128 [Anop...   499   e-138   
gi|50555079|ref|XP_504948.1| YALI0F03454p [Yarrowia lipolytica] ...   498   e-138   
gi|58294194|gb|AAW70037.1| coatomer protein complex subunit gamm...   498   e-138   
gi|58294192|gb|AAW70036.1| coatomer protein complex subunit gamm...   497   e-138   
gi|218192372|gb|EEC74799.1| hypothetical protein OsI_10600 [Oryz...   496   e-138   
gi|485647671|gb|EOD40771.1| COPG1, gamma subunit of the coatomer...   494   e-137   
gi|226503653|ref|NP_001146210.1| uncharacterized protein LOC1002...   493   e-137   
gi|414865697|tpg|DAA44254.1| TPA: hypothetical protein ZEAMMB73_...   493   e-137   
gi|357113264|ref|XP_003558424.1| PREDICTED: coatomer subunit gam...   493   e-137   
gi|357113262|ref|XP_003558423.1| PREDICTED: coatomer subunit gam...   493   e-137   
gi|384253897|gb|EIE27371.1| Coatomer, gamma subunit [Coccomyxa s...   493   e-137   
gi|219886193|gb|ACL53471.1| unknown [Zea mays] >gi|414865695|tpg...   493   e-137   
gi|195036520|ref|XP_001989718.1| GH18636 [Drosophila grimshawi] ...   491   e-136   
gi|498953156|ref|XP_004523456.1| PREDICTED: LOW QUALITY PROTEIN:...   490   e-136   
gi|242012413|ref|XP_002426927.1| Coatomer subunit gamma-2, putat...   490   e-136   
gi|195108569|ref|XP_001998865.1| GI23396 [Drosophila mojavensis]...   489   e-135   
gi|302803747|ref|XP_002983626.1| hypothetical protein SELMODRAFT...   489   e-135   
gi|66805117|ref|XP_636291.1| adaptin N-terminal domain-containin...   488   e-135   
gi|281206916|gb|EFA81100.1| adaptin N-terminal domain-containing...   488   e-135   
gi|195390482|ref|XP_002053897.1| GJ23086 [Drosophila virilis] >g...   488   e-135   
gi|302817818|ref|XP_002990584.1| hypothetical protein SELMODRAFT...   487   e-135   
gi|222624501|gb|EEE58633.1| hypothetical protein OsJ_09998 [Oryz...   485   e-134   
gi|301117764|ref|XP_002906610.1| coatomer subunit gamma, putativ...   484   e-134   
gi|343959216|dbj|BAK63463.1| testis specific protein 13 [Pan tro...   483   e-134   
gi|308481159|ref|XP_003102785.1| hypothetical protein CRE_29898 ...   480   e-133   
gi|341902292|gb|EGT58227.1| hypothetical protein CAEBREN_07602 [...   479   e-132   
gi|348688582|gb|EGZ28396.1| hypothetical protein PHYSODRAFT_5370...   478   e-132   
gi|341881963|gb|EGT37898.1| hypothetical protein CAEBREN_20098 [...   477   e-132   
gi|268537174|ref|XP_002633723.1| Hypothetical protein CBG03408 [...   474   e-131   
gi|391338718|ref|XP_003743702.1| PREDICTED: coatomer subunit gam...   473   e-131   
gi|345496421|ref|XP_003427722.1| PREDICTED: LOW QUALITY PROTEIN:...   473   e-131   
gi|483507647|gb|EOA98107.1| Coatomer subunit gamma, partial [Ana...   473   e-131   
gi|115532936|ref|NP_001040988.1| Protein T14G10.5, isoform a [Ca...   471   e-130   
gi|115532938|ref|NP_001040989.1| Protein T14G10.5, isoform b [Ca...   471   e-130   
gi|392900362|ref|NP_001255464.1| Protein T14G10.5, isoform c [Ca...   470   e-130   
gi|303273424|ref|XP_003056073.1| coatomer protein gamma-subunit ...   470   e-130   
gi|24421683|gb|AAN60990.1| Putative Nonclathrin coat protein gam...   469   e-129   
gi|511950247|ref|XP_004793549.1| PREDICTED: coatomer subunit gam...   469   e-129   
gi|391338720|ref|XP_003743703.1| PREDICTED: coatomer subunit gam...   469   e-129   
gi|255070801|ref|XP_002507482.1| coatomer protein gamma-subunit ...   468   e-129   
gi|406604075|emb|CCH44426.1| Coatomer subunit gamma-2 [Wickerham...   468   e-129   
gi|158300099|ref|XP_320089.2| AGAP009291-PA [Anopheles gambiae s...   466   e-128   
gi|307195785|gb|EFN77599.1| Coatomer subunit gamma-2 [Harpegnath...   465   e-128   
gi|307178478|gb|EFN67167.1| Coatomer subunit gamma-2 [Camponotus...   465   e-128   
gi|241705179|ref|XP_002413239.1| coatomer gamma subunit, putativ...   464   e-128   
gi|313225137|emb|CBY20930.1| unnamed protein product [Oikopleura...   464   e-128   
gi|395837481|ref|XP_003791662.1| PREDICTED: coatomer subunit gam...   463   e-128   
gi|507110445|emb|CDF34210.1| Coatomer subunit gamma [Chondrus cr...   463   e-128   
gi|395738974|ref|XP_002818503.2| PREDICTED: coatomer subunit gam...   462   e-127   
gi|109068230|ref|XP_001095932.1| PREDICTED: coatomer subunit gam...   462   e-127   
gi|84570040|gb|AAI10797.1| COPG2 protein [Homo sapiens]               461   e-127   
gi|313240132|emb|CBY32484.1| unnamed protein product [Oikopleura...   461   e-127   
gi|383849746|ref|XP_003700498.1| PREDICTED: coatomer subunit gam...   461   e-127   
gi|428183071|gb|EKX51930.1| coatomer subunit gammma [Guillardia ...   460   e-127   
gi|325185747|emb|CCA20227.1| hypothetical protein ARALYDRAFT_900...   459   e-127   
gi|440900610|gb|ELR51700.1| Coatomer subunit gamma-2, partial [B...   459   e-126   
gi|358340786|dbj|GAA28524.2| coatomer subunit gamma-2 [Clonorchi...   459   e-126   
gi|344298505|ref|XP_003420932.1| PREDICTED: coatomer subunit gam...   459   e-126   
gi|432111306|gb|ELK34595.1| Coatomer subunit gamma-2 [Myotis dav...   459   e-126   
gi|322781557|gb|EFZ10235.1| hypothetical protein SINV_06617 [Sol...   459   e-126   
gi|507667289|ref|XP_004636947.1| PREDICTED: coatomer subunit gam...   458   e-126   
gi|340722693|ref|XP_003399738.1| PREDICTED: coatomer subunit gam...   458   e-126   
gi|338724376|ref|XP_001498608.3| PREDICTED: coatomer subunit gam...   457   e-126   
gi|332028007|gb|EGI68058.1| Coatomer subunit gamma-2 [Acromyrmex...   457   e-126   
gi|478513118|ref|XP_004430817.1| PREDICTED: coatomer subunit gam...   456   e-126   
gi|291391066|ref|XP_002712043.1| PREDICTED: coatomer protein com...   456   e-126   
gi|470265489|ref|XP_004361518.1| adaptin N-terminal domain-conta...   453   e-125   
gi|511828002|ref|XP_004738746.1| PREDICTED: coatomer subunit gam...   450   e-124   
gi|7023756|dbj|BAA92078.1| unnamed protein product [Homo sapiens]     449   e-123   
gi|197100997|ref|NP_001124939.1| coatomer subunit gamma [Pongo a...   447   e-123   
gi|170054322|ref|XP_001863075.1| coatomer subunit gamma [Culex q...   444   e-122   
gi|385305115|gb|EIF49108.1| coatomer subunit [Dekkera bruxellens...   444   e-122   
gi|350424340|ref|XP_003493763.1| PREDICTED: coatomer subunit gam...   442   e-121   
gi|112983936|ref|NP_001036846.1| nonclathrin coat protein gamma1...   441   e-121   
gi|443913900|gb|ELU36251.1| coatomer gamma subunit (Gamma-coat p...   441   e-121   
gi|380014396|ref|XP_003691218.1| PREDICTED: coatomer subunit gam...   440   e-121   
gi|256088224|ref|XP_002580249.1| coatomer gamma subunit [Schisto...   440   e-121   
gi|66526642|ref|XP_395549.2| PREDICTED: coatomer subunit gamma i...   439   e-120   
gi|193587428|ref|XP_001949780.1| PREDICTED: coatomer subunit gam...   439   e-120   
gi|471908297|emb|CCO28335.1| putative coatomer subunit gamma Alt...   434   e-119   
gi|257216428|emb|CAX82419.1| Coatomer subunit gamma [Schistosoma...   431   e-118   
gi|257205640|emb|CAX82471.1| Coatomer subunit gamma [Schistosoma...   431   e-118   
gi|323447884|gb|EGB03791.1| hypothetical protein AURANDRAFT_3922...   428   e-117   
gi|339239235|ref|XP_003381172.1| coatomer subunit gamma-2 [Trich...   427   e-117   
gi|255730531|ref|XP_002550190.1| conserved hypothetical protein ...   424   e-116   
gi|363751230|ref|XP_003645832.1| hypothetical protein Ecym_3538 ...   424   e-116   
gi|412990393|emb|CCO19711.1| coatomer protein gamma-subunit [Bat...   423   e-116   
gi|50405699|ref|XP_456488.1| DEHA2A03322p [Debaryomyces hansenii...   422   e-115   
gi|260946005|ref|XP_002617300.1| hypothetical protein CLUG_02744...   421   e-115   
gi|367007962|ref|XP_003688710.1| hypothetical protein TPHA_0P011...   420   e-115   
gi|507645184|ref|XP_004702564.1| PREDICTED: LOW QUALITY PROTEIN:...   417   e-114   
gi|323453003|gb|EGB08875.1| hypothetical protein AURANDRAFT_3719...   415   e-113   
gi|254578536|ref|XP_002495254.1| ZYRO0B07018p [Zygosaccharomyces...   413   e-113   
gi|367014073|ref|XP_003681536.1| hypothetical protein TDEL_0E008...   413   e-113   
gi|512925234|ref|XP_004930789.1| PREDICTED: coatomer subunit gam...   413   e-112   
gi|354543803|emb|CCE40525.1| hypothetical protein CPAR2_105610 [...   412   e-112   
gi|219112963|ref|XP_002186065.1| predicted protein [Phaeodactylu...   411   e-112   
gi|426250050|ref|XP_004018753.1| PREDICTED: coatomer subunit gam...   410   e-112   
gi|444317040|ref|XP_004179177.1| hypothetical protein TBLA_0B084...   407   e-111   
gi|50309085|ref|XP_454548.1| hypothetical protein [Kluyveromyces...   407   e-111   
gi|241948809|ref|XP_002417127.1| coatomer gamma subunit (Gamma-c...   407   e-111   
gi|190344461|gb|EDK36139.2| hypothetical protein PGUG_00237 [Mey...   407   e-111   
gi|344304830|gb|EGW35062.1| hypothetical protein SPAPADRAFT_1322...   407   e-111   
gi|7637410|dbj|BAA93048.2| nonclathrin coat protein gamma2-COP [...   406   e-111   
gi|298705020|emb|CBJ28495.1| Coatomer protein complex, gamma sub...   406   e-111   
gi|365982335|ref|XP_003668001.1| hypothetical protein NDAI_0A060...   406   e-110   
gi|357622650|gb|EHJ74076.1| nonclathrin coat protein gamma1-COP ...   406   e-110   
gi|448517569|ref|XP_003867828.1| Sec21 protein [Candida orthopsi...   406   e-110   
gi|238879053|gb|EEQ42691.1| conserved hypothetical protein [Cand...   406   e-110   
gi|68484931|ref|XP_713604.1| hypothetical protein CaO19.8379 [Ca...   405   e-110   
gi|146421833|ref|XP_001486860.1| hypothetical protein PGUG_00237...   405   e-110   
gi|448101907|ref|XP_004199675.1| Piso0_002215 [Millerozyma farin...   404   e-110   
gi|397620717|gb|EJK65869.1| hypothetical protein THAOC_13228 [Th...   403   e-110   
gi|156841913|ref|XP_001644327.1| hypothetical protein Kpol_1066p...   403   e-110   
gi|344229491|gb|EGV61376.1| hypothetical protein CANTEDRAFT_1095...   402   e-109   
gi|459369350|gb|EMG47758.1| Coatomer gamma subunit (Gamma-coat) ...   402   e-109   
gi|448098031|ref|XP_004198825.1| Piso0_002215 [Millerozyma farin...   402   e-109   
gi|365758859|gb|EHN00684.1| Sec21p [Saccharomyces cerevisiae x S...   401   e-109   
gi|513032176|gb|AGO12168.1| AaceriAEL193Wp [Saccharomycetaceae s...   400   e-109   
gi|323303305|gb|EGA57101.1| Sec21p [Saccharomyces cerevisiae Fos...   400   e-109   
gi|6324042|ref|NP_014112.1| Sec21p [Saccharomyces cerevisiae S28...   400   e-109   
gi|365763614|gb|EHN05141.1| Sec21p [Saccharomyces cerevisiae x S...   400   e-109   
gi|349580663|dbj|GAA25822.1| K7_Sec21p [Saccharomyces cerevisiae...   399   e-108   
gi|323335985|gb|EGA77262.1| Sec21p [Saccharomyces cerevisiae Vin13]   399   e-108   
gi|323352831|gb|EGA85133.1| Sec21p [Saccharomyces cerevisiae VL3]     399   e-108   
gi|255710503|ref|XP_002551535.1| KLTH0A01694p [Lachancea thermot...   399   e-108   
gi|45190414|ref|NP_984668.1| AEL193Wp [Ashbya gossypii ATCC 1089...   399   e-108   
gi|374107885|gb|AEY96792.1| FAEL193Wp [Ashbya gossypii FDAG1]         399   e-108   
gi|470131333|ref|XP_004301551.1| PREDICTED: coatomer subunit gam...   398   e-108   
gi|171483|gb|AAA34598.1| sec21p [Saccharomyces cerevisiae]            398   e-108   
gi|149244836|ref|XP_001526961.1| conserved hypothetical protein ...   395   e-107   
gi|410075625|ref|XP_003955395.1| hypothetical protein KAFR_0A082...   395   e-107   
gi|401624045|gb|EJS42119.1| sec21p [Saccharomyces arboricola H-6]     395   e-107   
gi|145342240|ref|XP_001416165.1| Coatomer gamma subunit [Ostreoc...   393   e-106   
gi|150951546|ref|XP_001387882.2| coatomer gamma non-clathrin coa...   392   e-106   
gi|50294175|ref|XP_449499.1| hypothetical protein [Candida glabr...   389   e-105   
gi|357624625|gb|EHJ75334.1| nonclathrin coat protein gamma2-COP ...   388   e-105   
gi|403218099|emb|CCK72591.1| hypothetical protein KNAG_0K02280 [...   385   e-104   
gi|350591495|ref|XP_003132454.3| PREDICTED: coatomer subunit gam...   385   e-104   
gi|308800536|ref|XP_003075049.1| CopG Coatomer gamma subunit (IC...   384   e-104   
gi|366988313|ref|XP_003673923.1| hypothetical protein NCAS_0A098...   383   e-103   
gi|224008733|ref|XP_002293325.1| coatomer protein subunit gamma ...   378   e-102   
gi|290974281|ref|XP_002669874.1| coatomer protein gamma 2-subuni...   377   e-102   
gi|465980525|gb|EMP35629.1| Coatomer subunit gamma [Chelonia mydas]   373   e-101   
gi|298283455|gb|ADI72847.1| vesicle coat complex COPI gamma subu...   355   3e-95   
gi|449018312|dbj|BAM81714.1| coatomer protein complex, subunit g...   354   4e-95   
gi|485647672|gb|EOD40772.1| coatomer protein gamma 2 subunit [Em...   352   2e-94   
gi|472352222|ref|XP_004395788.1| PREDICTED: coatomer subunit gam...   349   1e-93   
gi|459185744|ref|XP_002128779.2| PREDICTED: coatomer subunit gam...   345   2e-92   
gi|402584397|gb|EJW78338.1| gamma-coatomer protein [Wuchereria b...   339   2e-90   
gi|452822007|gb|EME29031.1| coatomer protein complex, subunit ga...   338   3e-90   
gi|294947350|ref|XP_002785344.1| Coatomer subunit gamma, putativ...   333   7e-89   


>gi|384487518|gb|EIE79698.1| hypothetical protein RO3G_04403 [Rhizopus delemar RA 99-880]
          Length = 850

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/613 (60%), Positives = 467/613 (76%), Gaps = 17/613 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSPK TLRFAAIRTLNKL++  P AV SCNLD+E LI+D NRS+ATFAITTLLKTGN
Sbjct: 252 LFLSSPKPTLRFAAIRTLNKLSINNPAAVTSCNLDIETLISDSNRSIATFAITTLLKTGN 311

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFM++ISDEFKVIVV+AIRSLCLKFP+KQ VM+SFLS VLRDEGGY F
Sbjct: 312 EASVDRLMKQISGFMNDISDEFKVIVVEAIRSLCLKFPAKQAVMMSFLSNVLRDEGGYSF 371

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K+AVVEAIFD+VK IPESK+ AL+HLCEFIEDCEFTKLSVRVLHLLG+EGPK  TPTKYI
Sbjct: 372 KKAVVEAIFDIVKHIPESKDMALSHLCEFIEDCEFTKLSVRVLHLLGIEGPKAVTPTKYI 431

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRVILENS++RAAAVSALAKFG++  D EV+KS+ VLL+RCLDD DDEVRDRA LY
Sbjct: 432 RYIYNRVILENSVIRAAAVSALAKFGINGRDEEVRKSVHVLLSRCLDDVDDEVRDRAALY 491

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           L ++D+   A +YV DDSTY+L +LERQLV+Y+ NP      F L  IP I+K Q E E 
Sbjct: 492 LSMMDNQNLANRYVTDDSTYALPSLERQLVEYIGNPLGITGGFKLESIPVISKLQEEQER 551

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIAAF 360
             P +  + +  + G  +   G  N+   S+         +DQQ +Y+++L  IPE  +F
Sbjct: 552 RLPSNKGVPAATSPGVGTPISG--NNTFASS---------LDQQAMYAEKLAAIPEFTSF 600

Query: 361 GPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPESD 420
           G LFKSS KP++LTESETEY+V CVKH F +++VFQFI TNTLNDQLLENV +VMQPE  
Sbjct: 601 GVLFKSSSKPIDLTESETEYIVQCVKHTFAKHIVFQFICTNTLNDQLLENVHMVMQPEI- 659

Query: 421 EGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXXXX 480
           EG L +   IPA +L Y+ P +IYVAF++ +PEE    +F+NTLKF VKDCDP+T     
Sbjct: 660 EG-LAQVVEIPAERLEYNVPGTIYVAFEQEDPEELANVTFTNTLKFEVKDCDPTT-GEAD 717

Query: 481 XXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKS--LKDSC 538
                       IE++TSDYV  +Y+S+F+  + S+ ++ +V++TFAL   K+  L+D+C
Sbjct: 718 PEGFEDEYQVEDIEVITSDYVRSSYVSNFAEEFKSL-QDNEVIDTFALDKEKAHNLQDAC 776

Query: 539 TTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSVRS 598
            ++I+LLGM P+E + +P ++SVHTL+LSGTFL G K LAK RMTF  S+GV  EL+VRS
Sbjct: 777 DSIIDLLGMQPLEGTESPKNNSVHTLLLSGTFLDGSKALAKCRMTFNTSSGVAFELAVRS 836

Query: 599 PSEEISRIVIGAV 611
               +S+I++ A+
Sbjct: 837 EDVNVSQIILLAI 849



>gi|384489656|gb|EIE80878.1| hypothetical protein RO3G_05583 [Rhizopus delemar RA 99-880]
          Length = 937

 Score =  713 bits (1841), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/618 (61%), Positives = 462/618 (74%), Gaps = 23/618 (3%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSPK TLRFAAIRTLNKL++  PTAV  CNLD+ENLITD NRS+ATFAITTLLKTGN
Sbjct: 335 LFLSSPKPTLRFAAIRTLNKLSINSPTAVAPCNLDIENLITDSNRSIATFAITTLLKTGN 394

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFM++ISDEFKVIVV+AIRSLCLKFP+KQ +MLSFLS VLRDEGGY F
Sbjct: 395 EASVDRLMKQISGFMNDISDEFKVIVVEAIRSLCLKFPAKQAIMLSFLSNVLRDEGGYNF 454

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K+AVVEAIFD+VK IPESK+ AL+HLCEFIEDCEFTKLSVRVLHLLG+EGPKT TPTKYI
Sbjct: 455 KKAVVEAIFDMVKHIPESKDTALSHLCEFIEDCEFTKLSVRVLHLLGIEGPKTVTPTKYI 514

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRVILENSI+RAAAVSALAKFGV   D E++KS+ VLL+RCLDD DDEVRDRA LY
Sbjct: 515 RYIYNRVILENSIIRAAAVSALAKFGVHGRDEEIRKSVHVLLSRCLDDVDDEVRDRAALY 574

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           L ++D+ + A+KYV DDSTY+L  LERQL +Y+SNP  S + F L  IP I+K+Q E E 
Sbjct: 575 LSMMDNQDLAKKYVTDDSTYALPTLERQLAEYISNPVQSTQEFKLESIPVISKSQEEEE- 633

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPG-------VDQQQVYSQQLEQ 353
              R  +  S   I    SA  +  S   ++    TP  G       +DQQ +Y+++L  
Sbjct: 634 ---RRRNQPSDNAILPLLSAPSNKGSATAASPGVGTPVSGKNNFVSSLDQQAIYAEELAA 690

Query: 354 IPEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTV 413
           +PE A+FG LFKSS+KP+ELTESETEY+V C+KH F +++VFQF  TNTLNDQLLENV +
Sbjct: 691 VPEFASFGALFKSSVKPIELTESETEYIVHCIKHTFAKHIVFQFNCTNTLNDQLLENVHM 750

Query: 414 VMQPESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDP 473
           +MQPE  EG LV+   IPA KL YD P +IYVAF++ +PEE    +F+NTL+F +KDCDP
Sbjct: 751 IMQPEI-EG-LVQVAEIPAEKLEYDIPGNIYVAFEQEDPEELANVTFTNTLRFEIKDCDP 808

Query: 474 STXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKS 533
           +T                 IE+ TSDY+  +Y+SDF+  ++ +  + + ++TFAL   K+
Sbjct: 809 TT-GEADPEGFEDEYQVEDIEVTTSDYIRSSYVSDFAGEFEGLS-DNEAIDTFALDKEKA 866

Query: 534 LKDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTME 593
                     L  M P+E S +P ++SVHTL+LSGTFL G KVLAK RMTF  STGV  E
Sbjct: 867 HN--------LKSMQPLEGSESPKNNSVHTLLLSGTFLDGSKVLAKCRMTFNTSTGVAFE 918

Query: 594 LSVRSPSEEISRIVIGAV 611
           L+VRS    +S+IV+ A+
Sbjct: 919 LAVRSEDVNVSQIVLLAI 936



>gi|393218270|gb|EJD03758.1| coatomer subunit gamma [Fomitiporia mediterranea MF3/22]
          Length = 927

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 341/613 (55%), Positives = 440/613 (71%), Gaps = 18/613 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           L LSSPK+TL+FAAIRTL  LA+T P +V +CN++ME+LI+D NRS+AT+AITTLLKTG 
Sbjct: 329 LCLSSPKTTLKFAAIRTLASLALTHPGSVATCNVEMEHLISDPNRSIATYAITTLLKTGT 388

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFM+EISDEFKVIVVDAIRSLCLKFP+KQ  MLSFLSGVLRDEGGY+F
Sbjct: 389 EASVDRLMKQISGFMTEISDEFKVIVVDAIRSLCLKFPAKQAAMLSFLSGVLRDEGGYDF 448

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVEAIFD++KFI E KE AL+HLCEFIEDCEFTKLSVR+LHLLG+EGPK P P K+I
Sbjct: 449 KRAVVEAIFDMIKFISECKEQALSHLCEFIEDCEFTKLSVRILHLLGIEGPKMPQPAKFI 508

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAVS+LAKFGV+  D  ++KSI+VLL RCL+D DDEVRDRA  Y
Sbjct: 509 RYIYNRVVLENAIVRAAAVSSLAKFGVNVADSSMQKSIRVLLNRCLEDVDDEVRDRAAFY 568

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           LK++D+   A+ YVK+DS +SL+ LE  LV YV +P +S KPF   +IPKI++ QA  E+
Sbjct: 569 LKVLDEQVLAQTYVKEDSVFSLSVLEANLVSYVKDPSASTKPFSFDNIPKISREQAAKES 628

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIAAF 360
            +P + D        T ++      +       DA      + +  Y++QL ++PE A +
Sbjct: 629 ARPSTLD--------TIAAPSAKPAAATPPPRTDA------ETRSAYAEQLAEVPEFADY 674

Query: 361 GPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPESD 420
           GP+  SS KP +LTESETEY VSCVKH+FKE +VFQF V+NT+ D +LE V+V+MQP++D
Sbjct: 675 GPVLNSSTKPAQLTESETEYQVSCVKHIFKEYVVFQFNVSNTMPDTVLEQVSVIMQPQAD 734

Query: 421 EGTLVEEFVIPATKLPY-DQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXXX 479
            G L E+F+IP   L     P  +YV+F R +PEEY + SF   LKF+ K+ DPS+    
Sbjct: 735 SG-LTEKFIIPIPSLAQATSPGIVYVSFARDSPEEYAVASFQCILKFISKEVDPSSGEPE 793

Query: 480 XXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSCT 539
                              DY+ P+Y S F++ WD +       ETFAL+A +S+K +C 
Sbjct: 794 EEGYEDEYQLEEVELAPGGDYIIPSYAS-FAAEWDRLRAGATATETFALSAMESIKAACD 852

Query: 540 TLIELLGMSPVENSGTPTSSSVHTLMLSGTFL-GGIKVLAKNRMTFAPSTGVTMELSVRS 598
           ++IE+L M  +  +  P+S+SVHTL LSG  + GG KVL + RMT++ S GVT+EL VR+
Sbjct: 853 SIIEILNMEALGGTENPSSTSVHTLQLSGLVIGGGGKVLVRCRMTYSSSAGVTLELGVRA 912

Query: 599 PSEEISRIVIGAV 611
              E   +V+ A+
Sbjct: 913 ERAETCNLVVAAI 925



>gi|511001329|gb|EPB82812.1| hypothetical protein HMPREF1544_10426 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 931

 Score =  681 bits (1757), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/613 (59%), Positives = 463/613 (75%), Gaps = 11/613 (1%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSPK TLRFAAIR LN LA+++P+AV  CNLD+ENL++DQNRS+ATFAITTLLKTGN
Sbjct: 327 LFLSSPKPTLRFAAIRILNALALSKPSAVSPCNLDIENLVSDQNRSIATFAITTLLKTGN 386

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+ FM EISDEFKVIVV+AIRSLC+KFP+KQ VML+FLSGVLRDEGGYEF
Sbjct: 387 EASVDRLMKQISSFMGEISDEFKVIVVEAIRSLCMKFPNKQAVMLNFLSGVLRDEGGYEF 446

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K+AVVEAIFD+V+ IPESK+AAL++LCEFIEDCEFTKLSVRVLH+LG EGPKTPTPTKYI
Sbjct: 447 KKAVVEAIFDMVRHIPESKDAALSYLCEFIEDCEFTKLSVRVLHMLGTEGPKTPTPTKYI 506

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRVILENSI+R AAVSALAKFG +  D  VK+S+KVLL RC DD DDEVRDRA L 
Sbjct: 507 RYIYNRVILENSIIRGAAVSALAKFGTNCPDASVKQSVKVLLARCQDDVDDEVRDRATLA 566

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           L+++ +++ A+ Y  DDST++L  LER+LV+YV+   ++ K F+LS +P I+K+Q E E 
Sbjct: 567 LEMMKNDQLAKLYSIDDSTFALPILERELVEYVNLGSNNTKAFNLSAVPVISKSQEEEER 626

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIAAF 360
            + R  +L    TI TSS    S  +   +   D   +  +DQQ  Y+  L  IPEIAAF
Sbjct: 627 RRNRPQELT---TIATSSPHPSSTPA---TPQADHKSSSQLDQQAAYADALAAIPEIAAF 680

Query: 361 GPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPESD 420
           G LFKSS K +E+TESETEY V C+KH F +++VFQF   NTLNDQLLE+V +VMQ + +
Sbjct: 681 GALFKSSAK-IEVTESETEYAVHCIKHTFAKHIVFQFNCVNTLNDQLLEDVEMVMQIDDE 739

Query: 421 EGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXXXX 480
           E  LV    IPA KL YD P  IYVA++R + +++ + SF+NTLKF++KDCDP+T     
Sbjct: 740 EAGLVRVLEIPAPKLEYDIPGQIYVAYEREDVDDFPIASFTNTLKFVIKDCDPTT-GEPD 798

Query: 481 XXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASK--SLKDSC 538
                       I+++TSDY+ PTY+S+F   + +   EG+ +ET AL   K  SL+ +C
Sbjct: 799 EEGYEDEYQVEEIDLLTSDYIRPTYVSNFEEEFQAFA-EGEALETLALDREKAPSLQAAC 857

Query: 539 TTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSVRS 598
           T +I+LLGM P++++  P + +VHTL+++GTFL G KVLA+ RMTF  S+GV  E+ VRS
Sbjct: 858 TAIIDLLGMQPLDDTSLPRNPNVHTLIMAGTFLTGEKVLARCRMTFNSSSGVAFEMCVRS 917

Query: 599 PSEEISRIVIGAV 611
               IS+IV+ A+
Sbjct: 918 EDATISQIVLSAI 930



>gi|321257910|ref|XP_003193747.1| coatomer gamma subunit (Gamma-coat protein) [Cryptococcus gattii
           WM276]
 gi|317460217|gb|ADV21960.1| Coatomer gamma subunit (Gamma-coat protein), putative [Cryptococcus
           gattii WM276]
          Length = 921

 Score =  680 bits (1755), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/619 (55%), Positives = 450/619 (72%), Gaps = 24/619 (3%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSPK  ++FAA++TL+KLA T P +V + N++MENLITD NRS+AT+AITTLLKTGN
Sbjct: 319 LFLSSPKPVIKFAAVKTLSKLAQTLPQSVAALNVEMENLITDSNRSIATYAITTLLKTGN 378

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+ FM++I+DEFK+IVVDAIRSLCLKFP KQ VMLSFLSGVLRDEGGYEF
Sbjct: 379 EASVDRLMKQISSFMTDITDEFKIIVVDAIRSLCLKFPGKQAVMLSFLSGVLRDEGGYEF 438

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K AVVEAIFD++K+I +S++AALAHLCEFIEDCEFTKLSVR+LHLLG+EGPKT  PTK+I
Sbjct: 439 KHAVVEAIFDMIKYIQDSRDAALAHLCEFIEDCEFTKLSVRILHLLGIEGPKTRNPTKFI 498

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN++VRAAAVS+LAKFGV  +DP V KS+ VL+ RCLDD DDEVRDRA +Y
Sbjct: 499 RYIYNRVVLENAVVRAAAVSSLAKFGVCVDDPSVMKSVNVLMRRCLDDIDDEVRDRAAMY 558

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           +K++++   A+  VKD++ +SLA LE QL  YV +       FD+S +PK+++ QA AE 
Sbjct: 559 IKVLEEKSLADVLVKDEAQFSLATLEDQLTSYVHDNSKHALAFDISAVPKVSREQAHAEV 618

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQ-QQVYSQQLEQIPEIAA 359
            + R             SSA+     + V+    A+P P V + Q  Y+ QL  IPE   
Sbjct: 619 AQTR-------------SSALDVAGPSTVTPIAPASPIPSVKEAQSSYAAQLSTIPEFEP 665

Query: 360 FGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPES 419
           +GP+ KSS KP+ELTESETEYVV+ VKH+F++++VFQF V NT+ D +LE V V+MQP  
Sbjct: 666 YGPVLKSSTKPIELTESETEYVVTAVKHVFRKHVVFQFNVANTIPDTVLEQVAVIMQPSP 725

Query: 420 DEGTLVEEFVIPATKLPYD-QPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXX 478
           D G L E+F+IP   L      + +YV+F R NP+EY  GSF  TLKF+ K+ DPS    
Sbjct: 726 DCG-LTEDFIIPINSLTTQIGQAPVYVSFTRENPQEYAAGSFGCTLKFVSKEVDPSN-GQ 783

Query: 479 XXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSC 538
                         +++  +DY+ PT+++ F + WD +     + ETFAL++S+SLK++C
Sbjct: 784 PEEEGYDDEYQVEELDLGAADYITPTFVT-FVNEWDKLASSPSLTETFALSSSESLKEAC 842

Query: 539 TTLIELLGMSPVENSGTPTSSSVHTLMLSGTFL------GGIKVLAKNRMTFAPSTGVTM 592
            +L+E+LGM P+  +  PTS+SVHTL L+G  +         KVLA+ RMT+AP TGVT+
Sbjct: 843 QSLVEVLGMLPLGGTDMPTSNSVHTLNLAGLAVPIGEGEKSSKVLARCRMTYAPGTGVTI 902

Query: 593 ELSVRSPSEEISRIVIGAV 611
           ELSVR+  EE +R+++ A+
Sbjct: 903 ELSVRAEVEEAARLIMAAI 921



>gi|342320945|gb|EGU12883.1| Coatomer subunit gamma [Rhodotorula glutinis ATCC 204091]
          Length = 910

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/612 (58%), Positives = 446/612 (72%), Gaps = 14/612 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSPK+ L+F+AIRTL KLA T P+AV + NLDME LI D NRSVATFAITTLLKTGN
Sbjct: 311 LFLSSPKAALKFSAIRTLAKLAQTHPSAVAAVNLDMEKLINDDNRSVATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+ FMSEISDEFKVIVV+AIR+LCLKFP+KQ VML+FLSGVLRDEGGY+F
Sbjct: 371 EASVDRLMKQISAFMSEISDEFKVIVVNAIRALCLKFPAKQSVMLTFLSGVLRDEGGYDF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVEAIFD++KFI +SKEAALA LCEFIEDCEFTKLSVR+LHLLGVEGPK+P P+KYI
Sbjct: 431 KRAVVEAIFDMIKFIADSKEAALAQLCEFIEDCEFTKLSVRILHLLGVEGPKSPQPSKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRVILEN+IVRAAAVS+LAKFG++  D  VK+SIKVLLTRCLDD DDEVRDRA   
Sbjct: 491 RYIYNRVILENAIVRAAAVSSLAKFGINVADNAVKRSIKVLLTRCLDDVDDEVRDRAAFN 550

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           LKL+ D   A  +V+DDST+SL  LE +L  Y+++  + E+PFD + +PKI+K QA  E 
Sbjct: 551 LKLMQDEPLANTFVRDDSTFSLDTLEARLTSYMADSSALEQPFDFTAVPKISKEQA-LEA 609

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIAAF 360
            +    D   +  + + +S V S ++ + S S         + Q  Y +QL ++PE A++
Sbjct: 610 ARHSRKDAIDSVAMASEASGVASTSAAVPSAS---------ETQSAYEKQLTEVPEFASY 660

Query: 361 GPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPESD 420
           GP+FKS+ KPVELTE ETEYVVS VKH+F E++VFQF V NT++   LENV VVMQP S+
Sbjct: 661 GPVFKSTRKPVELTERETEYVVSAVKHVFAEHVVFQFNVRNTVDAVHLENVVVVMQP-SE 719

Query: 421 EGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXXXX 480
           E  L E+F+IP   L  +    +YV+F R NP  Y  GSF NTL+FL K+ DP T     
Sbjct: 720 EADLTEDFIIPVASLGPNSDGVVYVSFTRNNPSTYATGSFGNTLRFLSKEIDPDT-GEPE 778

Query: 481 XXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSCTT 540
                       +++  +DY+ P+Y + F++ WD +       ETFALTA  SLK +C +
Sbjct: 779 EDGYDDEYSLEELDLGAADYIVPSYAA-FATEWDRLRSGATAQETFALTALDSLKTACDS 837

Query: 541 LIELLGMSPVENSGTPTSSSVHTLMLSGTFL-GGIKVLAKNRMTFAPSTGVTMELSVRSP 599
           LIE+LGM  +  +  PTS +VHTL +SG    GG KVLA+ RMTF    GVTMEL+VR+ 
Sbjct: 838 LIEILGMEALGGTEAPTSPTVHTLNMSGLVAGGGGKVLARARMTFQTGKGVTMELTVRAE 897

Query: 600 SEEISRIVIGAV 611
            E  +++VI A+
Sbjct: 898 EEGAAQLVINAI 909



>gi|336364818|gb|EGN93172.1| hypothetical protein SERLA73DRAFT_116318 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336389926|gb|EGO31069.1| hypothetical protein SERLADRAFT_353728 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 927

 Score =  676 bits (1744), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 351/613 (57%), Positives = 443/613 (72%), Gaps = 18/613 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSPKS L+FAA RTL  LA++ P +V +CN+D+E+LITD NRSVAT+AITTLLKTGN
Sbjct: 329 LFLSSPKSVLKFAATRTLASLALSHPASVATCNVDLESLITDSNRSVATYAITTLLKTGN 388

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQITGFMSEISDEFKVI+VDAIRSLCLKFP K   ML+FLSGVLRDEGGY+F
Sbjct: 389 EASVDRLMKQITGFMSEISDEFKVIIVDAIRSLCLKFPLKHASMLAFLSGVLRDEGGYDF 448

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVEAIFD++KFI E KE AL+HLCEFIEDCEFTKLSVR+LHLLG EGPK P PTKYI
Sbjct: 449 KRAVVEAIFDMIKFIGECKEQALSHLCEFIEDCEFTKLSVRILHLLGAEGPKAPQPTKYI 508

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LEN+ VRAAAVS+LAKFGV+A D  +++SI VLL RCLDD DDEVRDRA ++
Sbjct: 509 RFIYNRVVLENATVRAAAVSSLAKFGVNAVDAGLRRSIGVLLNRCLDDVDDEVRDRAAMF 568

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           L+++ +   A+ Y+K++S +SLAALE +LV YV++P++ + PFD + IPKI++AQ  A+ 
Sbjct: 569 LRVLKEATLADAYIKEESVFSLAALESKLVAYVNDPDAIQTPFDATSIPKISRAQLAADA 628

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIAAF 360
            +P + D     TI   S+           TS    P    + Q  Y QQL ++PE+A++
Sbjct: 629 TRPSTLD-----TIAVPSAK---------KTSASPPPPTAAETQSAYLQQLSEVPELASY 674

Query: 361 GPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPESD 420
           GP+  SS KPV+LTE+ETEY V+CVKH+FKE++VFQF V+NTL D +LE V+V+MQP++D
Sbjct: 675 GPVLNSSTKPVQLTETETEYQVTCVKHIFKEHVVFQFNVSNTLPDTVLEQVSVIMQPQTD 734

Query: 421 EGTLVEEFVIPATKLPYD-QPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXXX 479
            G L E+F+IP   L     PS +YV+F R  PEEYT  SF   LKF+ K+ DPST    
Sbjct: 735 SG-LTEDFIIPVPSLASSTSPSIVYVSFTRDTPEEYTTASFQCILKFISKELDPSTGEPE 793

Query: 480 XXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSCT 539
                              DY+ P+Y S FS+ WD +       ETF+L +  SLK +C 
Sbjct: 794 EEGYEDEYQLEEVELSAGGDYIIPSY-STFSAEWDRLRSGATATETFSLGSMDSLKAACD 852

Query: 540 TLIELLGMSPVENSGTPTSSSVHTLMLSGTFL-GGIKVLAKNRMTFAPSTGVTMELSVRS 598
           ++IE+L M  +  + TP+SSSVHT+ LSG    GG KVL + RMTFA  TGVT+EL VR+
Sbjct: 853 SIIEVLNMEALGGTETPSSSSVHTMQLSGLVTGGGGKVLVRCRMTFAKGTGVTLELGVRA 912

Query: 599 PSEEISRIVIGAV 611
             E    +V+ AV
Sbjct: 913 EKENACNLVLAAV 925



>gi|449551339|gb|EMD42303.1| hypothetical protein CERSUDRAFT_110824 [Ceriporiopsis subvermispora
           B]
          Length = 926

 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/613 (57%), Positives = 451/613 (73%), Gaps = 20/613 (3%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSPKSTL+FAA RTL  LA+T P +V +CN+D+E+LI+DQNRSVAT+AITTLLKTGN
Sbjct: 330 LFLSSPKSTLKFAATRTLASLAVTHPASVATCNVDLESLISDQNRSVATYAITTLLKTGN 389

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQIT FMSEISDEFKVI+VDAIRSLCLKFP+K   MLSF SGVLRDEGGY+F
Sbjct: 390 EASVDRLMKQITTFMSEISDEFKVIIVDAIRSLCLKFPAKHAAMLSFFSGVLRDEGGYDF 449

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVEA+FD++KFI + KE AL+HLCEFIEDCEFTKLSVR+LHLLG EGPK P PTKYI
Sbjct: 450 KRAVVEAMFDMIKFITDCKEQALSHLCEFIEDCEFTKLSVRILHLLGAEGPKAPNPTKYI 509

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LEN+ VRAAAVS+LAKFG+   D ++ KSI VLL RCLDD DDEVRDRA +Y
Sbjct: 510 RFIYNRVVLENATVRAAAVSSLAKFGLEKLDTKLSKSINVLLNRCLDDVDDEVRDRAAMY 569

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           LK+  + E  + Y+K++S +SL+ALE +LV Y+S+P++ E+PFD+S IPKI++AQA  E 
Sbjct: 570 LKVYKEPELVQPYIKEESIFSLSALESKLVSYISDPDALEEPFDVSSIPKISRAQAAKEV 629

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIAAF 360
            +P S +     TIG  SS          S +    PT   + Q  Y+QQL ++PE A++
Sbjct: 630 ARPSSLE-----TIGVPSS----------SKAPTPPPTTAAETQSAYAQQLAEVPEFASY 674

Query: 361 GPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPESD 420
           GP+  SS KP +LTESETEY VSCVKH+FKE++VFQF V+NT+ D +LE V++VMQP++D
Sbjct: 675 GPVLSSSTKPQQLTESETEYQVSCVKHIFKEHVVFQFNVSNTIPDTVLEQVSIVMQPQTD 734

Query: 421 EGTLVEEFVIPATKL-PYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXXX 479
            G L E+F+IP   L   + P  +Y +F R +PEE+ + SFS  LKF+ K+ DPST    
Sbjct: 735 SG-LTEDFIIPLPSLSSANSPGIVYFSFTRDSPEEFQMASFSCILKFVSKELDPSTGEPE 793

Query: 480 XXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSCT 539
                         E+   DYV PTY++ F+S WD +      +ETFAL++ +SLK +C 
Sbjct: 794 DEGYEDEYQLEET-ELAAGDYVVPTYVT-FASEWDRLRGGASAMETFALSSMESLKAACI 851

Query: 540 TLIELLGMSPVENSGTPTSSSVHTLMLSGTFL-GGIKVLAKNRMTFAPSTGVTMELSVRS 598
           ++IE+L M P+  +  P SSSVHTL LSG    GG K+L + RMTF+ + GVT+EL VR+
Sbjct: 852 SIIEILNMQPLGGTEEPQSSSVHTLQLSGLVAGGGGKILVRCRMTFSKTQGVTLELGVRA 911

Query: 599 PSEEISRIVIGAV 611
             +E   +VI A+
Sbjct: 912 EKQEACNLVIAAI 924



>gi|501310786|dbj|GAC99544.1| clathrin binding protein [Pseudozyma hubeiensis SY62]
          Length = 943

 Score =  675 bits (1741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 359/616 (58%), Positives = 449/616 (72%), Gaps = 14/616 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSPKSTL+FAAIRTL KLA TQP AVQ+CN+DMENLITD NRS+AT+AITTLLKTGN
Sbjct: 336 LFLSSPKSTLKFAAIRTLAKLAQTQPAAVQTCNVDMENLITDTNRSIATYAITTLLKTGN 395

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFMSEISDEFKVIVVDAIRSLCLKFPSKQ VMLSFL+GVLRDEGG+E+
Sbjct: 396 EASVDRLMKQISGFMSEISDEFKVIVVDAIRSLCLKFPSKQTVMLSFLAGVLRDEGGFEY 455

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVEAIFD++KFI E KE ALAHLCEFIEDCEFTKLSVR+LHLLGVEGPK P P KYI
Sbjct: 456 KRAVVEAIFDMIKFIGECKETALAHLCEFIEDCEFTKLSVRILHLLGVEGPKMPQPHKYI 515

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRVILEN+IVRAAAVS+LAKFG++  D  +   IKVLL RCLDD DDEVRDRA +Y
Sbjct: 516 RYIYNRVILENAIVRAAAVSSLAKFGIA--DKSLNARIKVLLERCLDDVDDEVRDRAAMY 573

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           L+++ ++  A K V D+S+Y L ALE  L  YVS+P SS   FD++ IP++T+ ++  E 
Sbjct: 574 LRVLRESRLAAKVVNDESSYKLTALESALQSYVSDPSSSTSVFDITKIPRVTREESRQEA 633

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIAAF 360
           L+ +S   AS      SS +V + ++N  STS+ ++    VD + +Y++QL ++P+ A +
Sbjct: 634 LRAKSEATASVAMAADSSQSVHAASNNGASTSKASS----VDSETLYAKQLAEVPQFADY 689

Query: 361 GPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPESD 420
           GP+ KSS KPVELTESETEYVVS VKH+F +++V Q+ VTNTL D +LENV VV+   ++
Sbjct: 690 GPVLKSSTKPVELTESETEYVVSAVKHVFADHVVIQYNVTNTLPDTVLENVAVVVGGAAE 749

Query: 421 EGTLVEEFVIPATKLPYDQPSS-IYVAFKR-TNPEEYTLGSFSNTLKFLVKDCDPSTXXX 478
            G L E+F++    L    PS  +YV+F R     +Y   + SNTL+F+ K+ DPS+   
Sbjct: 750 AG-LREDFIVTVPALSAQSPSGVVYVSFTREGGATDYVQATLSNTLRFVSKEVDPSS-GE 807

Query: 479 XXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSC 538
                         +E+  +DY+ P Y ++F   WD +       ETFALTA   LK +C
Sbjct: 808 PEEEGYDDEYQTEELELGVADYIKPVY-ANFGEEWDQLASASTATETFALTALDGLKTAC 866

Query: 539 TTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLG---GIKVLAKNRMTFAPSTGVTMELS 595
            TLIELLGM P+  + +P S+SVHTL LSG        +K L + RMTFA   GVTMELS
Sbjct: 867 DTLIELLGMMPLGGTESPASTSVHTLNLSGAVASPGKAVKALTRCRMTFAAGQGVTMELS 926

Query: 596 VRSPSEEISRIVIGAV 611
           VR+ SE   ++V+ A+
Sbjct: 927 VRAESEAACQLVMSAI 942



>gi|358056622|dbj|GAA97462.1| hypothetical protein E5Q_04141 [Mixia osmundae IAM 14324]
          Length = 1508

 Score =  675 bits (1741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/602 (58%), Positives = 446/602 (74%), Gaps = 13/602 (2%)

Query: 2   FLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGNE 61
           FL+S KSTL+FAAIRTL++LA   P  V +CNLDME LI D NRSVAT+AITTLLKTGNE
Sbjct: 315 FLASTKSTLKFAAIRTLSRLAQVHPGPVSACNLDMEKLINDDNRSVATYAITTLLKTGNE 374

Query: 62  ASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEFK 121
           ASVDRLMKQI+ FM EISDEFKVIVV+AIRSLCLKFP+KQ VML+FLSGVLRDEGGY+FK
Sbjct: 375 ASVDRLMKQISSFMGEISDEFKVIVVNAIRSLCLKFPAKQSVMLTFLSGVLRDEGGYDFK 434

Query: 122 RAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYIR 181
           RAVVEAIFD++KFI +SKEAALA LCEFIEDCEFTKLSVR+LHLLGVEGPK P PTKYIR
Sbjct: 435 RAVVEAIFDMIKFIGDSKEAALAQLCEFIEDCEFTKLSVRILHLLGVEGPKAPQPTKYIR 494

Query: 182 YIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILYL 241
           YIYNRV+LEN+IVRAAAVS+LAKFGV+  D  VK SI+VLL RCLDD DDEVRDRA LYL
Sbjct: 495 YIYNRVVLENAIVRAAAVSSLAKFGVNVADTTVKTSIRVLLRRCLDDVDDEVRDRAALYL 554

Query: 242 KLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAENL 301
           K++D++  AE +V+D+ST+S+AALE QL  Y+S P   + PFD+  +P+I++ QA  E L
Sbjct: 555 KVLDEDLLAEAFVRDESTFSIAALEDQLATYISQPAGLDSPFDVGAVPRISREQAREEAL 614

Query: 302 KPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIAAFG 361
           + R         IG +S+A     ++I ++   A      + Q +Y+QQL ++PE+A++G
Sbjct: 615 RSR-----KEMPIGDASAA----QAHIGTSDAIAPAATAAESQSLYAQQLAEVPELASYG 665

Query: 362 PLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPESDE 421
            + KSS KP+EL+ESETEYVV+ VKH+F E++VFQF + NTL D +LENV+V+M   + E
Sbjct: 666 KVLKSSSKPIELSESETEYVVTAVKHVFSEHIVFQFNIRNTLQDTILENVSVIMTATT-E 724

Query: 422 GTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXXXXX 481
             LVE+F+IP  KL    P+ +YV+F R +  ++ + SFS +LKF+ K+ DPS+      
Sbjct: 725 THLVEDFIIPIDKLDATTPAVVYVSFSRASATDFAMASFSCSLKFVSKEVDPSS-GEPEE 783

Query: 482 XXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSCTTL 541
                      IE+   DY+ P+Y + F S W+ +       ETFAL+A +SLK +C TL
Sbjct: 784 EGYEDEYQVEEIELGAGDYIVPSY-ATFKSEWERLSTGATATETFALSALESLKAACDTL 842

Query: 542 IELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIK-VLAKNRMTFAPSTGVTMELSVRSPS 600
           IE+L M P+  +  PTSSSVHTL LSG   GG   VLA++RMTF+   GVTMELSVR+  
Sbjct: 843 IEILNMEPLGGTEIPTSSSVHTLTLSGLVCGGGGPVLARSRMTFSSGNGVTMELSVRAEK 902

Query: 601 EE 602
           EE
Sbjct: 903 EE 904



>gi|472582634|gb|EMS20312.1| coatomer protein complex, subunit gamma [Rhodosporidium toruloides
           NP11]
          Length = 910

 Score =  674 bits (1739), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/612 (58%), Positives = 445/612 (72%), Gaps = 14/612 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSPK+ L+F+AIRTL KLA T P AV + NLDME LI D NRSVATFAITTLLKTGN
Sbjct: 311 LFLSSPKAALKFSAIRTLAKLAQTHPNAVAAVNLDMEKLINDDNRSVATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+ FMSEISDEFKVIVV+AIR+LCLKFP+KQ VML+FLSGVLRDEGGY+F
Sbjct: 371 EASVDRLMKQISAFMSEISDEFKVIVVNAIRALCLKFPAKQSVMLTFLSGVLRDEGGYDF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVEAIFD++KFI +SKEAALA LCEFIEDCEFTKLSVR+LHLLGVEGPK+P P+KYI
Sbjct: 431 KRAVVEAIFDMIKFIADSKEAALAQLCEFIEDCEFTKLSVRILHLLGVEGPKSPQPSKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRVILEN+IVRAAAVS+LAKFG++  D  VK+SIKVLLTRCLDD DDEVRDRA   
Sbjct: 491 RYIYNRVILENAIVRAAAVSSLAKFGINVADNAVKRSIKVLLTRCLDDVDDEVRDRAAFN 550

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           LKL+ D   A  +V+DDST+SL  LE +L  Y+++  + E+PFD + +PKI+K QA  E 
Sbjct: 551 LKLMQDEPLANTFVRDDSTFSLDTLEARLTSYMADSSALEQPFDFTAVPKISKEQA-LEA 609

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIAAF 360
            +    D   +  + + +S V S ++ + S S         + Q  Y +QL ++PE A++
Sbjct: 610 ARHSRKDAIDSVAMASEASGVASTSAAVPSAS---------ETQSAYEKQLTEVPEFASY 660

Query: 361 GPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPESD 420
           GP+FKS+ KPVELTE ETEYVVS VKH+F E++VFQF V NT++   LENV VVMQP S+
Sbjct: 661 GPVFKSTRKPVELTERETEYVVSAVKHVFAEHVVFQFNVRNTVDAVHLENVVVVMQP-SE 719

Query: 421 EGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXXXX 480
           E  L E+F+IP   L  +    +YV+F R NP  Y  GSF NTL+FL K+ DP T     
Sbjct: 720 EADLTEDFIIPVASLGPNSDGVVYVSFTRNNPSTYATGSFGNTLRFLSKEIDPDT-GEPE 778

Query: 481 XXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSCTT 540
                       +++  +DY+ P+Y + F++ WD +       ETFALTA  SLK +C +
Sbjct: 779 EDGYDDEYSLEELDLGAADYIVPSYAA-FATEWDRLRSGATAQETFALTALDSLKTACDS 837

Query: 541 LIELLGMSPVENSGTPTSSSVHTLMLSGTFL-GGIKVLAKNRMTFAPSTGVTMELSVRSP 599
           +IE+LGM  +  +  PTS +VHTL +SG    GG KVLA+ RMTF    GVTMEL+VR+ 
Sbjct: 838 VIEILGMEALGGTEAPTSPTVHTLNMSGLVAGGGGKVLARARMTFQTGKGVTMELTVRAE 897

Query: 600 SEEISRIVIGAV 611
            E  +++V+ A+
Sbjct: 898 QEGAAQLVVNAI 909



>gi|443896681|dbj|GAC74025.1| vesicle coat complex COPI, gamma subunit [Pseudozyma antarctica
           T-34]
          Length = 946

 Score =  672 bits (1735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/616 (58%), Positives = 451/616 (73%), Gaps = 13/616 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSPKSTL+FAAIRTL KLA TQP AVQ+CN+DMENLITD NRS+AT+AITTLLKTGN
Sbjct: 338 LFLSSPKSTLKFAAIRTLAKLAQTQPAAVQTCNVDMENLITDTNRSIATYAITTLLKTGN 397

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFMSEISDEFKVIVVDAIRSLCLKFPSKQ VMLSFL+GVLRDEGG+E+
Sbjct: 398 EASVDRLMKQISGFMSEISDEFKVIVVDAIRSLCLKFPSKQTVMLSFLAGVLRDEGGFEY 457

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVEAIFD++KFI + KE ALAHLCEFIEDCEFTKLSVR+LHLLGVEGPK P P KYI
Sbjct: 458 KRAVVEAIFDMIKFIGDCKETALAHLCEFIEDCEFTKLSVRILHLLGVEGPKMPQPHKYI 517

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRVILEN+IVRAAAVS+LAKFG++  D  +   IKVLL RCLDD DDEVRDRA +Y
Sbjct: 518 RYIYNRVILENAIVRAAAVSSLAKFGIA--DKSLNARIKVLLERCLDDVDDEVRDRAAMY 575

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           L+++ ++  A K V D+S+Y L ALE  L  YVS+P SS   FD++ IP++T+ +A  E 
Sbjct: 576 LRVLRESGLAAKVVNDESSYKLTALESALQSYVSDPSSSTSGFDITKIPRVTREEARQEA 635

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIAAF 360
           L+ +S   AS      SS +V + ++   STS+ A+     D + +Y+QQL  +P+ A +
Sbjct: 636 LRAKSEATASVAMAADSSQSVHANSNKGASTSKVASSG---DSESLYAQQLAAVPQFAEY 692

Query: 361 GPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPESD 420
           GP+ KSS K VELTESETEYVVS VKH+F E++V Q+ VTNTL D +LENV VV+   ++
Sbjct: 693 GPVLKSSSKAVELTESETEYVVSAVKHVFAEHVVIQYNVTNTLPDTVLENVAVVVGGAAE 752

Query: 421 EGTLVEEFVIPATKLPYDQPS-SIYVAFKR-TNPEEYTLGSFSNTLKFLVKDCDPSTXXX 478
            G L E+F++    L    PS ++YV+F R     +Y   + SNTL+F+ K+ DPS+   
Sbjct: 753 AG-LHEDFIVTVPALSAQNPSGTVYVSFTREGGATDYAQATLSNTLRFVSKEVDPSS-GE 810

Query: 479 XXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSC 538
                         +E+  +DYV P Y ++FS  WD +       ETFALTA  SLK +C
Sbjct: 811 PEEEGYDDEYQTEELELGVADYVKPVY-ANFSEEWDKLASAPSATETFALTALDSLKTAC 869

Query: 539 TTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLG---GIKVLAKNRMTFAPSTGVTMELS 595
            TLIEL+GM P+  + +P+S+SVHTL LSG        +K LA+ RMTFA   GVTMELS
Sbjct: 870 DTLIELMGMMPLGGTESPSSTSVHTLTLSGAVANPGKPVKALARCRMTFASGQGVTMELS 929

Query: 596 VRSPSEEISRIVIGAV 611
           VR+ S+E  ++++ A+
Sbjct: 930 VRADSDEACQLIMSAI 945



>gi|403161790|ref|XP_003322109.2| hypothetical protein PGTG_03646 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|375171927|gb|EFP77690.2| hypothetical protein PGTG_03646 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 930

 Score =  672 bits (1734), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/612 (58%), Positives = 449/612 (73%), Gaps = 11/612 (1%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSPK  L+F AIRTL KLA+T P  VQ+CNLDME LI D NR VATFAITTLLKTGN
Sbjct: 328 LFLSSPKGALKFCAIRTLAKLALTHPQPVQACNLDMERLINDDNRGVATFAITTLLKTGN 387

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+ FMSEISDEFKV +V+AIR+LCLKFP+KQ VML+FLSG+LRDEGGY+F
Sbjct: 388 EASVDRLMKQISAFMSEISDEFKVTIVNAIRALCLKFPAKQAVMLNFLSGILRDEGGYDF 447

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVEAIFD++KFI ESKE ALA LCEFIEDCEFTKLSVR+LHLLG+EGPK   P+KYI
Sbjct: 448 KRAVVEAIFDMIKFIGESKETALAQLCEFIEDCEFTKLSVRILHLLGIEGPKALHPSKYI 507

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRVILEN+IVRAAAVS+LAKFGV+  DP VK SIKVLLTRCLDD DDEVRDRA LY
Sbjct: 508 RYIYNRVILENAIVRAAAVSSLAKFGVNVPDPRVKASIKVLLTRCLDDVDDEVRDRAALY 567

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           LK++D+   AEK+VKD+ST SLA LE +L  Y+S  ESS+ PF++S IP+I++ QA  E 
Sbjct: 568 LKVLDEEPLAEKFVKDESTISLATLESKLTTYISQKESSQAPFEISSIPRISREQACQEA 627

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIAAF 360
           L+ R    AS+   G S++   S  ++  S    A+ +   + Q+ Y+ QL  +PE + +
Sbjct: 628 LRAR--QEASSDMAGFSNA---SKTTDKQSVGPAASASTNAESQREYATQLSAVPEFSTY 682

Query: 361 GPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPESD 420
           G +FKSS KP+ LTE ETEYVVS VKH+F E++VFQF +TNTL D +LE V+V+  P  +
Sbjct: 683 GKVFKSSAKPIPLTEHETEYVVSVVKHIFAEHVVFQFNLTNTLPDTILEQVSVLTNP-PE 741

Query: 421 EGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXXXX 480
           EG L E+F+IP  K+  ++P  IYV++ R++PE Y LGSF+ TLKF+ K+ DP       
Sbjct: 742 EG-LTEDFIIPIPKMS-NEPGIIYVSYTRSSPENYALGSFNCTLKFISKEVDP-ISGEPE 798

Query: 481 XXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSCTT 540
                       +E+   DY+ PTY++ F++ WD +       ETF L+A KSLK +C T
Sbjct: 799 EEGYEDEYQIEDVELGVGDYIIPTYLT-FTTEWDRLRTGATATETFQLSALKSLKSACDT 857

Query: 541 LIELLGMSPVENSGTPTSSSVHTLMLSGTFLGG-IKVLAKNRMTFAPSTGVTMELSVRSP 599
           LIELL M P+  S  P+S++VHTL L+G   GG   +L + RMTF+   GVT+E+S R+ 
Sbjct: 858 LIELLNMEPLGGSENPSSTTVHTLQLAGILCGGEGNILVRTRMTFSVDQGVTIEMSARAE 917

Query: 600 SEEISRIVIGAV 611
             +  ++V+ A+
Sbjct: 918 KPKAVQLVMSAI 929



>gi|403416958|emb|CCM03658.1| predicted protein [Fibroporia radiculosa]
          Length = 927

 Score =  672 bits (1733), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/615 (55%), Positives = 452/615 (73%), Gaps = 23/615 (3%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSPKSTL+FAA RTL  LA+  P +V +CN+D+ENLI+DQNRSVAT+AITTLLKTGN
Sbjct: 330 LFLSSPKSTLKFAATRTLASLAINHPASVAACNMDLENLISDQNRSVATYAITTLLKTGN 389

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQITGFMSEISDEFKVI+VDAIRSLCLKFP+K   MLSFLSGVLRDEGGY+F
Sbjct: 390 EASVDRLMKQITGFMSEISDEFKVIIVDAIRSLCLKFPTKHASMLSFLSGVLRDEGGYDF 449

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVEA+FD++KFI E KE AL+HLCEFIEDCEFTKLSVR+LHLLGVEGPK+P PTKYI
Sbjct: 450 KRAVVEAMFDMIKFIGECKEQALSHLCEFIEDCEFTKLSVRILHLLGVEGPKSPQPTKYI 509

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+ VRAAAV++LAKFG++  D ++  S+ VLL RCLDD DDEVRDRA +Y
Sbjct: 510 RYIYNRVVLENATVRAAAVASLAKFGLNGLDEKLSNSVNVLLRRCLDDVDDEVRDRAAMY 569

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           LK+  +      Y+K+DSTYSL+ALE +LV Y+S+P+++E+PFD++ IPKI++ QA  E 
Sbjct: 570 LKVYQEPPLVTTYIKEDSTYSLSALESKLVSYMSDPDAAEQPFDVASIPKISREQAAKEV 629

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTP--GVDQQQVYSQQLEQIPEIA 358
            +P S +     TIG  S++  +           ATP P    + Q +Y+QQL  +PE A
Sbjct: 630 ARPSSLE-----TIGVPSTSKAA-----------ATPPPQTAAETQSIYAQQLSDVPEFA 673

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
           ++GP+  SS KP +LTE+ETEY VSCVKH+FKE+++FQF V+NT+ D +LE V+V MQ +
Sbjct: 674 SYGPVLNSSAKPTQLTEAETEYQVSCVKHIFKEHIIFQFNVSNTIADTVLEQVSVAMQSQ 733

Query: 419 SDEGTLVEEFVIPATKL-PYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXX 477
           +D G L E+ +I  + L   + P  +YV+F R +P+E+ L SF  TLKF+ K+ DPST  
Sbjct: 734 ADAG-LTEDGIIQISSLSAANSPGLVYVSFTRDSPDEFALASFQCTLKFVSKEVDPSTGE 792

Query: 478 XXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDS 537
                           E+   DYV P+Y++ F+S WD +       ETF+L+A +S+K +
Sbjct: 793 PEEDGYEDEYQLEEA-ELTAGDYVVPSYVT-FASEWDRLRGGASATETFSLSAMESMKAA 850

Query: 538 CTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGI-KVLAKNRMTFAPSTGVTMELSV 596
           C ++IE+L M P+  +  P S +VHTL LSG   GG  KVL + RM ++ + GVT+EL+V
Sbjct: 851 CDSIIEILNMQPLGGTEDPQSPTVHTLQLSGLVSGGCGKVLVRCRMAYSKAQGVTLELAV 910

Query: 597 RSPSEEISRIVIGAV 611
           R+  + + ++V+ A+
Sbjct: 911 RAEQDSVCQLVVSAI 925



>gi|402219892|gb|EJT99964.1| coatomer gamma subunit [Dacryopinax sp. DJM-731 SS1]
          Length = 922

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/613 (57%), Positives = 444/613 (72%), Gaps = 19/613 (3%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           +FLSS K TL+FAAIRTL+ LA+T P +V +CN+DMENLITD NRS+AT+AITTLLKTGN
Sbjct: 326 VFLSSSKPTLKFAAIRTLSALALTHPASVATCNVDMENLITDSNRSIATYAITTLLKTGN 385

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFM+EISDEFKVIVVDAIRSLCLKFP+KQ  ML+FLSGVLRDEGGY+F
Sbjct: 386 EASVDRLMKQISGFMTEISDEFKVIVVDAIRSLCLKFPAKQASMLTFLSGVLRDEGGYDF 445

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVEAIFD++K+I + KE ALAHLCEFIEDCEFTKLSVR+LHLLG+EGPKTP PTKYI
Sbjct: 446 KRAVVEAIFDMIKYIQDCKEVALAHLCEFIEDCEFTKLSVRILHLLGIEGPKTPQPTKYI 505

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAVS+LAKFG    D  VKKS+ VLL RCLDD DDEVRDRA LY
Sbjct: 506 RYIYNRVVLENAIVRAAAVSSLAKFGAVVSDLAVKKSVGVLLRRCLDDVDDEVRDRAALY 565

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           L  +DD   AEKYVKDDS +SL ALE +LV YV++ +++E+PFD+S IP +++ QA  E 
Sbjct: 566 LHTLDDELLAEKYVKDDSVFSLGALEAKLVVYVNDADAAEEPFDVSSIPTVSREQAFQET 625

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIAAF 360
            +P S D  +  T+  ++       +   + S              Y++QL  IPE A +
Sbjct: 626 ARPSSLDTIAAPTVKAATGPAPPAPTAAQTKS-------------AYAEQLAGIPEFAEY 672

Query: 361 GPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPESD 420
           G +  SS KP  LTESETEY+V+ VKH+FKE++VFQF V+NTL + +L+ V+ +M   S 
Sbjct: 673 GTVLNSSSKPQSLTESETEYIVTVVKHIFKEHVVFQFNVSNTLPETVLDQVSALMVANS- 731

Query: 421 EGTLVEEFVIPATKL-PYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXXX 479
           EG L E F+IP   L     P  +YV+F R  PEEYTLGSF  +LK++ K+ DP+T    
Sbjct: 732 EG-LTENFIIPIPTLTSATSPGIVYVSFSRDTPEEYTLGSFQTSLKYVSKEVDPAT-GEP 789

Query: 480 XXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSCT 539
                        +E+  +DY+ P Y+ +FS  W+ +G      ETF+L+A  SLK +C 
Sbjct: 790 EEEGYEDEYQVEEVELGAADYIVPNYV-NFSQEWERLGHGATATETFSLSALDSLKAACD 848

Query: 540 TLIELLGMSPVENSGTPTSSSVHTLMLSGTFL-GGIKVLAKNRMTFAPSTGVTMELSVRS 598
           +LIE+L M PV  + TP S+SVHTL LSG    GG KVLA++RMT++   GVT+ELSVR+
Sbjct: 849 SLIEVLNMEPVGGTETPASTSVHTLNLSGLVTGGGGKVLARSRMTYSAGQGVTLELSVRA 908

Query: 599 PSEEISRIVIGAV 611
             E   ++VI A+
Sbjct: 909 EKESACQLVISAI 921



>gi|71004498|ref|XP_756915.1| hypothetical protein UM00768.1 [Ustilago maydis 521]
 gi|46095907|gb|EAK81140.1| hypothetical protein UM00768.1 [Ustilago maydis 521]
          Length = 942

 Score =  669 bits (1726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/616 (58%), Positives = 449/616 (72%), Gaps = 14/616 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSPKSTL+FAAIRTL KLA TQP AVQ+CN+DMENLITD NRS+AT+AITTLLKTGN
Sbjct: 335 LFLSSPKSTLKFAAIRTLAKLAQTQPAAVQTCNVDMENLITDTNRSIATYAITTLLKTGN 394

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+ FMSEISDEFKVIVVDAIRSLCLKFPSKQ VML+FL+GVLRDEGG+E+
Sbjct: 395 EASVDRLMKQISSFMSEISDEFKVIVVDAIRSLCLKFPSKQTVMLTFLAGVLRDEGGFEY 454

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVEAIFD++KFI E KE ALAHLCEFIEDCEFTKLSVR+LHLLGVEGPK P P KYI
Sbjct: 455 KRAVVEAIFDMIKFIGECKETALAHLCEFIEDCEFTKLSVRILHLLGVEGPKMPQPHKYI 514

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRVILEN+IVRAAAVS+LAKFG++  D  +   IKVLL RCLDD DDEVRDRA +Y
Sbjct: 515 RYIYNRVILENAIVRAAAVSSLAKFGIA--DKSLNTRIKVLLERCLDDVDDEVRDRAAMY 572

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           L+++ ++  A K V D+S+Y L ALE  L  YVS+P SS   FD++ IP+IT+ +A  E 
Sbjct: 573 LRVLRESRLAAKVVNDESSYKLTALESALQSYVSDPSSSTSGFDITRIPRITREEARQEA 632

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIAAF 360
           L+ +S   AS      +S +V  I++N  STS+ A+    +D   +Y++QL ++P+ A +
Sbjct: 633 LRAKSEATASVAMAADNSQSV-HISNNGASTSKAAS---SLDSDTLYAKQLAEVPQFADY 688

Query: 361 GPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPESD 420
           GP+ KSS KPVELTESETEYVVS VKH+F +++V Q+ +TNTL D +LENV VV+   ++
Sbjct: 689 GPVLKSSSKPVELTESETEYVVSAVKHIFADHVVVQYNITNTLPDTVLENVAVVVGGAAE 748

Query: 421 EGTLVEEFVIPATKLPYDQPSS-IYVAFKR-TNPEEYTLGSFSNTLKFLVKDCDPSTXXX 478
            G L E+F++    L    PS  +YV+F R     +Y  G+ SNTL+F+ K+ DPS+   
Sbjct: 749 AG-LREDFIVTVPALSAQNPSGVVYVSFTREGGATDYAQGTLSNTLRFVSKEVDPSS-GE 806

Query: 479 XXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSC 538
                         +E+  SDY+ P Y ++F   WD +      +ETFALTA   LK +C
Sbjct: 807 PEEEGYDDEYQTEELELAVSDYIKPVY-ANFGEEWDKLASAPAAIETFALTALDGLKTAC 865

Query: 539 TTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLG---GIKVLAKNRMTFAPSTGVTMELS 595
            TLIELLGM P+  + +P S+SVHTL LSG        IK L + RMTFA   GVTMELS
Sbjct: 866 DTLIELLGMMPLGGTESPASTSVHTLNLSGAVASPGKPIKALTRCRMTFAAGQGVTMELS 925

Query: 596 VRSPSEEISRIVIGAV 611
           VR+ S+   ++V+ A+
Sbjct: 926 VRAESDAACQLVMSAI 941



>gi|392597822|gb|EIW87144.1| coatomer subunit gamma [Coniophora puteana RWD-64-598 SS2]
          Length = 926

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/614 (56%), Positives = 439/614 (71%), Gaps = 21/614 (3%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSPK  L+FAA RTL  LA+T P++V +CN+D+ENLI D NRSVAT+AITTLLKTGN
Sbjct: 329 LFLSSPKPVLKFAATRTLASLALTHPSSVATCNVDLENLIADSNRSVATYAITTLLKTGN 388

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQITGFMSEISDEFKVI+VDAIRSLCLKFP+K V ML+FLSGVLRDEGGY+F
Sbjct: 389 EASVDRLMKQITGFMSEISDEFKVIIVDAIRSLCLKFPAKHVSMLAFLSGVLRDEGGYDF 448

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVEAIFD++KFI E KE AL+HLCEFIEDCEFTKLSVR+L+LLG+EGPK P PTKYI
Sbjct: 449 KRAVVEAIFDMIKFIGECKEQALSHLCEFIEDCEFTKLSVRILYLLGIEGPKAPQPTKYI 508

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LEN+ VRAAAV++LAKFGV+  D  +++S+ +LL RCLDD DDEVRDRA +Y
Sbjct: 509 RFIYNRVVLENATVRAAAVASLAKFGVNGSDAALRRSVTILLNRCLDDVDDEVRDRAAMY 568

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           LK+  +   A+ YVK+DS +SLAALE +LV YV++P++++KPFD S IPKI++AQ  AE+
Sbjct: 569 LKVFKETPLADAYVKEDSVFSLAALESKLVSYVNDPDATQKPFDASSIPKISRAQLAAES 628

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTP--GVDQQQVYSQQLEQIPEIA 358
            +P + D  +  T                S   + +P P    + Q  Y QQL +I E  
Sbjct: 629 TRPSTLDTIAAPT----------------SRKTEVSPPPPTAAETQSAYVQQLAEISEFT 672

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
            +GP+  SS KP +LTE+ETEY V+CVKH+FKE++VFQ+ V+NTL + +LE VTVVMQP+
Sbjct: 673 EYGPVLNSSAKPAQLTETETEYQVTCVKHVFKEHVVFQYNVSNTLPETVLEQVTVVMQPQ 732

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXX 478
           ++ G L E+F +P  +L    P  +YV+F R +P EY   SF   LKF+ K+ DPST   
Sbjct: 733 TESG-LTEDFSMPVDQLTSAAPGIVYVSFTRDDPSEYVTASFQCILKFVSKEVDPSTGEP 791

Query: 479 XXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSC 538
                               DY+ P+Y S FSS WD +       ETF+L++ +S+K +C
Sbjct: 792 EEDGYEDEYQLEEVELSAGGDYIVPSYAS-FSSEWDRMRSGATATETFSLSSMESIKAAC 850

Query: 539 TTLIELLGMSPVENSGTPTSSSVHTLMLSGTFL-GGIKVLAKNRMTFAPSTGVTMELSVR 597
            ++IE+L M P+  + TP S SVHTL LSG    GG KVL + RMTF+   GVT+EL VR
Sbjct: 851 DSIIEVLNMEPLGGTETPNSQSVHTLQLSGLVAGGGGKVLVRCRMTFSRGQGVTLELGVR 910

Query: 598 SPSEEISRIVIGAV 611
           +  E    +V+ AV
Sbjct: 911 AEQESACALVLAAV 924



>gi|409051967|gb|EKM61443.1| hypothetical protein PHACADRAFT_180560 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 933

 Score =  663 bits (1711), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 348/614 (56%), Positives = 451/614 (73%), Gaps = 20/614 (3%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSPKS+LRFAA RTL  LA+  PTAV +CNL++E LI+D NRSVAT+AITTLLKTGN
Sbjct: 338 LFLSSPKSSLRFAATRTLASLALMHPTAVATCNLELEQLISDANRSVATYAITTLLKTGN 397

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRL+KQITGFMSEISDEF+VI+VDAIRSLCLKFP+K   MLSFLSGVLRDEGGY+F
Sbjct: 398 EASVDRLIKQITGFMSEISDEFRVIIVDAIRSLCLKFPAKHASMLSFLSGVLRDEGGYDF 457

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVEA+FD++KFI + KE AL+HLCEFIEDCEFTKLSVR+LHLLGVEGPK+  P KYI
Sbjct: 458 KRAVVEAMFDMIKFIGDCKEQALSHLCEFIEDCEFTKLSVRILHLLGVEGPKSSQPAKYI 517

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+ VRAAAVS+LAKFG++  D ++ KSIKVLL RCLDD DDEVRDRA +Y
Sbjct: 518 RYIYNRVVLENATVRAAAVSSLAKFGLNGLDEKLSKSIKVLLNRCLDDVDDEVRDRAAMY 577

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           LK+  +   AE YVK++S +SL+ALE +LV Y+S+PE+  +PFD+S IPKI++AQA  E 
Sbjct: 578 LKVYQEPPLAEAYVKEESVFSLSALEAKLVSYISDPEAVAEPFDVSSIPKISRAQAAKEA 637

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIAAF 360
            +P + +     T+G  S+          S +    P    + Q  Y+QQL ++PE A++
Sbjct: 638 SRPSTLE-----TLGAPST----------SRTATPPPPTAAETQSAYAQQLAEVPEFASY 682

Query: 361 GPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPESD 420
           GP+  SS KP +LTE+ETEY VS VKH++KE++VFQF V+NT+ D +LE V+VVMQ + +
Sbjct: 683 GPVLNSSTKPAQLTENETEYQVSVVKHIYKEHVVFQFNVSNTIPDTVLEQVSVVMQAQGE 742

Query: 421 EGTLVEEFVIPATKL-PYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXXX 479
            G L E+F++P  +L   + PS +Y +F R  P+EY +GSFS  LKF+ K+ DPST    
Sbjct: 743 TG-LTEDFLMPIPQLSSSNSPSIMYYSFTRDTPDEYPMGSFSCVLKFVSKEVDPSTGEPE 801

Query: 480 XXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSCT 539
                         E+  +DYV PTY++ F+S WD +     V ETF+L A +SLK +C 
Sbjct: 802 AEGYEDEYQLEDS-ELSAADYVVPTYVT-FASEWDRMRGGVNVTETFSLPAMESLKAACD 859

Query: 540 TLIELLGMSPVENSGTPTSSSVHTLMLSGTFL-GGIKVLAKNRMTFAPSTGVTMELSVRS 598
           ++IE+L M P+  S  P SS+VHTL LSG    GG KVL ++RMT++   GV +EL VR+
Sbjct: 860 SIIEILNMQPLGGSEDPQSSTVHTLQLSGLVAGGGGKVLVRSRMTYSKGQGVALELGVRA 919

Query: 599 PSEEISRIVIGAVV 612
             +E + +V+ A++
Sbjct: 920 EKQESASLVVAAIM 933



>gi|388855134|emb|CCF51265.1| probable coatomer gamma-2 subunit [Ustilago hordei]
          Length = 946

 Score =  662 bits (1709), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/616 (57%), Positives = 445/616 (72%), Gaps = 13/616 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSPKSTL+FAAIRTL KLA TQP AVQ+CN+DMENLITD NRS+AT+AITTLLKTGN
Sbjct: 338 LFLSSPKSTLKFAAIRTLAKLAQTQPAAVQTCNVDMENLITDTNRSIATYAITTLLKTGN 397

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFMSEISDEFKVIVVDAIRSLCLKFPSKQ VMLSFL+GVLRDEGG+E+
Sbjct: 398 EASVDRLMKQISGFMSEISDEFKVIVVDAIRSLCLKFPSKQTVMLSFLAGVLRDEGGFEY 457

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVEAIFD++KFI E KE ALAHLCEFIEDCEFTKLSVR+LHLLGVEGPK P P KYI
Sbjct: 458 KRAVVEAIFDMIKFIGECKETALAHLCEFIEDCEFTKLSVRILHLLGVEGPKMPQPHKYI 517

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRVILEN+IVRAAAVS+LAKFG++  D  +   IKVLL RCLDD DDEVRDRA +Y
Sbjct: 518 RYIYNRVILENAIVRAAAVSSLAKFGIT--DKSLNTRIKVLLERCLDDVDDEVRDRAAMY 575

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           L+++  +  A K V D+S+Y L ALE  L  YVS+P SS   FD+S IP++T+ +A  E 
Sbjct: 576 LRVLRGSRLAAKVVNDESSYKLTALESALQSYVSDPSSSTSGFDISKIPRVTREEARQEA 635

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIAAF 360
           L+ ++   AS      SS +V + ++N    +  +      D + +Y++QL ++P+ A +
Sbjct: 636 LRAKTQATASVAMAADSSQSVHAASNN---GASSSKAASSADSETLYAKQLAEVPQFADY 692

Query: 361 GPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPESD 420
           G + KSS KPVELTESETEYVVS VKH+F E++V Q+ VTNTL D +LENV VV+   ++
Sbjct: 693 GTVLKSSTKPVELTESETEYVVSAVKHIFAEHVVIQYNVTNTLPDTVLENVAVVVGGAAE 752

Query: 421 EGTLVEEFVIPATKLPYDQPSS-IYVAFKR-TNPEEYTLGSFSNTLKFLVKDCDPSTXXX 478
            G L E+F++    L    PS  +YV+F R    E+Y  G+ +NTL+F+ K+ DPS+   
Sbjct: 753 AG-LREDFIVTVPALSAQNPSGQVYVSFTREGGAEDYAQGTLTNTLRFVSKEVDPSS-GE 810

Query: 479 XXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSC 538
                         +E+  +DY+ P Y ++F   WD +       ETFALTA   LK +C
Sbjct: 811 PEEEGYDDEYQTEELELGVADYIKPVY-ANFGEEWDKLASAPTATETFALTALDGLKTAC 869

Query: 539 TTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLG---GIKVLAKNRMTFAPSTGVTMELS 595
            TLIELLGM P+  + +P+S+SVHTL LSG        +K L + RMTFA   GVTMELS
Sbjct: 870 DTLIELLGMMPLGGTESPSSTSVHTLNLSGAVAAPGKAVKALTRCRMTFAAGQGVTMELS 929

Query: 596 VRSPSEEISRIVIGAV 611
           VR+ S+   ++V+ A+
Sbjct: 930 VRAESDAACQLVMSAI 945



>gi|58266952|ref|XP_570632.1| hypothetical protein [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|57226865|gb|AAW43325.1| conserved hypothetical protein [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 921

 Score =  661 bits (1705), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/619 (55%), Positives = 456/619 (73%), Gaps = 24/619 (3%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSPK  ++FAA++TL+KLA T P +V + N++MENLITD NRS+AT+AITTLLKTGN
Sbjct: 319 LFLSSPKPVIKFAAVKTLSKLAQTLPQSVAALNVEMENLITDSNRSIATYAITTLLKTGN 378

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+ FM++I+DEFK+IVVDAIRSLCLKFP+KQ VMLSFLSGVLRDEGGYEF
Sbjct: 379 EASVDRLMKQISSFMTDITDEFKIIVVDAIRSLCLKFPAKQAVMLSFLSGVLRDEGGYEF 438

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K AVVEAIFD++K+I +S++AALAHLCEFIEDCEFTKLSVR+LHLLG+EGPKT  PTK+I
Sbjct: 439 KHAVVEAIFDMIKYIQDSRDAALAHLCEFIEDCEFTKLSVRILHLLGIEGPKTRNPTKFI 498

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN++VRAAAVS+LAKFGV  +DP V KS+ VL+ RCLDD DDEVRDRA +Y
Sbjct: 499 RYIYNRVVLENAVVRAAAVSSLAKFGVCVDDPSVMKSVNVLMRRCLDDVDDEVRDRAAMY 558

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           +K++++   A+  VKD++ +SLA LE QL+ YV +       FD+S +PK+++ QA AE 
Sbjct: 559 IKVLEEKSLADLLVKDEAQFSLANLEEQLMSYVRDNSKHASAFDISAVPKVSREQAHAEM 618

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQ-QQVYSQQLEQIPEIAA 359
            + RS   ++    G S++AV +           A+P P   + Q  Y+ QL  IPE   
Sbjct: 619 AQTRS---SALDVAGPSTAAVIT----------PASPIPSAKEAQSSYAAQLSTIPEFEP 665

Query: 360 FGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPES 419
           +GP+ KSS KP+ELTESETEYVV+ VKH+F++++VFQF V NT+ D +LE V V+MQP  
Sbjct: 666 YGPVLKSSAKPIELTESETEYVVTAVKHVFRKHVVFQFNVANTIPDTVLEQVAVIMQPSP 725

Query: 420 DEGTLVEEFVIPATKLPYD-QPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXX 478
           D G L+E+F+IP   L      + +YV+F R NP+EY  GSF  TLKF+ K+ DPS    
Sbjct: 726 DCG-LIEDFIIPINSLTTQVGQAPVYVSFTRENPQEYAAGSFGCTLKFVSKEVDPSN-GQ 783

Query: 479 XXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSC 538
                         +++  +DY+ PT+++ F + WD +     + ETFAL++S+SL+++C
Sbjct: 784 PEEEGYDDEYQVEELDLGAADYITPTFVT-FVNEWDKLASSPSLTETFALSSSESLREAC 842

Query: 539 TTLIELLGMSPVENSGTPTSSSVHTLMLSGTFL------GGIKVLAKNRMTFAPSTGVTM 592
            +LIE+LGM P+  + TPTS+SVHTL L+G  +         KVLA+ RMT+AP TGVT+
Sbjct: 843 RSLIEVLGMLPLGGTDTPTSNSVHTLNLAGLAIPIADGEKSSKVLARCRMTYAPGTGVTI 902

Query: 593 ELSVRSPSEEISRIVIGAV 611
           EL+VR+  EE +R+++ A+
Sbjct: 903 ELNVRAEEEEAARLIMAAI 921



>gi|323508323|emb|CBQ68194.1| probable coatomer gamma-2 subunit [Sporisorium reilianum SRZ2]
          Length = 943

 Score =  660 bits (1704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/616 (57%), Positives = 447/616 (72%), Gaps = 13/616 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSPKSTL+FAAIRTL KLA TQP AVQ+CN+DMENLITD NRS+AT+AITTLLKTGN
Sbjct: 335 LFLSSPKSTLKFAAIRTLAKLAQTQPAAVQTCNVDMENLITDTNRSIATYAITTLLKTGN 394

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFMSEISDEFKVIVVDAIRSLCLKFPSKQ VML+FL+GVLRDEGG+E+
Sbjct: 395 EASVDRLMKQISGFMSEISDEFKVIVVDAIRSLCLKFPSKQTVMLTFLAGVLRDEGGFEY 454

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVEAIFD++KFI E KE ALAHLCEFIEDCEFTKLSVR+LHLLGVEGPK P P KYI
Sbjct: 455 KRAVVEAIFDMIKFIGECKETALAHLCEFIEDCEFTKLSVRILHLLGVEGPKMPQPHKYI 514

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRVILEN+IVRAAAVS+LAKFG++  D  +   IKVLL RCLDD DDEVRDRA +Y
Sbjct: 515 RYIYNRVILENAIVRAAAVSSLAKFGIA--DKSLNTRIKVLLERCLDDVDDEVRDRAAMY 572

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           L+++ ++  A K V D+S+Y L ALE  L  YVS+P SS   FD++ IP++T+ +A  E 
Sbjct: 573 LRVLRESRLAAKVVNDESSYKLTALESALQSYVSDPSSSTSGFDITKIPRVTREEARQEA 632

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIAAF 360
           L+ +S   AS      SS +V + ++N    +  +      D + +Y++QL ++P+ A +
Sbjct: 633 LRAKSEATASVAMAADSSQSVHNASNN---GASTSKAASSADSETLYAKQLAEVPQFADY 689

Query: 361 GPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPESD 420
           GP+ KSS KPVELTESETEYVVS VKH+F E++V Q+ VTNTL + +LEN+ VV+   ++
Sbjct: 690 GPVLKSSSKPVELTESETEYVVSAVKHIFAEHVVIQYNVTNTLPETVLENIAVVVGGAAE 749

Query: 421 EGTLVEEFVIPATKLPYDQPS-SIYVAFKR-TNPEEYTLGSFSNTLKFLVKDCDPSTXXX 478
            G L E+F++    L    PS ++YV+F R     +Y  G+ SNTL+F+ K+ DPS+   
Sbjct: 750 AG-LREDFIVTVPALSAQNPSGAVYVSFTREGGATDYAQGTLSNTLRFVSKEVDPSS-GE 807

Query: 479 XXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSC 538
                         +E+  +DY+ P Y ++F   WD +       ETFALTA   LK +C
Sbjct: 808 PEEEGYDDEYQTEELELGVADYIKPVY-ANFGEEWDKLASAPTATETFALTALDGLKTAC 866

Query: 539 TTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLG---GIKVLAKNRMTFAPSTGVTMELS 595
            TLIELLGM P+  + +P+S+SVHTL LSG        +K L + RMTFA   GVTMELS
Sbjct: 867 DTLIELLGMMPLGGTESPSSTSVHTLNLSGAVASPGKPVKALTRCRMTFAAGQGVTMELS 926

Query: 596 VRSPSEEISRIVIGAV 611
           VR+ SE   ++V+ A+
Sbjct: 927 VRAESEAACQLVMSAI 942



>gi|134110724|ref|XP_775826.1| hypothetical protein CNBD2360 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50258492|gb|EAL21179.1| hypothetical protein CNBD2360 [Cryptococcus neoformans var.
           neoformans B-3501A]
          Length = 921

 Score =  660 bits (1704), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/619 (55%), Positives = 456/619 (73%), Gaps = 24/619 (3%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSPK  ++FAA++TL+KLA T P +V + N++MENLITD NRS+AT+AITTLLKTGN
Sbjct: 319 LFLSSPKPVIKFAAVKTLSKLAQTLPQSVAALNVEMENLITDSNRSIATYAITTLLKTGN 378

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+ FM++I+DEFK+IVVDAIRSLCLKFP+KQ VMLSFLSGVLRDEGGYEF
Sbjct: 379 EASVDRLMKQISSFMTDITDEFKIIVVDAIRSLCLKFPAKQAVMLSFLSGVLRDEGGYEF 438

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K AVVEAIFD++K+I +S++AALAHLCEFIEDCEFTKLSVR+LHLLG+EGPKT  PTK+I
Sbjct: 439 KHAVVEAIFDMIKYIQDSRDAALAHLCEFIEDCEFTKLSVRILHLLGIEGPKTRNPTKFI 498

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN++VRAAAVS+LAKFGV  +DP V KS+ VL+ RCLDD DDEVRDRA +Y
Sbjct: 499 RYIYNRVVLENAVVRAAAVSSLAKFGVCVDDPSVMKSVNVLMRRCLDDVDDEVRDRAAMY 558

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           +K++++   A+  VKD++ +SLA LE QL+ YV +       FD+S +PK+++ QA AE 
Sbjct: 559 IKVLEEKSLADLLVKDEAQFSLANLEEQLMSYVRDNSKHASAFDISAVPKVSREQAHAEM 618

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQ-QQVYSQQLEQIPEIAA 359
            + RS   ++    G S++AV +           A+P P   + Q  Y+ QL  IPE   
Sbjct: 619 AQTRS---SALDVAGPSTAAVIT----------PASPIPSAKEAQSSYAAQLSTIPEFEP 665

Query: 360 FGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPES 419
           +GP+ KSS KP+ELTESETEYVV+ VKH+F++++VFQF V NT+ D +LE V V+MQP  
Sbjct: 666 YGPVLKSSAKPIELTESETEYVVTAVKHVFRKHVVFQFNVANTIPDTVLEQVAVIMQPSP 725

Query: 420 DEGTLVEEFVIPATKLPYD-QPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXX 478
           D G L+E+F+IP   L      + +YV+F R NP+EY  GSF  TLKF+ K+ DPS    
Sbjct: 726 DCG-LIEDFIIPINSLTTQVGQAPVYVSFTRENPQEYAAGSFGCTLKFVSKEVDPSN-GQ 783

Query: 479 XXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSC 538
                         +++  +DY+ PT+++ F + WD +     + ETFAL++S+SL+++C
Sbjct: 784 PEEEGYDDEYQVEELDLGAADYITPTFVT-FVNEWDKLASSPSLTETFALSSSESLREAC 842

Query: 539 TTLIELLGMSPVENSGTPTSSSVHTLMLSGTFL------GGIKVLAKNRMTFAPSTGVTM 592
            +LIE+LGM P+  + TPTS+SVHTL L+G  +         KVLA+ RMT+AP TGVT+
Sbjct: 843 RSLIEVLGMLPLGGTDTPTSNSVHTLNLAGLAIPIADGEKSSKVLARCRMTYAPGTGVTI 902

Query: 593 ELSVRSPSEEISRIVIGAV 611
           EL+VR+  EE +R+++ A+
Sbjct: 903 ELNVRAEEEEAARLIMAAI 921



>gi|388582420|gb|EIM22725.1| Coatomer, gamma subunit [Wallemia sebi CBS 633.66]
          Length = 913

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/621 (55%), Positives = 440/621 (70%), Gaps = 27/621 (4%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           L LS+PK+ L+FAAIRTLN+LA   P AV +CNL+MENLITD NRS+ATFAITTLLKTGN
Sbjct: 309 LALSTPKTPLKFAAIRTLNRLAQVHPQAVAACNLEMENLITDSNRSIATFAITTLLKTGN 368

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFM EISDEFKVIVVDA+R+LCLKFPSK V ML FLSG LRDEGGY+F
Sbjct: 369 EASVDRLMKQISGFMLEISDEFKVIVVDAVRALCLKFPSKHVAMLGFLSGALRDEGGYDF 428

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVV+AIFD++K+I ESKE AL+HLCEFIEDCEFTKLSVRVLHLLGVEGPKT  PTKYI
Sbjct: 429 KRAVVDAIFDMIKYIEESKETALSHLCEFIEDCEFTKLSVRVLHLLGVEGPKTLEPTKYI 488

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVS----AEDPEVKKSIKVLLTRCLDDNDDEVRDR 236
           R+IYNRV+LEN+IVRAAAVS+LAKFGV+    AE   V++S+KVLL RCLDD DDEVRDR
Sbjct: 489 RHIYNRVVLENAIVRAAAVSSLAKFGVNVVQGAE--SVRRSVKVLLGRCLDDIDDEVRDR 546

Query: 237 AILYLKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQA 296
           A +Y+++I+D+E A + VKDDSTYS+ ALE +LV YV++P SS + FD S IP++ K Q 
Sbjct: 547 AAMYMRIIEDDELASRTVKDDSTYSIGALESKLVAYVNDPSSSAQAFDASAIPRVNKEQI 606

Query: 297 EAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQV---YSQQLEQ 353
             +           T     + SA+G+   ++  +S  A PT    ++     Y++Q+  
Sbjct: 607 RID-----------TNKAIVNESAMGTSTPDVTQSSSPA-PTAAASKEDTTAKYAEQIAN 654

Query: 354 IPEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTV 413
           IPE A +GP+ +SS  PVELTE ETEYVVS +KH+F  ++VFQF V NT+ + +LE+V+V
Sbjct: 655 IPEFATYGPILQSSSNPVELTERETEYVVSAIKHVFASHIVFQFNVQNTIAENVLEDVSV 714

Query: 414 VMQPESDEGTLVEE-FVIPATKLPYDQPS-SIYVAFKRTNPEEYTLGSFSNTLKFLVKDC 471
           +MQP  D    V+E F++P  +L  +  S +IYV+F R   EEY LGSF NTL F+ K+ 
Sbjct: 715 IMQPTDDLSEQVQEDFIMPVQQLTSEMGSTAIYVSFTRVLEEEYPLGSFINTLSFISKEV 774

Query: 472 DPSTXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTAS 531
           DP T                 IE+  +DYV P+Y S F + W+         ETF+LTA 
Sbjct: 775 DPDT-GDLEPEGYKDEYQIEDIELQVADYVQPSYAS-FGNEWEKHTTYA-ATETFSLTAL 831

Query: 532 KSLKDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGI-KVLAKNRMTFAPSTGV 590
            SL+ +C +L+ELL M  +  S   T+ ++HTL LSG   GG  K LA+ RM +   +GV
Sbjct: 832 DSLQSACDSLVELLNMEALGGSQNATNPAIHTLELSGLVCGGAGKALARARMAYEEGSGV 891

Query: 591 TMELSVRSPSEEISRIVIGAV 611
           T+E SVR+ S+    ++I A+
Sbjct: 892 TLEFSVRAESQNGLDLIINAI 912



>gi|405120097|gb|AFR94868.1| coatomer subunit gamma [Cryptococcus neoformans var. grubii H99]
          Length = 921

 Score =  656 bits (1692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/619 (54%), Positives = 454/619 (73%), Gaps = 24/619 (3%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSPK  ++FAA++TL+KLA T P +V + N++MENLITD NRS+AT+AITTLLKTGN
Sbjct: 319 LFLSSPKPVIKFAAVKTLSKLAQTLPQSVAALNVEMENLITDSNRSIATYAITTLLKTGN 378

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+ FM++I+DEFK+IVVDAIRSLCLKFP+KQ VMLSFLSGVLRDEGGYEF
Sbjct: 379 EASVDRLMKQISSFMTDITDEFKIIVVDAIRSLCLKFPAKQAVMLSFLSGVLRDEGGYEF 438

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K AVVEAIFD++K+I +S++AALAHLCEFIEDCEFTKLSVR+LHLLG+EGPKT  PTK+I
Sbjct: 439 KHAVVEAIFDMIKYIQDSRDAALAHLCEFIEDCEFTKLSVRILHLLGIEGPKTRNPTKFI 498

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN++VRAAAVS+LAKFGV  +DP V KS+ VL+ RCLDD DDEVRDRA +Y
Sbjct: 499 RYIYNRVVLENAVVRAAAVSSLAKFGVCVDDPSVMKSVNVLMRRCLDDVDDEVRDRAAMY 558

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           +K++++   A+  VKD++ +SLA LE QL+ YV +       FD+S +PK+++ QA AE 
Sbjct: 559 IKVLEEKSLADVLVKDEAQFSLATLEEQLMTYVQDNSKHASAFDISAVPKVSREQAHAEV 618

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQ-QQVYSQQLEQIPEIAA 359
            + RS   ++    G S++ V +           A+P P   + Q  Y+ QL  IPE   
Sbjct: 619 AQARS---SALDVAGPSTATVIA----------PASPIPSAKEAQSSYAAQLSAIPEFEP 665

Query: 360 FGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPES 419
           +GP+ KSS KP+ELTESETEYVV+ VKH+F++++VFQF V NT+ D +LE V V+MQP  
Sbjct: 666 YGPVLKSSAKPIELTESETEYVVTAVKHVFRKHVVFQFNVANTIPDTVLEQVAVIMQPSP 725

Query: 420 DEGTLVEEFVIPATKLPYD-QPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXX 478
           D G L+E+F+IP   L      + +YV+F R NP++Y  GSF  TLKF+ K+ DPS    
Sbjct: 726 DCG-LIEDFIIPIDSLTTQIGQAPVYVSFTRENPQKYAAGSFGCTLKFVSKEVDPSN-GQ 783

Query: 479 XXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSC 538
                         +++  +DY+ PT+++ F + WD +     + ETFAL++S+SL+++C
Sbjct: 784 PEEEGYDDEYQLEELDLGAADYITPTFVT-FVNEWDKLASSPSLTETFALSSSESLREAC 842

Query: 539 TTLIELLGMSPVENSGTPTSSSVHTLMLSGTFL------GGIKVLAKNRMTFAPSTGVTM 592
            +L+E+LGM P+  + TPTS+SVHTL L+G  +         KVLA+ RMT+AP  GVT+
Sbjct: 843 RSLVEVLGMLPLGGTDTPTSNSVHTLNLAGLAVPIADDERSSKVLARCRMTYAPGAGVTI 902

Query: 593 ELSVRSPSEEISRIVIGAV 611
           ELSVR+  EE +R+V+ A+
Sbjct: 903 ELSVRAEEEEAARLVMAAI 921



>gi|328768580|gb|EGF78626.1| hypothetical protein BATDEDRAFT_35627 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 903

 Score =  655 bits (1691), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/621 (53%), Positives = 436/621 (70%), Gaps = 18/621 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           L + + K  LRFAAIRTLN+LAM  P AV  CNLDMENLITD NRS+ATFAITTLLKTGN
Sbjct: 290 LMIVNHKPALRFAAIRTLNRLAMIHPNAVFPCNLDMENLITDSNRSIATFAITTLLKTGN 349

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFMSEISDEFK+IVVDA+RSLCLKFPSKQ +ML+FLSGVLRD+GGY F
Sbjct: 350 EASVDRLMKQISGFMSEISDEFKIIVVDAVRSLCLKFPSKQTLMLNFLSGVLRDDGGYFF 409

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K A+V+A+FD++  IPESKE AL+HLCEFIEDCEF KL+VR+LH+LG EGP    PTKYI
Sbjct: 410 KSAIVDAMFDIIHSIPESKEFALSHLCEFIEDCEFAKLAVRILHVLGAEGPHASNPTKYI 469

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRVILE SIVRAAAVSALA+F V  ED   +  I VLL RC DD+DDEVRDRA L+
Sbjct: 470 RFIYNRVILETSIVRAAAVSALAQFAVHLED--ARPRICVLLDRCTDDSDDEVRDRAALF 527

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKA--QAEA 298
           L+++++ + + KY+ ++ST++LA+LE  L  Y+  P   +KPFD++ +  ++K   Q E 
Sbjct: 528 LRILNNPDLSSKYIANNSTFALASLEANLSHYLKTPAGYDKPFDINSVAVVSKEQDQVER 587

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
           + +K  + D ++    G S+ A  + +S    +      +   D Q VY+  +  IP++A
Sbjct: 588 QRVKDAARDQSTAGAGGVSNGAAATHSSISAISGSAGAASSAFDAQSVYATIMSNIPQLA 647

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
           + GPL+KSS + V+LTE+ETEY+V+CVKH+F ++ VFQF   NTL+D +LENV+V M  +
Sbjct: 648 SLGPLYKSS-QAVDLTEAETEYIVTCVKHVFPQHFVFQFECKNTLDDSMLENVSVSMGLQ 706

Query: 419 S----DEGTLVEEFVIPATKLPYDQPSSIYVAFKRTN---PEEYTLGSFSNTLKFLVKDC 471
           S    D   L  EF+I A KL YD P+SIYV ++R N   P  Y    FSNTLKF+VKDC
Sbjct: 707 SSDSQDIHELQPEFIITAEKLVYDVPASIYVVYQRLNNATPTAY----FSNTLKFVVKDC 762

Query: 472 DPSTXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTAS 531
           DP+T                 +EI  SDY+ PTY++DF  AW+  GE GQV+E +ALTA 
Sbjct: 763 DPNT-GEPDEEGFDDEYLLEDVEITLSDYMLPTYVADFDRAWNDAGEAGQVIEAYALTAV 821

Query: 532 KSLKDSCTTLIELLGMSPVENSGTPT-SSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGV 590
           K +  +  +  ++LGM  +      +  ++ H +M++GTF+ G++VL K RM F PS+GV
Sbjct: 822 KGILQAVKSTCDMLGMQALNGCDNVSEKATTHAMMMAGTFVNGVQVLTKARMAFDPSSGV 881

Query: 591 TMELSVRSPSEEISRIVIGAV 611
           +ME+ VRS   +IS  V  A+
Sbjct: 882 SMEICVRSQDADISARVANAI 902



>gi|389751550|gb|EIM92623.1| coatomer subunit gamma [Stereum hirsutum FP-91666 SS1]
          Length = 929

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/613 (56%), Positives = 443/613 (72%), Gaps = 18/613 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSS K TL+FAA RTL  LA+  P +V +CN+D+ENLI+D NRSVAT+AITTLLKTGN
Sbjct: 331 LFLSSTKPTLKFAATRTLASLALVHPASVATCNVDLENLISDSNRSVATYAITTLLKTGN 390

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQITGFMSEISDEFKVI+VDAIRSLCLKFP+K + ML FLSGVLRDEGGY+F
Sbjct: 391 EASVDRLMKQITGFMSEISDEFKVIIVDAIRSLCLKFPTKHIAMLGFLSGVLRDEGGYDF 450

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVEAIFD++KFI + KE AL+HLCEFIEDCEFTKLSVR+LHLLG+EGPK P P KYI
Sbjct: 451 KRAVVEAIFDMIKFIGDCKEQALSHLCEFIEDCEFTKLSVRILHLLGIEGPKAPQPAKYI 510

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LEN+ VRAAAV++LAKFG+SA+D +++KS+ VLL RCLDD DDEVRDRA +Y
Sbjct: 511 RFIYNRVVLENATVRAAAVASLAKFGISADDGKLQKSVAVLLNRCLDDVDDEVRDRAAMY 570

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           LK++     AE YVKDDS +SL+ALE +LV YV++PE+SE+PFD++ IPK+++ QA  + 
Sbjct: 571 LKVLKAPPLAETYVKDDSVFSLSALEAKLVTYVNDPEASEQPFDVTSIPKVSRQQAAQDA 630

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIAAF 360
            +P + D     TIG  ++   S +    +           + Q  Y QQL ++PE+  +
Sbjct: 631 ARPSTLD-----TIGAPTAKKSSPSPPPPTAE---------ETQSAYLQQLAEVPELEPY 676

Query: 361 GPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPESD 420
           GP+  SS KPV+LTESETEY VSCVKH+FKE++VFQF V+NTL D +LE V+V+MQP +D
Sbjct: 677 GPVLHSSAKPVQLTESETEYQVSCVKHIFKEHVVFQFNVSNTLPDTVLEQVSVIMQPSAD 736

Query: 421 EGTLVEEFVIPATKLPY-DQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXXX 479
            G L E+F+IP   L     P  +YV+F   +PE YT+ SF   LKF+ K+ DPST    
Sbjct: 737 SG-LTEDFIIPLPSLAATTSPGIVYVSFTLDSPESYTMASFQCILKFISKELDPSTGEPE 795

Query: 480 XXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSCT 539
                              DY+ P+Y ++FSS WD +       ETF+L+A  S+K +C 
Sbjct: 796 EEGYEDEYQLEEVELAAGGDYIIPSY-ANFSSEWDRLRGGATATETFSLSAMDSIKAACD 854

Query: 540 TLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLA-KNRMTFAPSTGVTMELSVRS 598
           ++IE+L M P+  S  PTS+SVHTL LSG  +GG   +  ++RMTF    GVT+EL VR+
Sbjct: 855 SIIEILNMEPLGGSQNPTSTSVHTLQLSGLLVGGGGKILVRSRMTFTRGQGVTLELGVRA 914

Query: 599 PSEEISRIVIGAV 611
             +E   +V+ A+
Sbjct: 915 EKQEACDLVLAAI 927



>gi|393244690|gb|EJD52202.1| coatomer subunit gamma [Auricularia delicata TFB-10046 SS5]
          Length = 923

 Score =  649 bits (1675), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/613 (56%), Positives = 442/613 (72%), Gaps = 17/613 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           +FLSSPK +L+FAAIRTL+ LA+  PT V +CN +MENLITD NRS+AT+AITTLLKTGN
Sbjct: 324 IFLSSPKPSLKFAAIRTLSSLALIHPTVVAACNTEMENLITDPNRSIATYAITTLLKTGN 383

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFM+EISDEFKVIVV+A+R+LCLKFP+KQ +ML+FL+GVLR+EGGY+F
Sbjct: 384 EASVDRLMKQISGFMAEISDEFKVIVVEAVRALCLKFPAKQELMLNFLAGVLREEGGYDF 443

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVEAIFD++KFI   KEAAL+HLCEFIEDCEFTKLSVR+LHLLG+EGPK   PTKYI
Sbjct: 444 KRAVVEAIFDMIKFIGSCKEAALSHLCEFIEDCEFTKLSVRILHLLGLEGPKMTQPTKYI 503

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LEN+IVRAAAVS+LAKFGV+  D  VK+SI VLL+RCLDD DDEVRDRA +Y
Sbjct: 504 RFIYNRVVLENAIVRAAAVSSLAKFGVNVLDATVKRSIGVLLSRCLDDVDDEVRDRAAMY 563

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           L+++ +++ AE YVK+DS +SLAALE +LV YV++  ++E PFD + IPKI++AQA  E 
Sbjct: 564 LRVLKEDQLAETYVKEDSVFSLAALEAKLVSYVNDAAATETPFDTTAIPKISRAQAAQEV 623

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIAAF 360
            +P + D  +       +     + S               + Q  Y+ QL  +PE AA+
Sbjct: 624 ARPSALDAVAVAVTAKPAIVAAPVLS-------------AAETQSQYASQLAAVPEFAAY 670

Query: 361 GPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPESD 420
           GP+  SS+KP +LTE+ETEYVVSCVKH+FKE++VFQF V+NTL D +LE+VTVVM P  +
Sbjct: 671 GPVLNSSLKPAQLTENETEYVVSCVKHIFKEHVVFQFNVSNTLPDTVLEDVTVVMTPTDE 730

Query: 421 EG-TLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXXX 479
            G TL     IP        P   YV+F R +PEEY LGSF  TLKF+ K+ DPS+    
Sbjct: 731 TGLTLAGAMAIPQLTAS-TSPQIAYVSFTRDDPEEYALGSFQCTLKFVSKEVDPSSGEPE 789

Query: 480 XXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSCT 539
                              DY+ P+Y+ +FSS W+ +       ETFAL+A +S+K +C 
Sbjct: 790 EEGYADEYQLEEVELGAGGDYIVPSYV-NFSSEWEKMKGGPSQTETFALSAMESIKAACD 848

Query: 540 TLIELLGMSPVENSGTPTSSSVHTLM-LSGTFLGGIKVLAKNRMTFAPSTGVTMELSVRS 598
           +LIE+L M  + +S  PTS+SVHTL        GG KVLA+ RMTFA   GVT+ELSVR+
Sbjct: 849 SLIEILNMEALGSSDQPTSTSVHTLQLGGLVGGGGGKVLARVRMTFAAGQGVTLELSVRA 908

Query: 599 PSEEISRIVIGAV 611
             E + R+V+ A+
Sbjct: 909 EQEAVCRLVMSAI 921



>gi|328853690|gb|EGG02827.1| hypothetical protein MELLADRAFT_44773 [Melampsora larici-populina
           98AG31]
          Length = 941

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/628 (56%), Positives = 442/628 (70%), Gaps = 32/628 (5%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSPKSTL+FAAIRTL KLA   P  VQ+CNLDME LI D+NR VATFAITTLLKTGN
Sbjct: 328 LFLSSPKSTLKFAAIRTLAKLAQQHPQPVQACNLDMERLINDENRGVATFAITTLLKTGN 387

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+ FMSEISDEFKV +V+AIR+LCLKFP+KQ VML+FLSG+LRDEGGY+F
Sbjct: 388 EASVDRLMKQISAFMSEISDEFKVTIVNAIRALCLKFPAKQAVMLNFLSGILRDEGGYDF 447

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVEAIFD++KFI ESKE AL+ LCEFIEDCEFTKLSVR+LHLLG+EGPK   P+KYI
Sbjct: 448 KRAVVEAIFDMIKFISESKETALSQLCEFIEDCEFTKLSVRILHLLGIEGPKAVQPSKYI 507

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRVILEN+IVRAAAVS+LAKFGV+  D  VK SIKVLLTRCLDD DDEVRDRA LY
Sbjct: 508 RYIYNRVILENAIVRAAAVSSLAKFGVNVSDVGVKASIKVLLTRCLDDVDDEVRDRAALY 567

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           LK++ +   AEK+VKDDST SLA LE +LV Y+SN E++E PF+L++IP+I++ QA  E 
Sbjct: 568 LKVLKEEPLAEKFVKDDSTISLAVLETKLVSYMSNAEATESPFELTNIPRISREQARQEA 627

Query: 301 LKPRS-----FDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIP 355
           ++ R        + +     TS+ A+G  + N  S +         + Q  Y+ QL  +P
Sbjct: 628 IRARHETTTDLTVLNNPNKPTSAVAIGGPSPNAASRA---------ETQSNYAAQLATVP 678

Query: 356 EIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVM 415
           E A +GP+ KSS KP+ LTE ETEYVVS VKH+F E++VFQF +TNTL D +LE V+V+M
Sbjct: 679 EFATYGPVLKSSSKPIPLTEHETEYVVSLVKHVFAEHIVFQFNLTNTLPDTILEQVSVLM 738

Query: 416 QPESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPST 475
            P S   TL E+F+IP   +   +P +IYV++ R     Y LGSF  TLKF+ K+ D   
Sbjct: 739 TPTSPSDTLTEDFIIPIPSIG-SEPGTIYVSYSRIG---YDLGSFGCTLKFISKEVD-PE 793

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLK 535
                            +EI   DY+ PTY+  F+  WD +     V ETF+L++ KSL+
Sbjct: 794 SGEPEEEGYEDEYQIEEVEIGVGDYILPTYVG-FTQEWDRLRSGVNVTETFSLSSLKSLE 852

Query: 536 DSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLG------------GIKVLAKNRMT 583
            +C T+IELL M  +  S  PTSSSVHTL LSG  +G            G KVL + RMT
Sbjct: 853 SACGTIIELLNMEALGGSERPTSSSVHTLNLSGIVIGNQKGSSTTTEGKGQKVLVRVRMT 912

Query: 584 FAPSTGVTMELSVRSPSEEISRIVIGAV 611
           ++   GVT+E++ R   +E   +++ A+
Sbjct: 913 YSTQAGVTLEITARGEDQEACDLILSAI 940



>gi|426201286|gb|EKV51209.1| hypothetical protein AGABI2DRAFT_189487 [Agaricus bisporus var.
           bisporus H97]
          Length = 933

 Score =  646 bits (1666), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/613 (53%), Positives = 442/613 (72%), Gaps = 17/613 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSPK  L+F+A RTL  LA++ PT+V +CN+D+E+LI D NRSVAT+AITTLLKTGN
Sbjct: 334 LFLSSPKPVLKFSATRTLAALALSHPTSVATCNVDLESLIADPNRSVATYAITTLLKTGN 393

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRL+KQITGFM+EISDEFKVI+VDAIRSLCLKFP+K V ML FLSGVLRDEGGY+F
Sbjct: 394 EASVDRLIKQITGFMAEISDEFKVIIVDAIRSLCLKFPAKHVSMLGFLSGVLRDEGGYDF 453

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVEA+FD++KFI + KE AL+HLCEFIEDCEFTKLSVR+LHLLG+EGPK+P P KYI
Sbjct: 454 KRAVVEAMFDMIKFISDCKEQALSHLCEFIEDCEFTKLSVRILHLLGIEGPKSPQPAKYI 513

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LEN+ VRAAAV +LAKFG++A D  ++KSI VLL+RCLDD DDEVRDRA +Y
Sbjct: 514 RFIYNRVVLENATVRAAAVGSLAKFGINASDSSLQKSIHVLLSRCLDDVDDEVRDRAAMY 573

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           L++ +    A+ Y+K++S +SLAALE +LV Y  +P ++++PFD+S +PKI++AQA  E 
Sbjct: 574 LRVFNQKRLADIYIKEESVFSLAALEAKLVAYAKDPTAAKQPFDVSTVPKISRAQAAQEA 633

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIAAF 360
            +P + D+     IG  +            T          ++Q  Y+QQL  I + +++
Sbjct: 634 ARPSTLDM-----IGVPAPK---------KTQEAPAAPSAAEKQSAYAQQLADISQFSSY 679

Query: 361 GPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPESD 420
           GP+  SS  P +LTE+ETEY ++CVKH+F  ++VFQF V+NTL D +LE V+V+MQP S+
Sbjct: 680 GPVLNSSANPAQLTENETEYQITCVKHIFSNHIVFQFNVSNTLPDTVLEQVSVIMQPTSE 739

Query: 421 EGTLVEEFVIPATKL-PYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXXX 479
           E  L+E+F+IP+T L   + P  +YV+F RT P++Y + SF  TLKF+ K+ DPST    
Sbjct: 740 ESGLIEDFIIPSTSLTSSNSPDIVYVSFTRTEPDQYAMASFQCTLKFISKELDPSTGQPE 799

Query: 480 XXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSCT 539
                              DY+ P+Y++ F + WD +       ETFAL+A  SLK +C 
Sbjct: 800 EEGYEDEYQLEEVELSAGGDYIIPSYVT-FGAEWDRLRSGPSATETFALSAMDSLKAACD 858

Query: 540 TLIELLGMSPVENSGTPTSSSVHTLMLSGTFL-GGIKVLAKNRMTFAPSTGVTMELSVRS 598
           ++IE+L M P+  + +P+S+SVHTL LSG    GG KVL + RMT++   GVT+EL VR+
Sbjct: 859 SIIEVLNMEPLGGTESPSSTSVHTLQLSGIVTGGGGKVLVRCRMTYSRGQGVTLELGVRA 918

Query: 599 PSEEISRIVIGAV 611
             +E   +V+ AV
Sbjct: 919 EKQEACDLVVAAV 931



>gi|390605026|gb|EIN14417.1| coatomer gamma subunit [Punctularia strigosozonata HHB-11173 SS5]
          Length = 927

 Score =  644 bits (1660), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/613 (55%), Positives = 441/613 (71%), Gaps = 20/613 (3%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP+ TL+FAA RTL  LA++ P  V  CN D+E LITD NRS+AT+AITTLLKTGN
Sbjct: 331 LFLSSPRGTLKFAAARTLASLAVSHPNVVIPCNPDLEALITDSNRSIATYAITTLLKTGN 390

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQITGFM+EISDEFKVI+VDAIRSLCLKFP+K   ML+FLSGVLRDEGGY++
Sbjct: 391 EASVDRLMKQITGFMNEISDEFKVIIVDAIRSLCLKFPAKHASMLAFLSGVLRDEGGYDY 450

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVEAIFD++KFI E KE AL+HLCEFIEDCEFTKLSVR+LHLLG+EGPK+P P KYI
Sbjct: 451 KRAVVEAIFDMIKFIGECKEQALSHLCEFIEDCEFTKLSVRILHLLGLEGPKSPQPAKYI 510

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+ VRAAAV+A+AKFGV+  D  +KKSI VLL RCLDD DDEVRDRA LY
Sbjct: 511 RYIYNRVVLENATVRAAAVAAMAKFGVNVPDASMKKSIGVLLNRCLDDVDDEVRDRAALY 570

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           LK +D+   A+ YVKD+ST+SLAALE +LV YV+N  ++++P DLSDIPKI++ QA  E+
Sbjct: 571 LKTLDEEPLAQAYVKDESTFSLAALESKLVAYVNNNSAADEPLDLSDIPKISREQAAKES 630

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIAAF 360
            +P +  L +    G S +A G              P    + Q  Y+QQL ++PE A +
Sbjct: 631 ARPSA--LETVAVAGPSQAATGP------------PPPTAAEAQSQYAQQLAEVPEFADY 676

Query: 361 GPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPESD 420
           GP+  SS K   LTESETEY VSCVKH+FKE++VFQ  ++NT+ D +LENV V++QP  D
Sbjct: 677 GPVL-SSTKSTPLTESETEYQVSCVKHIFKEHIVFQCNISNTITDTVLENVAVILQPSED 735

Query: 421 EGTLVEEFVIPATKL-PYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXXX 479
            G L E+FVIP   L     P  +YV+F R +PE+Y + SF+  LKF+ K+ DPST    
Sbjct: 736 SG-LTEDFVIPLPSLTAATSPGLVYVSFTRDSPEQYAMASFAAALKFVSKELDPST-GEP 793

Query: 480 XXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSCT 539
                        +E+  +DY+ P+Y S F++ W+ + +     ETF+L+A  S++ +C 
Sbjct: 794 EEEGYEDEYQLEELELAAADYIVPSY-STFTTDWEQLADAASATETFSLSAMDSIQAACD 852

Query: 540 TLIELLGMSPVENSGTPTSSSVHTLMLSGTFL-GGIKVLAKNRMTFAPSTGVTMELSVRS 598
           ++IE+L M P+  + +P + +VHTL LSG    GG KVL + RMTFA   GVT+EL VR+
Sbjct: 853 SIIEILNMEPLGGTQSPANPTVHTLQLSGLVAGGGGKVLVRCRMTFAKGQGVTLELGVRA 912

Query: 599 PSEEISRIVIGAV 611
             ++   +V+ A+
Sbjct: 913 EKQQACELVVSAI 925



>gi|401885452|gb|EJT49568.1| coatomer gamma subunit (Gamma-coat protein) [Trichosporon asahii
           var. asahii CBS 2479]
          Length = 920

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/613 (57%), Positives = 452/613 (73%), Gaps = 16/613 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSPK+ L+FAA++TL+KLA T P AV SCNLDMENLITD NRS+AT+AITTLLKTGN
Sbjct: 322 LFLSSPKAVLKFAAVKTLSKLAQTHPNAVASCNLDMENLITDSNRSIATYAITTLLKTGN 381

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+ FM++I+DEFKVIVVDAIRSLCLKFP+KQ VML+FLSGVLRDEGGYEF
Sbjct: 382 EASVDRLMKQISSFMTDITDEFKVIVVDAIRSLCLKFPAKQGVMLTFLSGVLRDEGGYEF 441

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K AVVEAIFD++K+I +S+EAALAHLCEFIEDCEFTKLSVR+LHLLG+EGPKT  PTKYI
Sbjct: 442 KHAVVEAIFDMIKYIQDSREAALAHLCEFIEDCEFTKLSVRILHLLGIEGPKTRNPTKYI 501

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN++VRAAAVSALAKFG S +D  V KSI VLL RCLDD DDEVRDRA +Y
Sbjct: 502 RYIYNRVVLENAVVRAAAVSALAKFGASVDDEHVTKSIDVLLRRCLDDVDDEVRDRAAMY 561

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           LK++DD + A+ YV+D++T+SLA LE QLV Y+++     + FD S +PK+++ QA AE 
Sbjct: 562 LKVLDDKKLADTYVRDEATFSLAQLESQLVSYINDESKHGEAFDASSVPKVSREQAAAEV 621

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIAAF 360
              R   LA   TI  +S+A           S    P    + Q  Y+ QL +IPE+A++
Sbjct: 622 ASARPSALA---TIADTSAA--------PQKSESPAPVSAAEAQSAYAAQLAEIPELASY 670

Query: 361 GPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPESD 420
           G + KSS KP+ LTE ETEY V+ VKH+FKE++VFQF V+NT+ D +LE V+V++ P  +
Sbjct: 671 GQVLKSSSKPIPLTEDETEYAVTVVKHIFKEHVVFQFNVSNTIPDTVLEQVSVILVPAEE 730

Query: 421 EGTLVEEFVIPATKLPYDQPS-SIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXXX 479
            G L E+F+IP   L     + ++YV+F R +P EY  G++S TLKF+ K+ DPS+    
Sbjct: 731 SG-LTEDFIIPVPSLTTQTGAGAVYVSFTRDDPSEYATGAYSCTLKFISKEVDPSS-GEP 788

Query: 480 XXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSCT 539
                        +E+   DY+ PTY + FSS WD +     + ETFAL++S+SL+D+  
Sbjct: 789 EEEGYDDEYQVEDVELGAGDYITPTYAT-FSSEWDKLANGPSITETFALSSSESLRDAVK 847

Query: 540 TLIELLGMSPVENSGTPTSSSVHTLMLSGTFL-GGIKVLAKNRMTFAPSTGVTMELSVRS 598
           +L+E+L M P+  +  PTSSSVHTL +SG    GG KVLA+ RMTF+P  GVT+EL+VR+
Sbjct: 848 SLVEVLNMEPLGGTEQPTSSSVHTLNMSGLVCGGGGKVLARCRMTFSPGEGVTLELAVRA 907

Query: 599 PSEEISRIVIGAV 611
             EE   +V+ A+
Sbjct: 908 EKEEAVNLVMSAI 920



>gi|406694910|gb|EKC98227.1| coatomer gamma subunit (Gamma-coat protein) [Trichosporon asahii
           var. asahii CBS 8904]
          Length = 920

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/613 (57%), Positives = 452/613 (73%), Gaps = 16/613 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSPK+ L+FAA++TL+KLA T P AV SCNLDMENLITD NRS+AT+AITTLLKTGN
Sbjct: 322 LFLSSPKAVLKFAAVKTLSKLAQTHPNAVASCNLDMENLITDSNRSIATYAITTLLKTGN 381

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+ FM++I+DEFKVIVVDAIRSLCLKFP+KQ VML+FLSGVLRDEGGYEF
Sbjct: 382 EASVDRLMKQISSFMTDITDEFKVIVVDAIRSLCLKFPAKQGVMLTFLSGVLRDEGGYEF 441

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K AVVEAIFD++K+I +S+EAALAHLCEFIEDCEFTKLSVR+LHLLG+EGPKT  PTKYI
Sbjct: 442 KHAVVEAIFDMIKYIQDSREAALAHLCEFIEDCEFTKLSVRILHLLGIEGPKTRNPTKYI 501

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN++VRAAAVSALAKFG S +D  V KSI VLL RCLDD DDEVRDRA +Y
Sbjct: 502 RYIYNRVVLENAVVRAAAVSALAKFGASVDDEHVTKSIDVLLRRCLDDVDDEVRDRAAMY 561

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           LK++DD + A+ YV+D++T+SLA LE QLV Y+++     + FD S +PK+++ QA AE 
Sbjct: 562 LKVLDDKKLADTYVRDEATFSLAQLESQLVSYINDESKHGEAFDASSVPKVSREQAAAEV 621

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIAAF 360
              R   LA   TI  +S+A           S    P    + Q  Y+ QL +IPE+A++
Sbjct: 622 ASARPSALA---TIADTSAA--------PQKSESPAPVSAAEAQSAYAAQLAEIPELASY 670

Query: 361 GPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPESD 420
           G + KSS KP+ LTE ETEY V+ VKH+FKE++VFQF V+NT+ D +LE V+V++ P  +
Sbjct: 671 GQVLKSSSKPIPLTEDETEYAVTVVKHIFKEHVVFQFNVSNTIPDTVLEQVSVILVPAEE 730

Query: 421 EGTLVEEFVIPATKLPYDQPS-SIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXXX 479
            G L E+F+IP   L     + ++YV+F R +P EY  G++S TLKF+ K+ DPS+    
Sbjct: 731 SG-LTEDFIIPVPSLTTQTGAGAVYVSFTRDDPSEYATGAYSCTLKFISKEVDPSS-GEP 788

Query: 480 XXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSCT 539
                        +E+   DY+ PTY + FSS WD +     + ETFAL++S+SL+D+  
Sbjct: 789 EEEGYDDEYQVEDVELGAGDYITPTYAT-FSSEWDKLANGPSITETFALSSSESLRDAVK 847

Query: 540 TLIELLGMSPVENSGTPTSSSVHTLMLSGTFL-GGIKVLAKNRMTFAPSTGVTMELSVRS 598
           +L+E+L M P+  +  PTSSSVHTL +SG    GG KVLA+ RMTF+P  GVT+EL+VR+
Sbjct: 848 SLVEVLNMEPLGGTEQPTSSSVHTLNMSGLVCGGGGKVLARCRMTFSPGEGVTLELAVRA 907

Query: 599 PSEEISRIVIGAV 611
             EE   +V+ A+
Sbjct: 908 EKEEAVNLVMSAI 920



>gi|169845138|ref|XP_001829289.1| coatomer subunit gamma [Coprinopsis cinerea okayama7#130]
 gi|116509720|gb|EAU92615.1| coatomer subunit gamma [Coprinopsis cinerea okayama7#130]
          Length = 931

 Score =  643 bits (1658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/619 (57%), Positives = 445/619 (71%), Gaps = 27/619 (4%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSPK  L+FAA RTL  LA+T P AV +CN+D+E LI D NRSVAT+AITTLLKTGN
Sbjct: 330 LFLSSPKPVLKFAAARTLAALALTYPQAVAACNVDLEALIADPNRSVATYAITTLLKTGN 389

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRL+KQITGFM+EISDEFKVI+VDAIRSLCLKFP+K   MLSFLSGVLRDEGGY+F
Sbjct: 390 EASVDRLIKQITGFMTEISDEFKVIIVDAIRSLCLKFPTKYSSMLSFLSGVLRDEGGYDF 449

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVEA+FD++KFI +SKE AL+HLCEFIEDCEFTKLSVR+LHLLGVEGPK+P P KYI
Sbjct: 450 KRAVVEAMFDMIKFITDSKEQALSHLCEFIEDCEFTKLSVRILHLLGVEGPKSPQPAKYI 509

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+ VRAAAV++LAKFGV++ +  +K+SI VLL RCLDD DDEVRDRA LY
Sbjct: 510 RYIYNRVVLENATVRAAAVTSLAKFGVNSPEESLKRSITVLLRRCLDDVDDEVRDRAALY 569

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           LK+ D    A+ YVK++S +SLAALE +LV YV +P ++ +P D+S +PKI++AQA  E 
Sbjct: 570 LKIFDRKPLADAYVKEESVFSLAALEAKLVAYVKDPSAASEPLDVSSVPKISRAQAAQEA 629

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTP----GVDQQQVYSQQLEQIPE 356
            +P S D     TIG             V  ++  +P P      + Q  Y QQL ++PE
Sbjct: 630 ARPSSLD-----TIG-------------VPVAKSVSPAPQAPSAAETQSAYLQQLAEVPE 671

Query: 357 IAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
            A++G +  SS  P +LTESETEY V+CVKH+FKE++VFQF V+NTL D +LE V+V+M 
Sbjct: 672 FASYGTVLNSSATPAQLTESETEYQVTCVKHIFKEHVVFQFNVSNTLPDTVLEQVSVIMT 731

Query: 417 PESDEGT--LVEEFVIPATKL-PYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDP 473
           P SDE    LVE+F+IP   L   + P  IYV+F RT+PE Y LGSF+ TLKF+ K+ DP
Sbjct: 732 PSSDEDETPLVEDFIIPLPSLSSTNSPGIIYVSFTRTDPETYALGSFACTLKFISKEVDP 791

Query: 474 STXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKS 533
           +T                       DY+ P+Y + F S WD +       ETF L+A +S
Sbjct: 792 ATGEPEEEGYEDEYQLEEVELSAGGDYIIPSY-ATFGSEWDRMRSAPSQTETFTLSAMES 850

Query: 534 LKDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFL-GGIKVLAKNRMTFAPSTGVTM 592
           LK +C ++IE+L M P+  + TP S+SVHTL LSG    GG KVLA+ RMT++   GVT+
Sbjct: 851 LKAACDSIIEVLNMEPLGGTETPQSTSVHTLQLSGLATGGGGKVLARCRMTYSRGAGVTL 910

Query: 593 ELSVRSPSEEISRIVIGAV 611
           ELSVR+  +E+  +VI AV
Sbjct: 911 ELSVRAEKQEVCDLVIAAV 929



>gi|392580335|gb|EIW73462.1| hypothetical protein TREMEDRAFT_70972 [Tremella mesenterica DSM
           1558]
          Length = 918

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/613 (55%), Positives = 451/613 (73%), Gaps = 18/613 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSPK  L+FAAI+TL+KLAMT P AV +CNLDMENLITD NRS+AT+AITTLLKTGN
Sbjct: 322 LFLSSPKPVLKFAAIKTLSKLAMTHPQAVTACNLDMENLITDSNRSIATYAITTLLKTGN 381

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+ FM++I+DEFK+IVVDAIRSLCLKFP+KQ VMLSFLSGVLRDEGGY+F
Sbjct: 382 EASVDRLMKQISSFMADITDEFKIIVVDAIRSLCLKFPAKQAVMLSFLSGVLRDEGGYDF 441

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K AVVEAIFD+VK+I E ++ ALAHLCEFIEDCEFTKLSVR+LHLLG+EGPKT  PTK+I
Sbjct: 442 KHAVVEAIFDMVKYIKECRDTALAHLCEFIEDCEFTKLSVRILHLLGIEGPKTRNPTKFI 501

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN++VRAAAVS+LAKFGV  +D  V KS+ VLL RCLDD DDEVRDRA +Y
Sbjct: 502 RYIYNRVVLENAVVRAAAVSSLAKFGVCVDDKAVMKSVNVLLRRCLDDVDDEVRDRAAMY 561

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           +K++++   A+ +V++++T+SLAALE +LV YV +       FD+S IPK+++ QA+AE 
Sbjct: 562 IKVLEEKALADIFVREEATFSLAALESELVSYVKDDSRHSTAFDISSIPKVSREQAQAEI 621

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIAAF 360
           ++  S    + ++I  SSS     +    +TS  A+          Y+ QL  IPE+  +
Sbjct: 622 IQRPS----ALESITASSSKPSEPSPLPSATSETASS---------YATQLASIPELEGY 668

Query: 361 GPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPESD 420
           GP+ KSS KP+ELTESETEYVVS VKH+FK+++VFQF V+NT+ D +LE VTV+M P  D
Sbjct: 669 GPVLKSSPKPIELTESETEYVVSVVKHIFKQHIVFQFNVSNTIPDTVLEGVTVLMSPSPD 728

Query: 421 EGTLVEEFVIPATKL-PYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXXX 479
            G L E+F+IP   L       ++YV+F R +P EY  G+F  TL+F+ K+ DP+T    
Sbjct: 729 SG-LTEDFIIPIDSLTSVKGAGTVYVSFTRDDPMEYASGTFGCTLRFVSKEVDPNT-GEP 786

Query: 480 XXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSCT 539
                         ++   DY+ P+Y++ F++ W+ + +     ETFAL++S+SLKD+C 
Sbjct: 787 EEEGYQDEYQVEDCDLGAGDYISPSYVT-FATEWEKLVDAPGETETFALSSSESLKDACK 845

Query: 540 TLIELLGMSPVENSGTPTSSSVHTL-MLSGTFLGGIKVLAKNRMTFAPSTGVTMELSVRS 598
           +LIE+L M  +  + +PTS+SVHTL +      GG KVLA+ RMTFA   GVT+EL+VR+
Sbjct: 846 SLIEVLNMEALGGTESPTSNSVHTLNLSGLISGGGGKVLARCRMTFATGQGVTLELAVRA 905

Query: 599 PSEEISRIVIGAV 611
             E+  ++V+ A+
Sbjct: 906 EKEQAVKLVMAAI 918



>gi|302694773|ref|XP_003037065.1| hypothetical protein SCHCODRAFT_80625 [Schizophyllum commune H4-8]
 gi|300110762|gb|EFJ02163.1| hypothetical protein SCHCODRAFT_80625 [Schizophyllum commune H4-8]
          Length = 930

 Score =  639 bits (1648), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/615 (57%), Positives = 446/615 (72%), Gaps = 24/615 (3%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSPK  L+FAA RTL  LA+T P ++ +CN+D+E LI D NRSVAT+AITTLLKTGN
Sbjct: 334 LFLSSPKPVLKFAATRTLAALALTHPASIATCNVDLEGLIADSNRSVATYAITTLLKTGN 393

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRL+KQIT FM+EISDEFKVI+VDAIRSLCLKFP+K   MLSFLSGVLRDEGGY+F
Sbjct: 394 EASVDRLIKQITNFMTEISDEFKVIIVDAIRSLCLKFPAKHASMLSFLSGVLRDEGGYDF 453

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVEAIFD++KFI + KE AL+HLCEFIEDCEFTKLSVR+LHLLG+EGPK+P P+KYI
Sbjct: 454 KRAVVEAIFDMIKFIGDCKEQALSHLCEFIEDCEFTKLSVRILHLLGMEGPKSPQPSKYI 513

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LEN+ VRAAAV++LAKFGV+A D +++KSI VLL RCLDD DDEVRDRA LY
Sbjct: 514 RFIYNRVVLENATVRAAAVASLAKFGVNAPDTKLQKSIAVLLNRCLDDVDDEVRDRAALY 573

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           L    +   A+ YVK++S +SLAALE +LV YV NP  S +P DLS +PKI++ QA  E 
Sbjct: 574 LNTFKETTLAQAYVKEESVFSLAALETKLVSYVKNP--SAEPLDLSSVPKISRKQAAQEA 631

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTP--GVDQQQVYSQQLEQIPEIA 358
            +P + +     TIG  ++   S           ATP P    ++Q  Y+QQL ++PEIA
Sbjct: 632 ARPSTLE-----TIGVPTTQKTS-----------ATPPPPSAAEKQSAYAQQLAEVPEIA 675

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
           +FG +  SS  P +LTESETEY V+CVKH+F EN+VFQF V+NTL D LLENV+VVMQP+
Sbjct: 676 SFGQVLGSSSTPAQLTESETEYQVTCVKHIFAENIVFQFNVSNTLPDTLLENVSVVMQPQ 735

Query: 419 SDEGTLVEEFVIPATKL-PYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXX 477
           S++  L E+F IP   L     P  +YVAF R +PE Y +GSF+ TLKF+ K+ DPST  
Sbjct: 736 SEDTGLTEKFFIPIPTLDAAKSPGVVYVAFARDDPESYAMGSFACTLKFVSKEVDPST-G 794

Query: 478 XXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDS 537
                          IE+  SDY+ P+Y + F S WD +     V ETFAL+A +SLK +
Sbjct: 795 EPEEEGYEDEYQVEEIELSASDYIVPSY-ATFGSEWDRLKGAPSVTETFALSAMESLKAA 853

Query: 538 CTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLA-KNRMTFAPSTGVTMELSV 596
           C ++IE+LGM P+  +  P+S SVHTL LSG  +GG   +  + RMTF+  +GVT+EL V
Sbjct: 854 CDSIIEILGMEPLGGTEVPSSPSVHTLQLSGLLIGGGGKILVRCRMTFSRGSGVTLELGV 913

Query: 597 RSPSEEISRIVIGAV 611
           R+  +E   +V+ AV
Sbjct: 914 RAEKQEACDLVLAAV 928



>gi|407918611|gb|EKG11881.1| Clathrin/coatomer adaptor adaptin-like protein [Macrophomina
           phaseolina MS6]
          Length = 919

 Score =  636 bits (1640), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 337/616 (54%), Positives = 438/616 (71%), Gaps = 14/616 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAAIR L+  A  +P AV+ CN D+E LIT+ NRS+ATFAITTLLKTGN
Sbjct: 312 LFLTSPRAVTKFAAIRILHNFASFKPDAVRQCNPDIEALITNSNRSIATFAITTLLKTGN 371

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+GFM+EI+DEFKV +V+AIR+LCLKFPSKQ  ML+FLSG+LRDEGGYEF
Sbjct: 372 ESSVDRLMKQISGFMAEITDEFKVTIVEAIRTLCLKFPSKQAGMLAFLSGILRDEGGYEF 431

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+PESKE ALAHLCEFIEDCEFTKL+VR+LHLLG+EGPKT  PTKYI
Sbjct: 432 KRAVVESMFDLIKFVPESKEDALAHLCEFIEDCEFTKLAVRILHLLGMEGPKTAQPTKYI 491

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVK+S++VLLTRCLDD DDEVRDRA L 
Sbjct: 492 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKRSVRVLLTRCLDDTDDEVRDRAALN 551

Query: 241 LKLIDD-NESAEKYVKDDSTYSLAALERQLVQYVS--NPESSEKPFDLSDIPKITKAQAE 297
           L+L+DD +E A K++++DS +SL  LE QLV YV+  + E+  +PFDLS IP +T+ QA+
Sbjct: 552 LRLMDDEDEDAHKFIRNDSMFSLPTLEHQLVMYVTADDKETFSQPFDLSKIPVVTREQAD 611

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE       D     T  T +    S      + S            Q Y+ QL+ IPEI
Sbjct: 612 AE-------DRTKKLTSATPTLKAPSTGPKPATRSGADAAASATAAAQKYAAQLQAIPEI 664

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
           AAFG + KSS   VELTESETEYVVS +KH+FKE++V Q+ + NTL + +L +VT+V+ P
Sbjct: 665 AAFGGVLKSS-PIVELTESETEYVVSAIKHIFKEHVVIQYDIKNTLPETVLADVTMVVTP 723

Query: 418 -ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEE-YTLGSFSNTLKFLVKDCDPST 475
            + +E  L EEF+IPA  L  D+P ++YV+FKRT  E+ Y   SF+N LKF +K+ DPST
Sbjct: 724 ADEEESGLEEEFIIPAPLLKTDEPGTVYVSFKRTAGEDTYVAASFTNILKFTLKEIDPST 783

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLK 535
                            +++  +DY+ P Y   F + W+  G   Q  ET  L+A KS++
Sbjct: 784 -NEPEEGGYEDEYQVEDLDLNGADYIVPAYAGSFDNVWEQSGAGEQATETLQLSALKSIQ 842

Query: 536 DSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           D+   + + L + P+E +  P S+S H L L G  + G KV A+ RM F+  TGVTM++ 
Sbjct: 843 DAVEQIPKTLSLQPLEGTDVPLSTSTHALKLYGKTVTGGKVAAQVRMAFSAKTGVTMKID 902

Query: 596 VRSPSEEISRIVIGAV 611
           VRS  E ++ +VI +V
Sbjct: 903 VRSEEEGVATLVINSV 918



>gi|409083656|gb|EKM84013.1| hypothetical protein AGABI1DRAFT_110613 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 933

 Score =  635 bits (1638), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 336/613 (54%), Positives = 442/613 (72%), Gaps = 17/613 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSPK  L+FAA RTL  LA++ PT+V +CN+D+E+LI D NRSVAT+AITTLLKTGN
Sbjct: 334 LFLSSPKPVLKFAATRTLAALALSHPTSVATCNVDLESLIADPNRSVATYAITTLLKTGN 393

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRL+KQITGFM+EISDEFKVI+VDAIRSLCLKFP+K V ML FLSGVLRDEGGY+F
Sbjct: 394 EASVDRLIKQITGFMAEISDEFKVIIVDAIRSLCLKFPAKHVSMLGFLSGVLRDEGGYDF 453

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVEA+FD++KFI + KE AL+HLCEFIEDCEFTKLSVR+LHLLG+EGPK+P P KYI
Sbjct: 454 KRAVVEAMFDMIKFISDCKEQALSHLCEFIEDCEFTKLSVRILHLLGIEGPKSPQPAKYI 513

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LEN+ VRAAAV +LAKFG++A D  ++KSI VLL+RCLDD DDEVRDRA +Y
Sbjct: 514 RFIYNRVVLENATVRAAAVGSLAKFGINASDSSLQKSIHVLLSRCLDDVDDEVRDRAAMY 573

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           L++ +    A+ Y+K++S +SLAALE +LV Y  +P ++EKPFD+S +PKI++AQA  E 
Sbjct: 574 LRVFNQKRLADIYIKEESVFSLAALEAKLVAYAKDPTAAEKPFDVSTVPKISRAQAAQEA 633

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIAAF 360
            +P + D+     IG  +            T          ++Q  Y+QQL  I + +++
Sbjct: 634 ARPSTLDM-----IGVPAPK---------KTQEAPAAPSAAEKQSAYAQQLADISQFSSY 679

Query: 361 GPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPESD 420
           GP+  SS  PV+LTE+ETEY ++CVKH+F  ++VFQF V+NTL D +LE V+V+MQP S+
Sbjct: 680 GPVLNSSANPVQLTENETEYQITCVKHIFSNHIVFQFNVSNTLPDTVLEQVSVIMQPTSE 739

Query: 421 EGTLVEEFVIPATKL-PYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXXX 479
           E  LVE+F+IP T L   + P  +YV+F RT P++Y + SF  TLKF+ K+ DPST    
Sbjct: 740 ESGLVEDFIIPLTSLTSSNSPDIVYVSFTRTEPDQYAMASFQCTLKFISKELDPSTGQPE 799

Query: 480 XXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSCT 539
                              DY+ P+Y++ F + WD +       ETFAL+A  SLK +C 
Sbjct: 800 EEGYEDEYQLEEVELSAGGDYIIPSYVT-FGAEWDRLRSGPSATETFALSAMDSLKAACD 858

Query: 540 TLIELLGMSPVENSGTPTSSSVHTLMLSGTFL-GGIKVLAKNRMTFAPSTGVTMELSVRS 598
           ++IE+L M P+  + +P+S+SVHTL LSG    GG KVL + RMT++   GVT+EL VR+
Sbjct: 859 SIIEVLNMEPLGGTESPSSTSVHTLQLSGIVTGGGGKVLVRCRMTYSRGQGVTLELGVRA 918

Query: 599 PSEEISRIVIGAV 611
             +E   +V+ AV
Sbjct: 919 EKQEACDLVVAAV 931



>gi|121710672|ref|XP_001272952.1| Coatomer subunit  gamma, putative [Aspergillus clavatus NRRL 1]
 gi|119401102|gb|EAW11526.1| Coatomer subunit gamma, putative [Aspergillus clavatus NRRL 1]
          Length = 916

 Score =  632 bits (1630), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 332/617 (53%), Positives = 436/617 (70%), Gaps = 18/617 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP++  +FAAIR L+  A  +P  V  CN D+E+LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLSSPRAITKFAAIRILHNFASFKPHVVNVCNPDIESLISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFM++I+DEFK+ +V+AIR+LCLKFPSKQ  MLSFLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMKQISGFMADITDEFKITIVEAIRTLCLKFPSKQAGMLSFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KR+VVE++FDL+KF+PES+E ALAHLCEFIEDCEFTKLSVR+LHLLGVEGP+T  PTKYI
Sbjct: 431 KRSVVESMFDLIKFVPESREDALAHLCEFIEDCEFTKLSVRILHLLGVEGPRTSHPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVK S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKSSVSVLLTRCLDDTDDEVRDRAALN 550

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQAE 297
           L+L+ +++E AE+++K+DS YSL+  E QLV YV++ E       FD++ +P +T+ QA 
Sbjct: 551 LRLMAEEDEMAERFIKNDSMYSLSTFEHQLVMYVTSTEKETFAAAFDVATVPVVTQEQAL 610

Query: 298 AENLKPRSFDL-ASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPE 356
           AE    R+  L  +T T+   S+      +N V+ +  A         Q Y++QL QIPE
Sbjct: 611 AEE---RTKKLTTATPTLKAPSAGPPKGKANGVAEAATAA------ATQKYAEQLMQIPE 661

Query: 357 IAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
           + A+G L KSS+ PVELTESETEYVV+ VKH+FKE++V Q+ V NTL D +LE+VTV   
Sbjct: 662 LRAYGTLLKSSV-PVELTESETEYVVTAVKHVFKEHIVLQYDVKNTLPDTVLEDVTVAAT 720

Query: 417 PESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEE-YTLGSFSNTLKFLVKDCDPST 475
           P S+E  L EEF +PA KL  ++P  IYV FK+   E+ + + SF+N LKF  K+ DPST
Sbjct: 721 P-SEEDVLEEEFTVPAPKLATNEPGIIYVTFKKLAGEDSFPVTSFTNNLKFTSKEVDPST 779

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSL 534
                            +E+  SDYV PT+   F   W+  G  G +V ET  L+  KS+
Sbjct: 780 -GEPEDSGYEDEYQVEDLELTGSDYVIPTFAGSFDHVWEQTGANGEEVSETLQLSNMKSI 838

Query: 535 KDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
            D+   LI  L + P+E +    S+S HTL L G  + G +V A  +M F+  +GVT ++
Sbjct: 839 SDATEQLISALSLQPLEGTDVALSNSTHTLKLFGKTVSGGRVAALIKMAFSSKSGVTTKI 898

Query: 595 SVRSPSEEISRIVIGAV 611
           ++R+  E ++  V+ A+
Sbjct: 899 TIRAEEEGVATAVMAAL 915



>gi|353244874|emb|CCA76018.1| probable coatomer gamma-2 subunit [Piriformospora indica DSM 11827]
          Length = 856

 Score =  631 bits (1627), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 319/540 (59%), Positives = 395/540 (73%), Gaps = 23/540 (4%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSS K TLRFAA+RTL+ LA+T PT+V +CN++MENLI+D NRS+AT+AITTLLKTGN
Sbjct: 333 LFLSSTKPTLRFAAMRTLSALALTHPTSVATCNVEMENLISDSNRSIATYAITTLLKTGN 392

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMK ITGFMSEISDEFKVIVVDAIRSLCLKFP+KQ  ML+FLS +LRDEGGY+F
Sbjct: 393 EASVDRLMKSITGFMSEISDEFKVIVVDAIRSLCLKFPNKQSQMLTFLSSILRDEGGYDF 452

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVEAIFD++KFI ESKEAALAHLCEFIEDCEFTKLSVRVLHLLG+EGPK P PTKYI
Sbjct: 453 KRAVVEAIFDMIKFISESKEAALAHLCEFIEDCEFTKLSVRVLHLLGIEGPKAPNPTKYI 512

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV++LAKFGV   DP +K+S+ VLL+RCLDD DDEVRDRA +Y
Sbjct: 513 RYIYNRVVLENAIVRAAAVTSLAKFGVCGSDPTIKRSVSVLLSRCLDDIDDEVRDRAAMY 572

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           L+++ ++  AE  VK+DS YSLA LE +L  YVSNP++  + FD+S IPKI++AQA+ E 
Sbjct: 573 LRVMKEDALAEPLVKEDSVYSLATLESKLAAYVSNPDAQNEEFDISSIPKISRAQAQQEA 632

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGV----DQQQVYSQQLEQIPE 356
            +P + +               +  +++V   +   P P      + Q  Y+ QL  IP 
Sbjct: 633 ARPTTLE---------------TFTASVVPQPKANVPAPAAPSAQETQSAYASQLAAIPN 677

Query: 357 IAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
            + +G +  SS KP  LTE+ETEYVV+CVKH+FKE++VFQF V NT+ D +LENV+VVMQ
Sbjct: 678 FSGYGSVLTSSPKPTPLTETETEYVVTCVKHIFKEHIVFQFNVANTIPDTVLENVSVVMQ 737

Query: 417 PESDEGTLVEEFVIPATKLPYDQPSS-IYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPST 475
           P S EG + E+F+IP   L     S  +YV+F RT+PEEY LGSF+ TLKF+ K+ DPS+
Sbjct: 738 P-SAEG-VEEDFIIPVDSLDVAAGSQPVYVSFTRTDPEEYPLGSFACTLKFVSKEVDPSS 795

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLK 535
                               V  DY+ P Y S F + W  +GEE    E FAL +  S+K
Sbjct: 796 GLPEETGYDDEYQLEEVELSVGGDYIVPNYCS-FETEWVKLGEESGAEEEFALNSMSSIK 854



>gi|425768436|gb|EKV06959.1| Coatomer subunit gamma [Penicillium digitatum Pd1]
 gi|425770296|gb|EKV08769.1| Coatomer subunit gamma [Penicillium digitatum PHI26]
          Length = 941

 Score =  629 bits (1622), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 331/617 (53%), Positives = 428/617 (69%), Gaps = 17/617 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP+S  +FAAIR L+  A  +P  V +CN D+E+LI++ NRS+ATFAITTLLKTGN
Sbjct: 335 LFLSSPRSITKFAAIRILHNFASFKPHVVNACNPDIESLISNSNRSIATFAITTLLKTGN 394

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFM++I+DEFKV +V+AIR+LCLKFPSKQ  ML FLSG+LRDEGGYEF
Sbjct: 395 EASVDRLMKQISGFMADITDEFKVTIVEAIRTLCLKFPSKQAGMLVFLSGILRDEGGYEF 454

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KR VVE++FDL+KF+PESKE ALAHLCEFIEDCEFTKLSVR+LHLLG EGPKT +PTKYI
Sbjct: 455 KRTVVESMFDLIKFVPESKEDALAHLCEFIEDCEFTKLSVRILHLLGSEGPKTTSPTKYI 514

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVK S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 515 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKSSVHVLLTRCLDDTDDEVRDRAALN 574

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYVS--NPESSEKPFDLSDIPKITKAQAE 297
           L+L+ +++ESA  ++K+DS YSL+  E QLV YV+  + E+    F+++ IP ++  QA 
Sbjct: 575 LRLMGEEDESASAFIKNDSMYSLSTFEHQLVMYVTSGDKETFATAFNVATIPVVSHEQAL 634

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIV-STSRDATPTPGVDQQQVYSQQLEQIPE 356
           AE    +      T    ++    G   S +  + S  AT        Q Y++QL Q P+
Sbjct: 635 AEERTKKLTSATPTLKAPSAGPPKGKATSGMAEAASASAT--------QKYAEQLLQYPD 686

Query: 357 IAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
           I A+G L KSS  PVEL+ESETEYVVS VKH+FKE++V Q+ + NTL D +LENVTVV  
Sbjct: 687 IKAYGVLLKSS-APVELSESETEYVVSAVKHIFKEHIVVQYDIKNTLPDTILENVTVVAT 745

Query: 417 PESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYT-LGSFSNTLKFLVKDCDPST 475
           PE +E  L ++F+IPA KLP DQP  +YVAFK+ N +    + SF+N LKF  K+ DP T
Sbjct: 746 PE-EEDVLEDDFIIPAPKLPTDQPGVVYVAFKKLNGDNSVPITSFTNILKFTSKEIDP-T 803

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSL 534
                            +E+  SDYV PT+ S F   W+  G  G +  ET  L+  K +
Sbjct: 804 SGEPEDSGYDDEYQVEDLELTGSDYVIPTFASSFDHVWEQTGANGEEESETLQLSNMKGI 863

Query: 535 KDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
            D+   LI  L + P+E +    +SS HTL L G  + G +V +  +M ++   GVT ++
Sbjct: 864 NDAMEQLISALSLQPLEGTDVALNSSTHTLKLFGKTVSGGRVASLIKMAYSSKAGVTTKI 923

Query: 595 SVRSPSEEISRIVIGAV 611
           +VR+  E ++  VI +V
Sbjct: 924 TVRAEEEGVAAAVIASV 940



>gi|395334857|gb|EJF67233.1| coatomer subunit gamma [Dichomitus squalens LYAD-421 SS1]
          Length = 926

 Score =  625 bits (1613), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 341/613 (55%), Positives = 444/613 (72%), Gaps = 20/613 (3%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSPKSTL+FAA RTL  LA+T P +V +CN+D+ENLI+D NRSVAT+AITTLLKTGN
Sbjct: 330 LFLSSPKSTLKFAATRTLAALAVTHPQSVAACNIDLENLISDPNRSVATYAITTLLKTGN 389

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFMSEISDEFKVI+VDAIRSLCLKFP+K   ML+FLSGVLRDEGGY+F
Sbjct: 390 EASVDRLMKQISGFMSEISDEFKVIIVDAIRSLCLKFPAKHESMLAFLSGVLRDEGGYDF 449

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVEAIFD++KFI + KE AL+HLCEFIEDCEFTKLSVR+LHLLGVEGPK P PTKYI
Sbjct: 450 KRAVVEAIFDMIKFIADCKEQALSHLCEFIEDCEFTKLSVRILHLLGVEGPKAPNPTKYI 509

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LEN+ VRAAAVS+LAKFG++  D ++ KSI VLL RCLDD DDEVRDRA LY
Sbjct: 510 RFIYNRVVLENATVRAAAVSSLAKFGLNNLDEKLGKSIHVLLNRCLDDVDDEVRDRAALY 569

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           LK+ ++    + Y+K++S YSL+ALE +LV Y+S+P++ ++PFD +DIPK+++ QA  E+
Sbjct: 570 LKVYEEPPLVQPYIKEESIYSLSALESKLVSYISDPDAQDQPFDATDIPKVSREQAAKES 629

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIAAF 360
            +P + +     TIG  SS          S +    P    + Q  Y+QQL ++PE+A++
Sbjct: 630 ARPSTLE-----TIGVPSS----------SKAATPPPPSAAETQSNYAQQLAEVPELASY 674

Query: 361 GPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPESD 420
           GP+  SS KP  LTESETEY VS VKH+FKE++VFQF V+NT+ D +LE V+V+MQ ++D
Sbjct: 675 GPVLNSSTKPAPLTESETEYQVSVVKHIFKEHVVFQFNVSNTIPDTVLEQVSVIMQTQAD 734

Query: 421 EGTLVEEFVIPATKL-PYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXXX 479
             +L E+F+IP   L     P  +YV+F R NPEEY   SF   LKF+ K+ DP+T    
Sbjct: 735 -SSLTEDFIIPVPTLTATTSPGIVYVSFTRDNPEEYAQASFQCILKFVSKELDPTTGEPE 793

Query: 480 XXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSCT 539
                         E+  +DY+ P+Y++ F+S WD +     + ETF+L A +SLK +C 
Sbjct: 794 EEGYEDEYQLEDT-ELAAADYIIPSYVT-FASEWDRLRSGVSLTETFSLPAMESLKAACN 851

Query: 540 TLIELLGMSPVENSGTPTSSSVHTLM-LSGTFLGGIKVLAKNRMTFAPSTGVTMELSVRS 598
           ++IE+L M P+  S  P   +VHTL        GG KVL + RMT++ + GVT+E+ VRS
Sbjct: 852 SVIEILNMQPLGGSEEPQQPTVHTLQLSGLVGGGGGKVLVRCRMTYSKAQGVTLEVGVRS 911

Query: 599 PSEEISRIVIGAV 611
             +  + +VI A+
Sbjct: 912 EQQAAADLVIAAI 924



>gi|70989083|ref|XP_749391.1| Coatomer subunit  gamma [Aspergillus fumigatus Af293]
 gi|66847022|gb|EAL87353.1| Coatomer subunit  gamma, putative [Aspergillus fumigatus Af293]
 gi|159128806|gb|EDP53920.1| Coatomer subunit gamma, putative [Aspergillus fumigatus A1163]
          Length = 916

 Score =  622 bits (1605), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 332/617 (53%), Positives = 439/617 (71%), Gaps = 18/617 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP++  +FAAIR L+  A  +P  V  CN D+E+LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLSSPRAITKFAAIRILHNFASFKPHVVNVCNPDIESLISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFM++I+DEFK+ +V+AIR+LCLKFPSKQ  ML+FLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMKQISGFMADITDEFKITIVEAIRTLCLKFPSKQAGMLAFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KR+VVE++FDL+KF+PESKE ALAHLCEFIEDCEFTKLSVR+LHLLGVEGPKT  PTKYI
Sbjct: 431 KRSVVESMFDLIKFVPESKEDALAHLCEFIEDCEFTKLSVRILHLLGVEGPKTSHPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVK S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKSSVSVLLTRCLDDTDDEVRDRAALN 550

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYV--SNPESSEKPFDLSDIPKITKAQAE 297
           L+L+ +++E AE+++K+DS +SL+  E QLV YV  ++ E+    FD+S +P +T+ QA 
Sbjct: 551 LRLMAEEDEMAERFIKNDSMFSLSTFEHQLVMYVTSTDKETFAAAFDISTVPVVTQEQAL 610

Query: 298 AENLKPRSFDL-ASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPE 356
           AE    R+  L  +T T+   S+      +N V+ +  A         Q Y++QL QIPE
Sbjct: 611 AEE---RTKKLTTATPTLKAPSAGPPKGKANGVAEAATAA------ATQKYAEQLMQIPE 661

Query: 357 IAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
           + A+G L KSS+ PVELTESETEYVV+ VKH+FKE++V Q+ + NTL D +LE+VTVV  
Sbjct: 662 LKAYGTLLKSSV-PVELTESETEYVVTAVKHVFKEHIVVQYDIKNTLPDTVLEDVTVVAT 720

Query: 417 PESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEE-YTLGSFSNTLKFLVKDCDPST 475
           P S+E  L EEF++PA KL  ++P  +YV FK+ + E  + + SF+N LKF  K+ DPS+
Sbjct: 721 P-SEEEVLEEEFIVPAPKLAANEPGIVYVTFKKLSGEHSFPVTSFTNILKFTSKEIDPSS 779

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSL 534
                            +E+  SDYV PT+   F   W+  G  G +V ET  L+  K++
Sbjct: 780 -GEPEDSGYEDEYQVEDLELTGSDYVIPTFAGSFDHVWEQTGANGEEVSETLQLSNMKNI 838

Query: 535 KDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
            D+   LI  L + P+E S    S+S HTL L G  + G +V A  +M F+  TGVT ++
Sbjct: 839 SDATEQLITALSLQPLEGSDMALSNSTHTLKLFGKTVSGGRVAALIKMAFSSKTGVTTKI 898

Query: 595 SVRSPSEEISRIVIGAV 611
           ++R+  E ++  V+ A+
Sbjct: 899 TIRAEEEGVAPAVMAAL 915



>gi|398388215|ref|XP_003847569.1| hypothetical protein MYCGRDRAFT_51289 [Zymoseptoria tritici IPO323]
 gi|339467442|gb|EGP82545.1| hypothetical protein MYCGRDRAFT_51289 [Zymoseptoria tritici IPO323]
          Length = 929

 Score =  622 bits (1605), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 324/622 (52%), Positives = 437/622 (70%), Gaps = 20/622 (3%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAAIR L++ A  +P AV+ CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 316 LFLTSPRAVTKFAAIRILHQFASFKPDAVRQCNPDIEALISNSNRSIATFAITTLLKTGN 375

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLM QI+ FMS+I+DEFKV +V+AIR+LCLKFPSKQ  ML+FLSG+LRDEGGYEF
Sbjct: 376 ESSVDRLMTQISTFMSDITDEFKVTIVEAIRTLCLKFPSKQARMLAFLSGILRDEGGYEF 435

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KR+VVE++FDL+KF+PESKE ALAHLCEFIEDCEFTKL+VR+LHLLG+EGPKT  PTKYI
Sbjct: 436 KRSVVESMFDLIKFVPESKEDALAHLCEFIEDCEFTKLAVRILHLLGMEGPKTAQPTKYI 495

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVK+S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 496 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKRSVDVLLTRCLDDTDDEVRDRAALN 555

Query: 241 LKLI--DDNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQA 296
           L+L+  +D+E A K+V++DS +SL  LE QL  YV+   +S    PFD +++P +T+ Q+
Sbjct: 556 LRLMKEEDDEVAAKFVRNDSMFSLPVLEDQLAHYVNGSSASAFANPFDFANVPVVTREQS 615

Query: 297 EAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPE 356
            AE+   R+  L +T T    + +VG   S+  ST             Q Y+Q+L  IPE
Sbjct: 616 LAED---RTKKL-TTATPTLKAPSVGPKKSD--STMAAEAAANATVVTQRYAQELSAIPE 669

Query: 357 IAAFGPLFKSSIKPV-ELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVM 415
            AA+G + KSS  PV ELTE ETEYVVS VKH+FKE+MV QF V NTL D +L +V+V+ 
Sbjct: 670 FAAYGGVLKSS--PVIELTEPETEYVVSAVKHLFKEHMVLQFNVKNTLADYILTDVSVLC 727

Query: 416 QP---ESDEGTLVEE---FVIPATKLPYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVK 469
            P   ++DE T V E   F+IP   L  ++P+S+YV+F R +   +   SF+N LKF++K
Sbjct: 728 NPISEDADEDTPVFEDDGFLIPVPVLKPEEPASVYVSFSRPDSNSFVGASFTNVLKFVLK 787

Query: 470 DCDPSTXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALT 529
           + DPST                 +++  +DY+ P +   F + W  + E+ +  ET  L+
Sbjct: 788 EIDPST-GEPEATGYDDEYQVGDLDVSAADYILPAFAGSFDNVWSGLPEDSEASETLQLS 846

Query: 530 ASKSLKDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTG 589
            +K + D+  +L++ LGM P+E S    S+S HTL + G  + G KV A  RM ++  +G
Sbjct: 847 NAKGIADAVESLVKALGMQPLEGSEVALSTSTHTLRVYGKSVAGGKVAASVRMAYSAKSG 906

Query: 590 VTMELSVRSPSEEISRIVIGAV 611
           VT++++ RS  E ++ +V+  V
Sbjct: 907 VTVKITARSEEEGLAELVVNGV 928



>gi|485929790|gb|EOD53085.1| putative coatomer subunit protein [Neofusicoccum parvum UCRNP2]
          Length = 920

 Score =  622 bits (1604), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 334/619 (53%), Positives = 438/619 (70%), Gaps = 19/619 (3%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAAIR L+  A  +P AV+ CN D+E LIT+ NRS+ATFAITTLLKTGN
Sbjct: 312 LFLTSPRAVTKFAAIRILHNFASFKPDAVRQCNPDIEALITNSNRSIATFAITTLLKTGN 371

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+GFM+EI+DEFKV +V+AIR+LCLKFPSKQ  ML+FLS +LRDEGGYEF
Sbjct: 372 ESSVDRLMKQISGFMAEITDEFKVTIVEAIRTLCLKFPSKQAGMLAFLSSILRDEGGYEF 431

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+PESKE ALAHLCEFIEDCEFTKL+VR+LHLLG+EGPKTP PTKYI
Sbjct: 432 KRAVVESMFDLIKFVPESKEDALAHLCEFIEDCEFTKLAVRILHLLGMEGPKTPQPTKYI 491

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVK+S++VLL RCLDD DDEVRDRA L 
Sbjct: 492 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKRSVRVLLNRCLDDTDDEVRDRAALN 551

Query: 241 LKLID-DNESAEKYVKDDSTYSLAALERQLVQYVS--NPESSEKPFDLSDIPKITKAQAE 297
           ++L+D D+ESA +++++DS +SL  LE QLV YV+  + ++  + FDLS +P +T+ QA+
Sbjct: 552 MRLMDEDDESAHEFIRNDSMFSLPTLEHQLVMYVTADDKDTFSQSFDLSKVPIVTREQAD 611

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE       D     T  T +    S      S S            Q Y+ QL+ IPEI
Sbjct: 612 AE-------DRTKKLTSATPTLKAPSTGPKPASRSGADAAASATAAAQKYAAQLQAIPEI 664

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
           AAFG + KSS  PVELTESETEYVVS +KH+FKE++V Q+ + NTL D +L +VT+V+ P
Sbjct: 665 AAFGGVLKSS-PPVELTESETEYVVSAIKHIFKEHIVIQYEIKNTLPDTVLADVTMVVTP 723

Query: 418 --ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEE-YTLGSFSNTLKFLVKDCDPS 474
             + +E  L EEF+IPA  L  D+P +IYV+FKRT  E  Y   SF+N LKF +K+ DPS
Sbjct: 724 AEDEEESGLEEEFIIPAPALKTDEPGTIYVSFKRTAGEATYVASSFTNILKFTLKEIDPS 783

Query: 475 TXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWD--SVGEEGQVVETFALTASK 532
           T                 +++  +DY+ P Y   F + WD  S GEE    ET  L+A K
Sbjct: 784 T-NEPEEGGYEDEYQVEDLDLNGADYIVPAYAGSFDNVWDQSSAGEEA--TETLQLSALK 840

Query: 533 SLKDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTM 592
           S++D+   + + L + P+E +    ++S HTL L G  + G KV ++ RM ++   GVTM
Sbjct: 841 SIQDAVEQIPKALSLQPLEGTDVALNTSTHTLKLYGKTVTGGKVASQVRMAYSAKAGVTM 900

Query: 593 ELSVRSPSEEISRIVIGAV 611
           ++ VRS  E ++ +V+ +V
Sbjct: 901 KIEVRSEEEGVASLVVNSV 919



>gi|226293466|gb|EEH48886.1| coatomer subunit gamma-1 [Paracoccidioides brasiliensis Pb18]
          Length = 919

 Score =  622 bits (1604), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 320/617 (51%), Positives = 430/617 (69%), Gaps = 15/617 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP+   +FAAIRTL+ LA  +P  V  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLSSPRPVSKFAAIRTLHSLASFKPNVVNPCNQDIEALISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLM QI+GFM++ +DEFK+ +V+AIR+LCLKFP+KQ  ML+FLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMTQISGFMADTTDEFKITIVEAIRTLCLKFPNKQAGMLTFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KR+VVE++FDL+KF+P SKE ALAHLCEFIEDCEFTKL+VR+LHLLGVEGPKT  PTKYI
Sbjct: 431 KRSVVESMFDLIKFMPGSKEEALAHLCEFIEDCEFTKLAVRILHLLGVEGPKTSQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LENS++RAAAV+ALAKFGV  +DPE+K+S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENSVIRAAAVTALAKFGVGQKDPELKRSVNVLLTRCLDDTDDEVRDRAALN 550

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYV--SNPESSEKPFDLSDIPKITKAQAE 297
           L+L+ +++E AE+++K+DS +SL+  E QLV YV  ++ E+    FDL+ IP +++ QA 
Sbjct: 551 LRLMKEEDEMAERFIKNDSMFSLSTFEHQLVMYVTSTDKETFATAFDLNTIPVVSQEQAL 610

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSIN-SNIVSTSRDATPTPGVDQQQVYSQQLEQIPE 356
           AE    R+  L    T  T +    S+  S  +S+S            Q Y++QL QIPE
Sbjct: 611 AEE---RTKKL----TTATPTLKAPSMTPSKAISSSGAERAALAAAATQKYAEQLAQIPE 663

Query: 357 IAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
           + A+G L KSS  PVELTESETEYVVS +KH+FKE++V Q+ + NTL D LLENV+VV+ 
Sbjct: 664 LKAYGTLLKSST-PVELTESETEYVVSAIKHIFKEHVVLQYDIKNTLPDTLLENVSVVVS 722

Query: 417 PESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEE-YTLGSFSNTLKFLVKDCDPST 475
           P  D+ +L E+F +PA +L  + P  +YVAFK+   E  + + SF+N LKF  K+ DP+T
Sbjct: 723 PSDDDESLEEDFTVPAPRLLSNDPGIVYVAFKKLGGEHNFPVTSFTNNLKFTSKEIDPTT 782

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSL 534
                            +++  SDYV P ++  F   W+  G  G +  ET  L+  K +
Sbjct: 783 -GEPEESGYEDEYQVEDLDLTGSDYVVPAFVGSFDHVWEQTGANGEEASETLQLSNVKGI 841

Query: 535 KDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
            D+   LI  L + P+E S    +++ H+L L G  + G +V    RM ++  +GVT ++
Sbjct: 842 ADATEQLIATLSLQPLEGSDIVLTNTTHSLKLYGKTVSGGRVAGLVRMAYSAKSGVTTKI 901

Query: 595 SVRSPSEEISRIVIGAV 611
           ++R+  E I+  VI +V
Sbjct: 902 TIRAEEEGIAATVIASV 918



>gi|225684072|gb|EEH22356.1| coatomer subunit gamma-2 [Paracoccidioides brasiliensis Pb03]
          Length = 919

 Score =  622 bits (1603), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 320/617 (51%), Positives = 430/617 (69%), Gaps = 15/617 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP+   +FAAIRTL+ LA  +P  V  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLSSPRPVSKFAAIRTLHSLASFKPNVVNPCNQDIEALISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLM QI+GFM++ +DEFK+ +V+AIR+LCLKFP+KQ  ML+FLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMTQISGFMADTTDEFKITIVEAIRTLCLKFPNKQAGMLTFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KR+VVE++FDL+KF+P SKE ALAHLCEFIEDCEFTKL+VR+LHLLGVEGPKT  PTKYI
Sbjct: 431 KRSVVESMFDLIKFMPGSKEEALAHLCEFIEDCEFTKLAVRILHLLGVEGPKTSQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LENS++RAAAV+ALAKFGV  +DPE+K+S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENSVIRAAAVTALAKFGVGQKDPELKRSVNVLLTRCLDDTDDEVRDRAALN 550

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYV--SNPESSEKPFDLSDIPKITKAQAE 297
           L+L+ +++E AE+++K+DS +SL+  E QLV YV  ++ E+    FDL+ IP +++ QA 
Sbjct: 551 LRLMKEEDEMAERFIKNDSMFSLSTFEHQLVMYVTSTDKETFATAFDLNTIPVVSQEQAL 610

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSIN-SNIVSTSRDATPTPGVDQQQVYSQQLEQIPE 356
           AE    R+  L    T  T +    S+  S  +S+S            Q Y++QL QIPE
Sbjct: 611 AEE---RTKKL----TTATPTLKAPSMTPSKAISSSGAERAALAAAATQKYAEQLAQIPE 663

Query: 357 IAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
           + A+G L KSS  PVELTESETEYVVS +KH+FKE++V Q+ + NTL D LLENV+VV+ 
Sbjct: 664 LKAYGTLLKSST-PVELTESETEYVVSAIKHIFKEHVVLQYDIKNTLPDTLLENVSVVVS 722

Query: 417 PESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEE-YTLGSFSNTLKFLVKDCDPST 475
           P  D+ +L E+F +PA +L  + P  +YVAFK+   E  + + SF+N LKF  K+ DP+T
Sbjct: 723 PSDDDESLEEDFTVPAPRLLSNDPGIVYVAFKKLGGEHNFPVTSFTNNLKFTSKEIDPTT 782

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSL 534
                            +++  SDYV P ++  F   W+  G  G +  ET  L+  K +
Sbjct: 783 -GEPEESGYEDEYQVEDLDLTGSDYVVPAFVGSFDHVWEQTGANGEEASETLQLSNVKGI 841

Query: 535 KDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
            D+   LI  L + P+E S    +++ H+L L G  + G +V    RM ++  +GVT ++
Sbjct: 842 ADATEQLIATLSLQPLEGSDIVLNNTTHSLKLYGKTVSGGRVAGLVRMAYSAKSGVTTKI 901

Query: 595 SVRSPSEEISRIVIGAV 611
           ++R+  E I+  VI +V
Sbjct: 902 TIRAEEEGIAATVIASV 918



>gi|119498135|ref|XP_001265825.1| Coatomer subunit gamma, putative [Neosartorya fischeri NRRL 181]
 gi|119413989|gb|EAW23928.1| Coatomer subunit gamma, putative [Neosartorya fischeri NRRL 181]
          Length = 916

 Score =  622 bits (1603), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 332/617 (53%), Positives = 437/617 (70%), Gaps = 18/617 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP++  +FAAIR L+  A  +P  V  CN D+E+LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLSSPRAITKFAAIRILHNFASFKPHVVNVCNPDIESLISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFM++I+DEFK+ +V+AIR+LCLKFPSKQ  ML+FLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMKQISGFMADITDEFKITIVEAIRTLCLKFPSKQAGMLAFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KR+VVE++FDL+KF+PESKE ALAHLCEFIEDCEFTKLSVR+LHLLG+EGPKT  PTKYI
Sbjct: 431 KRSVVESMFDLIKFVPESKEDALAHLCEFIEDCEFTKLSVRILHLLGMEGPKTSHPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVK S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKSSVSVLLTRCLDDTDDEVRDRAALN 550

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYV--SNPESSEKPFDLSDIPKITKAQAE 297
           L+L+ +++E AE+++K+DS +SL+  E QLV YV  ++ E+    FD+S +P +T+ QA 
Sbjct: 551 LRLMAEEDEMAERFIKNDSMFSLSTFEHQLVMYVTSTDKETFAAAFDVSTVPVVTQEQAL 610

Query: 298 AENLKPRSFDL-ASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPE 356
           AE    R+  L  +T T+   S+      +N V+ +  A         Q Y++QL QIPE
Sbjct: 611 AEE---RTKKLTTATPTLKAPSAGPPKGKANGVAEAATAA------ATQKYAEQLMQIPE 661

Query: 357 IAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
           + A+G L KSS+ PVELTESETEYVV+ VKH+FKE++V Q+ + NTL D +LE+VTVV  
Sbjct: 662 LKAYGTLLKSSV-PVELTESETEYVVTAVKHVFKEHIVVQYDIKNTLPDTVLEDVTVVAT 720

Query: 417 PESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEE-YTLGSFSNTLKFLVKDCDPST 475
           P S+E  L EEF++PA KL  ++P  +YV FK+   E  + + SF+N LKF  K+ DP T
Sbjct: 721 P-SEEEVLEEEFIVPAPKLATNEPGIVYVTFKKLAGEHSFPVTSFTNILKFTSKEIDP-T 778

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSL 534
                            +E+  SDYV PT+   F   W+  G  G +V ET  L+  KS+
Sbjct: 779 SGEPEDSGYEDEYQVEDLELTGSDYVIPTFAGSFDHVWEQTGANGEEVSETLQLSNMKSI 838

Query: 535 KDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
            D+   LI  L + P+E S    S+S HTL L G  + G +V A  +M F+  TGVT ++
Sbjct: 839 SDATEQLITALSLQPLEGSDVALSNSTHTLKLFGKTVSGGRVAALIKMAFSSKTGVTTKI 898

Query: 595 SVRSPSEEISRIVIGAV 611
           ++R+  E ++  V+ A+
Sbjct: 899 TIRAEEEGVAPAVMAAL 915



>gi|449302536|gb|EMC98545.1| hypothetical protein BAUCODRAFT_32598 [Baudoinia compniacensis UAMH
           10762]
          Length = 927

 Score =  620 bits (1600), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 327/620 (52%), Positives = 439/620 (70%), Gaps = 17/620 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAAIR L++ A  +P AV+SCN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 315 LFLTSPRAVSKFAAIRILHQFATFKPDAVRSCNPDIEALISNTNRSIATFAITTLLKTGN 374

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ FMSEI+DEFKV +V+AIR+LCLKFPSKQ  ML+FLSG+LRDEGGYEF
Sbjct: 375 ESSVDRLMKQISNFMSEITDEFKVTIVEAIRTLCLKFPSKQAGMLTFLSGILRDEGGYEF 434

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+PESKE AL+HLCEFIEDCEFTKL+VR+LHLLG+EGPKTP PTKYI
Sbjct: 435 KRAVVESMFDLIKFVPESKEEALSHLCEFIEDCEFTKLAVRILHLLGMEGPKTPQPTKYI 494

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV   DP+VK S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 495 RYIYNRVVLENAIVRAAAVTALAKFGVGQTDPDVKSSVHVLLTRCLDDTDDEVRDRAALN 554

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYV--SNPESSEKPFDLSDIPKITKAQAE 297
           L+L+ +++E A K+V++DS +SL  LE QL  YV  ++ E+  +PFDLS IP +T+ Q+ 
Sbjct: 555 LRLMQEEDEVASKFVRNDSMFSLPVLEDQLAHYVNGTSAEAFAEPFDLSKIPVVTREQSL 614

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE+   R+  L +T T    + ++G   +   +   DA     V  Q+ Y+QQL+ +PE 
Sbjct: 615 AED---RTKKL-TTATPTLKAPSIGPKKAEAGTAVADAAREATVASQK-YAQQLQAVPEF 669

Query: 358 AAFGPLFKSSIKPV-ELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
           + +G + KSS  PV ELTESETEYVV+ VKH+FK++ V QF + NT+ D +L  V+V+  
Sbjct: 670 SNYGAVLKSS--PVIELTESETEYVVNAVKHLFKDHFVLQFDIKNTIPDYVLSEVSVLCT 727

Query: 417 PESDEG---TLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDP 473
           P S +G   TL EEF++PAT L  D+P  +YV+F R    ++   SF+N LKF V++ DP
Sbjct: 728 PTSGDGEASTLEEEFILPATMLKVDEPGIVYVSFTRPGDADFVAASFTNVLKFTVREIDP 787

Query: 474 STXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG--QVVETFALTAS 531
           ST                 +++  +DYV P +   F + W  +   G  +  ET  L+ +
Sbjct: 788 ST-SEPEEGGYEDEYQVGDLDLTGADYVLPAFAGSFDNIWSGLESSGTDEAEETLQLSNA 846

Query: 532 KSLKDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVT 591
           KS+ ++   L++ LGM P+E S    S S H L L G  +GG KV A  RM ++  +GVT
Sbjct: 847 KSIAEAVEMLVKALGMQPLEGSEVALSPSTHQLRLYGKSVGGGKVGAMVRMAYSAKSGVT 906

Query: 592 MELSVRSPSEEISRIVIGAV 611
           ++++ RS  E ++ +V+G V
Sbjct: 907 VKITARSEEEGLASLVVGGV 926



>gi|115386136|ref|XP_001209609.1| hypothetical protein ATEG_06923 [Aspergillus terreus NIH2624]
 gi|114190607|gb|EAU32307.1| hypothetical protein ATEG_06923 [Aspergillus terreus NIH2624]
          Length = 898

 Score =  620 bits (1599), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 325/617 (52%), Positives = 432/617 (70%), Gaps = 18/617 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP++  +FAAIR L+  A  +P  V  CN D+E+LI++ NRS+ATFAITTLLKTGN
Sbjct: 293 LFLSSPRAITKFAAIRILHNFATFKPHVVNVCNPDIESLISNSNRSIATFAITTLLKTGN 352

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFM++I+DEFK+ +V+AIR+LCLKFPSKQ  ML+FLSG+LRDEGGY+F
Sbjct: 353 EASVDRLMKQISGFMADITDEFKITIVEAIRTLCLKFPSKQAGMLAFLSGILRDEGGYDF 412

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KR+VVE++FDL+KF+PESKE ALAHLCEFIEDCEFTKLSVR+LHLLGVEGPKT  PTKYI
Sbjct: 413 KRSVVESMFDLIKFVPESKEDALAHLCEFIEDCEFTKLSVRILHLLGVEGPKTSHPTKYI 472

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVK S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 473 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKSSVSVLLTRCLDDTDDEVRDRAALN 532

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYVS--NPESSEKPFDLSDIPKITKAQAE 297
           L+L+ +++E A  ++K+DS YSL+  E QLV YV+  + ++    FD+S IP +++ QA 
Sbjct: 533 LRLMAEEDEMASSFIKNDSMYSLSTFEHQLVMYVTSNDKQTFAAAFDVSTIPVVSQEQAL 592

Query: 298 AENLKPRSFDLAS-TQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPE 356
           AE    R+  L S T T+   ++      +N V+ +  A         Q Y++QL QIPE
Sbjct: 593 AEE---RTKKLTSATPTLKAPTAGPTKSKANGVAEAATAA------ATQKYAEQLMQIPE 643

Query: 357 IAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
           +  +G L KSS+ PVEL+ESETEYVV+ VKH+FKE++V Q+ + NTL D +LE+VTV   
Sbjct: 644 LKEYGTLLKSSV-PVELSESETEYVVTAVKHIFKEHVVLQYDIKNTLPDTVLEDVTVAAT 702

Query: 417 PESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYT-LGSFSNTLKFLVKDCDPST 475
           P S+E  L EEF++PA KL  ++P  +YV FK+   E    + SF+N LKF  K+ DP+T
Sbjct: 703 P-SEEDVLEEEFIVPAPKLATNEPGIVYVTFKKLGGEHSVPVTSFTNVLKFTSKEIDPTT 761

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSL 534
                            +E+  SDYV PT+   F   W+  G  G ++ ET  L+  K +
Sbjct: 762 -GEPEESGYDDEYQVEDLELTGSDYVIPTFAGSFDHVWEQTGANGEEISETLQLSNMKGI 820

Query: 535 KDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
            D+   LI  L + P+E +    S+S HTL L G  + G +V +  +M ++  TGVT ++
Sbjct: 821 TDATEQLISTLSLQPLEGTDVALSNSTHTLKLFGKTVTGGRVASLIKMAYSSKTGVTTKI 880

Query: 595 SVRSPSEEISRIVIGAV 611
           +VR+  E ++  VI +V
Sbjct: 881 TVRAEEEGVASAVIASV 897



>gi|259482623|tpe|CBF77281.1| TPA: Coatomer subunit gamma, putative (Eurofung) [Aspergillus
           nidulans FGSC A4]
          Length = 917

 Score =  620 bits (1599), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 330/617 (53%), Positives = 433/617 (70%), Gaps = 17/617 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP++  +FAAIR L++ A  +P  V  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLSSPRAITKFAAIRILHRFASFKPHVVNVCNPDIEALISNTNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFM++I+DEFK+ +V+AIR+LCLKFPSKQ  MLSFLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMKQISGFMADITDEFKITIVEAIRTLCLKFPSKQAGMLSFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KR+VVE++FDL+KF+PESKE ALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKT  PTKYI
Sbjct: 431 KRSVVESMFDLIKFVPESKEDALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTSQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVK S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKSSVSVLLTRCLDDTDDEVRDRAALN 550

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYVS--NPESSEKPFDLSDIPKITKAQAE 297
           L+L+ +++E A  ++K++S YSL+  E QLV YV+  + E+    FD+S IP +++ QA 
Sbjct: 551 LRLMAEEDEMANLFIKNESMYSLSTFEHQLVMYVTSGDKETFATAFDVSTIPVVSQEQAL 610

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE  + +    A+      S+       +N V+ +  A         Q Y++QL QIPE+
Sbjct: 611 AEE-RTKKLTSATPTLKAPSTGPPKGAKANGVAEAATAA------ATQKYAEQLMQIPEL 663

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
            A+G L KSS+ PVEL+ESETEYVV+ VKH+FKE++V Q+ + NTL D +LE+VTVV  P
Sbjct: 664 KAYGTLLKSSV-PVELSESETEYVVTAVKHIFKEHIVLQYDIKNTLPDTVLEDVTVVATP 722

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYT-LGSFSNTLKFLVKDCDPSTX 476
            S+E  L EEF++PA KL  ++P  +YV FK+   E+   + SF+N LKF  K+ DP+T 
Sbjct: 723 -SEEDILEEEFIVPAPKLNTNEPGVVYVTFKKLEGEQSVPVVSFTNNLKFTTKEIDPTT- 780

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSLK 535
                           +E+  SDYV PT+   F   W+  G  G +V ET  L+  K + 
Sbjct: 781 GEPEDSGYEDEYQVNDLELTGSDYVIPTFAGSFDHVWEQAGANGEEVSETLQLSNLKGIA 840

Query: 536 DSCTTLIELLGMSPVENSGTPTSSSVHTLMLSG-TFLGGIKVLAKNRMTFAPSTGVTMEL 594
           D+   LI  L + P+E +    S+S HTL L G T LGG +V A  +M ++  TGVT ++
Sbjct: 841 DATEQLISTLSLQPLEGTDVALSNSTHTLKLFGKTVLGG-RVAALIKMAYSTKTGVTTKI 899

Query: 595 SVRSPSEEISRIVIGAV 611
           +VR+    ++  VI ++
Sbjct: 900 TVRAEEGGVAPAVIASL 916



>gi|67536754|ref|XP_662151.1| hypothetical protein AN4547.2 [Aspergillus nidulans FGSC A4]
 gi|40741700|gb|EAA60890.1| hypothetical protein AN4547.2 [Aspergillus nidulans FGSC A4]
          Length = 912

 Score =  620 bits (1599), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 330/617 (53%), Positives = 433/617 (70%), Gaps = 17/617 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP++  +FAAIR L++ A  +P  V  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 306 LFLSSPRAITKFAAIRILHRFASFKPHVVNVCNPDIEALISNTNRSIATFAITTLLKTGN 365

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFM++I+DEFK+ +V+AIR+LCLKFPSKQ  MLSFLSG+LRDEGGYEF
Sbjct: 366 EASVDRLMKQISGFMADITDEFKITIVEAIRTLCLKFPSKQAGMLSFLSGILRDEGGYEF 425

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KR+VVE++FDL+KF+PESKE ALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKT  PTKYI
Sbjct: 426 KRSVVESMFDLIKFVPESKEDALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTSQPTKYI 485

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVK S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 486 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKSSVSVLLTRCLDDTDDEVRDRAALN 545

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYVS--NPESSEKPFDLSDIPKITKAQAE 297
           L+L+ +++E A  ++K++S YSL+  E QLV YV+  + E+    FD+S IP +++ QA 
Sbjct: 546 LRLMAEEDEMANLFIKNESMYSLSTFEHQLVMYVTSGDKETFATAFDVSTIPVVSQEQAL 605

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE  + +    A+      S+       +N V+ +  A         Q Y++QL QIPE+
Sbjct: 606 AEE-RTKKLTSATPTLKAPSTGPPKGAKANGVAEAATAA------ATQKYAEQLMQIPEL 658

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
            A+G L KSS+ PVEL+ESETEYVV+ VKH+FKE++V Q+ + NTL D +LE+VTVV  P
Sbjct: 659 KAYGTLLKSSV-PVELSESETEYVVTAVKHIFKEHIVLQYDIKNTLPDTVLEDVTVVATP 717

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYT-LGSFSNTLKFLVKDCDPSTX 476
            S+E  L EEF++PA KL  ++P  +YV FK+   E+   + SF+N LKF  K+ DP+T 
Sbjct: 718 -SEEDILEEEFIVPAPKLNTNEPGVVYVTFKKLEGEQSVPVVSFTNNLKFTTKEIDPTT- 775

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSLK 535
                           +E+  SDYV PT+   F   W+  G  G +V ET  L+  K + 
Sbjct: 776 GEPEDSGYEDEYQVNDLELTGSDYVIPTFAGSFDHVWEQAGANGEEVSETLQLSNLKGIA 835

Query: 536 DSCTTLIELLGMSPVENSGTPTSSSVHTLMLSG-TFLGGIKVLAKNRMTFAPSTGVTMEL 594
           D+   LI  L + P+E +    S+S HTL L G T LGG +V A  +M ++  TGVT ++
Sbjct: 836 DATEQLISTLSLQPLEGTDVALSNSTHTLKLFGKTVLGG-RVAALIKMAYSTKTGVTTKI 894

Query: 595 SVRSPSEEISRIVIGAV 611
           +VR+    ++  VI ++
Sbjct: 895 TVRAEEGGVAPAVIASL 911



>gi|378733028|gb|EHY59487.1| hypothetical protein HMPREF1120_07475 [Exophiala dermatitidis
           NIH/UT8656]
          Length = 934

 Score =  619 bits (1595), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 318/618 (51%), Positives = 433/618 (70%), Gaps = 13/618 (2%)

Query: 2   FLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGNE 61
           FL+SP++  +FAAIR L+  A  +P AV S N D+E LI++ NRS+ATFAITTLLKTGNE
Sbjct: 323 FLTSPRAVTKFAAIRILHAFASFKPQAVHSANPDIEALISNSNRSIATFAITTLLKTGNE 382

Query: 62  ASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEFK 121
           ASVDRLMKQI+GFM+EI+DEFK+ +V+AIR+LC+KFPSKQ  ML+FLSG+LRDEGGYEFK
Sbjct: 383 ASVDRLMKQISGFMAEITDEFKITIVEAIRTLCMKFPSKQAGMLTFLSGILRDEGGYEFK 442

Query: 122 RAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYIR 181
           RAVVE++FDL+KF+P SKE  L+HLCEFIEDCEFTKL+VR+LHL+GVEGPKTP PTKYIR
Sbjct: 443 RAVVESMFDLIKFVPGSKEETLSHLCEFIEDCEFTKLAVRILHLIGVEGPKTPQPTKYIR 502

Query: 182 YIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILYL 241
           YIYNRV+LEN++VRAAAV+ALAKFGV  +DPEVKKS+ VLL RCLDD DDEVRDRA L L
Sbjct: 503 YIYNRVVLENALVRAAAVTALAKFGVGQKDPEVKKSVSVLLRRCLDDTDDEVRDRAALNL 562

Query: 242 KLI-DDNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQAEA 298
           +L+ +D+E AE+++K+DS +SL+  E +LV YV+  + +   KPFD++++P +++ QA A
Sbjct: 563 RLMQEDDEIAERFIKNDSMFSLSTFEHKLVLYVTADDKAVFSKPFDITEVPVVSQEQALA 622

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
           E    R+  L +T T    + + G       + +    P       Q Y+Q   +IPE+A
Sbjct: 623 EE---RTKKL-TTATPTLKAPSTGPTKQKGANGAAGEAPASAAAAAQKYTQIFSRIPELA 678

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
           A+GP+ KSS   VELTESETEYVV  VKH+FKEN+V Q+ + NTL+  +LENVTV+  P 
Sbjct: 679 AYGPVLKSS-PVVELTESETEYVVGAVKHIFKENIVIQYDIKNTLDQTVLENVTVLTTPS 737

Query: 419 SD--EGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEE-YTLGSFSNTLKFLVKDCDPST 475
            D  E TL EEF+IPA  L  ++P  +YVAFK+T  E+ + + +FSN LKF  K+ DP+T
Sbjct: 738 EDDEEPTLEEEFIIPAPALKTNEPGVVYVAFKKTGGEKSFPITTFSNVLKFTSKEIDPTT 797

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSL 534
                            +E+  +DYV P +   F   W+  G  G +  ET  L++ KSL
Sbjct: 798 -GEAEESGYEDEYEVENLELTGADYVLPAFAGSFDHIWEGTGANGEEASETLQLSSIKSL 856

Query: 535 KDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
            D+   L + L + P+E +    S++ H L L G  + G +V A  +M ++  +GVT+++
Sbjct: 857 ADATEQLAQTLSLQPLEGTDVVLSNTTHALKLYGKSVTGGRVAALIKMAYSAKSGVTVKV 916

Query: 595 SVRSPSEEISRIVIGAVV 612
           SVR+    ++  ++ A++
Sbjct: 917 SVRTDEAGLAPSILSALL 934



>gi|453080009|gb|EMF08061.1| coatomer subunit gamma [Mycosphaerella populorum SO2202]
          Length = 919

 Score =  617 bits (1591), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 318/620 (51%), Positives = 428/620 (69%), Gaps = 19/620 (3%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAAIR L++ A  +P AV+ CN D+E+LI++ NRS+ATFAITTLLKTGN
Sbjct: 309 LFLTSPRAVTKFAAIRILHQFASFKPDAVRQCNPDIESLISNSNRSIATFAITTLLKTGN 368

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLM QI+ FMSEI+DEFKV +V+AIR+LCLKFPSKQ  MLSFLSG+LRDEGGY+F
Sbjct: 369 ESSVDRLMTQISTFMSEITDEFKVTIVEAIRTLCLKFPSKQARMLSFLSGILRDEGGYDF 428

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KR+VVE++FDL+KF+PE+++ ALAHLCEFIEDCEFTKL+VR+LH+LG+EGPKT  PTKYI
Sbjct: 429 KRSVVESMFDLIKFVPEARDEALAHLCEFIEDCEFTKLAVRILHVLGMEGPKTAQPTKYI 488

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVKKS+ VLL RCLDD DDEVRDRA L 
Sbjct: 489 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKKSVGVLLKRCLDDTDDEVRDRAALN 548

Query: 241 LKLI--DDNESAEKYVKDDSTYSLAALERQLVQYVS--NPESSEKPFDLSDIPKITKAQA 296
           L+L+  DD+E + ++V++DS +SL  LE QL  YV+  + E+   PFD S +P +T+ Q+
Sbjct: 549 LRLMKDDDDEFSGRFVRNDSMFSLPILEDQLAHYVNGGSAEAFANPFDFSSVPVVTREQS 608

Query: 297 EAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPE 356
            AE       D     T  T +    +I       S          Q Q Y+ QL  IPE
Sbjct: 609 LAE-------DRTKKLTTATPTLKAPTIGPKKTDASAAEVVAQASAQTQKYASQLSAIPE 661

Query: 357 IAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
            +++G + KSS   VELTESETEYVVS VKH+FKE++V QF + NTL D +L +V+V+  
Sbjct: 662 FSSYGGVLKSS-SIVELTESETEYVVSAVKHLFKEHVVIQFDIKNTLADYVLSDVSVICT 720

Query: 417 P----ESDEGTLVEE-FVIPATKLPYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDC 471
           P    E +E  LV++ FVIP   L  D+P ++YV+F +  P ++   SF+N LKF +K+ 
Sbjct: 721 PSSPDEEEESALVDDGFVIPVDLLKSDEPGTVYVSFSKP-PGQFVAASFTNVLKFTLKEI 779

Query: 472 DPSTXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTAS 531
           DP+T                 +E+  SDYV P +   F + W S+ +  +  ET  L+ +
Sbjct: 780 DPTT-GEPEEGGYEDEYQTNDLELDGSDYVVPAFAGSFDNIWTSIPDASEASETLQLSNA 838

Query: 532 KSLKDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVT 591
           KS+ D+   L++ LGM P+E S    S+S HTL L G  + G KV    RM ++  +GVT
Sbjct: 839 KSIADAVELLVKALGMQPLEGSEVALSTSTHTLRLYGKSVTGGKVAGTVRMAYSAKSGVT 898

Query: 592 MELSVRSPSEEISRIVIGAV 611
           ++++ RS  E ++ +V+G V
Sbjct: 899 VKITARSEEEGLAALVVGGV 918



>gi|169775119|ref|XP_001822027.1| coatomer subunit gamma [Aspergillus oryzae RIB40]
 gi|238496261|ref|XP_002379366.1| Coatomer subunit  gamma, putative [Aspergillus flavus NRRL3357]
 gi|83769890|dbj|BAE60025.1| unnamed protein product [Aspergillus oryzae RIB40]
 gi|220694246|gb|EED50590.1| Coatomer subunit gamma, putative [Aspergillus flavus NRRL3357]
          Length = 915

 Score =  617 bits (1590), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 327/616 (53%), Positives = 429/616 (69%), Gaps = 16/616 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP++  +FAAIR L+  A  +P  V  CN D+E+LI++ NRS+ATFAITTLLKTGN
Sbjct: 310 LFLSSPRAITKFAAIRILHNFATFKPHVVNVCNPDIESLISNSNRSIATFAITTLLKTGN 369

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFM++I+DEFK+ +V+AIR+LCLKFPSKQ  ML+FLSG+LRDEGGYEF
Sbjct: 370 EASVDRLMKQISGFMADITDEFKITIVEAIRTLCLKFPSKQAGMLAFLSGILRDEGGYEF 429

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KR+VVE++FDL+KF+PES+E ALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKT  PTKYI
Sbjct: 430 KRSVVESMFDLIKFVPESREDALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTSHPTKYI 489

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVK S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 490 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKSSVSVLLTRCLDDTDDEVRDRAALN 549

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQAE 297
           L+L+ +++E+A  ++K+DS YSL+  E QLV YV++ E       FD+S +P +T+ QA 
Sbjct: 550 LRLMAEEDETASLFLKNDSMYSLSTFEHQLVMYVTSTEKETFAAAFDVSTVPVVTQEQAL 609

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE    R+  L +T T    + + G   S     +        V   Q Y+++L +IPE+
Sbjct: 610 AEE---RTKKL-TTATPTLKAPSTGPPKSK----ANGVAEAATVAATQKYAEELMRIPEL 661

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
             +G L KSS+ PVELTESETEYVV+ VKH+FKE++V Q+ + NTL D +LE+VTVV  P
Sbjct: 662 KEYGTLLKSSV-PVELTESETEYVVTAVKHVFKEHIVVQYDIKNTLPDTVLEDVTVVATP 720

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYT-LGSFSNTLKFLVKDCDPSTX 476
            S+E  L EEF++PA KL  ++P  +YV FK+   E    + SF+N LKF  K+ DP+T 
Sbjct: 721 -SEEDVLEEEFIVPAPKLATNEPGIVYVTFKKLAGENSVPVTSFTNILKFTSKEIDPTT- 778

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSLK 535
                           +E+  SDYV PT+   F   W+  G  G +  ET  L+  K + 
Sbjct: 779 GEPEDSGYEDEYQVEDLELTGSDYVIPTFAGSFDHVWEQTGANGEEESETLQLSNMKGIS 838

Query: 536 DSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           D+   LI  L + P+E +    S+S HTL L G  + G +V A  +M F+  TGVT +++
Sbjct: 839 DATEQLISALSLQPLEGTDVALSNSTHTLKLFGKTVSGGRVAALIKMAFSSKTGVTTKIT 898

Query: 596 VRSPSEEISRIVIGAV 611
           VR+  E ++  VI ++
Sbjct: 899 VRAEEEGVAPAVIASL 914



>gi|391873061|gb|EIT82136.1| vesicle coat complex COPI, gamma subunit [Aspergillus oryzae 3.042]
          Length = 915

 Score =  616 bits (1589), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 326/616 (52%), Positives = 429/616 (69%), Gaps = 16/616 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP++  +FAAIR L+  A  +P  V  CN D+E+LI++ NRS+ATFAITTLLKTGN
Sbjct: 310 LFLSSPRAITKFAAIRILHNFATFKPHVVNVCNPDIESLISNSNRSIATFAITTLLKTGN 369

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFM++I+DEFK+ +V+AIR+LCLKFPSKQ  ML+FLSG+LRDEGGYEF
Sbjct: 370 EASVDRLMKQISGFMADITDEFKITIVEAIRTLCLKFPSKQAGMLAFLSGILRDEGGYEF 429

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KR+VVE++FDL+KF+PES+E ALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKT  PTKYI
Sbjct: 430 KRSVVESMFDLIKFVPESREDALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTSHPTKYI 489

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVK S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 490 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKSSVSVLLTRCLDDTDDEVRDRAALN 549

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQAE 297
           L+L+ +++E+A  ++K+DS YSL+  E QLV YV++ E       FD+S +P +T+ QA 
Sbjct: 550 LRLMAEEDETASLFLKNDSMYSLSTFEHQLVMYVTSTEKETFAAAFDVSTVPVVTQEQAL 609

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE    R+  L +T T    + + G   S     +        V   Q Y+++L +IPE+
Sbjct: 610 AEE---RTKKL-TTATPTLKAPSTGPPKSK----ANGVAEAATVAATQKYAEELMRIPEL 661

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
             +G L KSS+ PVELTESETEYVV+ VKH+FKE++V Q+ + NTL D +LE+VTVV  P
Sbjct: 662 KEYGTLLKSSV-PVELTESETEYVVTAVKHVFKEHIVVQYDIKNTLPDTVLEDVTVVATP 720

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYT-LGSFSNTLKFLVKDCDPSTX 476
            S+E  L EEF++PA KL  ++P  +YV FK+   E    + SF+N LKF  K+ DP+T 
Sbjct: 721 -SEEDVLEEEFIVPAPKLATNEPGIVYVTFKKLAGENSVPVTSFTNILKFTSKEIDPTT- 778

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSLK 535
                           +E+  SDY+ PT+   F   W+  G  G +  ET  L+  K + 
Sbjct: 779 GEPEDSGYEDEYQVEDLELTGSDYIIPTFAGSFDHVWEQTGANGEEESETLQLSNMKGIS 838

Query: 536 DSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           D+   LI  L + P+E +    S+S HTL L G  + G +V A  +M F+  TGVT +++
Sbjct: 839 DATEQLISALSLQPLEGTDVALSNSTHTLKLFGKTVSGGRVAALIKMAFSSKTGVTTKIT 898

Query: 596 VRSPSEEISRIVIGAV 611
           VR+  E ++  VI ++
Sbjct: 899 VRAEEEGVAPAVIASL 914



>gi|511008243|gb|EPB89512.1| hypothetical protein HMPREF1544_03595 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 935

 Score =  616 bits (1588), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 327/625 (52%), Positives = 429/625 (68%), Gaps = 36/625 (5%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           +FLSSPK TLRFAAIRTLN +++  P +V  CNLD+ NLI DQNRS+A FAITTLLKTG+
Sbjct: 332 IFLSSPKPTLRFAAIRTLNSVSIEMPASVAPCNLDITNLIGDQNRSIAIFAITTLLKTGD 391

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVD+LM+QI GFM +I D+FK+IVV+AIRSLCLKFP+KQ  ML+FL  +LRDEGGY F
Sbjct: 392 ESSVDQLMQQINGFMLDIPDDFKIIVVNAIRSLCLKFPAKQSTMLTFLGNILRDEGGYSF 451

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K+ +VEAI  +VK IPE +EAAL+ LCEFIEDCEF KLSVR+LHLLG +G K  TPTKYI
Sbjct: 452 KKTIVEAIMAMVKHIPECREAALSQLCEFIEDCEFPKLSVRILHLLGQQGHKMSTPTKYI 511

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRVILENSIVRAAAVSAL KFG+   D  VK+S+ VLLTRCL+D +DEVRDRA LY
Sbjct: 512 RYIYNRVILENSIVRAAAVSALVKFGIYGRDASVKQSVVVLLTRCLNDVNDEVRDRATLY 571

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           L ++ + + A+ Y  +D+TY LA LE +L++YV + E++ K F+LS IP I+KA+ + E 
Sbjct: 572 LAMLKNEQLAKSYSANDATYPLATLESKLLEYVGSHENA-KQFNLSAIPVISKAEEQLEQ 630

Query: 301 LKPRSFD------LASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQI 354
              R+        L+S Q  G SS A      NI   S        VD Q  Y ++L  I
Sbjct: 631 YHTRANTNSSLALLSSNQQGGCSSGA----KKNIAPAS--------VDFQ--YGEKLSSI 676

Query: 355 PEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVV 414
           P+ + +GPLFKS+   + LTE ETEY VSC+KH+F +++VFQF  TNTLNDQ+LE+V ++
Sbjct: 677 PQFSNYGPLFKST-AAIHLTEEETEYTVSCIKHIFDKHIVFQFDCTNTLNDQVLEDVHMM 735

Query: 415 MQPESDE----GTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEE--YTLGSFSNTLKFLV 468
           MQP  DE      L++   IPA +L Y    S+YVAF++ +P++   T   F+NTL F V
Sbjct: 736 MQPNIDEEGEVAGLIQVADIPADRLEYGVTQSLYVAFEQQDPDDELATNVVFNNTLVFQV 795

Query: 469 KDCDPSTXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFAL 528
           KDCDP+T                 +E+ TSDY+ P  I ++         + QVVETFAL
Sbjct: 796 KDCDPAT-GEADPEGYGDEYQVEAVEVATSDYIRPDCIENYQEL-----NQNQVVETFAL 849

Query: 529 TASK--SLKDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAP 586
              K  SLK +CT+LI LLGM P+E +  P ++++H L+LSGTF+ G K+  + +MTF  
Sbjct: 850 DKDKAPSLKAACTSLISLLGMRPLEGTEDPKNNNLHVLLLSGTFIDGTKISCQCKMTFDA 909

Query: 587 STGVTMELSVRSPSEEISRIVIGAV 611
           S GV  ++ + S  E +S+ V+ A+
Sbjct: 910 SNGVAFQVKISSQDEYVSQFVLVAI 934



>gi|384495301|gb|EIE85792.1| hypothetical protein RO3G_10502 [Rhizopus delemar RA 99-880]
          Length = 844

 Score =  615 bits (1586), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 321/613 (52%), Positives = 432/613 (70%), Gaps = 16/613 (2%)

Query: 2   FLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGNE 61
           FLSSPK TLR A++RTLN LA+ +P+AV SCNLD+E+L++D NRS+AT AITTLLKT NE
Sbjct: 244 FLSSPKPTLRLASVRTLNNLALRKPSAVISCNLDIESLVSDSNRSIATIAITTLLKTANE 303

Query: 62  ASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEFK 121
            S+DRLM QI+ FM + SDEFKVI+V  + SLC+KFP KQV ML+FL  +LRD GGY+FK
Sbjct: 304 TSIDRLMSQISKFMGDASDEFKVIIVSTVHSLCIKFPRKQVEMLTFLGSLLRDGGGYDFK 363

Query: 122 RAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYIR 181
           + VVEA+FD+V  I ESK+ AL++LCEFIEDCEFTKLSVR+LHLLGVEGPKT +PTKYIR
Sbjct: 364 KTVVEAMFDIVHVISESKDLALSYLCEFIEDCEFTKLSVRILHLLGVEGPKTNSPTKYIR 423

Query: 182 YIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILYL 241
           +IYNRVILEN+IVRAAAV+ALAKFG+S  + +VK +IKVLL RC DD+DDEVRDRA L L
Sbjct: 424 HIYNRVILENTIVRAAAVNALAKFGLSTSEDDVKSNIKVLLIRCQDDSDDEVRDRATLAL 483

Query: 242 KLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKA-QAEAEN 300
           +L+   +S ++   D S+++L  LER+L+QY+ + +++EK FDLS IP  +KA +A   N
Sbjct: 484 ELMKQRDSGKQCGFDGSSWALPILERELIQYIGS-KTNEKAFDLSTIPITSKAVRANPSN 542

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIAAF 360
            + +  D      I   +  V +  +N+     +A     +DQ+ +Y++ L  +PEI  F
Sbjct: 543 EQRQPTD----SIIPLQTDNVYNKMNNL-----NARQNSLLDQKAIYTEALSSVPEITTF 593

Query: 361 GPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPESD 420
           G L KSS K V +TE+ETEYVV CVKH+F +++VFQF   NTLNDQLLENV VVM  ++ 
Sbjct: 594 GALLKSS-KRVHVTETETEYVVYCVKHLFAKHIVFQFDCLNTLNDQLLENVEVVMDIDNQ 652

Query: 421 EGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXXXX 480
           E  LV+ F +PA+K+ Y+    IYVA+++     + + SFS  LKF VKDCDP T     
Sbjct: 653 ELGLVKVFDLPASKIEYNALKHIYVAYEKQEISSFPVASFSCKLKFTVKDCDPVT-GEPD 711

Query: 481 XXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKS--LKDSC 538
                       IE+   DY+ PTYIS+F   ++ +  +G+VV+ FAL   K+  L+ +C
Sbjct: 712 EQGYEDEYRIDNIELSIKDYIQPTYISEFEEEFNKLA-DGEVVQVFALDLKKAPNLQVAC 770

Query: 539 TTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSVRS 598
           TT+I L G+ P+++S    + ++HTL++SGTFL G K+LAK RM F  ++G   ELSVRS
Sbjct: 771 TTIINLFGLQPLQDSSLLRNPNIHTLIMSGTFLTGKKILAKCRMMFNSASGAAFELSVRS 830

Query: 599 PSEEISRIVIGAV 611
               IS + + A+
Sbjct: 831 EDIAISEVALSAI 843



>gi|408388175|gb|EKJ67865.1| hypothetical protein FPSE_12013 [Fusarium pseudograminearum CS3096]
          Length = 916

 Score =  615 bits (1585), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 335/617 (54%), Positives = 441/617 (71%), Gaps = 18/617 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAA+R L+  A  +P AV  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLTSPRAVTKFAALRILHNFASFKPNAVNPCNPDIELLISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+ FMSEI+DEFK+ +V+AIR+LCLKFPSKQ  ML+FLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMKQISTFMSEITDEFKITIVEAIRTLCLKFPSKQAGMLTFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+P+SKE ALAHLCEFIEDCEFTKL+VR+LHL+G+EGPKT  PTKYI
Sbjct: 431 KRAVVESMFDLIKFVPDSKEDALAHLCEFIEDCEFTKLAVRILHLIGLEGPKTAQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DP+VK S++VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPDVKSSVRVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLID--DNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQA 296
           LKL++  D+E A ++VK+++ +SL   E+QLV YV++ E+S  + PFD+S IP +T+ QA
Sbjct: 551 LKLMNEEDDEMAVRFVKNENMFSLPYFEQQLVMYVTSEEASAFDSPFDISKIPVVTREQA 610

Query: 297 EAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPE 356
           +AE+   RS  L +T T    +  VG       +T  +A  T    Q Q Y+Q+L +IPE
Sbjct: 611 DAED---RSKKLIAT-TPTLKAPKVGPTK----ATGAEAVATASA-QAQKYAQELMEIPE 661

Query: 357 IAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
           +  FG + KSS   +ELTE+ETEYVVS VKH+FKE++V Q+ V NTL D +LENV+VV  
Sbjct: 662 MQEFGNVLKSS-PLIELTEAETEYVVSLVKHIFKEHVVLQYEVKNTLPDTVLENVSVVAT 720

Query: 417 PESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPST 475
           P  DE  L E F+I A KL  D+P  +YVAFK+   E    + +F+N LKF  K+ DPST
Sbjct: 721 PADDE-ELEEVFIIQAEKLSTDEPGKVYVAFKKIGGEASLPISTFTNVLKFTSKEIDPST 779

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSL 534
                             ++  SDYV PT+  +FS  W+ VG  G +V ET  L+  +S+
Sbjct: 780 -GEPEDTGYDDEYEVAEFDLSGSDYVIPTFAGNFSHIWEQVGASGEEVTETLQLSGMESI 838

Query: 535 KDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
            D+   L + L + P+E +  P + + HTL L G  +GG +V+A  RM F+  TGVT ++
Sbjct: 839 ADATEQLTKALSLQPLEGTDVPVNQTTHTLKLLGKTVGGGRVVANVRMAFSSKTGVTTKI 898

Query: 595 SVRSPSEEISRIVIGAV 611
           +VRS  E ++ +VI +V
Sbjct: 899 TVRSEEENVAALVIASV 915



>gi|295664865|ref|XP_002792984.1| coatomer subunit gamma-1 [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226278505|gb|EEH34071.1| coatomer subunit gamma-1 [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 919

 Score =  614 bits (1584), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 317/617 (51%), Positives = 428/617 (69%), Gaps = 15/617 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP+   +FAAIRTL+ LA  +P  V  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLSSPRPVSKFAAIRTLHSLASFKPNVVNPCNQDIEALISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLM QI+GFM++ +DEFK+ +V+AIR+LCLKFP+KQ  ML+FLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMTQISGFMADTTDEFKITIVEAIRTLCLKFPNKQAGMLTFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KR+VVE++FDL+KF+P SKE ALAHLCEFIEDCEFTKL+VR+LHLLGVEGPKT  PTKYI
Sbjct: 431 KRSVVESMFDLIKFVPGSKEEALAHLCEFIEDCEFTKLAVRILHLLGVEGPKTSQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LENS++RAAAV+ALAKFGV  +DPE+K+S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENSVIRAAAVTALAKFGVGQKDPELKRSVNVLLTRCLDDTDDEVRDRAALN 550

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYV--SNPESSEKPFDLSDIPKITKAQAE 297
           L+L+ +++E AE+++K+DS +SL+  E +LV YV  ++ E+    FDL+ IP +++ QA 
Sbjct: 551 LRLMKEEDEMAERFIKNDSMFSLSTFEHKLVMYVTATDKETFATAFDLNTIPVVSQEQAL 610

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSIN-SNIVSTSRDATPTPGVDQQQVYSQQLEQIPE 356
           AE    R+  L    T  T +    S+  S   S+S            Q Y++QL QIPE
Sbjct: 611 AEE---RTKKL----TTATPTLKAPSMTPSKAKSSSGAEGAALAATATQKYAEQLAQIPE 663

Query: 357 IAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
           + A+G L KSS  PVELTESETEYVVS +KH+FKE++V Q+ + NTL D LLENV+VV+ 
Sbjct: 664 LKAYGTLLKSS-APVELTESETEYVVSAIKHIFKEHVVLQYDIKNTLPDTLLENVSVVVS 722

Query: 417 PESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEE-YTLGSFSNTLKFLVKDCDPST 475
              D+ +L E+F +PA +L  + P  +YVAFK+   E  + + SF+N LKF  K+ DP+T
Sbjct: 723 LSDDDESLEEDFTVPAPRLLSNDPGIVYVAFKKLGGEHNFPVTSFTNNLKFTSKEIDPTT 782

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSL 534
                            +++  SDYV P ++  F   W+  G  G +  ET  L+  K +
Sbjct: 783 -GEPEESGYEDEYQVEDLDLTGSDYVVPAFVGSFDHVWEQTGANGEEASETLQLSNVKGI 841

Query: 535 KDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
            D+   LI  L + P+E S    +++ H+L L G  + G +V    +M ++  +GVT ++
Sbjct: 842 ADATEQLIATLSLQPLEGSDVVLNNTTHSLKLYGKTVSGGRVAGLVKMAYSAKSGVTTKI 901

Query: 595 SVRSPSEEISRIVIGAV 611
           ++R+  E I+  VI +V
Sbjct: 902 TIRAEEEGIAATVIASV 918



>gi|255934848|ref|XP_002558451.1| Pc12g16530 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|255942167|ref|XP_002561852.1| Pc18g00050 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211583070|emb|CAP81280.1| Pc12g16530 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211586585|emb|CAP94229.1| Pc18g00050 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 917

 Score =  613 bits (1582), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 327/617 (52%), Positives = 423/617 (68%), Gaps = 17/617 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP+S  +FAAIR L+  A  +P  V  CN DME+LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLSSPRSITKFAAIRILHNFASFKPHVVNVCNPDMESLISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFM++I+DEFKV +V+AIR+LCLKFPSKQ  ML FLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMKQISGFMADITDEFKVTIVEAIRTLCLKFPSKQAGMLVFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KR VVE++FDL+KF+PESKE ALAHLCEFIEDCEFTKLSVR+LHLLG EGPKT  PTKYI
Sbjct: 431 KRTVVESMFDLIKFVPESKEDALAHLCEFIEDCEFTKLSVRILHLLGSEGPKTTHPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVK S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKSSVHVLLTRCLDDTDDEVRDRAALN 550

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYVS--NPESSEKPFDLSDIPKITKAQAE 297
           L+L+  ++E A  ++K+DS YSL+  E QLV YV+  + E+    FD++ IP ++  QA 
Sbjct: 551 LRLMAAEDECASAFIKNDSMYSLSTFEHQLVMYVTSGDKETFAAAFDVATIPVVSHEQAL 610

Query: 298 AENLKPRSFDLAS-TQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPE 356
           AE    R+  L S T T+   S+      +        +         Q Y++QL Q P+
Sbjct: 611 AEE---RTKKLTSATPTLKAPSAGPPKGAAAGGMAEAASASA-----TQKYAEQLLQYPD 662

Query: 357 IAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
           I A+G L KSS  PVEL+ESETEYVV+ VKH+FKE++V Q+ + NTL D +LENVTVV  
Sbjct: 663 IKAYGTLLKSS-APVELSESETEYVVTAVKHIFKEHIVVQYDIKNTLPDTVLENVTVVAT 721

Query: 417 PESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYT-LGSFSNTLKFLVKDCDPST 475
           P+ +E  L ++F+IPA KL  DQP  +YVAFK+   E    + SF+N L+F  K+ DP++
Sbjct: 722 PD-EEDVLEDDFIIPAPKLATDQPGVVYVAFKKLAGENSVPVTSFTNVLRFTSKEIDPAS 780

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSL 534
                            +E+  SDYV PT+   F   W+  G  G +  ET  L+  KS+
Sbjct: 781 -GEPEDSGYDDEYQVEDLELTGSDYVIPTFAGSFDHVWEQTGANGEEESETLQLSNMKSI 839

Query: 535 KDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
            D+   LI  L + P+E +    +SS HTL L G  + G +V +  +M ++   GVT ++
Sbjct: 840 NDATEQLISALSLQPLEGTDVALNSSTHTLKLFGKTVSGGRVASLIKMAYSSKAGVTTKI 899

Query: 595 SVRSPSEEISRIVIGAV 611
           +VR+  E ++  VI +V
Sbjct: 900 TVRAEEEGVAAAVIASV 916



>gi|392570970|gb|EIW64142.1| coatomer subunit gamma [Trametes versicolor FP-101664 SS1]
          Length = 926

 Score =  612 bits (1579), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 337/612 (55%), Positives = 440/612 (71%), Gaps = 19/612 (3%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSPKSTL+FAA RTL  LA++ PT+V +CN+D+ENLI+D NRSVAT+AITTLLKTGN
Sbjct: 331 LFLSSPKSTLKFAATRTLAALAVSHPTSVAACNIDLENLISDPNRSVATYAITTLLKTGN 390

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFMSEISDEFKVI+VDAIRSLCLKFP+K   ML+FLSGVLRDEGGY+F
Sbjct: 391 EASVDRLMKQISGFMSEISDEFKVIIVDAIRSLCLKFPAKHESMLAFLSGVLRDEGGYDF 450

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVEAIFD++KFI E KE AL+HLCEFIEDCEFTKLSVRVLHLLG EGPK P PTKYI
Sbjct: 451 KRAVVEAIFDMIKFIGECKEQALSHLCEFIEDCEFTKLSVRVLHLLGAEGPKAPQPTKYI 510

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LEN+ VRAAAV+AL KFG++  D ++  S+ VLL RCLDD DDEVRDRA LY
Sbjct: 511 RFIYNRVVLENATVRAAAVAALGKFGLTNIDAKLGSSVNVLLNRCLDDVDDEVRDRAALY 570

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           LK        + YVK++S YSL+ALE +LV Y+S+PE  ++P D+S IPKI+K QA  ++
Sbjct: 571 LKAYSAPPLIQPYVKEESIYSLSALESKLVSYLSDPELLDQPLDMSSIPKISKQQAAKDS 630

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIAAF 360
            +     +++ +T+G  S+          S +    P    + Q  Y+ QL ++PE+A++
Sbjct: 631 AR-----VSTLETLGMPST----------SKAATPPPPSAAETQSNYASQLAEVPELASY 675

Query: 361 GPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPESD 420
           G +  SS+KP  LTESETEY VS VKH+F+E++VFQF V+NT+ D +LE V+V+MQP+++
Sbjct: 676 GNVLSSSVKPAPLTESETEYQVSVVKHIFREHIVFQFNVSNTIADTVLEQVSVIMQPQTE 735

Query: 421 EGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXXXX 480
            G L E+F+IP   +    P  +YV+F R  PEEY   SF   LKF+ K+ DPST     
Sbjct: 736 SG-LTEDFIIPVPTVTASTPGVVYVSFTRDTPEEYVQASFQCILKFVSKELDPSTGEPEE 794

Query: 481 XXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSCTT 540
                        E+  SDY+ P+Y++ F+S WD +     + ETFAL A +SLK +C +
Sbjct: 795 EGYEDEYQLEET-ELAASDYIVPSYVT-FASEWDRMRSGVSLTETFALPAMESLKAACNS 852

Query: 541 LIELLGMSPVENSGTPTSSSVHTLMLSGTFL-GGIKVLAKNRMTFAPSTGVTMELSVRSP 599
           +IE+L M P+  +  P S +VH L LSG    GG KVL + RMT++ + GVT+E+ VR+ 
Sbjct: 853 VIEILNMQPLGGTEDPQSPTVHALQLSGLVAGGGGKVLVRCRMTYSKAQGVTLEVGVRAE 912

Query: 600 SEEISRIVIGAV 611
            +  + +V+ A+
Sbjct: 913 QQAAADLVVSAI 924



>gi|327308708|ref|XP_003239045.1| coatomer subunit gamma [Trichophyton rubrum CBS 118892]
 gi|326459301|gb|EGD84754.1| coatomer subunit gamma [Trichophyton rubrum CBS 118892]
          Length = 917

 Score =  612 bits (1578), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 312/616 (50%), Positives = 428/616 (69%), Gaps = 14/616 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           L+LSSP++T +FAAIR L+  A  +P  V +CN D+E+LI++ NRS+ATFAITTLLKTGN
Sbjct: 310 LYLSSPRTTSKFAAIRLLHTFASFKPHVVNACNQDIESLISNSNRSIATFAITTLLKTGN 369

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLM QI+GFMS+I+DEFK+ +V+AIR+LCLKFPSKQ  MLSF+SG+LRDEGGYEF
Sbjct: 370 EASVDRLMSQISGFMSDITDEFKITIVEAIRTLCLKFPSKQAGMLSFISGILRDEGGYEF 429

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K++VVE++FDL+KF+P SKE AL+HLCEFIEDCEFTKL+VR+LHLLGVEGPKTP PTKYI
Sbjct: 430 KKSVVESMFDLIKFVPGSKEEALSHLCEFIEDCEFTKLAVRILHLLGVEGPKTPNPTKYI 489

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LENS VRAAAV+ALAKFGV  +DPE+++S+ VLL RCLDD DDEVRDRA L 
Sbjct: 490 RYIYNRVVLENSTVRAAAVTALAKFGVGQKDPELRRSVIVLLKRCLDDTDDEVRDRAALN 549

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYV--SNPESSEKPFDLSDIPKITKAQAEA 298
           L+LIDD+E AE+++ +D+ YSL+  E QLV YV  ++ E+    FDLS IP +++ QA A
Sbjct: 550 LRLIDDSEIAERFIANDTMYSLSTFEHQLVMYVTATDKETFATAFDLSKIPVVSQEQALA 609

Query: 299 ENLKPRSFDLAS-TQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           E    R+  L S T T+   ++       N  +    A           ++++L QIPE+
Sbjct: 610 EE---RTKKLTSATPTLKAPTAGPSKAKQNGAADGAAAAQATTQK----FAEELAQIPEL 662

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
             +G L KSS  PVELTE ETEYVV+ +KH+FK+++V Q+ + NTL D +LE+V+VV  P
Sbjct: 663 KEYGTLLKSS-SPVELTERETEYVVTAIKHIFKDHIVVQYDIKNTLPDTVLEDVSVVATP 721

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPSTX 476
              + +L E+F++PA KL  ++P  +YVAFK+   E +Y + SF+N LKF  K+ DP+T 
Sbjct: 722 SEGDESLEEDFIVPAPKLVPNEPGLVYVAFKKAGGEHDYPITSFTNVLKFTSKEIDPTT- 780

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSLK 535
                           +E+  SDYV P +  +F   W+  G  G +  ET  L+  K + 
Sbjct: 781 GEPEETGYEDEYQVEDLELTGSDYVVPAFSGNFDHLWEQTGANGEEASETLQLSNMKGIS 840

Query: 536 DSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           D+   LI  L + P+E +    ++S H+L L G  + G KV    R+ ++  +GVT +++
Sbjct: 841 DATEQLIATLSLQPLEGTDVVLNNSTHSLKLYGETVSGGKVTGLVRLAYSAKSGVTTKIT 900

Query: 596 VRSPSEEISRIVIGAV 611
           +R+  E ++  +I +V
Sbjct: 901 IRAEEEGVAAAIITSV 916



>gi|500255686|gb|EON99024.1| putative coatomer subunit gamma protein [Togninia minima UCRPA7]
          Length = 917

 Score =  612 bits (1577), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 329/616 (53%), Positives = 441/616 (71%), Gaps = 15/616 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAA+R L+  A  +P AV  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLTSPRAVTKFAALRILHNFASFKPQAVNVCNPDIELLISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFMSEI+DEFK+ +V+AIR+LCLKFPSKQ  ML FLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMKQISGFMSEITDEFKITIVEAIRTLCLKFPSKQAGMLQFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+P+SKE ALAHLCEFIEDCEFTKL+VR+LHLLG+EGPKT  PTKYI
Sbjct: 431 KRAVVESMFDLIKFVPDSKEDALAHLCEFIEDCEFTKLAVRILHLLGLEGPKTSQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVK+S++VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKRSVEVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLIDD-NESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQAE 297
           L+L+++ ++ AE++VK+DS +SL+  E QLV YV++ + S  +  FD+S IP +T+ QA+
Sbjct: 551 LRLMNETDDMAERFVKNDSMFSLSYFEHQLVMYVTSDDKSTFDSAFDISKIPVVTREQAD 610

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE+   R+  L +T T       V    S    T  D T +     Q+ Y+Q+L QIPE+
Sbjct: 611 AED---RTKKLTAT-TPSLKPPKVAP--SKAAGTGADPTASASAIAQK-YAQELMQIPEM 663

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
             FG + KS+   VELTE+ETEYVV  VKH+FKE++V Q+ +TNTL+  LLENV+VV  P
Sbjct: 664 KEFGTVLKSAT-VVELTEAETEYVVRVVKHIFKEHVVLQYEITNTLDSVLLENVSVVATP 722

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPSTX 476
            +DE  L E F+IPA KL  ++P  +YVAFK+ N E    + +FSNTLKF  K+ DP+T 
Sbjct: 723 -ADEEDLEEVFIIPAEKLSQNEPGKVYVAFKKINGEASLPITTFSNTLKFTSKEIDPTT- 780

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSLK 535
                            ++  SDYV PT+  +F+  W+ VG  G +  ET  L+  KS+ 
Sbjct: 781 NEPEDTGYDDEYEVAEFDLAGSDYVIPTFAGNFAHIWEQVGAAGEEAEETLQLSGMKSIA 840

Query: 536 DSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           D+   L + L + P+E +  P + + HTL L G  + G +V+A  RM ++  +GVT +++
Sbjct: 841 DATEQLAKTLSLQPLEGTDVPVNQTTHTLKLLGKTVNGGRVVANIRMAYSSKSGVTTKVT 900

Query: 596 VRSPSEEISRIVIGAV 611
           VR+  E ++ +V+ ++
Sbjct: 901 VRAEEENVAALVVASI 916



>gi|296815002|ref|XP_002847838.1| coatomer subunit gamma-2 [Arthroderma otae CBS 113480]
 gi|238840863|gb|EEQ30525.1| coatomer subunit gamma-2 [Arthroderma otae CBS 113480]
          Length = 917

 Score =  612 bits (1577), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 311/616 (50%), Positives = 427/616 (69%), Gaps = 14/616 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           L+LSSP++T +FAAIR L+  A  +P  V +CN D+E+LI++ NRS+ATFAITTLLKTGN
Sbjct: 310 LYLSSPRTTSKFAAIRLLHTFASFKPHVVNACNQDIESLISNSNRSIATFAITTLLKTGN 369

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLM QI+GFMS+I+DEFK+ +V+AIR+LCLKFPSKQ  MLSF+SG+LRDEGGYEF
Sbjct: 370 EASVDRLMGQISGFMSDITDEFKITIVEAIRTLCLKFPSKQAGMLSFISGILRDEGGYEF 429

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K++VVE++FDL+KF+P SKE AL+HLCEFIEDCEFTKL+VR+LHLLGVEGPKTP+PTKYI
Sbjct: 430 KKSVVESMFDLIKFVPGSKEEALSHLCEFIEDCEFTKLAVRILHLLGVEGPKTPSPTKYI 489

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LENS VRAAAV+ALAKFGV  +DPE+++S+ VLL RCLDD DDEVRDRA L 
Sbjct: 490 RYIYNRVVLENSTVRAAAVTALAKFGVGQKDPELRRSVVVLLKRCLDDTDDEVRDRAALN 549

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYV--SNPESSEKPFDLSDIPKITKAQAEA 298
           L+LIDD+E AE+++ +D+ YSL+  E QLV YV  ++ E+    FDLS IP +++ QA A
Sbjct: 550 LRLIDDSEIAERFITNDTMYSLSTFEHQLVMYVTATDKETFATAFDLSKIPVVSQEQALA 609

Query: 299 ENLKPRSFDLAS-TQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           E    R+  L S T T+   +        N  +    A           ++++L QIPE+
Sbjct: 610 EE---RTKKLTSATPTLKAPTDGPSKAKQNGAADGAAAAQATTQK----FAEELSQIPEL 662

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
             +G L KSS  PVELTE ETEYVV+ +KH+FK+++V Q+ + NTL D +LE+V+VV  P
Sbjct: 663 KEYGTLLKSS-SPVELTERETEYVVTAIKHIFKDHIVVQYDIKNTLPDTVLEDVSVVATP 721

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEE-YTLGSFSNTLKFLVKDCDPSTX 476
             ++  L E+F++P+ KL  ++P  +YVAFK+   E  Y + SF+N LKF  K+ DP+T 
Sbjct: 722 SEEDEALEEDFIVPSPKLVPNEPGLVYVAFKKAGGEHNYPITSFTNVLKFTSKEIDPTT- 780

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSLK 535
                           +E+  SDYV P +  +F   W+  G  G +  ET  L+  K + 
Sbjct: 781 GEPEDTGYEDEYQVEDLELTGSDYVIPAFAGNFDHLWEQTGANGEEASETLQLSNMKGIS 840

Query: 536 DSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           D+   LI  L + P+E +    ++S H+L L G  + G +V    R+ ++  +GVT +++
Sbjct: 841 DATEQLISTLSLQPLEGTDVVLNNSTHSLKLYGKTVSGGRVTGLVRLAYSAKSGVTTKIT 900

Query: 596 VRSPSEEISRIVIGAV 611
           VR+  E ++  +I +V
Sbjct: 901 VRAEEEGVAAAIITSV 916



>gi|325089078|gb|EGC42388.1| coatomer gamma subunit [Ajellomyces capsulatus H88]
          Length = 916

 Score =  610 bits (1573), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 315/607 (51%), Positives = 422/607 (69%), Gaps = 15/607 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP+   +FAAIRTL+ LA  +P  V  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 308 LFLSSPRPITKFAAIRTLHSLASFKPNVVNPCNQDIEALISNSNRSIATFAITTLLKTGN 367

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLM QI+GFM++ +DEFK+ +V+AIR+LCLKFP KQ  ML+FLSG+LRDEGGYEF
Sbjct: 368 EASVDRLMTQISGFMADTTDEFKITIVEAIRTLCLKFPHKQAGMLAFLSGILRDEGGYEF 427

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KR+VVE++FDL+KF+P SKE ALAHLCEFIEDCEFTKL+VR+LHLLGVEGPKT  PTKYI
Sbjct: 428 KRSVVESMFDLIKFVPGSKEDALAHLCEFIEDCEFTKLAVRILHLLGVEGPKTSQPTKYI 487

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+++RAAAV+ALAKFGV  +DPE+K+S+ VLL RCLDD DDEVRDRA L 
Sbjct: 488 RYIYNRVVLENAVIRAAAVTALAKFGVGQKDPELKRSVNVLLARCLDDTDDEVRDRAALN 547

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYV--SNPESSEKPFDLSDIPKITKAQAE 297
           L+L+ +++E AE+++K DS +SL+  E QLV YV  ++ E+    FDL+ IP +++ QA 
Sbjct: 548 LRLMKEEDELAERFIKTDSMFSLSTFEHQLVMYVTATDKETFAAAFDLNTIPVVSQEQAL 607

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSIN-SNIVSTSRDATPTPGVDQQQVYSQQLEQIPE 356
           AE    R+  L    T  T +    S+  S   ST+            Q Y++QL QIPE
Sbjct: 608 AEE---RTKKL----TTATPTLKAPSMTPSKAKSTAGVDGVAAAAASTQRYAEQLVQIPE 660

Query: 357 IAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
           + A+G L KSS  PVELTESETEYVVS VKH+FKE++V Q+ + NTL D LLE+V+VV  
Sbjct: 661 LKAYGTLLKSST-PVELTESETEYVVSAVKHIFKEHIVLQYDIKNTLPDTLLEDVSVVAS 719

Query: 417 PESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEE-YTLGSFSNTLKFLVKDCDPST 475
           P  D+ +L E+F++PA KL  ++P  +YVAFK+   E  + + SF+N LKF  K+ DP+T
Sbjct: 720 PLDDDESLEEDFIVPAPKLMTNEPGIVYVAFKKLGGEHNFPVTSFTNNLKFTSKEIDPTT 779

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSL 534
                            ++++ SDYV P +   F   W+  G  G +  ET  L+  K +
Sbjct: 780 -GDPEETGYEDEYQVEDLDLIGSDYVIPAFAGSFDHVWEQTGANGEEASETLQLSNMKGI 838

Query: 535 KDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
           +D+   L+  L + P+E +    +++ H L L G  + G +V A  RM ++  +GVT ++
Sbjct: 839 EDATEQLVATLSLQPLEGTDVVLNNTTHALKLYGKTVSGGRVAALVRMAYSAKSGVTTKV 898

Query: 595 SVRSPSE 601
           +VR+  E
Sbjct: 899 TVRAEEE 905



>gi|240280667|gb|EER44171.1| coatomer subunit gamma-1 [Ajellomyces capsulatus H143]
          Length = 916

 Score =  610 bits (1572), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 315/607 (51%), Positives = 421/607 (69%), Gaps = 15/607 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP+   +FAAIRTL+ LA  +P  V  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 308 LFLSSPRPITKFAAIRTLHSLASFKPNVVNPCNQDIEALISNSNRSIATFAITTLLKTGN 367

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLM QI+GFM++ +DEFK+ +V+AIR+LCLKFP KQ  ML+FLSG+LRDEGGYEF
Sbjct: 368 EASVDRLMTQISGFMADTTDEFKITIVEAIRTLCLKFPHKQAGMLAFLSGILRDEGGYEF 427

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KR+VVE++FDL+KF+P SKE ALAHLCEFIEDCEFTKL+VR+LHLLGVEGPKT  PTKYI
Sbjct: 428 KRSVVESMFDLIKFVPGSKEDALAHLCEFIEDCEFTKLAVRILHLLGVEGPKTSQPTKYI 487

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+++RAAAV+ALAKFGV  +DPE+K+S+ VLL RCLDD DDEVRDRA L 
Sbjct: 488 RYIYNRVVLENAVIRAAAVTALAKFGVGQKDPELKRSVNVLLARCLDDTDDEVRDRAALN 547

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYV--SNPESSEKPFDLSDIPKITKAQAE 297
           L+L+ +++E AE+++K DS +SL+  E QLV YV  ++ E+    FDL+ IP +++ QA 
Sbjct: 548 LRLMKEEDELAERFIKTDSMFSLSTFEHQLVMYVTATDKETFAAAFDLNTIPVVSQEQAL 607

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSIN-SNIVSTSRDATPTPGVDQQQVYSQQLEQIPE 356
           AE    R+  L    T  T +    S+  S   ST+            Q Y++QL QIPE
Sbjct: 608 AEE---RTKKL----TTATPTLKAPSMTPSKAKSTAGVDGVAAAAASTQRYAEQLVQIPE 660

Query: 357 IAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
           + A+G L KSS  PVELTESETEYVVS VKH+FKE++V Q+ + NTL D LLE+V+VV  
Sbjct: 661 LKAYGTLLKSST-PVELTESETEYVVSAVKHIFKEHIVLQYDIKNTLPDTLLEDVSVVAS 719

Query: 417 PESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEE-YTLGSFSNTLKFLVKDCDPST 475
           P  D+ +L E+F++PA KL  ++P  +YVAFK+   E  + + SF+N LKF  K+ DP+T
Sbjct: 720 PLDDDESLEEDFIVPAPKLMTNEPGIVYVAFKKLGGEHNFPVTSFTNNLKFTSKEIDPTT 779

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSL 534
                            ++++ SDYV P +   F   W+  G  G +  ET  L+  K +
Sbjct: 780 -GDPEETGYEDEYQVEDLDLIGSDYVIPAFAGSFDHVWEQTGANGEEASETLQLSNMKGI 838

Query: 535 KDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
           +D+   L+  L + P+E +    +++ H L L G  + G +V A  RM +   +GVT ++
Sbjct: 839 EDATEQLVATLSLQPLEGTDVVLNNTTHALKLYGKTVSGGRVAALVRMAYTAKSGVTTKV 898

Query: 595 SVRSPSE 601
           +VR+  E
Sbjct: 899 TVRAEEE 905



>gi|452836712|gb|EME38655.1| hypothetical protein DOTSEDRAFT_180497 [Dothistroma septosporum
           NZE10]
          Length = 920

 Score =  608 bits (1569), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 313/621 (50%), Positives = 424/621 (68%), Gaps = 21/621 (3%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAAIR L++ A  +P AV+ CN D+E+LI++ NRS+ATFAITTLLKTGN
Sbjct: 310 LFLTSPRAVTKFAAIRILHQFASFKPDAVRQCNQDIESLISNSNRSIATFAITTLLKTGN 369

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLM QI+ FMSEI+DEFKV +V+AIR+LCLKFPSKQ  ML FLSG+LRDEGGYEF
Sbjct: 370 EASVDRLMTQISTFMSEITDEFKVTIVEAIRTLCLKFPSKQARMLQFLSGILRDEGGYEF 429

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KR+VVE++FDL+KF+ ESKE ALAHLCEFIEDCEFTKL+VR+LHLLG+EGP+T  PTKYI
Sbjct: 430 KRSVVESMFDLIKFVAESKEEALAHLCEFIEDCEFTKLAVRILHLLGMEGPRTAQPTKYI 489

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVK+S+ VLL RCLDD DDEVRDRA L 
Sbjct: 490 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKQSVHVLLKRCLDDTDDEVRDRAALN 549

Query: 241 LKLI--DDNESAEKYVKDDSTYSLAALERQLVQYVS--NPESSEKPFDLSDIPKITKAQA 296
           L+L+  +D+E A ++V++DS +SL  LE QL  YV+  + E+   PFD S++P +++ Q+
Sbjct: 550 LRLMKEEDDEVAARFVRNDSMFSLPVLEDQLAHYVNGGSAEAFANPFDFSNVPVVSREQS 609

Query: 297 EAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPE 356
            AE       D     T  T +    ++      +S            Q Y+QQL+ IPE
Sbjct: 610 LAE-------DRTKKLTTATPTLKAPTVGPKKTESSAAEAAATATAATQKYAQQLQAIPE 662

Query: 357 IAAFGPLFKSSIKPV-ELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVM 415
            +++GP+ KSS  PV ELTE ETEYVVS +KH+FKE++V Q+ + NTL D +L +VTV+ 
Sbjct: 663 FSSYGPVLKSS--PVIELTERETEYVVSAIKHLFKEHVVLQYDIKNTLPDYVLSDVTVIS 720

Query: 416 QP----ESDEGTLVEE-FVIPATKLPYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKD 470
            P    E +E  L ++ F+IP   L  D+P ++Y +F R   + +   SF+N LKF +K+
Sbjct: 721 NPSPGEEGEEPALEDDGFIIPVPLLKADEPGTVYTSFSRP-ADSFVPASFTNVLKFTLKE 779

Query: 471 CDPSTXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTA 530
            DP+T                 +E+  +DYV P +   F + W  +    +  ET  L +
Sbjct: 780 IDPTT-SEPEEGGYDDEYQVEDLELAGADYVLPAFAGSFDNIWQGLPSADEASETLQLES 838

Query: 531 SKSLKDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGV 590
            KS+ D+  +L++ LGM P+E +    S+S HTL L G  + G KV A  RM F+   GV
Sbjct: 839 VKSISDAVESLVKTLGMQPLEGTDVALSTSTHTLRLYGKSVTGGKVAATVRMAFSARAGV 898

Query: 591 TMELSVRSPSEEISRIVIGAV 611
           T+++  RS  + ++ +V+G V
Sbjct: 899 TVQIKARSEEDGLAALVVGGV 919



>gi|340975620|gb|EGS22735.1| coatomer subunit gamma-like protein [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 917

 Score =  608 bits (1569), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 332/617 (53%), Positives = 437/617 (70%), Gaps = 17/617 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP++  +FAA+R L+ +A  +P  V  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLSSPRAVTKFAALRILHTIASFRPHVVNVCNPDIELLISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQITGFMSEI+DEFK+ +V+AIR+LCLKFPSKQ  ML FLSG+LRDEGGY+F
Sbjct: 371 EASVDRLMKQITGFMSEITDEFKITIVEAIRTLCLKFPSKQAGMLQFLSGILRDEGGYDF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+PESKE ALAHLCEFIEDCEFTKL+VR+LHLLGVEGPKT  PTKYI
Sbjct: 431 KRAVVESMFDLIKFVPESKEEALAHLCEFIEDCEFTKLAVRILHLLGVEGPKTSQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DP+VK+S++VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPDVKRSVEVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQAE 297
           L+L+ ++++ A ++VK+DS ++L   E+QLV YV++ + S  E PFD+S IP +T+ QA+
Sbjct: 551 LRLMQEEDDIANRFVKNDSMFALPYFEQQLVMYVTSDDKSTFETPFDISKIPIVTREQAD 610

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE+   R+  L +T    T S          ++ S            Q Y+Q+L +IPEI
Sbjct: 611 AED---RTKKLTAT----TPSLKPPKTGPTKMAPSAAEAAASATAVAQKYAQELAEIPEI 663

Query: 358 AAFGPLFKSSIKPV-ELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
             FG + KSS  PV ELTE+ETEYVVS VKH+FKE++V Q+ + NTL   +LENV+V+  
Sbjct: 664 REFGNVLKSS--PVIELTEAETEYVVSVVKHIFKEHIVLQYDIKNTLPSTILENVSVLAT 721

Query: 417 PESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPST 475
           P  DEG L + FV+ A KL  D P  +YVAF++ N E    + +FSN LKF  K+ DP+T
Sbjct: 722 PSDDEG-LEDAFVVQAEKLETDVPGKVYVAFRKVNGEGSMPVTTFSNVLKFTSKEIDPTT 780

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSL 534
                             ++  SDYV PT+ S+F+  W+ VG +G +  ET  L+  KS+
Sbjct: 781 -NEPEETGYEDEYEVSDFDLSGSDYVIPTFASNFAHVWEQVGAQGEEAEETLQLSGMKSI 839

Query: 535 KDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
            ++   L + L + PVE +  P + S HTL L G  + G KV A  RM ++  TGVT ++
Sbjct: 840 AEATEQLAKALSLQPVEGTDVPINQSTHTLKLLGKTVNGGKVAANVRMAYSSKTGVTTKI 899

Query: 595 SVRSPSEEISRIVIGAV 611
           +VRS  E ++ +V+G+V
Sbjct: 900 TVRSEEEGVAALVVGSV 916



>gi|302497501|ref|XP_003010751.1| hypothetical protein ARB_03453 [Arthroderma benhamiae CBS 112371]
 gi|302656128|ref|XP_003019820.1| hypothetical protein TRV_06108 [Trichophyton verrucosum HKI 0517]
 gi|291174294|gb|EFE30111.1| hypothetical protein ARB_03453 [Arthroderma benhamiae CBS 112371]
 gi|291183592|gb|EFE39196.1| hypothetical protein TRV_06108 [Trichophyton verrucosum HKI 0517]
          Length = 912

 Score =  608 bits (1568), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 313/616 (50%), Positives = 429/616 (69%), Gaps = 14/616 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           L+LSSP++T +FAAIR L+  A  +P  V +CN D+E+LI++ NRS+ATFAITTLLKTGN
Sbjct: 305 LYLSSPRTTSKFAAIRLLHTFASFKPHVVNACNQDIESLISNSNRSIATFAITTLLKTGN 364

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLM QI+GFMS+I+DEFK+ +V+AIR+LCLKFPSKQ  MLSF+SG+LRDEGGYEF
Sbjct: 365 EASVDRLMSQISGFMSDITDEFKITIVEAIRTLCLKFPSKQAGMLSFISGILRDEGGYEF 424

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K++VVE++FDL+KF+P SKE AL+HLCEFIEDCEFTKL+VR+LHLLGVEGPKTP PTKYI
Sbjct: 425 KKSVVESMFDLIKFVPGSKEEALSHLCEFIEDCEFTKLAVRILHLLGVEGPKTPNPTKYI 484

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LENS VRAAAV+ALAKFGV  +DPE+++S+ VLL RCLDD DDEVRDRA L 
Sbjct: 485 RYIYNRVVLENSTVRAAAVTALAKFGVGQKDPELRRSVIVLLKRCLDDTDDEVRDRAALN 544

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYV--SNPESSEKPFDLSDIPKITKAQAEA 298
           L+LIDD+E AE+++ +D+ YSL+  E QLV YV  ++ E+    FDLS IP +++ QA A
Sbjct: 545 LRLIDDSEIAERFIANDTMYSLSTFEHQLVMYVTATDKETFATAFDLSKIPVVSQEQALA 604

Query: 299 ENLKPRSFDLAS-TQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           E    R+  L S T T+   +S       N  +    A           ++++L QIPE+
Sbjct: 605 EE---RTKKLTSATPTLKAPTSGPSKAKQNGAADGAAAAQATTQK----FAEELAQIPEL 657

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
             +G L KSS  P+ELTE ETEYVV+ +KH+FK+++V Q+ + NTL D +LE+V+VV  P
Sbjct: 658 KEYGTLLKSS-SPIELTERETEYVVTAIKHIFKDHIVVQYDIKNTLPDTVLEDVSVVATP 716

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPSTX 476
             +E +L E+F++PA KL  ++P  +YVAFK+   E +Y + SF+N LKF  K+ DP+T 
Sbjct: 717 SEEEESLEEDFIVPAPKLVPNEPGLVYVAFKKAGGEHDYPITSFTNVLKFTSKEIDPTT- 775

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSLK 535
                           +E+  SDYV P +  +F   W+  G  G +  ET  L+  K + 
Sbjct: 776 GEPEETGYEDEYQVEDLELTGSDYVVPAFAGNFDHLWEQTGANGEEASETLQLSNMKGIS 835

Query: 536 DSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           D+   LI  L + P+E +    ++S H+L L G  + G KV    R+ ++  +GVT +++
Sbjct: 836 DATEQLIATLSLQPLEGTDVVLNNSTHSLKLYGKTVSGGKVTGLVRLAYSAKSGVTTKIT 895

Query: 596 VRSPSEEISRIVIGAV 611
           +R+  E ++  +I +V
Sbjct: 896 IRAEEEGVAAAIITSV 911



>gi|326477801|gb|EGE01811.1| coatomer subunit gamma [Trichophyton equinum CBS 127.97]
          Length = 901

 Score =  608 bits (1567), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 313/616 (50%), Positives = 430/616 (69%), Gaps = 14/616 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           L+LSSP++T +FAAIR L+  A  +P  V +CN D+E+LI++ NRS+ATFAITTLLKTGN
Sbjct: 294 LYLSSPRTTSKFAAIRLLHTFASFKPHVVNACNQDIESLISNSNRSIATFAITTLLKTGN 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLM QI+GFMS+I+DEFK+ +V+AIR+LCLKFPSKQ  MLSF+SG+LRDEGGYEF
Sbjct: 354 EASVDRLMSQISGFMSDITDEFKITIVEAIRTLCLKFPSKQAGMLSFISGILRDEGGYEF 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K++VVE++FDL+KF+P SKE AL+HLCEFIEDCEFTKL+VR+LHLLGVEGPKTP PTKYI
Sbjct: 414 KKSVVESMFDLIKFVPGSKEEALSHLCEFIEDCEFTKLAVRILHLLGVEGPKTPNPTKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LENS VRAAAV+ALAKFGV  +DPE+++S+ VLL RCLDD DDEVRDRA L 
Sbjct: 474 RYIYNRVVLENSTVRAAAVTALAKFGVGQKDPELRRSVIVLLKRCLDDTDDEVRDRAALN 533

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYV--SNPESSEKPFDLSDIPKITKAQAEA 298
           L+LIDD+E AE+++ +D+ YSL+  E QLV YV  ++ E+    FDLS IP +++ QA A
Sbjct: 534 LRLIDDSEIAERFITNDTMYSLSTFEHQLVMYVTATDKETFATAFDLSKIPVVSQEQALA 593

Query: 299 ENLKPRSFDLAS-TQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           E    R+  L S T T+   ++       N  +    A           ++++L QIPE+
Sbjct: 594 EE---RTKKLTSATPTLKAPTAGPSKSKQNGAADGAAAAQATTQK----FAEELAQIPEL 646

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
             +G L KSS  PVELTE ETEYVV+ +KH+FK+++V Q+ + NTL D +LE+V+VV  P
Sbjct: 647 KEYGTLLKSS-SPVELTERETEYVVTAIKHIFKDHIVVQYDIKNTLPDTVLEDVSVVASP 705

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPSTX 476
             ++ +L E+F++PA KL  ++P  +YVAFK+   E +Y + SF+N LKF  K+ DP+T 
Sbjct: 706 SEEDESLEEDFIVPAPKLVPNEPGLVYVAFKKAGGEHDYPIASFTNVLKFTSKEIDPTT- 764

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSLK 535
                           +E+  SDYV P + S+F   W+  G  G +  ET  L+  K + 
Sbjct: 765 GEPEETGYEDEYQVEDLELTGSDYVVPAFASNFDHLWEQTGANGEEASETLQLSNMKGIS 824

Query: 536 DSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           D+   LI  L + P+E +    ++S H+L L G  + G KV    R+ ++  +GVT +++
Sbjct: 825 DATEQLITTLSLQPLEGTDVVLNNSTHSLKLYGKTVSGGKVTGLVRLAYSAKSGVTTKIT 884

Query: 596 VRSPSEEISRIVIGAV 611
           +R+  E ++  +I +V
Sbjct: 885 IRAEEEGVAAAIITSV 900



>gi|326474812|gb|EGD98821.1| coatomer subunit gamma [Trichophyton tonsurans CBS 112818]
          Length = 617

 Score =  607 bits (1566), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 314/616 (50%), Positives = 431/616 (69%), Gaps = 14/616 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           L+LSSP++T +FAAIR L+  A  +P  V +CN D+E+LI++ NRS+ATFAITTLLKTGN
Sbjct: 10  LYLSSPRTTSKFAAIRLLHTFASFKPHVVNACNQDIESLISNSNRSIATFAITTLLKTGN 69

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLM QI+GFMS+I+DEFK+ +V+AIR+LCLKFPSKQ  MLSF+SG+LRDEGGYEF
Sbjct: 70  EASVDRLMSQISGFMSDITDEFKITIVEAIRTLCLKFPSKQAGMLSFISGILRDEGGYEF 129

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K++VVE++FDL+KF+P SKE AL+HLCEFIEDCEFTKL+VR+LHLLGVEGPKTP PTKYI
Sbjct: 130 KKSVVESMFDLIKFVPGSKEEALSHLCEFIEDCEFTKLAVRILHLLGVEGPKTPNPTKYI 189

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LENS VRAAAV+ALAKFGV  +DPE+++S+ VLL RCLDD DDEVRDRA L 
Sbjct: 190 RYIYNRVVLENSTVRAAAVTALAKFGVGQKDPELRRSVIVLLKRCLDDTDDEVRDRAALN 249

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYV--SNPESSEKPFDLSDIPKITKAQAEA 298
           L+LIDD+E AE+++ +D+ YSL+  E QLV YV  ++ E+    FDLS IP +++ QA A
Sbjct: 250 LRLIDDSEIAERFITNDTMYSLSTFEHQLVMYVTATDKETFATAFDLSKIPVVSQEQALA 309

Query: 299 ENLKPRSFDLAS-TQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           E    R+  L S T T+   ++       N  +    A         Q ++++L QIPE+
Sbjct: 310 EE---RTKKLTSATPTLKAPTAGPSKSKQNGAADGAAAA----QATTQKFAEELAQIPEL 362

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
             +G L KSS  PVELTE ETEYVV+ +KH+FK+++V Q+ + NTL D +LE+V+VV  P
Sbjct: 363 KEYGTLLKSS-SPVELTERETEYVVTAIKHIFKDHIVVQYDIKNTLPDTVLEDVSVVASP 421

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPSTX 476
             ++ +L E+F++PA KL  ++P  +YVAFK+   E +Y + SF+N LKF  K+ DP+T 
Sbjct: 422 SEEDESLEEDFIVPAPKLVPNEPGLVYVAFKKAGGEHDYPIASFTNVLKFTSKEIDPTT- 480

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSLK 535
                           +E+  SDYV P + S+F   W+  G  G +  ET  L+  K + 
Sbjct: 481 GEPEETGYEDEYQVEDLELTGSDYVVPAFASNFDHLWEQTGANGEEASETLQLSNMKGIS 540

Query: 536 DSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           D+   LI  L + P+E +    ++S H+L L G  + G KV    R+ ++  +GVT +++
Sbjct: 541 DATEQLITTLSLQPLEGTDVVLNNSTHSLKLYGKTVSGGKVTGLVRLAYSAKSGVTTKIT 600

Query: 596 VRSPSEEISRIVIGAV 611
           +R+  E ++  +I +V
Sbjct: 601 IRAEEEGVAAAIITSV 616



>gi|452987266|gb|EME87022.1| hypothetical protein MYCFIDRAFT_56148 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 922

 Score =  607 bits (1565), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 317/621 (51%), Positives = 437/621 (70%), Gaps = 21/621 (3%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAAIR L++ A  +P AV+ CN D+E+LI++ NRS+ATFAITTLLKTGN
Sbjct: 312 LFLTSPRAVTKFAAIRILHQFASFKPDAVRQCNPDIESLISNSNRSIATFAITTLLKTGN 371

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLM QI+ FMSEI+DEFKV +V+AIR+LCLKFPSKQ  ML+FLSG+LR+EGGY+F
Sbjct: 372 ESSVDRLMTQISTFMSEITDEFKVTIVEAIRTLCLKFPSKQARMLAFLSGILREEGGYDF 431

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE+IFDL+KF+PESKE ALAHLCEFIEDCEFTKL+VR+LH+LG+EGPKT  PTKYI
Sbjct: 432 KRAVVESIFDLIKFVPESKEEALAHLCEFIEDCEFTKLAVRILHVLGMEGPKTMQPTKYI 491

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVK+S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 492 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKRSVGVLLTRCLDDTDDEVRDRAALN 551

Query: 241 LKLI--DDNESAEKYVKDDSTYSLAALERQLVQYVS--NPESSEKPFDLSDIPKITKAQA 296
           L+L+  +D+E A K+V++DS +SL  LE QL  YV+  + E+   PFD S++P +++ Q+
Sbjct: 552 LRLMKEEDDEVAAKFVRNDSMFSLPVLEDQLAHYVNGGSAEAFANPFDFSNVPIVSREQS 611

Query: 297 EAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPE 356
            AE+ + +     +T T    +  VG   ++  +     T T      Q Y+ QL+ IPE
Sbjct: 612 LAEDRQKK----LTTATPTLKAPTVGPKKTDASAAQVAETATAAT---QNYASQLQAIPE 664

Query: 357 IAAFGPLFKSSIKPV-ELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVM 415
            +++G + KSS  PV +LTESETEYVVS VKH+FKE++V QF + NTL D +L +VTV+ 
Sbjct: 665 FSSYGGVLKSS--PVIDLTESETEYVVSAVKHLFKEHVVLQFNIKNTLADYVLSDVTVIC 722

Query: 416 QPESDEGT----LVEE-FVIPATKLPYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKD 470
            P   E      LV++ F+IPA  L  D+P ++YV+F R   ++    SF+N LKF +K+
Sbjct: 723 TPSGSEEEEESPLVDDGFIIPAELLKTDEPGTVYVSFTRP-ADQPVAASFTNVLKFTLKE 781

Query: 471 CDPSTXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTA 530
            DPST                 +E+  +DY+ P +   F + +  +  E +  ET  L+ 
Sbjct: 782 MDPST-GEPEEGGYEDEYQVEDLELSGADYILPAFAGSFDNIFSGLPIETEASETLQLSN 840

Query: 531 SKSLKDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGV 590
           +K++ D+   LI+ LGM P+E +    S+S HTL L G  + G KV +  RM ++  +GV
Sbjct: 841 AKAITDAVEMLIKTLGMQPLEGTEVALSTSTHTLKLYGKSVTGGKVASTVRMAYSAKSGV 900

Query: 591 TMELSVRSPSEEISRIVIGAV 611
           T++++ RS  E ++++++G V
Sbjct: 901 TVKITARSEEEGLAQLLVGGV 921



>gi|315054085|ref|XP_003176417.1| coatomer subunit gamma-2 [Arthroderma gypseum CBS 118893]
 gi|311338263|gb|EFQ97465.1| coatomer subunit gamma-2 [Arthroderma gypseum CBS 118893]
          Length = 917

 Score =  607 bits (1564), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 311/616 (50%), Positives = 429/616 (69%), Gaps = 14/616 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           L+LSSP++T +FAAIR L+  A  +P  V +CN D+E+LI++ NRS+ATFAITTLLKTGN
Sbjct: 310 LYLSSPRTTSKFAAIRLLHTFASFKPHVVNACNQDIESLISNSNRSIATFAITTLLKTGN 369

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLM QI GFMS+I+DEFK+ +V+AIR+LCLKFPSKQ  MLSF+SG+LRDEGGYEF
Sbjct: 370 EASVDRLMSQIAGFMSDITDEFKITIVEAIRTLCLKFPSKQAGMLSFISGILRDEGGYEF 429

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K++VVE++FDL+KF+P SKE AL+HLCEFIEDCEFTKL+VR+LHLLGVEGPKTP PTKYI
Sbjct: 430 KKSVVESMFDLIKFVPGSKEEALSHLCEFIEDCEFTKLAVRILHLLGVEGPKTPNPTKYI 489

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LENS VRAAAV+ALAKFGV  +DPE+++S+ VLL RCLDD DDEVRDRA L 
Sbjct: 490 RYIYNRVVLENSTVRAAAVTALAKFGVGQKDPELRRSVIVLLKRCLDDTDDEVRDRAALN 549

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYV--SNPESSEKPFDLSDIPKITKAQAEA 298
           L+LIDD+E AE+++ +D+ YSL+  E QLV YV  ++ ++    FDLS+IP +++ QA A
Sbjct: 550 LRLIDDSEIAERFIANDTMYSLSTFEHQLVMYVTATDKQTFATAFDLSNIPVVSQEQALA 609

Query: 299 ENLKPRSFDLAS-TQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           E    R+  L S T T+   ++       N  +    A           ++++L QIPE+
Sbjct: 610 EE---RTKKLTSATPTLKAPTAGPSKAKQNGAADGAAAAQATTQK----FAEELAQIPEL 662

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
             +G L KSS  PVELTE ETEYVV+ +KH+FK+++V Q+ + NTL D +LE+V++V  P
Sbjct: 663 KEYGTLLKSS-SPVELTERETEYVVTAIKHIFKDHIVVQYDIKNTLPDTVLEDVSLVATP 721

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPSTX 476
             ++ +L E+F++PA KL  ++P  +YVAFK+   E +Y + SF+N LKF  K+ DP+T 
Sbjct: 722 SEEDESLEEDFIVPAPKLVPNEPGLVYVAFKKAGGEHDYPITSFTNVLKFTSKEIDPTT- 780

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSLK 535
                           +E+  SDYV P +  +F   W+  G  G +  ET  L+  K + 
Sbjct: 781 GEPEETGYEDEYQVEDLELTGSDYVIPAFAGNFDHLWEQTGANGEEATETLQLSNMKGIS 840

Query: 536 DSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           D+   LI  L + P+E +    ++S H+L L G  + G KV    R+ ++  TGVT +++
Sbjct: 841 DATEQLITALSLQPLEGTDVVLNNSTHSLKLYGKTVSGGKVTGLVRLAYSAKTGVTTKIT 900

Query: 596 VRSPSEEISRIVIGAV 611
           +R+  E ++  +I +V
Sbjct: 901 IRAEEEGVAAAIITSV 916



>gi|402072343|gb|EJT68175.1| coatomer subunit gamma [Gaeumannomyces graminis var. tritici
           R3-111a-1]
          Length = 917

 Score =  606 bits (1563), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 337/616 (54%), Positives = 438/616 (71%), Gaps = 15/616 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAA+R L+  A  +P AV  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLTSPRAVTKFAALRILHNFATFKPQAVNVCNPDIELLISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQITGFMSEI+DEFK+ +V+AIR+LCLKFPSKQ  ML+FLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMKQITGFMSEITDEFKITIVEAIRTLCLKFPSKQAGMLAFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+P+SKE ALAHLCEFIEDCEFTKL+VR+LHLLG+EGPKT  PTKYI
Sbjct: 431 KRAVVESMFDLIKFVPDSKEDALAHLCEFIEDCEFTKLAVRILHLLGLEGPKTSQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVK+S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKRSVHVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLID-DNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQAE 297
           L+L+D ++E AEK+VK+DS YSL+  E QLV YV++ + S    PFD+S+IP +T+ QA+
Sbjct: 551 LRLMDEEDELAEKFVKNDSMYSLSYFEHQLVMYVTSDDKSTFSTPFDMSNIPVVTREQAD 610

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE+   R+  L +T    T S     +     + +            Q Y+++L QIPE+
Sbjct: 611 AED---RTKKLTAT----TPSLKPPKVGPTKAAPTGAEAAASASAAAQKYAEELVQIPEM 663

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
             FG + KSS   VELTE+ETEYVVS VKH+FKE++V QF V NTL   +LENV+VV  P
Sbjct: 664 KEFGGVLKSS-PVVELTEAETEYVVSVVKHIFKEHVVLQFEVKNTLPATVLENVSVVATP 722

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPSTX 476
            SDE  L E F+I A KLP D+P  IYVAFK+ + E    + +FSNTLKF  K+ DPST 
Sbjct: 723 -SDEEELEELFIIEAEKLPTDEPGKIYVAFKKASGEGSMPISTFSNTLKFTTKEIDPST- 780

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSLK 535
                            ++  SDYV P + S+F+  W+ VG  G +  ET  L + KS+ 
Sbjct: 781 NEPEESGYDDEYEVAEFDLSGSDYVVPAFASNFNHIWEQVGASGEEAEETLQLGSMKSIA 840

Query: 536 DSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           ++   L + L + P+E +  P + + HTL L G  +GG +V+A  RM ++  +GVT ++ 
Sbjct: 841 EATEQLAKALSLQPLEGTDVPINQTTHTLKLLGKTVGGGRVVASVRMAYSSKSGVTTKIV 900

Query: 596 VRSPSEEISRIVIGAV 611
           VRS  E ++ +V+ +V
Sbjct: 901 VRSEEEGVAALVVASV 916



>gi|380492433|emb|CCF34606.1| hypothetical protein CH063_06566 [Colletotrichum higginsianum]
          Length = 917

 Score =  606 bits (1563), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 330/616 (53%), Positives = 439/616 (71%), Gaps = 15/616 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAA+R L+  A  +P AV  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLTSPRAVTKFAALRILHNFASFKPNAVNVCNPDIELLISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFMSEI+DEFK+ +V+AIR+LCLKFPSKQ  ML+FLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMKQISGFMSEITDEFKITIVEAIRTLCLKFPSKQAGMLAFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+PESKE ALAHLCEFIEDCEFTKL+VR+LHLLG+EGPKT  PTKYI
Sbjct: 431 KRAVVESMFDLIKFVPESKEDALAHLCEFIEDCEFTKLAVRILHLLGLEGPKTSQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVK+S++VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKRSVEVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQAE 297
           L+L+  ++E +EK+VK+DS +SL   E+QLV YV++ + S    PFD+S IP +T+ QA+
Sbjct: 551 LRLMHQEDEISEKFVKNDSIFSLPYFEQQLVMYVTSEDKSAFNSPFDISQIPVVTREQAD 610

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE+   R+  L +T      S     +     +              Q Y+Q+L QIPE+
Sbjct: 611 AED---RTKKLTAT----APSLKPPKVGPTKAAAGGAEAAASATAATQRYAQELMQIPEM 663

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
             FG + KSS   VELTESE EYVV+ VKH+FKE++VFQ+ V NTL+  +LENV++V  P
Sbjct: 664 KEFGSVLKSS-PVVELTESEMEYVVTVVKHIFKEHVVFQYEVKNTLDATVLENVSIVATP 722

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPSTX 476
            S+E  L E F+I A KLP ++P  +YVAFK+ N E    + SFSN LKF  K+ DP+T 
Sbjct: 723 -SEEEELEEVFIIQAEKLPTNEPGKVYVAFKKVNGEGSMPISSFSNVLKFTSKEIDPTT- 780

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSLK 535
                            ++  SDYV PT+ S+F+  W+ VG  G +  ET  L++ KS+ 
Sbjct: 781 NEPEDTGYDDEYEVAEFDLAGSDYVIPTFASNFNHIWEQVGAAGEEAEETLQLSSMKSIA 840

Query: 536 DSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           ++   L ++L + P+E +  P + + HTL L G  +GG +V+A  RM ++  +GVT +++
Sbjct: 841 EATEQLAKVLSLQPLEGTDVPVNQTTHTLKLLGKTVGGGRVVANVRMAYSSKSGVTTKIT 900

Query: 596 VRSPSEEISRIVIGAV 611
           VRS  E ++ +V+ +V
Sbjct: 901 VRSEEEGVASLVVASV 916



>gi|342876647|gb|EGU78230.1| hypothetical protein FOXB_11256 [Fusarium oxysporum Fo5176]
          Length = 916

 Score =  606 bits (1563), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 331/622 (53%), Positives = 439/622 (70%), Gaps = 28/622 (4%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAA+R L+  A  +PTAV +CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLTSPRAVTKFAALRILHNFASFKPTAVNACNPDIELLISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+ FMSEI+DEFK+ +V+AIR+LCLKFPSKQ  ML+FLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMKQISTFMSEITDEFKITIVEAIRTLCLKFPSKQAGMLTFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+P+SKE ALAHLCEFIEDCEFTKL+VR+LHL+G+EGPKT  PTKYI
Sbjct: 431 KRAVVESMFDLIKFVPDSKEDALAHLCEFIEDCEFTKLAVRILHLIGLEGPKTAQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVK S++VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKSSVRVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLID--DNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQA 296
           LKL++  D+E A ++VK+++ +SL   E+QLV YV++ + S  + PFD++ IP +T+ QA
Sbjct: 551 LKLMNEEDDEMAARFVKNENMFSLPYFEQQLVLYVTSDDKSAFDSPFDIAKIPVVTREQA 610

Query: 297 EAENLKPRSFDLAST---QTIG-TSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLE 352
           +AE+   +    A T     +G T  +   ++ S      R             Y+Q+L 
Sbjct: 611 DAEDRSKKLIATAPTLKAPKVGPTKPTGAEAVASASAQAQR-------------YAQELL 657

Query: 353 QIPEIAAFGPLFKSSIKPV-ELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENV 411
           +IPE+  FG + KSS  PV ELTE+ETEYVVS VKH+FKE++V Q+ V NTL D +LENV
Sbjct: 658 EIPEMKEFGSVLKSS--PVIELTEAETEYVVSLVKHIFKEHIVLQYEVKNTLPDTILENV 715

Query: 412 TVVMQPESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKD 470
           +VV  P +DE  L E F+I A KL  D+P  +YVAFK+   E    + +FSN LKF  K+
Sbjct: 716 SVVATP-ADEEELEEVFIIQAEKLATDEPGKVYVAFKKVGGEASLPISTFSNVLKFTSKE 774

Query: 471 CDPSTXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALT 529
            DPST                  ++  SDYV PT+  +FS  W+ VG  G +V ET  L+
Sbjct: 775 IDPST-GEPEDSGYDDEYEVAEFDLAGSDYVIPTFAGNFSHIWEQVGASGEEVTETLQLS 833

Query: 530 ASKSLKDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTG 589
             +S+ D+   L + L + P+E +  P + + HTL L G  +GG +V+A  RM ++  TG
Sbjct: 834 GMESIADATEQLTKALSLQPLEGTDVPVNQTTHTLKLLGKTVGGGRVVANVRMAYSSKTG 893

Query: 590 VTMELSVRSPSEEISRIVIGAV 611
           VT +++VRS  E ++ +VI +V
Sbjct: 894 VTTKITVRSEEENVAALVIASV 915



>gi|347833364|emb|CCD49061.1| similar to coatomer subunit gamma-2 [Botryotinia fuckeliana T4]
 gi|472243834|gb|EMR88473.1| putative coatomer subunit gamma-2 protein [Botryotinia fuckeliana
           BcDW1]
          Length = 917

 Score =  606 bits (1563), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 324/619 (52%), Positives = 445/619 (71%), Gaps = 21/619 (3%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAAIR L+  A  +P AV  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLTSPRAVTKFAAIRILHNFASFKPQAVHPCNPDIELLISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFM++I+DEFK+ +V+AIR+LCLKFP+KQ  ML+FLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMKQISGFMADITDEFKITIVEAIRTLCLKFPNKQAGMLAFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+P+SKE ALAHLCEFIEDCEFTKL+VR+LHLLG+EGPKT  PTKYI
Sbjct: 431 KRAVVESMFDLIKFVPDSKEDALAHLCEFIEDCEFTKLAVRILHLLGLEGPKTSQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV+ +DPEVK+S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENAIVRAAAVTALAKFGVAQKDPEVKRSVTVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQAE 297
           L+L+ + +++A++++K+++T++L  LE QLV YV+  + S  + PFD++ +P +TK QA+
Sbjct: 551 LRLMSESDDTADRFIKNENTFALPYLEHQLVMYVTADDKSTFDDPFDIASVPVVTKEQAD 610

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSR---DATPTPGVDQQQVYSQQLEQI 354
           AE           T+ + T +  + +  S    TS+   +A  +     Q+ Y+Q+L +I
Sbjct: 611 AEE---------RTKKLTTVTPTIKAPKSGPTKTSQSGAEAVASASATAQK-YAQELLKI 660

Query: 355 PEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVV 414
           PEI  +G + KSS   VELTESETEYVV+ VKH+FKE++V Q+ V NTL D +LE V+VV
Sbjct: 661 PEITPYGAVLKSS-PVVELTESETEYVVTVVKHIFKEHIVLQYEVKNTLPDTVLEEVSVV 719

Query: 415 MQPESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDP 473
             P SDE  L E+F+IPATKL  D+P +IYV+FK+ + E  +   +F+N LKF  K+ DP
Sbjct: 720 ASP-SDEEELEEDFIIPATKLVTDEPGTIYVSFKKISGEAAFPSSTFTNILKFTTKEIDP 778

Query: 474 STXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASK 532
           +T                 +E+  SDYV P +  +F+  W+ VG  G +  ET  L+  K
Sbjct: 779 TT-GEPEDTGYDDEYQVEDLELTGSDYVVPAFAGNFNHIWEQVGASGEEAEETLQLSGVK 837

Query: 533 SLKDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTM 592
           S+ D+   L + L + P++ +  P +++ HTL L G  + G +V+A  RM ++  +GVT 
Sbjct: 838 SIADATEQLTKTLSLQPLDGTDVPINTTTHTLKLFGKTVTGGRVVANIRMAYSSKSGVTS 897

Query: 593 ELSVRSPSEEISRIVIGAV 611
           ++ VR   E I+ +VIG+V
Sbjct: 898 KIVVRGEEEGIAALVIGSV 916



>gi|261203897|ref|XP_002629162.1| coatomer subunit gamma [Ajellomyces dermatitidis SLH14081]
 gi|239586947|gb|EEQ69590.1| coatomer subunit gamma [Ajellomyces dermatitidis SLH14081]
 gi|239608822|gb|EEQ85809.1| coatomer subunit gamma [Ajellomyces dermatitidis ER-3]
 gi|327356131|gb|EGE84988.1| coatomer subunit gamma-1 [Ajellomyces dermatitidis ATCC 18188]
          Length = 919

 Score =  606 bits (1563), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 319/613 (52%), Positives = 435/613 (70%), Gaps = 27/613 (4%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP+   +FAAIRTL+ LA  +P  V  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLSSPRPITKFAAIRTLHSLASFKPNVVNPCNQDIEALISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLM QI+GFM++ +DEFK+ +V+AIR+LCLKFP+KQ  ML+FLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMTQISGFMADTTDEFKITIVEAIRTLCLKFPNKQAGMLTFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KR+VVE++FDL+KF+P SKE ALAHLCEFIEDCEFTKL+VR+LHLLGVEGPKT  PTKYI
Sbjct: 431 KRSVVESMFDLIKFVPGSKEEALAHLCEFIEDCEFTKLAVRILHLLGVEGPKTSQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+++RAAAV+ALAKFGV  +DPE+K+S+ VLLTRCLDD DDEVRDRA+L 
Sbjct: 491 RYIYNRVVLENAVIRAAAVTALAKFGVGQKDPELKRSVNVLLTRCLDDTDDEVRDRAVLN 550

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYV--SNPESSEKPFDLSDIPKITKAQAE 297
           L+L+ +++E AE++VK DS +SL+  E QLV YV  ++ E+    FD++ IP +++ QA 
Sbjct: 551 LRLMKEEDELAERFVKADSMFSLSTFEHQLVMYVTATDKETFATAFDVNTIPIVSQEQAL 610

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQ-------QVYSQQ 350
           AE    R+  L         ++A+ ++ +  ++ S+ A PT G D         Q Y+QQ
Sbjct: 611 AEE---RTKKL---------TTAIPTLKAPSMTPSK-AKPTAGADGVAAAAASTQKYAQQ 657

Query: 351 LEQIPEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLEN 410
           L +IPE+ A+G L KSS+ PVELTESETEYVVS VKH+FKE++V Q+ + NTL D LLE+
Sbjct: 658 LVRIPELKAYGTLLKSSV-PVELTESETEYVVSAVKHIFKEHIVLQYDIKNTLPDTLLED 716

Query: 411 VTVVMQPESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVK 469
           V+VV  PE D+ +L E+F++PA KL  ++P  +YVAFK+   E ++ + SF+N LKF  K
Sbjct: 717 VSVVASPEDDDESLEEDFIVPAPKLMTNEPGIVYVAFKKLGGEHDFPVTSFTNNLKFTSK 776

Query: 470 DCDPSTXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFAL 528
           + DP+T                 +++  SDYV P +   F   W+  G  G +  ET  L
Sbjct: 777 EIDPTT-GDPEETGYEDEYQVEDLDLTGSDYVIPAFAGSFDHVWEQTGANGEEATETLQL 835

Query: 529 TASKSLKDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPST 588
           +  K ++D+   L+  L + P+E S    +++ H+L L G  + G +V A  RM ++  +
Sbjct: 836 SNVKGIEDATEQLVATLSLQPLEGSDVVLNNTTHSLKLYGKTVSGGRVAALVRMAYSAKS 895

Query: 589 GVTMELSVRSPSE 601
           GVT +++VR+  E
Sbjct: 896 GVTTKVTVRAEEE 908



>gi|154322170|ref|XP_001560400.1| hypothetical protein BC1G_01232 [Botryotinia fuckeliana B05.10]
          Length = 912

 Score =  606 bits (1563), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 324/619 (52%), Positives = 445/619 (71%), Gaps = 21/619 (3%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAAIR L+  A  +P AV  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 306 LFLTSPRAVTKFAAIRILHNFASFKPQAVHPCNPDIELLISNSNRSIATFAITTLLKTGN 365

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFM++I+DEFK+ +V+AIR+LCLKFP+KQ  ML+FLSG+LRDEGGYEF
Sbjct: 366 EASVDRLMKQISGFMADITDEFKITIVEAIRTLCLKFPNKQAGMLAFLSGILRDEGGYEF 425

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+P+SKE ALAHLCEFIEDCEFTKL+VR+LHLLG+EGPKT  PTKYI
Sbjct: 426 KRAVVESMFDLIKFVPDSKEDALAHLCEFIEDCEFTKLAVRILHLLGLEGPKTSQPTKYI 485

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV+ +DPEVK+S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 486 RYIYNRVVLENAIVRAAAVTALAKFGVAQKDPEVKRSVTVLLTRCLDDVDDEVRDRAALN 545

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQAE 297
           L+L+ + +++A++++K+++T++L  LE QLV YV+  + S  + PFD++ +P +TK QA+
Sbjct: 546 LRLMSESDDTADRFIKNENTFALPYLEHQLVMYVTADDKSTFDDPFDIASVPVVTKEQAD 605

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSR---DATPTPGVDQQQVYSQQLEQI 354
           AE           T+ + T +  + +  S    TS+   +A  +     Q+ Y+Q+L +I
Sbjct: 606 AEE---------RTKKLTTVTPTIKAPKSGPTKTSQSGAEAVASASATAQK-YAQELLKI 655

Query: 355 PEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVV 414
           PEI  +G + KSS   VELTESETEYVV+ VKH+FKE++V Q+ V NTL D +LE V+VV
Sbjct: 656 PEITPYGAVLKSS-PVVELTESETEYVVTVVKHIFKEHIVLQYEVKNTLPDTVLEEVSVV 714

Query: 415 MQPESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDP 473
             P SDE  L E+F+IPATKL  D+P +IYV+FK+ + E  +   +F+N LKF  K+ DP
Sbjct: 715 ASP-SDEEELEEDFIIPATKLVTDEPGTIYVSFKKISGEAAFPSSTFTNILKFTTKEIDP 773

Query: 474 STXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASK 532
           +T                 +E+  SDYV P +  +F+  W+ VG  G +  ET  L+  K
Sbjct: 774 TT-GEPEDTGYDDEYQVEDLELTGSDYVVPAFAGNFNHIWEQVGASGEEAEETLQLSGVK 832

Query: 533 SLKDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTM 592
           S+ D+   L + L + P++ +  P +++ HTL L G  + G +V+A  RM ++  +GVT 
Sbjct: 833 SIADATEQLTKTLSLQPLDGTDVPINTTTHTLKLFGKTVTGGRVVANIRMAYSSKSGVTS 892

Query: 593 ELSVRSPSEEISRIVIGAV 611
           ++ VR   E I+ +VIG+V
Sbjct: 893 KIVVRGEEEGIAALVIGSV 911



>gi|477518812|gb|ENH71012.1| Putative coatomer subunit gamma [Fusarium oxysporum f. sp. cubense
           race 1]
          Length = 929

 Score =  605 bits (1560), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 331/622 (53%), Positives = 439/622 (70%), Gaps = 28/622 (4%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAA+R L+  A  +PTAV +CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 324 LFLTSPRAVTKFAALRILHNFASFKPTAVNACNPDIELLISNSNRSIATFAITTLLKTGN 383

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+ FMSEI+DEFK+ +V+AIR+LCLKFPSKQ  ML+FLSG+LRDEGGYEF
Sbjct: 384 EASVDRLMKQISTFMSEITDEFKITIVEAIRTLCLKFPSKQAGMLTFLSGILRDEGGYEF 443

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+P+SKE ALAHLCEFIEDCEFTKL+VR+LHL+G+EGPKT  PTKYI
Sbjct: 444 KRAVVESMFDLIKFVPDSKEDALAHLCEFIEDCEFTKLAVRILHLIGLEGPKTTQPTKYI 503

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVK S++VLLTRCLDD DDEVRDRA L 
Sbjct: 504 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKSSVRVLLTRCLDDVDDEVRDRAALN 563

Query: 241 LKLID--DNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQA 296
           LKL++  D+E A ++VK+++ +SL   E+QLV YV++ + S  + PFD++ IP +T+ QA
Sbjct: 564 LKLMNEEDDEMAARFVKNENMFSLPYFEQQLVLYVTSDDKSAFDSPFDIAKIPVVTREQA 623

Query: 297 EAENLKPRSFDLAST---QTIG-TSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLE 352
           +AE+   +    A T     +G T  +   ++ S      R             Y+Q+L 
Sbjct: 624 DAEDRSKKLIATAPTLKAPKVGPTKPTGAEAVASASAQAQR-------------YAQELL 670

Query: 353 QIPEIAAFGPLFKSSIKPV-ELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENV 411
           +IPE+  FG + KSS  PV ELTE+ETEYVVS VKH+FKE++V Q+ V NTL D +LENV
Sbjct: 671 EIPEMKEFGSVLKSS--PVIELTEAETEYVVSLVKHIFKEHIVLQYEVKNTLPDTILENV 728

Query: 412 TVVMQPESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKD 470
           +VV  P +DE  L E F+I A KL  D+P  +YVAFK+   E    + +FSN LKF  K+
Sbjct: 729 SVVATP-ADEEELEEVFIIQAEKLATDEPGKVYVAFKKVGGEASLPISTFSNVLKFTSKE 787

Query: 471 CDPSTXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALT 529
            DPST                  ++  SDYV PT+  +FS  W+ VG  G +V ET  L+
Sbjct: 788 IDPST-GEPEDSGYDDEYEVAEFDLAGSDYVIPTFAGNFSHIWEQVGASGEEVTETLQLS 846

Query: 530 ASKSLKDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTG 589
             +S+ D+   L + L + P+E +  P + + HTL L G  +GG +V+A  RM ++  TG
Sbjct: 847 GMESIADATEQLTKALSLQPLEGTDVPVNQTTHTLKLLGKTVGGGRVVANVRMAYSSKTG 906

Query: 590 VTMELSVRSPSEEISRIVIGAV 611
           VT +++VRS  E ++ +VI +V
Sbjct: 907 VTTKITVRSEEENVAALVIASV 928



>gi|389647045|ref|XP_003721154.1| coatomer subunit gamma [Magnaporthe oryzae 70-15]
 gi|351638546|gb|EHA46411.1| coatomer subunit gamma [Magnaporthe oryzae 70-15]
 gi|440467075|gb|ELQ36316.1| coatomer subunit gamma [Magnaporthe oryzae Y34]
 gi|440482473|gb|ELQ62961.1| coatomer subunit gamma [Magnaporthe oryzae P131]
          Length = 917

 Score =  604 bits (1557), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 334/616 (54%), Positives = 438/616 (71%), Gaps = 15/616 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAA+R L+  A  +P  V  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLTSPRAVTKFAALRILHNFASFKPNTVNVCNPDIELLISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQITGFMSEI+DEFK+ +V+AIR+LCLKFPSKQ  ML+FLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMKQITGFMSEITDEFKITIVEAIRTLCLKFPSKQAGMLAFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+P+SKE ALAHLCEFIEDCEFTKL+VR+LHLLG+EGPKT  PTKYI
Sbjct: 431 KRAVVESMFDLIKFVPDSKEDALAHLCEFIEDCEFTKLAVRILHLLGLEGPKTSQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVK+S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKRSVHVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLIDDNES-AEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQAE 297
           L+L+D+ ++ AEK+VK+DS +SL   E QLV YV++ + S  + PFD+S IP +T+ QA+
Sbjct: 551 LRLMDEEDALAEKFVKNDSMFSLPYFEHQLVMYVTSDDKSTFDSPFDISKIPVVTREQAD 610

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE+   R+  L +T    T S     +     + +            Q Y+Q+L QIPE+
Sbjct: 611 AED---RTKKLTAT----TPSLKPPKVGPTKAAPTGAEAAASATAAAQKYAQELMQIPEM 663

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
             FG + KSS   VELTE+ETEYVVS VKH+FKE++V QF V NTL   +LENV+VV  P
Sbjct: 664 KEFGSVLKSS-PIVELTEAETEYVVSVVKHIFKEHIVLQFEVKNTLPSTVLENVSVVATP 722

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPSTX 476
            SDE  L E F+I A KLP D+P  +YVAFK+ + E    + +FSN+LKF  K+ DP+T 
Sbjct: 723 -SDEEELEELFIIEAEKLPTDEPGKVYVAFKKVSGEGSMPISTFSNSLKFTTKEIDPTT- 780

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSLK 535
                            ++  SDYV PT+ S+F+  W+ VG  G +  ET  L+A KS+ 
Sbjct: 781 NEPEDEGYEDEYEVAEFDVSGSDYVIPTFASNFNHLWEQVGAAGEEAEETLQLSAMKSIA 840

Query: 536 DSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           ++   L + L + P+E +  P + + HTL L G  + G +V+A  RM ++  +GVT +++
Sbjct: 841 EATEQLSKALSLQPLEGTDVPVNQTTHTLKLLGKTVNGGRVVANVRMAYSSKSGVTTKIT 900

Query: 596 VRSPSEEISRIVIGAV 611
           VRS  E ++ +VI +V
Sbjct: 901 VRSEEEGVAALVIASV 916



>gi|46129310|ref|XP_389016.1| hypothetical protein FG08840.1 [Fusarium graminearum PH-1]
          Length = 933

 Score =  604 bits (1557), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 335/634 (52%), Positives = 441/634 (69%), Gaps = 35/634 (5%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAA+R L+  A  +P AV  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLTSPRAVTKFAALRILHNFASFKPNAVNPCNPDIELLISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+ FMSEI+DEFK+ +V+AIR+LCLKFPSKQ  ML+FLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMKQISTFMSEITDEFKITIVEAIRTLCLKFPSKQAGMLTFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+P+SKE ALAHLCEFIEDCEFTKL+VR+LHL+G+EGPKT  PTKYI
Sbjct: 431 KRAVVESMFDLIKFVPDSKEDALAHLCEFIEDCEFTKLAVRILHLIGLEGPKTAQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DP+VK S++VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPDVKSSVRVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLID--DNESAEKYVKD-----------------DSTYSLAALERQLVQYVSNPESS-- 279
           LKL++  D+E A ++VK+                 ++ +SL   E+QLV YV++ E+S  
Sbjct: 551 LKLMNEEDDEMAVRFVKNGKKTITPHRQTVTNAATENMFSLPYFEQQLVMYVTSEEASAF 610

Query: 280 EKPFDLSDIPKITKAQAEAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTP 339
           + PFD+S IP +T+ QA+AE+   RS  L +T T    +  VG       +T  +A  T 
Sbjct: 611 DSPFDISKIPVVTREQADAED---RSKKLIAT-TPTLKAPKVGPTK----ATGAEAVATA 662

Query: 340 GVDQQQVYSQQLEQIPEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIV 399
              Q Q Y+Q+L +IPE+  FG + KSS   +ELTE+ETEYVVS VKH+FKE++V Q+ V
Sbjct: 663 SA-QAQKYAQELMEIPEMQEFGNVLKSS-PLIELTEAETEYVVSLVKHIFKEHVVLQYEV 720

Query: 400 TNTLNDQLLENVTVVMQPESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLG 458
            NTL D +LENV+VV  P  DE  L E F+I A KL  D+P  +YVAFK+   E    + 
Sbjct: 721 KNTLPDTVLENVSVVATPADDE-ELEEVFIIQAEKLATDEPGKVYVAFKKIGGEASLPIS 779

Query: 459 SFSNTLKFLVKDCDPSTXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGE 518
           +F+N LKF  K+ DPST                  ++  SDYV PT+  +FS  W+ VG 
Sbjct: 780 TFTNVLKFTSKEIDPST-GEPEDTGYDDEYEVAEFDLSGSDYVIPTFAGNFSHIWEQVGA 838

Query: 519 EG-QVVETFALTASKSLKDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVL 577
            G +V ET  L+  +S+ D+   L + L + P+E +  P + + HTL L G  +GG +V+
Sbjct: 839 SGEEVTETLQLSGMESIADATEQLTKALSLQPLEGTDVPVNQTTHTLKLLGKTVGGGRVV 898

Query: 578 AKNRMTFAPSTGVTMELSVRSPSEEISRIVIGAV 611
           A  RM F+  TGVT +++VRS  E ++ +VI +V
Sbjct: 899 ANVRMAFSSKTGVTTKITVRSEEENVAALVIASV 932



>gi|470319067|gb|EMR10691.1| hypothetical protein PNEG_00842 [Pneumocystis murina B123]
          Length = 912

 Score =  603 bits (1556), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 300/611 (49%), Positives = 433/611 (70%), Gaps = 18/611 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           +FLSSP++  RF+AIR LN+ AMT+P  V  CN D+E+LI+  N+S+ATFAITTLLKTGN
Sbjct: 319 VFLSSPRTVCRFSAIRILNRFAMTKPHLVGCCNSDIESLISYTNKSIATFAITTLLKTGN 378

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E ++D+LMKQI GFMS+I+DEFK+IV+DAIRSLCLKFPSKQ VMLSFL+  LRDEGGY+F
Sbjct: 379 EVNIDKLMKQIQGFMSDITDEFKIIVIDAIRSLCLKFPSKQAVMLSFLNNALRDEGGYDF 438

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K +VVE +FD++KFIPESKE AL+ LCEFIEDCEFTKL++R+LH+LG+EGP+    TKYI
Sbjct: 439 KNSVVETLFDMIKFIPESKEDALSSLCEFIEDCEFTKLTIRILHMLGIEGPRINQSTKYI 498

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNR++LEN++VRAAAVSAL+KFG    + ++K SIK LL RCL+D+DDEVRDRA+L 
Sbjct: 499 RYIYNRIVLENALVRAAAVSALSKFGQGLNNSDLKISIKTLLKRCLEDSDDEVRDRAVLN 558

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAEN 300
           +K ++D+  ++ + K+++ +S +ALE QLV Y+S+  S EK FD+S IP I+K + ++E+
Sbjct: 559 IKFLEDDSISDIF-KNNNAFSFSALEYQLVSYISS-NSFEKQFDISSIPIISKEEMDSES 616

Query: 301 LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIAAF 360
            + +  +L S  T+  ++  +  +N    S S D            YS  L+ I E   +
Sbjct: 617 YRQKIAELESLSTLTEATQQLSLVN----SFSEDVISQ--------YSNILQSISEFKDY 664

Query: 361 GPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPESD 420
           GPL KS++KP+ELTES  EY ++ VKH+FKE++V QF + NTL+D +LEN+++V +P  D
Sbjct: 665 GPLLKSTLKPIELTESGIEYSITAVKHIFKEHIVLQFNLLNTLSDAILENISMVSEP--D 722

Query: 421 EGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXXXX 480
           + +L EEF+I A K  ++   SIYV+F R NP+ +   +F+N LKF+ K+ DPST     
Sbjct: 723 DPSLKEEFIIQAPKAEHNSSVSIYVSFLRENPDFFVTTTFTNVLKFITKEIDPST-GEPE 781

Query: 481 XXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSCTT 540
                       +E+   DY+ P YI++F+  WDS+ ++ +VVETF+L++  SL+D+C  
Sbjct: 782 KVGYDDEYQIEALELSPGDYISPIYINNFTQLWDSLTDKNEVVETFSLSSITSLQDACYR 841

Query: 541 LIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSVRSPS 600
           + E L M P+E +   T+S  H + LSG    GI +LA  ++ F+ +  +T++LSVRS +
Sbjct: 842 ISEQLSMQPIEGTDNVTNSFFHIMKLSGKSTNGITILAVAKLVFSKNE-ITLKLSVRSEN 900

Query: 601 EEISRIVIGAV 611
           + ++ +    +
Sbjct: 901 KLVATLATNGI 911



>gi|358393479|gb|EHK42880.1| hypothetical protein TRIATDRAFT_149621 [Trichoderma atroviride IMI
           206040]
          Length = 918

 Score =  603 bits (1555), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 333/617 (53%), Positives = 439/617 (71%), Gaps = 16/617 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAA+R L+  A   PTAV  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLTSPRAVTKFAALRILHSFASFNPTAVSVCNTDIELLISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFMSEI+DEFK+ +V+AIR+LCLKFPSKQ  ML+FLSG+LRDEGG+EF
Sbjct: 371 EASVDRLMKQISGFMSEITDEFKITIVEAIRTLCLKFPSKQAGMLTFLSGILRDEGGFEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+P+SKE ALAHLCEFIEDCEFTKL+VR+LHL+G+EGPKT  PTKYI
Sbjct: 431 KRAVVESMFDLIKFVPDSKEDALAHLCEFIEDCEFTKLAVRILHLIGLEGPKTAQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DP+VK S++VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPDVKSSVRVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLI--DDNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQA 296
           LKL+  +D+E A  +VK+D+ +SL   E QLV YV++ + S  + PFD+S IP +T+ QA
Sbjct: 551 LKLMAEEDDEMARNFVKNDNMFSLPFFEHQLVMYVTSDDKSAFDVPFDISKIPVVTREQA 610

Query: 297 EAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPE 356
           +AE+   R+  L +T     +  A G   ++  S    AT +    +   Y+Q+L QIPE
Sbjct: 611 DAED---RTKKLTATAPTLKAPKA-GPTKTSTSSAEAAATASAQAQR---YAQELMQIPE 663

Query: 357 IAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
           +  FG + KSS   VELTE+ETEYVVS VKH+FKE++V Q+ V NTL D +LENV+VV  
Sbjct: 664 MKEFGSVLKSS-PVVELTEAETEYVVSVVKHIFKEHIVLQYEVKNTLPDTVLENVSVVAS 722

Query: 417 PESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPST 475
           P SDE  L E F+I + KL  ++P  +YVAFK+ N E    + +FSN LKF  K+ DPST
Sbjct: 723 P-SDEEELEEVFIIQSEKLATNEPGKVYVAFKKLNGEASLPISTFSNVLKFTSKEIDPST 781

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSL 534
                             E+  SDYV PT+  +FS  W+ VG  G +  ET  L++ KS+
Sbjct: 782 -GDPEDTGYDDEYEVSEFELSGSDYVIPTFAGNFSHLWEQVGATGEEAEETLQLSSMKSI 840

Query: 535 KDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
            ++   L ++L + P+E +  P + S HTL L G  + G +V+A  RM F+  +GVT ++
Sbjct: 841 AEATEQLAKILSLQPLEGTDVPVNQSTHTLKLLGKTVNGGRVVANIRMAFSSKSGVTTKI 900

Query: 595 SVRSPSEEISRIVIGAV 611
           +VR   E ++ +VI +V
Sbjct: 901 TVRGEEEGVAALVIASV 917



>gi|429852937|gb|ELA28048.1| coatomer subunit [Colletotrichum gloeosporioides Nara gc5]
          Length = 861

 Score =  603 bits (1554), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 328/616 (53%), Positives = 437/616 (70%), Gaps = 30/616 (4%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAA+R L+  A  +P AV  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 270 LFLTSPRAVTKFAALRILHNFASFKPNAVNVCNPDIELLISNSNRSIATFAITTLLKTGN 329

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFMSEI+DEFK+ +V+AIR+LCLKFPSKQ  ML+FLSG+LRDEGGYEF
Sbjct: 330 EASVDRLMKQISGFMSEITDEFKITIVEAIRTLCLKFPSKQAGMLAFLSGILRDEGGYEF 389

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+PESKE ALAHLCEFIEDCEFTKL+VR+LHLLG+EGPKT  PTKYI
Sbjct: 390 KRAVVESMFDLIKFVPESKEDALAHLCEFIEDCEFTKLAVRILHLLGLEGPKTSQPTKYI 449

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVK+S++VLLTRCLDD DDEVRDRA L 
Sbjct: 450 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKRSVEVLLTRCLDDVDDEVRDRAALN 509

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQAE 297
           L+L+ +D+  +EK+VK+DS +SL   E QLV YV++ + S  + PFD+S IP +T+ QA+
Sbjct: 510 LRLMHEDDAISEKFVKNDSMFSLPYFEHQLVMYVTSEDKSAFDTPFDISQIPVVTREQAD 569

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE+          T+ +  ++    +  S   +  R             Y+Q+L QIPE+
Sbjct: 570 AED---------RTKKLTATAPGAEAAASATAAAQR-------------YAQELMQIPEM 607

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
             FG + KSS   VELTESE EYVV+ VKH+FKE++VFQ+ + NTL   +LENV+VV  P
Sbjct: 608 KEFGSVLKSS-PVVELTESEMEYVVTVVKHIFKEHIVFQYEIKNTLQATVLENVSVVATP 666

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPSTX 476
            S+E  L E F+I A KLP D+P  +YVAFK+   E    + SFSN LKF  K+ DP+T 
Sbjct: 667 -SEEEELEEVFIIQAEKLPTDEPGKVYVAFKKVGGEGSMPVSSFSNILKFTSKEIDPTT- 724

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSLK 535
                            ++  SDYV PT+ S+F+  W+ VG  G +  ET  L++ KS+ 
Sbjct: 725 NEPEATGYDDEYEVAEFDLAGSDYVVPTFASNFNHIWEQVGAAGEEAEETLQLSSMKSIA 784

Query: 536 DSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           ++   L ++L + P+E +  P + + HTL L G  +GG +V+A  RM ++  +GVT +++
Sbjct: 785 EATEQLAKVLSLQPLEGTDVPVNQTTHTLKLLGKTVGGGRVVANVRMAYSSKSGVTTKIT 844

Query: 596 VRSPSEEISRIVIGAV 611
           VRS  E ++ +V+ +V
Sbjct: 845 VRSEEEGVASLVVASV 860



>gi|477535413|gb|ENH86936.1| coatomer subunit [Colletotrichum orbiculare MAFF 240422]
          Length = 1546

 Score =  602 bits (1552), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 329/622 (52%), Positives = 442/622 (71%), Gaps = 25/622 (4%)

Query: 1    LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
            LFL+SP++  +FAA+R L+  A  +P AV  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 940  LFLTSPRAVTKFAALRILHNFASFKPNAVSVCNPDIELLISNSNRSIATFAITTLLKTGN 999

Query: 61   EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
            EASVDRLMKQI+GFMSEI+DEFK+ +V+AIR+LCLKFP+KQ  ML+FLSG+LRDEGGYEF
Sbjct: 1000 EASVDRLMKQISGFMSEITDEFKITIVEAIRTLCLKFPNKQAGMLAFLSGILRDEGGYEF 1059

Query: 121  KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
            KRAVVE++FDL+KF+PESKE AL+HLCEFIEDCEFTKL+VR+LHLLG+EGPKTP PTKYI
Sbjct: 1060 KRAVVESMFDLIKFVPESKEDALSHLCEFIEDCEFTKLAVRILHLLGLEGPKTPQPTKYI 1119

Query: 181  RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
            RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVK+S++VLLTRCLDD DDEVRDRA L 
Sbjct: 1120 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKRSVEVLLTRCLDDVDDEVRDRAALN 1179

Query: 241  LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQAE 297
            L+L+ +D+E +EK+VK+DS +SL   E QLV YV++ + S  + PFD+S IP +T+ QA+
Sbjct: 1180 LRLMHEDDEISEKFVKNDSMFSLPYFEHQLVMYVTSEDKSAFDTPFDISQIPVVTREQAD 1239

Query: 298  AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTP-----GVDQQQVYSQQLE 352
            AE+   R+  L +T           S+     S ++ +  +P          Q Y+Q+L 
Sbjct: 1240 AED---RTKKLTAT---------APSLKPPKASPTKTSAGSPEAAASATAAAQRYAQELM 1287

Query: 353  QIPEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVT 412
            QIPE+  FG + KSS   VELTESE EYVV+ VKH+FKE++VFQ+ + NTL   +LENV+
Sbjct: 1288 QIPEMKEFGSVLKSSPI-VELTESEMEYVVTVVKHIFKEHIVFQYEIKNTLQATVLENVS 1346

Query: 413  VVMQPESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDC 471
            VV  P S+E  L E F++ A  L  D+P  +YVAFK+ N E    + SFSN LKF  K+ 
Sbjct: 1347 VVATP-SEEEELEEVFILQAESLATDEPGKVYVAFKKVNGEGSMPVSSFSNILKFTSKEI 1405

Query: 472  DPSTXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTA 530
            DP+T                  ++  SDYV PT+  +F+  W+ VG  G +  ET  L++
Sbjct: 1406 DPTT-NEPEESGYDDEYEVAEFDLAGSDYVIPTFAGNFNHIWEQVGASGEEAEETLQLSS 1464

Query: 531  SKSLKDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGV 590
             KS+ ++   L ++L + P+E +  P + + HTL L G  +GG +V+A  RM ++  +GV
Sbjct: 1465 MKSIAEATEELAKVLSLQPLEGTDVPVNQTTHTLKLLGKTVGGGRVVANVRMAYSSKSGV 1524

Query: 591  TMELSVRSPSEEISRIVIGAVV 612
            T +++VRS  E ++ +V+ +V 
Sbjct: 1525 TTKITVRSEEEGVASLVVASVA 1546



>gi|336463523|gb|EGO51763.1| hypothetical protein NEUTE1DRAFT_70784 [Neurospora tetrasperma FGSC
           2508]
          Length = 916

 Score =  602 bits (1551), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 331/616 (53%), Positives = 433/616 (70%), Gaps = 16/616 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAA+R L+  A  +P AV  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLTSPRAVTKFAALRILHNFASFKPAAVAVCNPDIELLISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFMSEI+DEFK+ +V+AIR+LCLKFPSKQ  ML FLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMKQISGFMSEITDEFKITIVEAIRTLCLKFPSKQAGMLQFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+PESKE ALAHLCEFIEDCEFTKL+VRVLHLLG+EGPKT  PTKYI
Sbjct: 431 KRAVVESMFDLIKFVPESKEEALAHLCEFIEDCEFTKLAVRVLHLLGLEGPKTSQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LENSIVRAAAV+ALAKFGV  +DPEVK+S++VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENSIVRAAAVTALAKFGVGQKDPEVKRSVEVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQAE 297
           LKL+ +++E A ++VK+DS +SL+  E QLV YV++ + S  E PFD+S IP +T+ QA+
Sbjct: 551 LKLMKEEDELANRFVKNDSMFSLSFFEHQLVTYVTSDDRSTFEAPFDISKIPVVTREQAD 610

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE+   R+  L +T    T S     +     + +            Q Y+Q+L QIPE+
Sbjct: 611 AED---RTKKLTAT----TPSLKPPKVGPTKAAPTSAEAAASASAAAQKYAQELMQIPEM 663

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
           A FG   KSS   VELTE+ETEYVV  VKH+FKE++V Q+ V NTL D +LENV+VV  P
Sbjct: 664 AEFGAALKSS-PVVELTEAETEYVVGVVKHIFKEHIVLQYEVKNTLPDTVLENVSVVATP 722

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPSTX 476
             +   L E F+I A KL  D P  +YVAF++ + E    + +FSN LKF  K+ DPST 
Sbjct: 723 AEE--ELEELFIIQAEKLETDVPGKVYVAFRKVSGEGSLPVSTFSNVLKFTSKEIDPST- 779

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSLK 535
                            ++  SDYV P + S+F+  W+ VG  G +  ET  L++ KS+ 
Sbjct: 780 GEPEETGYDDEYEVAEFDLAGSDYVIPVFASNFAHIWEQVGASGEEAEETLLLSSMKSIS 839

Query: 536 DSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           D+   L + L + P+E +  P + + HTL L G  + G +V+A  RM F+  +GVT +++
Sbjct: 840 DATEQLAKTLSLQPLEGTDVPLNQTTHTLKLLGKTVNGGRVVANVRMAFSAKSGVTTKIT 899

Query: 596 VRSPSEEISRIVIGAV 611
           VRS  E ++ +++ +V
Sbjct: 900 VRSEEEGVAALIVASV 915



>gi|242785576|ref|XP_002480623.1| Coatomer subunit  gamma, putative [Talaromyces stipitatus ATCC
           10500]
 gi|218720770|gb|EED20189.1| Coatomer subunit gamma, putative [Talaromyces stipitatus ATCC
           10500]
          Length = 917

 Score =  601 bits (1550), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 329/617 (53%), Positives = 429/617 (69%), Gaps = 16/617 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP++  +FAAIR L+  A  +P  V  CN D+E+LI++ NRS+ATFAITTLLKTGN
Sbjct: 310 LFLSSPRAITKFAAIRILHSFASFKPHVVNQCNPDIESLISNSNRSIATFAITTLLKTGN 369

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFM++I+DEFK+ +V+AIR+LCLKFPSKQ  ML+FLSG+LRDEGGYEF
Sbjct: 370 EASVDRLMKQISGFMADITDEFKITIVEAIRTLCLKFPSKQASMLTFLSGILRDEGGYEF 429

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KR+VVE++FDL+KF+P SKE ALAHLCEFIEDCEFTKLSVR+LHLLGVEGPKTP PTKYI
Sbjct: 430 KRSVVESMFDLIKFVPGSKEDALAHLCEFIEDCEFTKLSVRILHLLGVEGPKTPQPTKYI 489

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN++VRAAAV+ALAKFGV  +DPEVK+S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 490 RYIYNRVVLENAVVRAAAVTALAKFGVGQQDPEVKRSVSVLLTRCLDDTDDEVRDRAALN 549

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYV--SNPESSEKPFDLSDIPKITKAQAE 297
           L+L+ +++E A ++VK+DS YSL+  E QLV YV  ++ E+    FD+S IP ++  QA 
Sbjct: 550 LRLMQEEDEVANRFVKNDSMYSLSTFEHQLVMYVTATDKEAFSVAFDVSSIPVVSHEQAL 609

Query: 298 AENLKPRSFDLAS-TQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPE 356
           AE    R+  L S T T+   S+A     +N       A         Q Y++QL QIPE
Sbjct: 610 AEE---RTKKLTSATPTLKAPSTAPTKAKANGAVEGAAAVAA-----TQKYAEQLMQIPE 661

Query: 357 IAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
           +  +G L KSS   VELTESETEYVVS VKH+FKE++V Q+ + NTL D +LE+VTVV  
Sbjct: 662 LKEYGTLLKSS-NVVELTESETEYVVSAVKHIFKEHIVLQYDLKNTLPDTVLEDVTVVAT 720

Query: 417 PESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEE-YTLGSFSNTLKFLVKDCDPST 475
           P  DE  L E+F++P  KLP ++P  +YVAFK+T  E  +   SF+N LKF  K+ DP+T
Sbjct: 721 PTDDEDDLEEDFIVPCPKLPTNEPGIVYVAFKKTGGEHSFPTMSFTNNLKFTSKEVDPTT 780

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSL 534
                            +++  SDYV P +   F   W+  G  G +  ETF L+  KS+
Sbjct: 781 -GEPEDTGYEDEYQVEDLDLTGSDYVIPAFAGSFDHVWEQTGANGEEASETFQLSNVKSI 839

Query: 535 KDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
            D+   LI  L + P+E +    S++ HTL L G  + G +V    +M F+  TGVT ++
Sbjct: 840 ADATEQLIAALSLQPLEGTDVALSNTTHTLKLYGKTVSGGRVAGLVKMAFSARTGVTTKV 899

Query: 595 SVRSPSEEISRIVIGAV 611
           ++RS  E  +  ++ +V
Sbjct: 900 TIRSEEEGFAAAIVTSV 916



>gi|350297256|gb|EGZ78233.1| Coatomer, gamma subunit [Neurospora tetrasperma FGSC 2509]
          Length = 916

 Score =  600 bits (1548), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 330/616 (53%), Positives = 433/616 (70%), Gaps = 16/616 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAA+R L+  A  +P AV  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLTSPRAVTKFAALRILHNFASFKPAAVAVCNPDIELLISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFMSEI+DEFK+ +V+AIR+LCLKFPSKQ  ML FLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMKQISGFMSEITDEFKITIVEAIRTLCLKFPSKQAGMLQFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+PESKE ALAHLCEFIEDCEFTKL+VRVLHLLG+EGPKT  PTKYI
Sbjct: 431 KRAVVESMFDLIKFVPESKEEALAHLCEFIEDCEFTKLAVRVLHLLGLEGPKTSQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LENSIVRAAAV+ALAKFGV  +DPEVK+S++VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENSIVRAAAVTALAKFGVGQKDPEVKRSVEVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQAE 297
           LKL+ +++E A ++VK+DS +SL   E QLV YV++ + S  E PFD+S IP +T+ QA+
Sbjct: 551 LKLMKEEDELANRFVKNDSMFSLPFFEHQLVTYVTSDDRSTFEAPFDISKIPVVTREQAD 610

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE+   R+  L +T    T S     +     + +            Q Y+Q+L QIPE+
Sbjct: 611 AED---RTKKLTAT----TPSLKPPKVGPTKAAPTSAEAAASASAAAQKYAQELMQIPEM 663

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
           A FG + KSS   VELTE+ETEYVV  VKH+FKE++V Q+ V NTL D +LENV+VV  P
Sbjct: 664 AEFGAVLKSS-PVVELTEAETEYVVGVVKHIFKEHIVLQYEVKNTLPDTVLENVSVVATP 722

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPSTX 476
             +   L E F+I A KL  D P  +YVAF++ + E    + +FSN LKF  K+ DPST 
Sbjct: 723 AEE--ELEELFIIQAEKLETDVPGKVYVAFRKVSGEGSLPVSTFSNVLKFTSKEIDPST- 779

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSLK 535
                            ++  SDYV P + S+F+  W+ VG  G +  ET  L++ KS+ 
Sbjct: 780 GEPEETGYDDEYEVAEFDLAGSDYVIPVFASNFAHIWEQVGASGEEAEETLLLSSMKSIS 839

Query: 536 DSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           D+   L + L + P+E +  P + + HTL L G  + G +V+A  RM F+  +GVT +++
Sbjct: 840 DATEQLAKTLSLQPLEGTDVPLNQTTHTLKLLGKTVNGGRVVANVRMAFSAKSGVTTKIT 899

Query: 596 VRSPSEEISRIVIGAV 611
           VRS  E ++ +++ ++
Sbjct: 900 VRSEEEGVAALIVASI 915



>gi|340519786|gb|EGR50024.1| coatamer complex, gamma subunit [Trichoderma reesei QM6a]
          Length = 918

 Score =  600 bits (1548), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 329/607 (54%), Positives = 430/607 (70%), Gaps = 16/607 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAA+R L+  A   PTAV  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLTSPRAVTKFAALRILHSFASFNPTAVSVCNTDIELLISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFMSEI+DEFK+ +V+AIR+LCLKFPSKQ  ML+FLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMKQISGFMSEITDEFKITIVEAIRTLCLKFPSKQAGMLTFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+P+SKE ALAHLCEFIEDCEFTKL+VR+LHL+G+EGPKT  PTKYI
Sbjct: 431 KRAVVESMFDLIKFVPDSKEDALAHLCEFIEDCEFTKLAVRILHLIGLEGPKTAQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DP+VK S+KVLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPDVKSSVKVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLI--DDNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQA 296
           LKL+  +D+E A  +VK+D+ +SL   E QLV YV++ + S  E+PFD+S IP +T+ QA
Sbjct: 551 LKLMAEEDDELARNFVKNDNMFSLPFFEHQLVLYVTSDDKSTFEEPFDISKIPVVTREQA 610

Query: 297 EAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPE 356
           +AE+   R+  L +T    T +             S          Q Q Y+Q+L QIPE
Sbjct: 611 DAED---RTKKLTAT----TPTLKAPKAGPTKTPASGAEAAASASAQAQRYAQELMQIPE 663

Query: 357 IAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
           +  FG + KSS   VELTE+ETEYVVS VKH+F E++V Q+ V NTL D +LENV+VV  
Sbjct: 664 MKEFGSVVKSS-PVVELTEAETEYVVSVVKHIFNEHIVLQYEVKNTLPDTVLENVSVVAT 722

Query: 417 PESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPST 475
           P SDE  L E F+I A KL  ++P ++YVAF++ N +    + +FSN LKF  K+ DPST
Sbjct: 723 P-SDEEELEEVFIIQAEKLATNEPGNVYVAFRKVNGQASLPVSTFSNVLKFTSKEIDPST 781

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSL 534
                             ++  SDYV PTY S+F+  W+ VG  G +  ET  L++ KS+
Sbjct: 782 -GEPEETGYDDEYEVSEFDLSGSDYVIPTYASNFNHLWEQVGASGEEAEETLQLSSMKSI 840

Query: 535 KDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
            ++   L ++L + P+E +  P + + HTL L G  + G +V+A  RM F+  +GVT ++
Sbjct: 841 AEATEQLAKILSLQPLEGTDVPVNQTTHTLKLLGKTVNGGRVVANIRMAFSSKSGVTTKI 900

Query: 595 SVRSPSE 601
           +VR+  E
Sbjct: 901 TVRAEEE 907



>gi|85115358|ref|XP_964857.1| hypothetical protein NCU01992 [Neurospora crassa OR74A]
 gi|28926653|gb|EAA35621.1| hypothetical protein NCU01992 [Neurospora crassa OR74A]
          Length = 916

 Score =  600 bits (1548), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 331/616 (53%), Positives = 433/616 (70%), Gaps = 16/616 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAA+R L+  A  +P AV  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLTSPRAVTKFAALRILHNFASFKPAAVAVCNPDIELLISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFMSEI+DEFK+ +V+AIR+LCLKFPSKQ  ML FLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMKQISGFMSEITDEFKITIVEAIRTLCLKFPSKQAGMLQFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+PESKE ALAHLCEFIEDCEFTKL+VRVLHLLG+EGPKT  PTKYI
Sbjct: 431 KRAVVESMFDLIKFVPESKEEALAHLCEFIEDCEFTKLAVRVLHLLGLEGPKTSQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LENSIVRAAAV+ALAKFGV  +DPEVK+S++VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENSIVRAAAVTALAKFGVGQKDPEVKRSVEVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQAE 297
           LKL+ +++E A ++VK+DS +SL   E QLV YV++ + S  E PFD+S IP +T+ QA+
Sbjct: 551 LKLMKEEDELANRFVKNDSMFSLPFFEHQLVTYVTSDDRSTFEAPFDISKIPVVTREQAD 610

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE+   R+  L +T    T S     +     + +            Q Y+Q+L QIPE+
Sbjct: 611 AED---RTKKLTAT----TPSLKPPKVGPTKAAPTSAEAAASASAAAQKYAQELMQIPEM 663

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
           A FG + KSS   VELTE+ETEYVV  VKH+FKE++V Q+ V NTL D +LENV+VV  P
Sbjct: 664 AEFGAVLKSS-PVVELTEAETEYVVGVVKHIFKEHIVLQYEVKNTLPDTVLENVSVVATP 722

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPSTX 476
             +   L E F+I A KL  D P  +YVAF++ + E    + +FSN LKF  K+ DPST 
Sbjct: 723 AEE--ELEELFIIQAEKLETDVPGKVYVAFRKVSGEGSLPVSTFSNVLKFTSKEIDPST- 779

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSLK 535
                            ++  SDYV P + S+F+  W+ VG  G +  ET  L++ KS+ 
Sbjct: 780 GEPEETGYDDEYEVAEFDLAGSDYVIPVFASNFAHIWEQVGASGEEAEETLLLSSMKSIS 839

Query: 536 DSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           D+   L + L + P+E +  P + + HTL L G  + G +V+A  RM F+  +GVT +++
Sbjct: 840 DATEQLAKTLSLQPLEGTDVPLNQTTHTLKLLGKTVNGGRVVANVRMAFSAKSGVTTKIT 899

Query: 596 VRSPSEEISRIVIGAV 611
           VRS  E ++ +++ +V
Sbjct: 900 VRSEEEGVAALIVASV 915



>gi|358385002|gb|EHK22599.1| Adaptor protein complex [Trichoderma virens Gv29-8]
          Length = 918

 Score =  600 bits (1547), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 330/617 (53%), Positives = 436/617 (70%), Gaps = 16/617 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAA+R L+  A   PTAV  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLTSPRAVTKFAALRILHSFASFNPTAVSVCNTDIELLISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFMSEI+DEFK+ +V+AIR+LCLKFPSKQ  ML+FLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMKQISGFMSEITDEFKITIVEAIRTLCLKFPSKQAGMLTFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+P+SKE ALAHLCEFIEDCEFTKL+VR+LHL+G+EGPKT  PTKYI
Sbjct: 431 KRAVVESMFDLIKFVPDSKEDALAHLCEFIEDCEFTKLAVRILHLIGLEGPKTVQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DP+VK S+KVLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPDVKSSVKVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLI--DDNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQA 296
           LKL+  +D+E A  +VK+D+ +SL   E QLV YV++ + S  + PFD+S IP +T+ QA
Sbjct: 551 LKLMAEEDDEMARNFVKNDNMFSLPFFEHQLVLYVTSDDKSAFDVPFDISKIPVVTREQA 610

Query: 297 EAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPE 356
           +AE+   R+  L +T T    +   G   +        AT +    +   Y+Q+L QIPE
Sbjct: 611 DAED---RTKKLTAT-TPTLKAPKAGPTKTPASGAEAAATASAQAQR---YAQELMQIPE 663

Query: 357 IAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
           +  FG + KSS   VELTE+ETEYVVS VKH+F E++V Q+ V NTL D +LENV+VV  
Sbjct: 664 MKEFGSVVKSS-PVVELTEAETEYVVSVVKHIFNEHIVLQYEVKNTLPDTVLENVSVVAS 722

Query: 417 PESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPST 475
           P +DE  L E F+I A KL  ++P  +YVAFK+ N +    + +FSN LKF  K+ DPST
Sbjct: 723 P-ADEEELEEVFIIQAEKLATNEPGKVYVAFKKVNGQASLPVSTFSNVLKFTSKEIDPST 781

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSL 534
                             ++  SDYV PTY  +F+  W+ VG  G +  ET  L++ KS+
Sbjct: 782 -GEPEETGYDDEYEVSEFDLSGSDYVIPTYAGNFNHIWEQVGAAGEEAEETLQLSSMKSI 840

Query: 535 KDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
            ++   L ++L + P+E +  P + S HTL L G  + G +V+A  RM ++  +GVT ++
Sbjct: 841 AEATGQLAKILSLQPLEGTDVPVNQSTHTLKLLGKTVNGGRVVANIRMAYSSKSGVTTKI 900

Query: 595 SVRSPSEEISRIVIGAV 611
           +VR   E ++ +VI +V
Sbjct: 901 TVRGEEEGVAALVIASV 917



>gi|350635716|gb|EHA24077.1| hypothetical protein ASPNIDRAFT_56195 [Aspergillus niger ATCC 1015]
          Length = 916

 Score =  600 bits (1547), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 331/617 (53%), Positives = 432/617 (70%), Gaps = 18/617 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP+S  +FAAIR L+  A  +P  V  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLSSPRSITKFAAIRILHNFASFKPHVVNVCNPDIEALISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFM++I+DEFK+ +V+AIR+LCLKFPSKQ  MLSFLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMKQISGFMADITDEFKITIVEAIRTLCLKFPSKQAGMLSFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KR+VVE++FDL+KF+PESKE ALAHLCEFIEDCEFTKLSVR+LHLLGVEGPKT  PTKYI
Sbjct: 431 KRSVVESMFDLIKFVPESKEDALAHLCEFIEDCEFTKLSVRILHLLGVEGPKTSHPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVK S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKSSVSVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYV--SNPESSEKPFDLSDIPKITKAQAE 297
           L+L+ +++E+A +++ ++S YSL+  E QLV YV  ++ E+    FD++ IP +++ QA 
Sbjct: 551 LRLMSEEDETASRFISNESMYSLSTFEHQLVMYVTSTDKETFAAAFDVATIPVVSQEQAL 610

Query: 298 AENLKPRSFDLAS-TQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPE 356
           AE    R+  L S T T+   S+      +N V+ +     T      Q Y++QL QIPE
Sbjct: 611 AEE---RTKKLTSATPTLKAPSTGPPKGKANGVAEAVTVAAT------QKYAEQLMQIPE 661

Query: 357 IAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
           +  +G L KSS  PVELTESETEYVV+ VKH+FKE++V Q+ + NTL D +LE+VTVV  
Sbjct: 662 LKEYGTLLKSS-APVELTESETEYVVTAVKHIFKEHVVLQYDIKNTLPDTVLEDVTVVAT 720

Query: 417 PESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYT-LGSFSNTLKFLVKDCDPST 475
           P S+E  L EEF++PA KL  ++P  +YV FK+   E    + SF+N LKF  K+ DP+T
Sbjct: 721 P-SEEDVLEEEFIVPAPKLATNEPGIVYVTFKKLAGEHSVPVISFTNNLKFTSKEIDPTT 779

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSL 534
                            +++  SDYV PT+   F   W+  G  G +V ET  L+  K +
Sbjct: 780 -GEPEDSGYDDEYQVEDLDLTGSDYVIPTFAGSFDHVWEQTGANGEEVSETLQLSNMKGI 838

Query: 535 KDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
            D+   LI  L + P+E +    S+S HTL L G  + G +V +  +M F+  TGVTM++
Sbjct: 839 SDATEQLISTLSLQPLEGTDVALSNSTHTLKLFGKTVTGGRVASLIKMAFSSKTGVTMKI 898

Query: 595 SVRSPSEEISRIVIGAV 611
            VR+  E ++  VI +V
Sbjct: 899 VVRAEEEGVAPAVIASV 915



>gi|145238068|ref|XP_001391681.1| coatomer subunit gamma [Aspergillus niger CBS 513.88]
 gi|134076160|emb|CAK48973.1| unnamed protein product [Aspergillus niger]
          Length = 916

 Score =  600 bits (1546), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 330/617 (53%), Positives = 432/617 (70%), Gaps = 18/617 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP+S  +FAAIR L+  A  +P  V  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLSSPRSITKFAAIRILHNFASFKPHVVNVCNPDIEALISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFM++I+DEFK+ +V+AIR+LCLKFPSKQ  MLSFLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMKQISGFMADITDEFKITIVEAIRTLCLKFPSKQAGMLSFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KR+VVE++FDL+KF+PESKE ALAHLCEFIEDCEFTKLSVR+LHLLGVEGPKT  PTKYI
Sbjct: 431 KRSVVESMFDLIKFVPESKEDALAHLCEFIEDCEFTKLSVRILHLLGVEGPKTSHPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVK S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKSSVSVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYV--SNPESSEKPFDLSDIPKITKAQAE 297
           L+L+ +++E+A +++ ++S YSL+  E QLV YV  ++ E+    FD++ IP +++ QA 
Sbjct: 551 LRLMSEEDETASRFISNESMYSLSTFEHQLVMYVTSTDKETFAAAFDVATIPVVSQEQAL 610

Query: 298 AENLKPRSFDLAS-TQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPE 356
           AE    R+  L S T T+   S+      +N V+ +     T      Q Y++QL QIPE
Sbjct: 611 AEE---RTKKLTSATPTLKAPSTGPPKGKANGVAEAVTVAAT------QKYAEQLMQIPE 661

Query: 357 IAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
           +  +G L KSS  PVELTESETEYVV+ VKH+FKE++V Q+ + NTL D +LE+VTVV  
Sbjct: 662 LKEYGTLLKSS-APVELTESETEYVVTAVKHIFKEHVVLQYDIKNTLPDTVLEDVTVVAT 720

Query: 417 PESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYT-LGSFSNTLKFLVKDCDPST 475
           P S+E  L EEF++PA KL  ++P  +YV FK+   E    + SF+N LKF  K+ DP+T
Sbjct: 721 P-SEEDVLEEEFIVPAPKLATNEPGIVYVTFKKLAGEHSVPVISFTNNLKFTSKEIDPTT 779

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSL 534
                            +++  SDYV PT+   F   W+  G  G +V ET  L+  K +
Sbjct: 780 -GEPEDSGYDDEYQVEDLDLTGSDYVIPTFAGSFDHVWEQTGANGEEVSETLQLSNMKGI 838

Query: 535 KDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
            D+   LI  L + P+E +    S+S HTL L G  + G +V +  +M F+  TGVTM++
Sbjct: 839 SDATEQLISTLSLQPLEGTDVALSNSTHTLKLFGKTVTGGRVASLIKMAFSSKTGVTMKI 898

Query: 595 SVRSPSEEISRIVIGAV 611
            +R+  E ++  VI +V
Sbjct: 899 VIRAEEEGVAPAVIASV 915



>gi|322709613|gb|EFZ01189.1| putative coatomer gamma-2 subunit [Metarhizium anisopliae ARSEF 23]
          Length = 918

 Score =  599 bits (1545), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 328/618 (53%), Positives = 439/618 (71%), Gaps = 18/618 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           +FL+SP++  +FAA+R L+  A  +PTAV  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 MFLTSPRAVTKFAALRILHSFASFKPTAVSVCNPDIELLISNANRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+ FMSEI+DEFK+ +V+AIR+LCLKFPSKQ  ML+FLS +LRDEGGYEF
Sbjct: 371 EASVDRLMKQISSFMSEITDEFKITIVEAIRTLCLKFPSKQAGMLTFLSSILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+P+SK+ ALAHLCEFIEDCEFTKL+VR+LHL+G+EGPKT  PTKYI
Sbjct: 431 KRAVVESMFDLIKFVPDSKDEALAHLCEFIEDCEFTKLAVRILHLIGLEGPKTSQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LENSIVRAAAV+ALAKFGV  +DP+VK S+KVLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENSIVRAAAVTALAKFGVGQKDPDVKASVKVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLI--DDNESAEKYVKDDSTYSLAALERQLVQYVSNPE--SSEKPFDLSDIPKITKAQA 296
           LKL+  +D+E A+ +VK+++ +SL   E QLV YV++ +  S  +PFD++ IP +T+ QA
Sbjct: 551 LKLMGEEDDEMAQNFVKNENMFSLPVFEHQLVMYVTSDDKGSFAEPFDITKIPVVTREQA 610

Query: 297 EAENLKPRSFDLASTQ-TIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIP 355
           +AE+   R+  L +T  TI   +  VG+  + +      A+ +    +   Y+++L QIP
Sbjct: 611 DAED---RTKKLTATAPTI--KAPKVGAAKAPVSGAEAAASASAQAQR---YAEELMQIP 662

Query: 356 EIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVM 415
           E+  FG + KSS   VELTE+ETEYVV+ VKH+FKE++V Q+ V NTL D +LENV+VV 
Sbjct: 663 EMKEFGNVLKSST-VVELTEAETEYVVTVVKHIFKEHIVLQYEVKNTLPDTVLENVSVVA 721

Query: 416 QPESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPS 474
            P  +E  L E F+I   KL  D+P  +YVAF++ N E    + SFSN LKF  K+ DPS
Sbjct: 722 TP-GEEDELEEVFIIQCEKLATDEPGKVYVAFQKVNGEGSMPVTSFSNVLKFTSKEIDPS 780

Query: 475 TXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKS 533
           T                  ++  SDY+ PT+ S+FS  W+ +G  G Q  ET  L+  KS
Sbjct: 781 T-GEPEDTGYDDEYEVSEFDLSGSDYIVPTFASNFSHLWEQIGASGEQAEETLQLSGMKS 839

Query: 534 LKDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTME 593
           + D+   L + L + P+E +  P + S HTL L G  + G +V+A  RM F+  +GVT +
Sbjct: 840 IADATEQLAKALSLQPLEGTDVPVNQSTHTLKLLGKTISGGRVVASVRMAFSSKSGVTTK 899

Query: 594 LSVRSPSEEISRIVIGAV 611
           ++VRS  E ++ +VI +V
Sbjct: 900 ITVRSEEENVAALVIASV 917



>gi|310791155|gb|EFQ26684.1| hypothetical protein GLRG_02504 [Glomerella graminicola M1.001]
          Length = 917

 Score =  599 bits (1545), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 332/616 (53%), Positives = 440/616 (71%), Gaps = 15/616 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAA+R L+  A  +P AV  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLTSPRAVTKFAALRILHNFASFKPNAVNVCNPDIELLISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFMSEI+DEFK+ +V+AIR+LCLKFPSKQ  ML+FLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMKQISGFMSEITDEFKITIVEAIRTLCLKFPSKQAGMLAFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+PESKE ALAHLCEFIEDCEFTKL+VR+LHLLG+EGPKT  PTKYI
Sbjct: 431 KRAVVESMFDLIKFVPESKEDALAHLCEFIEDCEFTKLAVRILHLLGLEGPKTSQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DP+VK+S++VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPDVKRSVEVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQAE 297
           L+L+  ++E AEK+VK+DS +SL   E QLV YV++ + S  + PFD+S IP +T+ QA+
Sbjct: 551 LRLMHQEDEIAEKFVKNDSMFSLPYFEHQLVMYVTSEDKSAFDSPFDISQIPVVTREQAD 610

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE+   R+  L  T T  +             S +  A     V Q+  Y+Q+L QIPE+
Sbjct: 611 AED---RTKKL--TATAPSLKPPKAGPTKAAASGAEAAASATAVTQR--YAQELMQIPEM 663

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
             FG + KSS   VELTESE EYVV+ VKH+FKE++VFQ+ V NTL+  +LENV+VV  P
Sbjct: 664 KEFGSVLKSS-PVVELTESEMEYVVTVVKHIFKEHIVFQYEVKNTLDATVLENVSVVATP 722

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPSTX 476
            S+E  L E F+I A KL  ++P  +YVAFK+ N E    + S SN LKF  K+ DP+T 
Sbjct: 723 -SEEEELEEVFIIQAEKLATNEPGKLYVAFKKVNGEGSMPVSSISNILKFTSKEIDPTT- 780

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSLK 535
                            ++  SDYV PT+ S+F+  W+ VG  G +  ET  L++ KS+ 
Sbjct: 781 NEPEDTGYDDEYEVAEFDLTGSDYVIPTFASNFNHIWEQVGAAGEEAEETLQLSSMKSIA 840

Query: 536 DSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           ++   L ++L + P+E +  P + + HTL L G  +GG +V+A  RM ++  +GVT +++
Sbjct: 841 EATEQLAKVLSLQPLEGTDVPVNQTTHTLKLLGKTVGGGRVVANVRMAYSSKSGVTTKIT 900

Query: 596 VRSPSEEISRIVIGAV 611
           VRS  E ++ +V+ +V
Sbjct: 901 VRSEEEGVASLVVASV 916



>gi|336264720|ref|XP_003347136.1| hypothetical protein SMAC_05435 [Sordaria macrospora k-hell]
 gi|380093831|emb|CCC08795.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 916

 Score =  599 bits (1544), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 332/606 (54%), Positives = 427/606 (70%), Gaps = 16/606 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAA+R L+  A  +P AV  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLTSPRAVTKFAALRILHNFASFKPAAVAVCNPDIELLISNTNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFMSEI+DEFK+ +V+AIR+LCLKFPSKQ  ML FLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMKQISGFMSEITDEFKITIVEAIRTLCLKFPSKQAGMLQFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+PESKE ALAHLCEFIEDCEFTKL+VRVLHLLG+EGPKT  PTKYI
Sbjct: 431 KRAVVESMFDLIKFVPESKEEALAHLCEFIEDCEFTKLAVRVLHLLGLEGPKTSQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LENSIVRAAAV+ALAKFGV  +DPEVK+S++VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENSIVRAAAVTALAKFGVGQKDPEVKRSVEVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQAE 297
           LKL+ +++E A ++VK+DS +SL   E QLV YV++ + S  E PFD+S IP +T+ QA+
Sbjct: 551 LKLMKEEDELANRFVKNDSMFSLPFFEHQLVTYVTSDDRSTFEAPFDISKIPVVTREQAD 610

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE+   R+  L +T    T S     +     + +            Q Y+Q+L QIPE+
Sbjct: 611 AED---RTKKLTAT----TPSLKPPKVGPTKAAPTSAEAAASASAAAQKYAQELMQIPEM 663

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
           A FG + KSS   VELTE+ETEYVVS VKH+FKE++V Q+ V NTL D +LENV+VV  P
Sbjct: 664 AEFGAVLKSS-PVVELTEAETEYVVSVVKHIFKEHIVLQYEVKNTLPDTVLENVSVVATP 722

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPSTX 476
             +   L E F+I A KL  D P  +YVAF++ N E    + +FSN LKF  K+ DPST 
Sbjct: 723 SEE--ELEELFIIQAEKLDTDVPGKVYVAFRKVNGEGSLPVSAFSNVLKFTSKEIDPST- 779

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSLK 535
                            ++  SDYV P + S+F+  W+ VG  G +  ET  L++ KS+ 
Sbjct: 780 GEPEETGYDDEYEVAEFDLAGSDYVIPVFASNFAHIWEQVGASGEEAEETLLLSSMKSIA 839

Query: 536 DSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           D+   L + L + P+E +  P + + HTL L G  + G +V+A  RM F+  +GVT +++
Sbjct: 840 DATEQLAKTLSLQPLEGTDVPLNQTTHTLKLLGKTVNGGRVVANVRMAFSAKSGVTTKIT 899

Query: 596 VRSPSE 601
           VRS  E
Sbjct: 900 VRSEEE 905



>gi|302921242|ref|XP_003053248.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256734188|gb|EEU47535.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 932

 Score =  598 bits (1543), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 332/633 (52%), Positives = 439/633 (69%), Gaps = 34/633 (5%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAA+R L+  A  +PTAV  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLTSPRAVTKFAALRILHNFASFKPTAVHVCNPDIELLISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+ FMSEI+DEFK+ +V+AIR+LCLKFPSKQ  ML+FLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMKQISTFMSEITDEFKITIVEAIRTLCLKFPSKQAGMLTFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+P+SKE ALAHLCEFIEDCEFTKL+VR+LHL+G+EGPKT  PTKYI
Sbjct: 431 KRAVVESMFDLIKFVPDSKEDALAHLCEFIEDCEFTKLAVRILHLIGLEGPKTAQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVK S++VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKSSVRVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLI--DDNESAEKYVKD----------------DSTYSLAALERQLVQYVSNPESS--E 280
           LKL+  +D+E A ++VK+                ++ +SL   E+QLV YV++ + S  +
Sbjct: 551 LKLMAEEDDEMAARFVKNGKQEIYVIMNNANSPTENMFSLPFFEQQLVLYVTSDDKSAFD 610

Query: 281 KPFDLSDIPKITKAQAEAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPG 340
            PFD+S IP +T+ QA+AE+   +   +A+T T+   +  VG        TS        
Sbjct: 611 SPFDISKIPIVTREQADAEDRTKKL--IATTPTL--KAPKVGP-----TKTSGAEAQASA 661

Query: 341 VDQQQVYSQQLEQIPEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVT 400
             Q Q Y+Q+L +IPE+  FG + KSS   +ELTE+ETEYVV+ VKH+FKE++V Q+ V 
Sbjct: 662 TAQAQRYAQELLEIPEMKEFGSVLKSS-PLLELTEAETEYVVTLVKHIFKEHIVLQYEVK 720

Query: 401 NTLNDQLLENVTVVMQPESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGS 459
           NTL D +LENV+VV  P  DE  L E F+I A KLP DQP  +YVAFK+ N E    + +
Sbjct: 721 NTLPDTVLENVSVVATPSDDE-ELEEVFIIQAEKLPTDQPGKVYVAFKKINGEGSLPIST 779

Query: 460 FSNTLKFLVKDCDPSTXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEE 519
           FSN L+F  K+ DPST                  ++  SDYV PT+  +FS  W+ VG  
Sbjct: 780 FSNILRFTSKEIDPST-NEPEETGYDDEYEVAEFDLTGSDYVIPTFAGNFSHIWEQVGAS 838

Query: 520 G-QVVETFALTASKSLKDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLA 578
           G +  ET  L+   S+ ++   L + L + P+E +  P + + HTL L G  +GG +V+A
Sbjct: 839 GEEATETLQLSGMSSIAEATEQLTKALSLQPLEGTDVPVNQTTHTLKLLGKTVGGGRVVA 898

Query: 579 KNRMTFAPSTGVTMELSVRSPSEEISRIVIGAV 611
             RM F+  TGVT +++VRS  E ++ +V+ +V
Sbjct: 899 TVRMAFSSKTGVTTKITVRSEEENVATLVVASV 931



>gi|358368668|dbj|GAA85284.1| coatomer subunit gamma [Aspergillus kawachii IFO 4308]
          Length = 916

 Score =  597 bits (1540), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 328/617 (53%), Positives = 433/617 (70%), Gaps = 18/617 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP+S  +FAAIR L+  A  +P  V  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLSSPRSITKFAAIRILHNFASFKPHVVNVCNPDIEALISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFM++I+DEFK+ +V+AIR+LCLKFPSKQ  MLSFLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMKQISGFMADITDEFKITIVEAIRTLCLKFPSKQAGMLSFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KR+VVE++FDL+KF+PES+E ALAHLCEFIEDCEFTKLSVR+LHLLGVEGPKT  PTK+I
Sbjct: 431 KRSVVESMFDLIKFVPESQEDALAHLCEFIEDCEFTKLSVRILHLLGVEGPKTSHPTKFI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVK S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKSSVSVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLID-DNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQAE 297
           L+L++ ++E+A +++ ++S YSL+  E QLV YV++ + +  +  FD++ IP +++ QA 
Sbjct: 551 LRLMNEEDETASRFISNESMYSLSTFEHQLVMYVTSTDKATFDAAFDVATIPVVSQEQAL 610

Query: 298 AENLKPRSFDLAS-TQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPE 356
           AE    R+  L S T T+   S+      +N V+ +     T      Q Y++QL QIPE
Sbjct: 611 AEE---RTKKLTSATPTLKAPSTGPPKGKANGVAEAVTVAAT------QKYAEQLMQIPE 661

Query: 357 IAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
           +  +G L KSS  PVELTESETEYVV+ VKH+FKE++V Q+ + NTL D +LE+VTVV  
Sbjct: 662 LKEYGTLLKSS-APVELTESETEYVVTAVKHIFKEHVVLQYDIKNTLPDTVLEDVTVVAT 720

Query: 417 PESDEGTLVEEFVIPATKLPYDQPSSIYVAFKR-TNPEEYTLGSFSNTLKFLVKDCDPST 475
           P S+E  L EEF++PA KL  ++P  +YV FK+ T      + SF+N LKF  K+ DP+T
Sbjct: 721 P-SEEDVLEEEFIVPAPKLATNEPGIVYVTFKKLTGEHSVPVISFTNNLKFTSKEIDPTT 779

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSL 534
                            +++  SDYV PT+   F   W+  G  G +V ET  L+  K +
Sbjct: 780 -GEPEDSGYDDEYQVEDLDLTGSDYVIPTFAGSFDHVWEQTGANGEEVSETLQLSNMKGI 838

Query: 535 KDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
            D+   LI  L + P+E +    S+S HTL L G  + G +V +  +M F+  TGVTM++
Sbjct: 839 SDATEQLISTLSLQPLEGTDVALSNSTHTLKLFGKTVTGGRVASLIKMAFSSKTGVTMKI 898

Query: 595 SVRSPSEEISRIVIGAV 611
            VR+  E ++  VI +V
Sbjct: 899 VVRAEEEGVAPAVIASV 915



>gi|322701444|gb|EFY93194.1| putative coatomer gamma-2 subunit [Metarhizium acridum CQMa 102]
          Length = 918

 Score =  597 bits (1539), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 326/617 (52%), Positives = 433/617 (70%), Gaps = 16/617 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAA+R L+  A  +P+AV  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLTSPRAVTKFAALRILHSFASFKPSAVSVCNPDIELLISNANRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+ FMSEI+DEFK+ +V+AIR+LCLKFPSKQ  ML+FLS +LRDEGGYEF
Sbjct: 371 EASVDRLMKQISSFMSEITDEFKITIVEAIRTLCLKFPSKQAGMLTFLSSILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+P+SK+ ALAHLCEFIEDCEFTKL+VR+LHL+G+EGPKT  PTKYI
Sbjct: 431 KRAVVESMFDLIKFVPDSKDEALAHLCEFIEDCEFTKLAVRILHLIGLEGPKTSQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LENSIVRAAAV+ALAKFGV  +DP+VK S+KVLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENSIVRAAAVTALAKFGVGQKDPDVKASVKVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLI--DDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSE--KPFDLSDIPKITKAQA 296
           LKL+  +D+E A+ +VK+++ +SL   E QLV YV++ + S   +PFD++ +P +T+ QA
Sbjct: 551 LKLMGEEDDEMAQNFVKNENMFSLPVFEHQLVMYVTSDDKSSFAEPFDITKVPVVTREQA 610

Query: 297 EAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPE 356
           +AE+   RS  L +T      +     + +   S S          Q Q Y+++L Q+PE
Sbjct: 611 DAED---RSKKLTAT----APTIKAPKVGAAKASASGAEAAASASAQAQRYAEELMQVPE 663

Query: 357 IAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
           +  FG + KSS   VELTE+ETEYVV+ VKH+FKE++V Q+ V NTL D +LENV+VV  
Sbjct: 664 MKEFGNVLKSST-VVELTEAETEYVVTLVKHIFKEHIVLQYEVKNTLPDTVLENVSVVAT 722

Query: 417 PESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPST 475
           P  +E  L E F+I   KL  D+P  +YVAF++ N E    + SFSN LKF  K+ DPST
Sbjct: 723 P-GEEDELEEVFIIQCEKLVTDEPGKVYVAFQKVNGEGSMPVTSFSNILKFTSKEIDPST 781

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSL 534
                             ++  SDY+ PT+ S+FS  W+ +G  G Q  ET  L+  KS+
Sbjct: 782 -GEPEDTGYDDEYEVSEFDLSGSDYIVPTFASNFSHVWEQIGASGEQAEETLQLSGMKSI 840

Query: 535 KDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
            D+   L + L + P+E +  P + S HTL L G  + G +V A  RM F+  +GVT ++
Sbjct: 841 ADATEQLAKALSLQPLEGTDVPVNQSTHTLKLLGKTVSGGRVAASVRMAFSSKSGVTTKI 900

Query: 595 SVRSPSEEISRIVIGAV 611
           +VRS  E ++ +VI +V
Sbjct: 901 TVRSEEENVAALVIASV 917



>gi|512188859|gb|EPE04628.1| coatomer subunit gamma-2 [Ophiostoma piceae UAMH 11346]
          Length = 926

 Score =  595 bits (1533), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 335/626 (53%), Positives = 435/626 (69%), Gaps = 26/626 (4%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP++  +FAA+R L+  A  +P AV  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLSSPRAVTKFAALRILHNFASFKPQAVHVCNPDIELLISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+  MSEI+DEFK+ +V+AIR+LCLKFPSKQ  ML FLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMKQISSLMSEITDEFKITIVEAIRTLCLKFPSKQAGMLGFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+PE+KE ALAHLCEFIEDCEFTKL+VR+LHLLG+EGPKT  PTKYI
Sbjct: 431 KRAVVESMFDLIKFVPEAKEEALAHLCEFIEDCEFTKLAVRILHLLGIEGPKTSQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVKKS++VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKKSVQVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLIDD-NESAEKYVKDDSTYSLAALERQLVQYVS--NPESSEKPFDLSDIPKITKAQAE 297
           L+L+++ +E + ++VK+++ +SL   E QLV YV+  N E+   PFD+S IP +T+ QA+
Sbjct: 551 LRLMNEPDELSTRFVKNENMFSLQYFEHQLVSYVTADNKETFATPFDISKIPVVTREQAD 610

Query: 298 AENLKPRSFDLASTQ------TIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQL 351
           AE+   R+  L ST        IG +S   G+ NS   ++S          Q Q Y+ +L
Sbjct: 611 AED---RTKKLTSTTPSLKPPKIGGAS---GASNSGKSASSGVEAAAAASVQAQKYATEL 664

Query: 352 EQIPEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENV 411
             IPE+  FG + KSS   V+LTE+ETEYVVS VKH+FKE++V QF V NTL D +LENV
Sbjct: 665 LAIPEMKEFGAVLKSS-PVVDLTEAETEYVVSVVKHIFKEHIVLQFEVKNTLPDTVLENV 723

Query: 412 TVVMQPESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLGS-FSNTLKFLVKD 470
           +VV  P SDE  L E F++ A +L  D+P  +YVA ++ N  +    S FSN LKF  K+
Sbjct: 724 SVVATP-SDEEELEEVFILQAERLATDEPGKVYVALQKVNGADALPASTFSNVLKFTSKE 782

Query: 471 CDPSTXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVG-----EEGQVVET 525
            DP+T                  E+  SDYV PT+ S+FS  W+ VG     EE +  ET
Sbjct: 783 IDPTT-NEPEETGYDDEYEVSEFELSGSDYVIPTFASNFSHLWEQVGASQNAEESE--ET 839

Query: 526 FALTASKSLKDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFA 585
             L   KS+ D+   L   L + P+E +  P S + HTL L G  + G +V+A  RM ++
Sbjct: 840 LQLEGVKSIADATEQLAATLSLQPLEGTDIPMSQTTHTLKLLGKTVNGGRVVATVRMAYS 899

Query: 586 PSTGVTMELSVRSPSEEISRIVIGAV 611
             +GVT +++VRS  E +S ++I A+
Sbjct: 900 AKSGVTTKVTVRSEEEGVSALIIAAL 925



>gi|399165326|emb|CCE33776.1| related to coatomer gamma-2 subunit [Claviceps purpurea 20.1]
          Length = 918

 Score =  594 bits (1532), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 323/622 (51%), Positives = 440/622 (70%), Gaps = 26/622 (4%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAA+R L+  A  +PTAV  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLTSPRAVTKFAALRILHNFASFKPTAVSICNPDIELLISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFMSEI+DEFK+ +V+AIR+LCLKFP+KQ  ML+FLSG+LRDEGG+EF
Sbjct: 371 EASVDRLMKQISGFMSEITDEFKITIVEAIRTLCLKFPNKQAGMLTFLSGILRDEGGFEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+P+SK+ ALAHLCEFIEDCEFTKL+VR+LHL+G+EGPKT  PTKYI
Sbjct: 431 KRAVVESMFDLIKFVPDSKDEALAHLCEFIEDCEFTKLAVRILHLIGLEGPKTAQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DP+VK S+KVLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPDVKASVKVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLI--DDNESAEKYVKDDSTYSLAALERQLVQYVSNPE--SSEKPFDLSDIPKITKAQA 296
           LKL+  +D+  AE +VK++S +SL   E QLV YV++ +  S   PFD+S IP +T+ QA
Sbjct: 551 LKLMGEEDDAMAENFVKNESMFSLPIFEHQLVMYVTSDDQASFNDPFDISSIPVVTREQA 610

Query: 297 EAENLKPRSFDLAS----TQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLE 352
           +AE+ + +    A+       +G + + VGS+ +   ++++             Y+++L 
Sbjct: 611 DAED-RTKKLTAAAPSLKAPKLGPTKAPVGSVEAAASASAQAQR----------YAEELM 659

Query: 353 QIPEIAAFGPLFKSSIKPV-ELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENV 411
           QI E++ FG + KSS  PV ELTE+ETEYVV+ VKH+FKE++V Q+ V NTL D +LE V
Sbjct: 660 QISEMSEFGHVLKSS--PVTELTEAETEYVVTLVKHVFKEHIVLQYEVKNTLPDTVLEAV 717

Query: 412 TVVMQPESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKD 470
           +VV  P  DE  L E F++ A KL  D+P  +YVAFK+ N E    + +F+N LKF  K+
Sbjct: 718 SVVATP-GDEDELEEVFILQAEKLATDEPGKVYVAFKKVNGEGSMPITTFTNILKFTSKE 776

Query: 471 CDPSTXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALT 529
            DPS                   ++  SDY+ PT+ S+FS  W+ +G  G +  ET  L+
Sbjct: 777 IDPSN-GEPEESGYDDEYEVSEFDLSGSDYIVPTFASNFSHIWEQIGASGEEAEETLQLS 835

Query: 530 ASKSLKDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTG 589
           + KS+ D+   L + L + P+E +  P + S HTL L G  + G +V+A  RM ++  +G
Sbjct: 836 SMKSIADATEQLAKALSLQPLEGTDVPVNPSTHTLKLLGKTVHGGRVVANVRMAYSSKSG 895

Query: 590 VTMELSVRSPSEEISRIVIGAV 611
           VT +++VRS  E ++ +VI +V
Sbjct: 896 VTTKITVRSEEENVAALVIASV 917



>gi|406862589|gb|EKD15639.1| hypothetical protein MBM_06267 [Marssonina brunnea f. sp.
           'multigermtubi' MB_m1]
          Length = 917

 Score =  593 bits (1528), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 327/622 (52%), Positives = 439/622 (70%), Gaps = 27/622 (4%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAAIR L K A  +P AV SCN D+E LI++ NRS+ATFA+TTLLKTGN
Sbjct: 311 LFLTSPRAVTKFAAIRILEKFASFKPQAVHSCNPDIELLISNSNRSIATFALTTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EA+VDRL+KQ++GFM++ISD+FK+ +V+ +R LCLKFPSKQ  ML FLSG+LRDEGGYEF
Sbjct: 371 EANVDRLVKQVSGFMADISDDFKITIVEGLRGLCLKFPSKQAGMLVFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+P+SKE ALAHLCEFIEDCEFTKL+VR+LHLLG+EGPKT  PTKY+
Sbjct: 431 KRAVVESMFDLIKFVPDSKEDALAHLCEFIEDCEFTKLAVRILHLLGLEGPKTSQPTKYV 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVK+S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKRSVTVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLIDD-NESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQAE 297
           L+L+ + +E A+++VK+++T++L   E QLV YV+  + S  + PFD+S +P +TK QA+
Sbjct: 551 LRLMTEPDEMADRFVKNENTFALQYFEHQLVMYVTADDKSTFDNPFDISSVPVVTKEQAD 610

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQ------QQVYSQQL 351
           AE+   R+  L +T T    +   G   S         TPT            Q Y Q L
Sbjct: 611 AED---RTKKL-TTITPTIKAPKAGPTKS---------TPTGAEAAATASAVSQKYQQAL 657

Query: 352 EQIPEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENV 411
            QIPE+ ++G L KSS   VELTESETEYVVS VKH+FKE++V Q+ V NTL D +LE+V
Sbjct: 658 LQIPEMKSYGSLLKSS-PVVELTESETEYVVSVVKHIFKEHIVLQYEVKNTLPDTVLEDV 716

Query: 412 TVVMQPESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEE-YTLGSFSNTLKFLVKD 470
           +VV  P ++E  L E+F+IPA KL  D+P +IYV+FK+ N E+ +T  SF+N LKF  K+
Sbjct: 717 SVVATP-TEEEELEEDFIIPAAKLVTDEPGTIYVSFKKVNGEDTFTASSFTNILKFTTKE 775

Query: 471 CDPSTXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALT 529
            DP+T                 +E+  SDYV P +  +F+  W+ VG  G +  ET  L+
Sbjct: 776 IDPTT-GEPEESGYDDEYQVEDLELTGSDYVVPAFAGNFNHIWEQVGATGEEAEETLQLS 834

Query: 530 ASKSLKDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTG 589
             KS+ D+   L + L + P+E +  P +++ HTL L G  + G +V+A  RM ++  +G
Sbjct: 835 GVKSIVDATEQLAKTLSLQPLEGTDVPINTTTHTLKLFGKTVMGGRVVANIRMAYSTKSG 894

Query: 590 VTMELSVRSPSEEISRIVIGAV 611
           VT ++ VRS    ++ +VIG+V
Sbjct: 895 VTSKIVVRSEEGGVAALVIGSV 916



>gi|38567064|emb|CAE76361.1| related to coatomer gamma-2 subunit [Neurospora crassa]
          Length = 909

 Score =  593 bits (1528), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 328/614 (53%), Positives = 428/614 (69%), Gaps = 19/614 (3%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAA+R L+  A  +P AV  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLTSPRAVTKFAALRILHNFASFKPAAVAVCNPDIELLISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFMSEI+DEFK+ +V+AIR+LCLKFPSKQ  ML FLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMKQISGFMSEITDEFKITIVEAIRTLCLKFPSKQAGMLQFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+PESKE ALAHLCEFIEDCEFTKL+VRVLHLLG+EGPKT  PTKYI
Sbjct: 431 KRAVVESMFDLIKFVPESKEEALAHLCEFIEDCEFTKLAVRVLHLLGLEGPKTSQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LENSIVRAAAV+ALAKFGV  +DPEVK+S++VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENSIVRAAAVTALAKFGVGQKDPEVKRSVEVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAE 299
           LKL+ +++E A ++VK+DS +SL   E QLV       + E PFD+S IP +T+ QA+AE
Sbjct: 551 LKLMKEEDELANRFVKNDSMFSLPFFEHQLVT-----STFEAPFDISKIPVVTREQADAE 605

Query: 300 NLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIAA 359
           +   R+  L +T    T S     +     + +            Q Y+Q+L QIPE+A 
Sbjct: 606 D---RTKKLTAT----TPSLKPPKVGPTKAAPTSAEAAASASAAAQKYAQELMQIPEMAE 658

Query: 360 FGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPES 419
           FG + KSS   VELTE+ETEYVV  VKH+FKE++V Q+ V NTL D +LENV+VV  P  
Sbjct: 659 FGAVLKSS-PVVELTEAETEYVVGVVKHIFKEHIVLQYEVKNTLPDTVLENVSVVATPAE 717

Query: 420 DEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPSTXXX 478
           +   L E F+I A KL  D P  +YVAF++ + E    + +FSN LKF  K+ DPST   
Sbjct: 718 E--ELEELFIIQAEKLETDVPGKVYVAFRKVSGEGSLPVSTFSNVLKFTSKEIDPST-GE 774

Query: 479 XXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSLKDS 537
                          ++  SDYV P + S+F+  W+ VG  G +  ET  L++ KS+ D+
Sbjct: 775 PEETGYDDEYEVAEFDLAGSDYVIPVFASNFAHIWEQVGASGEEAEETLLLSSMKSISDA 834

Query: 538 CTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSVR 597
              L + L + P+E +  P + + HTL L G  + G +V+A  RM F+  +GVT +++VR
Sbjct: 835 TEQLAKTLSLQPLEGTDVPLNQTTHTLKLLGKTVNGGRVVANVRMAFSAKSGVTTKITVR 894

Query: 598 SPSEEISRIVIGAV 611
           S  E ++ +++ +V
Sbjct: 895 SEEEGVAALIVASV 908



>gi|330919728|ref|XP_003298734.1| hypothetical protein PTT_09529 [Pyrenophora teres f. teres 0-1]
 gi|311327938|gb|EFQ93177.1| hypothetical protein PTT_09529 [Pyrenophora teres f. teres 0-1]
          Length = 916

 Score =  592 bits (1527), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 319/617 (51%), Positives = 431/617 (69%), Gaps = 16/617 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAA+R L+++A  +P AV+SCN D+E+LIT+ NRS+ATFAITTLLKTGN
Sbjct: 309 LFLTSPRAVTKFAALRILSQMASFKPDAVRSCNQDIESLITNSNRSIATFAITTLLKTGN 368

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQITGFM+EI+DEFKV +V+A+R+L LKF +KQ   L+FLSG+LRDEGGYEF
Sbjct: 369 ESSVDRLMKQITGFMAEITDEFKVTIVEAVRTLALKFKAKQSGFLAFLSGILRDEGGYEF 428

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVEAI DL++F+PE+KE ALA LCEFIEDCEFTKL+VR+L +LG EGP TP PTKYI
Sbjct: 429 KRAVVEAIMDLIRFVPEAKEDALATLCEFIEDCEFTKLAVRILFVLGREGPSTPHPTKYI 488

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAA SALAKFGV  +DPE+KKS+ VLLTRCLDD DDEVRDRA L 
Sbjct: 489 RYIYNRVVLENAIVRAAATSALAKFGVGQKDPEIKKSVHVLLTRCLDDVDDEVRDRAALN 548

Query: 241 LKLID--DNESAEKYVKDDSTYSLAALERQLVQYVSNP--ESSEKPFDLSDIPKITKAQA 296
           L+L+D  D++ A  ++++DS +SL  LE QL  YVS+   ++ E  FD++ IP +++ QA
Sbjct: 549 LRLMDQGDDDMAISFIRNDSMFSLPVLEHQLAMYVSSDSRDTFEAAFDITKIPTVSREQA 608

Query: 297 EAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPE 356
           +A +L  ++    +T T+   S+A         S +         +  Q Y+ +L++IPE
Sbjct: 609 DAADLTKKT--EGATPTLKAPSAAKAP------SKAGADAAANAANNAQKYAVELQKIPE 660

Query: 357 IAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
           +AA G + KSS  PVELTESETEYVV+ +KH+FK+++V Q+ + NTL+D +L +V +V+ 
Sbjct: 661 LAAHGGVLKSS-DPVELTESETEYVVTAIKHIFKDHIVLQYDIKNTLDDTVLVDVEIVVT 719

Query: 417 PESD-EGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPS 474
           PE D +  L EEFVIPA KL  ++P ++YV+FKR   E ++   SF+N LKF  K+ DPS
Sbjct: 720 PEDDGDVQLEEEFVIPAPKLSTNEPGTVYVSFKRLETESQFIAASFTNVLKFTTKEIDPS 779

Query: 475 TXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSL 534
           T                 + +  +DYV P Y   F + WD    +    ET  L   KS+
Sbjct: 780 TNEPEEGDGYADEYSVEDLYLTGADYVVPAYAGSFDNVWDQSNGDS-ATETLQLGNMKSI 838

Query: 535 KDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
            D+   L + L + P+E +    S+S HTL L G  + G KV A  RM F+  TGVTM++
Sbjct: 839 ADATEQLTKTLSLQPLEGTDVALSASTHTLKLYGKTITGGKVAAMVRMAFSAKTGVTMKI 898

Query: 595 SVRSPSEEISRIVIGAV 611
            VRS  E ++ +V+G+V
Sbjct: 899 DVRSEEEGVAALVVGSV 915



>gi|430812778|emb|CCJ29818.1| unnamed protein product [Pneumocystis jirovecii]
 gi|430814328|emb|CCJ28424.1| unnamed protein product [Pneumocystis jirovecii]
          Length = 908

 Score =  592 bits (1525), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 297/610 (48%), Positives = 420/610 (68%), Gaps = 21/610 (3%)

Query: 2   FLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGNE 61
           FLSSP++  RFAAIR LNK  M +   V  CN D+E+LI+D NRS+ATFAITTLLKTGNE
Sbjct: 319 FLSSPRTVCRFAAIRILNKFTMIKSHMVGCCNSDIESLISDSNRSIATFAITTLLKTGNE 378

Query: 62  ASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEFK 121
            ++D+LMKQI  FM +I+DEFK+IV++AIRSLCLKFPSK  VMLSFLS  LRDEGGY+FK
Sbjct: 379 INIDKLMKQIQSFMGDITDEFKIIVIEAIRSLCLKFPSKYTVMLSFLSSALRDEGGYDFK 438

Query: 122 RAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYIR 181
           ++VVEA+FD++KFIPESKE AL+ LCEFIEDCEFTKL++R+LH LG+EGP    PTKYIR
Sbjct: 439 KSVVEAMFDMIKFIPESKEEALSSLCEFIEDCEFTKLTIRILHTLGIEGPYINQPTKYIR 498

Query: 182 YIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILYL 241
           YIYNR++LEN++VRAAAV+AL+ FG+   + E+K +IK+LL RCL+D DDEVRDR  L +
Sbjct: 499 YIYNRIVLENALVRAAAVTALSNFGLGLNNSELKNNIKILLQRCLEDPDDEVRDRVALNI 558

Query: 242 KLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEAENL 301
           KL++DN  +      D+  SL+ALE QLV Y+S+  S EK FD+S IP I+K + +AE+ 
Sbjct: 559 KLLEDNNVS------DNMPSLSALEYQLVCYISS-NSFEKQFDVSSIPNISKEELDAESY 611

Query: 302 KPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIAAFG 361
           + ++ ++ S  T     +       N + +          D    Y+  L+ + E   +G
Sbjct: 612 RQKTIEVDSLSTFMLIETKANQTTHNTLLS----------DVTAQYTNILQSVSEFKDYG 661

Query: 362 PLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPESDE 421
           PL KS+  P+ELTESE EY V+ +KH+FKE++V QF + NTL+D +LEN++++ +P  D 
Sbjct: 662 PLLKSTSNPIELTESEIEYYVTAIKHIFKEHIVLQFDLVNTLSDTILENISMISEP--DG 719

Query: 422 GTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXXXXX 481
             L EEFVI A K  ++ P SIYV+F R +P+ +   +F+N LKF  K+ DP+T      
Sbjct: 720 SGLKEEFVIQAQKAEHNSPVSIYVSFLREDPDSFVTITFTNILKFTTKEIDPNT-GELEK 778

Query: 482 XXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSCTTL 541
                      +E+  +DYVFP YI++F+  WDS+ ++ +VVETF+L++  S++++C  +
Sbjct: 779 TGYDDEYQVEALELSVADYVFPIYINNFAQIWDSLTDKNEVVETFSLSSITSVQEACHKI 838

Query: 542 IELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSVRSPSE 601
            E L M P+E +     SS HT+ LSG  + G KVLA  ++ +A +  +T++LSVRS + 
Sbjct: 839 PEQLSMQPLEGTEAVVHSSFHTMRLSGKSINGNKVLAIAKIAYAKNE-MTLKLSVRSENI 897

Query: 602 EISRIVIGAV 611
            ++ ++   +
Sbjct: 898 MLATLIANGI 907



>gi|212543053|ref|XP_002151681.1| Coatomer subunit  gamma, putative [Talaromyces marneffei ATCC
           18224]
 gi|210066588|gb|EEA20681.1| Coatomer subunit gamma, putative [Talaromyces marneffei ATCC 18224]
          Length = 917

 Score =  591 bits (1524), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 324/616 (52%), Positives = 425/616 (68%), Gaps = 14/616 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP++  +FAAIR L+  A  +P  V  CN D+E+LI++ NRS+ATFAITTLLKTGN
Sbjct: 310 LFLSSPRAITKFAAIRILHSFASFKPHVVNQCNQDIESLISNSNRSIATFAITTLLKTGN 369

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFM++I+DEFK+ +V+AIR+LCLKFPSKQ  ML+FLSG+LRDEGGYEF
Sbjct: 370 EASVDRLMKQISGFMADITDEFKITIVEAIRTLCLKFPSKQASMLTFLSGILRDEGGYEF 429

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KR+VVE++FDL+KF+P SKE ALAHLCEFIEDCEFTKLSVR+LHLLGVEGPKTP PTKYI
Sbjct: 430 KRSVVESMFDLIKFVPGSKEDALAHLCEFIEDCEFTKLSVRILHLLGVEGPKTPQPTKYI 489

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN++VRAAAV+ALAKFGV  +DPEVK+S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 490 RYIYNRVVLENAVVRAAAVTALAKFGVGQQDPEVKRSVSVLLTRCLDDTDDEVRDRAALN 549

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYV--SNPESSEKPFDLSDIPKITKAQAE 297
           L+L+ +++E A ++VK+DS YSL+  E QLV YV  ++ E+    FD+S IP ++  QA 
Sbjct: 550 LRLMKEEDEIANRFVKNDSMYSLSTFEHQLVMYVTATDKETFSVAFDVSSIPVVSHEQAL 609

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE    R+  L S     T +    S        +  A         Q Y++QL QIPE+
Sbjct: 610 AEE---RTKKLTS----ATPTLKAPSTTPTKAKANGAAEGAATAAATQKYAEQLMQIPEL 662

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
             +G L KSS   VELTESETEYVVS VKH+FKE++V Q+ + NTL D +LE+V+VV  P
Sbjct: 663 KEYGTLLKSS-NVVELTESETEYVVSAVKHIFKEHIVLQYDLKNTLPDTVLEDVSVVATP 721

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEE-YTLGSFSNTLKFLVKDCDPSTX 476
             +E  L E+F++P  KLP ++P  +YVAFK+T  E  +   SF+N LKF  K+ DP+T 
Sbjct: 722 TDEEEELEEDFIVPCPKLPTNEPGIVYVAFKKTGGEHSFPTMSFTNNLKFTSKEIDPTT- 780

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSLK 535
                           +++  SDYV P +   F   W+  G  G +  ETF L+  KS+ 
Sbjct: 781 GEPEESGYKDEYQVEDLDLTGSDYVIPAFAGSFDHVWEQTGANGEEASETFQLSNVKSIA 840

Query: 536 DSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           D+   LI  L + P+E +    S++ HTL L G  + G ++    +M F+  TGVT ++S
Sbjct: 841 DATEQLITALSLQPLEGTDVALSNTTHTLKLYGKTVSGGRIAGLVKMAFSARTGVTTKVS 900

Query: 596 VRSPSEEISRIVIGAV 611
           +RS  E  +  ++ +V
Sbjct: 901 IRSEEEGFAAAIVASV 916



>gi|471559289|gb|EMR61729.1| putative coatomer subunit gamma protein [Eutypa lata UCREL1]
          Length = 917

 Score =  591 bits (1524), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 326/616 (52%), Positives = 426/616 (69%), Gaps = 15/616 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP++  +FAA+R L+  A  +P AV  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLSSPRAVTKFAALRILHNFASFKPQAVNVCNPDIEALISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFMSEI+DEFK+ +V+AIR+LCLKFPSKQ  ML+FLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMKQISGFMSEITDEFKITIVEAIRTLCLKFPSKQAGMLAFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+P+SKE ALAHLCEFIEDCEFTKL+VR+LHLLG+EGPKT  PTKYI
Sbjct: 431 KRAVVESMFDLIKFVPDSKEDALAHLCEFIEDCEFTKLAVRILHLLGLEGPKTSQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVK+S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKRSVDVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQAE 297
           L+L+ ++++  E+++K+++ Y+L   E QLV YV++ + S     FD+S IP +T+ QA+
Sbjct: 551 LRLMHEEDDLGERFIKNENMYALPYFEHQLVMYVTSEDKSIFGNAFDISSIPIVTREQAD 610

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE+   R+  L +T    T S        +    S               +++L  IPE+
Sbjct: 611 AED---RTKKLTAT----TPSLKPPKTGPSKSVQSGAEAQASAAAAAAKVAEELMSIPEM 663

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
             FG + KSS   VELTE+ETEYVV+ VKH+FKE +V QF + NTL D +LENV+VV  P
Sbjct: 664 KEFGGVLKSS-AVVELTEAETEYVVTVVKHIFKEYVVVQFEIKNTLPDTVLENVSVVATP 722

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPSTX 476
            SDE  L E F+IPA KLP  +P  +YVAFK+ N E      SFSN LKF  K+ DP+T 
Sbjct: 723 -SDEEELEEVFIIPAEKLPAGEPGKVYVAFKKANGEGSLPTSSFSNVLKFTSKEIDPTT- 780

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSLK 535
                            E+  SDYV PTY  +++  W+SVG  G +  ET  L+   S+ 
Sbjct: 781 NEPEESGYDDEYEVGDFELTGSDYVIPTYAGNYNHLWESVGAAGEEAQETLQLSGINSIA 840

Query: 536 DSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           D+   LI+ L + P+E +  P S + H L L G  + G KV+A  RM ++  +GVT ++ 
Sbjct: 841 DATEQLIKALSLQPLEGTDVPVSQTSHQLKLLGKTVNGGKVVANVRMVYSSKSGVTTKIV 900

Query: 596 VRSPSEEISRIVIGAV 611
           VRS  E ++ +V  ++
Sbjct: 901 VRSEEENVAAMVAASI 916



>gi|367041998|ref|XP_003651379.1| hypothetical protein THITE_2111582 [Thielavia terrestris NRRL 8126]
 gi|346998641|gb|AEO65043.1| hypothetical protein THITE_2111582 [Thielavia terrestris NRRL 8126]
          Length = 919

 Score =  590 bits (1522), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 324/608 (53%), Positives = 424/608 (69%), Gaps = 17/608 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP++  +FAA+R L+ +A  +P  V  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLSSPRAVTKFAALRILHTIASFKPHVVNVCNPDIELLISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFMSEI+DEFK+ +V+AIR+LCLKFPSKQ  ML FLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMKQISGFMSEITDEFKITIVEAIRTLCLKFPSKQAGMLQFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+P+SKE ALAHLCEFIEDCEFTKL+VR+LHLLGVEGPKT  PTKYI
Sbjct: 431 KRAVVESMFDLIKFVPDSKEEALAHLCEFIEDCEFTKLAVRILHLLGVEGPKTSQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVK+S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKRSVDVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQAE 297
           L+L+ +++E A ++VK+D+ ++L   E QLV YV++ + S  E PFD+S IP +T+ QA+
Sbjct: 551 LRLMHEEDELAARFVKNDNMFALPFFEHQLVMYVTSDDKSAFETPFDISKIPVVTREQAD 610

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE+   R+  L +T      S     +     + S            Q Y+Q+L QIPE+
Sbjct: 611 AED---RTKKLTAT----IPSLKPPKVGPTKTAPSSADAAASASAAAQKYAQELMQIPEM 663

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
             FG + KSS  PVELTE+ETEYVVS VKH+FKE++V Q+ + NTL   +LENV+V+  P
Sbjct: 664 NEFGSVLKSS-PPVELTEAETEYVVSVVKHIFKEHIVLQYEIKNTLPATILENVSVMATP 722

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTN-PEEYTLGSFSNTLKFLVKDCDPSTX 476
            SDE  L E F+I A  L  D P  +YVAF++ N      + +FSN LKF  K+ DP+T 
Sbjct: 723 -SDEEELEEVFIIQAETLQTDVPGKVYVAFRKVNGGSSLPVCTFSNVLKFTSKEIDPTT- 780

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQ---VVETFALTASKS 533
                            ++  SDYV PT+ S+F+  W+ VG + Q     ET  L+  KS
Sbjct: 781 NEPEEGGYEDEYEVSDFDLSGSDYVIPTFASNFAHVWEQVGAQPQAEEAEETLQLSGMKS 840

Query: 534 LKDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTME 593
           + ++   L + L + P+E +  P + + HTL L G  + G +V+A  RM ++  TGVT +
Sbjct: 841 IPEATEQLAKTLSLQPLEGTDVPVNQTTHTLKLLGKTVNGGRVVANVRMAYSSKTGVTTK 900

Query: 594 LSVRSPSE 601
           ++VRS  E
Sbjct: 901 ITVRSEEE 908



>gi|169595076|ref|XP_001790962.1| hypothetical protein SNOG_00271 [Phaeosphaeria nodorum SN15]
 gi|160701009|gb|EAT91766.2| hypothetical protein SNOG_00271 [Phaeosphaeria nodorum SN15]
          Length = 904

 Score =  590 bits (1521), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 318/616 (51%), Positives = 432/616 (70%), Gaps = 15/616 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAA+R L+++A  +P AV++CN D+E+LIT+ NRS+ATFAITTLLKTGN
Sbjct: 298 LFLTSPRAVTKFAALRILSQMASFKPDAVRTCNQDIESLITNSNRSIATFAITTLLKTGN 357

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQITGFM+EI+DEFKV +V+A+R+L LKF +KQ   L+FLSG+LRDEGGYEF
Sbjct: 358 ESSVDRLMKQITGFMAEITDEFKVTIVEAVRTLALKFKAKQSGFLAFLSGILRDEGGYEF 417

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KR+VVEAI DL++F+PE+KE ALA LCEFIEDCEFTKL+VR+L +LG EGP TP PTKYI
Sbjct: 418 KRSVVEAIMDLIRFVPEAKEDALATLCEFIEDCEFTKLAVRILFVLGREGPSTPHPTKYI 477

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAA SALAKFGV  +DPE+KKS+ VLLTRCLDD DDEVRDRA L 
Sbjct: 478 RYIYNRVVLENAIVRAAATSALAKFGVGQKDPEIKKSVHVLLTRCLDDVDDEVRDRAALN 537

Query: 241 LKLID-DNESAEKYVKDDSTYSLAALERQLVQYVSNP--ESSEKPFDLSDIPKITKAQAE 297
           L+L+D D++ A  ++++DS +SL  LE QL  YVS+   ++ E  FD++ IP +++ QA+
Sbjct: 538 LRLMDQDDDLALSFIRNDSMFSLPVLEHQLAMYVSSDSRDTFETAFDITKIPTVSREQAD 597

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           A +L        + +T G + +      S   S +     +   +  Q Y+++L++IPE+
Sbjct: 598 AADL--------TKKTEGATPTLKAPSASKAPSKAGADAASTAANNAQKYAEELQKIPEL 649

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
           AA G + KSS   VELTESETEYVV+ VKH+FK+++V Q+ + NTL D +L +V +V+ P
Sbjct: 650 AAHGSVLKSS-DLVELTESETEYVVTAVKHIFKDHIVLQYDIKNTLPDTVLLDVEMVVTP 708

Query: 418 ESD-EGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPST 475
           E D +  L EEFVIPA KLP ++P ++YV+FKR   E +Y   SF+N LKF  K+ DPST
Sbjct: 709 EDDGDVQLEEEFVIPAPKLPTNEPGTVYVSFKRLETESQYIAASFTNVLKFTSKEIDPST 768

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLK 535
                            +++  +DYV P Y   F + W+    E    ET  L+  KS+ 
Sbjct: 769 NEPEDGDGYPDEYQVEDLDLNGADYVVPAYAGSFDNVWEQSNGES-ATETLQLSNIKSIS 827

Query: 536 DSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           D+   L + L + P++ +    S+S HTL L G  + G KV A  RM F+  TGVTM++ 
Sbjct: 828 DATEQLTKTLSLQPLDGTDVALSTSTHTLKLYGKTITGGKVAAMVRMAFSAKTGVTMKID 887

Query: 596 VRSPSEEISRIVIGAV 611
           VRS  E ++ +VIG+V
Sbjct: 888 VRSEEEGVAALVIGSV 903



>gi|171685111|ref|XP_001907497.1| hypothetical protein [Podospora anserina S mat+]
 gi|170942516|emb|CAP68168.1| unnamed protein product [Podospora anserina S mat+]
          Length = 918

 Score =  590 bits (1521), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 332/620 (53%), Positives = 430/620 (69%), Gaps = 22/620 (3%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAA+R L+ +A  +P  V  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLTSPRAVTKFAALRILHNIASFKPNVVNVCNPDIELLISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFMSEI+DEFK+ +V+AIR+LCLKFPSKQ  ML FLSGVLRDEGGYEF
Sbjct: 371 EASVDRLMKQISGFMSEITDEFKITIVEAIRTLCLKFPSKQAGMLQFLSGVLRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+PESKE ALAHLCEFIEDCEFTKL+VR+LHLLGVEGPKT  PTKYI
Sbjct: 431 KRAVVESMFDLIKFVPESKEEALAHLCEFIEDCEFTKLAVRILHLLGVEGPKTSQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN++VRAAAV+ALAKFGV  +DPEVK+S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENALVRAAAVTALAKFGVGQKDPEVKRSVDVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQAE 297
           L L+ +++E A ++VK+DS +SL   E QLV YV++ + S  +  FD+S IP +T+ QA+
Sbjct: 551 LSLMHEEDELATRFVKNDSMFSLPYFEHQLVMYVTSDDKSVFDDSFDVSKIPIVTREQAD 610

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE+   R+  L +T    T S           + S            Q Y+Q+L  IPE+
Sbjct: 611 AED---RTKKLTAT----TPSLKPPKTGPTKAAPSAADAAASATATAQKYAQELLAIPEL 663

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
             FG + KSS   VELTE+ETEYVVS VKH+FKE++V Q+ V NTL D +LENV+VV  P
Sbjct: 664 KEFGAVLKSS-PVVELTEAETEYVVSVVKHIFKEHIVLQYEVKNTLPDTVLENVSVVATP 722

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPSTX 476
            SDE  L E F+I A KL  D+P  IYVAF++ N E    + +FSN LKF  K+ DP+T 
Sbjct: 723 -SDEEELQEVFIIQAEKLATDEPGKIYVAFQKVNGEGALPIATFSNVLKFTSKEIDPTT- 780

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSLK 535
                            ++  +DYV P + S+F+  W+ VG +G +  ET  L+  KS+ 
Sbjct: 781 SEPEETGYDDEYEVSEFDLSGADYVVPAFASNFAHIWEQVGAQGDEAEETLQLSGMKSIA 840

Query: 536 ----DSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVT 591
                   T I L+ +   E +  P + + HTL L G  +GG +V+A  RM ++  TGVT
Sbjct: 841 GMFFSPTFTTISLVCL---EGTDVPVTQTTHTLKLLGKTVGGGRVVANVRMAYSSKTGVT 897

Query: 592 MELSVRSPSEEISRIVIGAV 611
            +++VRS  E ++ +VIG+V
Sbjct: 898 TKITVRSEEEGVAALVIGSV 917



>gi|400600740|gb|EJP68408.1| coatomer gamma-2 subunit [Beauveria bassiana ARSEF 2860]
          Length = 917

 Score =  590 bits (1520), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 324/619 (52%), Positives = 438/619 (70%), Gaps = 20/619 (3%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           +FL+SP++  +FAA+R L+  A  +P AV  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 310 MFLTSPRAVTKFAALRILHNFASFKPIAVSPCNQDIELLISNSNRSIATFAITTLLKTGN 369

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI  FMSEI+DEFK+ +V+AIR+LCLKFPSKQ  ML+FLSG+LRDEGGYEF
Sbjct: 370 EASVDRLMKQIASFMSEITDEFKITIVEAIRTLCLKFPSKQAGMLTFLSGILRDEGGYEF 429

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K+AV+E++FDL+KF+P+SK+ ALAHLCEFIEDCEFTKL+VR+LHL+G+EGPKT  PTKYI
Sbjct: 430 KKAVIESMFDLIKFVPDSKDEALAHLCEFIEDCEFTKLAVRILHLIGLEGPKTSNPTKYI 489

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV   D +VK S+KVLLTRCLDD DDEVRDRA L 
Sbjct: 490 RYIYNRVVLENAIVRAAAVTALAKFGVGQADADVKSSVKVLLTRCLDDVDDEVRDRAALN 549

Query: 241 LKLI--DDNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQA 296
           LKL+  +D++ A  +VK+DS ++L   E QLV YV++ + S  E+PFD+S IP +T+ QA
Sbjct: 550 LKLMSEEDDKMASNFVKNDSMFALPYFEHQLVMYVTSDDKSNFEEPFDISKIPVVTREQA 609

Query: 297 EAENLKPRSFDL-ASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIP 355
           +AE+   R+  L A+T T+    S      +     +  A+      Q Q Y+++L  IP
Sbjct: 610 DAED---RTKKLTATTPTLKAPKSGPTKAPATGAEAAAAAS-----AQVQKYTEELTAIP 661

Query: 356 EIAAFGPLFKSSIKPV-ELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVV 414
           ++A FG + KSS  PV ELTE+ETEYVVS VKH+FKE++V QF V NTL D +LENV+VV
Sbjct: 662 DMAEFGSVLKSS--PVIELTEAETEYVVSLVKHIFKEHIVLQFDVKNTLPDTVLENVSVV 719

Query: 415 MQPESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEE-YTLGSFSNTLKFLVKDCDP 473
             P S+E  L E F++ + +L  D+P  +YVAFK+ N E    + SF+N L+F  K+ DP
Sbjct: 720 ASP-SEEEELEEVFILQSDRLATDEPGKVYVAFKKVNGENSLPVSSFTNVLRFTSKEIDP 778

Query: 474 STXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASK 532
           +T                  E+  SDY+ PT+ S+F+  W+ +G  G Q  ET  L++ K
Sbjct: 779 AT-GDPEETGYDDEYEVSEFELTGSDYIIPTFASNFNHLWEQIGASGEQAEETLQLSSMK 837

Query: 533 SLKDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTM 592
           S+ D+   L + L + P++ +  P + S HTL L G  + G +V+A  RM F+  +GVT 
Sbjct: 838 SIADATEQLTQALSLQPLDGTDVPVNQSTHTLKLLGRTVSGGRVVAMVRMAFSSKSGVTT 897

Query: 593 ELSVRSPSEEISRIVIGAV 611
           +++VRS  E ++ +VI ++
Sbjct: 898 KITVRSEEENVAALVIASI 916



>gi|189201912|ref|XP_001937292.1| coatomer subunit gamma [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|187984391|gb|EDU49879.1| coatomer subunit gamma [Pyrenophora tritici-repentis Pt-1C-BFP]
          Length = 916

 Score =  587 bits (1512), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 319/617 (51%), Positives = 431/617 (69%), Gaps = 16/617 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAA+R L+++A  +P AV+SCN D+E+LIT+ NRS+ATFAITTLLKTGN
Sbjct: 309 LFLTSPRAVTKFAALRILSQMASFKPDAVRSCNQDIESLITNSNRSIATFAITTLLKTGN 368

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQITGFM+EI+DEFKV +V+A+R+L LKF +KQ   L+FLSG+LRDEGGYEF
Sbjct: 369 ESSVDRLMKQITGFMAEITDEFKVTIVEAVRTLALKFKAKQSGFLAFLSGILRDEGGYEF 428

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVEAI DL++F+PE+KE ALA LCEFIEDCEFTKL+VR+L +LG EGP TP PTKYI
Sbjct: 429 KRAVVEAIMDLIRFVPEAKEDALATLCEFIEDCEFTKLAVRILFVLGREGPSTPHPTKYI 488

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAA SALAKFGV  +DPE+KKS+ VLLTRCLDD DDEVRDRA L 
Sbjct: 489 RYIYNRVVLENAIVRAAATSALAKFGVGQKDPEIKKSVHVLLTRCLDDVDDEVRDRAALN 548

Query: 241 LKLID--DNESAEKYVKDDSTYSLAALERQLVQYVSNP--ESSEKPFDLSDIPKITKAQA 296
           L+L+D  D++ A  ++++DS +SL  LE QL  YVS+   ++ E  FD++ IP +++ QA
Sbjct: 549 LRLMDQGDDDMAISFIRNDSMFSLPVLEHQLAMYVSSDSRDTFETAFDITKIPTVSREQA 608

Query: 297 EAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPE 356
           +A +L  ++    +T T+   S+A         S +         +  Q Y+ +L++IPE
Sbjct: 609 DAADLTKKT--EGATPTLKAPSAAKAP------SKAGADAAANAANNAQKYAAELQKIPE 660

Query: 357 IAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
           +AA G + KSS  PVELTESETEYVV+ +KH+FK+++V Q+ + NTL+D +L +V +V+ 
Sbjct: 661 LAAHGGVLKSS-DPVELTESETEYVVTAIKHIFKDHIVLQYDIKNTLDDTVLVDVEMVVT 719

Query: 417 PESD-EGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPS 474
           PE D +  L EEFVIPA KL  ++P ++YV+FKR   E ++   SF+N LKF  K+ DPS
Sbjct: 720 PEDDGDVQLEEEFVIPAPKLATNEPGTVYVSFKRLETESQFIAASFTNVLKFTTKEIDPS 779

Query: 475 TXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSL 534
           T                 + +  +DYV P Y   F + WD    +    ET  L   KS+
Sbjct: 780 TNEPEEGDGYADEYSVEDLYLTGADYVVPAYAGSFDNVWDQSNGDS-ATETLQLGNMKSI 838

Query: 535 KDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
            D+   L + L + P+E +    S+S HTL L G  + G KV A  RM F+  TGVTM++
Sbjct: 839 ADATEQLTKTLSLQPLEGTDVALSASTHTLKLYGKTITGGKVAAMVRMAFSAKTGVTMKI 898

Query: 595 SVRSPSEEISRIVIGAV 611
            VRS  E ++ +V+G+V
Sbjct: 899 DVRSEEEGVAALVVGSV 915



>gi|346977584|gb|EGY21036.1| coatomer subunit gamma-2 [Verticillium dahliae VdLs.17]
          Length = 917

 Score =  585 bits (1508), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 325/617 (52%), Positives = 429/617 (69%), Gaps = 17/617 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAA+R L+  A  +P AV  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLTSPRAVTKFAALRILHNFASFKPNAVNVCNPDIELLISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMK I+ FMSEI+DEFK+ +V+AIR+LCLKFPSKQ  ML+FLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMKHISSFMSEITDEFKITIVEAIRTLCLKFPSKQAGMLAFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+PESKE ALAHLCEFIEDCEFTKL+VR+LHLLG+EGPKT  PTKYI
Sbjct: 431 KRAVVESMFDLIKFVPESKEDALAHLCEFIEDCEFTKLAVRILHLLGLEGPKTSQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVK+S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKRSVDVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQAE 297
           L L+ +D+E A ++VK+DS +SL   E QLV YV++ + S  + PFD+S IP +T+ QA+
Sbjct: 551 LSLMHEDDELATQFVKNDSMFSLPYFEHQLVMYVTSDDRSTFDDPFDISKIPVVTREQAD 610

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE+   R+  L +T      S     +     + S            Q Y+Q+L +IPE+
Sbjct: 611 AED---RTKKLTAT----APSLKPPKVGPTKSAASGAEAAASASAAAQRYAQELMEIPEM 663

Query: 358 AAFGPLFKSSIKPV-ELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
             FG + KSS  PV ELTE+ETEYVV+ VKH+FKE++V Q+ V NTL   +LENV+VV  
Sbjct: 664 KEFGSVLKSS--PVIELTEAETEYVVTVVKHIFKEHIVLQYEVKNTLPATVLENVSVVAT 721

Query: 417 PESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPST 475
           P ++E  L E F+I A  L  D+P  +YVAF++ N E    + SFSN LKF  K+ DP+T
Sbjct: 722 P-AEEEELEEVFIIQAESLATDEPGKVYVAFQKVNGEGSLPVSSFSNILKFTSKEIDPTT 780

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSL 534
                             ++  SDYV P +  +F+  W+ VG  G +  ET  L+  KS+
Sbjct: 781 -NEPEETGYDDEYEVSEFDLAGSDYVVPAFAGNFNHIWEQVGAAGEEAEETLQLSGMKSI 839

Query: 535 KDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
            D+   L + L + P++ +  P + + HTL L G  + G KV+A  RM ++  +GVT ++
Sbjct: 840 ADATDQLAKTLSLQPLDGTDVPVNQTTHTLKLFGKTIAGGKVVANVRMAYSSKSGVTTKI 899

Query: 595 SVRSPSEEISRIVIGAV 611
           +VRS  E ++ +VI +V
Sbjct: 900 TVRSEEEGVAALVIASV 916



>gi|116193677|ref|XP_001222651.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51]
 gi|88182469|gb|EAQ89937.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51]
          Length = 917

 Score =  584 bits (1506), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 318/606 (52%), Positives = 426/606 (70%), Gaps = 15/606 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP++  +FAA+R L+ +A  +P  V  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLSSPRAVTKFAALRILHNIASFKPHVVNVCNPDIELLISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFMSEI+DEFK+ +V+AIR+LCLKFPSKQ  ML FLSG+LRDEGGY+F
Sbjct: 371 EASVDRLMKQISGFMSEITDEFKITIVEAIRTLCLKFPSKQAGMLQFLSGILRDEGGYDF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+P+SKE ALAHLCEFIEDCEFTKL+VR+LHLLG+EGPKT  PTKYI
Sbjct: 431 KRAVVESMFDLIKFVPDSKEEALAHLCEFIEDCEFTKLAVRILHLLGMEGPKTSQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVK+S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKRSVDVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQAE 297
           L+L+ +++E A ++VK+D+ ++L   E QLV YV++ + +  + PFD+S IP +T+ QA+
Sbjct: 551 LRLMHEEDELATRFVKNDNMFALPFFEHQLVMYVTSDDKAAFDTPFDISKIPVVTREQAD 610

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE+   R+  L +T    T S     +     + S            Q Y+Q+L +IPE+
Sbjct: 611 AED---RTKKLTAT----TPSLKPPKVGPTKAAPSAAEAAASATATAQKYAQELMEIPEM 663

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
             FG + KSS   VELTE+ETEYVV+ VKH+F E++V Q+ V NTL D +LE+V+V   P
Sbjct: 664 KEFGSVLKSS-PLVELTEAETEYVVAVVKHVFSEHIVLQYEVKNTLPDTVLEDVSVTATP 722

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPSTX 476
            S+E  L E F+I A KL  D P  +YVAF++ + E    + +FSN LKF  K+ DP+T 
Sbjct: 723 -SEEDELEEVFIIRAEKLATDVPGKVYVAFRKVHGEGALPISTFSNVLKFTSKEIDPTT- 780

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSLK 535
                            ++  SDYV PT+ S+F+  W+ VG +G +  ET  L+  KS+ 
Sbjct: 781 NEPEESGYEDEYEVSDFDLSGSDYVIPTFASNFAHVWEQVGAKGEEAEETLQLSGMKSIP 840

Query: 536 DSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           ++   L + L + P+E +  P + + HTL L G  + G +V+A  RM ++  TGVT +++
Sbjct: 841 EATEQLAKALSLQPLEGTDVPVNQTTHTLKLLGKTVNGGRVVANVRMAYSSKTGVTTKIT 900

Query: 596 VRSPSE 601
           VRS  E
Sbjct: 901 VRSEEE 906



>gi|320589422|gb|EFX01883.1| coatamer subunit protein [Grosmannia clavigera kw1407]
          Length = 919

 Score =  584 bits (1506), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 327/616 (53%), Positives = 436/616 (70%), Gaps = 14/616 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP+S  +FAA+R L+  A  +P AV+ CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLTSPRSVTKFAALRILHNFASFKPEAVRVCNPDIELLISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFMSEI+DEFK+ +V+AIR+LCLKFPSKQ  ML+FLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMKQISGFMSEITDEFKITIVEAIRTLCLKFPSKQAGMLAFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KR VVE++FDL+KF+P+SKE ALAHLCEFIEDCEFTKL+VR+LHLLG+EGPKT  PTKYI
Sbjct: 431 KRTVVESMFDLIKFVPDSKEDALAHLCEFIEDCEFTKLAVRILHLLGIEGPKTSQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVKKS++VLL+RCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKKSVQVLLSRCLDDVDDEVRDRAALN 550

Query: 241 LKLIDDNES-AEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQAE 297
           L+L+++ ++ AE++VK+++ YSL+  E QLV YV++ E       FD+S IP +T+ QA+
Sbjct: 551 LRLMNEPDALAERFVKNENMYSLSFFEHQLVTYVTSDEKDTFTTSFDISKIPVVTREQAD 610

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE+   R+  L +T     +    G+  S        A+ +    +   Y+Q+L QIPEI
Sbjct: 611 AED---RTKKLTATAPTLKAPKVGGAAKSAASVAEEAASASAQAQK---YAQELLQIPEI 664

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
             FG + KSS   VELTE+ETEYVVS +KH+FKE +V Q+ + NTL D +LENV+VV  P
Sbjct: 665 QEFGAVLKSS-PVVELTEAETEYVVSVIKHIFKEYIVLQYEIKNTLPDTVLENVSVVATP 723

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKR-TNPEEYTLGSFSNTLKFLVKDCDPSTX 476
            S+E  L E F++ A +L  ++P  +YVAFK+    +     +FSN LKF  K+ DPST 
Sbjct: 724 -SEEDELEEAFILQAERLATNEPGKVYVAFKKVAGADGLPTSTFSNVLKFTSKEIDPST- 781

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSLK 535
                            ++  SDYV PT+ S+FS  W+ VG  G +  ET  L+  KS+ 
Sbjct: 782 REPEESGYDDEYEVSEFDLSGSDYVIPTFASNFSHLWEQVGASGEESEETLQLSGVKSIA 841

Query: 536 DSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           ++   L + L + P+E +  P S + HTL L G  +GG +V+A  RM ++  TGVT +++
Sbjct: 842 EATDLLAKTLSLQPLEGTDIPQSQTTHTLKLLGKTVGGGRVVATVRMAYSTKTGVTTKVT 901

Query: 596 VRSPSEEISRIVIGAV 611
           VRS  E +S +V+ A+
Sbjct: 902 VRSEEEGVSALVVAAL 917



>gi|346326535|gb|EGX96131.1| Coatomer subunit gamma, putative [Cordyceps militaris CM01]
          Length = 917

 Score =  584 bits (1506), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 321/619 (51%), Positives = 433/619 (69%), Gaps = 20/619 (3%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           +FL+SP++  +FAA+R L+  A   PTAV  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 310 MFLTSPRAVTKFAALRILHNFASFTPTAVAPCNQDIELLISNSNRSIATFAITTLLKTGN 369

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI  FMSEI+DEFK+ +V+AIR+LCLKFP+KQ  ML+FLSG+LRDEGG+EF
Sbjct: 370 EASVDRLMKQIASFMSEITDEFKITIVEAIRTLCLKFPNKQAGMLTFLSGILRDEGGFEF 429

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K+AV+E++FDL+KF+P+SK+ ALAHLCEFIEDCEFTKL+VR+LHL+G+EGPKT  PTKYI
Sbjct: 430 KKAVIESMFDLIKFVPDSKDEALAHLCEFIEDCEFTKLAVRILHLIGLEGPKTSNPTKYI 489

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV   D +VK S+KVLL RCLDD DDEVRDRA L 
Sbjct: 490 RYIYNRVVLENAIVRAAAVTALAKFGVGQTDADVKSSVKVLLARCLDDVDDEVRDRAALN 549

Query: 241 LKLI--DDNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQA 296
           LKL+   D++ A  +VK++S ++L   E QLV YV++ + S  E PFD+S IP +T+ QA
Sbjct: 550 LKLMSEQDDQMASNFVKNESMFALPYFEHQLVMYVTSEDKSNFENPFDISKIPVVTREQA 609

Query: 297 EAENLKPRSFDL-ASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIP 355
           +AE+   R+  L A+T TI   +   G   +        A  +    +   Y+++   IP
Sbjct: 610 DAED---RTKKLTATTPTI--KAPKAGPTKAPASGAEAAAAASAQAQK---YTEEFMTIP 661

Query: 356 EIAAFGPLFKSSIKPV-ELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVV 414
           ++A FG + KSS  PV ELTE+ETEYVVS VKH+FKE++V QF V NTL D +LENV+VV
Sbjct: 662 DMAEFGSVLKSS--PVIELTEAETEYVVSLVKHVFKEHIVLQFDVKNTLPDTVLENVSVV 719

Query: 415 MQPESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEE-YTLGSFSNTLKFLVKDCDP 473
             P S+E  L E F++ + KL  D+P  +YVAFK+ N E+   + SF+N L+F  K+ DP
Sbjct: 720 ASP-SEEDELEEVFILQSDKLATDEPGKVYVAFKKVNGEKSLPVSSFTNVLRFTSKEIDP 778

Query: 474 STXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASK 532
           ST                  E+  SDY+ PT+  +F   W+ VG  G +  ET  L++ K
Sbjct: 779 ST-GEPEESGYDDEYEVSEFELTGSDYIIPTFAGNFDDLWEQVGSAGEEAEETLQLSSMK 837

Query: 533 SLKDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTM 592
           S+ D+   L + L + P++ +  P + S HTL L G  + G +V+A  RM F+  +GVT 
Sbjct: 838 SIADATEQLTQALSLQPLDGTDVPVNQSTHTLKLLGKTVTGGRVVATVRMAFSTKSGVTT 897

Query: 593 ELSVRSPSEEISRIVIGAV 611
           +++VRS  E+++ +VI +V
Sbjct: 898 KITVRSEEEDVAALVIASV 916



>gi|367021802|ref|XP_003660186.1| hypothetical protein MYCTH_2298167 [Myceliophthora thermophila ATCC
           42464]
 gi|347007453|gb|AEO54941.1| hypothetical protein MYCTH_2298167 [Myceliophthora thermophila ATCC
           42464]
          Length = 917

 Score =  584 bits (1505), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 320/606 (52%), Positives = 426/606 (70%), Gaps = 15/606 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP++  +FAA+R L+ +A  +P  V  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLSSPRAVTKFAALRILHSIASFRPHVVHVCNPDIELLISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFMSEI+DEFK+ +V+AIR+LCLKFPSKQ  ML FLSG+LRDEGGY+F
Sbjct: 371 EASVDRLMKQISGFMSEITDEFKITIVEAIRTLCLKFPSKQAGMLQFLSGILRDEGGYDF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+PESKE ALAHLCEFIEDCEFTKL+VR+LHLLGVEGPKT  PTKYI
Sbjct: 431 KRAVVESMFDLIKFVPESKEEALAHLCEFIEDCEFTKLAVRILHLLGVEGPKTSQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DP+VK+S++VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPDVKRSVEVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQAE 297
           L+L+ +++E A ++VK+D+ ++L   E+QLV YV++ + S  E PFD+S IP +T+ QA+
Sbjct: 551 LRLMHEEDELATRFVKNDTMFALPYFEQQLVMYVTSDDRSAFETPFDISKIPVVTREQAD 610

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE+   R+  L +T T        G       +    A+ +      Q Y+Q+L QIPE+
Sbjct: 611 AED---RTKKLTAT-TPSLKPPKTGPTKGAPSAAEAAASAS---AVAQKYAQELMQIPEM 663

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
             FG + KSS   VELTE+ETEYVV  VKH+FKE++V Q+ + NTL   +LENV+VV+ P
Sbjct: 664 REFGNVLKSS-PLVELTEAETEYVVGVVKHVFKEHIVLQYEIKNTLPATILENVSVVVTP 722

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPSTX 476
            S+E    + FV  A KL  D P  +YV F++   E    + +FSN LKF  K+ DP+T 
Sbjct: 723 -SEEDEFEDVFVAQAEKLETDVPGKVYVVFRKARGEGAMPVSTFSNVLKFTSKEIDPTT- 780

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSLK 535
                            ++  SDYV PT+ S+F+  W+ VG +G +  ET  L+  KS+ 
Sbjct: 781 NEPEETGYEDEYEVSDFDLTGSDYVIPTFASNFAHIWEQVGAQGEEAEETLQLSGVKSIP 840

Query: 536 DSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           ++   L + L + P+E +  P + + HTL L G  + G +V+A  RM ++  TGVT +++
Sbjct: 841 EATEQLAKALSLQPLEGTDVPVNQTTHTLKLLGKTVNGGRVVANVRMAYSSKTGVTTKIT 900

Query: 596 VRSPSE 601
           VRS  E
Sbjct: 901 VRSEEE 906



>gi|482808732|gb|EOA85617.1| hypothetical protein SETTUDRAFT_169646 [Setosphaeria turcica Et28A]
          Length = 916

 Score =  582 bits (1501), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 318/622 (51%), Positives = 433/622 (69%), Gaps = 26/622 (4%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAA+R L+++A  +P AV+SCN D+E+LIT+ NRS+ATFAITTLLKTGN
Sbjct: 309 LFLTSPRAVTKFAALRILSQMASFKPDAVRSCNQDIESLITNSNRSIATFAITTLLKTGN 368

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQITGFM+EI+DEFKV +V+A+R+L LKF SKQ   L+FLSG+LRDEGGY+F
Sbjct: 369 ESSVDRLMKQITGFMAEITDEFKVTIVEAVRTLALKFKSKQSGFLAFLSGILRDEGGYDF 428

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVEAI DL++F+PE+KE ALA LCEFIEDCEFTKL+VR+L +LG EGP TP PTKYI
Sbjct: 429 KRAVVEAIMDLIRFVPEAKEDALATLCEFIEDCEFTKLAVRILFVLGREGPSTPHPTKYI 488

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAA SALAKFGV  +DPE+KKS+ VLLTRCLDD DDEVRDRA L 
Sbjct: 489 RYIYNRVVLENAIVRAAATSALAKFGVGQKDPEIKKSVHVLLTRCLDDVDDEVRDRAALN 548

Query: 241 LKLID--DNESAEKYVKDDSTYSLAALERQLVQYVSNP--ESSEKPFDLSDIPKITKAQA 296
           L+L+D  D++ A  ++++DS +SL  LE QL  YVS+   ++ E  FD++ IP +++ QA
Sbjct: 549 LRLMDQEDDDMAISFIRNDSMFSLPVLEHQLAMYVSSDSRDTFETAFDITKIPTVSREQA 608

Query: 297 EAENLKPRSFDLASTQTIGTSSSA-----VGSINSNIVSTSRDATPTPGVDQQQVYSQQL 351
           +A +L  ++    +T T+   S+A     VG+  +   +++            Q Y+ +L
Sbjct: 609 DAADLSKKT--EGATPTLKAPSAAKQPSKVGADAAANAASN-----------AQKYAVEL 655

Query: 352 EQIPEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENV 411
           ++IPE+AA G + KSS   VELTESETEYVV+ +KH+FK+++V Q+ + NTL D +L +V
Sbjct: 656 QKIPELAAHGGVLKSS-DVVELTESETEYVVTAIKHIFKDHVVLQYDIKNTLEDTVLLDV 714

Query: 412 TVVMQPESD-EGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVK 469
            +V+ PE D +  L EEFVIPA KL  ++P ++YV+FKR   E ++   SF+N LKF  K
Sbjct: 715 EMVVTPEDDGDVQLEEEFVIPAPKLTTNEPGTVYVSFKRLETESQFIAASFTNVLKFTSK 774

Query: 470 DCDPSTXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALT 529
           + DPST                 + +  +DYV P Y   F + W+    +    ET  L 
Sbjct: 775 EIDPSTNEPEEGDGYPDEYQVEDLYLTGADYVVPAYAGSFDNVWEQSNTDS-ATETLQLA 833

Query: 530 ASKSLKDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTG 589
             KS+ D+   L + L + P+E +    S+S HTL L G  + G KV A  RM F+  TG
Sbjct: 834 NMKSIADATEQLTKTLSLQPLEGTDVALSTSTHTLKLYGKTITGGKVAAMVRMAFSAKTG 893

Query: 590 VTMELSVRSPSEEISRIVIGAV 611
           VTM++ VRS  E ++ +V+G+V
Sbjct: 894 VTMKIDVRSEEEGVAALVVGSV 915



>gi|396469416|ref|XP_003838400.1| similar to coatomer subunit gamma-2 [Leptosphaeria maculans JN3]
 gi|312214968|emb|CBX94921.1| similar to coatomer subunit gamma-2 [Leptosphaeria maculans JN3]
          Length = 915

 Score =  579 bits (1493), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 314/618 (50%), Positives = 425/618 (68%), Gaps = 18/618 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FA++R L+++A  +P AV+SCN D+E+LIT+ NRS+ATFAITTLLKTGN
Sbjct: 308 LFLTSPRAVTKFASLRILSQMASFKPDAVRSCNQDIESLITNSNRSIATFAITTLLKTGN 367

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQITGFM+EI+DEFKV +V+A+R+L LKF +KQ   L+FLSG+LRDEGGYEF
Sbjct: 368 ESSVDRLMKQITGFMAEITDEFKVTIVEAVRTLALKFKAKQSGFLAFLSGILRDEGGYEF 427

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVEAI DL++F+PE+KE ALA LCEFIEDCEFTKL+VR+L +LG EGP TP PTKYI
Sbjct: 428 KRAVVEAIMDLIRFVPEAKEDALATLCEFIEDCEFTKLAVRILFVLGREGPSTPHPTKYI 487

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAA SALAKFGV  +DPE+KKS+ VLLTRCLDD DDEVRDRA L 
Sbjct: 488 RYIYNRVVLENAIVRAAATSALAKFGVGQKDPEIKKSVHVLLTRCLDDVDDEVRDRAALN 547

Query: 241 LKLI--DDNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQA 296
           L+L+  DD+E A K++++DS +SL  LE QL  YVS+      E  FD++ IP +++ QA
Sbjct: 548 LRLMDQDDDEMAIKFIRNDSMFSLPVLEHQLAMYVSSDSRDVFETAFDITKIPTVSREQA 607

Query: 297 EAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPE 356
           +A +L        + +T G + +      +   +              Q Y+ +L++IPE
Sbjct: 608 DAADL--------TKKTEGATPTLKAPSATKAPAKGGADAAASAASNAQKYAVELQKIPE 659

Query: 357 IAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
           +AA G + KSS + VELTESETEYVV+ +KH+FK ++V Q+ + NTL D +L +V +V+ 
Sbjct: 660 LAAHGTVLKSS-EVVELTESETEYVVTAIKHIFKNHVVLQYDIKNTLPDTVLLDVEMVVT 718

Query: 417 PESDEG--TLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDP 473
            E DEG   L EEF+IPA KLP ++P ++YV+FKR   E ++   SF+N LKF  K+ DP
Sbjct: 719 AE-DEGDVQLEEEFIIPAPKLPTNEPGTVYVSFKRLETESQFISASFTNVLKFTSKEIDP 777

Query: 474 STXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKS 533
           ST                 + +  +DYV P Y   F + W+    E +  ET  L   KS
Sbjct: 778 STGEPEDGDGYPDEYQVEDLYLTGADYVVPAYAGSFDNVWEQANGE-KATETLQLENVKS 836

Query: 534 LKDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTME 593
           + D+   + + L + P+E S    S+S HTL L G  + G KV A  RM ++  TGVTM+
Sbjct: 837 ISDATEQVTKTLSLQPLEGSDVALSTSTHTLKLYGKTITGGKVAAMVRMAYSARTGVTMK 896

Query: 594 LSVRSPSEEISRIVIGAV 611
           + VRS  E ++ +++ +V
Sbjct: 897 IDVRSEEEGVAALMVASV 914



>gi|156060825|ref|XP_001596335.1| hypothetical protein SS1G_02555 [Sclerotinia sclerotiorum 1980]
 gi|154699959|gb|EDN99697.1| hypothetical protein SS1G_02555 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 901

 Score =  578 bits (1490), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 310/572 (54%), Positives = 415/572 (72%), Gaps = 17/572 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAAIR L+  A  +P AV  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLTSPRAVTKFAAIRILHNFASFKPQAVHPCNPDIELLISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFM++I+DEFK+ +V+AIR+LCLKFP+KQ  ML+FLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMKQISGFMADITDEFKITIVEAIRTLCLKFPNKQAGMLAFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+PESKE ALAHLCEFIEDCEFTKL+VR+LHLLG+EGPKT  PTKYI
Sbjct: 431 KRAVVESMFDLIKFVPESKEDALAHLCEFIEDCEFTKLAVRILHLLGLEGPKTSQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAAV+ALAKFGV  +DPEVK+S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENAIVRAAAVTALAKFGVGQKDPEVKRSVTVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQAE 297
           L+L+ + +++A++++K+++T++L  LE QLV YV+  + S  + PFD++ +P +TK QA+
Sbjct: 551 LRLMSESDDTADRFIKNENTFALPYLEHQLVMYVTADDKSTFDNPFDIASVPIVTKEQAD 610

Query: 298 AENLKPRSFDLAS-TQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPE 356
           AE    R+  L + T TI    S     + +       A+ T      Q Y+Q+L +IPE
Sbjct: 611 AEE---RTKKLTTVTPTIKAPKSGPTKASPSGAEAVASASATA-----QKYAQELLKIPE 662

Query: 357 IAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
              +G + KSS+  VELTESETEYVV+ VKH+FKE++V Q+ V NTL D +LE V+VV  
Sbjct: 663 FKPYGAVLKSSL-VVELTESETEYVVTVVKHIFKEHIVLQYEVKNTLPDTVLEEVSVVAT 721

Query: 417 PESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPST 475
           P +DE  L E+F+IPATKL  D+P +IYV+FK+T+ E  +   SF+N LKF  K+ DP+T
Sbjct: 722 P-TDEEELEEDFIIPATKLVTDEPGTIYVSFKKTSGEAAFPSSSFTNVLKFTTKEIDPTT 780

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSL 534
                            +E+  SDYV P +  +F+  W+ VG  G +  ET  L+  KS+
Sbjct: 781 -GEPEETGYDDEYQVEDLELTGSDYVVPAFAGNFNHIWEQVGASGEEAEETLQLSGVKSI 839

Query: 535 KDSCTTLIELLGMSPVENSGTPTSSSVHTLML 566
            D+   L + L + P++ +  P +++ HTL L
Sbjct: 840 ADATEQLTKTLSLQPLDGTDVPINTTTHTLKL 871



>gi|258568144|ref|XP_002584816.1| hypothetical protein UREG_05505 [Uncinocarpus reesii 1704]
 gi|237906262|gb|EEP80663.1| hypothetical protein UREG_05505 [Uncinocarpus reesii 1704]
          Length = 917

 Score =  577 bits (1487), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 313/616 (50%), Positives = 424/616 (68%), Gaps = 14/616 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP++T RFAAIR L+  A  +P  V +CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 310 LFLSSPRTTSRFAAIRILHSFASFKPHVVNTCNQDIEALISNPNRSIATFAITTLLKTGN 369

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLM QI+GFM++I+DEFK+ VV+AIR+LCLKFP+KQ  ML+FLSG+LRDEGGYEF
Sbjct: 370 EASVDRLMAQISGFMADITDEFKITVVEAIRTLCLKFPNKQAGMLTFLSGILRDEGGYEF 429

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KR+VVE++FDL+KF+P SKE ALAHLCEFIEDCEFTKL+VR+LHLLG+EGPKT  PTKYI
Sbjct: 430 KRSVVESMFDLIKFVPGSKEDALAHLCEFIEDCEFTKLAVRILHLLGIEGPKTSHPTKYI 489

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+ +RAAAV+ALAKFGV  +DPE+++S+ VLL RCLDD DDEVRDRA L 
Sbjct: 490 RYIYNRVVLENATIRAAAVTALAKFGVGQKDPELRRSVIVLLRRCLDDVDDEVRDRAALN 549

Query: 241 LKLIDD-NESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQAE 297
           L+LI++ +E AE+++K+++ ++LA  E QLV YV+  + +     FD+S +P ++  QA 
Sbjct: 550 LRLIENQDEMAERFIKNENMFALATFEHQLVMYVTATDKATFAAAFDMSQVPIVSHEQAL 609

Query: 298 AENLKPRSFDLAS-TQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPE 356
           AE    R+  L S T TI   S        N        +        + YS+QL +IPE
Sbjct: 610 AEE---RTKKLTSATPTIKAPSIGADRAKQN----GAADSAKAAAAATEKYSEQLMEIPE 662

Query: 357 IAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
           + A+GPL KSS  PVELTE ETEYVV+ +KH+FK+++V Q+ +TNTL D +LE V+V   
Sbjct: 663 LKAYGPLLKSS-PPVELTERETEYVVTVIKHIFKKHVVLQYDITNTLPDTVLEGVSVDAT 721

Query: 417 PESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
           P  +E  L  EF +P  KL  ++P  +YVAFK+ +   Y + SF+N L+F  K+ DP+T 
Sbjct: 722 PSEEEEVLEYEFDVPTPKLATNEPGVVYVAFKKLDESSYPITSFTNILRFTSKEIDPTT- 780

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSLK 535
                           +++  SDY+ P + + F S WD +   G +  ET  L+  K ++
Sbjct: 781 GEPEETGYEDEYQVEDLDLTGSDYIIPAFSASFDSIWDDLAANGEESSETLQLSNMKGIQ 840

Query: 536 DSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           D+   LI +L + P+E      ++S HTL L G  + G KV A  R+ +   TGVT +++
Sbjct: 841 DATEQLIAVLSLQPLEGCEVVLNNSTHTLKLYGNSITGGKVAALVRLAYTAKTGVTTKVT 900

Query: 596 VRSPSEEISRIVIGAV 611
           VRS  E +S +V+ +V
Sbjct: 901 VRSEEEGVSSLVVASV 916



>gi|512196368|gb|EPE25205.1| ARM repeat-containing protein [Glarea lozoyensis ATCC 20868]
          Length = 917

 Score =  577 bits (1487), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 315/616 (51%), Positives = 432/616 (70%), Gaps = 15/616 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAAIR L+ LA   P AV+ C  + E LI + NRS+AT+AITTLL+ G 
Sbjct: 311 LFLTSPRAVTKFAAIRILHNLASFNPQAVRQCLSEFELLILNANRSIATYAITTLLRAGT 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E  VDRLMK I GFM++I+DEFK+ +V+AIR++CLKFPSKQ  ML+FLSG+LRDEGGYEF
Sbjct: 371 ENMVDRLMKVIQGFMADITDEFKITIVEAIRTMCLKFPSKQAGMLAFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+P+SKE ALAHLCEFIEDCEF KL+VR+LHLLG+EGPKT  PTKYI
Sbjct: 431 KRAVVESMFDLIKFVPDSKEDALAHLCEFIEDCEFNKLAVRILHLLGIEGPKTSQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LE +IVRAAAV+AL KFGV  +DPEVK+S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLEIAIVRAAAVTALGKFGVGQKDPEVKRSVTVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLIDD-NESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQAE 297
           L+L+++ +E A+++VK+++T++L   E QLV YV+  + S  + PFD++ IP +TK QA+
Sbjct: 551 LRLMNESDEMADRFVKNENTFALPYFEHQLVMYVTAEDKSTFDSPFDIATIPVVTKEQAD 610

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE+   R+  L +T T    +   G     + S    A  +      Q Y ++L QIPE+
Sbjct: 611 AED---RTKKL-TTVTPAAKAPKTGPSKDPVSSAEASANAS---AAAQKYQEELLQIPEM 663

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
            ++G + KSS   VELTE+ETEYVV+ +KH+FKE++V Q+ V NTL D +LE+V+VV  P
Sbjct: 664 KSYGSVLKSS-PVVELTETETEYVVNVIKHIFKEHIVLQYEVKNTLPDTVLEDVSVVATP 722

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKR-TNPEEYTLGSFSNTLKFLVKDCDPSTX 476
            SDE  L E+F+IP +KL  D+P +IYV+FK+ T    +   SF+N LKF  K+ DP+T 
Sbjct: 723 -SDEEELEEDFIIPVSKLATDEPGTIYVSFKKLTGEASFPASSFTNVLKFTSKEIDPTT- 780

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSLK 535
                           +E+  SDYV P + +DFS+ W+ VG  G +  ET  L+  KS+ 
Sbjct: 781 SEPEETGYDDEYQVEDLELNGSDYVVPAFAADFSTIWEEVGTAGEEAQETLQLSGVKSIA 840

Query: 536 DSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           D+   L + L + P++ +  P +++ HTL L G  + G KV+A  RM ++  +GVT ++ 
Sbjct: 841 DATEQLTKTLSLQPLDGTDVPVNTTTHTLKLFGKTVTGGKVVANIRMAYSTKSGVTSKIV 900

Query: 596 VRSPSEEISRIVIGAV 611
           VRS  E ++ +VIG+V
Sbjct: 901 VRSEEEGVAELVIGSV 916



>gi|451852072|gb|EMD65367.1| hypothetical protein COCSADRAFT_304729 [Bipolaris sorokiniana
           ND90Pr]
          Length = 916

 Score =  577 bits (1486), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 319/622 (51%), Positives = 431/622 (69%), Gaps = 26/622 (4%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAA+R L+++A  +P AV+SCN D+E+LIT+ NRS+ATFAITTLLKTGN
Sbjct: 309 LFLTSPRAVTKFAALRILSQMASFKPDAVRSCNQDIESLITNSNRSIATFAITTLLKTGN 368

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQITGFM+EI+DEFKV +V+A+R+L LKF SKQ   L+FLSG+LRDEGGYEF
Sbjct: 369 ESSVDRLMKQITGFMAEITDEFKVTIVEAVRTLALKFKSKQSGFLAFLSGILRDEGGYEF 428

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVEAI DL++F+PE+KE ALA LCEFIEDCEFTKL+VR+L +LG EGP TP PTKYI
Sbjct: 429 KRAVVEAIMDLIRFVPEAKEDALATLCEFIEDCEFTKLAVRILFVLGREGPSTPHPTKYI 488

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAA SALAKFGV  +DPE+KKS+ VLLTRCLDD DDEVRDRA L 
Sbjct: 489 RYIYNRVVLENAIVRAAATSALAKFGVGQKDPEIKKSVHVLLTRCLDDVDDEVRDRAALN 548

Query: 241 LKLID--DNESAEKYVKDDSTYSLAALERQLVQYVSNP--ESSEKPFDLSDIPKITKAQA 296
           L+L+D  D++ A  ++++DS +SL  LE QL  YVS+   ++ E  FD++ IP +++ QA
Sbjct: 549 LRLMDQEDDDMAISFIRNDSMFSLPVLEHQLAMYVSSDSRDTFETAFDITKIPTVSREQA 608

Query: 297 EAENLKPRSFDLASTQTIGTSSSA-----VGSINSNIVSTSRDATPTPGVDQQQVYSQQL 351
           +A +L  ++    +T T+   S+A     VG+  +   + +            Q Y+ +L
Sbjct: 609 DAADLTKKT--EGATPTLKAPSAAKQPSKVGADAAANAANN-----------AQKYAAEL 655

Query: 352 EQIPEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENV 411
           ++IPE+AA G + KSS   VELTESETEYVV+ +KH+FK+++V Q+ + NTL D +L +V
Sbjct: 656 QKIPELAAHGGVLKSS-DVVELTESETEYVVTAIKHIFKDHVVIQYDIKNTLEDTVLLDV 714

Query: 412 TVVMQPESD-EGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVK 469
            +V+ PE D +  L EEFVIPA KL  ++P ++YV+FKR   E ++   SF+N LKF  K
Sbjct: 715 EMVVTPEDDGDVQLEEEFVIPAPKLLTNEPGTVYVSFKRLETESQFIAASFTNVLKFTSK 774

Query: 470 DCDPSTXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALT 529
           + DPST                 + +  +DYV P Y   F + W+    +    ET  L 
Sbjct: 775 EIDPSTNEPEEGDGYPDEYSVEDLYLTGADYVVPAYAGSFDNVWEQSNND-TATETLQLG 833

Query: 530 ASKSLKDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTG 589
             KS+ D+   L   L + P+E +    S+S HTL L G  + G KV A  RM F+  TG
Sbjct: 834 NMKSIADATEQLTRTLSLQPLEGTDVALSTSTHTLKLYGKTITGGKVAAMVRMAFSAKTG 893

Query: 590 VTMELSVRSPSEEISRIVIGAV 611
           VTM++ VRS  E ++ +V+G+V
Sbjct: 894 VTMKIDVRSEEEGVAALVVGSV 915



>gi|170085681|ref|XP_001874064.1| coatomer protein [Laccaria bicolor S238N-H82]
 gi|164651616|gb|EDR15856.1| coatomer protein [Laccaria bicolor S238N-H82]
          Length = 932

 Score =  575 bits (1482), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 306/558 (54%), Positives = 400/558 (71%), Gaps = 19/558 (3%)

Query: 57  KTGNEASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEG 116
           +TGNEASVDRL+KQITGFM+EISDEFKVI+VDAIRSLCLKFP+K V MLSFLSGVLRDEG
Sbjct: 389 RTGNEASVDRLIKQITGFMTEISDEFKVIIVDAIRSLCLKFPTKHVSMLSFLSGVLRDEG 448

Query: 117 GYEFKRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTP 176
           GY+FKRAVVEA+FD++KFI E KE AL+HLCEFIEDCEFTKLSVR+LHLLGVEGPK+P P
Sbjct: 449 GYDFKRAVVEAMFDMIKFIGECKEQALSHLCEFIEDCEFTKLSVRILHLLGVEGPKSPQP 508

Query: 177 TKYIRYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDR 236
            KYIR+IYNRV+LEN+ VRAAAV++LAKFGV++ +  +K+SI VLL RCLDD DDEVRDR
Sbjct: 509 AKYIRFIYNRVVLENATVRAAAVTSLAKFGVNSPEASLKRSITVLLNRCLDDVDDEVRDR 568

Query: 237 AILYLKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQA 296
           A  +LK+  +   A+ YVK++S +SLAALE +LV YV +P S+ +  D+S + KI++AQA
Sbjct: 569 AAFFLKVFKEKPLADTYVKEESVFSLAALEAKLVAYVKDPSSAGQALDVSSVQKISRAQA 628

Query: 297 EAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTP-GVDQQQVYSQQLEQIP 355
             E  +P S D     TIG     V + N  +     DA   P   ++Q  Y QQL ++P
Sbjct: 629 AQEAARPSSLD-----TIG-----VPAPNKAV-----DAPVAPSAAEKQSAYLQQLSEVP 673

Query: 356 EIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVM 415
           E  ++GP+  SS+ P +LTE+ETEY V+CVKH+FKE++VFQ+ V+NTL D +LE V+V+M
Sbjct: 674 EFGSYGPVINSSLTPAQLTENETEYQVTCVKHVFKEHIVFQYNVSNTLPDTVLEQVSVIM 733

Query: 416 QPESDEGTLVEEFVIPATKL-PYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPS 474
           QP+SD+  L E+F+IP   L   + P +IYV+F R +P+++ LGSF  TLKF+ K+ DP+
Sbjct: 734 QPQSDDNALSEDFIIPLPALTAANSPGTIYVSFTRNSPDQFALGSFQCTLKFISKELDPA 793

Query: 475 TXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSL 534
           T                       DY+ P+Y S F + WD +       ETFAL+A +SL
Sbjct: 794 TGEPEEEGYEDEYQLEEVELSAGGDYIIPSY-STFGAEWDRLRSAPSATETFALSAMESL 852

Query: 535 KDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFL-GGIKVLAKNRMTFAPSTGVTME 593
           K +C ++IE+L M P+  S  P+S+SVHTL LSG    GG KVL + RMTF+   GVT+E
Sbjct: 853 KAACDSIIEVLNMEPLGGSEVPSSTSVHTLQLSGLVTGGGGKVLVRCRMTFSRGQGVTLE 912

Query: 594 LSVRSPSEEISRIVIGAV 611
           L VR+  +E+  +V+ AV
Sbjct: 913 LGVRAEKQEVCNLVLTAV 930



>gi|225560789|gb|EEH09070.1| coatomer subunit gamma-1 [Ajellomyces capsulatus G186AR]
          Length = 897

 Score =  575 bits (1481), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 303/607 (49%), Positives = 405/607 (66%), Gaps = 36/607 (5%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP+   +FAAIRTL+ LA  +P  V  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 310 LFLSSPRPITKFAAIRTLHSLASFKPNVVNPCNQDIEALISNSNRSIATFAITTLLKTGN 369

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLM QI+GFM++ +DEFK+ +V+AIR+LCLKFP KQ  ML+FLSG+LRDEGGYEF
Sbjct: 370 EASVDRLMTQISGFMADTTDEFKITIVEAIRTLCLKFPHKQAGMLAFLSGILRDEGGYEF 429

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KR+VVE++FDL+KF+P SKE ALAHLCEFIEDCEFTKL+VR+LHLLGVEGPKT  PTKYI
Sbjct: 430 KRSVVESMFDLIKFVPGSKEDALAHLCEFIEDCEFTKLAVRILHLLGVEGPKTSQPTKYI 489

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+++RAAAV+ALAKFGV  +DPE+K+S+ VLL RCLDD DDEVRDRA L 
Sbjct: 490 RYIYNRVVLENAVIRAAAVTALAKFGVGQKDPELKRSVNVLLARCLDDTDDEVRDRAALN 549

Query: 241 LKLI-DDNESAEKYVKDDSTYSLAALERQLVQYV--SNPESSEKPFDLSDIPKITKAQAE 297
           L+L+ +++E AE+++K DS +SL+  E QLV YV  ++ E+    FDL+ IP +++ QA 
Sbjct: 550 LRLMKEEDELAERFIKTDSMFSLSTFEHQLVMYVTATDKETFAAAFDLNTIPVVSQEQAL 609

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSIN-SNIVSTSRDATPTPGVDQQQVYSQQLEQIPE 356
           AE    R+  L    T  T +    S+  S   ST+            Q Y++QL QIPE
Sbjct: 610 AEE---RTKKL----TTATPTLKAPSMTPSKAKSTAGVDGVAAAAASTQKYAEQLVQIPE 662

Query: 357 IAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
           + A+G L KSS  PVELTESETEYVVS VKH+FKE++V Q+ + NT  + L         
Sbjct: 663 LKAYGTLLKSST-PVELTESETEYVVSAVKHIFKEHIVLQYDIKNTRPNTL--------- 712

Query: 417 PESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEE-YTLGSFSNTLKFLVKDCDPST 475
                        +PA KL  ++P  +YVAFK+   E  + + SF+N LKF  K+ DP+T
Sbjct: 713 ------------TVPAPKLMTNEPGIVYVAFKKLGGEHNFPVTSFTNNLKFTSKEIDPTT 760

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSL 534
                            ++++ SDYV P +   F   W+  G  G +  ET  L+  K +
Sbjct: 761 -GDPEETGYEDEYQVEDLDLIGSDYVIPAFAGSFDHVWEQTGANGEEASETLQLSNVKGI 819

Query: 535 KDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
           +D+   L+  L + P+E +    +++ H L L G  + G +V A  RM ++  +GVT ++
Sbjct: 820 EDATEQLVATLSLQPLEGTDVVLNNTTHALKLYGKTVSGGRVAALVRMAYSAKSGVTTKV 879

Query: 595 SVRSPSE 601
           +VR+  E
Sbjct: 880 TVRAEEE 886



>gi|156382581|ref|XP_001632631.1| predicted protein [Nematostella vectensis]
 gi|156219690|gb|EDO40568.1| predicted protein [Nematostella vectensis]
          Length = 881

 Score =  573 bits (1478), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 307/614 (50%), Positives = 400/614 (65%), Gaps = 30/614 (4%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP+ TLRFAA+RTLNK+AMTQP +V +CNLD+ENLITD NRS+AT AITTLLKTGN
Sbjct: 294 LFLSSPRPTLRFAAVRTLNKVAMTQPMSVTTCNLDLENLITDVNRSIATLAITTLLKTGN 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SV+RLMKQI+ FMSEISDEFK++VV+AIRSLCLKFP K +VM++FLS +LRDEGG+E+
Sbjct: 354 ESSVERLMKQISSFMSEISDEFKIVVVEAIRSLCLKFPRKHLVMMNFLSSMLRDEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K+A+V+ I  +++   E+KE  L+HLCEFIEDCE T L+ R+LHLLG EGP++  P +YI
Sbjct: 414 KKAIVDTIITIIEENGEAKETGLSHLCEFIEDCEHTVLATRILHLLGREGPRSQQPGRYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRVILEN+ VRAAAV++LAKFG   E   +  SI+VLL+RCL D DDEVRDRA  Y
Sbjct: 474 RYIYNRVILENAAVRAAAVTSLAKFGAHCES--LLPSIEVLLSRCLLDTDDEVRDRATFY 531

Query: 241 LKLID--DNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L ++   D   +  Y+ +    S+  LER L  YV +   S  PFDL  +P  T    E 
Sbjct: 532 LNVLSQKDKSLSSAYILNGLQVSIIGLERALHAYVKDTNHS-APFDLKTVPLATTPMQE- 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
                        Q I    +A+         +++ A P   V +Q VY+ QL  IP  A
Sbjct: 590 -------------QVIKAGKTAI----ETPAPSTKAAAPIAAV-RQDVYAGQLAAIPAFA 631

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLF+SS KP ELTESETEYVV+CVKH+F +++VFQF  TNTLNDQ+LENV V M P 
Sbjct: 632 KLGPLFRSSPKPAELTESETEYVVNCVKHVFNDHIVFQFDCTNTLNDQVLENVKVEMDPS 691

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXX 478
             E  +V +   P+  LPY+QP + Y   K          +FSNTLKFLVKDCDPST   
Sbjct: 692 DGEFEVVCQIECPS--LPYNQPGTTYTLIKLPEDHSSVTCTFSNTLKFLVKDCDPSTGEA 749

Query: 479 XXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSC 538
                           +V        +  +F ++W+ +G+E ++ +T+ALT+  SL+++ 
Sbjct: 750 DEDGYEDEYVLEDVDVVVADHVQ-QVHRPNFLASWEEIGDECELEDTYALTSMSSLEEAV 808

Query: 539 TTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSVR 597
             +IE LGM P E S   P   S H L+L+G + GG  VL K R+ F    GVTM ++VR
Sbjct: 809 KQIIEYLGMQPCERSDRVPEGKSSHALLLAGVYRGGHDVLVKTRLAF--DQGVTMNITVR 866

Query: 598 SPSEEISRIVIGAV 611
           S    +S +++ AV
Sbjct: 867 SRDSTVSEVILSAV 880



>gi|451997606|gb|EMD90071.1| hypothetical protein COCHEDRAFT_1178391 [Bipolaris maydis C5]
 gi|477592645|gb|ENI09715.1| hypothetical protein COCC4DRAFT_184970 [Bipolaris maydis ATCC
           48331]
          Length = 917

 Score =  573 bits (1477), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 318/618 (51%), Positives = 429/618 (69%), Gaps = 17/618 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAA+R L+++A  +P AV+SCN D+E+LIT+ NRS+ATFAITTLLKTGN
Sbjct: 309 LFLTSPRAVTKFAALRILSQMASFKPDAVRSCNQDIESLITNSNRSIATFAITTLLKTGN 368

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQITGFM+EI+DEFKV +V+A+R+L LKF SKQ   L+FLSG+LRDEGGYEF
Sbjct: 369 ESSVDRLMKQITGFMAEITDEFKVTIVEAVRTLALKFKSKQSGFLAFLSGILRDEGGYEF 428

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVEAI DL++F+PE+KE ALA LCEFIEDCEFTKL+VR+L +LG EGP TP PTKYI
Sbjct: 429 KRAVVEAIMDLIRFVPEAKEDALATLCEFIEDCEFTKLAVRILFVLGREGPSTPHPTKYI 488

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+IVRAAA SALAKFGV  +DPE+KKS+ VLLTRCLDD DDEVRDRA L 
Sbjct: 489 RYIYNRVVLENAIVRAAATSALAKFGVGQKDPEIKKSVHVLLTRCLDDVDDEVRDRAALN 548

Query: 241 LKLID--DNESAEKYVKDDSTYSLAALERQLVQYVSNP--ESSEKPFDLSDIPKITKAQA 296
           L+L+D  D++ A  ++++DS +SL  LE QL  YVS+   ++ E  FD++ IP +++ QA
Sbjct: 549 LRLMDQEDDDMAISFIRNDSMFSLPVLEHQLAMYVSSDSRDTFETAFDITKIPTVSREQA 608

Query: 297 EAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPE 356
           +A +L  ++    +T T+   S+A         S +         +  Q Y+ +L++IPE
Sbjct: 609 DAADLTKKT--EGATPTLKAPSAAKQP------SKAGADAAANAANNAQKYAAELQKIPE 660

Query: 357 IAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
           +AA G + KSS   VELTESETEYVV+ +KH+FK+++V Q+ + NTL D +L +V +V+ 
Sbjct: 661 LAAHGGVLKSS-DVVELTESETEYVVTAIKHIFKDHVVIQYDIKNTLEDTVLLDVEMVVT 719

Query: 417 PESD-EGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPS 474
           PE D +  L EEFVIPA KL  ++P ++YV+FKR   E ++   SF+N LKF  K+ DPS
Sbjct: 720 PEDDGDVQLEEEFVIPAPKLSTNEPGTVYVSFKRLETESQFIAASFTNVLKFTSKEIDPS 779

Query: 475 TXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSL 534
           T                 + +  +DYV P Y   F + W+    +    ET  L   KS+
Sbjct: 780 TNEPEEGDGYPDEYSVEDLYLTGADYVVPAYAGSFDNVWEQSNND-TATETLQLGNMKSI 838

Query: 535 -KDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTME 593
             D+   L + L + P+E +    S+S HTL L G  + G KV A  RM F+  TGVTM+
Sbjct: 839 AADATEQLTKTLSLQPLEGTDVALSTSTHTLKLYGKTITGGKVAAMVRMAFSAKTGVTMK 898

Query: 594 LSVRSPSEEISRIVIGAV 611
           + VRS  E ++ +V+G+V
Sbjct: 899 IDVRSEEEGVAALVVGSV 916



>gi|440637226|gb|ELR07145.1| hypothetical protein GMDG_02413 [Geomyces destructans 20631-21]
          Length = 917

 Score =  570 bits (1468), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 322/616 (52%), Positives = 434/616 (70%), Gaps = 15/616 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FA IR L+  A  +P AV  CN D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 311 LFLNSPRAVTKFATIRILHNFATFKPQAVHPCNPDIELLISNSNRSIATFAITTLLKTGN 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFMSEI+DEFK+ +V+AIR+LCLKFP+KQ  ML+FLSG+LRDEGGYEF
Sbjct: 371 EASVDRLMKQISGFMSEITDEFKITIVEAIRTLCLKFPNKQAGMLAFLSGILRDEGGYEF 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+PESKE ALAHLCEFIEDCEFTKL+VR+LHLLG+EGPKT  PTKYI
Sbjct: 431 KRAVVESMFDLIKFVPESKEDALAHLCEFIEDCEFTKLAVRILHLLGLEGPKTSQPTKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN++VRAAAV+ALAKFGV  +DPEVK+S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 491 RYIYNRVVLENAVVRAAAVTALAKFGVGQKDPEVKRSVTVLLTRCLDDVDDEVRDRAALN 550

Query: 241 LKLIDD-NESAEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQAE 297
           L+L+ + +E A++++K+++ +SL   E QLV YV+  + S  + PFD+S IP +TK QA+
Sbjct: 551 LRLMTEPDEMADRFIKNENMFSLPYFEHQLVMYVTAEDKSVFDNPFDVSTIPVVTKEQAD 610

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE+   R+  L +T T    +   G   +   S    A+ T   +  Q YS+QL  IPE+
Sbjct: 611 AED---RTKKL-TTATPTLKAPKAGPTKTAPSSAEALASAT---EAAQKYSEQLLAIPEM 663

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
             +G L KSS   VELTESETEYVV  +KH+FK+++V Q+ + NTL D +LE V+V+  P
Sbjct: 664 KGYGALLKSS-PVVELTESETEYVVGVIKHIFKDHIVLQYEIKNTLPDTVLEEVSVLATP 722

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEE-YTLGSFSNTLKFLVKDCDPSTX 476
            SDE  L E+F+IPA KL  D+P ++YV+FK+   +  +   SF+N LKF  K+ DP T 
Sbjct: 723 -SDEDELEEDFIIPAPKLATDEPGTVYVSFKKVARDSAFVASSFTNILKFTSKEIDP-TN 780

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSV-GEEGQVVETFALTASKSLK 535
                           +E+  +DYV P +  +FS  W+ V     +  ET  L+  KS+ 
Sbjct: 781 GEPEETGYDDEYQVEDLELTGTDYVTPAFAGNFSHIWEQVGAAGEEEEETLQLSGVKSIA 840

Query: 536 DSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           D+   L   L + P++ +  P +++ HTL L G  + G +V+A  RM ++  +GVT +L+
Sbjct: 841 DATEQLTRTLSLQPLDGTDVPVNTTTHTLKLFGKTVTGGRVVANIRMAYSTKSGVTSKLT 900

Query: 596 VRSPSEEISRIVIGAV 611
           VR+  E ++ +VIG+V
Sbjct: 901 VRAEEEGVAALVIGSV 916



>gi|494831148|gb|EON67640.1| hypothetical protein W97_06783 [Coniosporium apollinis CBS 100218]
          Length = 905

 Score =  568 bits (1465), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 303/608 (49%), Positives = 404/608 (66%), Gaps = 26/608 (4%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAAIR L+  A  +P AV++CN D+E LI++ NRS+AT A++TLLKTGN
Sbjct: 306 LFLTSPRAVTKFAAIRILHDFASFKPDAVRTCNPDIELLISNSNRSIATLAVSTLLKTGN 365

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI  FMSEISDEFKV ++DA+R+LCLKFPSKQ  ML FLS VLRDEGG+E 
Sbjct: 366 ESSVDRLMKQIQSFMSEISDEFKVTIIDAVRTLCLKFPSKQAGMLQFLSSVLRDEGGFEM 425

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KR+VVEAIFDL+KF+PESKE AL HL EFIEDCEFTKL+VRVLH LG EGPKT       
Sbjct: 426 KRSVVEAIFDLIKFVPESKEDALGHLAEFIEDCEFTKLAVRVLHCLGTEGPKT------- 478

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
            YIYNR+ LEN+IVRAAAV+ALAKFGV  +D E+K+S+ VLL+RC+DD DDEVRDRA L 
Sbjct: 479 -YIYNRITLENAIVRAAAVTALAKFGVGQKDEELKRSVHVLLSRCMDDTDDEVRDRAALN 537

Query: 241 LKLID-DNESAEKYVKDDSTYSLAALERQLVQYV--SNPESSEKPFDLSDIPKITKAQAE 297
           L+L+D D +   +++++DS +SL  LE+QLV YV  S+ ++   PFDLS IP +T+ Q+ 
Sbjct: 538 LRLMDSDEDMGIRFIRNDSMFSLPVLEQQLVLYVTSSDKQNFSAPFDLSAIPIVTREQSL 597

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE       D     T  T +    S          ++         Q Y+++L ++PE+
Sbjct: 598 AE-------DRTKKLTTATPTLKAPSTGPKPDHRGGESAAQSAAAATQKYAEELAKVPEL 650

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
           A++G + KSS   V+LTESETEYVVS +KH+F+ ++V QF V NTL   +L +V+VV  P
Sbjct: 651 ASYGAVLKSS-PVVDLTESETEYVVSAIKHIFRSHIVLQFNVKNTLPATVLTDVSVVCTP 709

Query: 418 E-SDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEE-YTLGSFSNTLKFLVKDCDPST 475
           E ++E  L E+F+IPA  L  D+P  +YV+F+R   E+ YT  +F+N L+F  K+ DPST
Sbjct: 710 EDAEEAGLEEDFIIPAPALKTDEPGVVYVSFRRVGGEKAYTAATFNNVLRFTSKEIDPST 769

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSV--GEEGQVVETFALTASKS 533
                            +E+  +DYV P Y   F + WD    GEE Q  ET  L   KS
Sbjct: 770 -GEPEEQGYEDEYAVEDLELGGADYVIPAYAGSFENVWDQAQGGEEAQ--ETLVLEGVKS 826

Query: 534 LKDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTME 593
           L D+  TLI+ L + P+E S    S + H+L L G  L G +V  + R+ F+  +G TM+
Sbjct: 827 LADATETLIKQLSLQPLEGSDVVLSPTTHSLKLYGKTLTGGRVAVRVRLAFSAKSGATMK 886

Query: 594 LSVRSPSE 601
           +  R+  E
Sbjct: 887 IEARAEEE 894



>gi|119194875|ref|XP_001248041.1| hypothetical protein CIMG_01812 [Coccidioides immitis RS]
 gi|392862715|gb|EAS36619.2| coatomer subunit gamma [Coccidioides immitis RS]
          Length = 920

 Score =  568 bits (1463), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 320/617 (51%), Positives = 426/617 (69%), Gaps = 15/617 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP++T RFAAIR L+  A  +P  V +CN D+E+LI++ NRS+ATFAITTLLKTGN
Sbjct: 312 LFLSSPRTTSRFAAIRILHSFASFKPHIVNTCNQDIESLISNPNRSIATFAITTLLKTGN 371

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLM QI+GFM++I+DEFK+ VV+AIR+LCLKFP+KQ  ML+FLSG+LRDEGGYEF
Sbjct: 372 EASVDRLMSQISGFMADITDEFKITVVEAIRTLCLKFPNKQAGMLTFLSGILRDEGGYEF 431

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KR+VVE++FDL+KF+P SKE ALAHLCEFIEDCEFTKL+VR+LHLLG+EGPKT  PTKYI
Sbjct: 432 KRSVVESMFDLIKFVPGSKEDALAHLCEFIEDCEFTKLAVRILHLLGIEGPKTSHPTKYI 491

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+ VRAAAV+ALAKFGV  +DPE+++S+ VLL RCLDD DDEVRDRA L 
Sbjct: 492 RYIYNRVVLENAAVRAAAVTALAKFGVGQKDPELRRSVYVLLRRCLDDVDDEVRDRAALN 551

Query: 241 LKLIDDNES-AEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQAE 297
           L+LI   +S AE+++K+++ ++LA  E QLV YV+  +       FD+S +P ++  QA 
Sbjct: 552 LRLIQSEDSMAERFIKNENMFALATFEHQLVMYVTATDKGTFSTAFDMSKVPVVSHEQAL 611

Query: 298 AENLKPRSFDLAS-TQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPE 356
           AE    R+  L S T TI   S+       N        +        + YS+QL QIPE
Sbjct: 612 AEE---RTKKLTSATPTIRAPSTGPDRAKQN----GAADSAKAAAAATEKYSEQLMQIPE 664

Query: 357 IAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
           + A+G L KSS  PVELTE ETEYVV+ VKH+FKE++V Q+ + NTL D +LE+V+V+  
Sbjct: 665 LKAYGALLKSS-PPVELTERETEYVVTAVKHIFKEHIVLQYDIMNTLPDTVLEDVSVIAT 723

Query: 417 PESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPST 475
           P  DE  L E+F++P  KL  ++P  +YVAFK+ + +  + + SF+N LKF  K+ DP+T
Sbjct: 724 PSEDEEVLEEDFIVPTPKLMTNEPGIVYVAFKKVDDDTSFAVTSFTNVLKFTSKEIDPTT 783

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSL 534
                            +++V SDYV P +   F S WD +  +G +  ET  L+  K +
Sbjct: 784 -GEPEETGYEDEYQVEDLDLVGSDYVIPAFSGSFDSIWDELATDGEESSETLQLSNMKGI 842

Query: 535 KDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
           +D+   LI  L + P+E      S+S HTL L G  + G KV A  R+ +   TGVT ++
Sbjct: 843 QDATEQLIAALCLQPLEGCEVVLSNSTHTLKLYGNSITGGKVAALVRLAYTSRTGVTTKV 902

Query: 595 SVRSPSEEISRIVIGAV 611
           +VRS  E +S IV+ +V
Sbjct: 903 TVRSEEEGVSSIVVASV 919



>gi|303310891|ref|XP_003065457.1| conserved hypothetical protein [Coccidioides posadasii C735 delta
           SOWgp]
 gi|240105119|gb|EER23312.1| conserved hypothetical protein [Coccidioides posadasii C735 delta
           SOWgp]
 gi|320034655|gb|EFW16598.1| coatomer subunit gamma [Coccidioides posadasii str. Silveira]
          Length = 920

 Score =  566 bits (1459), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 320/617 (51%), Positives = 426/617 (69%), Gaps = 15/617 (2%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP++T RFAAIR L+  A  +P  V +CN D+E+LI++ NRS+ATFAITTLLKTGN
Sbjct: 312 LFLSSPRTTSRFAAIRILHSFASFKPHIVNTCNQDIESLISNPNRSIATFAITTLLKTGN 371

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLM QI+GFM++I+DEFK+ VV+AIR+LCLKFP+KQ  ML+FLSG+LRDEGGYEF
Sbjct: 372 EASVDRLMSQISGFMADITDEFKITVVEAIRTLCLKFPNKQAGMLTFLSGILRDEGGYEF 431

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KR+VVE++FDL+KF+P SKE ALAHLCEFIEDCEFTKL+VR+LHLLG+EGPKT  PTKYI
Sbjct: 432 KRSVVESMFDLIKFVPGSKEDALAHLCEFIEDCEFTKLAVRILHLLGIEGPKTSHPTKYI 491

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN+ VRAAAV+ALAKFGV  +DPE+++S+ VLL RCLDD DDEVRDRA L 
Sbjct: 492 RYIYNRVVLENAAVRAAAVTALAKFGVGQKDPELRRSVYVLLRRCLDDVDDEVRDRAALN 551

Query: 241 LKLIDDNES-AEKYVKDDSTYSLAALERQLVQYVSNPESS--EKPFDLSDIPKITKAQAE 297
           L+LI   +S AE+++K+++ ++LA  E QLV YV+  +       FD+S +P +++ QA 
Sbjct: 552 LRLIQSEDSMAERFIKNENMFALATFEHQLVMYVTATDKGTFSTAFDMSKVPVVSQEQAL 611

Query: 298 AENLKPRSFDLAS-TQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPE 356
           AE    R+  L S T TI   S+       N        +        + YS+QL QIPE
Sbjct: 612 AEE---RTKKLTSATPTIRAPSTGPDRAKQN----GAADSAKAAAAATEKYSEQLMQIPE 664

Query: 357 IAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQ 416
           + A+G L KSS  PVELTE ETEYVV+ VKH+FKE++V Q+ + NTL D +LE+V+VV  
Sbjct: 665 LKAYGALLKSS-PPVELTERETEYVVTAVKHIFKEHIVLQYDIMNTLPDTVLEDVSVVAT 723

Query: 417 PESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFLVKDCDPST 475
           P  DE  L E+F++P  KL  ++P  +YVAFK+ + +  +   SF+N LKF  K+ DP+T
Sbjct: 724 PSEDEEVLEEDFIVPTPKLMTNEPGIVYVAFKKVDDDTSFAATSFTNVLKFTSKEIDPTT 783

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFALTASKSL 534
                            +++V SDYV P +   F S WD +  +G +  ET  L+  K +
Sbjct: 784 -GEPEETGYEDEYQVEDLDLVGSDYVIPAFSGSFDSIWDELATDGEESSETLQLSNMKGI 842

Query: 535 KDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
           +D+   LI  L + P+E      S+S HTL L G  + G KV A  R+ +   TGVT ++
Sbjct: 843 QDATEQLIAALCLQPLEGCEVVLSNSTHTLKLYGNSITGGKVAALVRLAYTSRTGVTTKV 902

Query: 595 SVRSPSEEISRIVIGAV 611
           +VRS  E +S +V+ +V
Sbjct: 903 TVRSEEEGLSSLVVASV 919



>gi|390343290|ref|XP_784737.3| PREDICTED: coatomer subunit gamma-2-like [Strongylocentrotus
           purpuratus]
          Length = 872

 Score =  563 bits (1452), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 312/614 (50%), Positives = 400/614 (65%), Gaps = 38/614 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSPK TLRFAA +TLNK+AMT P AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 293 LFLSSPKPTLRFAATKTLNKVAMTHPAAVTACNLDLENLITDVNRSIATLAITTLLKTGS 352

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI  FMSEISDEFKV+VV A+RSLC KFP K  VM+SFLS +LRDEGG+E+
Sbjct: 353 ESSVDRLMKQIGTFMSEISDEFKVVVVSAVRSLCSKFPRKHSVMMSFLSNMLRDEGGFEY 412

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+++  +++  PESKE  L+HLCEFIEDCE T L+ R+LHL+G EGP++P P KYI
Sbjct: 413 KRAIVDSLIAIIEENPESKETGLSHLCEFIEDCEHTSLATRILHLIGREGPRSPNPAKYI 472

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRVILEN+ +RAAAVS+LAKFG   E  E+  SI VLL R L D+DDEVRDRA  Y
Sbjct: 473 RFIYNRVILENAAIRAAAVSSLAKFGAHCE--ELLPSIVVLLERSLLDSDDEVRDRATFY 530

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L ++  ++ A    Y+ +  + S+A LER L  Y  +P  SE PFD+  +P  T+   E 
Sbjct: 531 LSVLKHSQKALNSAYILNGLSVSIAGLERALHHYTLSP--SETPFDMKTVPIETQPLTEQ 588

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
              KP S D+A                  +++T  +    P    Q +Y+ QL  IPEIA
Sbjct: 589 ---KPVS-DIAP-----------------LMATKPEKLAPP---TQDIYADQLRAIPEIA 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             G LFKSS+KP ELTESETEY+V C+KH F E++VFQF  TNTLNDQ LENVTV M  E
Sbjct: 625 DLGALFKSSVKPSELTESETEYMVRCIKHTFPEHIVFQFDCTNTLNDQQLENVTVQM--E 682

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXX 478
           S EG  V+ + IPA  L Y+QP   Y   +          +FSNTLKF VKDCDP+T   
Sbjct: 683 SAEGFEVQHY-IPAPVLKYNQPGITYTVVQMPEDTSDVSSAFSNTLKFTVKDCDPNT-GE 740

Query: 479 XXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSC 538
                         IEI  SD++      +F ++W+ VG+E +  ET+ L ASKSL+++ 
Sbjct: 741 PDDDGYEDEYVLEDIEIALSDHMQRVLKPNFMASWEEVGDENETEETYGL-ASKSLEEAI 799

Query: 539 TTLIELLGMSPVENSGTPT-SSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSVR 597
             ++  LGM P E S   +   S HTL L+G F GG   L + R+    +  +TM ++VR
Sbjct: 800 KDIVSFLGMQPCERSDKVSEGKSSHTLYLAGVFRGGHDTLVRARLALQDT--ITMHITVR 857

Query: 598 SPSEEISRIVIGAV 611
           S    +S ++  +V
Sbjct: 858 SSDSGVSELIASSV 871



>gi|449689859|ref|XP_002154548.2| PREDICTED: coatomer subunit gamma-2-like [Hydra magnipapillata]
          Length = 878

 Score =  562 bits (1449), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 295/614 (48%), Positives = 407/614 (66%), Gaps = 32/614 (5%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSSP+ TLRFAA+RTLNK+A+ QP +V +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 293 LFLSSPRPTLRFAAVRTLNKVAILQPQSVMTCNLDLENLITDVNRSIATLAITTLLKTGS 352

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E SVDRLMKQI+ FMSEISDEFK++VVDAIR+LCLKFP K +VM++FLS +LR++GG+++
Sbjct: 353 ENSVDRLMKQISSFMSEISDEFKIVVVDAIRALCLKFPRKHLVMMTFLSTMLREDGGFDY 412

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K+A+V+AI  +++   ++KE+ L HLCEFIEDCE T LS ++L+LLG EGP+TP+P+KYI
Sbjct: 413 KKAIVDAIVAIIEENSDAKESGLGHLCEFIEDCEHTSLSTKILYLLGQEGPRTPSPSKYI 472

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRVILEN+ VRAAAV++LAKFG   +   +  SI VLL+RC+ D DDEVRDRA  Y
Sbjct: 473 RFIYNRVILENAEVRAAAVTSLAKFGAHCD--SLLPSILVLLSRCMMDTDDEVRDRAAFY 530

Query: 241 LKLID--DNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
             +++  D +    Y+ +    S+  LER L  Y+  P S+  PFD+  +P  T    E 
Sbjct: 531 YHILNKQDKQLTSGYILNSLNVSVVGLERALAAYLKEPTST--PFDMKIVPLTTVPLHEQ 588

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
           +++K          T G  +          V+T           +Q VY++QL  IPE+A
Sbjct: 589 KSIK----------TTGEPT----------VNTVMQRASVQTATRQDVYAEQLSAIPELA 628

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
            +GPLFKSS K ++LTESETEYVVSC+KH F  ++VFQF  TNTLNDQ+LENVTV M+  
Sbjct: 629 VYGPLFKSSQKALQLTESETEYVVSCIKHTFANHIVFQFNCTNTLNDQILENVTVNMET- 687

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXX 478
           SD+ ++V   +IP  KL Y  P + Y   + +        SF+ TLKF VKDCDP+T   
Sbjct: 688 SDDVSVVA--MIPCKKLVYGTPGTTYTCVQYSEDLSSVTASFTCTLKFNVKDCDPNTGEP 745

Query: 479 XXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSC 538
                         +E+V +D+V     ++FS++WD +GE+ Q  ETFAL+   SL+++ 
Sbjct: 746 DDDEGYDDEYVLEDVELVVADHVQGVVRTNFSASWDEIGEDNQKEETFALSEMTSLEEAV 805

Query: 539 TTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSVR 597
           T + + +G+ P E S    T  + HTL+L+G +  G+ VL + ++      GV M LSVR
Sbjct: 806 TKINQFIGLQPCERSDRISTDKNSHTLLLAGVYRNGVDVLVRAKLIL--RDGVQMHLSVR 863

Query: 598 SPSEEISRIVIGAV 611
           S    +  ++I A+
Sbjct: 864 STDPIVCDVMISAI 877



>gi|405961297|gb|EKC27123.1| Coatomer subunit gamma-2 [Crassostrea gigas]
          Length = 873

 Score =  560 bits (1443), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 303/614 (49%), Positives = 401/614 (65%), Gaps = 35/614 (5%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK TLRFAAIRTLNK+AM  P AV +CN+++ENLITD NRS+AT AITTLLKTGN
Sbjct: 291 LFCSSPKPTLRFAAIRTLNKVAMKHPAAVTACNMELENLITDSNRSIATLAITTLLKTGN 350

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ FM+EISDEFK++VV AI+SLCLKFP K  V+++FLS +LRDEGG+E+
Sbjct: 351 ESSVDRLMKQISSFMNEISDEFKIVVVQAIQSLCLKFPRKHNVLMNFLSSMLRDEGGFEY 410

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+ ++I  +++   ++KEA LAHLCEFIEDCE T L+ R+LHLLG EGP+TPTP+KYI
Sbjct: 411 KRAICDSIIIIIEENADAKEAGLAHLCEFIEDCEHTVLATRILHLLGREGPRTPTPSKYI 470

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRVILE++ VRAAAVSALAKFG   E  E+  S  VLL RCL D DDEVRDRA  Y
Sbjct: 471 RFIYNRVILEHAPVRAAAVSALAKFGAHCE--ELLPSCIVLLERCLLDTDDEVRDRATFY 528

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           + ++   + A    Y+ +    S+  LER L  Y   P  +E+PFD+  +P  T+   E 
Sbjct: 529 VHVLQQKQKAINSAYILNGLQVSVVGLERALHHYTLEP--TEQPFDMKSVPLETQPMTEQ 586

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
           + ++    D A+ ++            ++ V+ SR          Q VY++QL  IPE A
Sbjct: 587 KAVREPG-DTAAPKS------------TDKVAASR----------QDVYAEQLRAIPEFA 623

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             G LFKSS  PVELTESETEYVV CVKH F   MVFQF  TNTLNDQ+LE VTV M P 
Sbjct: 624 NLGNLFKSSSLPVELTESETEYVVQCVKHTFGRYMVFQFDCTNTLNDQVLERVTVQMDPA 683

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXX 478
             EG  V +  IP   LPY++P + Y   +     +   G+FS TLKF+VKDCDP+T   
Sbjct: 684 --EGFDVLK-TIPCPSLPYNKPGTTYTLVRLPEDAQLVTGTFSCTLKFIVKDCDPNT-GE 739

Query: 479 XXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSC 538
                         +E+  +D+V      +FS++W+ VG E ++ +T+AL+  K+L+D+ 
Sbjct: 740 PDDEGYEDEYVLEDVEVTVADHVQRVMKPNFSASWEEVGPENELEDTYALSTMKTLEDAV 799

Query: 539 TTLIELLGMSPVENSGT-PTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSVR 597
             +I+ +GM P E S       S HTL L+G + GG   L + ++  +   GVTM+L+VR
Sbjct: 800 KQIIQFMGMQPCERSDKIAEGKSSHTLYLAGVYRGGHDALVRAKLALS-DNGVTMQLTVR 858

Query: 598 SPSEEISRIVIGAV 611
           S   + S ++  A+
Sbjct: 859 SSDPDASEVLATAI 872



>gi|345566084|gb|EGX49031.1| hypothetical protein AOL_s00079g252 [Arthrobotrys oligospora ATCC
           24927]
          Length = 925

 Score =  559 bits (1441), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 318/625 (50%), Positives = 430/625 (68%), Gaps = 26/625 (4%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFL+SP++  +FAAIR L+ +A  +P  +Q CN+D+E LI++ NRS+ATFAITTLLKTGN
Sbjct: 312 LFLTSPRAVTKFAAIRILHHIASFKPNTLQHCNMDIETLISNSNRSIATFAITTLLKTGN 371

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+GFM++I+DEFK+ +V+AIR+LCLKFPSKQ  ML+FLSG+LRDEGGYEF
Sbjct: 372 EASVDRLMKQISGFMADITDEFKITIVEAIRTLCLKFPSKQAGMLAFLSGILRDEGGYEF 431

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K++VVE++FDL+KF+P+SKE        FIEDCEFTKL+VRVLHLLG EGPKT  PTKYI
Sbjct: 432 KKSVVESMFDLIKFVPDSKEEGKL----FIEDCEFTKLAVRVLHLLGQEGPKTSHPTKYI 487

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV+LEN++VRAAAV+ALAKFGV  +D EVK+S+ VLLTRCLDD DDEVRDRA L 
Sbjct: 488 RYIYNRVVLENAVVRAAAVTALAKFGVGQKDEEVKRSVVVLLTRCLDDPDDEVRDRAALN 547

Query: 241 LKLIDD-NESAEKYVKDDSTYSLAALERQLVQYVSNPESS-EKPFDLSDIPKITKAQAEA 298
           LKL+   +E   K++ +DS +SL   E QLV YV+  +S+  KPFD++ IP +T+A+A+A
Sbjct: 548 LKLVTGASEYGAKFIHNDSIFSLPIFEHQLVMYVTGDQSTFSKPFDIASIPVVTRAEADA 607

Query: 299 EN----LKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQI 354
           E+    ++P S D+ + +    S+       + I   + +A         Q Y+  L  I
Sbjct: 608 EDKSKKMRPAS-DMPTLKAPTISAPGARPSAAPISEAAVNAA-----AASQQYAATLSAI 661

Query: 355 PEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVT-- 412
           PEI A G L KSS + VELTE+E EYVV+ VKH+FK+++V Q+ V NTL D +LENVT  
Sbjct: 662 PEIKALGQLLKSS-RVVELTEAEMEYVVTSVKHIFKDHIVLQYNVKNTLTDSVLENVTVQ 720

Query: 413 VVMQPESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEE---YTLGSFSNTLKFLVK 469
           V +  E +E  LVEEF +PA K+  D P +IYVAFKR   EE   YT  +F+N LKF  K
Sbjct: 721 VTVAEEDEEEPLVEEFYVPAPKIAVDSPGTIYVAFKRPQSEEGAGYTTTTFNNVLKFTTK 780

Query: 470 DCDPSTXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETFAL 528
           + DPST                 +E+   DYV P +  +F + W+ VG  G +V ET+ L
Sbjct: 781 EIDPST-GEAEDGGYDDEYEVEDLELTGGDYVVPAFCGNFGTVWEQVGTAGEEVTETYGL 839

Query: 529 TAS--KSLKDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAP 586
                K+L+++C  L   L + P+E +  P S++ H L L G  + G +V+A  +M F+ 
Sbjct: 840 PQENVKNLEEACNLLASALSLQPMEGTDVPMSTTSHVLKLFGKTISGGRVVAMVKMVFSS 899

Query: 587 STGVTMELSVRSPSEEISRIVIGAV 611
            +GVT++++VRS    + ++V+ AV
Sbjct: 900 KSGVTVKITVRSEESGVGQLVVSAV 924



>gi|505756737|gb|EOR00878.1| Coatomer subunit gamma [Wallemia ichthyophaga EXF-994]
          Length = 924

 Score =  559 bits (1440), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 311/639 (48%), Positives = 412/639 (64%), Gaps = 35/639 (5%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           L LS+P + L+FAAIRTLN LA   P  V SCNL++ENLITD NRS+ATFAITTLLKTGN
Sbjct: 292 LALSTPNTPLKFAAIRTLNDLAQRHPLTVSSCNLEIENLITDSNRSIATFAITTLLKTGN 351

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           EASVDRLMKQI+ FM EISDEFKVIVVDA+R+LCLKFP+K   ML+FLS  LRDEGGY+F
Sbjct: 352 EASVDRLMKQISSFMLEISDEFKVIVVDAVRTLCLKFPNKYPAMLAFLSQALRDEGGYDF 411

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVEAI D++K I ESKE ALAHLCEFIEDCEFTKLSVRVLHLLGVEGP TP PTKYI
Sbjct: 412 KRAVVEAIIDMIKGIGESKEMALAHLCEFIEDCEFTKLSVRVLHLLGVEGPSTPEPTKYI 471

Query: 181 RYIYNRVILENSIVRAAAVSALAKFG--VSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAI 238
           R+IYNRV+LEN+IVRAAAVS+LAKFG  V+     V++S+KVLL RCLDD+DDEVRDRA 
Sbjct: 472 RHIYNRVVLENAIVRAAAVSSLAKFGTNVAYAAQHVRRSVKVLLGRCLDDSDDEVRDRAA 531

Query: 239 LYLKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           +Y+++I D+E A++   ++ T+S+  LE+ L  Y +  ++ E+PF+ + IP++ K Q   
Sbjct: 532 MYMRIIHDDELAKRTTHEEHTWSVGVLEKSLCTYTTE-QNYEEPFNSAVIPRMPKDQIRL 590

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVST-----SRDATPTPGVDQQQVYS----Q 349
           +    R  DL   Q  G S ++  + ++    +     S DA  +        ++     
Sbjct: 591 DTHVGRLGDLGEKQ--GESENSKNNKDNATAHSEELLLSHDAPASAATSAHNSHALSSTT 648

Query: 350 QLEQIPEIAAFG-PLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLL 408
            +  IPE A +G PL  S   PV LTE ETEYVVS  KH+F E++VF++ V NT+ + +L
Sbjct: 649 NITSIPEFAGYGAPLHTS--PPVHLTEEETEYVVSVQKHLFSEHVVFEYHVRNTVPEAVL 706

Query: 409 ENVTVVMQPESDEGTLVEEFVIPATKLPY-DQPSSIYVAFKRTNPE--------EYTLGS 459
           + V+V+M      G+L E+F++P   L   D   S YV++   + E         Y  G+
Sbjct: 707 DGVSVLMGLGDVGGSLREDFILPIDTLTVADGERSTYVSYSFIDDEGDGNGDNAGYPTGA 766

Query: 460 FSNTLKFLVKDCDPSTXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSV--- 516
            SNTL F  K+ DP +                 +E+  SDYV P ++S F   W+++   
Sbjct: 767 LSNTLTFTTKEVDPDS-GMVEEEGYADEYQVDDVELGISDYVRPEWVS-FDGEWEAMSME 824

Query: 517 -GEEGQVVETFALTASKSLKDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGI- 574
             E  ++ ++F L+A  SL+++   L  LLGM  +  S    S+ +HTL LSG  + G  
Sbjct: 825 HSEHSELRDSFTLSAMGSLQEATDALTALLGMMALGGSDVVGSAHLHTLRLSGCIIRGSA 884

Query: 575 --KVLAKNRMTFAPSTGVTMELSVRSPSEEISRIVIGAV 611
             KVLA  RM F    GV +E+ VRSP+     +++GAV
Sbjct: 885 QGKVLAMARMAFEEGEGVNLEMVVRSPNSFTCELIMGAV 923



>gi|466080713|ref|XP_004284385.1| PREDICTED: coatomer subunit gamma-1 [Orcinus orca]
          Length = 874

 Score =  554 bits (1427), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 296/616 (48%), Positives = 395/616 (64%), Gaps = 41/616 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V++SFL  +LR+EGG+E+
Sbjct: 354 EGSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMSFLFSMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 414 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LSVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATTPMAEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
                             S+    +     V+ +R          Q+++ +QL  +PE  
Sbjct: 590 RT---------------ESTPITAAKQPEKVAATR----------QEIFQEQLAAVPEFQ 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV LTESETEYV+ C KH F E+MVFQF  TNTLNDQ LENVTV M+P 
Sbjct: 625 GLGPLFKSSPEPVALTESETEYVIRCTKHTFPEHMVFQFDCTNTLNDQTLENVTVQMEPT 684

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
                L     +PA  LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP+T 
Sbjct: 685 EAYEVLC---YVPARSLPYNQPGTCYTLVALPKEDPTAVGC-TFSCMMKFTVKDCDPTT- 739

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  +D++      +F +AWD VG+E +  ETF L+  K+L++
Sbjct: 740 GETDDEGYEDEYVLEDLEVTIADHIQKVMKLNFEAAWDEVGDEFEKEETFTLSTIKTLEE 799

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   +++ LGM P E S   P + + HTL+L+G F GG  +L ++R+    +  VTM+++
Sbjct: 800 AVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILVRSRLLLLDA--VTMQVT 857

Query: 596 VRSPSEEISRIVIGAV 611
            RS  E    IV+ +V
Sbjct: 858 ARSSEELPVDIVLASV 873



>gi|488581129|ref|XP_004476000.1| PREDICTED: coatomer subunit gamma-1 [Dasypus novemcinctus]
          Length = 875

 Score =  554 bits (1427), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 295/616 (47%), Positives = 398/616 (64%), Gaps = 40/616 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 414 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LSVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATAPIAEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
              +P S  +A+        +A                      +Q+++ +QL  +PE  
Sbjct: 590 ---RPESTPIAAAVKQPEKVAAT---------------------RQEIFQEQLAAVPEFR 625

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV LTESETEYV+ C KH F E+MVFQF  TNTLNDQ LENVTV M+P 
Sbjct: 626 GLGPLFKSSPEPVALTESETEYVIRCTKHTFTEHMVFQFDCTNTLNDQTLENVTVQMEPT 685

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
                L     +PA  LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP+T 
Sbjct: 686 EAYEVLC---CVPARSLPYNQPGTCYTLVALPKEDPTAVAC-TFSCMMKFTVKDCDPTT- 740

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  +D++      +F +AWD VG+E +  ETF L+  K+L++
Sbjct: 741 GETDDEGYEDEYVLEDLEVTVADHIQKVLKLNFEAAWDEVGDEFEKEETFTLSTIKTLEE 800

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   +++ LGM P E S   P + + HTL+L+G F GG  +L ++R+    +  VTM+++
Sbjct: 801 AVGNIVKFLGMHPCERSDKVPENKNTHTLLLAGVFRGGHDILVRSRLLLLDT--VTMQVT 858

Query: 596 VRSPSEEISRIVIGAV 611
            RS  E    I++ +V
Sbjct: 859 ARSSEELPVDIILASV 874



>gi|296414628|ref|XP_002837000.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295632848|emb|CAZ81191.1| unnamed protein product [Tuber melanosporum]
          Length = 879

 Score =  554 bits (1427), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 305/626 (48%), Positives = 426/626 (68%), Gaps = 42/626 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           L+L+S  +  +F AI  L+ LA  +P AV  CN+D+E LI + NR +ATF ITTLLKT  
Sbjct: 280 LYLTSRSAVAKFNAIVILHNLAYLRPAAVNVCNIDIETLIFNINRLIATFVITTLLKTAK 339

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E S+DRLM + +  M++I+DEFK+ +V+AIR+LCLKFPSKQ  MLSFLSG+LRDEGGYEF
Sbjct: 340 EGSMDRLMGKTSAIMADITDEFKITIVEAIRTLCLKFPSKQAGMLSFLSGILRDEGGYEF 399

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRAVVE++FDL+KF+PES+E ALAHLCEFIEDCEFTKLSVR+LHLLG EGPKT  PTKYI
Sbjct: 400 KRAVVESMFDLIKFVPESREEALAHLCEFIEDCEFTKLSVRILHLLGTEGPKTSQPTKYI 459

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAE----DPEVKKSIKVLLTRCLDDNDDEVRDR 236
           RYIYNRV+LEN++VRAAAV+ALAKFGV+++    D EVKKS+ VLLTRCLDD DDEVRDR
Sbjct: 460 RYIYNRVVLENAVVRAAAVTALAKFGVASKEGKVDTEVKKSVVVLLTRCLDDPDDEVRDR 519

Query: 237 AILYLKLI--DDNESAEKYVKDDSTYSLAALERQLVQYVSNPESS-EKPFDLSDIPKITK 293
           A L L+LI  ++ E AEK++K++ST+SL   E QLV YV+  +S+   PFD+S IP +T+
Sbjct: 520 AALNLRLIQEEEGEVAEKFIKNESTFSLPIFEHQLVMYVTGDQSTFGTPFDISSIPIVTR 579

Query: 294 AQAEAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQ 353
           A+A+AE+ +P +   AS      +++A                                 
Sbjct: 580 AEADAED-RPSAAPSASEAATSAAAAAQQHAQQLAT------------------------ 614

Query: 354 IPEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTV 413
           +PE+  +GPL KSS + VELTE+ETEYVV+ +KH+FK+++V QF V NTL D +LE+V++
Sbjct: 615 VPELKPYGPLLKSS-REVELTEAETEYVVTAIKHIFKDHLVLQFNVKNTLMDIILEDVSM 673

Query: 414 V---MQPESDEGTLV--EEFVIPATKLPYDQPSSIYVAFKRTNPE-EYTLGSFSNTLKFL 467
           V     PE +E  L   E+F+IP  KL  ++  +IYV+FKRT  E  Y + +F+N LKF 
Sbjct: 674 VATPADPEDEEQALGLEEDFIIPVPKLATEEVGTIYVSFKRTGDESNYAITTFANVLKFT 733

Query: 468 VKDCDPSTXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEG-QVVETF 526
           +K+ DPST                 +E+   DYV P+++  F + W+ VG  G +V ETF
Sbjct: 734 LKEIDPST-GEPEDQGFEDEYQVEDLELTGGDYVVPSFVGSFGNVWEQVGAAGCEVTETF 792

Query: 527 AL-TASKSLKDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFA 585
           +L T  KS++++C  L + L + P+E S    +++ H L L G  + G +V+A+ +M ++
Sbjct: 793 SLGTGVKSIQEACEALSQSLSLQPLEGSDVVANTATHNLKLFGKTISGGRVVAQVKMAYS 852

Query: 586 PSTGVTMELSVRSPSEEISRIVIGAV 611
             TGV ++++ R+  E ++ +++G+V
Sbjct: 853 SKTGVALKITARAEEEGVAEMIVGSV 878



>gi|512847549|ref|XP_004886277.1| PREDICTED: coatomer subunit gamma-1-like isoform X2 [Heterocephalus
           glaber]
          Length = 874

 Score =  553 bits (1426), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 295/616 (47%), Positives = 401/616 (65%), Gaps = 41/616 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  ++++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAILMNFLFTMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 414 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATTPMAEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
              +P S  + +T+                VS +R          Q+++ +QL  +PE  
Sbjct: 590 ---RPESTPITATK------------QPEKVSATR----------QEIFQEQLAAVPEFQ 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV LTE ETEYVV C KH+F E+MVFQF  TNTLND++LENVTV M+P 
Sbjct: 625 GLGPLFKSSPEPVALTELETEYVVHCTKHVFTEHMVFQFDCTNTLNDRMLENVTVYMEPT 684

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
                L     +PA  LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP+T 
Sbjct: 685 EAYEVLC---YVPARSLPYNQPGTCYTLVALPKEDPTAVGC-TFSCMMKFTVKDCDPTT- 739

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  +D++      +F +AWD VG+E +  ETF L+  K+L++
Sbjct: 740 GEMDEEGYEDEYVLEDLEVNVADHIQKVMKVNFEAAWDEVGDEFEKEETFTLSTIKTLEE 799

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   +++ LGM   E S   P + + HTL+L+G F GG  +L ++R+    +  VTM+++
Sbjct: 800 AVGNIVKFLGMHACERSDKVPENKNTHTLLLAGVFRGGHDILVRSRLLLLDT--VTMQVT 857

Query: 596 VRSPSEEISRIVIGAV 611
            RS  E    I++G+V
Sbjct: 858 ARSSEELPVDIILGSV 873



>gi|470603560|ref|XP_004313094.1| PREDICTED: coatomer subunit gamma-1 [Tursiops truncatus]
          Length = 874

 Score =  553 bits (1426), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 296/616 (48%), Positives = 395/616 (64%), Gaps = 41/616 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V++SFL  +LR+EGG+E+
Sbjct: 354 EGSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMSFLFSMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 414 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LSVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATTPMAEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
                             S+    +     V+ +R          Q+++ +QL  +PE  
Sbjct: 590 RT---------------ESTPITAAKQPEKVAATR----------QEIFQEQLAAVPEFQ 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV LTESETEYV+ C KH F E+MVFQF  TNTLNDQ LENVTV M+P 
Sbjct: 625 GLGPLFKSSPEPVALTESETEYVIRCTKHTFPEHMVFQFDCTNTLNDQTLENVTVQMEPT 684

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
                L     +PA  LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP+T 
Sbjct: 685 EAYEVLC---YVPARSLPYNQPGTCYTLVALPKEDPTAVGC-TFSCMMKFTVKDCDPTT- 739

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  +D++      +F +AWD VG+E +  ETF L+  K+L++
Sbjct: 740 GETDDEGYEDEYVLEDLEVTIADHIQKVMKLNFEAAWDEVGDEFEKEETFTLSTIKTLEE 799

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   +++ LGM P E S   P + + HTL+L+G F GG  +L ++R+    +  VTM+++
Sbjct: 800 AVGNIVKFLGMHPCERSDRVPDNKNTHTLLLAGVFRGGHDILVRSRLLLLDT--VTMQVT 857

Query: 596 VRSPSEEISRIVIGAV 611
            RS  E    IV+ +V
Sbjct: 858 ARSSEELPVDIVLASV 873



>gi|512847546|ref|XP_004886276.1| PREDICTED: coatomer subunit gamma-1-like isoform X1 [Heterocephalus
           glaber]
 gi|351701017|gb|EHB03936.1| Coatomer subunit gamma [Heterocephalus glaber]
          Length = 874

 Score =  553 bits (1426), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 295/616 (47%), Positives = 401/616 (65%), Gaps = 41/616 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  ++++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAILMNFLFTMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 414 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATTPMAEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
              +P S  + +T+                VS +R          Q+++ +QL  +PE  
Sbjct: 590 ---RPESTPITATK------------QPEKVSATR----------QEIFQEQLAAVPEFQ 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV LTE ETEYVV C KH+F E+MVFQF  TNTLND++LENVTV M+P 
Sbjct: 625 GLGPLFKSSPEPVALTELETEYVVHCTKHVFTEHMVFQFDCTNTLNDRMLENVTVYMEPT 684

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
                L     +PA  LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP+T 
Sbjct: 685 EAYEVLC---YVPARSLPYNQPGTCYTLVALPKEDPTAVGC-TFSCMMKFTVKDCDPTT- 739

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  +D++      +F +AWD VG+E +  ETF L+  K+L++
Sbjct: 740 GEMDEEGYEDEYVLEDLEVNVADHIQKVMKVNFEAAWDEVGDEFEKEETFTLSTIKTLEE 799

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   +++ LGM   E S   P + + HTL+L+G F GG  +L ++R+    +  VTM+++
Sbjct: 800 AVGNIVKFLGMHACERSDKVPENKNTHTLLLAGVFRGGHDILVRSRLLLLDT--VTMQVT 857

Query: 596 VRSPSEEISRIVIGAV 611
            RS  E    I++G+V
Sbjct: 858 ARSSEELPVDIILGSV 873



>gi|507562957|ref|XP_004665164.1| PREDICTED: coatomer subunit gamma-1 [Jaculus jaculus]
          Length = 874

 Score =  553 bits (1425), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 295/624 (47%), Positives = 396/624 (63%), Gaps = 57/624 (9%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGP+T  P+KYI
Sbjct: 414 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPRTNNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATTPMAEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQ--------QQVYSQQ 350
                                              +ATPT  V Q        Q+++ +Q
Sbjct: 590 RT---------------------------------EATPTATVKQPEKVAATRQEIFQEQ 616

Query: 351 LEQIPEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLEN 410
           L  +PE    GPLFKSS +PV LTESETEYV+ C KH F ++MVFQF  TNTLNDQ LEN
Sbjct: 617 LAAVPEFQELGPLFKSSPEPVALTESETEYVIRCTKHTFADHMVFQFDCTNTLNDQTLEN 676

Query: 411 VTVVMQPESDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLV 468
           VTV M+P      L     +PA  LPY+QP + Y  VA  + +P      +FS  +KF V
Sbjct: 677 VTVHMEPTEAYEVLCH---VPARSLPYNQPGTCYTLVALPKEDPTAVAC-TFSCMMKFTV 732

Query: 469 KDCDPSTXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFAL 528
           KDCDP+T                 +E+  +D++      +F +AWD VG+E +  ETF L
Sbjct: 733 KDCDPNT-GETDEEGYEDEYVLEDLEVTVADHIQKVMKVNFEAAWDEVGDEFEKEETFTL 791

Query: 529 TASKSLKDSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPS 587
           +  K+L+++   +++ LGM P E S   P + + HTL+L+G F GG  +L ++R+    +
Sbjct: 792 STIKTLEEAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILVRSRLLLLDT 851

Query: 588 TGVTMELSVRSPSEEISRIVIGAV 611
             VTM+++ RS  E    I++ +V
Sbjct: 852 --VTMQVTARSSEELPVDIILASV 873



>gi|432090076|gb|ELK23672.1| Coatomer subunit gamma [Myotis davidii]
          Length = 876

 Score =  553 bits (1425), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 296/617 (47%), Positives = 402/617 (65%), Gaps = 43/617 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 296 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 355

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 356 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFSMLREEGGFEY 415

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 416 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYI 475

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 476 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 533

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 534 LNVLEQKQKALNASYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATAPMAEQ 591

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINS-NIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
                            T S+ + ++     V+ +R          Q+++ +QL  +PE 
Sbjct: 592 R----------------TESTPITAVKQPEKVAATR----------QEIFQEQLAAVPEF 625

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
              GPLFKSS +PV LTESETEYV+ C KH F  +MVFQF  TNTLNDQ LENVTV M+P
Sbjct: 626 QGLGPLFKSSPEPVALTESETEYVIHCTKHTFTHHMVFQFDCTNTLNDQTLENVTVQMEP 685

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPST 475
              EG  V  +V PA  LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP+T
Sbjct: 686 --TEGYEVLCYV-PAWTLPYNQPGTCYTLVALPKEDPTAVAC-TFSCMMKFTVKDCDPTT 741

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLK 535
                            +E+  +D++      +F +AW+ VG+E +  ETF L+ +K+L+
Sbjct: 742 -GETDDEGYEDEYVLEDLEVTVADHIQKVMKLNFEAAWEEVGDEFEKEETFTLSTTKTLE 800

Query: 536 DSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
           ++   +++ LGM P E S   P + + HTL+L+G F GG  +L ++R+    +  VTM++
Sbjct: 801 EAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILVRSRLLLLDT--VTMQV 858

Query: 595 SVRSPSEEISRIVIGAV 611
           + RS  E    I++ +V
Sbjct: 859 TARSSEELPVDIILASV 875



>gi|1706000|sp|P53620.1|COPG1_BOVIN RecName: Full=Coatomer subunit gamma-1; AltName: Full=Gamma-1-coat
           protein; Short=Gamma-1-COP
 gi|1066165|emb|CAA63574.1| coat protein gamma-cop [Bos primigenius]
          Length = 874

 Score =  553 bits (1424), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 293/616 (47%), Positives = 395/616 (64%), Gaps = 41/616 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDANRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 EGSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFSMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGP+T  P+KYI
Sbjct: 414 KRAIVDCIISIIEENAESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPRTSNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE++ VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHAEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +    S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LNVLEQKQKALNAGYILNGLAVSIPGLERALQQYTLEP--SEKPFDLKSVPLATAPLAEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
                             S+    +     V+ +R          Q+++ +QL  +PE  
Sbjct: 590 RT---------------ESTPVTAAKQPEKVAATR----------QEIFQEQLAAVPEFQ 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV LTESETEYV+ C KH F ++MVFQF  TNTLNDQ LENVTV M+P 
Sbjct: 625 GLGPLFKSSPEPVALTESETEYVIRCTKHTFTDHMVFQFDCTNTLNDQTLENVTVQMEPS 684

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
                L     +PA  LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP+T 
Sbjct: 685 EAYEVLC---YVPARSLPYNQPGTCYTLVALPKEDPTAVAC-TFSCVMKFTVKDCDPTT- 739

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  +D++      +F +AWD VG+E Q  ETF L+  K+L++
Sbjct: 740 GEADDEGYEDEYVLEDLEVTIADHIQKVMKLNFEAAWDEVGDEFQKEETFTLSTIKTLEE 799

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   +++ LGM P E S   P + + HTL+L+G F GG  +L ++R+    +  VTM+++
Sbjct: 800 AVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILVRSRLLLLDT--VTMQVT 857

Query: 596 VRSPSEEISRIVIGAV 611
            RS  E    IV+ +V
Sbjct: 858 ARSSEELPVDIVLASV 873



>gi|157817775|ref|NP_001100399.1| coatomer subunit gamma-2 [Rattus norvegicus]
 gi|149065190|gb|EDM15266.1| similar to Coatomer gamma-2 subunit (Gamma-2 coat protein) (Gamma-2
           COP) (predicted) [Rattus norvegicus]
          Length = 871

 Score =  553 bits (1424), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 294/619 (47%), Positives = 402/619 (64%), Gaps = 50/619 (8%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 354 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K+A+V+ I  +V+  PESKEA LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 414 KKAIVDCIISIVEENPESKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 474 RFIFNRVVLENEAVRAAAVSALAKFG--AQNESLLPSILVLLQRCMMDTDDEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIP----KITKA 294
           L ++   + A    Y+ +  T S+  +E+ L QY   P  SEKPFD+  IP     + + 
Sbjct: 532 LNVLQQRQMALNATYIFNGLTVSIPGMEKALHQYTLEP--SEKPFDMKSIPLAMAPVFEQ 589

Query: 295 QAEAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQI 354
           ++E   + P+   LA ++                               Q ++ +QL  I
Sbjct: 590 KSEITLVTPKPEKLAPSR-------------------------------QDIFQEQLAAI 618

Query: 355 PEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVV 414
           PE    GPLFKSS +PV+LTE+ETEY V CVKHMF +++VFQF  TNTLNDQLLE VTV 
Sbjct: 619 PEFVNLGPLFKSS-EPVQLTEAETEYFVRCVKHMFTDHIVFQFDCTNTLNDQLLEKVTVQ 677

Query: 415 MQPESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTL-GSFSNTLKFLVKDCDP 473
           M+P      L     +PA  LPY+QP   Y   +  + +   + G+FS T+KF V+DCDP
Sbjct: 678 MEPSDSYEVLC---CVPAPSLPYNQPGICYTLVRLPDEDPTAVAGTFSCTMKFTVRDCDP 734

Query: 474 STXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKS 533
           +T                 +E+  SD++      +F++AW+ VG+  +  ETFAL+++K+
Sbjct: 735 NT-GVPDEDGYDDEYVLEDLEVTVSDHIQKILKPNFAAAWEEVGDAFEKEETFALSSTKT 793

Query: 534 LKDSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTM 592
           L+D+   +I  LGM P E S   P + + H+L L+G + GG  +L ++R+  A   GVTM
Sbjct: 794 LEDAVNNIITFLGMQPCERSDKVPENKNSHSLYLAGVYRGGYDLLVRSRLALA--DGVTM 851

Query: 593 ELSVRSPSEEISRIVIGAV 611
           +++VRS  +    +++ +V
Sbjct: 852 QVTVRSREKTPVDVILASV 870



>gi|26346320|dbj|BAC36811.1| unnamed protein product [Mus musculus]
          Length = 878

 Score =  552 bits (1423), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 298/614 (48%), Positives = 401/614 (65%), Gaps = 41/614 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 414 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LE+ L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LNVLEQKQKALNAGYILNGLTVSIPGLEKALQQYTLEP--SEKPFDLKSVPLATTPMAEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
              +P S          T+++AV       V+ +R          Q+++ +QL  +PE  
Sbjct: 590 ---RPES----------TATAAVKQPEK--VAATR----------QEIFQEQLAAVPEFQ 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV LTESETEYV+ C KH F +++VFQF  TNTLNDQ LENVTV M+P 
Sbjct: 625 GLGPLFKSSPEPVALTESETEYVIRCTKHTFSDHLVFQFDCTNTLNDQTLENVTVQMEP- 683

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
             E   V  +V PA  LPY+QP + Y  VA    +P      +FS  +KF VKDCDP+T 
Sbjct: 684 -TEAYEVLSYV-PARSLPYNQPGTCYTLVALPTEDPTAVAC-TFSCVMKFTVKDCDPNT- 739

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  +D++      +F +AWD VG+E +  ETF L+  K+L++
Sbjct: 740 GEIDEEGYEDEYVLEDLEVTVADHIQKVMKVNFEAAWDEVGDEFEKEETFTLSTIKTLEE 799

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   +++ LGM P E S   P + + HTL+L+G F GG  +L  +R+    +  VTM+++
Sbjct: 800 AVGNIVKFLGMHPCERSDKVPENKNTHTLLLAGVFRGGHDILVHSRLLLLDT--VTMQVT 857

Query: 596 VRSPSEEISRIVIG 609
            RS  E  SR  +G
Sbjct: 858 ARSSEEAASRYHLG 871



>gi|83715992|ref|NP_001032904.1| coatomer subunit gamma-1 [Bos taurus]
 gi|83405754|gb|AAI11323.1| Coatomer protein complex, subunit gamma [Bos taurus]
 gi|296474615|tpg|DAA16730.1| TPA: coatomer subunit gamma [Bos taurus]
          Length = 874

 Score =  552 bits (1423), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 293/616 (47%), Positives = 395/616 (64%), Gaps = 41/616 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDANRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 EGSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFSMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGP+T  P+KYI
Sbjct: 414 KRAIVDCIISIIEENAESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPRTSNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE++ VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHAEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +    S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LNVLEQKQKALNAGYILNGLAVSIPGLERALQQYTLEP--SEKPFDLKSVPLATAPLAEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
                             S+    +     V+ +R          Q+++ +QL  +PE  
Sbjct: 590 RT---------------ESTPVTAAKQPEKVAATR----------QEIFQEQLAAVPEFQ 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV LTESETEYV+ C KH F ++MVFQF  TNTLNDQ LENVTV M+P 
Sbjct: 625 GLGPLFKSSPEPVALTESETEYVIRCTKHTFTDHMVFQFDCTNTLNDQTLENVTVQMEPT 684

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
                L     +PA  LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP+T 
Sbjct: 685 EAYEVLC---YVPARSLPYNQPGTCYTLVALPKEDPTAVAC-TFSCVMKFTVKDCDPTT- 739

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  +D++      +F +AWD VG+E Q  ETF L+  K+L++
Sbjct: 740 GEADDEGYEDEYVLEDLEVTIADHIQKVMKLNFEAAWDEVGDEFQKEETFTLSTIKTLEE 799

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   +++ LGM P E S   P + + HTL+L+G F GG  +L ++R+    +  VTM+++
Sbjct: 800 AVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILVRSRLLLLDT--VTMQVT 857

Query: 596 VRSPSEEISRIVIGAV 611
            RS  E    IV+ +V
Sbjct: 858 ARSSEELPVDIVLASV 873



>gi|291393350|ref|XP_002713207.1| PREDICTED: coatomer protein complex, subunit gamma 1-like
           [Oryctolagus cuniculus]
          Length = 874

 Score =  552 bits (1423), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 295/617 (47%), Positives = 399/617 (64%), Gaps = 43/617 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 414 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATTPVAEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINS-NIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
                            T S+ + ++     V+ +R          Q+++ +QL  +PE 
Sbjct: 590 R----------------TESTPITAVKQPEKVAATR----------QEIFQEQLAAVPEF 623

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
              GPLFKSS +PV LTESETEYV+ C KH F ++MVFQF  TNTLNDQ LENVTV M+P
Sbjct: 624 HGLGPLFKSSPEPVALTESETEYVIRCTKHTFTDHMVFQFDCTNTLNDQTLENVTVQMEP 683

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPST 475
                 L     +PA  LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP+T
Sbjct: 684 TEAYEVLC---YVPARSLPYNQPGTCYTLVALPKEDPTAVAC-TFSCMMKFTVKDCDPTT 739

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLK 535
                            +E+  +D++      +F +AWD VG+E +  ETF L+  K+L+
Sbjct: 740 -GETDDEGYEDEYVLEDLEVTVADHIQKVMKLNFEAAWDEVGDEFEKEETFTLSTIKTLE 798

Query: 536 DSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
           ++   +++ LGM P E S   P + + HTL+L+G F GG  +L ++R+    +  VTM++
Sbjct: 799 EAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILVRSRLLLLDT--VTMQV 856

Query: 595 SVRSPSEEISRIVIGAV 611
           + RS  E    IV+ +V
Sbjct: 857 TARSSEELPVDIVLASV 873



>gi|149728227|ref|XP_001488579.1| PREDICTED: coatomer subunit gamma [Equus caballus]
          Length = 874

 Score =  552 bits (1423), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 294/616 (47%), Positives = 396/616 (64%), Gaps = 41/616 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 414 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATTPMAEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
                             S+    +     V+ +R          Q+++ +QL  +PE  
Sbjct: 590 RT---------------ESTPITAAKQPEKVAATR----------QEIFQEQLAAVPEFC 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV LTESETEYVV C KH F ++MVFQF  TNTLNDQ LENVTV M+P 
Sbjct: 625 GLGPLFKSSPEPVALTESETEYVVRCTKHTFTDHMVFQFDCTNTLNDQTLENVTVQMEPT 684

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
                L     +PA  LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP+T 
Sbjct: 685 EAYEVLC---YVPARSLPYNQPGTCYTLVALPKEDPTAVAC-TFSCMMKFTVKDCDPTT- 739

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  +D++      +F +AWD VG+E +  ETF L+  K+L++
Sbjct: 740 GETDDDGYEDEYVLEDLEVAVADHIQKVMKLNFEAAWDEVGDEFEKEETFTLSTIKTLEE 799

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   +++ LGM P E S   P + + HTL+L+G F GG  +L ++R+    +  VTM+++
Sbjct: 800 AVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILVRSRLLLLDT--VTMQVT 857

Query: 596 VRSPSEEISRIVIGAV 611
            RS  E    I++ +V
Sbjct: 858 ARSSEELPVDIILASV 873



>gi|507976351|ref|XP_004692390.1| PREDICTED: coatomer subunit gamma-1 [Condylura cristata]
          Length = 874

 Score =  552 bits (1423), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 292/616 (47%), Positives = 396/616 (64%), Gaps = 41/616 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFSMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGP+T  P+KYI
Sbjct: 414 KRAIVDCIISIIEENTESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPRTNNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATTPMAEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
                             S+    +     V+ +R          Q+++ +QL  +PE  
Sbjct: 590 RT---------------ESTPVTAAKQPEKVAATR----------QEIFQEQLAAVPEFL 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV LTESETEYV+ C KH F ++MVFQF  TNTLNDQ LENVTV M+P 
Sbjct: 625 GLGPLFKSSPEPVALTESETEYVIRCTKHTFTDHMVFQFDCTNTLNDQTLENVTVQMEPT 684

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
                L     +PA  LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP+T 
Sbjct: 685 EAYEVLCH---VPARSLPYNQPGTCYTLVALPKEDPTTVAC-TFSCVMKFTVKDCDPNT- 739

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  +D++      +F +AWD VG+E +  ETF L+  K+L++
Sbjct: 740 GETDEEGYEDEYVLEDLEVTVADHIQKVMKVNFEAAWDEVGDEFEKEETFTLSTIKTLEE 799

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   +++ LGM P E S   P + + HTL+L+G F GG  +L ++R+    +  VTM+++
Sbjct: 800 AVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILVRSRLLLLDA--VTMQVT 857

Query: 596 VRSPSEEISRIVIGAV 611
            RS  E    I++ +V
Sbjct: 858 ARSSEELPVDIILASV 873



>gi|148681777|gb|EDL13724.1| coatomer protein complex, subunit gamma 2 [Mus musculus]
          Length = 859

 Score =  552 bits (1422), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 294/619 (47%), Positives = 401/619 (64%), Gaps = 50/619 (8%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 282 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 341

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 342 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCHKYPRKHSVMMTFLSNMLRDDGGFEY 401

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K+A+V+ I  +V+  PESKEA LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 402 KKAIVDCIISIVEENPESKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYI 461

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 462 RFIFNRVVLENEAVRAAAVSALAKFG--AQNESLLPSILVLLQRCMMDTDDEVRDRATFY 519

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIP----KITKA 294
           L ++   + A    Y+ +  T S+  +E+ L QY   P  SEKPFD+  IP     + + 
Sbjct: 520 LNVLQQRQMALNATYIFNGLTVSIPGMEKALHQYTLEP--SEKPFDMKSIPLAMAPVFEQ 577

Query: 295 QAEAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQI 354
           ++E   + P+   LA ++                               Q ++ +QL  I
Sbjct: 578 KSEITLVTPKPEKLAPSR-------------------------------QDIFQEQLAAI 606

Query: 355 PEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVV 414
           PE    GPLFKSS +PV+LTE+ETEY V CVKHMF +++VFQF  TNTLNDQLLE VTV 
Sbjct: 607 PEFMNLGPLFKSS-EPVQLTEAETEYFVRCVKHMFTDHIVFQFDCTNTLNDQLLEKVTVQ 665

Query: 415 MQPESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTL-GSFSNTLKFLVKDCDP 473
           M+P      L     IPA  LPY+QP   Y   +  + +   + G+FS T+KF V+DCDP
Sbjct: 666 MEPSDSYEVLC---CIPAPSLPYNQPGICYTLVRLPDEDPTAVAGTFSCTMKFTVRDCDP 722

Query: 474 STXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKS 533
           +T                 +E+  SD++      +F++AW+ VG+  +  ETFAL+++K+
Sbjct: 723 NT-GVPDEDGYDDEYVLEDLEVTVSDHIQKILKPNFAAAWEEVGDAFEKEETFALSSTKT 781

Query: 534 LKDSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTM 592
           L+++   +I  LGM P E S   P + + H+L L+G + GG  +L ++R+  A   GVTM
Sbjct: 782 LEEAVNNIITFLGMQPCERSDKVPENKNSHSLYLAGVYRGGYDLLVRSRLALA--DGVTM 839

Query: 593 ELSVRSPSEEISRIVIGAV 611
           +++VRS       +++ +V
Sbjct: 840 QVTVRSKERTPVDVILASV 858



>gi|511827870|ref|XP_004738683.1| PREDICTED: coatomer subunit gamma-1 [Mustela putorius furo]
          Length = 874

 Score =  551 bits (1421), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 295/619 (47%), Positives = 395/619 (63%), Gaps = 47/619 (7%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 414 KRAIVDCIISIIEENTESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATTPMAE- 588

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTP---GVDQQQVYSQQLEQIP 355
                                          ST   AT  P      +Q+++ +QL  +P
Sbjct: 589 ---------------------------QRTESTPITATKQPEKVAATRQEIFQEQLAAVP 621

Query: 356 EIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVM 415
           E    GPLFKSS +PV LTESETEYV+ C KH F ++MVFQF  TNTLNDQ LENVTV M
Sbjct: 622 EFHGLGPLFKSSPEPVALTESETEYVIRCTKHTFTDHMVFQFDCTNTLNDQTLENVTVQM 681

Query: 416 QPESDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDP 473
           +P      L     +PA  LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP
Sbjct: 682 EPTEAYEVLC---YVPARSLPYNQPGTCYTLVALPKEDPXXVAC-TFSCMMKFTVKDCDP 737

Query: 474 STXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKS 533
           +T                 +E+  +D++      +F +AWD VG+E +  ETF L+  K+
Sbjct: 738 TT-GETDDEGYEDEYVLEDLEVTVADHIQKVMKLNFEAAWDEVGDEFEKEETFTLSTIKT 796

Query: 534 LKDSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTM 592
           L+++   +++ LGM P E S   P + + HTL+L+G F GG  +L ++R+    +  VTM
Sbjct: 797 LEEAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILVRSRLLLLDT--VTM 854

Query: 593 ELSVRSPSEEISRIVIGAV 611
           +++ RS  E    I++ +V
Sbjct: 855 QVTARSSEELPVDIILASV 873



>gi|301764543|ref|XP_002917686.1| PREDICTED: coatomer subunit gamma-like [Ailuropoda melanoleuca]
          Length = 874

 Score =  551 bits (1421), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 293/616 (47%), Positives = 396/616 (64%), Gaps = 41/616 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 414 KRAIVDCIISIIEENTESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATTPMAEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
                             S+    +     V+ +R          Q+++ +QL  +PE  
Sbjct: 590 RT---------------ESTPITAAKQPEKVAATR----------QEIFQEQLAAVPEFH 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV LTESETEYV+ C KH F ++MVFQF  TNTLNDQ LENVTV M+P 
Sbjct: 625 GLGPLFKSSPEPVALTESETEYVIRCTKHTFTDHMVFQFDCTNTLNDQTLENVTVQMEPT 684

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
                L     +PA  LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP+T 
Sbjct: 685 EAYEVLC---YVPARSLPYNQPGTCYTLVALPKEDPTAVAC-TFSCMMKFTVKDCDPTT- 739

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  +D++      +F +AWD VG+E +  ETF L+  K+L++
Sbjct: 740 GETDDEGYEDEYVLEDLEVTVADHIQKVMKLNFEAAWDEVGDEFEKEETFTLSTIKTLEE 799

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   +++ LGM P E S   P + + HTL+L+G F GG  +L ++R+    +  VTM+++
Sbjct: 800 AVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILVRSRLLLLDT--VTMQVT 857

Query: 596 VRSPSEEISRIVIGAV 611
            RS  E    I++ +V
Sbjct: 858 ARSSEELPVDIILASV 873



>gi|443727134|gb|ELU14014.1| hypothetical protein CAPTEDRAFT_162815 [Capitella teleta]
          Length = 869

 Score =  551 bits (1421), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 298/614 (48%), Positives = 397/614 (64%), Gaps = 37/614 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK TLRFAA+RTLNK+AM  P AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 289 LFCSSPKPTLRFAAVRTLNKVAMKHPAAVTACNLDLENLITDVNRSIATLAITTLLKTGS 348

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ FMSEISDEFK++VV AIRSLCLKFP K  +M++FLS +LRDEGG+E+
Sbjct: 349 ESSVDRLMKQISSFMSEISDEFKIVVVQAIRSLCLKFPRKHSIMMTFLSSMLRDEGGFEY 408

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   E+KEA LAHLCEFIEDCE T L+ R+LHLLG EGP+TP P KYI
Sbjct: 409 KRAIVDTIIGILEENSEAKEAGLAHLCEFIEDCEHTVLATRILHLLGKEGPRTPQPAKYI 468

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRVILE++ VRAAAVSALAKFG   +  E+  SI VLL R   D DDEVRDRA  Y
Sbjct: 469 RFIYNRVILEDAPVRAAAVSALAKFGAHCD--ELLPSIMVLLQRVQLDMDDEVRDRATFY 526

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L ++  ++ A    ++ +    S+  LER L  Y   P  +E PFDL  +P         
Sbjct: 527 LNILAQHQKALNSAFILNSLQVSIVGLERALHHYTMEP--TETPFDLKSVP--------- 575

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
                      +TQ +   S  +   +S   ST + A       +Q VY++QL  +PE+A
Sbjct: 576 ----------LATQPLQELSKPIMEASSGPKSTEKAAA-----SRQDVYAEQLASVPELA 620

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS  PVELTESETEY+V C+KH F  ++VFQF  TNTLNDQ+LENVTV M+  
Sbjct: 621 NLGPLFKSSSLPVELTESETEYMVRCIKHTFPHHLVFQFDCTNTLNDQVLENVTVQME-N 679

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXXX 478
           +D+  ++    +PA  L Y++P + Y   +          +F+ TLKF+VKDCDP+T   
Sbjct: 680 TDDFEVIRS--VPAASLVYEKPGTTYTLVRLPEDPTQVTTTFTCTLKFIVKDCDPNT-GE 736

Query: 479 XXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDSC 538
                         +E+  SD+V      +F+++W+ VG   ++ +T+AL + KS+ ++ 
Sbjct: 737 ADEEGYEDEYVLEDLEVTVSDHVQKVVKPNFAASWEEVGASNELEDTYALASMKSIDEAV 796

Query: 539 TTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSVR 597
            ++I+ +G+   E S   P   S HTL L+G F GG  VL + ++ F  S GVTM+++VR
Sbjct: 797 KSIIQFMGLQACERSDKVPDDKSSHTLYLAGVFRGGHDVLVRAKLAF--SEGVTMQITVR 854

Query: 598 SPSEEISRIVIGAV 611
           S     S ++  AV
Sbjct: 855 STDAYASEVLASAV 868



>gi|344275959|ref|XP_003409778.1| PREDICTED: coatomer subunit gamma [Loxodonta africana]
          Length = 874

 Score =  551 bits (1421), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 294/617 (47%), Positives = 399/617 (64%), Gaps = 43/617 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 414 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATAPIAEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINS-NIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
                            T S+ + ++     V+ +R          Q+++ +QL  +PE 
Sbjct: 590 R----------------TESTPITAVKQPEKVAATR----------QEIFQEQLAAVPEF 623

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
              GPLFKSS +PV LTESETEYVV C KH F ++MVFQF  TNTLNDQ LEN+TV M+P
Sbjct: 624 RGLGPLFKSSPEPVALTESETEYVVRCTKHTFTDHMVFQFDCTNTLNDQTLENITVQMEP 683

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPST 475
                 L     +PA  LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP+T
Sbjct: 684 TEAYEVLC---YVPARSLPYNQPGTCYTLVALPKEDPTAVAC-TFSCMMKFTVKDCDPTT 739

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLK 535
                            +E+  +D++      +F +AWD VG+E +  ETF L+  K+L+
Sbjct: 740 -GETDDEGYEDEYVLEDLEVTVADHIQKVMKVNFEAAWDEVGDEFEKEETFTLSTIKTLE 798

Query: 536 DSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
           ++   +++ LGM P E S   P + + HTL+L+G F GG  +L ++R+    +  VTM++
Sbjct: 799 EAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILVRSRLLLLDT--VTMQV 856

Query: 595 SVRSPSEEISRIVIGAV 611
           + RS  E    I++ +V
Sbjct: 857 TARSSEELPVDIILASV 873



>gi|449465393|ref|XP_004150412.1| PREDICTED: coatomer subunit gamma-like [Cucumis sativus]
 gi|449496814|ref|XP_004160233.1| PREDICTED: coatomer subunit gamma-like [Cucumis sativus]
          Length = 887

 Score =  551 bits (1421), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 299/609 (49%), Positives = 403/609 (66%), Gaps = 35/609 (5%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSS K  LRFAA+RTLNK+AM+ P AV +CN+DME+LI+DQNRS+AT AITTLLKTGN
Sbjct: 299 LFLSSSKPVLRFAAVRTLNKVAMSHPMAVTNCNIDMESLISDQNRSIATLAITTLLKTGN 358

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQIT FMS+I+DEFK++VV+AI+SLCLKFP K   +++FLS +LR+EGG+++
Sbjct: 359 ESSVDRLMKQITNFMSDIADEFKIVVVEAIKSLCLKFPLKYRSLMNFLSNILREEGGFDY 418

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K+A+V++I  L++ IP++KE+ L HLCEFIEDCEFT LS ++LH LG+EGPKT  P+KYI
Sbjct: 419 KKAIVDSIVILIRDIPDAKESGLLHLCEFIEDCEFTYLSTQILHFLGIEGPKTSDPSKYI 478

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV LEN+ VRA+AVS LA+FGV+ E   +K  I VLL RCL DNDDEVRDRA LY
Sbjct: 479 RYIYNRVHLENATVRASAVSTLARFGVTVE--SLKPRIFVLLRRCLFDNDDEVRDRATLY 536

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQY---VSNPESSEKPFDLSDIPKITKAQAE 297
           LK +  + +  +  KD + +   +L+  L+     + N E SE+PFD+  +PK  K+Q  
Sbjct: 537 LKTLGADGTVAETEKDATDFLFGSLDVPLINLETSLKNYEPSEEPFDIDSVPKEIKSQPL 596

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE   P           G   + +G+  S          PT  VD    Y + L  IPE 
Sbjct: 597 AEKKAP-----------GKKPAGLGAPPSG---------PTATVD---AYEKLLSSIPEF 633

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
           A FG LFKSS  PVELTE+ETEY V+ VKH+F  ++VFQ+  TNT+ +QLLENV VV+  
Sbjct: 634 ANFGKLFKSS-APVELTEAETEYAVNVVKHIFDSHVVFQYNCTNTIPEQLLENVFVVVDA 692

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYT-LGSFSNTLKFLVKDCDPSTX 476
            SD     E    P   LPYD P   +VAF++  PE  + +G FSN L+F+VK+ DPST 
Sbjct: 693 -SDAEEFSEVISRPLRSLPYDSPGQTFVAFEK--PEGVSAVGKFSNMLRFIVKEVDPST- 748

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+V++DY+    +S+F +AWDS+G + + V+ + L   +SL +
Sbjct: 749 GEAEEDGVEDEYQLEDLEVVSADYMLKVGVSNFKNAWDSLGPDCERVDEYGLGPRESLAE 808

Query: 537 SCTTLIELLGMSPVENS-GTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   +I LLGM P E +    ++S  HT +LSG ++G +KVL +       S  V M+L+
Sbjct: 809 AVGAVINLLGMQPCEGTEAVASNSRSHTCLLSGVYIGNVKVLVRLSFGIDSSREVAMKLA 868

Query: 596 VRSPSEEIS 604
           VRS  E +S
Sbjct: 869 VRSDDEVVS 877



>gi|18858453|ref|NP_571069.1| coatomer subunit gamma-2 [Danio rerio]
 gi|6179934|gb|AAF05717.1|AF191561_1 coatomer protein gamma2-COP [Danio rerio]
          Length = 873

 Score =  551 bits (1421), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 291/616 (47%), Positives = 400/616 (64%), Gaps = 42/616 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 354 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMNFLSNMLRDDGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++  PESKE  LAHLCEFIEDCE T L+ ++LHLLG EGP+TPTP+KYI
Sbjct: 414 KRAIVDCIISIIEENPESKETGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPTPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LE+  VRAAAVSALAKFG  A++ ++  S+ VL+ RC+ D+DDEVRDRA  Y
Sbjct: 474 RFIFNRVVLESEAVRAAAVSALAKFG--AQNDDLLPSVLVLMQRCMMDSDDEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           + ++   + A    Y+ +  + S+  LE+ L QY   P  SEKPFD+  +P  T    E 
Sbjct: 532 MNVLQQKQKALNAAYIFNGLSVSVLGLEKSLHQYTLEP--SEKPFDMKTVPLATAPITEH 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
           +           T+    ++S +       ++ SR          Q +Y +QL  IPE  
Sbjct: 590 K-----------TEIAPVATSKL----PEKLAPSR----------QDIYQEQLSAIPEFQ 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV+LTE+ETEYVV C+KH F  +M+FQF  TNTLNDQLL+ V V M+P 
Sbjct: 625 GLGPLFKSS-EPVQLTEAETEYVVRCIKHTFANHMIFQFDCTNTLNDQLLQKVLVQMEPS 683

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
                L     +PA  LPY QP S Y  V     +P   +  +FS T+K+LV+DCDP+T 
Sbjct: 684 ESYEVL---HYVPAANLPYSQPGSCYSLVRLPEDDPTAVSC-TFSCTMKYLVRDCDPNT- 738

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  +D++      +F++AWD VG+E +  ETFAL   ++L +
Sbjct: 739 GEPDDDGYDDEYVLEDLEVTVADHIQKVLKPNFAAAWDEVGDECEKEETFALATVRTLDE 798

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   ++  LGM P E S   P + + H L L+G F GG  VL + R+  A   GVTM+++
Sbjct: 799 AVNNIVSFLGMQPCERSDKVPENKNSHVLFLAGVFRGGHDVLVRARLALA--DGVTMQVT 856

Query: 596 VRSPSEEISRIVIGAV 611
           VRS  + +  +++ +V
Sbjct: 857 VRSTDDNVVDVILASV 872



>gi|281347012|gb|EFB22596.1| hypothetical protein PANDA_006034 [Ailuropoda melanoleuca]
          Length = 844

 Score =  551 bits (1420), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 293/616 (47%), Positives = 396/616 (64%), Gaps = 41/616 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 264 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 323

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 324 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 383

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 384 KRAIVDCIISIIEENTESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYI 443

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 444 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 501

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 502 LNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATTPMAEQ 559

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
                             S+    +     V+ +R          Q+++ +QL  +PE  
Sbjct: 560 RT---------------ESTPITAAKQPEKVAATR----------QEIFQEQLAAVPEFH 594

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV LTESETEYV+ C KH F ++MVFQF  TNTLNDQ LENVTV M+P 
Sbjct: 595 GLGPLFKSSPEPVALTESETEYVIRCTKHTFTDHMVFQFDCTNTLNDQTLENVTVQMEPT 654

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
                L     +PA  LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP+T 
Sbjct: 655 EAYEVLC---YVPARSLPYNQPGTCYTLVALPKEDPTAVAC-TFSCMMKFTVKDCDPTT- 709

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  +D++      +F +AWD VG+E +  ETF L+  K+L++
Sbjct: 710 GETDDEGYEDEYVLEDLEVTVADHIQKVMKLNFEAAWDEVGDEFEKEETFTLSTIKTLEE 769

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   +++ LGM P E S   P + + HTL+L+G F GG  +L ++R+    +  VTM+++
Sbjct: 770 AVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILVRSRLLLLDT--VTMQVT 827

Query: 596 VRSPSEEISRIVIGAV 611
            RS  E    I++ +V
Sbjct: 828 ARSSEELPVDIILASV 843



>gi|114589077|ref|XP_001141317.1| PREDICTED: coatomer subunit gamma-1 isoform 1 [Pan troglodytes]
          Length = 874

 Score =  551 bits (1420), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 294/617 (47%), Positives = 398/617 (64%), Gaps = 43/617 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 414 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTTNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATAPMAEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINS-NIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
                            T S+ + ++     V+ +R          Q+++ +QL  +PE 
Sbjct: 590 R----------------TESTPITAVKQPEKVAATR----------QEIFQEQLAAVPEF 623

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
              GPLFKSS +PV LTESETEYV+ C KH F  +MVFQF  TNTLNDQ LENVTV M+P
Sbjct: 624 RGLGPLFKSSPEPVALTESETEYVIRCTKHTFTNHMVFQFDCTNTLNDQTLENVTVQMEP 683

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPST 475
                 L     +PA  LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP+T
Sbjct: 684 TEAYEVLC---YVPARSLPYNQPGTCYTLVALPKEDPTAVAC-TFSCMMKFTVKDCDPTT 739

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLK 535
                            +E+  +D++      +F +AWD VG+E +  ETF L+  K+L+
Sbjct: 740 -GETDDEGYEDEYVLEDLEVTVADHIQKVMKLNFEAAWDEVGDEFEKEETFTLSTIKTLE 798

Query: 536 DSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
           ++   +++ LGM P E S   P + + HTL+L+G F GG  +L ++R+    +  VTM++
Sbjct: 799 EAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILVRSRLLLLDT--VTMQV 856

Query: 595 SVRSPSEEISRIVIGAV 611
           + RS  E    I++ +V
Sbjct: 857 TARSLEELPVDIILASV 873



>gi|8567340|ref|NP_059506.1| coatomer subunit gamma-2 [Mus musculus]
 gi|13124084|sp|Q9QXK3.1|COPG2_MOUSE RecName: Full=Coatomer subunit gamma-2; AltName: Full=Gamma-2-coat
           protein; Short=Gamma-2-COP
 gi|6573256|gb|AAF17607.1|AF205065_1 coatomer protein gamma2-COP [Mus musculus]
 gi|8919670|emb|CAB96146.1| coatomer protein gamma 2-subunit [Mus musculus]
 gi|29165813|gb|AAH49178.1| Coatomer protein complex, subunit gamma 2 [Mus musculus]
 gi|148877666|gb|AAI45901.1| Coatomer protein complex, subunit gamma 2 [Mus musculus]
 gi|148878338|gb|AAI45899.1| Coatomer protein complex, subunit gamma 2 [Mus musculus]
          Length = 871

 Score =  551 bits (1420), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 294/619 (47%), Positives = 401/619 (64%), Gaps = 50/619 (8%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 354 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCHKYPRKHSVMMTFLSNMLRDDGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K+A+V+ I  +V+  PESKEA LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 414 KKAIVDCIISIVEENPESKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 474 RFIFNRVVLENEAVRAAAVSALAKFG--AQNESLLPSILVLLQRCMMDTDDEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIP----KITKA 294
           L ++   + A    Y+ +  T S+  +E+ L QY   P  SEKPFD+  IP     + + 
Sbjct: 532 LNVLQQRQMALNATYIFNGLTVSIPGMEKALHQYTLEP--SEKPFDMKSIPLAMAPVFEQ 589

Query: 295 QAEAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQI 354
           ++E   + P+   LA ++                               Q ++ +QL  I
Sbjct: 590 KSEITLVTPKPEKLAPSR-------------------------------QDIFQEQLAAI 618

Query: 355 PEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVV 414
           PE    GPLFKSS +PV+LTE+ETEY V CVKHMF +++VFQF  TNTLNDQLLE VTV 
Sbjct: 619 PEFMNLGPLFKSS-EPVQLTEAETEYFVRCVKHMFTDHIVFQFDCTNTLNDQLLEKVTVQ 677

Query: 415 MQPESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTL-GSFSNTLKFLVKDCDP 473
           M+P      L     IPA  LPY+QP   Y   +  + +   + G+FS T+KF V+DCDP
Sbjct: 678 MEPSDSYEVLC---CIPAPSLPYNQPGICYTLVRLPDEDPTAVAGTFSCTMKFTVRDCDP 734

Query: 474 STXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKS 533
           +T                 +E+  SD++      +F++AW+ VG+  +  ETFAL+++K+
Sbjct: 735 NT-GVPDEDGYDDEYVLEDLEVTVSDHIQKILKPNFAAAWEEVGDAFEKEETFALSSTKT 793

Query: 534 LKDSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTM 592
           L+++   +I  LGM P E S   P + + H+L L+G + GG  +L ++R+  A   GVTM
Sbjct: 794 LEEAVNNIITFLGMQPCERSDKVPENKNSHSLYLAGVYRGGYDLLVRSRLALA--DGVTM 851

Query: 593 ELSVRSPSEEISRIVIGAV 611
           +++VRS       +++ +V
Sbjct: 852 QVTVRSKERTPVDVILASV 870



>gi|471355682|ref|XP_004368444.1| PREDICTED: coatomer subunit gamma-1 [Trichechus manatus
           latirostris]
          Length = 874

 Score =  551 bits (1420), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 293/617 (47%), Positives = 399/617 (64%), Gaps = 43/617 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 414 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATAPIAEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINS-NIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
                            T S+ + ++     V+ +R          Q+++ +QL  +PE 
Sbjct: 590 R----------------TESTPITTVKQPEKVAATR----------QEIFQEQLAAVPEF 623

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
              GPLFKSS +PV LTESETEYV+ C KH F ++MVFQF  TNTLNDQ LEN+TV M+P
Sbjct: 624 RGLGPLFKSSPEPVALTESETEYVIRCTKHTFTDHMVFQFDCTNTLNDQTLENITVQMEP 683

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPST 475
                 L     +PA  LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP+T
Sbjct: 684 TEAYEVLC---YVPARSLPYNQPGTCYTLVALPKEDPTAVAC-TFSCMMKFTVKDCDPTT 739

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLK 535
                            +E+  +D++      +F +AWD VG+E +  ETF L+  K+L+
Sbjct: 740 -GETDDEGYEDEYVLEDLEVTVADHIQKVMKVNFEAAWDEVGDEFEKEETFTLSTIKTLE 798

Query: 536 DSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
           ++   +++ LGM P E S   P + + HTL+L+G F GG  +L ++R+    +  VTM++
Sbjct: 799 EAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILVRSRLLLLDT--VTMQV 856

Query: 595 SVRSPSEEISRIVIGAV 611
           + RS  E    I++ +V
Sbjct: 857 TARSSEELPVDIILASV 873



>gi|504137882|ref|XP_004581396.1| PREDICTED: coatomer subunit gamma-1 [Ochotona princeps]
          Length = 874

 Score =  551 bits (1420), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 298/618 (48%), Positives = 399/618 (64%), Gaps = 44/618 (7%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 414 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATTPMAEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINS-NIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
                            T S+ + ++     V+ +R          Q+++ +QL  +PE 
Sbjct: 590 R----------------TESTPITAVKQPEKVAATR----------QEIFQEQLAAVPEF 623

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
              GPLFKSS +P  LTESETEYVV C KH F ++MVFQF  TNTLNDQ LENVTV M+P
Sbjct: 624 QGLGPLFKSSPEPAALTESETEYVVRCTKHTFADHMVFQFDCTNTLNDQTLENVTVQMEP 683

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPST 475
                 L     +PA  LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP+T
Sbjct: 684 TEAYEVLC---YVPARSLPYNQPGTCYTLVALPKEDPTTVAC-TFSCMMKFTVKDCDPTT 739

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLK 535
                            +E+  +D++      +F +AWD VG+E +  ETF L+  K+L+
Sbjct: 740 -GETDDEGYEDEYVLEDLEVTVADHIQKVMKVNFEAAWDEVGDEFEKEETFTLSTIKTLE 798

Query: 536 DSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
           ++   +++ LGM P E S   P + + HTL+L+G F GG  +L + R+    +  VTM++
Sbjct: 799 EAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILVRARLLLLDT--VTMQV 856

Query: 595 SVRSPSEEISRIVIGAVV 612
           + RS SEE+   VI A V
Sbjct: 857 TARS-SEELPVDVILASV 873



>gi|66910281|gb|AAH96860.1| Copg2 protein [Danio rerio]
 gi|182892180|gb|AAI65205.1| Copg2 protein [Danio rerio]
          Length = 873

 Score =  551 bits (1420), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 291/616 (47%), Positives = 400/616 (64%), Gaps = 42/616 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 354 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMNFLSNMLRDDGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++  PESKE  LAHLCEFIEDCE T L+ ++LHLLG EGP+TPTP+KYI
Sbjct: 414 KRAIVDCIISIIEENPESKETGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPTPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LE+  VRAAAVSALAKFG  A++ ++  S+ VL+ RC+ D+DDEVRDRA  Y
Sbjct: 474 RFIFNRVVLESEAVRAAAVSALAKFG--AQNDDLLPSVLVLMQRCMMDSDDEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           + ++   + A    Y+ +  + S+  LE+ L QY   P  SEKPFD+  +P  T    E 
Sbjct: 532 MNVLQQKQKALNAAYIFNGLSVSVLGLEKSLHQYTLEP--SEKPFDIKTVPLATAPITEH 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
           +           T+    ++S +       ++ SR          Q +Y +QL  IPE  
Sbjct: 590 K-----------TEIAPVATSKL----PEKLAPSR----------QDIYQEQLSAIPEFQ 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV+LTE+ETEYVV C+KH F  +M+FQF  TNTLNDQLL+ V V M+P 
Sbjct: 625 GLGPLFKSS-EPVQLTEAETEYVVRCIKHTFANHMIFQFDCTNTLNDQLLQKVLVQMEPS 683

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
                L     +PA  LPY QP S Y  V     +P   +  +FS T+K+LV+DCDP+T 
Sbjct: 684 ESYEVL---HYVPAANLPYSQPGSCYSLVRLPEDDPTAVSC-TFSCTMKYLVRDCDPNT- 738

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  +D++      +F++AWD VG+E +  ETFAL   ++L +
Sbjct: 739 GEPDDDGYDDEYVLEDLEVTVADHIQKVLKPNFAAAWDEVGDECEKEETFALATVRTLDE 798

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   ++  LGM P E S   P + + H L L+G F GG  VL + R+  A   GVTM+++
Sbjct: 799 AVNNIVSFLGMQPCERSDKVPENKNSHVLFLAGVFRGGHDVLVRARLALA--DGVTMQVT 856

Query: 596 VRSPSEEISRIVIGAV 611
           VRS  + +  +++ +V
Sbjct: 857 VRSTDDNVVDVILASV 872



>gi|11559929|ref|NP_057212.1| coatomer subunit gamma-1 [Homo sapiens]
 gi|397518588|ref|XP_003829466.1| PREDICTED: coatomer subunit gamma-1 [Pan paniscus]
 gi|402887085|ref|XP_003906935.1| PREDICTED: coatomer subunit gamma-1 [Papio anubis]
 gi|426342026|ref|XP_004036317.1| PREDICTED: coatomer subunit gamma-1 [Gorilla gorilla gorilla]
 gi|12229771|sp|Q9Y678.1|COPG1_HUMAN RecName: Full=Coatomer subunit gamma-1; AltName: Full=Gamma-1-coat
           protein; Short=Gamma-1-COP
 gi|5410298|gb|AAD43020.1| coat protein gamma-cop [Homo sapiens]
 gi|11094283|dbj|BAB17657.1| gamma1-COP [Homo sapiens]
 gi|44890366|gb|AAH66650.1| Coatomer protein complex, subunit gamma [Homo sapiens]
 gi|119599673|gb|EAW79267.1| coatomer protein complex, subunit gamma, isoform CRA_a [Homo
           sapiens]
 gi|261857844|dbj|BAI45444.1| coatomer protein complex, subunit gamma [synthetic construct]
          Length = 874

 Score =  551 bits (1420), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 294/617 (47%), Positives = 398/617 (64%), Gaps = 43/617 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 414 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTTNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATAPMAEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINS-NIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
                            T S+ + ++     V+ +R          Q+++ +QL  +PE 
Sbjct: 590 R----------------TESTPITAVKQPEKVAATR----------QEIFQEQLAAVPEF 623

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
              GPLFKSS +PV LTESETEYV+ C KH F  +MVFQF  TNTLNDQ LENVTV M+P
Sbjct: 624 RGLGPLFKSSPEPVALTESETEYVIRCTKHTFTNHMVFQFDCTNTLNDQTLENVTVQMEP 683

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPST 475
                 L     +PA  LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP+T
Sbjct: 684 TEAYEVLC---YVPARSLPYNQPGTCYTLVALPKEDPTAVAC-TFSCMMKFTVKDCDPTT 739

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLK 535
                            +E+  +D++      +F +AWD VG+E +  ETF L+  K+L+
Sbjct: 740 -GETDDEGYEDEYVLEDLEVTVADHIQKVMKLNFEAAWDEVGDEFEKEETFTLSTIKTLE 798

Query: 536 DSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
           ++   +++ LGM P E S   P + + HTL+L+G F GG  +L ++R+    +  VTM++
Sbjct: 799 EAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILVRSRLLLLDT--VTMQV 856

Query: 595 SVRSPSEEISRIVIGAV 611
           + RS  E    I++ +V
Sbjct: 857 TARSLEELPVDIILASV 873



>gi|119599676|gb|EAW79270.1| coatomer protein complex, subunit gamma, isoform CRA_d [Homo
           sapiens]
          Length = 768

 Score =  551 bits (1419), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 294/617 (47%), Positives = 398/617 (64%), Gaps = 43/617 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 188 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 247

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 248 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 307

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 308 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTTNPSKYI 367

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 368 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 425

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 426 LNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATAPMAEQ 483

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINS-NIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
                            T S+ + ++     V+ +R          Q+++ +QL  +PE 
Sbjct: 484 R----------------TESTPITAVKQPEKVAATR----------QEIFQEQLAAVPEF 517

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
              GPLFKSS +PV LTESETEYV+ C KH F  +MVFQF  TNTLNDQ LENVTV M+P
Sbjct: 518 RGLGPLFKSSPEPVALTESETEYVIRCTKHTFTNHMVFQFDCTNTLNDQTLENVTVQMEP 577

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPST 475
                 L     +PA  LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP+T
Sbjct: 578 TEAYEVLC---YVPARSLPYNQPGTCYTLVALPKEDPTAVAC-TFSCMMKFTVKDCDPTT 633

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLK 535
                            +E+  +D++      +F +AWD VG+E +  ETF L+  K+L+
Sbjct: 634 -GETDDEGYEDEYVLEDLEVTVADHIQKVMKLNFEAAWDEVGDEFEKEETFTLSTIKTLE 692

Query: 536 DSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
           ++   +++ LGM P E S   P + + HTL+L+G F GG  +L ++R+    +  VTM++
Sbjct: 693 EAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILVRSRLLLLDT--VTMQV 750

Query: 595 SVRSPSEEISRIVIGAV 611
           + RS  E    I++ +V
Sbjct: 751 TARSLEELPVDIILASV 767



>gi|432943073|ref|XP_004083090.1| PREDICTED: coatomer subunit gamma-2-like [Oryzias latipes]
          Length = 873

 Score =  551 bits (1419), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 289/615 (46%), Positives = 398/615 (64%), Gaps = 40/615 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 354 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMNFLSNMLRDDGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++  PESKE  LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 414 KRAIVDCIISIIEENPESKETGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPQPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LE+  VRAAAVSALAKFG  A++ ++  S+ VL+ RC+ D+DDEVRDRA  Y
Sbjct: 474 RFIFNRVVLESEAVRAAAVSALAKFG--AQNDDLLPSVLVLMQRCMMDSDDEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           + ++   + A    Y+ +  + S+  LE+ L QY   P  +EKPFD+  +P  T    E 
Sbjct: 532 MNVLQQKQKALNAAYIFNGLSVSIPGLEKSLHQYTLEP--TEKPFDMKSVPLATTPITE- 588

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
                        Q    +  A   +   +  + +D           +Y +QL  IPE  
Sbjct: 589 -------------QKTEIAPVATSKLPEKLAPSRQD-----------IYQEQLAAIPEFQ 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
           + GPLFKSS  PV+LTE+ETEYVV C+KH F  +MVFQF  TNTLNDQLL+ V V M+P 
Sbjct: 625 SLGPLFKSS-DPVQLTEAETEYVVRCIKHTFARHMVFQFDCTNTLNDQLLQKVVVQMEP- 682

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLG-SFSNTLKFLVKDCDPSTXX 477
             E   VE + +PA  LPY QP S Y   +  + +   +  +FS T+K+LV+DCDP+T  
Sbjct: 683 -SEAYEVEHY-LPALSLPYSQPGSCYTLIRLPDDDPTAVSCTFSCTMKYLVRDCDPNT-G 739

Query: 478 XXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDS 537
                          +E+  +D++      +F +AW+ VG+E +  ETFAL + ++L ++
Sbjct: 740 EPDDDGYDDEYVLEDLEVTVADHIQKVLKPNFGAAWEEVGDEFEKEETFALASVRTLDEA 799

Query: 538 CTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSV 596
              +I  LGM P E S   P + + H L L+G F GG  VL + R+  A   GVTM+++V
Sbjct: 800 VNNIISFLGMQPCERSDKVPENKNSHVLFLAGVFRGGHDVLVRARLALA--DGVTMQVTV 857

Query: 597 RSPSEEISRIVIGAV 611
           RS  E +  +++ +V
Sbjct: 858 RSSEETVVDVILASV 872



>gi|32425777|gb|AAH20498.2| COPG protein, partial [Homo sapiens]
          Length = 699

 Score =  551 bits (1419), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 294/617 (47%), Positives = 398/617 (64%), Gaps = 43/617 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 119 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 178

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 179 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 238

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 239 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTTNPSKYI 298

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 299 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 356

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 357 LNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATAPMAEQ 414

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINS-NIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
                            T S+ + ++     V+ +R          Q+++ +QL  +PE 
Sbjct: 415 R----------------TESTPITAVKQPEKVAATR----------QEIFQEQLAAVPEF 448

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
              GPLFKSS +PV LTESETEYV+ C KH F  +MVFQF  TNTLNDQ LENVTV M+P
Sbjct: 449 RGLGPLFKSSPEPVALTESETEYVIRCTKHTFTNHMVFQFDCTNTLNDQTLENVTVQMEP 508

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPST 475
                 L     +PA  LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP+T
Sbjct: 509 TEAYEVLC---YVPARSLPYNQPGTCYTLVALPKEDPTAVAC-TFSCMMKFTVKDCDPTT 564

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLK 535
                            +E+  +D++      +F +AWD VG+E +  ETF L+  K+L+
Sbjct: 565 -GETDDEGYEDEYVLEDLEVTVADHIQKVMKLNFEAAWDEVGDEFEKEETFTLSTIKTLE 623

Query: 536 DSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
           ++   +++ LGM P E S   P + + HTL+L+G F GG  +L ++R+    +  VTM++
Sbjct: 624 EAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILVRSRLLLLDT--VTMQV 681

Query: 595 SVRSPSEEISRIVIGAV 611
           + RS  E    I++ +V
Sbjct: 682 TARSLEELPVDIILASV 698



>gi|348514957|ref|XP_003445006.1| PREDICTED: coatomer subunit gamma-2-like [Oreochromis niloticus]
          Length = 873

 Score =  551 bits (1419), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 292/615 (47%), Positives = 398/615 (64%), Gaps = 40/615 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 354 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMNFLSNMLRDDGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++  PESKE  LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 414 KRAIVDCIISIIEENPESKETGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPQPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LE+  VRAAAVSALAKFG  A++ ++  S+ VLL RC+ D+DDEVRDRA  Y
Sbjct: 474 RFIFNRVVLESEAVRAAAVSALAKFG--AQNDDLLPSVLVLLQRCMMDSDDEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           + ++   + A    Y+ +  + S+  LE+ L QY   P  SEKPFD+  +P  T    E 
Sbjct: 532 MNVLQQKQKALNAAYIFNGLSVSIPGLEKSLHQYTLEP--SEKPFDMKTVPLATAPITE- 588

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
                        Q    +  A   +   +  + +D           +Y +QL  IPE  
Sbjct: 589 -------------QKTEIAPVATSKLPEKLAPSRQD-----------IYQEQLAAIPEFQ 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV+LTE+ETEYVV C+KH F  +MVFQF  TNTLNDQLL+ V V M+P 
Sbjct: 625 GLGPLFKSS-EPVQLTEAETEYVVRCIKHTFAGHMVFQFDCTNTLNDQLLQKVLVQMEPS 683

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLG-SFSNTLKFLVKDCDPSTXX 477
             E   V ++V PA  LPY QP S Y   +  + +   +  +FS T+K+LV+DCDP+T  
Sbjct: 684 --EAYEVVQYV-PAPSLPYSQPGSCYTLIRLPDDDPTAVSCTFSCTMKYLVRDCDPNT-G 739

Query: 478 XXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDS 537
                          +E+  +D++      +F +AWD VG+E +  ETFAL + ++L ++
Sbjct: 740 EPDDDGYDDEYVLEDLEVTVADHIQKVLKPNFGAAWDEVGDEFEKEETFALASVRTLDEA 799

Query: 538 CTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSV 596
              +I  LGM P E S   P + + H L L+G F GG  VL + R+  A   GVTM+++V
Sbjct: 800 VGNIISFLGMQPCERSDKVPENKNSHVLFLAGVFRGGHDVLVRARLALA--DGVTMQVTV 857

Query: 597 RSPSEEISRIVIGAV 611
           RS  E +  +++ +V
Sbjct: 858 RSGDENVVDVILASV 872



>gi|397484719|ref|XP_003813516.1| PREDICTED: coatomer subunit gamma-2 [Pan paniscus]
          Length = 799

 Score =  551 bits (1419), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 297/626 (47%), Positives = 396/626 (63%), Gaps = 64/626 (10%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 222 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 281

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 282 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEY 341

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +V+  PESKEA LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 342 KRAIVDCIISIVEENPESKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYI 401

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 402 RFIFNRVVLENEAVRAAAVSALAKFG--AQNESLLPSILVLLQRCMMDTDDEVRDRATFY 459

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIP--------- 289
           L ++   + A    Y+ +  T S+  +E+ L QY   P  SEKPFD+  IP         
Sbjct: 460 LNVLQQRQMALNATYIFNGLTVSVPGMEKALHQYTLEP--SEKPFDMKSIPLAMAPVFEQ 517

Query: 290 --KITKAQAEAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVY 347
             +IT    + E L P                                       +Q ++
Sbjct: 518 KAEITLVATKPEKLAP--------------------------------------SRQDIF 539

Query: 348 SQQLEQIPEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQL 407
            +QL  IPE    GPLFKSS +PV+LTE+ETEY V C+KHMF  ++VFQF  TNTLNDQL
Sbjct: 540 QEQLAAIPEFLNIGPLFKSS-EPVQLTEAETEYFVRCIKHMFTNHIVFQFDCTNTLNDQL 598

Query: 408 LENVTVVMQPESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTL-GSFSNTLKF 466
           LE VTV M+P      L     IPA  LPY+QP   Y   +  + +   + GSFS T+KF
Sbjct: 599 LEKVTVQMEPSDSYEVLS---CIPAPSLPYNQPGICYTLVRLPDDDPTAVAGSFSCTMKF 655

Query: 467 LVKDCDPSTXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETF 526
            V+DCDP+T                 +E+  SD++      +F++AW+ VG+  +  ETF
Sbjct: 656 TVRDCDPNT-GVPDEDGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDTFEKEETF 714

Query: 527 ALTASKSLKDSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFA 585
           AL+++K+L+++   +I  LGM P E S   P + + H+L L+G F GG  +L ++R+  A
Sbjct: 715 ALSSTKTLEEAVNNIITFLGMQPCERSDKVPENKNSHSLYLAGIFRGGYDLLVRSRLALA 774

Query: 586 PSTGVTMELSVRSPSEEISRIVIGAV 611
              GVTM+++VRS       +++ +V
Sbjct: 775 --DGVTMQVTVRSKERTPVDVILASV 798



>gi|10434610|dbj|BAB14315.1| unnamed protein product [Homo sapiens]
          Length = 799

 Score =  551 bits (1419), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 295/615 (47%), Positives = 395/615 (64%), Gaps = 42/615 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 222 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 281

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 282 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEY 341

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +V+  PESKEA LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 342 KRAIVDCIISIVEENPESKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYI 401

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 402 RFIFNRVVLENEAVRAAAVSALAKFG--AQNESLLPSILVLLQRCMMDTDDEVRDRATFY 459

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L ++   + A    Y+ +  T S+  +E+ L QY   P  SEKPFD+  IP       E 
Sbjct: 460 LNVLQQRQMALNATYIFNGLTVSVPGMEKALHQYTLEP--SEKPFDMKSIPLAMAPVFEQ 517

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
           +         A    + T    +                     +Q ++ +QL  IPE  
Sbjct: 518 K---------AEITLVATKPEKLAP------------------SRQDIFQEQLAAIPEFL 550

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV+LTE+ETEY V C+KHMF  ++VFQF  TNTLNDQLLE VTV M+P 
Sbjct: 551 NIGPLFKSS-EPVQLTEAETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQMEPS 609

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTL-GSFSNTLKFLVKDCDPSTXX 477
                L     IPA  LPY+QP   Y   +  + +   + GSFS T+KF V+DCDP+T  
Sbjct: 610 DSYEVLS---CIPAPSLPYNQPGICYTLVRLPDDDPTAVAGSFSCTMKFTVRDCDPNT-G 665

Query: 478 XXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDS 537
                          +E+  SD++      +F++AW+ VG+  +  ETFAL+++K+L+++
Sbjct: 666 VPDEDGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDTFEKEETFALSSTKTLEEA 725

Query: 538 CTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSV 596
              +I  LGM P E S   P + + H+L L+G F GG  +L ++R+  A   GVTM+++V
Sbjct: 726 VNNIITFLGMQPCERSDKVPENKNSHSLYLAGIFRGGYDLLVRSRLALA--DGVTMQVTV 783

Query: 597 RSPSEEISRIVIGAV 611
           RS       +++ +V
Sbjct: 784 RSKERTPVDVILASV 798



>gi|119599675|gb|EAW79269.1| coatomer protein complex, subunit gamma, isoform CRA_c [Homo
           sapiens]
          Length = 871

 Score =  551 bits (1419), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 294/617 (47%), Positives = 398/617 (64%), Gaps = 43/617 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 291 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 350

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 351 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 410

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 411 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTTNPSKYI 470

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 471 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 528

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 529 LNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATAPMAEQ 586

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINS-NIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
                            T S+ + ++     V+ +R          Q+++ +QL  +PE 
Sbjct: 587 R----------------TESTPITAVKQPEKVAATR----------QEIFQEQLAAVPEF 620

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
              GPLFKSS +PV LTESETEYV+ C KH F  +MVFQF  TNTLNDQ LENVTV M+P
Sbjct: 621 RGLGPLFKSSPEPVALTESETEYVIRCTKHTFTNHMVFQFDCTNTLNDQTLENVTVQMEP 680

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPST 475
                 L     +PA  LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP+T
Sbjct: 681 TEAYEVLC---YVPARSLPYNQPGTCYTLVALPKEDPTAVAC-TFSCMMKFTVKDCDPTT 736

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLK 535
                            +E+  +D++      +F +AWD VG+E +  ETF L+  K+L+
Sbjct: 737 -GETDDEGYEDEYVLEDLEVTVADHIQKVMKLNFEAAWDEVGDEFEKEETFTLSTIKTLE 795

Query: 536 DSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
           ++   +++ LGM P E S   P + + HTL+L+G F GG  +L ++R+    +  VTM++
Sbjct: 796 EAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILVRSRLLLLDT--VTMQV 853

Query: 595 SVRSPSEEISRIVIGAV 611
           + RS  E    I++ +V
Sbjct: 854 TARSLEELPVDIILASV 870



>gi|119599674|gb|EAW79268.1| coatomer protein complex, subunit gamma, isoform CRA_b [Homo
           sapiens]
          Length = 737

 Score =  551 bits (1419), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 294/617 (47%), Positives = 398/617 (64%), Gaps = 43/617 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 157 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 216

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 217 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 276

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 277 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTTNPSKYI 336

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 337 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 394

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 395 LNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATAPMAEQ 452

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINS-NIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
                            T S+ + ++     V+ +R          Q+++ +QL  +PE 
Sbjct: 453 R----------------TESTPITAVKQPEKVAATR----------QEIFQEQLAAVPEF 486

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
              GPLFKSS +PV LTESETEYV+ C KH F  +MVFQF  TNTLNDQ LENVTV M+P
Sbjct: 487 RGLGPLFKSSPEPVALTESETEYVIRCTKHTFTNHMVFQFDCTNTLNDQTLENVTVQMEP 546

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPST 475
                 L     +PA  LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP+T
Sbjct: 547 TEAYEVLC---YVPARSLPYNQPGTCYTLVALPKEDPTAVAC-TFSCMMKFTVKDCDPTT 602

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLK 535
                            +E+  +D++      +F +AWD VG+E +  ETF L+  K+L+
Sbjct: 603 -GETDDEGYEDEYVLEDLEVTVADHIQKVMKLNFEAAWDEVGDEFEKEETFTLSTIKTLE 661

Query: 536 DSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
           ++   +++ LGM P E S   P + + HTL+L+G F GG  +L ++R+    +  VTM++
Sbjct: 662 EAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILVRSRLLLLDT--VTMQV 719

Query: 595 SVRSPSEEISRIVIGAV 611
           + RS  E    I++ +V
Sbjct: 720 TARSLEELPVDIILASV 736



>gi|354482843|ref|XP_003503605.1| PREDICTED: coatomer subunit gamma isoform 1 [Cricetulus griseus]
 gi|344253369|gb|EGW09473.1| Coatomer subunit gamma [Cricetulus griseus]
          Length = 874

 Score =  551 bits (1419), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 295/616 (47%), Positives = 399/616 (64%), Gaps = 41/616 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 414 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATTPVAEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
              +P S    +T T+        +                   +Q+++ +QL  +PE  
Sbjct: 590 ---RPES---TATATVKQPEKVAAT-------------------RQEIFQEQLAAVPEFQ 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV LTESETEYV+ C KH F +++VFQF  TNTLNDQ LENVTV M+P 
Sbjct: 625 GLGPLFKSSPEPVALTESETEYVIRCTKHTFSDHLVFQFDCTNTLNDQTLENVTVQMEP- 683

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
             E   V  +V PA  LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP+T 
Sbjct: 684 -TEAYEVLSYV-PARSLPYNQPGTCYTLVALPKEDPTTVAC-TFSCVMKFTVKDCDPNT- 739

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  +D++      +F +AWD VG+E +  ETF L+  K+L++
Sbjct: 740 GEIDEEGYEDEYVLEDLEVTVADHIQKVMKVNFEAAWDEVGDEFEKEETFTLSTIKTLEE 799

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   +++ LGM P E S   P + + HTL+L+G F GG  +L + R+    +  VTM+++
Sbjct: 800 AVGNIVKFLGMHPCERSDKVPENKNTHTLLLAGVFRGGHDILVRARLLLLDT--VTMQVT 857

Query: 596 VRSPSEEISRIVIGAV 611
            RS  E    I++ +V
Sbjct: 858 ARSSEELPVDIILASV 873



>gi|350539577|ref|NP_001233167.1| coatomer subunit gamma-2 [Sus scrofa]
 gi|301087607|gb|ADK56184.1| coatomer protein complex subunit gamma 2 [Sus scrofa]
          Length = 871

 Score =  550 bits (1418), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 295/602 (49%), Positives = 394/602 (65%), Gaps = 42/602 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K P K  VM++FLS +LRD+GG+E+
Sbjct: 354 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKHPRKHSVMMTFLSNMLRDDGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I ++V+  PESKEA LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 414 KRAIVDCIINIVEENPESKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 474 RFIFNRVVLENEAVRAAAVSALAKFG--AQNENLLPSILVLLQRCMMDTDDEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L ++   + A    Y+ +  T S+  +E+ L QY   P  SEKPFD+  IP         
Sbjct: 532 LNVLQQRQMALNATYIFNGLTVSVPGMEKALHQYTLEP--SEKPFDMKSIPLA------- 582

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
             + P  F+  S  T+             + + S    P+    +Q ++ +QL  IPE  
Sbjct: 583 --MAP-VFEQKSEITL-------------VATKSEKLAPS----RQDIFQEQLAAIPEFM 622

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV+LTE+ETEY V CVKHMF  ++VFQF  TNTLNDQLLE VTV ++P 
Sbjct: 623 NLGPLFKSS-EPVQLTEAETEYFVRCVKHMFTHHVVFQFDCTNTLNDQLLEKVTVQVEPS 681

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEY-TLGSFSNTLKFLVKDCDPSTXX 477
                L     IPA  LPY+QP   Y   +  + +     G+FS T+KF V+DCDP T  
Sbjct: 682 DSYEVLC---CIPAASLPYNQPGICYTLVRLPDDDSIAAAGTFSCTMKFTVRDCDPDT-G 737

Query: 478 XXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDS 537
                          +E+  SD++      +F++AW+ VG+  +  ETFAL+++K+L+++
Sbjct: 738 VPAEEGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDTFEKEETFALSSTKTLEEA 797

Query: 538 CTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSV 596
            + +I  LGM P E S   P + + H L L+G + GG  +L ++R+  A   GVTM+++V
Sbjct: 798 VSNIITFLGMQPCERSDKVPENKNSHALYLAGVYRGGCDLLVRSRLALA--DGVTMQVTV 855

Query: 597 RS 598
           RS
Sbjct: 856 RS 857



>gi|109134349|ref|NP_036265.3| coatomer subunit gamma-2 [Homo sapiens]
 gi|332869077|ref|XP_519383.3| PREDICTED: coatomer subunit gamma-2 [Pan troglodytes]
 gi|13124090|sp|Q9UBF2.1|COPG2_HUMAN RecName: Full=Coatomer subunit gamma-2; AltName: Full=Gamma-2-coat
           protein; Short=Gamma-2-COP
 gi|6492310|gb|AAF14271.1|AF157833_1 nonclathrin coat protein gamma2-COP [Homo sapiens]
 gi|6625948|gb|AAF19433.1|AF207598_1 coat protein gamma2-COP [Homo sapiens]
 gi|11094285|dbj|BAB17658.1| gamma2-COP [Homo sapiens]
 gi|51094839|gb|EAL24085.1| coatomer protein complex, subunit gamma 2 [Homo sapiens]
 gi|119604175|gb|EAW83769.1| coatomer protein complex, subunit gamma 2 [Homo sapiens]
 gi|158256254|dbj|BAF84098.1| unnamed protein product [Homo sapiens]
          Length = 871

 Score =  550 bits (1418), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 295/615 (47%), Positives = 395/615 (64%), Gaps = 42/615 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 354 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +V+  PESKEA LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 414 KRAIVDCIISIVEENPESKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 474 RFIFNRVVLENEAVRAAAVSALAKFG--AQNESLLPSILVLLQRCMMDTDDEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L ++   + A    Y+ +  T S+  +E+ L QY   P  SEKPFD+  IP         
Sbjct: 532 LNVLQQRQMALNATYIFNGLTVSVPGMEKALHQYTLEP--SEKPFDMKSIPLA------- 582

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
             + P     A    + T    +                     +Q ++ +QL  IPE  
Sbjct: 583 --MAPVFEQKAEITLVATKPEKLAP------------------SRQDIFQEQLAAIPEFL 622

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV+LTE+ETEY V C+KHMF  ++VFQF  TNTLNDQLLE VTV M+P 
Sbjct: 623 NIGPLFKSS-EPVQLTEAETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQMEPS 681

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTL-GSFSNTLKFLVKDCDPSTXX 477
                L     IPA  LPY+QP   Y   +  + +   + GSFS T+KF V+DCDP+T  
Sbjct: 682 DSYEVLS---CIPAPSLPYNQPGICYTLVRLPDDDPTAVAGSFSCTMKFTVRDCDPNT-G 737

Query: 478 XXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDS 537
                          +E+  SD++      +F++AW+ VG+  +  ETFAL+++K+L+++
Sbjct: 738 VPDEDGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDTFEKEETFALSSTKTLEEA 797

Query: 538 CTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSV 596
              +I  LGM P E S   P + + H+L L+G F GG  +L ++R+  A   GVTM+++V
Sbjct: 798 VNNIITFLGMQPCERSDKVPENKNSHSLYLAGIFRGGYDLLVRSRLALA--DGVTMQVTV 855

Query: 597 RSPSEEISRIVIGAV 611
           RS       +++ +V
Sbjct: 856 RSKERTPVDVILASV 870



>gi|403256803|ref|XP_003921038.1| PREDICTED: coatomer subunit gamma-2 [Saimiri boliviensis
           boliviensis]
          Length = 871

 Score =  550 bits (1418), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 294/615 (47%), Positives = 395/615 (64%), Gaps = 42/615 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 354 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +V+  PESKEA LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 414 KRAIVDCIISIVEENPESKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 474 RFIFNRVVLENEAVRAAAVSALAKFG--AQNESLLPSILVLLQRCMMDTDDEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L ++   + A    Y+ +  T S+  +E+ L QY   P  SEKPFD+  IP         
Sbjct: 532 LNVLQQRQMALNATYIFNGLTVSVPGMEKALHQYTLEP--SEKPFDMKSIPLA------- 582

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
             + P     A    + T    +                     +Q ++ +QL  IPE  
Sbjct: 583 --MAPVFEQKAEITLVATKPEKLAP------------------SRQDIFQEQLAAIPEFM 622

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV+LTE+ETEY V C+KHMF  ++VFQF  TNTLNDQLLE VTV M+P 
Sbjct: 623 NIGPLFKSS-EPVQLTEAETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQMEPS 681

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTL-GSFSNTLKFLVKDCDPSTXX 477
                L     IPA  LPY+QP   Y   +  + +   + G+FS T+KF V+DCDP+T  
Sbjct: 682 DSYEVLC---CIPAPSLPYNQPGICYTLVRLPDDDPTAVAGTFSCTMKFTVRDCDPNT-G 737

Query: 478 XXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDS 537
                          +E+  SD++      +F++AW+ VG+  +  ETFAL+++K+L+++
Sbjct: 738 VPDEDGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDTFEKEETFALSSTKTLEEA 797

Query: 538 CTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSV 596
              +I  LGM P E S   P + + H+L L+G F GG  +L ++R+  A   GVTM+++V
Sbjct: 798 VNNIITFLGMQPCERSDKVPENKNSHSLYLAGIFRGGYDLLVRSRLALA--DGVTMQVTV 855

Query: 597 RSPSEEISRIVIGAV 611
           RS       +++ +V
Sbjct: 856 RSKERTPVDVILASV 870



>gi|126723233|ref|NP_001075917.1| coatomer subunit gamma-2 [Bos taurus]
 gi|193806726|sp|A2VE21.1|COPG2_BOVIN RecName: Full=Coatomer subunit gamma-2; AltName: Full=Gamma-2-coat
           protein; Short=Gamma-2-COP
 gi|126010675|gb|AAI33530.1| COPG2 protein [Bos taurus]
 gi|296488266|tpg|DAA30379.1| TPA: coatomer subunit gamma-2 [Bos taurus]
          Length = 871

 Score =  550 bits (1417), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 296/604 (49%), Positives = 393/604 (65%), Gaps = 46/604 (7%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 354 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +V+  PESKEA LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 414 KRAIVDCIIHIVEENPESKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 474 RFIFNRVVLENEAVRAAAVSALAKFG--AQNENLLPSILVLLQRCMMDTDDEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L ++   + A    Y+ +  T S+  +E+ L QY   P  SEKPFD+  IP  T    E 
Sbjct: 532 LNVLQQRQMALNATYIFNGLTVSVPGMEKALHQYTLEP--SEKPFDMKSIPLATAPVFE- 588

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
              +     L ST+    + S                       +Q ++ +QL  IPE  
Sbjct: 589 ---QKAEITLVSTKPEKLAPS-----------------------RQDIFQEQLAAIPEFM 622

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV+LTE+ETEY V CVKHMF  ++VFQF  TNTLNDQLLE VTV ++P 
Sbjct: 623 NLGPLFKSS-EPVQLTEAETEYFVRCVKHMFTNHIVFQFDCTNTLNDQLLEKVTVQVEPS 681

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTL---GSFSNTLKFLVKDCDPST 475
                L     +PA  LPY+QP   Y   +   PE+ ++   G+FS T+KF V+DCDP T
Sbjct: 682 EAYEVLC---CVPAPSLPYNQPGVCYTLVRL--PEDDSIAAAGTFSCTMKFTVRDCDPDT 736

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLK 535
                            +E+  SD++      +F++AW+ VG   +  ETFAL+++K+L+
Sbjct: 737 -GVPTEEGYDDEYVLEDLEVTVSDHIQKVMKPNFAAAWEEVGNTFEKEETFALSSTKTLE 795

Query: 536 DSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
           ++   +I  LGM P E S   P + + H+L L+G + GG  +L ++R+  A   GVTM++
Sbjct: 796 EAVNNIITFLGMQPCERSDKVPENKNSHSLYLAGVYRGGYDLLVRSRLALA--DGVTMQV 853

Query: 595 SVRS 598
           +VRS
Sbjct: 854 TVRS 857



>gi|48257296|gb|AAH17443.2| COPG2 protein, partial [Homo sapiens]
          Length = 865

 Score =  550 bits (1417), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 297/626 (47%), Positives = 396/626 (63%), Gaps = 64/626 (10%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 288 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 347

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 348 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEY 407

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +V+  PESKEA LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 408 KRAIVDCIISIVEENPESKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYI 467

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 468 RFIFNRVVLENEAVRAAAVSALAKFG--AQNESLLPSILVLLQRCMMDTDDEVRDRATFY 525

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIP--------- 289
           L ++   + A    Y+ +  T S+  +E+ L QY   P  SEKPFD+  IP         
Sbjct: 526 LNVLQQRQMALNATYIFNGLTVSVPGMEKALHQYTLEP--SEKPFDMKSIPLAMAPVFEQ 583

Query: 290 --KITKAQAEAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVY 347
             +IT    + E L P                                       +Q ++
Sbjct: 584 KAEITLVATKPEKLAP--------------------------------------SRQDIF 605

Query: 348 SQQLEQIPEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQL 407
            +QL  IPE    GPLFKSS +PV+LTE+ETEY V C+KHMF  ++VFQF  TNTLNDQL
Sbjct: 606 QEQLAAIPEFLNIGPLFKSS-EPVQLTEAETEYFVRCIKHMFTNHIVFQFDCTNTLNDQL 664

Query: 408 LENVTVVMQPESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTL-GSFSNTLKF 466
           LE VTV M+P      L     IPA  LPY+QP   Y   +  + +   + GSFS T+KF
Sbjct: 665 LEKVTVQMEPSDSYEVLS---CIPAPSLPYNQPGICYTLVRLPDDDPTAVAGSFSCTMKF 721

Query: 467 LVKDCDPSTXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETF 526
            V+DCDP+T                 +E+  SD++      +F++AW+ VG+  +  ETF
Sbjct: 722 TVRDCDPNT-GVPDEDGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDTFEKEETF 780

Query: 527 ALTASKSLKDSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFA 585
           AL+++K+L+++   +I  LGM P E S   P + + H+L L+G F GG  +L ++R+  A
Sbjct: 781 ALSSTKTLEEAVNNIITFLGMQPCERSDKVPENKNSHSLYLAGIFRGGYDLLVRSRLALA 840

Query: 586 PSTGVTMELSVRSPSEEISRIVIGAV 611
              GVTM+++VRS       +++ +V
Sbjct: 841 --DGVTMQVTVRSKERTPVDVILASV 864



>gi|73984948|ref|XP_533723.2| PREDICTED: coatomer subunit gamma [Canis lupus familiaris]
          Length = 874

 Score =  550 bits (1417), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 295/616 (47%), Positives = 398/616 (64%), Gaps = 41/616 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 414 KRAIVDCIISIIEENTESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATTPMAEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
                             S+    +     V+ +R          Q+++ +QL  +PE  
Sbjct: 590 RT---------------ESTPITAAKQPEKVAATR----------QEIFQEQLAAVPEFH 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV LTESETEYV+ C KH F ++MVFQF  TNTLNDQ LENVTV M+P 
Sbjct: 625 GLGPLFKSSPEPVALTESETEYVIRCTKHTFTDHMVFQFDCTNTLNDQTLENVTVQMEP- 683

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
             E   V  +V PA  LPY+QP + Y  V+  + +P      +FS  +KF VKDCDP+T 
Sbjct: 684 -TEAYEVVSYV-PARSLPYNQPGTCYTLVSLPKEDPTAVAC-TFSCMMKFTVKDCDPTT- 739

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +EI  +D++      +F +AWD VG+E +  ETF L+  K+L++
Sbjct: 740 GETDDEGYEDEYVLEDLEITVADHIQKVMKLNFEAAWDEVGDEFEKEETFTLSTIKTLEE 799

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   +++ LGM P E S   P + + HTL+L+G F GG  +L ++R+    +  VTM+++
Sbjct: 800 AVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILVRSRLLLLDT--VTMQVT 857

Query: 596 VRSPSEEISRIVIGAV 611
            RS  E    I++ +V
Sbjct: 858 ARSSEELPVDIILASV 873



>gi|148666818|gb|EDK99234.1| coatomer protein complex, subunit gamma, isoform CRA_b [Mus
           musculus]
          Length = 876

 Score =  550 bits (1417), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 297/616 (48%), Positives = 403/616 (65%), Gaps = 41/616 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 296 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 355

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 356 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 415

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 416 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYI 475

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 476 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 533

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LE+ L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 534 LNVLEQKQKALNAGYILNGLTVSIPGLEKALQQYTLEP--SEKPFDLKSVPLATTPMAEQ 591

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
              +P S          T+++AV       V+ +R          Q+++ +QL  +PE  
Sbjct: 592 ---RPES----------TATAAVKQPEK--VAATR----------QEIFQEQLAAVPEFQ 626

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV LTESETEYV+ C KH F +++VFQF  TNTLNDQ LENVTV M+P 
Sbjct: 627 GLGPLFKSSPEPVALTESETEYVIRCTKHTFSDHLVFQFDCTNTLNDQTLENVTVQMEP- 685

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
             E   V  +V PA  LPY+QP + Y  VA    +P      +FS  +KF VKDCDP+T 
Sbjct: 686 -TEAYEVLSYV-PARSLPYNQPGTCYTLVALPTEDPTAVAC-TFSCVMKFTVKDCDPNT- 741

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  +D++      +F +AWD VG+E +  ETF L+  K+L++
Sbjct: 742 GEIDEEGYEDEYVLEDLEVTVADHIQKVMKVNFEAAWDEVGDEFEKEETFTLSTIKTLEE 801

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   +++ LGM P E S   P + + HTL+L+G F GG  +L ++R+    +  VTM+++
Sbjct: 802 AVGNIVKFLGMHPCERSDKVPENKNTHTLLLAGVFRGGHDILVRSRLLLLDT--VTMQVT 859

Query: 596 VRSPSEEISRIVIGAV 611
            RS  E    I++ +V
Sbjct: 860 ARSSEELPVDIILASV 875



>gi|355748018|gb|EHH52515.1| hypothetical protein EGM_12967, partial [Macaca fascicularis]
          Length = 859

 Score =  550 bits (1417), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 295/619 (47%), Positives = 399/619 (64%), Gaps = 50/619 (8%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 282 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 341

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 342 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEY 401

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +V+  PESKEA LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 402 KRAIVDCIISIVEENPESKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYI 461

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 462 RFIFNRVVLENEAVRAAAVSALAKFG--AQNESLLPSILVLLQRCMMDTDDEVRDRATFY 519

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIP----KITKA 294
           L ++   + A    Y+ +  T S+  +E+ L QY   P  SEKPFD+  IP     + + 
Sbjct: 520 LNVLQQRQMALNATYIFNGLTVSVPGMEKALHQYTLEP--SEKPFDMKSIPLAMAPVFEQ 577

Query: 295 QAEAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQI 354
           +AE   +  +   LA +                               +Q ++ +QL  I
Sbjct: 578 KAEITFVATKPEKLAPS-------------------------------RQDIFQEQLAAI 606

Query: 355 PEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVV 414
           PE    GPLFKSS +PV+LTE+ETEY V C+KHMF  ++VFQF  TNTLNDQLLE VTV 
Sbjct: 607 PEFLNIGPLFKSS-EPVQLTEAETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQ 665

Query: 415 MQPESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTL-GSFSNTLKFLVKDCDP 473
           M+P      L     IPA  LPY+QP   Y   +  + +   + G+FS T+KF V+DCDP
Sbjct: 666 MEPSDSYEVLC---CIPAPSLPYNQPGICYTLVRLPDDDPTAVAGTFSCTMKFTVRDCDP 722

Query: 474 STXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKS 533
           +T                 +E+  SD++      +F++AW+ VG+  +  ETFAL+++K+
Sbjct: 723 NT-GVPDEDGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDTFEKEETFALSSTKT 781

Query: 534 LKDSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTM 592
           L+++   +I  LGM P E S   P + + H+L L+G F GG  +L ++R+  A   GVTM
Sbjct: 782 LEEAVNNIITFLGMQPCERSDKVPENKNSHSLYLAGIFRGGCDLLVRSRLALA--DGVTM 839

Query: 593 ELSVRSPSEEISRIVIGAV 611
           +++VRS       +++ +V
Sbjct: 840 QVTVRSKERTPVDVILASV 858



>gi|8567338|ref|NP_059505.1| coatomer subunit gamma-1 isoform 1 [Mus musculus]
 gi|81882043|sp|Q9QZE5.1|COPG1_MOUSE RecName: Full=Coatomer subunit gamma-1; AltName: Full=Gamma-1-coat
           protein; Short=Gamma-1-COP
 gi|6013383|gb|AAF01325.1|AF187079_1 coat protein gamma-cop [Mus musculus]
 gi|19354081|gb|AAH24686.1| Coatomer protein complex, subunit gamma [Mus musculus]
 gi|26340160|dbj|BAC33743.1| unnamed protein product [Mus musculus]
 gi|74141904|dbj|BAE41019.1| unnamed protein product [Mus musculus]
 gi|74179070|dbj|BAE42743.1| unnamed protein product [Mus musculus]
 gi|74190855|dbj|BAE28212.1| unnamed protein product [Mus musculus]
 gi|74192514|dbj|BAE43046.1| unnamed protein product [Mus musculus]
 gi|74216540|dbj|BAE37716.1| unnamed protein product [Mus musculus]
 gi|148666817|gb|EDK99233.1| coatomer protein complex, subunit gamma, isoform CRA_a [Mus
           musculus]
          Length = 874

 Score =  550 bits (1417), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 297/616 (48%), Positives = 403/616 (65%), Gaps = 41/616 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 414 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LE+ L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LNVLEQKQKALNAGYILNGLTVSIPGLEKALQQYTLEP--SEKPFDLKSVPLATTPMAEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
              +P S          T+++AV       V+ +R          Q+++ +QL  +PE  
Sbjct: 590 ---RPES----------TATAAVKQPEK--VAATR----------QEIFQEQLAAVPEFQ 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV LTESETEYV+ C KH F +++VFQF  TNTLNDQ LENVTV M+P 
Sbjct: 625 GLGPLFKSSPEPVALTESETEYVIRCTKHTFSDHLVFQFDCTNTLNDQTLENVTVQMEP- 683

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
             E   V  +V PA  LPY+QP + Y  VA    +P      +FS  +KF VKDCDP+T 
Sbjct: 684 -TEAYEVLSYV-PARSLPYNQPGTCYTLVALPTEDPTAVAC-TFSCVMKFTVKDCDPNT- 739

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  +D++      +F +AWD VG+E +  ETF L+  K+L++
Sbjct: 740 GEIDEEGYEDEYVLEDLEVTVADHIQKVMKVNFEAAWDEVGDEFEKEETFTLSTIKTLEE 799

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   +++ LGM P E S   P + + HTL+L+G F GG  +L ++R+    +  VTM+++
Sbjct: 800 AVGNIVKFLGMHPCERSDKVPENKNTHTLLLAGVFRGGHDILVRSRLLLLDT--VTMQVT 857

Query: 596 VRSPSEEISRIVIGAV 611
            RS  E    I++ +V
Sbjct: 858 ARSSEELPVDIILASV 873



>gi|426228031|ref|XP_004008118.1| PREDICTED: coatomer subunit gamma-2 [Ovis aries]
          Length = 799

 Score =  550 bits (1417), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 295/604 (48%), Positives = 394/604 (65%), Gaps = 46/604 (7%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 222 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 281

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 282 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEY 341

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +V+  PESKEA LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 342 KRAIVDCIISIVEENPESKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYI 401

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 402 RFIFNRVVLENEAVRAAAVSALAKFG--AQNENLLPSILVLLQRCMMDTDDEVRDRATFY 459

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L ++   + A    Y+ +  T S+  +E+ L QY   P  SEKPFD+  +P  T    E 
Sbjct: 460 LNVLQQRQMALNATYIFNGLTVSVPGMEKALHQYTLEP--SEKPFDMKSVPLATAPVFE- 516

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
              +     L ST+    + S                       +Q ++ +QL  IPE  
Sbjct: 517 ---QKAEITLVSTKPEKLAPS-----------------------RQDIFQEQLAAIPEFM 550

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV+LTE+ETEY V CVKHMF  ++VFQF  TNTLNDQLLE VTV ++P 
Sbjct: 551 NLGPLFKSS-EPVQLTEAETEYFVRCVKHMFTNHIVFQFDCTNTLNDQLLEKVTVQVEPS 609

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTL---GSFSNTLKFLVKDCDPST 475
                L     IPA  LPY+QP   Y   +   PE+ ++   G+FS T++F V+DCDP T
Sbjct: 610 ESYEVLC---CIPAPSLPYNQPGVCYTLVRL--PEDDSIAAAGTFSCTMRFTVRDCDPDT 664

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLK 535
                            +E+  SD++      +F++AW+ VG+  +  ETFAL+++K+L+
Sbjct: 665 -GVPAEEGYDDEYVLEDLEVTVSDHIQKVMKPNFAAAWEEVGDTFEKEETFALSSTKTLE 723

Query: 536 DSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
           ++   +I  LGM P E S   P + + H+L L+G + GG  +L ++R+  A   GVTM++
Sbjct: 724 EAVNNIITFLGMQPCERSDKVPENKNSHSLYLAGVYRGGYDLLVRSRLALA--DGVTMQV 781

Query: 595 SVRS 598
           +VRS
Sbjct: 782 TVRS 785



>gi|395847161|ref|XP_003796252.1| PREDICTED: coatomer subunit gamma-1 [Otolemur garnettii]
          Length = 874

 Score =  550 bits (1417), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 295/617 (47%), Positives = 396/617 (64%), Gaps = 43/617 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 414 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATTPLAEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINS-NIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
                            T S+ + ++     V+ +R          Q+++ +QL  +PE 
Sbjct: 590 R----------------TESAPISAVKQPEKVAATR----------QEIFQEQLAAVPEF 623

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
              GPLFKSS +PV LTESETEYV+ C KH F  +MVFQF  TNTLNDQ LENVTV M+P
Sbjct: 624 RGLGPLFKSSPEPVALTESETEYVIRCTKHTFTNHMVFQFDCTNTLNDQTLENVTVQMEP 683

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPST 475
                 L     +P   LPY+QP + Y  VA  + +P       FS  LKF VKDCDP+T
Sbjct: 684 TEAYEVLC---YVPTRSLPYNQPGTCYTLVALPKEDPTAVAC-MFSCMLKFTVKDCDPTT 739

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLK 535
                            +E+  +D++      +F +AWD VG+E +  ETF L+  K+L+
Sbjct: 740 -GETDDEGYEDEYVLEDLEVTVADHIQKVMKLNFEAAWDEVGDEFEKEETFTLSTIKTLE 798

Query: 536 DSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
           ++   +++ LGM P E S   P + + HTL+L+G F GG  +L ++R+    +  VTM++
Sbjct: 799 EAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILVRSRLLLLDT--VTMQV 856

Query: 595 SVRSPSEEISRIVIGAV 611
           + RS  E    IV+ +V
Sbjct: 857 TARSSEELPVDIVLASV 873



>gi|355560998|gb|EHH17684.1| hypothetical protein EGK_14141, partial [Macaca mulatta]
          Length = 859

 Score =  550 bits (1417), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 295/619 (47%), Positives = 399/619 (64%), Gaps = 50/619 (8%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 282 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 341

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 342 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEY 401

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +V+  PESKEA LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 402 KRAIVDCIISIVEENPESKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYI 461

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 462 RFIFNRVVLENEAVRAAAVSALAKFG--AQNESLLPSILVLLQRCMMDTDDEVRDRATFY 519

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIP----KITKA 294
           L ++   + A    Y+ +  T S+  +E+ L QY   P  SEKPFD+  IP     + + 
Sbjct: 520 LNVLQQRQVALNATYIFNGLTVSVPGMEKALHQYTLEP--SEKPFDMKSIPLAMAPVFEQ 577

Query: 295 QAEAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQI 354
           +AE   +  +   LA ++                               Q ++ +QL  I
Sbjct: 578 KAEITFVATKPEKLAPSR-------------------------------QDIFQEQLAAI 606

Query: 355 PEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVV 414
           PE    GPLFKSS +PV+LTE+ETEY V C+KHMF  ++VFQF  TNTLNDQLLE VTV 
Sbjct: 607 PEFLNIGPLFKSS-EPVQLTEAETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQ 665

Query: 415 MQPESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTL-GSFSNTLKFLVKDCDP 473
           M+P      L     IPA  LPY+QP   Y   +  + +   + G+FS T+KF V+DCDP
Sbjct: 666 MEPSDSYEVLC---CIPAPSLPYNQPGICYTLVRLPDDDPTAVAGTFSCTMKFTVRDCDP 722

Query: 474 STXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKS 533
           +T                 +E+  SD++      +F++AW+ VG+  +  ETFAL+++K+
Sbjct: 723 NT-GVPDEDGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDTFEKEETFALSSTKT 781

Query: 534 LKDSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTM 592
           L+++   +I  LGM P E S   P + + H+L L+G F GG  +L ++R+  A   GVTM
Sbjct: 782 LEEAVNNIITFLGMQPCERSDKVPENKNSHSLYLAGIFRGGCDLLVRSRLALA--DGVTM 839

Query: 593 ELSVRSPSEEISRIVIGAV 611
           +++VRS       +++ +V
Sbjct: 840 QVTVRSKERTPVDVILASV 858



>gi|14250257|gb|AAH08553.1| Copg protein, partial [Mus musculus]
          Length = 635

 Score =  550 bits (1416), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 297/616 (48%), Positives = 403/616 (65%), Gaps = 41/616 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 55  LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 114

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 115 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 174

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 175 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYI 234

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 235 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 292

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LE+ L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 293 LNVLEQKQKALNAGYILNGLTVSIPGLEKALQQYTLEP--SEKPFDLKSVPLATTPMAEQ 350

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
              +P S          T+++AV       V+ +R          Q+++ +QL  +PE  
Sbjct: 351 ---RPES----------TATAAVKQPEK--VAATR----------QEIFQEQLAAVPEFQ 385

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV LTESETEYV+ C KH F +++VFQF  TNTLNDQ LENVTV M+P 
Sbjct: 386 GLGPLFKSSPEPVALTESETEYVIRCTKHTFSDHLVFQFDCTNTLNDQTLENVTVQMEP- 444

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
             E   V  +V PA  LPY+QP + Y  VA    +P      +FS  +KF VKDCDP+T 
Sbjct: 445 -TEAYEVLSYV-PARSLPYNQPGTCYTLVALPTEDPTAVAC-TFSCVMKFTVKDCDPNT- 500

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  +D++      +F +AWD VG+E +  ETF L+  K+L++
Sbjct: 501 GEIDEEGYEDEYVLEDLEVTVADHIQKVMKVNFEAAWDEVGDEFEKEETFTLSTIKTLEE 560

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   +++ LGM P E S   P + + HTL+L+G F GG  +L ++R+    +  VTM+++
Sbjct: 561 AVGNIVKFLGMHPCERSDKVPENKNTHTLLLAGVFRGGHDILVRSRLLLLDT--VTMQVT 618

Query: 596 VRSPSEEISRIVIGAV 611
            RS  E    I++ +V
Sbjct: 619 ARSSEELPVDIILASV 634



>gi|193806152|sp|Q9PUE4.2|COPG2_DANRE RecName: Full=Coatomer subunit gamma-2; AltName: Full=Gamma-2-coat
           protein; Short=Gamma-2-COP
          Length = 873

 Score =  549 bits (1415), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 290/616 (47%), Positives = 400/616 (64%), Gaps = 42/616 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 354 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMNFLSNMLRDDGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++  PESKE  LAHLCEFIEDCE T L+ ++LHLLG EGP+TPTP+KYI
Sbjct: 414 KRAIVDCIISIIEENPESKETGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPTPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LE+  VRAAAVSALAKFG  A++ ++  S+ VL+ RC+ D+DDEVRDRA  Y
Sbjct: 474 RFIFNRVVLESEAVRAAAVSALAKFG--AQNDDLLPSVLVLMQRCMMDSDDEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           + ++   + A    Y+ +  + S+  LE+ L QY   P  SEKPFD+  +P  T    E 
Sbjct: 532 MNVLQQKQKALNAAYIFNGLSVSVLGLEKSLHQYTLEP--SEKPFDMKTVPLATAPITEH 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
           +           T+    ++S +       ++ SR          Q +Y +QL  IPE  
Sbjct: 590 K-----------TEIAPVATSKL----PEKLAPSR----------QDIYQEQLSAIPEFQ 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV+LTE+ETEYVV C+KH F  +M+FQF  TNTLNDQLL+ V V M+P 
Sbjct: 625 GLGPLFKSS-EPVQLTEAETEYVVRCIKHTFANHMIFQFDCTNTLNDQLLQKVLVQMEPS 683

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
                L     +PA  LPY QP S Y  V     +P   +  +FS T+K+LV+DCDP+T 
Sbjct: 684 ESYEVL---HYVPAANLPYSQPGSCYSLVRLPEDDPTAVSC-TFSCTMKYLVRDCDPNT- 738

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  +D++      +F++AWD VG+E +  ETFAL   ++L +
Sbjct: 739 GEPDDDGYDDEYVLEDLEVTVADHIQKVLKPNFAAAWDEVGDECEKEETFALATVRTLDE 798

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   ++  LGM P E S   P + + H L L+G F GG  VL + R+  A   GVT++++
Sbjct: 799 AVNNIVSFLGMQPCERSDKVPENKNSHVLFLAGVFRGGHDVLVRARLALA--DGVTIQVT 856

Query: 596 VRSPSEEISRIVIGAV 611
           VRS  + +  +++ +V
Sbjct: 857 VRSTDDNVVDVILASV 872



>gi|213513461|ref|NP_001133706.1| Coatomer subunit gamma-2 [Salmo salar]
 gi|209155020|gb|ACI33742.1| Coatomer subunit gamma-2 [Salmo salar]
          Length = 873

 Score =  549 bits (1415), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 294/616 (47%), Positives = 400/616 (64%), Gaps = 42/616 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 354 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMNFLSNMLRDDGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++  PESKE  LAHLCEFIEDCE T L+ ++LHLLG EGP+TP+P+KYI
Sbjct: 414 KRAIVDCIISIIEENPESKETGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPSPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LE+  VRAAAVSALAKFG  A++ ++  S+ VL+ RC+ D+DDEVRDRA  Y
Sbjct: 474 RFIFNRVVLESEAVRAAAVSALAKFG--AQNDDLLPSVLVLMQRCMMDSDDEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           + ++   + A    Y+ +  + S+  LE+ L QY   P  +EKPFD+  +P         
Sbjct: 532 MNVLQQKQKALNAAYIFNGLSVSVPGLEKSLHQYTLEP--TEKPFDMKSVP--------- 580

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
                    LA+T      +          V+TS+     PG  +Q +Y +QL  IPE  
Sbjct: 581 ---------LANTPITEQKTEFAP------VATSK-LPEKPGPTRQDIYQEQLAAIPEFQ 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             G LFK+S + V+LTE+ETEYVV CVKH F  +MVFQF  TNTLNDQLL+ V V M+P 
Sbjct: 625 GLGSLFKTS-EAVQLTEAETEYVVRCVKHTFARHMVFQFDCTNTLNDQLLQKVMVQMEPS 683

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
                L     +PA  LPY QP S Y  V     +P   +  +FS TLK+LVKDCDP+T 
Sbjct: 684 EAYEVL---HYVPAANLPYSQPGSCYSLVRLPEDDPTAVSC-TFSCTLKYLVKDCDPNT- 738

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  +D++      +F++AWD VG++ +  ETFAL + ++L +
Sbjct: 739 GEPDDDGYDDEYVLEDLEVTVADHIQKVLKPNFAAAWDEVGDDFEKEETFALASVRTLDE 798

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   +I  LGM P E S   P + + H L L+G F GG  VL ++R+  A   GVTM+++
Sbjct: 799 AVGNIISFLGMQPCERSDKVPENKNSHILFLAGVFRGGHDVLVRSRLALA--DGVTMQVT 856

Query: 596 VRSPSEEISRIVIGAV 611
           VRS  E +  I++ +V
Sbjct: 857 VRSSDETVVDIILASV 872



>gi|19354315|gb|AAH24896.1| Coatomer protein complex, subunit gamma [Mus musculus]
          Length = 874

 Score =  549 bits (1415), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 297/616 (48%), Positives = 403/616 (65%), Gaps = 41/616 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 414 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LE+ L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LNVLEQKQKALNAGYILNGLTVSIPGLEKALQQYTLEP--SEKPFDLKSVPLATTPMAEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
              +P S          T+++AV       V+ +R          Q+++ +QL  +PE  
Sbjct: 590 ---RPES----------TATAAVKQPEK--VAATR----------QEIFQEQLAAVPEFQ 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV LTESETEYV+ C KH F +++VFQF  TNTLNDQ LENVTV M+P 
Sbjct: 625 GLGPLFKSSPEPVALTESETEYVIRCTKHTFSDHLVFQFDCTNTLNDQTLENVTVQMEP- 683

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
             E   V  +V PA  LPY+QP + Y  VA    +P      +FS  +KF VKDCDP+T 
Sbjct: 684 -TEAYEVLSYV-PARSLPYNQPGTCYTLVALPTEDPTAVAC-TFSCVMKFTVKDCDPNT- 739

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  +D++      +F +AWD VG+E +  ETF L+  K+L++
Sbjct: 740 GEIDEEGYEDEYVLEDLEVTVADHIQKVMKVNFEAAWDEVGDEFEKEETFTLSTIKTLEE 799

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   +++ LGM P E S   P + + HTL+L+G F GG  +L ++R+    +  VTM+++
Sbjct: 800 AVGNIVKFLGMPPCERSDKVPENKNTHTLLLAGVFRGGHDILVRSRLLLLDT--VTMQVT 857

Query: 596 VRSPSEEISRIVIGAV 611
            RS  E    I++ +V
Sbjct: 858 ARSSEELPVDIILASV 873



>gi|73532768|ref|NP_001026992.1| coatomer subunit gamma-1 [Rattus norvegicus]
 gi|123797612|sp|Q4AEF8.1|COPG1_RAT RecName: Full=Coatomer subunit gamma-1; AltName: Full=Gamma-1-coat
           protein; Short=Gamma-1-COP
 gi|71891597|dbj|BAE16997.1| coatomer protein complex, subunit gamma [Rattus norvegicus]
 gi|71891599|dbj|BAE16998.1| coatomer protein complex, subunit gamma [Rattus norvegicus]
 gi|120537420|gb|AAI29075.1| Coatomer protein complex, subunit gamma [Rattus norvegicus]
 gi|149036679|gb|EDL91297.1| coatomer protein complex, subunit gamma [Rattus norvegicus]
          Length = 874

 Score =  549 bits (1415), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 296/616 (48%), Positives = 402/616 (65%), Gaps = 41/616 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 414 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LE+ L QY   P  SEKPFDL  +P  T    E 
Sbjct: 532 LNVLEQKQKALNAGYILNGLTVSIPGLEKALQQYTLEP--SEKPFDLKSVPLATTPMTEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
              +P S          TS++AV       V+ +R          Q+++ +QL  +PE  
Sbjct: 590 ---RPES----------TSTAAVKQPEK--VAATR----------QEIFQEQLAAVPEFQ 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV LTESETEYV+ C KH F +++VFQF  TNTLNDQ LENVTV M+P 
Sbjct: 625 GLGPLFKSSPEPVALTESETEYVIRCTKHTFSDHLVFQFDCTNTLNDQTLENVTVQMEP- 683

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
             E   V  +V P   LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP+T 
Sbjct: 684 -TEAYEVLSYV-PVRSLPYNQPGTCYTLVALPKEDPTAVAC-TFSCVMKFTVKDCDPNT- 739

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  +D++      +F +AWD VG+E +  ETF L+  K+L++
Sbjct: 740 GEIDEEGYEDEYVLEDLEVTVADHIQKVMKVNFEAAWDEVGDEFEKEETFTLSTIKTLEE 799

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   +++ LGM P E S   P + + HTL+L+G F GG  +L ++R+    +  VTM+++
Sbjct: 800 AVGNIVKFLGMHPCERSDKVPENKNTHTLLLAGVFRGGHDILVRSRLLLLDT--VTMQVT 857

Query: 596 VRSPSEEISRIVIGAV 611
            RS  E    I++ +V
Sbjct: 858 ARSSEELPVDIILASV 873



>gi|351705713|gb|EHB08632.1| Coatomer subunit gamma-2 [Heterocephalus glaber]
          Length = 844

 Score =  549 bits (1414), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 295/619 (47%), Positives = 399/619 (64%), Gaps = 50/619 (8%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 267 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 326

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 327 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEY 386

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +V+  P+SKEA LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 387 KRAIVDCIITIVEENPDSKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYI 446

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  +RAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 447 RFIFNRVVLENEAIRAAAVSALAKFG--AQNENLLPSILVLLQRCMMDTDDEVRDRATFY 504

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIP----KITKA 294
           L ++   + A    Y+ +  T S+  +E+ L QY   P  SEKPFDL  IP     + + 
Sbjct: 505 LNVLQQRQMALNATYIFNGLTVSVPGMEKALHQYTLEP--SEKPFDLKSIPLAMAPVFEQ 562

Query: 295 QAEAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQI 354
           +AE   + P+   LA ++                               Q ++ +QL  I
Sbjct: 563 KAEITLVAPKPEKLAPSR-------------------------------QDIFQEQLAAI 591

Query: 355 PEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVV 414
           PE    GPLFKSS +PV+LTE+ETEY V C+KHMF  ++VFQF  TNTLNDQLLE VTV 
Sbjct: 592 PEFMNLGPLFKSS-EPVQLTEAETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQ 650

Query: 415 MQPESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTL-GSFSNTLKFLVKDCDP 473
           M+P      L     IPA  L Y+QP   Y   +  + +   + GSFS T+KF V+DCDP
Sbjct: 651 MEPSDSFEVLC---CIPAPNLTYNQPGICYTLVRLPDEDPTAVAGSFSCTMKFTVRDCDP 707

Query: 474 STXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKS 533
           +T                 +E+  SD++      +FS+AW+ VG+  +  ETFAL+++K+
Sbjct: 708 NT-GVPDEDGYDDEYVLEDLEVSVSDHIQKVLKPNFSAAWEEVGDTFEKEETFALSSTKT 766

Query: 534 LKDSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTM 592
           L+++   +I  LGM P E S   P + + H+L L+G + GG  +L ++R+  A   GVTM
Sbjct: 767 LEEAVNNIITFLGMQPCERSDKVPENKNSHSLYLAGVYRGGYDLLVRSRLALA--DGVTM 824

Query: 593 ELSVRSPSEEISRIVIGAV 611
           +++VRS       +++ +V
Sbjct: 825 QVTVRSKERTPVDVILASV 843



>gi|74139818|dbj|BAE31753.1| unnamed protein product [Mus musculus]
 gi|74191375|dbj|BAE30269.1| unnamed protein product [Mus musculus]
 gi|74198992|dbj|BAE30713.1| unnamed protein product [Mus musculus]
          Length = 874

 Score =  549 bits (1414), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 296/616 (48%), Positives = 402/616 (65%), Gaps = 41/616 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 414 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LE+ L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LNVLEQKQKALNAGYILNGLTVSIPGLEKALQQYTLEP--SEKPFDLKSVPLATTPMAEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
              +P S          T+++AV       V+ +R          Q+++ +QL  +PE  
Sbjct: 590 ---RPES----------TATAAVKQPEK--VAATR----------QEIFQEQLAAVPEFQ 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV LTESETEYV+ C KH F +++VFQF  TNTLNDQ LENVTV M+P 
Sbjct: 625 GLGPLFKSSPEPVALTESETEYVIRCTKHTFSDHLVFQFDCTNTLNDQTLENVTVQMEP- 683

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
             E   V  +V PA  LPY+QP + Y  VA    +P      +FS  +KF VKDCDP+T 
Sbjct: 684 -TEAYEVLSYV-PARSLPYNQPGTCYTLVALPTEDPTAVAC-TFSCVMKFTVKDCDPNT- 739

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  +D++      +F +AWD VG+E +  ETF L+  K+L++
Sbjct: 740 GEIDEEGYEDEYVLEDLEVTVADHIQKVMKVNFEAAWDEVGDEFEKEETFTLSTIKTLEE 799

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   +++ LGM P E S   P + + HTL+L+G F GG  +  ++R+    +  VTM+++
Sbjct: 800 AVGNIVKFLGMHPCERSDKVPENKNTHTLLLAGVFRGGHDIFVRSRLLLLDT--VTMQVT 857

Query: 596 VRSPSEEISRIVIGAV 611
            RS  E    I++ +V
Sbjct: 858 ARSSEELPVDIILASV 873



>gi|512874469|ref|XP_004893442.1| PREDICTED: coatomer subunit gamma-2 [Heterocephalus glaber]
 gi|512988931|ref|XP_004856380.1| PREDICTED: coatomer subunit gamma-2 [Heterocephalus glaber]
          Length = 871

 Score =  549 bits (1414), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 295/619 (47%), Positives = 399/619 (64%), Gaps = 50/619 (8%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 354 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +V+  P+SKEA LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 414 KRAIVDCIITIVEENPDSKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  +RAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 474 RFIFNRVVLENEAIRAAAVSALAKFG--AQNENLLPSILVLLQRCMMDTDDEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIP----KITKA 294
           L ++   + A    Y+ +  T S+  +E+ L QY   P  SEKPFDL  IP     + + 
Sbjct: 532 LNVLQQRQMALNATYIFNGLTVSVPGMEKALHQYTLEP--SEKPFDLKSIPLAMAPVFEQ 589

Query: 295 QAEAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQI 354
           +AE   + P+   LA ++                               Q ++ +QL  I
Sbjct: 590 KAEITLVAPKPEKLAPSR-------------------------------QDIFQEQLAAI 618

Query: 355 PEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVV 414
           PE    GPLFKSS +PV+LTE+ETEY V C+KHMF  ++VFQF  TNTLNDQLLE VTV 
Sbjct: 619 PEFMNLGPLFKSS-EPVQLTEAETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQ 677

Query: 415 MQPESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTL-GSFSNTLKFLVKDCDP 473
           M+P      L     IPA  L Y+QP   Y   +  + +   + GSFS T+KF V+DCDP
Sbjct: 678 MEPSDSFEVLC---CIPAPNLTYNQPGICYTLVRLPDEDPTAVAGSFSCTMKFTVRDCDP 734

Query: 474 STXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKS 533
           +T                 +E+  SD++      +FS+AW+ VG+  +  ETFAL+++K+
Sbjct: 735 NT-GVPDEDGYDDEYVLEDLEVSVSDHIQKVLKPNFSAAWEEVGDTFEKEETFALSSTKT 793

Query: 534 LKDSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTM 592
           L+++   +I  LGM P E S   P + + H+L L+G + GG  +L ++R+  A   GVTM
Sbjct: 794 LEEAVNNIITFLGMQPCERSDKVPENKNSHSLYLAGVYRGGYDLLVRSRLALA--DGVTM 851

Query: 593 ELSVRSPSEEISRIVIGAV 611
           +++VRS       +++ +V
Sbjct: 852 QVTVRSKERTPVDVILASV 870



>gi|410918755|ref|XP_003972850.1| PREDICTED: coatomer subunit gamma-2-like [Takifugu rubripes]
          Length = 873

 Score =  548 bits (1413), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 290/615 (47%), Positives = 397/615 (64%), Gaps = 40/615 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 354 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMNFLSNMLRDDGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++  PESKE  LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 414 KRAIVDCIISIIEENPESKETGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPQPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LE+  VRAAAVSALAKFG  A++ ++  S+ VL+ RC+ D+DDEVRDRA  Y
Sbjct: 474 RFIFNRVVLESEAVRAAAVSALAKFG--AQNDDLLPSVLVLMQRCMMDSDDEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           + ++   + A    Y+ +  + S+  LE+ L QY   P  SEKPFD+  +P  T    E 
Sbjct: 532 MNVLQQKQKALNAAYIFNGLSVSIPGLEKSLHQYTLEP--SEKPFDMKSVPLATTPITE- 588

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
                        Q    + +A   +   +  + +D           +Y +QL  IPE  
Sbjct: 589 -------------QKTEIAPAATSKLPEKLAPSRQD-----------IYQEQLAAIPEFQ 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS  PV+LTE+ETEYVV C+KH F  +MVFQF  TNTLNDQLL+ V V M+P 
Sbjct: 625 GLGPLFKSS-DPVQLTEAETEYVVRCIKHTFARHMVFQFDCTNTLNDQLLQKVLVQMEP- 682

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLG-SFSNTLKFLVKDCDPSTXX 477
             E   V  + IPA  LPY QP S Y   +  + +   +  +FS T+K+LV+DCDP+T  
Sbjct: 683 -SEAYEVIHY-IPAPSLPYSQPGSCYSLVRLPDDDPTAVSCTFSCTMKYLVRDCDPNT-G 739

Query: 478 XXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDS 537
                          +E+  +D++      +F +AW+ VG+E +  ETFAL + ++L ++
Sbjct: 740 EPDDDGYDDEYVLEDLEVTVADHIQKVLKPNFGAAWEEVGDEFEKEETFALASVRTLDEA 799

Query: 538 CTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSV 596
              +I  LGM P E S   P + + H L L+G F GG  VL + R+  A   GVTM+++V
Sbjct: 800 VGNIISFLGMQPCERSDKVPENKNSHVLFLAGVFRGGHDVLVRARLALA--DGVTMQVTV 857

Query: 597 RSPSEEISRIVIGAV 611
           RS  E +  +++ +V
Sbjct: 858 RSSEETVVDVILASV 872



>gi|344242096|gb|EGV98199.1| Coatomer subunit gamma-2 [Cricetulus griseus]
          Length = 808

 Score =  548 bits (1413), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 297/615 (48%), Positives = 402/615 (65%), Gaps = 42/615 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 231 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 290

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 291 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEY 350

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K+A+V+ I  +V+  PESKEA LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 351 KKAIVDCIISIVEENPESKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYI 410

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 411 RFIFNRVVLENEAVRAAAVSALAKFG--AQNESLLPSILVLLQRCMMDTDDEVRDRATFY 468

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L ++   + A    Y+ +  T S+  +E+ L QY   P  SEKPFDL  IP    A A  
Sbjct: 469 LNVLQQRQMALNATYIFNGLTVSIPGMEKALHQYTLEP--SEKPFDLKSIPL---AMAPV 523

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
                  F+  S  T+ TS           ++ SR          Q ++ +QL  IPE  
Sbjct: 524 -------FEQKSEITLVTS-------KPEKLAPSR----------QDIFQEQLAAIPEFM 559

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
           + GPLFKSS +PV+LTE+ETEY V C+KH+F +++VFQF  TNTLNDQLLE VTV M+P 
Sbjct: 560 SLGPLFKSS-EPVQLTEAETEYFVRCIKHVFTDHIVFQFDCTNTLNDQLLEKVTVQMEPS 618

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLGS-FSNTLKFLVKDCDPSTXX 477
                L     +PA  LPY+QP   Y   +  + +   + S FS T+KF V+DCDP T  
Sbjct: 619 DSYEVLC---YVPAPSLPYNQPGMCYTLVRLPDEDPTAVASTFSCTMKFTVRDCDPHT-G 674

Query: 478 XXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDS 537
                          +E+  SD++      +F++AW+ VG+  +  ETFAL+++K+L+++
Sbjct: 675 VPDDDGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDAFEKEETFALSSTKTLEEA 734

Query: 538 CTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSV 596
              +I  LGM P E S   P + + H+L L+G + GG  +L ++R+  A   GVTM+++V
Sbjct: 735 VNNIITFLGMQPCERSDKVPENKNSHSLYLAGMYRGGYDLLVRSRLALA--DGVTMQVTV 792

Query: 597 RSPSEEISRIVIGAV 611
           RS  +    +++ +V
Sbjct: 793 RSKEKTPVDVILASV 807



>gi|158256818|dbj|BAF84382.1| unnamed protein product [Homo sapiens]
          Length = 874

 Score =  548 bits (1413), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 293/617 (47%), Positives = 397/617 (64%), Gaps = 43/617 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 414 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTTNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATAPMAEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINS-NIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
                            T S+ + ++     V+ +R          Q+++ +QL  +PE 
Sbjct: 590 R----------------TESTPITAVKQPEKVAATR----------QEIFQEQLAAVPEF 623

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
              GPLFKSS +PV LTESETEYV+ C KH F  +MVFQF  TNTLNDQ LENVTV M+P
Sbjct: 624 RGLGPLFKSSPEPVALTESETEYVIRCTKHTFTNHMVFQFDCTNTLNDQTLENVTVQMEP 683

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPST 475
                 L     +PA  LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP+T
Sbjct: 684 TEAYEVLC---YVPARSLPYNQPGTCYTLVALPKEDPTAVAC-TFSCMMKFTVKDCDPTT 739

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLK 535
                            +E+  +D++      +F +AWD VG+E +  ETF L+  K+L+
Sbjct: 740 -GETDDEGYEDEYVLEDLEVTVADHIQKVMKLNFEAAWDEVGDEFEKEETFTLSTIKTLE 798

Query: 536 DSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
           ++   +++ LGM P E S   P + + HTL+L+G F GG  +L ++R+    +  VT ++
Sbjct: 799 EAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILVRSRLLLLDT--VTTQV 856

Query: 595 SVRSPSEEISRIVIGAV 611
           + RS  E    I++ +V
Sbjct: 857 TARSLEELPVDIILASV 873



>gi|354470721|ref|XP_003497593.1| PREDICTED: coatomer subunit gamma-2 [Cricetulus griseus]
          Length = 872

 Score =  548 bits (1412), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 297/615 (48%), Positives = 402/615 (65%), Gaps = 42/615 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 295 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 354

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 355 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEY 414

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K+A+V+ I  +V+  PESKEA LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 415 KKAIVDCIISIVEENPESKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYI 474

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 475 RFIFNRVVLENEAVRAAAVSALAKFG--AQNESLLPSILVLLQRCMMDTDDEVRDRATFY 532

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L ++   + A    Y+ +  T S+  +E+ L QY   P  SEKPFDL  IP    A A  
Sbjct: 533 LNVLQQRQMALNATYIFNGLTVSIPGMEKALHQYTLEP--SEKPFDLKSIPL---AMAPV 587

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
                  F+  S  T+ TS           ++ SR          Q ++ +QL  IPE  
Sbjct: 588 -------FEQKSEITLVTS-------KPEKLAPSR----------QDIFQEQLAAIPEFM 623

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
           + GPLFKSS +PV+LTE+ETEY V C+KH+F +++VFQF  TNTLNDQLLE VTV M+P 
Sbjct: 624 SLGPLFKSS-EPVQLTEAETEYFVRCIKHVFTDHIVFQFDCTNTLNDQLLEKVTVQMEPS 682

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLGS-FSNTLKFLVKDCDPSTXX 477
                L     +PA  LPY+QP   Y   +  + +   + S FS T+KF V+DCDP T  
Sbjct: 683 DSYEVLC---YVPAPSLPYNQPGMCYTLVRLPDEDPTAVASTFSCTMKFTVRDCDPHT-G 738

Query: 478 XXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDS 537
                          +E+  SD++      +F++AW+ VG+  +  ETFAL+++K+L+++
Sbjct: 739 VPDDDGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDAFEKEETFALSSTKTLEEA 798

Query: 538 CTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSV 596
              +I  LGM P E S   P + + H+L L+G + GG  +L ++R+  A   GVTM+++V
Sbjct: 799 VNNIITFLGMQPCERSDKVPENKNSHSLYLAGMYRGGYDLLVRSRLALA--DGVTMQVTV 856

Query: 597 RSPSEEISRIVIGAV 611
           RS  +    +++ +V
Sbjct: 857 RSKEKTPVDVILASV 871



>gi|498974185|ref|XP_004548319.1| PREDICTED: coatomer subunit gamma-2-like [Maylandia zebra]
          Length = 873

 Score =  548 bits (1412), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 289/615 (46%), Positives = 398/615 (64%), Gaps = 40/615 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 354 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMNFLSNMLRDDGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++  PESKE  LAHLCEFIEDCE T L+ ++LHL+G EGP+TP P+KYI
Sbjct: 414 KRAIVDCIISIIEENPESKETGLAHLCEFIEDCEHTVLATKILHLMGKEGPRTPQPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LE+  VRAAAVSALAKFG  A++ ++  S+ VLL RC+ D+DDEVRDRA  Y
Sbjct: 474 RFIFNRVVLESEAVRAAAVSALAKFG--AQNDDLLPSVLVLLQRCMMDSDDEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           + ++   + A    Y+ +  + S+  LE+ L QY   P  SEKPFD+  +P  T    E 
Sbjct: 532 MNVLQQKQKALNAAYIFNGLSVSIPGLEKSLHQYTLEP--SEKPFDMKTVPLATAPITE- 588

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
                        Q    +  A   +   +  + +D           +Y +QL  IPE  
Sbjct: 589 -------------QKTEIAPVATSKLPEKLAPSRQD-----------IYQEQLAAIPEFQ 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV+LTE+ETEYVV C+KH F  +MVFQF  TNTLNDQLL+ V V M+P 
Sbjct: 625 GLGPLFKSS-EPVQLTEAETEYVVRCIKHTFAGHMVFQFDCTNTLNDQLLQKVVVQMEP- 682

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLG-SFSNTLKFLVKDCDPSTXX 477
           S+   +V    +PA  LPY QP S Y   +  + +   +  +FS T+K+LV+DCDP+T  
Sbjct: 683 SEAYEVVH--CVPAPSLPYSQPGSCYTLIRLPDDDPTAVSCTFSCTMKYLVRDCDPNT-G 739

Query: 478 XXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDS 537
                          +E+  +D++      +F +AW+ VG+E +  ETFAL + ++L ++
Sbjct: 740 EPDDDGYDDEYVLEDLEVTVADHIQKVLKPNFGAAWEEVGDEFEKEETFALASVRTLDEA 799

Query: 538 CTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSV 596
              +I  LGM P E S   P + + H L L+G F GG  VL + R+  A   GVTM+++V
Sbjct: 800 VGNIINFLGMQPCERSDKVPENKNSHVLFLAGVFRGGHDVLVRARLALA--DGVTMQVTV 857

Query: 597 RSPSEEISRIVIGAV 611
           RS  E +  +++ +V
Sbjct: 858 RSGDENVVDVILASV 872



>gi|359475304|ref|XP_003631645.1| PREDICTED: coatomer subunit gamma-2-like [Vitis vinifera]
 gi|297741448|emb|CBI32579.3| unnamed protein product [Vitis vinifera]
          Length = 887

 Score =  548 bits (1412), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 300/608 (49%), Positives = 399/608 (65%), Gaps = 33/608 (5%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSS K  LRFAA+RTLNK+AMT P AV +CN+DME+LI+DQNRS+AT AITTLLKTGN
Sbjct: 299 LFLSSSKPVLRFAAVRTLNKVAMTHPMAVTNCNIDMESLISDQNRSIATLAITTLLKTGN 358

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQIT FMS+I+DEFK++VV+AIRSLCLKFP K   +++FLS +LR+EGG+E+
Sbjct: 359 ESSVDRLMKQITNFMSDIADEFKIVVVEAIRSLCLKFPLKYRALMNFLSNILREEGGFEY 418

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K+A+V++I  L++ IP++KE+ L HLCEFIEDCEFT LS ++LH LG+EGPKT  P+KYI
Sbjct: 419 KKAIVDSIVILIRDIPDAKESGLLHLCEFIEDCEFTYLSTQILHFLGIEGPKTSDPSKYI 478

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRVILEN+ VRA+AVS LAKFG   +   +K  I VLL RCL D+DDEVRDRA LY
Sbjct: 479 RYIYNRVILENATVRASAVSTLAKFGAMVDS--LKPRIFVLLRRCLFDSDDEVRDRATLY 536

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQY---VSNPESSEKPFDLSDIPKITKAQAE 297
           L  +  + S  +  KD   +    L+  LV     + N E SE+PFD+  +P+  K+Q  
Sbjct: 537 LNTLGGDGSVVETDKDVKDFLFGLLDIPLVNLETSLKNYEPSEEPFDIDCVPREVKSQPL 596

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE   P           G   + +G+  S          PT  VD    Y + L  IPE 
Sbjct: 597 AEKKAP-----------GKKPTGLGAPPSG---------PTSTVD---AYEKLLSSIPEY 633

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
           A+FG  FKSS  PVELTE+ETEY V+ VKH+F  ++VFQ+  TNT+ +QLLENVTV++  
Sbjct: 634 ASFGKPFKSS-APVELTEAETEYAVNVVKHIFDRHVVFQYNCTNTIPEQLLENVTVIVDA 692

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTXX 477
            SD     E    P   LPYD P   +VAF++ +     +G FSN LKF+VK+ DP+T  
Sbjct: 693 -SDAEEFSEVSTKPLRSLPYDSPGQTFVAFEKPDGVP-AVGKFSNMLKFIVKEVDPTT-G 749

Query: 478 XXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDS 537
                          +E+V +DYV    +S+F +AW+S+G E + V+ + L   +SL ++
Sbjct: 750 ETEEDGVEDEYQLEDLEVVAADYVLKVGVSNFRNAWESMGPEFERVDEYGLGPRESLAEA 809

Query: 538 CTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSV 596
            +T+I LLG+ P E +   P++S  HT +LSG F+G +KVL +          V M+L+V
Sbjct: 810 VSTVISLLGLQPCEGTEVVPSNSRSHTCLLSGVFIGNMKVLVRLSFGIDGPKEVAMKLAV 869

Query: 597 RSPSEEIS 604
           RS  E +S
Sbjct: 870 RSEDESVS 877



>gi|507705407|ref|XP_004645653.1| PREDICTED: coatomer subunit gamma-1 [Octodon degus]
          Length = 874

 Score =  548 bits (1411), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 292/616 (47%), Positives = 399/616 (64%), Gaps = 41/616 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 414 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATTPMAEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
              +P S  + +T+                V+ +R          Q+++ +QL  +P+  
Sbjct: 590 ---RPESTPITATK------------QPEKVAATR----------QEIFQEQLAAVPDFQ 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV LTE ETEYVV C KH+F E+MVFQF  TNTLND++LENVTV ++P 
Sbjct: 625 GLGPLFKSSPEPVALTELETEYVVHCTKHVFTEHMVFQFDCTNTLNDRMLENVTVYLEPT 684

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
                L     +PA  LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP+T 
Sbjct: 685 EAYEVLC---YVPARSLPYNQPGTCYTLVALPKEDPTAVAC-TFSCMMKFTVKDCDPTT- 739

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  +D++      +F +AWD VG+E +  ETF L+  K+L++
Sbjct: 740 GEIDEEGYEDEYVLEDLEVSVADHIQKVMKVNFEAAWDEVGDEFEKEETFTLSTIKTLEE 799

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   +++ LGM   E S   P + + HTL+L+G F GG  +L + R+    +  VTM+++
Sbjct: 800 AVGNIVKFLGMHACERSDKVPDNKNTHTLLLAGVFRGGHDILVRARLLLLDT--VTMQVT 857

Query: 596 VRSPSEEISRIVIGAV 611
            RS  E    I++ +V
Sbjct: 858 ARSSEELPVDIILASV 873



>gi|505839315|ref|XP_004613186.1| PREDICTED: coatomer subunit gamma-1 [Sorex araneus]
          Length = 874

 Score =  548 bits (1411), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 291/616 (47%), Positives = 394/616 (63%), Gaps = 41/616 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 414 KRAIVDCIIGIIEENAESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + +    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LSVLEQKQKSLNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATAPLAE- 588

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
                        Q   T+          + +T           +Q+++ +QL  +PE  
Sbjct: 589 -------------QRTETTPITAAKQPEKVAAT-----------RQEIFQEQLAAVPEFQ 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV LTESETEYV+ C KH F  +MVFQF   NTLNDQ LENVTV M+P 
Sbjct: 625 GLGPLFKSSPEPVALTESETEYVIRCTKHTFTGHMVFQFDCMNTLNDQTLENVTVQMEPT 684

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
                L     +PA  LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP+T 
Sbjct: 685 EAYEVLCH---VPARSLPYNQPGTCYTLVALPKEDPTTVAC-TFSCVMKFTVKDCDPTT- 739

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  +D++      +F +AWD VG+E +  ETF L+  K+L++
Sbjct: 740 GETDEEGYEDEYVLEDLEVTVADHIQKVMKVNFEAAWDEVGDEFEKEETFTLSTIKTLEE 799

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   +++ LGM P E S   P + + HTL+L+G F GG  +L ++R+    +  VTM+++
Sbjct: 800 AVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILVRSRLLLLDT--VTMQVT 857

Query: 596 VRSPSEEISRIVIGAV 611
            RS  E    I++ +V
Sbjct: 858 ARSSEELPVDIILASV 873



>gi|478537735|ref|XP_004442980.1| PREDICTED: coatomer subunit gamma-1 [Ceratotherium simum simum]
          Length = 874

 Score =  548 bits (1411), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 292/616 (47%), Positives = 395/616 (64%), Gaps = 41/616 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 414 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATMPLAEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
                             S+    +     V+ +R          Q+++ +QL  +PE  
Sbjct: 590 RT---------------ESTPITAAKQPEKVAATR----------QEIFQEQLAAVPEFH 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV LTESETEYVV C KH F ++MVFQF  TNTLNDQ LENVTV M+P 
Sbjct: 625 GLGPLFKSSPEPVALTESETEYVVRCTKHTFTDHMVFQFDCTNTLNDQTLENVTVQMEPT 684

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
                L     +PA  LPY+QP + Y  VA  + +P      +FS  +KF +KDCDP+T 
Sbjct: 685 EAYEVLC---YVPARSLPYNQPGTCYTLVALPKEDPTAVAC-TFSCVMKFTIKDCDPTT- 739

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  +D++      +F +AWD VG+E +  ETF L+  K+L++
Sbjct: 740 GETDDEGYEDEYVLEDLEVTVADHIQKVMKLNFEAAWDEVGDEFEKEETFTLSTIKTLEE 799

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   +++ LGM P E +   P + + HTL+L+G F GG  +L  +R+    +  VTM+++
Sbjct: 800 AVGNIVKFLGMHPCERTDKVPDNKNTHTLLLAGVFRGGHDILVCSRLLLLDT--VTMQVT 857

Query: 596 VRSPSEEISRIVIGAV 611
            RS  E    I++ +V
Sbjct: 858 ARSSEELPVDIILASV 873



>gi|193784830|dbj|BAG53983.1| unnamed protein product [Homo sapiens]
          Length = 610

 Score =  547 bits (1410), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 293/617 (47%), Positives = 397/617 (64%), Gaps = 43/617 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 30  LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 89

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K P K  V+++FL  +LR+EGG+E+
Sbjct: 90  ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKHPRKHAVLMNFLFTMLREEGGFEY 149

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 150 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTTNPSKYI 209

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 210 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 267

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 268 LNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATAPMAEQ 325

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINS-NIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
                            T S+ + ++     V+ +R          Q+++ +QL  +PE 
Sbjct: 326 R----------------TESTPITAVKQPEKVAATR----------QEIFQEQLAAVPEF 359

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
              GPLFKSS +PV LTESETEYV+ C KH F  +MVFQF  TNTLNDQ LENVTV M+P
Sbjct: 360 RGLGPLFKSSPEPVALTESETEYVIRCTKHTFTNHMVFQFDCTNTLNDQTLENVTVQMEP 419

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPST 475
                 L     +PA  LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP+T
Sbjct: 420 TEAYEVLC---YVPARSLPYNQPGTCYTLVALPKEDPTAVAC-TFSCMMKFTVKDCDPTT 475

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLK 535
                            +E+  +D++      +F +AWD VG+E +  ETF L+  K+L+
Sbjct: 476 -GETDDEGYEDEYVLEDLEVTVADHIQKVMKLNFEAAWDEVGDEFEKEETFTLSTIKTLE 534

Query: 536 DSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
           ++   +++ LGM P E S   P + + HTL+L+G F GG  +L ++R+    +  VT+++
Sbjct: 535 EAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILVRSRLLLLDT--VTIQV 592

Query: 595 SVRSPSEEISRIVIGAV 611
           + RS  E    I++ +V
Sbjct: 593 TARSLEELPVDIILASV 609



>gi|326910990|ref|XP_003201846.1| PREDICTED: coatomer subunit gamma-2-like isoform 2 [Meleagris
           gallopavo]
          Length = 873

 Score =  547 bits (1409), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 294/616 (47%), Positives = 402/616 (65%), Gaps = 42/616 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKPVLRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 354 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMAFLSSMLRDDGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++  PESKE+ LAHLCEFIEDCE T L+ ++LHLLG EGP+TP+P+KYI
Sbjct: 414 KRAIVDCIISIIEENPESKESGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPSPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D+DDEVRDRA  Y
Sbjct: 474 RFIFNRVVLENEAVRAAAVSALAKFG--AQNENLLPSILVLLQRCMMDSDDEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L ++   + A    Y+ +  T S+  +E+ L QY   P  S+KPFD+  +P  T    E 
Sbjct: 532 LNVLQQRQIALNAAYIFNGLTVSVPGMEKALHQYTLEP--SDKPFDMKTVPLATAPIFEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
           +                      G+  + + S      P+    +Q ++ +QL  IPE  
Sbjct: 590 K---------------------AGNAQAFLTSKPEKVAPS----RQDIFQEQLAAIPEFK 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV+LTE+ETEY V C+KH+F  ++VFQF  TNTLNDQLLE VTV M+P 
Sbjct: 625 GLGPLFKSS-EPVQLTEAETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEP- 682

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
           SD   ++    IPA  L Y+QP   Y  V   + +P      +FS T+KF V+DCDP+T 
Sbjct: 683 SDAYDVI--CCIPAPSLAYNQPGMCYTLVQMPQADPTAVAC-TFSCTMKFTVRDCDPNT- 738

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  SD++      +F++AW+ VG++ +  ETFAL + K+L +
Sbjct: 739 GVPDEDGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDDFEKEETFALGSIKTLDE 798

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   +I+ LGM P E S   P + + HTL L+G + GG  VL ++R+  A   GVTM+++
Sbjct: 799 AVNNIIKFLGMQPCERSDKVPENKNSHTLYLAGVYRGGCDVLVRSRL--ALGDGVTMQVT 856

Query: 596 VRSPSEEISRIVIGAV 611
           VRS  E    +++ +V
Sbjct: 857 VRSKEEMPVDVILASV 872



>gi|354482845|ref|XP_003503606.1| PREDICTED: coatomer subunit gamma isoform 2 [Cricetulus griseus]
          Length = 872

 Score =  547 bits (1409), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 295/620 (47%), Positives = 398/620 (64%), Gaps = 51/620 (8%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 414 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATTPVAEQ 589

Query: 299 ENLK----PRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQI 354
              K    P+   +A+T+                               Q+++ +QL  +
Sbjct: 590 RPGKVLLIPKPEKVAATR-------------------------------QEIFQEQLAAV 618

Query: 355 PEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVV 414
           PE    GPLFKSS +PV LTESETEYV+ C KH F +++VFQF  TNTLNDQ LENVTV 
Sbjct: 619 PEFQGLGPLFKSSPEPVALTESETEYVIRCTKHTFSDHLVFQFDCTNTLNDQTLENVTVQ 678

Query: 415 MQPESDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCD 472
           M+P   E   V  +V PA  LPY+QP + Y  VA  + +P      +FS  +KF VKDCD
Sbjct: 679 MEP--TEAYEVLSYV-PARSLPYNQPGTCYTLVALPKEDPTTVAC-TFSCVMKFTVKDCD 734

Query: 473 PSTXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASK 532
           P+T                 +E+  +D++      +F +AWD VG+E +  ETF L+  K
Sbjct: 735 PNT-GEIDEEGYEDEYVLEDLEVTVADHIQKVMKVNFEAAWDEVGDEFEKEETFTLSTIK 793

Query: 533 SLKDSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVT 591
           +L+++   +++ LGM P E S   P + + HTL+L+G F GG  +L + R+    +  VT
Sbjct: 794 TLEEAVGNIVKFLGMHPCERSDKVPENKNTHTLLLAGVFRGGHDILVRARLLLLDT--VT 851

Query: 592 MELSVRSPSEEISRIVIGAV 611
           M+++ RS  E    I++ +V
Sbjct: 852 MQVTARSSEELPVDIILASV 871



>gi|508706148|gb|EOX98044.1| Coatomer gamma-2 subunit / gamma-2 coat protein / gamma-2 COP,
           putative isoform 1 [Theobroma cacao]
          Length = 887

 Score =  546 bits (1408), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 301/613 (49%), Positives = 398/613 (64%), Gaps = 43/613 (7%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSS K  LRFAA+RTLNK+AMT P AV +CN+DME+LI+DQNRS+AT AITTLLKTGN
Sbjct: 299 LFLSSSKPVLRFAAVRTLNKVAMTHPMAVTNCNIDMESLISDQNRSIATLAITTLLKTGN 358

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQIT FMS+I+DEFK++VV+AIRSLCLKFP K   +++FLS +LR+EGG+E+
Sbjct: 359 ESSVDRLMKQITNFMSDIADEFKIVVVEAIRSLCLKFPLKHRSLMNFLSNILREEGGFEY 418

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K+A+V++I  L++ IPE+KE+ L HLCEFIEDCEFT LS ++LH LG+EGPKT  P+KYI
Sbjct: 419 KKAIVDSIVILIRDIPEAKESGLLHLCEFIEDCEFTYLSTQILHFLGIEGPKTSDPSKYI 478

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV LEN+ VRA AVS LAKFG   +   +K  I VLL RCL DNDDEVRDRA LY
Sbjct: 479 RYIYNRVHLENATVRAGAVSTLAKFGAMVD--ALKPRIFVLLRRCLFDNDDEVRDRATLY 536

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQY---VSNPESSEKPFDLSDIPKITKAQAE 297
           L  +  + +  +  +D   +   +L+  LV     + N E SE+ FD+  +PK  K Q  
Sbjct: 537 LNTLGGDGAVVETGEDVKEFLFGSLDIPLVNLENSLKNYELSEESFDIDSVPKEVKTQPL 596

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE   P        +  G S+   G              P   VD    Y + L  IPE 
Sbjct: 597 AEKKAP------GKKPTGLSAPPTG--------------PPSTVD---AYERLLSSIPEF 633

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
           A FG LFKSS  PVELTE+ETEY V+ VKH+F  ++VFQF  TNT+ +QLLENVTV++  
Sbjct: 634 ANFGKLFKSS-APVELTEAETEYAVNVVKHIFDGHVVFQFNCTNTIPEQLLENVTVIV-- 690

Query: 418 ESDEGTLVEEFVIPATK----LPYDQPSSIYVAFKRTNPEEYT-LGSFSNTLKFLVKDCD 472
              + +  EEF   ATK    LPYD P   +VAF++  PE  + +G FSN L+F+VK+ D
Sbjct: 691 ---DASEAEEFAEVATKPLRSLPYDSPGQTFVAFEK--PEGVSAVGKFSNMLRFIVKEVD 745

Query: 473 PSTXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASK 532
           PST                 +E+V +DY+    +S+F +AW+S+G + + V+ + L    
Sbjct: 746 PST-GEAEEDGVEDEYQLEDLEVVAADYMLKVGVSNFRNAWESMGADCERVDEYGLGPRD 804

Query: 533 SLKDSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVT 591
           SL ++   +I LLGM P E +   P++S  HT +LSG ++G +KVL + +        V 
Sbjct: 805 SLAEAVNAVINLLGMQPCEGTEVVPSNSRSHTCLLSGVYIGNVKVLVRLQFGIDGPKDVA 864

Query: 592 MELSVRSPSEEIS 604
           M+L+VRS  E +S
Sbjct: 865 MKLAVRSEDEAVS 877



>gi|26353514|dbj|BAC40387.1| unnamed protein product [Mus musculus]
          Length = 870

 Score =  546 bits (1408), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 294/619 (47%), Positives = 400/619 (64%), Gaps = 51/619 (8%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 354 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCHKYPRKHSVMMTFLSNMLRDDGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K+A+V+ I  +V+  PESKEA LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 414 KKAIVDCIISIVEENPESKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 474 RFIFNRVVLENEAVRAAAVSALAKFG--AQNESLLPSILVLLQRCMMDTDDEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIP----KITKA 294
           L ++   + A    Y+ +  T S+  +E+ L QY   P  SEKPFD+  IP     + + 
Sbjct: 532 LNVLQQRQMALNATYIFNGLTVSIPGMEKALHQYTLEP--SEKPFDMKSIPLAMAPVFEQ 589

Query: 295 QAEAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQI 354
           ++E   + P+   LA ++                               Q ++ +QL  I
Sbjct: 590 KSEITLVTPKPEKLAPSR-------------------------------QDIFQEQLAAI 618

Query: 355 PEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVV 414
           PE    GPLFKSS +PV+LTE+ETEY V CVKHMF +++VFQF  TNTLNDQLLE VTV 
Sbjct: 619 PEFMNLGPLFKSS-EPVQLTEAETEYFVRCVKHMFTDHIVFQFDCTNTLNDQLLEKVTVQ 677

Query: 415 MQPESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTL-GSFSNTLKFLVKDCDP 473
           M+P      L     IPA  LPY+QP   Y   +  + +   + G+FS T+KF V+DCDP
Sbjct: 678 MEPSDSYEVLC---CIPAPSLPYNQPGICYTLVRLPDEDPTAVAGTFSCTMKFTVRDCDP 734

Query: 474 STXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKS 533
           +T                 +E+  SD++      +F++AW+ VG+  +  ETFAL+++K+
Sbjct: 735 NT-GVPDEDGYDDEYVLEDLEVTVSDHIQKILKPNFAAAWEEVGDAFEKEETFALSSTKT 793

Query: 534 LKDSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTM 592
           L ++   +I  LGM P E S   P + + H+L L+G + GG  +L ++R+  A   GVTM
Sbjct: 794 L-EAVNNIITFLGMQPCERSDKVPENKNSHSLYLAGVYRGGYDLLVRSRLALA--DGVTM 850

Query: 593 ELSVRSPSEEISRIVIGAV 611
           +++VRS       +++ +V
Sbjct: 851 QVTVRSKERTPVDVILASV 869



>gi|45361156|ref|NP_989174.1| coatomer protein complex, subunit gamma 1 [Xenopus (Silurana)
           tropicalis]
 gi|38649187|gb|AAH63375.1| coatomer protein complex, subunit gamma [Xenopus (Silurana)
           tropicalis]
 gi|89272741|emb|CAJ83106.1| coatomer protein complex, subunit gamma [Xenopus (Silurana)
           tropicalis]
          Length = 874

 Score =  546 bits (1408), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 293/615 (47%), Positives = 388/615 (63%), Gaps = 39/615 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  VM++FL  +LR+EGG+++
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAINALCHKYPRKHSVMMNFLFTMLREEGGFDY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++  PESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGP+T  P+KYI
Sbjct: 414 KRAIVDCIISIIEENPESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPRTNNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRVILEN  VRA AVSALAKFG   ED  +  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVILENEEVRAGAVSALAKFGAQNED--MLPSILVLLRRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LSILEHRQKALNSTYILNGLTVSVPGLERALQQYTLEP--SEKPFDLKSVPLATAPLAE- 588

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
                +  D     T+      V S                   +Q+++ +QL  +PE  
Sbjct: 589 -----QRADNVPAATVRQPEKLVSS-------------------RQEIFQEQLAAVPEFK 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV LTESETEYV+ C KH F  +MVFQF  TNTLNDQ+LENVTV M+P 
Sbjct: 625 ELGPLFKSSAEPVALTESETEYVIRCTKHTFVNHMVFQFDCTNTLNDQILENVTVQMEPT 684

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLG-SFSNTLKFLVKDCDPSTXX 477
                +     +PA  L Y+QP   Y        +  TL  +FS  LKF VKDCDP+T  
Sbjct: 685 EGYEVIC---CVPAKTLSYNQPGICYTLVSVPEEDPNTLACTFSCLLKFTVKDCDPNT-G 740

Query: 478 XXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDS 537
                          IE+  +D++      +F +AWD VG+E    ETF L+  K+L+++
Sbjct: 741 EADDEGYEDEYVLEDIEVTVADHIQKILKPNFGAAWDEVGDEFDKEETFNLSTIKTLEEA 800

Query: 538 CTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSV 596
              +++ LGM P E S   P + + HTL L+G F GG  +L + ++    +  VTM+++ 
Sbjct: 801 VGNVVKFLGMQPCERSDKVPENKNAHTLYLAGVFRGGHDILVRAKLVLTDT--VTMQVTA 858

Query: 597 RSPSEEISRIVIGAV 611
           RS  E    +++ +V
Sbjct: 859 RSKDEFPVDVIMASV 873



>gi|82177624|sp|Q9I8E6.1|COPG2_FUGRU RecName: Full=Coatomer subunit gamma-2; AltName: Full=Gamma-2-coat
           protein; Short=Gamma-2-COP
 gi|8926697|emb|CAB96534.1| coatomer protein gamma 2-subunit [Takifugu rubripes]
          Length = 873

 Score =  546 bits (1407), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 289/615 (46%), Positives = 395/615 (64%), Gaps = 40/615 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K   M++FLS +LRD+GG+E+
Sbjct: 354 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSAMMNFLSNMLRDDGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++  PESKE  LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 414 KRAIVDCIISIIEENPESKETGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPQPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LE+  VRAAAVSALAKFG  A++ ++  S+ VL+ RC+ D+DDEVRDRA  Y
Sbjct: 474 RFIFNRVVLESEAVRAAAVSALAKFG--AQNDDLLPSVLVLMQRCMMDSDDEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           + ++   + A    Y+ +  + S+  LE+ L QY   P  SEKPFD+  +P  T    E 
Sbjct: 532 MNVLQQKQKALNAAYIFNGLSVSIPGLEKSLHQYTLEP--SEKPFDMKSVPLATTPITE- 588

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
                        Q    + +A   +   +  + +D           +Y +QL  IPE  
Sbjct: 589 -------------QKTEIAPAATSKLPEKLAPSRQD-----------IYQEQLAAIPEFQ 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS  PV+LTE+ETEYVV C+KH F  +MVFQF  TNTLNDQLL+ V V M+P 
Sbjct: 625 GLGPLFKSS-DPVQLTEAETEYVVRCIKHTFARHMVFQFDCTNTLNDQLLQKVLVQMEP- 682

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLG-SFSNTLKFLVKDCDPSTXX 477
             E   V  + IPA  LPY QP S Y   +  + +   +  +FS T+K+LV+DCDP+T  
Sbjct: 683 -SEAYEVIHY-IPAPSLPYSQPGSCYSLVRLPDDDPTAVSCTFSCTMKYLVRDCDPNT-G 739

Query: 478 XXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDS 537
                          +E+   D++      +F +AW+ VG+E +  ETFAL + ++L ++
Sbjct: 740 EPDDDGYDDEYVLEDLEVTVPDHIQKVLKPNFGAAWEEVGDEFEKEETFALASVRTLDEA 799

Query: 538 CTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSV 596
              +I  LGM P E S   P + + H L L+G F GG  VL + R+  A   GVTM+++V
Sbjct: 800 VGNIISFLGMQPCERSDKVPENKNSHVLFLAGVFRGGHDVLVRARLALA--DGVTMQVTV 857

Query: 597 RSPSEEISRIVIGAV 611
           RS  E +  +++ +V
Sbjct: 858 RSSEETVVDVILASV 872



>gi|193786513|dbj|BAG51296.1| unnamed protein product [Homo sapiens]
          Length = 681

 Score =  546 bits (1407), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 294/615 (47%), Positives = 393/615 (63%), Gaps = 42/615 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 104 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 163

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 164 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEY 223

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +V+  PESKEA LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 224 KRAIVDCIISIVEENPESKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYI 283

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 284 RFIFNRVVLENEAVRAAAVSALAKFG--AQNESLLPSILVLLQRCMMDTDDEVRDRATFY 341

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L ++   + A    Y+ +  T S+  + + L QY   P  SEKPFD+  IP       E 
Sbjct: 342 LNVLQQRQMALNATYIFNGLTVSVPGMGKALHQYTLEP--SEKPFDMKSIPLAMAPVFEQ 399

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
           +         A    + T    +                     +Q ++ +QL  IPE  
Sbjct: 400 K---------AEITLVATKPEKLAP------------------SRQDIFQEQLAAIPEFL 432

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV+LTE+ETEY V C+KHMF  ++VFQF  TNTLNDQLLE VTV M+P 
Sbjct: 433 NIGPLFKSS-EPVQLTEAETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQMEPS 491

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTL-GSFSNTLKFLVKDCDPSTXX 477
                L     IPA  LPY+QP   Y   +  + +   + GSFS T+KF V+DCDP+T  
Sbjct: 492 DSYEVLS---CIPAPSLPYNQPGICYTLVRLPDDDPTAVAGSFSCTMKFTVRDCDPNT-G 547

Query: 478 XXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDS 537
                          +E+  SD++      +F++AW+ VG+  +  ETFAL+++K+L ++
Sbjct: 548 VPDEDGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDAFEKEETFALSSTKTLVEA 607

Query: 538 CTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSV 596
              +I  LGM P E S   P + + H+L L+G F GG  +L ++R+  A   GVTM+++V
Sbjct: 608 VNNIITFLGMQPCERSDKVPENKNSHSLYLAGIFRGGYDLLVRSRLALA--DGVTMQVTV 665

Query: 597 RSPSEEISRIVIGAV 611
           RS       +++ +V
Sbjct: 666 RSKERTPVDVILASV 680



>gi|507931738|ref|XP_004677112.1| PREDICTED: coatomer subunit gamma-2 [Condylura cristata]
          Length = 799

 Score =  546 bits (1407), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 293/602 (48%), Positives = 390/602 (64%), Gaps = 42/602 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 222 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 281

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 282 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHGVMMAFLSNMLRDDGGFEY 341

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +V+  PESKEA LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 342 KRAIVDCIISIVEENPESKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYI 401

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 402 RFIFNRVVLENEAVRAAAVSALAKFG--AQNENLLPSILVLLQRCMMDTDDEVRDRATFY 459

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L ++   + A    Y+ +  T S+  +E+ L QY   P  SEKPFD+  +P         
Sbjct: 460 LNVLQQRQMALNATYIFNGLTVSVPGMEKALHQYTLEP--SEKPFDMKSVP--------- 508

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
                    LA T      +          + T++     P   +Q ++ +QL  IPE  
Sbjct: 509 ---------LAMTPVFEQKAEIT-------LVTTKPEKLAPS--RQDIFQEQLAAIPEFM 550

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV+LTE+ETEY V CVKHMF  ++VFQF  TNTLNDQLLE VTV ++P 
Sbjct: 551 NLGPLFKSS-EPVQLTEAETEYFVRCVKHMFTNHIVFQFDCTNTLNDQLLEKVTVQVEPS 609

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLGS-FSNTLKFLVKDCDPSTXX 477
                L     +PA  LPY+QP   Y   +  + +     S FS T+KF V+DCDP T  
Sbjct: 610 ESCEVLC---CVPAPSLPYNQPGICYTLVRLPDDDATAAASTFSCTMKFTVRDCDPDT-G 665

Query: 478 XXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDS 537
                          +E+  SD++      +F++AW+ VGE  +  ETFAL+++K+L+++
Sbjct: 666 VPAEEGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGETFEKEETFALSSTKTLEEA 725

Query: 538 CTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSV 596
              +I  LGM P E S   P + + H+L L+G + GG  +L ++R+  A   GVTM+++V
Sbjct: 726 VNNIITFLGMQPCERSDKVPENKNSHSLYLAGVYRGGYDLLVRSRLALA--DGVTMQVTV 783

Query: 597 RS 598
           RS
Sbjct: 784 RS 785



>gi|355564530|gb|EHH21030.1| hypothetical protein EGK_04006 [Macaca mulatta]
          Length = 874

 Score =  546 bits (1406), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 292/617 (47%), Positives = 396/617 (64%), Gaps = 43/617 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EG KT  P+KYI
Sbjct: 414 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGSKTTNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATAPMAEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINS-NIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
                            T S+ + ++     V+ +R          Q+++ +QL  +PE 
Sbjct: 590 R----------------TESTPITAVKQPEKVAATR----------QEIFQEQLAAVPEF 623

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
              GPLFKSS +PV LTESETEYV+ C KH F  +MVFQF  TNTLNDQ LENVTV M+P
Sbjct: 624 RGLGPLFKSSPEPVALTESETEYVIRCTKHTFTNHMVFQFDCTNTLNDQTLENVTVQMEP 683

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPST 475
                 L     +P   LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP+T
Sbjct: 684 TEAYEVLC---YVPTQSLPYNQPGTCYTLVALPKEDPTAVAC-TFSCMMKFTVKDCDPTT 739

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLK 535
                            +E+  +D++      +F +AWD VG+E +  ETF L+  K+L+
Sbjct: 740 -GETDDEGYEDEYVLEDLEVTVADHIQKVMKLNFEAAWDEVGDEFEKEETFTLSTIKTLE 798

Query: 536 DSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
           ++   +++ LGM P E S   P + + HTL+L+G F GG  +L ++R+    +  VTM++
Sbjct: 799 EAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILVRSRLLLLDT--VTMQV 856

Query: 595 SVRSPSEEISRIVIGAV 611
           + RS  E    I++ +V
Sbjct: 857 TARSLEELPVDIILASV 873



>gi|193785992|dbj|BAG50968.1| unnamed protein product [Homo sapiens]
          Length = 874

 Score =  546 bits (1406), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 292/617 (47%), Positives = 397/617 (64%), Gaps = 43/617 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 414 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTTNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATAPMAEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINS-NIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
                            T S+ + ++     V+ +R          Q+++ +QL  +P  
Sbjct: 590 R----------------TESTPITAVKQPEKVAATR----------QEIFQEQLAAVPVF 623

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
              GPLFKSS +PV LTESETEYV+ C KH F  +MVFQF  TNTLNDQ LENVTV M+P
Sbjct: 624 RGLGPLFKSSPEPVALTESETEYVIRCTKHTFTNHMVFQFDCTNTLNDQTLENVTVQMEP 683

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPST 475
                 L     +PA  LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP+T
Sbjct: 684 TEAYEVLC---YVPARSLPYNQPGTCYTLVALPKEDPTAVAC-TFSCMMKFTVKDCDPTT 739

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLK 535
                            +E+  +D++      +F +AWD VG+E +  ETF L+  K+L+
Sbjct: 740 -GETDDEGYEDEYVLEDLEVTVADHIQKVMKLNFEAAWDEVGDEFEKGETFTLSTIKTLE 798

Query: 536 DSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
           ++   +++ LGM P E S   P + + HTL+L+G F GG  +L ++R+    +  VT+++
Sbjct: 799 EAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILMRSRLLLLDT--VTIQV 856

Query: 595 SVRSPSEEISRIVIGAV 611
           + RS  E    I++ +V
Sbjct: 857 TARSLEELPVDIILASV 873



>gi|148235681|ref|NP_001083575.1| coatomer protein complex, subunit gamma 1 [Xenopus laevis]
 gi|38197523|gb|AAH61661.1| MGC68533 protein [Xenopus laevis]
          Length = 874

 Score =  546 bits (1406), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 291/616 (47%), Positives = 391/616 (63%), Gaps = 41/616 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  +M++FL  +LR+EGG+++
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAINALCHKYPRKHSIMMNFLFTMLREEGGFDY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++  PESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGP+T  P+KYI
Sbjct: 414 KRAIVDCIISIIEENPESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPRTNNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LEN  VRA AVSALAKFG   ED  +  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLENEEVRAGAVSALAKFGAQNED--MLPSIMVLLRRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LNILEQRQKALNSTYILNGLTVSVPGLERALQQYTLEP--SEKPFDLKSVPLATAPIAE- 588

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
                +  D   T T+      + S                   +Q+++ +QL  IPE  
Sbjct: 589 -----QRADNVPTATVRQPEKVISS-------------------RQEIFQEQLAAIPEFK 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV LTESETEYV+ C KH F  +MVFQF  TNTLNDQ+LENVTV M+P 
Sbjct: 625 ELGPLFKSSAEPVALTESETEYVIRCTKHTFVNHMVFQFDCTNTLNDQILENVTVQMEPT 684

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
                +     +PA  L Y+QP   Y  V+  + +P      +FS  LKF VKDCDP+T 
Sbjct: 685 EGYEVIC---CVPAKALSYNQPGICYTLVSIPQEDPNALAC-TFSCLLKFTVKDCDPNT- 739

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           IE+  +D++      +F +AWD VG+E    ETF L+  K+L++
Sbjct: 740 GESDEEGYEDEYVLEDIEVTVADHIQKILKPNFGAAWDEVGDEFDKEETFNLSTIKTLEE 799

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   +++ LGM P E S   P + + H+L L+G F GG  +L + ++    +  VTM+++
Sbjct: 800 AVGNVVKFLGMQPCERSDKVPENKNAHSLYLAGVFRGGHDILVRAKLVLTDT--VTMQVT 857

Query: 596 VRSPSEEISRIVIGAV 611
            RS  E    +++ +V
Sbjct: 858 ARSKDEFPVDVIMASV 873



>gi|149411654|ref|XP_001511377.1| PREDICTED: coatomer subunit gamma-2 [Ornithorhynchus anatinus]
          Length = 871

 Score =  546 bits (1406), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 289/616 (46%), Positives = 397/616 (64%), Gaps = 44/616 (7%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKPALRYAAVRTLNKVAMRHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 354 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHGVMMTFLSNMLRDDGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +V+  PESKE+ LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 414 KRAIVDCIISIVEENPESKESGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D+DDEVRDRA  Y
Sbjct: 474 RFIFNRVVLENEAVRAAAVSALAKFG--AQNENLLPSILVLLQRCMMDSDDEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L ++   + A    Y+ +  + S+  LE+ L QY   P  +EKPFD+  +P  T    E 
Sbjct: 532 LNVLQQRQMALNATYIFNGLSVSIPGLEKALHQYTLEP--AEKPFDMKSVPLATAPALEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
           +         A    +      +                     +Q ++ +QL  +PE  
Sbjct: 590 K---------AEITLVANKPEKLAP------------------SRQDIFQEQLAALPEFK 622

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +P++LTE+ETEY V CVKH F +++VFQF  TNTLNDQLLE VTV M+P 
Sbjct: 623 NLGPLFKSS-EPLQLTEAETEYFVRCVKHTFTDHIVFQFDCTNTLNDQLLEKVTVQMEPS 681

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
                L     IPA  LPY+QP + Y  V+    +P      +FS T+KF V+DCDP+T 
Sbjct: 682 EAYDVLC---CIPAPSLPYNQPGTCYTLVSLPEDDPTAVAC-TFSCTMKFTVRDCDPNT- 736

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  SD++      +F++AW+ VG++ +  ETFAL+++K+L++
Sbjct: 737 GVPDEDGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSTKTLEE 796

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   ++  LGM P E S   P + + H L L+G + GG+ VL ++R+      GVTM+++
Sbjct: 797 AVNNIVTFLGMQPCERSDKVPENKNSHALYLAGVYRGGVDVLVRSRLALG--DGVTMQVT 854

Query: 596 VRSPSEEISRIVIGAV 611
           VRS  E    +++ +V
Sbjct: 855 VRSKEETPVDVILASV 870



>gi|449271822|gb|EMC82040.1| Coatomer subunit gamma, partial [Columba livia]
          Length = 857

 Score =  546 bits (1406), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 300/617 (48%), Positives = 399/617 (64%), Gaps = 42/617 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 277 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 336

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 337 ESSIDRLMKQISSFMSEISDEFKVVVVQAINALCQKYPRKHAVLMNFLFTMLREEGGFEY 396

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 397 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYI 456

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 457 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 514

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T    E 
Sbjct: 515 LNVLEQKQKALNAGYILNGLTVSIPGLERALHQYTLEP--SEKPFDLKSVPLATAPIVE- 571

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
                        Q    +  AV      + +T           +Q+++ +QL  IPE  
Sbjct: 572 -------------QRTENAPVAVVKQPEKVAAT-----------RQEIFQEQLGAIPEFR 607

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV LTE ETEYVV C KH F  +MVFQF  TNTLNDQ+LENVTV M+P 
Sbjct: 608 GLGPLFKSSPEPVALTELETEYVVRCTKHTFVRHMVFQFDCTNTLNDQILENVTVQMEP- 666

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
             EG  V  +V PA  L Y+QP + Y  VA    +P      +FS  +KF VKDCDP+T 
Sbjct: 667 -TEGYEVIGYV-PAKTLVYNQPGTCYTLVALSEEDPTAVAC-TFSCMMKFTVKDCDPNT- 722

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  +D++      +F +AWD VG+E +  ETF L+A K+L++
Sbjct: 723 GEMDDEGYEDEYVLEDLEVTVADHIQRVLKPNFGAAWDEVGDEYEKEETFTLSAIKTLEE 782

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           + + +++ LGM P E S   P + + HTL L+G F GG  +L ++R+    +  VTM+++
Sbjct: 783 AVSNIVKFLGMQPCERSDKVPDNKNSHTLYLAGVFRGGHDLLVRSRLVLTDT--VTMQVT 840

Query: 596 VRSPSEEISRIVIGAVV 612
            RS SEE+   V+ A V
Sbjct: 841 ARS-SEELPVDVVMASV 856



>gi|345324772|ref|XP_003430857.1| PREDICTED: coatomer subunit gamma [Ornithorhynchus anatinus]
          Length = 834

 Score =  545 bits (1405), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 292/617 (47%), Positives = 396/617 (64%), Gaps = 43/617 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 254 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 313

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 314 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 373

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 374 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYI 433

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 434 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 491

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 492 LSVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATTPIAEQ 549

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINS-NIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
                            T S+ + ++     V+ +R          Q+++ +QL  +PE 
Sbjct: 550 R----------------TESTPITTVKQPEKVAATR----------QEIFQEQLAAVPEF 583

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
              GPLFKSS +PV LTESETEYV+ C KH F  ++VFQF  TNTLNDQ+LENVTV M+P
Sbjct: 584 RRLGPLFKSSSEPVALTESETEYVIRCTKHTFTGHLVFQFDCTNTLNDQILENVTVQMEP 643

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPST 475
                 L     +PA  L Y+QP + Y  VA    +P      +FS  +KF VKDCDP+T
Sbjct: 644 TEAYEVLC---YVPAKSLAYNQPGTCYTLVALPEEDPTAVAC-TFSCMMKFTVKDCDPNT 699

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLK 535
                            +E+  +D++      +F +AWD VG+E +  ETF L+  K+L+
Sbjct: 700 -GETDDEGYEDEYVLEDLEVTVADHIQRVLKPNFGAAWDEVGDEFEKEETFTLSTIKTLE 758

Query: 536 DSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
           ++   +++ LGM P E S   P + + HTL L+G F GG  +L ++R+    +  VTM++
Sbjct: 759 EAVGNIVKFLGMQPCERSDKVPENKNAHTLFLAGVFRGGHDILVRSRLVLTDT--VTMQV 816

Query: 595 SVRSPSEEISRIVIGAV 611
           + RS  E    I++ +V
Sbjct: 817 TARSSEELPVDIILASV 833



>gi|356538767|ref|XP_003537872.1| PREDICTED: coatomer subunit gamma-2-like [Glycine max]
          Length = 887

 Score =  545 bits (1404), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 299/609 (49%), Positives = 400/609 (65%), Gaps = 35/609 (5%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSS K  LRFAA+RTLNK+AMT P AV +CN+DME+L++DQNRS+AT AITTLLKTGN
Sbjct: 299 LFLSSSKPVLRFAAVRTLNKVAMTHPMAVTNCNIDMESLLSDQNRSIATLAITTLLKTGN 358

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQIT FMS+I+DEFK++VV+AIRSLCLKFP K   +++FLS +LR+EGG+++
Sbjct: 359 ESSVDRLMKQITNFMSDIADEFKIVVVEAIRSLCLKFPLKYRSLMNFLSNILREEGGFDY 418

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K+AVV++I  L++ IP++KE+ L HLCEFIEDCEFT LS ++LH LGVEGPKT  P+KYI
Sbjct: 419 KKAVVDSIVILIRDIPDAKESGLLHLCEFIEDCEFTYLSTQILHFLGVEGPKTSDPSKYI 478

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV LEN+ VRA AVS LAKFG + +  E+K  I +LL RCL D+DDEVRDRA LY
Sbjct: 479 RYIYNRVHLENATVRAGAVSTLAKFGAAVD--ELKPRIFILLRRCLFDSDDEVRDRATLY 536

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQY---VSNPESSEKPFDLSDIPKITKAQAE 297
           L  +  + S  +  KD   +   + +  LV     + N E SE+ FD+  +P+  K+Q  
Sbjct: 537 LNTLGGDGSVVETDKDVKDFLFGSFDIPLVNLETSLKNYEPSEEAFDIDSVPREVKSQPL 596

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE   P           G   + +G+  S   ST+ DA           Y + L  IPE 
Sbjct: 597 AEKKAP-----------GKKPTGLGAPPSGPPSTA-DA-----------YERLLLSIPEF 633

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
           A FG LFKSS +PVELTE+ETEY V+ VKH+F  ++VFQ+  TNT+ +QLLE+V V++  
Sbjct: 634 ANFGKLFKSS-EPVELTEAETEYAVNVVKHIFDRHVVFQYNCTNTIPEQLLEDVIVIVDA 692

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTL-GSFSNTLKFLVKDCDPSTX 476
            S+     E F  P   LPYD P   +V F++  PE  ++ G FSN LKF+VK+ DP+T 
Sbjct: 693 -SEAEEFSEVFSKPLRSLPYDSPGQTFVGFEK--PEGLSIAGKFSNVLKFIVKEVDPTT- 748

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+VT+DY+    +S+F SAW+S+G + + V+ + L   +SL +
Sbjct: 749 GETEDDGVEDEYQLEDLEVVTADYMLKVGVSNFRSAWESIGPDCERVDEYGLGPRESLAE 808

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +  T+I LLGM P E +   P +S  HT +LSG F+G +KVL +          V M+LS
Sbjct: 809 AVNTVINLLGMQPCEGTEVVPPNSRSHTCLLSGVFIGNVKVLVRLSFGLDGPKDVAMKLS 868

Query: 596 VRSPSEEIS 604
           VRS  E +S
Sbjct: 869 VRSEDETVS 877



>gi|164656585|ref|XP_001729420.1| hypothetical protein MGL_3455 [Malassezia globosa CBS 7966]
 gi|159103311|gb|EDP42206.1| hypothetical protein MGL_3455 [Malassezia globosa CBS 7966]
          Length = 952

 Score =  545 bits (1404), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 303/629 (48%), Positives = 413/629 (65%), Gaps = 28/629 (4%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           +FLSSP+S L+FAA+RTL +LA  +P AVQSCN+DME+LITD NR VAT+AI TLLKTGN
Sbjct: 333 MFLSSPRSVLKFAAVRTLAELAQLRPAAVQSCNVDMESLITDSNRGVATYAIATLLKTGN 392

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRL+KQI+GFMS+ISDEFKVIVVDAIRSL  KFPSKQ  ML FL+G+LRDEGGYEF
Sbjct: 393 ESSVDRLIKQISGFMSDISDEFKVIVVDAIRSLSFKFPSKQAAMLGFLAGILRDEGGYEF 452

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KR VVEAIF + +++   KEAAL+HLCEFIEDCEFTKL+VR+LHLLG EGP+ P P KYI
Sbjct: 453 KRCVVEAIFAMARYVRGCKEAALSHLCEFIEDCEFTKLNVRILHLLGAEGPRMPEPHKYI 512

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRVILEN+IVRAAAV++LAKFG  A +  +   I+VLL RCL+D DDEVRDRA   
Sbjct: 513 RFIYNRVILENAIVRAAAVNSLAKFG--AYNEHLTARIRVLLRRCLEDVDDEVRDRATYA 570

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKI-----TKAQ 295
           L  ++    +   +  D T +L  LE+ L  YV +  +S  PFD   +P+      T++ 
Sbjct: 571 LHTLE--PPSMPVITLDDTPNLQVLEQSLQSYVDSMATS-APFDYESVPRALDGPETESG 627

Query: 296 AEAENLKPRSFDLASTQTI-------GTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYS 348
             ++ L P      +   +       G   + +G   + + + +       G+D    ++
Sbjct: 628 PASDPLLPTGGAPGTAGAMMGVEGGTGGVMAGIGGEGAGLSAANTMGAEASGLDAYADHA 687

Query: 349 QQLEQIPEIAAFGPLFKSSI--KPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQ 406
            +L  I E A++G L  +S    PV+LTESETEY+V+  KH+F E++V Q+ VTNTL + 
Sbjct: 688 TELASIAEFASYGKLLTTSPVNAPVQLTESETEYIVTAYKHVFAEHIVLQYNVTNTLAEI 747

Query: 407 LLENVTVVMQPESDEGTLVEEFVIPATKLPYDQPSS-IYVAFKRTNPEEYTLGSFSNTLK 465
           +LE+V VV+    + G L EEF++P   L    PS  +YV+ +R     + L + +NTL+
Sbjct: 748 VLEDVVVVVGGLMEAG-LEEEFILPIPCLSSATPSGKVYVSIRRDPSLPFPLATLTNTLR 806

Query: 466 FLVKDCDPSTXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVET 525
           F+ K+ DPS+                 +++  +D++ P  + DF+  WD++       ET
Sbjct: 807 FVSKEVDPSS-GEPEPEGYQDEYQTEELDVGVADFLQPVEL-DFAMTWDTL--PASASET 862

Query: 526 FALTASKSLKDSCTTLIELLGMSPVENSGTPTSSSVHTLMLSGTFL--GGIK-VLAKNRM 582
           FALTA +SL  SC+TL+ELLGM  +  +  P + SVHT+ML+G     GG++ VLA+ RM
Sbjct: 863 FALTALESLDASCSTLVELLGMQALGGTDVPANPSVHTMMLAGLLACPGGLETVLARVRM 922

Query: 583 TFAPSTGVTMELSVRSPSEEISRIVIGAV 611
              PS GVTMELSVR+PS+E    ++ A+
Sbjct: 923 MHQPSEGVTMELSVRAPSDEACLFILSAI 951



>gi|224105405|ref|XP_002313799.1| predicted protein [Populus trichocarpa]
 gi|222850207|gb|EEE87754.1| predicted protein [Populus trichocarpa]
          Length = 886

 Score =  545 bits (1404), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 297/609 (48%), Positives = 399/609 (65%), Gaps = 35/609 (5%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSS K  LRFAA+RTLNK+AMT P AV +CN+DME+LI+DQNRS+AT AITTLLKTGN
Sbjct: 298 LFLSSSKPVLRFAAVRTLNKVAMTHPMAVTNCNIDMESLISDQNRSIATLAITTLLKTGN 357

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQIT FMS+I+DEFK++VV+AIRSLCLKFP K   +++FLS +LR+EGG+E+
Sbjct: 358 ESSVDRLMKQITNFMSDIADEFKIVVVEAIRSLCLKFPLKYRSLMNFLSNILREEGGFEY 417

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K+A+V++I  L++ IPE+KE+ L HLCEFIEDCEFT LS ++LH LG+EGPKT  P+KYI
Sbjct: 418 KKAIVDSIVILIRDIPEAKESGLLHLCEFIEDCEFTYLSTQILHFLGIEGPKTTDPSKYI 477

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV LEN+ VRAAAVS LAKFG   +   +K  I VLL RC+ D+DDEVRDR  LY
Sbjct: 478 RYIYNRVHLENATVRAAAVSTLAKFGAMVD--ALKPRIFVLLRRCIFDSDDEVRDRTTLY 535

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQY---VSNPESSEKPFDLSDIPKITKAQAE 297
           L  +  +    +  +D  T+    L+  LV     + N E SE+PFD+  +PK  K+Q  
Sbjct: 536 LSTLGGDGEVVETDRDTKTFLFGDLDIPLVNLETSLKNYEPSEEPFDIDSVPKEVKSQPL 595

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE   P           G   + +G         +  A P   VD    Y + L  IPE 
Sbjct: 596 AEKKAP-----------GKKPTGLG---------APPAGPPSTVD---AYERLLSSIPEF 632

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
           + FG  FKSS  PVELTE+ETEY V+ VKH+F  ++VFQ+  TNT+ +QLLENV+V++  
Sbjct: 633 SDFGKPFKSS-APVELTEAETEYAVNVVKHIFDRHVVFQYNCTNTIPEQLLENVSVIVD- 690

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYT-LGSFSNTLKFLVKDCDPSTX 476
            S+     E    P   LPYD P   +VAF++  P+  T +G FSNTL+F+VK+ DP+T 
Sbjct: 691 SSEADNFAEVASKPLRSLPYDTPGQTFVAFEK--PKGITAVGKFSNTLRFIVKEVDPTT- 747

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+V +DY+    +S+F +AW+S+G+E + V+ + L   ++L +
Sbjct: 748 GEAEEDGVEDEYQLEDLEVVAADYMMKVGVSNFRNAWESMGDEFEHVDEYGLGPRENLAE 807

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   +I LLGM P E +    T+S  HT +LSG FLG ++VLA+ +     S  V M+L+
Sbjct: 808 AVIAVINLLGMQPCEGTEVVATNSRSHTCLLSGVFLGNVRVLARLQFGIHGSRDVAMKLA 867

Query: 596 VRSPSEEIS 604
           VRS  E +S
Sbjct: 868 VRSEDEAVS 876



>gi|507667552|ref|XP_004707875.1| PREDICTED: coatomer subunit gamma-2 [Echinops telfairi]
          Length = 759

 Score =  545 bits (1403), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 293/626 (46%), Positives = 395/626 (63%), Gaps = 64/626 (10%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 182 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 241

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 242 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHGVMMTFLSNMLRDDGGFEY 301

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +V+  PESKE+ LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 302 KRAIVDCIISIVEENPESKESGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPAPSKYI 361

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 362 RFIFNRVVLENEAVRAAAVSALAKFG--AQNESLLPSILVLLQRCMMDTDDEVRDRATFY 419

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIP--------- 289
           L ++   + A    Y+ +  T S+  +E+ L QY   P  SEKPFD+  IP         
Sbjct: 420 LNVLQQRQMALNAAYIFNGLTVSVPGMEKALHQYTLEP--SEKPFDMKSIPLAMAPVFEQ 477

Query: 290 --KITKAQAEAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVY 347
             +IT    + E L P                                       +Q ++
Sbjct: 478 KAEITLVTNKPEKLAP--------------------------------------SRQDIF 499

Query: 348 SQQLEQIPEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQL 407
            +QL  IPE    GPLFKSS +PV+LTE+ETEY V C+KH+F  ++VFQF  TNTLNDQL
Sbjct: 500 QEQLAAIPEFMNLGPLFKSS-EPVQLTEAETEYFVRCIKHVFTNHIVFQFDCTNTLNDQL 558

Query: 408 LENVTVVMQPESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLG-SFSNTLKF 466
           LE VTV M+P      L     IPA  L Y+QP   Y   +  + +   +  +FS T+KF
Sbjct: 559 LEKVTVRMEPSDAHEVLC---CIPAPSLAYNQPGMCYTLVRLPDDDPTAVACTFSCTMKF 615

Query: 467 LVKDCDPSTXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETF 526
            V+DCDPST                 +E+  SD++      +F++AW+ VG+  +  ETF
Sbjct: 616 TVRDCDPST-GVPDEDGYDDEYVLEDLEVTMSDHIQKVLKPNFAAAWEEVGDTFEKEETF 674

Query: 527 ALTASKSLKDSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFA 585
           AL+++K+L+++ + ++  LGM P E S   P + + H L L+G F GG  +L ++R+  A
Sbjct: 675 ALSSTKTLEEAVSNIVTFLGMQPCERSDRVPENKNSHALYLAGVFRGGCDLLVRSRLALA 734

Query: 586 PSTGVTMELSVRSPSEEISRIVIGAV 611
              GVTM+++VRS  E    +++ +V
Sbjct: 735 --DGVTMQVTVRSTEETPVDVILASV 758



>gi|224066105|ref|XP_002198012.1| PREDICTED: coatomer subunit gamma-1 [Taeniopygia guttata]
          Length = 874

 Score =  545 bits (1403), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 296/616 (48%), Positives = 397/616 (64%), Gaps = 41/616 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAINALCQKYPRKHAVLMNFLFTMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 414 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLRRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T    E 
Sbjct: 532 LNVLEQKQKALNAGYILNGLTVSIPGLERALHQYTLEP--SEKPFDLKSVPLATAPIIE- 588

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
                        Q    +  AV      + +T           +Q+++ +QL  IPE  
Sbjct: 589 -------------QRAENAPVAVVKQPEKVAAT-----------RQEIFQEQLGAIPEFR 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV LTE ETEYVV C KH F  +MVFQF  TNTLNDQ+LENVTV M+P 
Sbjct: 625 GLGPLFKSSPEPVALTELETEYVVRCTKHTFVNHMVFQFDCTNTLNDQILENVTVQMEP- 683

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
             EG  V  + IPA  L Y+QP + Y  VA    +P      +FS  +KF VKDCDP+T 
Sbjct: 684 -TEGYEVIGY-IPAKTLVYNQPGTCYTLVALSEEDPTAVAC-TFSCMMKFTVKDCDPNT- 739

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  +D++      +F +AWD VG+E +  ETF L+A K+L++
Sbjct: 740 GETDDEGYEDEYVLEDLEVTVADHIQRVLKPNFGAAWDEVGDEFEKEETFTLSAIKTLEE 799

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           + + +++ LGM P E S   P + + HTL L+G F GG  +L ++R+    +  VTM+++
Sbjct: 800 AVSNIVKFLGMQPCERSDKVPDNKNSHTLYLAGVFRGGHDLLVRSRLVLTDT--VTMQVT 857

Query: 596 VRSPSEEISRIVIGAV 611
            RS  E    +++ +V
Sbjct: 858 ARSAEELPVDVIMASV 873



>gi|466021139|ref|XP_004272238.1| PREDICTED: coatomer subunit gamma-2 [Orcinus orca]
          Length = 871

 Score =  545 bits (1403), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 290/602 (48%), Positives = 388/602 (64%), Gaps = 42/602 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 354 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +V+  P+SKEA LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 414 KRAIVDCIISIVEENPDSKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 474 RFIFNRVVLENEAVRAAAVSALAKFG--AQNENLLPSILVLLQRCMMDTDDEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L ++   + A    Y+ +  T S+  +E+ L QY   P  SEKPFD+  IP    A  E 
Sbjct: 532 LNVLQQRQMALNATYIFNGLTVSVPGMEKALHQYTLEP--SEKPFDMKSIPLAMAAVFEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
           +         A    + T    +                     +Q ++ +QL  IPE  
Sbjct: 590 K---------AEITLMATKPEKLAP------------------SRQDIFQEQLAVIPEFM 622

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV+LTE+ETEY V C+KHMF  ++VFQF  TNTLNDQLLE VTV ++P 
Sbjct: 623 NLGPLFKSS-EPVQLTEAETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQVEPS 681

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEE-YTLGSFSNTLKFLVKDCDPSTXX 477
                L     IP   LPY+QP   Y   +  + +     G+FS T+KF V+DCDP T  
Sbjct: 682 DSYEVLC---CIPVPSLPYNQPGICYTLVRLPDDDSTAAAGTFSCTMKFTVRDCDPDT-G 737

Query: 478 XXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDS 537
                          +E+  SD++      +F++AW+ VG+  +  ETFAL+++K+L+++
Sbjct: 738 VPAEEGYDDEYVLEDLEVTVSDHIQKVMKPNFAAAWEEVGDTFEKEETFALSSTKTLEEA 797

Query: 538 CTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSV 596
              +I  LGM P E S   P + + H+L L+G + GG  +L ++R+  A   GVTM+++V
Sbjct: 798 VNNIITFLGMQPCERSDKVPENKNSHSLYLAGVYRGGYDLLVRSRLALA--DGVTMQVTV 855

Query: 597 RS 598
           RS
Sbjct: 856 RS 857



>gi|505801263|ref|XP_004608312.1| PREDICTED: coatomer subunit gamma-2 [Sorex araneus]
          Length = 871

 Score =  544 bits (1402), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 290/606 (47%), Positives = 392/606 (64%), Gaps = 50/606 (8%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AIR+LC K+P K  V+++FLS +LRD+GG+E+
Sbjct: 354 ESSVDRLMKQISSFVSEISDEFKVVVVQAIRALCQKYPRKHSVLMTFLSNMLRDDGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +V+  PESKEA LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 414 KRAIVDCIISIVEENPESKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPAPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 474 RFIFNRVVLENEAVRAAAVSALAKFG--AQNESLLPSILVLLQRCMMDTDDEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIP----KITKA 294
           L ++   ++A    Y+ +  T S+  +E+ L QY   P  SEKPFD+  IP     + + 
Sbjct: 532 LNVLQQRQTALNAAYIFNGLTVSVPGMEKALHQYTLEP--SEKPFDMKAIPLAMTPVFEQ 589

Query: 295 QAEAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQI 354
           + E   + P+   LA +                               +Q ++ +QL  I
Sbjct: 590 KTEITLVTPKPEKLAPS-------------------------------RQDIFREQLAAI 618

Query: 355 PEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVV 414
           PE    GPLFKSS +PV+LTE+ETEY V CVKHMF  ++VFQF  TNTLNDQLLE VTV 
Sbjct: 619 PEFTTLGPLFKSS-EPVQLTEAETEYSVRCVKHMFTNHIVFQFDCTNTLNDQLLERVTVQ 677

Query: 415 MQPESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLGS-FSNTLKFLVKDCDP 473
           ++P      L     +PA  L Y+QP   Y   +    +   + + FS T+KF V+DCDP
Sbjct: 678 VEPSEPYEVLC---YVPAPSLAYNQPGICYTLLRLPEDDSAAVAATFSCTMKFAVRDCDP 734

Query: 474 STXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKS 533
            T                 +E+  SD++      +F++AW+ VG+  +  ETFAL+++K+
Sbjct: 735 DT-GVPAEDGYEDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDAFEKEETFALSSTKT 793

Query: 534 LKDSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTM 592
           L+++   +I  LGM P E S   P + + H+L L+G + GG  +L ++R+  A   GVTM
Sbjct: 794 LEEAVNNIISFLGMQPCERSDKVPENKNSHSLYLAGVYRGGSDLLVRSRLALA--DGVTM 851

Query: 593 ELSVRS 598
           +++VRS
Sbjct: 852 QVAVRS 857



>gi|224092677|ref|XP_002187860.1| PREDICTED: coatomer subunit gamma-2 isoform 1 [Taeniopygia guttata]
          Length = 871

 Score =  544 bits (1402), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 292/616 (47%), Positives = 398/616 (64%), Gaps = 44/616 (7%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKPVLRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 354 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++  PESKE+ LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 414 KRAIVDCIISIIEENPESKESGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPAPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D+DDEVRDRA  Y
Sbjct: 474 RFIFNRVVLENEAVRAAAVSALAKFG--AQNENLLPSILVLLQRCMMDSDDEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L ++   + A    Y+ +  T S+  +E+ L QY   P  SEKPFD+  +P         
Sbjct: 532 LNVLQQRQLALNAAYIFNGLTVSVPGMEKALHQYTLEP--SEKPFDMKTVP--------- 580

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
                      +T  I    + +  + S          PT    +Q ++ +QL  IPE  
Sbjct: 581 ----------LATAPIFEQKAEIALVPSK----PEKVAPT----RQDIFQEQLAAIPEFK 622

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
           + GPLFKSS +PV+LTE+ETEY V C+KH+F  ++VFQF  TNTLNDQLLE V+V M+P 
Sbjct: 623 SLGPLFKSS-EPVQLTEAETEYFVRCIKHVFPTHIVFQFDCTNTLNDQLLERVSVQMEPS 681

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
                +     IPA  L Y+QP   Y  V   + +P      +FS T+KF V+DCDPST 
Sbjct: 682 DGYDVIC---CIPAPSLAYNQPGMCYTLVRIPQDDPTAVAC-TFSCTMKFTVRDCDPST- 736

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  SD++      +F++AW+ VG++ +  ETFAL++ K+L +
Sbjct: 737 GVPEEDGYEDEYVLEDLEVTVSDHIQRVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDE 796

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   +I+ LGM P E S   P + + HTL L+G + GG  VL ++R+      GVTM+++
Sbjct: 797 AVNNIIKFLGMQPCERSDKVPENKNSHTLYLAGVYRGGCDVLVRSRLALG--DGVTMQVT 854

Query: 596 VRSPSEEISRIVIGAV 611
           VRS  E    +++ +V
Sbjct: 855 VRSKDETSVDVILASV 870



>gi|345779909|ref|XP_532421.3| PREDICTED: coatomer subunit gamma-2 [Canis lupus familiaris]
          Length = 808

 Score =  544 bits (1402), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 290/602 (48%), Positives = 387/602 (64%), Gaps = 42/602 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 231 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 290

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 291 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEY 350

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +V+  PE KEA LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 351 KRAIVDCIISIVEENPEGKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYI 410

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 411 RFIFNRVVLENEAVRAAAVSALAKFG--AQNENLLPSILVLLQRCMMDTDDEVRDRATFY 468

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L ++   + A    Y+ +  T S+  +E+ L QY   P  SEKPFD+  IP         
Sbjct: 469 LNVLQQRQMALNATYIFNGLTVSVPGMEKALHQYTLEP--SEKPFDMKSIPLA------- 519

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
             + P     A    + T    V                     +Q ++ +QL  IPE  
Sbjct: 520 --MAPVFEQKAEITLVATKPEKVAP------------------SRQDIFQEQLAAIPEFM 559

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV+LTE+ETEY V C+KHMF  ++VFQF  TNTLNDQLLE VTV ++P 
Sbjct: 560 DLGPLFKSS-EPVQLTEAETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQVEPS 618

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTL-GSFSNTLKFLVKDCDPSTXX 477
                L     IPA  L Y+QP   Y   +  + +   + G+FS T+KF V+DCDP T  
Sbjct: 619 DSYEVLC---CIPAPSLSYNQPGICYTLVRLPDDDSTAVAGTFSCTMKFTVRDCDPDT-G 674

Query: 478 XXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDS 537
                          +E+  SD++      +F++AW+ VG+  +  ETFAL+++K+L+++
Sbjct: 675 VPAEEGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDTFEKEETFALSSTKTLEEA 734

Query: 538 CTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSV 596
              +I  LGM P E S   P + + H+L L+G + GG  +L ++R+  A   GVTM+++V
Sbjct: 735 VNNIITFLGMQPCERSDKVPENKNSHSLYLAGVYRGGYDLLVRSRLALA--DGVTMQVTV 792

Query: 597 RS 598
           RS
Sbjct: 793 RS 794



>gi|118081889|ref|XP_414981.2| PREDICTED: coatomer subunit gamma-2 isoform X2 [Gallus gallus]
          Length = 871

 Score =  544 bits (1401), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 294/616 (47%), Positives = 402/616 (65%), Gaps = 44/616 (7%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKPVLRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 354 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++  PESKE+ LAHLCEFIEDCE T L+ ++LHLLG EGP+TP+P+KYI
Sbjct: 414 KRAIVDCIISIIEENPESKESGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPSPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D+DDEVRDRA  Y
Sbjct: 474 RFIFNRVVLENEAVRAAAVSALAKFG--AQNENLLPSILVLLQRCMMDSDDEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L ++   + A    Y+ +  T S+  +E+ L QY   P  S+KPFD+  +P         
Sbjct: 532 LNVLQQRQIALNAAYIFNGLTVSVPGMEKALHQYTLEP--SDKPFDMKTVP--------- 580

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
                      +T  I    + +    S + S      P+    +Q ++ +QL  IPE  
Sbjct: 581 ----------LATAPIFEQKAEI----SLVTSKPEKVAPS----RQDIFQEQLAAIPEFK 622

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
           + GPLFKSS +PV+LTE+ETEY V C+KH+F  ++VFQF  TNTLNDQLLE VTV M+P 
Sbjct: 623 SLGPLFKSS-EPVQLTEAETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEP- 680

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
           SD   ++    IPA  L Y+QP   Y  V   + +P      +FS T+KF V+DCDP+T 
Sbjct: 681 SDAYDVI--CCIPAPSLAYNQPGMCYTLVQMPQDDPTAVAC-TFSCTMKFTVRDCDPNT- 736

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  SD++      +F++AW+ VG++ +  ETFAL + K+L +
Sbjct: 737 GVPDEDGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDDFEKEETFALGSIKTLDE 796

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   +I+ LGM P E S   P + + HTL LSG + GG  VL ++R+      GVTM+++
Sbjct: 797 AVNNIIKFLGMQPCERSDKVPENKNSHTLYLSGVYRGGCDVLVRSRLALG--DGVTMQVT 854

Query: 596 VRSPSEEISRIVIGAV 611
           VRS  E    +++ +V
Sbjct: 855 VRSKEEMPVDVILASV 870



>gi|410952887|ref|XP_003983109.1| PREDICTED: coatomer subunit gamma-2 [Felis catus]
          Length = 808

 Score =  544 bits (1401), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 290/613 (47%), Positives = 388/613 (63%), Gaps = 64/613 (10%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 231 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 290

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 291 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEY 350

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +V+  PE KEA LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 351 KRAIVDCIISIVEENPEGKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYI 410

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 411 RFIFNRVVLENEAVRAAAVSALAKFG--AQNENLLPSILVLLQRCMMDTDDEVRDRATFY 468

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIP--------- 289
           L ++   + +    Y+ +    S+  +E+ L QY   P  SEKPFD+  IP         
Sbjct: 469 LNVLQQRQMSLNATYIFNGLAVSVPGMEKALHQYTLEP--SEKPFDMKSIPLAMAPVFEQ 526

Query: 290 --KITKAQAEAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVY 347
             +IT    + E L P                                       +Q ++
Sbjct: 527 KAEITLVATKPEKLAP--------------------------------------SRQDIF 548

Query: 348 SQQLEQIPEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQL 407
            +QL  +PE    GPLFKSS +PV+LTE+ETEY V C+KHMF +++VFQF  TNTLNDQL
Sbjct: 549 QEQLAAVPEFMNLGPLFKSS-EPVQLTEAETEYFVRCIKHMFTDHIVFQFECTNTLNDQL 607

Query: 408 LENVTVVMQPESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEE-YTLGSFSNTLKF 466
           LE VTV ++P      L     IPA  LPY+QP   Y   +  + +     G+FS T+KF
Sbjct: 608 LEKVTVQVEPSDSYEVLC---CIPAPSLPYNQPGICYTLVRLPDDDSTAAAGTFSCTMKF 664

Query: 467 LVKDCDPSTXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETF 526
            V+DCDP T                 +E+  SD++      +F++AW+ VG+  +  ETF
Sbjct: 665 TVRDCDPDT-GVPAEEGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDTFEKEETF 723

Query: 527 ALTASKSLKDSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFA 585
           AL+++K+L+++   +I  LGM P E S   P + + H+L LSG + GG  +L ++R+  A
Sbjct: 724 ALSSTKTLQEAVNNIITFLGMQPCERSDKVPENKNSHSLYLSGVYRGGYDLLVRSRLALA 783

Query: 586 PSTGVTMELSVRS 598
              GVTM+++VRS
Sbjct: 784 --DGVTMQVTVRS 794



>gi|326910988|ref|XP_003201845.1| PREDICTED: coatomer subunit gamma-2-like isoform 1 [Meleagris
           gallopavo]
          Length = 871

 Score =  544 bits (1401), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 293/616 (47%), Positives = 401/616 (65%), Gaps = 44/616 (7%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKPVLRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 354 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMAFLSSMLRDDGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++  PESKE+ LAHLCEFIEDCE T L+ ++LHLLG EGP+TP+P+KYI
Sbjct: 414 KRAIVDCIISIIEENPESKESGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPSPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D+DDEVRDRA  Y
Sbjct: 474 RFIFNRVVLENEAVRAAAVSALAKFG--AQNENLLPSILVLLQRCMMDSDDEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L ++   + A    Y+ +  T S+  +E+ L QY   P  S+KPFD+  +P         
Sbjct: 532 LNVLQQRQIALNAAYIFNGLTVSVPGMEKALHQYTLEP--SDKPFDMKTVP--------- 580

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
                      +T  I    + +    S + S      P+    +Q ++ +QL  IPE  
Sbjct: 581 ----------LATAPIFEQKAEI----SLVTSKPEKVAPS----RQDIFQEQLAAIPEFK 622

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV+LTE+ETEY V C+KH+F  ++VFQF  TNTLNDQLLE VTV M+P 
Sbjct: 623 GLGPLFKSS-EPVQLTEAETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLERVTVQMEP- 680

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
           SD   ++    IPA  L Y+QP   Y  V   + +P      +FS T+KF V+DCDP+T 
Sbjct: 681 SDAYDVI--CCIPAPSLAYNQPGMCYTLVQMPQADPTAVAC-TFSCTMKFTVRDCDPNT- 736

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  SD++      +F++AW+ VG++ +  ETFAL + K+L +
Sbjct: 737 GVPDEDGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDDFEKEETFALGSIKTLDE 796

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   +I+ LGM P E S   P + + HTL L+G + GG  VL ++R+      GVTM+++
Sbjct: 797 AVNNIIKFLGMQPCERSDKVPENKNSHTLYLAGVYRGGCDVLVRSRLALG--DGVTMQVT 854

Query: 596 VRSPSEEISRIVIGAV 611
           VRS  E    +++ +V
Sbjct: 855 VRSKEEMPVDVILASV 870



>gi|126340699|ref|XP_001367114.1| PREDICTED: coatomer subunit gamma-2 [Monodelphis domestica]
          Length = 871

 Score =  543 bits (1400), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 294/615 (47%), Positives = 395/615 (64%), Gaps = 42/615 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 354 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +V+  PESKE+ LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 414 KRAIVDCIISIVEDNPESKESGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 474 RFIFNRVVLENEAVRAAAVSALAKFG--AQNENLLPSILVLLQRCMMDTDDEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L ++   + A    Y+ +    S+  +E+ L QY   P  SEKPFDL  +P  T      
Sbjct: 532 LNVLQQKQMALNAAYIFNGLMVSIPGMEKALHQYTLAP--SEKPFDLKSVPLATAP---- 585

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
                  F+  +  T+             + S      P+    +Q ++ +QL  IPE  
Sbjct: 586 ------VFEQKAEITL-------------VASKPEKLAPS----RQDIFQEQLAAIPEFK 622

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV+LTE+ETEY V CVKHMF  ++VFQF  TNTLNDQLLE VTV M+P 
Sbjct: 623 NIGPLFKSS-EPVQLTEAETEYFVRCVKHMFNNHIVFQFDCTNTLNDQLLEKVTVQMEPS 681

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLG-SFSNTLKFLVKDCDPSTXX 477
                L     IPA  L Y+QP   Y   +  + +   +  +FS T+KF V+DCDP+T  
Sbjct: 682 DAYDVLC---CIPAPSLTYNQPGICYTLVRLPDDDPTAVACTFSCTMKFTVRDCDPNT-G 737

Query: 478 XXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDS 537
                          +E+  SD++      +F+ AW+ VG+  +  ETFAL+ +K+L+++
Sbjct: 738 IPDEDGYDDEYVLEDLEVCMSDHIQKVLKPNFAVAWEEVGDNFEKEETFALSTTKTLEEA 797

Query: 538 CTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSV 596
              ++  LGM P E S   P + + HTL LSG + GG  +L ++R+  A   GVTM+++V
Sbjct: 798 VNNIVTFLGMQPCERSDKVPENKNSHTLYLSGVYRGGYDLLVRSRL--ALGDGVTMQVTV 855

Query: 597 RSPSEEISRIVIGAV 611
           RS  E    +++ +V
Sbjct: 856 RSKEETPVDVILASV 870



>gi|332261819|ref|XP_003279964.1| PREDICTED: coatomer subunit gamma-1 isoform 2 [Nomascus leucogenys]
          Length = 874

 Score =  543 bits (1400), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 291/617 (47%), Positives = 396/617 (64%), Gaps = 43/617 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEF+V+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFQVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 414 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTTNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATAPMAEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINS-NIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
                            T S+ + ++     V+ +R          Q+++ +QL  +PE 
Sbjct: 590 R----------------TESTPITAVKQPEKVAATR----------QEIFQEQLAAVPEF 623

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
              GPLFKSS +PV LTESETEYV+ C KH F  +MVFQF  TNTLNDQ LENVTV M+P
Sbjct: 624 RGLGPLFKSSPEPVALTESETEYVIRCTKHTFTNHMVFQFDCTNTLNDQTLENVTVQMEP 683

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPST 475
                 L     +PA  LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP+T
Sbjct: 684 TEAYEVLC---YVPARSLPYNQPGTCYTLVALPKEDPTAVAC-TFSCMMKFTVKDCDPTT 739

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLK 535
                            +E+  +D++      +F +AWD VG+E +  ETF L+  K+L+
Sbjct: 740 -GETDDEGYEDEYVLEDLEVTVADHIQKVMKLNFEAAWDEVGDEFEKEETFTLSTIKTLE 798

Query: 536 DSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
           ++   +++ LGM P E S   P ++ VHT+  +  F GG  +L ++R+    +  VTM++
Sbjct: 799 EAVGNIVKFLGMHPCERSDKVPENNRVHTVYFACVFRGGHDILVRSRLLLLDT--VTMQV 856

Query: 595 SVRSPSEEISRIVIGAV 611
           + RS  E    I++ +V
Sbjct: 857 TARSLEELPVDIILASV 873



>gi|356508418|ref|XP_003522954.1| PREDICTED: coatomer subunit gamma-like [Glycine max]
          Length = 886

 Score =  543 bits (1400), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 301/609 (49%), Positives = 396/609 (65%), Gaps = 35/609 (5%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSS K  LRFAA+RTLNK+AMT P AV +CN+DME+LI+DQNRS+AT AITTLLKTGN
Sbjct: 298 LFLSSTKPVLRFAAVRTLNKVAMTHPMAVTNCNIDMESLISDQNRSIATLAITTLLKTGN 357

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQIT FMS+I+DEFK++VV+AIRSLCLKFP K   +++FLS +LR+EGG+++
Sbjct: 358 ESSVDRLMKQITNFMSDIADEFKIVVVEAIRSLCLKFPLKYRSLMNFLSNILREEGGFDY 417

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K+A+V++I  L++ IP +KEA L HLCEFIEDCEFT LS ++LH LG+EGPKT  P+KYI
Sbjct: 418 KKAIVDSIVILIRDIPNAKEAGLLHLCEFIEDCEFTYLSTQILHFLGIEGPKTSDPSKYI 477

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV LEN+IVRA+AVS LAKFG + +   +K  I VLL RCL D+DDEVRDRA LY
Sbjct: 478 RYIYNRVHLENAIVRASAVSTLAKFGAAVD--ALKPRIFVLLRRCLFDSDDEVRDRATLY 535

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQY---VSNPESSEKPFDLSDIPKITKAQAE 297
           L  +  + S  +  KD   +     +  LV     + N E SE+ FD++ +PK  K Q  
Sbjct: 536 LNTLGGDGSVVETDKDVKDFLFGPFDVPLVNLETSLKNYEPSEEAFDINSVPKEVKFQPL 595

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE   P           G   + +G+  S   ST+ DA           Y + L  IPE 
Sbjct: 596 AEKKAP-----------GKKPTGLGAPPSGPPSTA-DA-----------YERMLSTIPEC 632

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
           A FG LFKSS  PVELTE+ETEY V+ +KH+F  ++VFQ+  TNT+ +QLLE+V V +  
Sbjct: 633 ANFGKLFKSS-APVELTEAETEYAVNVIKHIFDRHVVFQYNCTNTIPEQLLEDVIVTVDA 691

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEY-TLGSFSNTLKFLVKDCDPSTX 476
            SD     E F  P   LPYD P   +VAF++  PE   T+G FSN LKF++K+ DP+T 
Sbjct: 692 -SDADEFSEVFSKPLRSLPYDSPGQTFVAFEK--PEGVPTVGKFSNVLKFIIKEVDPTT- 747

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +EIV +DYV    +S+F +AW+S+G + + V+ + L   +SL +
Sbjct: 748 GEAEDDGVEDEYQLEDLEIVAADYVLKVGVSNFRNAWESLGPDFERVDEYGLGPRESLAE 807

Query: 537 SCTTLIELLGMSPVENS-GTPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +  T+I LLG+ P E +   P +S  HT +LSG F G IKVL +          + M+LS
Sbjct: 808 AVNTVINLLGLEPCEGTEEVPPNSRSHTCLLSGVFTGNIKVLVRLSFGLDGPKDIAMKLS 867

Query: 596 VRSPSEEIS 604
           VRS  E +S
Sbjct: 868 VRSEDETVS 876



>gi|410951822|ref|XP_003982592.1| PREDICTED: coatomer subunit gamma-1 [Felis catus]
          Length = 874

 Score =  543 bits (1399), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 288/616 (46%), Positives = 395/616 (64%), Gaps = 41/616 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 414 KRAIVDCIISIIEENTESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATTPMAEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
                             S+    +  +  V+ +R          + ++ +QL  +PE  
Sbjct: 590 RT---------------ESTPITAAKQAEKVAATR----------EDIFQEQLAAVPEFH 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             G LFKSS +PV LTESETEYV+ C KH F ++MVFQF  TNTLNDQ LENVTV M+P 
Sbjct: 625 GLGLLFKSSPEPVALTESETEYVIRCTKHTFTDHMVFQFDCTNTLNDQTLENVTVQMEPT 684

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
                L     +PA  LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP+T 
Sbjct: 685 EAYEVLC---YVPARSLPYNQPGTCYTLVALPKEDPTAVAC-TFSCMMKFTVKDCDPTT- 739

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  +D++    + +F +AWD +G+E +  ETF L+  K+L++
Sbjct: 740 GETDDEGYEDEYVLEDLEVTVADHIQKVMVLNFEAAWDQLGDEFEKEETFTLSTIKTLEE 799

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +   +++ LGM P E S   P + + HTL+L+G F G   +L ++R+    +  VTM+++
Sbjct: 800 AVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGNHDILVRSRLLLLDT--VTMQVT 857

Query: 596 VRSPSEEISRIVIGAV 611
            RS  E    +++ +V
Sbjct: 858 ARSSEELPVDMILASV 873



>gi|502130920|ref|XP_004500815.1| PREDICTED: coatomer subunit gamma-like [Cicer arietinum]
          Length = 887

 Score =  543 bits (1399), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 302/613 (49%), Positives = 403/613 (65%), Gaps = 43/613 (7%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSS K  LRFAA+RTLNK+AMT PT+V +CN+DME+LI+DQNRS+AT AITTLLKTGN
Sbjct: 299 LFLSSSKPVLRFAAVRTLNKVAMTHPTSVTNCNIDMESLISDQNRSIATLAITTLLKTGN 358

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQIT FMS+I+DEFK++VV+AIRSLC KFP K   +++FLS +LR+EGG+E+
Sbjct: 359 ESSVDRLMKQITNFMSDIADEFKIVVVEAIRSLCQKFPLKYRSLMNFLSNILREEGGFEY 418

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K+A+V++I  L++ IP++KE  L HLCEFIEDCEFT LS ++LH LG+EGPKT  P++YI
Sbjct: 419 KKAIVDSIVILIREIPDAKETGLLHLCEFIEDCEFTYLSTQILHFLGIEGPKTSDPSRYI 478

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV LEN+ VRA AVS LAKFG + +  E+K  I VLL RCL D+DDEVRDRA LY
Sbjct: 479 RFIYNRVHLENATVRAGAVSTLAKFGAAVD--ELKPRIFVLLRRCLFDSDDEVRDRATLY 536

Query: 241 LKLIDDNESA---EKYVKDDSTYSLAALERQLVQY---VSNPESSEKPFDLSDIPKITKA 294
           L  +  + S    +K VKD   +     +  LV     + N E SE+ FD+  +PK  K+
Sbjct: 537 LNTLGGDGSVVETDKAVKD---FLFGPFDIPLVNLETSLKNYEPSEEAFDIDSVPKEVKS 593

Query: 295 QAEAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQI 354
           Q+ AE   P           G   + +G+  S   ST+ DA           Y + L  I
Sbjct: 594 QSLAEKKAP-----------GKKPTGLGAPPSGPPSTA-DA-----------YQKILSSI 630

Query: 355 PEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVV 414
           PE A FG LFKSS  PVELTE+ETEY V+ VKH+F  ++VFQ+  TNT+ +QLLENV V+
Sbjct: 631 PEFANFGNLFKSS-APVELTEAETEYAVNVVKHIFDRHVVFQYNCTNTIPEQLLENVIVI 689

Query: 415 MQ-PESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEY-TLGSFSNTLKFLVKDCD 472
           +   E+DE    E F  P   LPYD P  I+VAF++  PE   TLG FSN LKF+V++ D
Sbjct: 690 VDSSEADE--FAEVFSKPLKSLPYDSPGQIFVAFEK--PEGAPTLGKFSNVLKFIVREVD 745

Query: 473 PSTXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASK 532
           P+T                 +EIV++DY     +S+F +AW+S+G + + V+ + L   +
Sbjct: 746 PTT-GEAEDDGVEDEYQLEDLEIVSADYTLKVAVSNFRNAWESMGPDCERVDEYGLGPRE 804

Query: 533 SLKDSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVT 591
           SL ++  T+I LLG+ P E +   P +S  HT +LSG ++G +KVL +          V 
Sbjct: 805 SLAEAVNTVINLLGLQPCEGTEVVPPNSRSHTCLLSGVYIGNVKVLVRLSFGLDGPKDVA 864

Query: 592 MELSVRSPSEEIS 604
           M+L+VRS  E +S
Sbjct: 865 MKLTVRSDDETVS 877



>gi|301755308|ref|XP_002913488.1| PREDICTED: coatomer subunit gamma-2-like [Ailuropoda melanoleuca]
          Length = 871

 Score =  543 bits (1398), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 288/602 (47%), Positives = 387/602 (64%), Gaps = 42/602 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 354 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +V+  PE KEA LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 414 KRAIVDCIISIVEENPEGKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 474 RFIFNRVVLENEAVRAAAVSALAKFG--AQNENLLPSILVLLQRCMMDTDDEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L ++   + A    Y+ +  T S+  +E+ L QY   P  SEKPFD+  IP         
Sbjct: 532 LNVLQQRQMALNATYIFNGLTVSVPGMEKALHQYTLEP--SEKPFDMKSIPLA------- 582

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
             + P     A    + T    +                     +Q ++ +QL  IPE  
Sbjct: 583 --MAPVFEQKAEIMLVATKPEKLAP------------------SRQDIFQEQLAAIPEFM 622

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV+LTE+ETEY V C+KH+F  ++VFQF  TNTLNDQLLE VTV M+P 
Sbjct: 623 DLGPLFKSS-EPVQLTEAETEYFVRCIKHVFTNHIVFQFDCTNTLNDQLLEKVTVQMEPS 681

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTL-GSFSNTLKFLVKDCDPSTXX 477
                L     +PA  L Y+QP   Y   +  + +   + G+FS T+KF V+DCDP T  
Sbjct: 682 ESYEVLC---CLPAPSLAYNQPGICYTLVRLPDDDSTAVAGTFSCTMKFTVRDCDPDT-G 737

Query: 478 XXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDS 537
                          +E+  SD++      +F++AW+ VG+  +  ETFAL+++K+L+++
Sbjct: 738 VPAEEGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDTFEKEETFALSSTKTLEEA 797

Query: 538 CTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSV 596
              +I  LGM P E S   P + + H+L L+G + GG  +L ++R+  A   GVTM+++V
Sbjct: 798 VNNIITFLGMQPCERSDKVPENKNSHSLYLAGVYRGGYDLLVRSRLALA--DGVTMQVTV 855

Query: 597 RS 598
           RS
Sbjct: 856 RS 857



>gi|355786374|gb|EHH66557.1| hypothetical protein EGM_03573 [Macaca fascicularis]
          Length = 874

 Score =  543 bits (1398), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 294/617 (47%), Positives = 396/617 (64%), Gaps = 43/617 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAISALCQKYPRKHAVLMNFLFTMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EG KT  P+KYI
Sbjct: 414 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGSKTTNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
            +IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 HFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T   AE 
Sbjct: 532 LNVLEQKQKALNAGYILNGLTVSIPGLERALQQYTLEP--SEKPFDLKSVPLATAPMAEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINS-NIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
                            T S+ + ++     V+ +R          Q+++ +QL  +PE 
Sbjct: 590 R----------------TESTPITAVKQPEKVAATR----------QEIFQEQLAAVPEF 623

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
              GPLFKSS +PV LTESETEYV+ C KH F  +MVFQF  TNTLNDQ LENVTV M+P
Sbjct: 624 RGLGPLFKSSPEPVALTESETEYVIRCTKHTFTNHMVFQFDCTNTLNDQTLENVTVQMEP 683

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPST 475
              E   V  +V P   LPY+QP + Y  VA  + +P      +FS  +KF VKDCDP+T
Sbjct: 684 --TEAYEVLRYV-PTQSLPYNQPGTCYTLVALPKEDPTAVAC-TFSCMMKFTVKDCDPTT 739

Query: 476 XXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLK 535
                            +E+  +D++      +F +AWD VG+E +  ETF L+  K+L+
Sbjct: 740 -GETDDEGYEDEYVLEDLEVTVADHIQKVMKLNFEAAWDEVGDEFEKEETFTLSTIKTLE 798

Query: 536 DSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMEL 594
           ++   +++ LGM P E S   P + + HTL+L+G F GG  +L  +R+    +  VTM+L
Sbjct: 799 EAVGNIVKFLGMHPCERSDKVPDNKNTHTLLLAGVFRGGHDILVHSRLPLLDT--VTMQL 856

Query: 595 SVRSPSEEISRIVIGAV 611
           + RS  E    I++ +V
Sbjct: 857 TPRSLEELPVDIILASV 873



>gi|395539415|ref|XP_003771666.1| PREDICTED: coatomer subunit gamma-2 [Sarcophilus harrisii]
          Length = 888

 Score =  542 bits (1397), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 291/615 (47%), Positives = 396/615 (64%), Gaps = 42/615 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 311 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 370

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+++
Sbjct: 371 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFKY 430

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I ++V+  PESKE+ LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 431 KRAIVDCIINIVEENPESKESGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYI 490

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 491 RFIFNRVVLENEAVRAAAVSALAKFG--AQNENLLPSILVLLQRCMMDTDDEVRDRATFY 548

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L ++   + A    Y+ +  T S+  +E+ L QY  +P  SEKPFDL  +P  T      
Sbjct: 549 LNVLQQKQMALNAAYIFNGLTVSIPGMEKALHQYTLSP--SEKPFDLKSVPLATAP---- 602

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
                  F+  +  T+             + +      P+    +Q ++ +QL  IPE  
Sbjct: 603 ------VFEQKAEITL-------------VANKPEKLAPS----RQDIFQEQLAAIPEFK 639

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV+LTE+ETEY V CVKHMF  ++VFQF  TNTLNDQ LE VTV M+P 
Sbjct: 640 NLGPLFKSS-EPVQLTEAETEYFVRCVKHMFNNHIVFQFDCTNTLNDQFLEKVTVQMEPS 698

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLG-SFSNTLKFLVKDCDPSTXX 477
                L     IPA  L Y+QP   Y   +  + +   +  +FS T+KF V+DCDP+T  
Sbjct: 699 DAYDVLC---CIPAPSLTYNQPGICYTLVRLPDDDPTAVACTFSCTMKFTVRDCDPNT-G 754

Query: 478 XXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDS 537
                          +E+  SD++      +F+ AW+ VG+  +  ETFAL+ +K+L+++
Sbjct: 755 IPDEDGYDDEYVLEDLEVSMSDHIQKVLKPNFAVAWEEVGDNFEKEETFALSTTKTLEEA 814

Query: 538 CTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSV 596
              ++  LGM P E S   P + + HTL LSG + GG  +L ++R+      GVTM+++V
Sbjct: 815 VNNIVTFLGMQPCERSDKVPENKNSHTLYLSGVYRGGYDLLVRSRLALG--DGVTMQVTV 872

Query: 597 RSPSEEISRIVIGAV 611
           RS  E    +++ +V
Sbjct: 873 RSKEETPVDVILASV 887



>gi|71895411|ref|NP_001025768.1| coatomer subunit gamma [Gallus gallus]
 gi|60098603|emb|CAH65132.1| hypothetical protein RCJMB04_3p13 [Gallus gallus]
          Length = 874

 Score =  542 bits (1396), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 300/617 (48%), Positives = 397/617 (64%), Gaps = 42/617 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK+ LR+AA+RTLNK+AM  P+AV +CNLD+ENL+TD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKAALRYAAVRTLNKVAMKHPSAVTACNLDLENLVTDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+S+DRLMKQI+ FMSEISDEFKV+VV AI +LC K+P K  V+++FL  +LR+EGG+E+
Sbjct: 354 ESSIDRLMKQISSFMSEISDEFKVVVVQAINALCQKYPRKHAVLMNFLFTMLREEGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++   ESKE  L+HLCEFIEDCEFT L+ R+LHLLG EGPKT  P+KYI
Sbjct: 414 KRAIVDCIISIIEENSESKETGLSHLCEFIEDCEFTVLATRILHLLGQEGPKTNNPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+IYNRV+LE+  VRA AVSALAKFG  A++ E+  SI VLL RC+ D+D+EVRDRA  Y
Sbjct: 474 RFIYNRVVLEHEEVRAGAVSALAKFG--AQNEEMLPSILVLLKRCVMDDDNEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L +++  + A    Y+ +  T S+  LER L QY   P  SEKPFDL  +P  T    E 
Sbjct: 532 LNVLEQKQKALNAGYILNGLTVSIPGLERALHQYTLEP--SEKPFDLKSVPLATAPIIE- 588

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
                        Q    +  AV      + +T           +Q+++ +QL  IPE  
Sbjct: 589 -------------QRAENAPVAVAKQPEKVAAT-----------RQEIFQEQLGAIPEFR 624

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             G LFKSS +PV LTE ETEYVV C KH F  +MVFQF  TNTLNDQ+LENVTV M+P 
Sbjct: 625 GLGSLFKSSPEPVALTELETEYVVRCTKHTFVSHMVFQFDCTNTLNDQILENVTVQMEP- 683

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
             EG  V  + IPA  L Y+QP + Y  VA    +P      +FS  +KF VKDCDP+T 
Sbjct: 684 -TEGYEVIGY-IPAKSLVYNQPGTCYTLVALSEEDPTAVAC-TFSCMMKFTVKDCDPNT- 739

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+  +D++      +F +AWD VG+E +  ETF L+A K+L++
Sbjct: 740 GETDDEGYEDEYVLEDLEVTVADHIQRVLKPNFGAAWDEVGDEYEKEETFTLSAIKTLEE 799

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           + + +++ LGM P E S   P + + HTL L+G F GG  VL + R+    +  VTM+++
Sbjct: 800 AVSNIVKFLGMQPCERSDKVPDNKNSHTLYLAGVFRGGHDVLLRARLLLTDT--VTMQVT 857

Query: 596 VRSPSEEISRIVIGAVV 612
            RS +EE+   VI A V
Sbjct: 858 ARS-AEELPVDVIMASV 873



>gi|471399394|ref|XP_004382736.1| PREDICTED: coatomer subunit gamma-2 [Trichechus manatus
           latirostris]
          Length = 871

 Score =  541 bits (1395), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 291/606 (48%), Positives = 392/606 (64%), Gaps = 50/606 (8%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 354 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHGVMMTFLSNMLRDDGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +V+  PESKE+ LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 414 KRAIVDCIISIVEENPESKESGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 474 RFIFNRVVLENEAVRAAAVSALAKFG--AQNENLLPSILVLLQRCMMDTDDEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIP----KITKA 294
           L ++   + A    Y+ +  T S+  +E+ L QY   P  SEKPFD+  IP     + + 
Sbjct: 532 LNVLQQRQMALNATYIFNGLTVSVPGMEKALHQYTLEP--SEKPFDMKSIPLAMAPVFEQ 589

Query: 295 QAEAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQI 354
           +AE   +  +   LA ++                               Q ++ +QL  I
Sbjct: 590 KAEISLVANKPEKLAPSR-------------------------------QDIFQEQLAAI 618

Query: 355 PEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVV 414
           PE    GPLFKSS +PV+LTE+ETEY V C+KHMF  ++VFQF  TNTLNDQLLE VTV 
Sbjct: 619 PEFMNLGPLFKSS-EPVQLTEAETEYFVRCIKHMFANHIVFQFDCTNTLNDQLLEKVTVQ 677

Query: 415 MQPESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLG-SFSNTLKFLVKDCDP 473
           M+P      L     IPA  L Y+QP   Y   +  + +   +  +FS T+KF V+DCDP
Sbjct: 678 MEPSDAYEVLC---YIPAPSLTYNQPGICYTLVRLPDDDPTAVACTFSCTMKFTVRDCDP 734

Query: 474 STXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKS 533
           +T                 +E+  SD++      +F++AW+ VG+  +  ETFAL+++K+
Sbjct: 735 NT-GVPDEDGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDTFEKEETFALSSAKT 793

Query: 534 LKDSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTM 592
           L+++   +I  LGM P E S   P + + H+L L+G F GG  +L ++R+  A   GVTM
Sbjct: 794 LEEAVNNIITFLGMQPCERSDKVPENKNSHSLYLAGVFRGGYDLLVRSRLALA--DGVTM 851

Query: 593 ELSVRS 598
           +++VRS
Sbjct: 852 QVTVRS 857



>gi|511834340|ref|XP_004741802.1| PREDICTED: coatomer subunit gamma-2 isoform X2 [Mustela putorius
           furo]
 gi|511941668|ref|XP_004789616.1| PREDICTED: coatomer subunit gamma-2 isoform X2 [Mustela putorius
           furo]
          Length = 874

 Score =  541 bits (1395), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 289/602 (48%), Positives = 391/602 (64%), Gaps = 39/602 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 354 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +V+  PE KEA LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 414 KRAIVDCIISIVEENPEGKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 474 RFIFNRVVLENEAVRAAAVSALAKFG--AQNENLLPSILVLLQRCMMDTDDEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L ++   + A    Y+ +  T S+  LE+ L +Y   P  SEKPFD+  IP +  A    
Sbjct: 532 LNVLQQRQMALNATYIFNGLTVSVPGLEKALHRYTLEP--SEKPFDMKSIP-LAVAPVFE 588

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
           +  +     L +T+    + S                       +Q ++ +QL  IPE  
Sbjct: 589 QKAESTEITLVATKPEKLAPS-----------------------RQDIFQEQLAAIPEFM 625

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +P++LTE+ETEY V C+KHMF  ++VFQF  TNTLNDQLLE VTV ++P 
Sbjct: 626 DLGPLFKSS-EPIQLTEAETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQVEPS 684

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTL-GSFSNTLKFLVKDCDPSTXX 477
                L     IPA  L Y+QP   Y   +  + +  T+  +FS T+KF V+DCDP T  
Sbjct: 685 DSYEVLC---CIPAPSLAYNQPGICYTLVRLPDDDSTTVTATFSCTMKFTVRDCDPDT-G 740

Query: 478 XXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDS 537
                          +E+  SD++      +F++AW+ VG+  +  ETFAL+++K+L+++
Sbjct: 741 VPAEEGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDTFEKEETFALSSTKTLEEA 800

Query: 538 CTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSV 596
              +I  LGM P E S   P + + H+L L+G + GG  +L ++R+  A   GVTM+++V
Sbjct: 801 VNNIITFLGMQPCERSDKVPENKNSHSLYLAGVYRGGYDLLVRSRLALA--DGVTMQVTV 858

Query: 597 RS 598
           RS
Sbjct: 859 RS 860



>gi|507554973|ref|XP_004661259.1| PREDICTED: coatomer subunit gamma-2 [Jaculus jaculus]
          Length = 871

 Score =  541 bits (1394), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 290/619 (46%), Positives = 399/619 (64%), Gaps = 50/619 (8%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SS K  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSLKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC ++P K  VM++FLS +LRD+GG+E+
Sbjct: 354 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQRYPRKHSVMMTFLSNMLRDDGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +V+  PESKEA LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 414 KRAIVDCIISIVEENPESKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 474 RFIFNRVVLENEAVRAAAVSALAKFG--AQNESLLPSILVLLQRCMMDTDDEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIP----KITKA 294
           L ++   + +    Y+ +  T S+  +E+ L QY   P  SEKPFDL  IP     + + 
Sbjct: 532 LNVLQQRQMSLNATYIFNGLTVSVPGMEKALHQYTLEP--SEKPFDLKSIPLAMAPVFEQ 589

Query: 295 QAEAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQI 354
           ++E   + P+   LA ++                               Q ++ +QL  I
Sbjct: 590 KSEITLVAPKPEKLAPSR-------------------------------QDIFQEQLAAI 618

Query: 355 PEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVV 414
           PE    GPLFKSS +PV+LTE+ETEY V C+KHMF +++VFQF  TNTLNDQLLE VTV 
Sbjct: 619 PEFMNLGPLFKSS-EPVQLTEAETEYFVRCIKHMFTDHIVFQFDCTNTLNDQLLERVTVQ 677

Query: 415 MQPESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTL-GSFSNTLKFLVKDCDP 473
           ++P      L     IPA  L Y+QP   Y   +  + +   + G+FS T+KF V+DCDP
Sbjct: 678 VEPSDSYEVLC---CIPAPSLTYNQPGICYTLVRLPDEDPTAVAGTFSCTMKFTVRDCDP 734

Query: 474 STXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKS 533
           +T                 +E+  SD++      +F++AW+ VG+  +  ETFAL+++K+
Sbjct: 735 NT-GVPDEDGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDAFEKEETFALSSTKT 793

Query: 534 LKDSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTM 592
           L+++   +I  LGM P E S   P + + H+L L+G + GG  +L ++R+  A   GVTM
Sbjct: 794 LEEAVNNIIAFLGMQPCERSDKVPENKNSHSLYLAGVYRGGYDLLVRSRLALA--DGVTM 851

Query: 593 ELSVRSPSEEISRIVIGAV 611
           +++VRS       +++ +V
Sbjct: 852 QVTVRSKERTPVDVILASV 870



>gi|431911700|gb|ELK13848.1| Coatomer subunit gamma-2, partial [Pteropus alecto]
          Length = 866

 Score =  540 bits (1392), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 291/613 (47%), Positives = 388/613 (63%), Gaps = 64/613 (10%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 289 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 348

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 349 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEY 408

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +V+  PESKE  LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 409 KRAIVDCIISIVEENPESKETGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYI 468

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 469 RFIFNRVVLENEAVRAAAVSALAKFG--AQNENLLPSILVLLQRCMMDTDDEVRDRATFY 526

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIP--------- 289
           L ++   + A    Y+ +  T S+  +E+ L QY   P  SEKPFD+  IP         
Sbjct: 527 LNVLQQRQMALNATYIFNGLTVSVPGMEKALYQYTLEP--SEKPFDMKSIPLAMAPVFEQ 584

Query: 290 --KITKAQAEAENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVY 347
             +IT    + E L P                                       +Q ++
Sbjct: 585 KAEITLVATKPEKLAP--------------------------------------SRQDIF 606

Query: 348 SQQLEQIPEIAAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQL 407
            +QL  IPE    GPLFKSS +PV+LTE+ETEY V C+KHMF  ++VFQF  TNTLNDQL
Sbjct: 607 QEQLAAIPEFMNLGPLFKSS-EPVQLTEAETEYFVRCIKHMFTNHIVFQFDCTNTLNDQL 665

Query: 408 LENVTVVMQPESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTL-GSFSNTLKF 466
           LE VTV ++P      L     IPA  L Y+QP   Y   +  + +   + G+FS T+KF
Sbjct: 666 LEKVTVQVEPSDSFEVLC---YIPALSLTYNQPGICYTLVRLPDDDSSAVAGTFSCTMKF 722

Query: 467 LVKDCDPSTXXXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETF 526
            V+DCDP T                 +E+  SD++       F++AW+ VG+  +  ETF
Sbjct: 723 TVRDCDPDT-GVPAEEGYDDEYVLEDLEVTLSDHIQKVLKPSFAAAWEEVGDTFEKEETF 781

Query: 527 ALTASKSLKDSCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFA 585
           AL+++K+L+++ + +I  LGM P E S   P + + H+L L+G + GG  +L ++R+  A
Sbjct: 782 ALSSTKTLEEAVSNIITFLGMQPCERSDKVPENKNSHSLYLAGVYRGGYDLLVRSRLALA 841

Query: 586 PSTGVTMELSVRS 598
              GVTM+++VRS
Sbjct: 842 --DGVTMQVTVRS 852



>gi|511834338|ref|XP_004741801.1| PREDICTED: coatomer subunit gamma-2 isoform X1 [Mustela putorius
           furo]
 gi|511941666|ref|XP_004789615.1| PREDICTED: coatomer subunit gamma-2 isoform X1 [Mustela putorius
           furo]
          Length = 871

 Score =  540 bits (1392), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 288/602 (47%), Positives = 387/602 (64%), Gaps = 42/602 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 354 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +V+  PE KEA LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 414 KRAIVDCIISIVEENPEGKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 474 RFIFNRVVLENEAVRAAAVSALAKFG--AQNENLLPSILVLLQRCMMDTDDEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L ++   + A    Y+ +  T S+  LE+ L +Y   P  SEKPFD+  IP       E 
Sbjct: 532 LNVLQQRQMALNATYIFNGLTVSVPGLEKALHRYTLEP--SEKPFDMKSIPLAVAPVFEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
           +         A    + T    +                     +Q ++ +QL  IPE  
Sbjct: 590 K---------AEITLVATKPEKLAP------------------SRQDIFQEQLAAIPEFM 622

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +P++LTE+ETEY V C+KHMF  ++VFQF  TNTLNDQLLE VTV ++P 
Sbjct: 623 DLGPLFKSS-EPIQLTEAETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQVEPS 681

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTL-GSFSNTLKFLVKDCDPSTXX 477
                L     IPA  L Y+QP   Y   +  + +  T+  +FS T+KF V+DCDP T  
Sbjct: 682 DSYEVLC---CIPAPSLAYNQPGICYTLVRLPDDDSTTVTATFSCTMKFTVRDCDPDT-G 737

Query: 478 XXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDS 537
                          +E+  SD++      +F++AW+ VG+  +  ETFAL+++K+L+++
Sbjct: 738 VPAEEGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDTFEKEETFALSSTKTLEEA 797

Query: 538 CTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSV 596
              +I  LGM P E S   P + + H+L L+G + GG  +L ++R+  A   GVTM+++V
Sbjct: 798 VNNIITFLGMQPCERSDKVPENKNSHSLYLAGVYRGGYDLLVRSRLALA--DGVTMQVTV 855

Query: 597 RS 598
           RS
Sbjct: 856 RS 857



>gi|224077826|ref|XP_002305424.1| predicted protein [Populus trichocarpa]
 gi|222848388|gb|EEE85935.1| predicted protein [Populus trichocarpa]
          Length = 885

 Score =  540 bits (1392), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 297/609 (48%), Positives = 397/609 (65%), Gaps = 35/609 (5%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSS K  LRFAA+RTLNK+AMT P AV +CN+DME+LI+DQNRS+AT AITTLLKTGN
Sbjct: 297 LFLSSSKPVLRFAAVRTLNKVAMTHPMAVTNCNIDMESLISDQNRSIATLAITTLLKTGN 356

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQIT FMS+I+DEFK++VV+AIRSLCLKFP K   +++FLS +LR+EGG+E+
Sbjct: 357 ESSVDRLMKQITNFMSDIADEFKIVVVEAIRSLCLKFPLKYRSLMNFLSNILREEGGFEY 416

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K+A+V++I  L++ IPE+KE+ L HLCEFIEDCEFT LS ++LH LG+EGPKT  P+KYI
Sbjct: 417 KKAIVDSIVILIRDIPEAKESGLLHLCEFIEDCEFTYLSTQILHFLGIEGPKTTDPSKYI 476

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV LEN+ VRAAAVS LAKFG   +   +K  I VLL RC+ D+DDEVRDRA LY
Sbjct: 477 RYIYNRVHLENATVRAAAVSTLAKFGAMVD--ALKPRIFVLLRRCIFDSDDEVRDRATLY 534

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQY---VSNPESSEKPFDLSDIPKITKAQAE 297
           L  +  +    +  K+  T+    L+  LV     + N E SE+PFD+  +PK  K+Q  
Sbjct: 535 LNTLGGDGEVVETDKEVKTFLFGDLDIPLVNLETSLKNYEPSEEPFDIHSVPKEVKSQPL 594

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
            E   P           G   + +G         +  A P   VD    Y + L  IPE 
Sbjct: 595 VEKKAP-----------GKKPAGLG---------APPAGPPSTVD---AYERLLSSIPEF 631

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
           + FG LFKSS  PVELTE+ETEY V+ VKH+F  ++VFQ+  TNT+ +QLLENV+V++  
Sbjct: 632 SNFGKLFKSS-APVELTEAETEYAVNVVKHIFDRHVVFQYNCTNTIPEQLLENVSVIVDA 690

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEY-TLGSFSNTLKFLVKDCDPSTX 476
            S+     E    P   LPYD P   +VAF++  PE   T+G F+N L+F+VK+ DPST 
Sbjct: 691 -SEADDFAEVASKPLRSLPYDTPGQTFVAFEK--PEGITTVGKFTNMLRFIVKEVDPST- 746

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+V +D++    +S+F +AW+S+G++ + V+ + L   +SL +
Sbjct: 747 GEAEEDGVEDEYQLEDLEVVAADFMMKVGVSNFRNAWESMGDDFERVDEYGLGPRESLAE 806

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           + + +I LLGM P E +    T+S  HT +LSG  LG +KVL + +     S  V M+LS
Sbjct: 807 AVSAVINLLGMQPCEGTEVVATNSRSHTCLLSGVSLGNVKVLVRLQFGIEGSRDVAMKLS 866

Query: 596 VRSPSEEIS 604
           VRS  E I 
Sbjct: 867 VRSEDEAIG 875



>gi|356545247|ref|XP_003541056.1| PREDICTED: coatomer subunit gamma-like [Glycine max]
          Length = 887

 Score =  540 bits (1391), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 298/609 (48%), Positives = 399/609 (65%), Gaps = 35/609 (5%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LFLSS K  LRFAA+RTLNK+AMT P AV +CN+DME+LI+DQNRS+AT AITTLLKTGN
Sbjct: 299 LFLSSSKPVLRFAAVRTLNKVAMTHPMAVTNCNIDMESLISDQNRSIATLAITTLLKTGN 358

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQIT FMS+I+DEFK++VV+AIRSLCLKFP K   +++FLS +LR+EGG+++
Sbjct: 359 ESSVDRLMKQITNFMSDIADEFKIVVVEAIRSLCLKFPLKYRSLMNFLSNILREEGGFDY 418

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           K+A+V++I  L++ IP++KE+ L HLCEFIEDCEFT LS ++LH LGVEGPKT  P+KYI
Sbjct: 419 KKAIVDSIVILIRDIPDAKESGLLHLCEFIEDCEFTYLSTQILHFLGVEGPKTSDPSKYI 478

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           RYIYNRV LEN+ VRA+AVS LAKFG + +   +K  I VLL RCL D+DDEVRDRA LY
Sbjct: 479 RYIYNRVHLENATVRASAVSTLAKFGAAVD--ALKPRIFVLLRRCLFDSDDEVRDRATLY 536

Query: 241 LKLIDDNESAEKYVKDDSTYSLAALERQLVQY---VSNPESSEKPFDLSDIPKITKAQAE 297
           L  +  + S  +  KD   +   +    LV     + N E SE+ FD+  +P+  K+Q  
Sbjct: 537 LNTLGGDGSVVETDKDVKDFLFGSFVIPLVNLETSLKNYEPSEEAFDIDSVPREVKSQPL 596

Query: 298 AENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEI 357
           AE   P           G   + +G+  S   ST+ DA           Y + L  IPE 
Sbjct: 597 AEKKAP-----------GKKPTGLGAPPSGPPSTA-DA-----------YERLLLSIPEF 633

Query: 358 AAFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQP 417
           A FG LFKSS +PVELTE+ETEY V+ VKH+F  ++VFQ+  TNT+ +QLLE+V V++  
Sbjct: 634 ANFGKLFKSS-EPVELTEAETEYAVNVVKHIFDRHVVFQYNCTNTIPEQLLEDVIVIVDA 692

Query: 418 ESDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTL-GSFSNTLKFLVKDCDPSTX 476
            S+     E F  P   LPYD P   +VAF++  PE   + G FSN LKF+VK+ DP+T 
Sbjct: 693 -SEAEEFSEVFSKPLRSLPYDSPGQTFVAFEK--PEGLPIAGKFSNVLKFIVKEVDPTT- 748

Query: 477 XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                           +E+VT+DY+    +S+F SAW+S+G + + V+ + L   ++L +
Sbjct: 749 GETEDDGVEDEYQLEDLEVVTADYILKVGVSNFRSAWESMGPDCERVDEYGLGPRENLAE 808

Query: 537 SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
           +  T+I LLGM P E +   P +S  HT +LSG F+G +KVL +          V M+L+
Sbjct: 809 AVNTVINLLGMQPCEGTEVVPPNSRSHTCLLSGVFIGNVKVLVRLSFGLDGPKDVAMKLA 868

Query: 596 VRSPSEEIS 604
           VRS  E +S
Sbjct: 869 VRSEDETVS 877



>gi|465994215|gb|EMP39438.1| Coatomer subunit gamma-2 [Chelonia mydas]
          Length = 1018

 Score =  540 bits (1391), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 293/616 (47%), Positives = 401/616 (65%), Gaps = 44/616 (7%)

Query: 1    LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
            LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 441  LFCSSPKPVLRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 500

Query: 61   EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
            E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 501  ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEY 560

Query: 121  KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
            KRA+V+ I  +++  PESKE+ LAHLCEFIEDCE T L+ ++LHLLG EGP+TP+P+KYI
Sbjct: 561  KRAIVDCIISIIEENPESKESGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPSPSKYI 620

Query: 181  RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
            R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D+DDEVRDRA  Y
Sbjct: 621  RFIFNRVVLENEAVRAAAVSALAKFG--AQNESLLPSILVLLQRCMMDSDDEVRDRATFY 678

Query: 241  LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
            L ++   + A    Y+ +  T S+  +E+ L QY   P  S+KPFD+  +P  T    E 
Sbjct: 679  LNVLQQRQIALNAAYIFNGLTVSVPGMEKALHQYTLEP--SDKPFDMKTVPLATAPIFEQ 736

Query: 299  ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
            +                   + V S    +  +  D           ++ +QL  IPE  
Sbjct: 737  K----------------AEIALVASKPEKVAPSLHD-----------IFQEQLAAIPEFK 769

Query: 359  AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
            + GPLFKSS +PV+LTE+ETEY V C KH+F  +MVFQF  TNTLNDQLLE VTV M+P 
Sbjct: 770  SLGPLFKSS-EPVQLTEAETEYFVCCTKHVFTNHMVFQFDCTNTLNDQLLERVTVQMEP- 827

Query: 419  SDEGTLVEEFVIPATKLPYDQPSSIY--VAFKRTNPEEYTLGSFSNTLKFLVKDCDPSTX 476
            SD   ++    IPA  L Y+QP   Y  V   + +P      +FS T+KF V+DC+P+T 
Sbjct: 828  SDAYDVIRS--IPAASLSYNQPGMCYTLVRLPQDDPTAVAC-TFSCTMKFTVRDCNPNT- 883

Query: 477  XXXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKD 536
                            +E+  SD++      +F++AW+ VG++ +  ETFAL++ K+L +
Sbjct: 884  GVPEDDGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDDFEKEETFALSSIKTLDE 943

Query: 537  SCTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELS 595
            + + +I+ LGM P E S   P + + HTL L+G + GG  VL ++R+  A   GVTM+++
Sbjct: 944  AVSNIIKFLGMQPCERSDKVPENKNSHTLYLAGVYRGGYDVLVRSRL--ALGDGVTMQVT 1001

Query: 596  VRSPSEEISRIVIGAV 611
            VRS  E    +++ +V
Sbjct: 1002 VRSKDETPVDVILASV 1017



>gi|511941670|ref|XP_004789617.1| PREDICTED: coatomer subunit gamma-2 isoform X3 [Mustela putorius
           furo]
          Length = 770

 Score =  540 bits (1391), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 288/602 (47%), Positives = 387/602 (64%), Gaps = 42/602 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 193 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 252

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 253 ESSVDRLMKQISSFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEY 312

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +V+  PE KEA LAHLCEFIEDCE T L+ ++LHLLG EGP+TP P+KYI
Sbjct: 313 KRAIVDCIISIVEENPEGKEAGLAHLCEFIEDCEHTVLATKILHLLGKEGPRTPVPSKYI 372

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  SI VLL RC+ D DDEVRDRA  Y
Sbjct: 373 RFIFNRVVLENEAVRAAAVSALAKFG--AQNENLLPSILVLLQRCMMDTDDEVRDRATFY 430

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
           L ++   + A    Y+ +  T S+  LE+ L +Y   P  SEKPFD+  IP       E 
Sbjct: 431 LNVLQQRQMALNATYIFNGLTVSVPGLEKALHRYTLEP--SEKPFDMKSIPLAVAPVFEQ 488

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
           +         A    + T    +                     +Q ++ +QL  IPE  
Sbjct: 489 K---------AEITLVATKPEKLAP------------------SRQDIFQEQLAAIPEFM 521

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +P++LTE+ETEY V C+KHMF  ++VFQF  TNTLNDQLLE VTV ++P 
Sbjct: 522 DLGPLFKSS-EPIQLTEAETEYFVRCIKHMFTNHIVFQFDCTNTLNDQLLEKVTVQVEPS 580

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTL-GSFSNTLKFLVKDCDPSTXX 477
                L     IPA  L Y+QP   Y   +  + +  T+  +FS T+KF V+DCDP T  
Sbjct: 581 DSYEVLC---CIPAPSLAYNQPGICYTLVRLPDDDSTTVTATFSCTMKFTVRDCDPDT-G 636

Query: 478 XXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDS 537
                          +E+  SD++      +F++AW+ VG+  +  ETFAL+++K+L+++
Sbjct: 637 VPAEEGYDDEYVLEDLEVTVSDHIQKVLKPNFAAAWEEVGDTFEKEETFALSSTKTLEEA 696

Query: 538 CTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSV 596
              +I  LGM P E S   P + + H+L L+G + GG  +L ++R+  A   GVTM+++V
Sbjct: 697 VNNIITFLGMQPCERSDKVPENKNSHSLYLAGVYRGGYDLLVRSRLALA--DGVTMQVTV 754

Query: 597 RS 598
           RS
Sbjct: 755 RS 756



>gi|56118472|ref|NP_001008019.1| coatomer subunit gamma-2 [Xenopus (Silurana) tropicalis]
 gi|82181416|sp|Q66JI9.1|COPG2_XENTR RecName: Full=Coatomer subunit gamma-2; AltName: Full=Gamma-2-coat
           protein; Short=Gamma-2-COP
 gi|51703830|gb|AAH80897.1| copg2 protein [Xenopus (Silurana) tropicalis]
          Length = 872

 Score =  540 bits (1391), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 297/615 (48%), Positives = 403/615 (65%), Gaps = 41/615 (6%)

Query: 1   LFLSSPKSTLRFAAIRTLNKLAMTQPTAVQSCNLDMENLITDQNRSVATFAITTLLKTGN 60
           LF SSPK  LR+AA+RTLNK+AM  P+AV +CNLD+ENLITD NRS+AT AITTLLKTG+
Sbjct: 294 LFCSSPKPALRYAAVRTLNKVAMKHPSAVTACNLDLENLITDSNRSIATLAITTLLKTGS 353

Query: 61  EASVDRLMKQITGFMSEISDEFKVIVVDAIRSLCLKFPSKQVVMLSFLSGVLRDEGGYEF 120
           E+SVDRLMKQI+ F+SEISDEFKV+VV AI +LC K+P K  VM++FLS +LRD+GG+E+
Sbjct: 354 ESSVDRLMKQISTFVSEISDEFKVVVVQAISALCQKYPRKHSVMMTFLSNMLRDDGGFEY 413

Query: 121 KRAVVEAIFDLVKFIPESKEAALAHLCEFIEDCEFTKLSVRVLHLLGVEGPKTPTPTKYI 180
           KRA+V+ I  +++  P+SKE+ LAHLCEFIEDCE T L+ ++LHLLG EGPKTPTP+KYI
Sbjct: 414 KRAIVDCIISIIEENPDSKESGLAHLCEFIEDCEHTVLATKILHLLGREGPKTPTPSKYI 473

Query: 181 RYIYNRVILENSIVRAAAVSALAKFGVSAEDPEVKKSIKVLLTRCLDDNDDEVRDRAILY 240
           R+I+NRV+LEN  VRAAAVSALAKFG  A++  +  S+ VLL RC+ D+DDEVRDRA  Y
Sbjct: 474 RFIFNRVVLENEAVRAAAVSALAKFG--AQNEPLLPSVLVLLQRCMMDSDDEVRDRATFY 531

Query: 241 LKLIDDNESA--EKYVKDDSTYSLAALERQLVQYVSNPESSEKPFDLSDIPKITKAQAEA 298
             +++ N+ A    Y+ +  T S+  +E+ L QY   P  SEKPFD+  +P  T    E 
Sbjct: 532 FNVLNQNQLALNTAYIFNGLTVSVFGMEKALHQYTLEP--SEKPFDMKTVPLATVPFLEQ 589

Query: 299 ENLKPRSFDLASTQTIGTSSSAVGSINSNIVSTSRDATPTPGVDQQQVYSQQLEQIPEIA 358
           +       DLA                   ++T +     P   +Q ++  QL  IPE  
Sbjct: 590 KT------DLAP------------------IATKQPEKMVPV--RQDIFQDQLAAIPEFK 623

Query: 359 AFGPLFKSSIKPVELTESETEYVVSCVKHMFKENMVFQFIVTNTLNDQLLENVTVVMQPE 418
             GPLFKSS +PV+LTE+ETEY V C+KH+F  ++VFQF  TNTLNDQLLE VTV M+P 
Sbjct: 624 NLGPLFKSS-EPVQLTEAETEYFVRCIKHVFPNHIVFQFDCTNTLNDQLLEKVTVQMEP- 681

Query: 419 SDEGTLVEEFVIPATKLPYDQPSSIYVAFKRTNPEEYTLG-SFSNTLKFLVKDCDPSTXX 477
             E   V  +V PA  LPY+QP   Y   +  + +   +  +FS T+KF+V+DCDP T  
Sbjct: 682 -SEAYEVVHYV-PAPSLPYNQPGISYTLVRLPDDDPTAVSCTFSCTMKFVVRDCDPQT-G 738

Query: 478 XXXXXXXXXXXXXXXIEIVTSDYVFPTYISDFSSAWDSVGEEGQVVETFALTASKSLKDS 537
                          +E+  SD++      +F +AW+ +G+  +  ETFALT +KSL+++
Sbjct: 739 VPDDEGYSDEYVLEDLEVTLSDHIQKILKPNFGAAWEEIGDTYEKEETFALTTTKSLEEA 798

Query: 538 CTTLIELLGMSPVENSG-TPTSSSVHTLMLSGTFLGGIKVLAKNRMTFAPSTGVTMELSV 596
              +I+ LGM P E S   P + + H L LSG + GG  VL ++R+  A   GVTM+++V
Sbjct: 799 VNNIIKFLGMQPCERSDKVPENKNSHVLYLSGVYRGGHDVLVRSRLALA--DGVTMQVTV 856

Query: 597 RSPSEEISRIVIGAV 611
           RS  E  + +++ +V
Sbjct: 857 RSQDETPANVILVSV 871