BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10164_c0_seq1-m.64 5prime_partial 3-1589(+) 529 (+)
         (528 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|511010993|gb|EPB92208.1| hypothetical protein HMPREF1544_0103...   202   3e-49   Mucor circinelloides f. circinelloides 1006PhL
gi|384485927|gb|EIE78107.1| hypothetical protein RO3G_02811 [Rhi...   186   1e-44   Rhizopus delemar RA 99-880
gi|511006315|gb|EPB87631.1| hypothetical protein HMPREF1544_0561...   184   7e-44   Mucor circinelloides f. circinelloides 1006PhL
gi|384496450|gb|EIE86941.1| hypothetical protein RO3G_11652 [Rhi...   178   4e-42   Rhizopus delemar RA 99-880
gi|336364087|gb|EGN92451.1| hypothetical protein SERLA73DRAFT_11...   137   1e-29   Serpula lacrymans var. lacrymans S7.3
gi|336377416|gb|EGO18578.1| hypothetical protein SERLADRAFT_4541...   132   2e-28   Serpula lacrymans var. lacrymans S7.9
gi|392595877|gb|EIW85200.1| hypothetical protein CONPUDRAFT_1418...   117   6e-24   Coniophora puteana RWD-64-598 SS2
gi|170088324|ref|XP_001875385.1| predicted protein [Laccaria bic...   102   2e-19   Laccaria bicolor S238N-H82
gi|389748835|gb|EIM90012.1| hypothetical protein STEHIDRAFT_1190...   100   9e-19   Stereum hirsutum FP-91666 SS1
gi|405120241|gb|AFR95012.1| hypothetical protein CNAG_01134 [Cry...    87   1e-14   Cryptococcus neoformans var. grubii H99
gi|58266600|ref|XP_570456.1| hypothetical protein [Cryptococcus ...    84   2e-13   Cryptococcus neoformans var. neoformans JEC21
gi|296423327|ref|XP_002841206.1| hypothetical protein [Tuber mel...    81   8e-13   Tuber melanosporum Mel28
gi|321257549|ref|XP_003193627.1| hypothetical protein CGB_D5130W...    80   1e-12   Cryptococcus gattii WM276
gi|402216763|gb|EJT96847.1| hypothetical protein DACRYDRAFT_5999...    76   2e-11   Dacryopinax primogenitus
gi|472587100|gb|EMS24599.1| retinoic acid induced 16-like protei...    75   5e-11   Rhodotorula toruloides NP11


>gi|511010993|gb|EPB92208.1| hypothetical protein HMPREF1544_01033 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 955

 Score =  202 bits (513), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 135/355 (38%), Positives = 189/355 (53%), Gaps = 55/355 (15%)

Query: 1   FSRLRSSSQQAVIATLKLLHTVISKHCRYSLKLLNIELDENATCFPRPNYLLESSFNVEQ 60
           FSRL+S+SQ  VIATLKLL T+++KHC+YSL LL+I                        
Sbjct: 454 FSRLKSNSQTTVIATLKLLKTLVTKHCQYSLGLLSI------------------------ 489

Query: 61  PGPTSSGQPKLTTISHHLRELDLFFDLISAIDPTQNMEIFTNGYDSYVRDAEMIIEADRC 120
             P ++  P +  ISHHLRE++L+F LI AID     ++   GY+ Y+RD EM I+ D C
Sbjct: 490 -APNTTKNPII--ISHHLREVELYFSLIIAIDAAHAEDVLACGYEDYLRDVEMTIDNDWC 546

Query: 121 YINGQ---DVEWTEDGPIRPKSNKSNRQKLLTYNP----------GKGAESAFKCMSKVP 167
           Y + +   D      G  R +  K+ R++   Y             K  + + K  S V 
Sbjct: 547 YQHSRPAGDAAHDRMGG-RAELPKAKRRRSFKYGQRDIRDEEAENQKSRQDSIKPCSLV- 604

Query: 168 KHRLVPTNPGDSLLQILVGTLSNFFAHSPELNLTLTGVLSALSVCPYRSLEGWLVFSGVD 227
           +HR+  T+P   L+QIL+  LS+FF  S ELNL LTGV+SAL++CPYRSLEGW+ FS  D
Sbjct: 605 RHRVRSTDP---LMQILLSLLSHFFTQSSELNLALTGVISALALCPYRSLEGWIAFSESD 661

Query: 228 RLDNRRDSSTKDFERLQHEPKNLEPSLGINNQEGISTSNGXXXXXXXXXXXXXXXXXYNA 287
           R +  RD    D   L  + +       +  Q+ I  S                   + A
Sbjct: 662 RTN--RD----DVLVLNSDGQPAVSQTKVRRQD-IYASFETSAPVNDDDDDDDRSVDFGA 714

Query: 288 DKSPSAAKAIGATPMWTNFPPFFTIFKTLTQQVDYYRSEIDGFNQFLEDRRNGLL 342
           ++  S+ K I     + ++PPFFT+ +TLTQQVDYYRSEI  F++ LE+RRN L+
Sbjct: 715 ERE-SSKKTIPT--YFKSYPPFFTLLRTLTQQVDYYRSEIQTFDKLLEERRNALI 766



>gi|384485927|gb|EIE78107.1| hypothetical protein RO3G_02811 [Rhizopus delemar RA 99-880]
          Length = 648

 Score =  186 bits (473), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 132/345 (38%), Positives = 185/345 (53%), Gaps = 44/345 (12%)

Query: 1   FSRLRSSSQQAVIATLKLLHTVISKHCRYSLKLLNIELDENATCFPRPNYLLESSFNVEQ 60
            SRL+S+SQ AVIATLKLL T+I+ HCRY+L+LL+I                        
Sbjct: 174 LSRLQSNSQTAVIATLKLLKTLITHHCRYALRLLSI------------------------ 209

Query: 61  PGPTSSGQPKLTTISHHLRELDLFFDLISAIDPTQNMEIFTNGYDSYVRDAEMIIEADRC 120
             P S+ +P  TT+SHHLRE++L+F LI AID T   +I +NGY+ Y+RD EM I+ D C
Sbjct: 210 -YPESNRKP--TTVSHHLREVELYFSLILAIDSTHAKDILSNGYEEYLRDLEMTIDRDGC 266

Query: 121 YINGQ---DVEWTEDGPIRPKSNKSNRQKLLTYNPGKGAESAFKCMSKVPKHRLVPTNPG 177
           Y + +   D    +   I+ K  +S +      +  K  + +      + +HR+    P 
Sbjct: 267 YQHTRPSDDRAGVDQAAIKAKRRRSFKYGQRYEDLEKERQPSLTTRRPLFRHRI---RPS 323

Query: 178 DSLLQILVGTLSNFFAHSPELNLTLTGVLSALSVCPYRSLEGWLVFSGVDRLDNRRDSST 237
           D LLQIL+  LS+FF  S ELNL LTGV++AL+VCPYRSLEGW+ FS  D+      +S 
Sbjct: 324 DRLLQILLSLLSHFFTQSTELNLALTGVVTALAVCPYRSLEGWISFSESDQ------TSP 377

Query: 238 KDFERLQHEPKNLEPSLGINNQEGISTSNGXXXXXXXXXXXXXXXXXYNADKSPSAAKAI 297
            D   L  E + L     I +Q+ I                      + A++   + K  
Sbjct: 378 DDILVLNPEDQPLRAP-KIRSQD-IYAHFEVTAPVDEDDDEDDRSVDFGAER--ESIKKT 433

Query: 298 GATPMWTNFPPFFTIFKTLTQQVDYYRSEIDGFNQFLEDRRNGLL 342
             T  + ++P FFT+ +TLTQQV YYRSEI  F + LE+RR  L+
Sbjct: 434 QPT-FFKSYPTFFTLLRTLTQQVGYYRSEIPSFEELLEERRKALI 477



>gi|511006315|gb|EPB87631.1| hypothetical protein HMPREF1544_05615 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 1016

 Score =  184 bits (466), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 137/359 (38%), Positives = 196/359 (54%), Gaps = 52/359 (14%)

Query: 1   FSRLRSSSQQAVIATLKLLHTVISKHCRYSLKLLNIELDENATCFPRPNYLLESSFNVEQ 60
           F+RL+SSSQ  VIATLKLL T+I KHCR+S +LL+   D  A              + EQ
Sbjct: 462 FTRLKSSSQPTVIATLKLLRTLIVKHCRFSDRLLSTVPDTKA--------------HDEQ 507

Query: 61  PGPTSSGQPKLTTISHHLRELDLFFDLISAIDPTQNMEIFTNGYDSYVRDAEMIIEADRC 120
             P+       T +SHH+RE+ L+F LISAID     +I T GY+ Y+ D +  IE D C
Sbjct: 508 VPPS-------TNVSHHIREIQLYFSLISAIDHAHADDILTMGYEDYLEDVKTTIEQDVC 560

Query: 121 YINGQDV-EWTEDGPIRP--KSNKSNRQKLLTYNPGKGAESAFKCMSKVPKHRLVP-TNP 176
           Y   QD+ E + D   +P  K + S  ++  ++  G+ A ++ + +    +  ++P T P
Sbjct: 561 Y---QDLLESSCDNQQQPYKKPSSSKSERRRSFKYGQRAGASHEEIHHQHQQSILPNTQP 617

Query: 177 --------GDSLLQILVGTLSNFFAHSPELNLTLTGVLSALSVCPYRSLEGWLVFSGVDR 228
                    D+LLQ+L+G LS+FFA S ELNL LT V+SAL++CPYRSLEGW+ F   DR
Sbjct: 618 PVRQRIRSTDTLLQLLLGLLSHFFAQSSELNLALTSVISALALCPYRSLEGWISFCESDR 677

Query: 229 LDNRRD-----SSTKDFERLQHEPKNLEPSLGINNQEGISTSNGXXXXXXXXXXXXXXXX 283
             N  D     S   D       P  +  S  I+    +S+ N                 
Sbjct: 678 -TNANDILHLGSGGADNGIRGSGPMGMSISNDIHQIPAMSSKNA-------DDDDDDKSL 729

Query: 284 XYNADKSPSAAKAIGATPMWTNFPPFFTIFKTLTQQVDYYRSEIDGFNQFLEDRRNGLL 342
            + A+++   +  +     + +FPPF+T+F+TLTQQVDYYRSE+DGF+  L++R NGLL
Sbjct: 730 DFGAERN---SVHMTTPTQFKSFPPFYTLFRTLTQQVDYYRSEVDGFDALLDERWNGLL 785



>gi|384496450|gb|EIE86941.1| hypothetical protein RO3G_11652 [Rhizopus delemar RA 99-880]
          Length = 791

 Score =  178 bits (451), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 126/363 (34%), Positives = 179/363 (49%), Gaps = 71/363 (19%)

Query: 1   FSRLRSSSQQAVIATLKLLHTVISKHCRYSLKLLNIELDENATCFPRPNYLLESSFNVEQ 60
            SRL+S+SQ AV ATLKLL T+++ HCRY+L+LL+IE D N                   
Sbjct: 325 LSRLQSNSQSAVTATLKLLKTLVTHHCRYALRLLSIESDTNK------------------ 366

Query: 61  PGPTSSGQPKLTTISHHLRELDLFFDLISAIDPTQNMEIFTNGYDSYVRDAEMIIEADRC 120
                    K   +SHHLRE++L+F LI AID T   +    GY+ Y+RD E+ + +D C
Sbjct: 367 ---------KPIMVSHHLREIELYFSLIIAIDSTHAKDTLVCGYEEYLRDLELRVGSDGC 417

Query: 121 YINGQDVE---WTEDGPIRPKSNKS---NRQKLLTYNPGKGAESAFKCMSKVPKHRLVPT 174
           Y   +  +       G +R K  +S    +Q+       KG  ++ K + +   HRL  +
Sbjct: 418 YQQMRPCDERAGCAKGTVRMKRRRSFKYGQQREEEEERRKGRVTSTKPLFR---HRLCSS 474

Query: 175 NPGDSLLQILVGTLSNFFAHSPELNLTLTGVLSALSVCPYRSLEGWLVFSGVDRLDNRRD 234
           +P    L      LS+FF  S ELNL LTGV++AL++CPYRSLEGW+ FS  D       
Sbjct: 475 DPLLQALL---SLLSHFFTQSAELNLALTGVVTALALCPYRSLEGWISFSESD------- 524

Query: 235 SSTKDFERLQHEPKNLEPSLGIN-NQEGISTSNGXXXXXXXXXXXXXXXXXYNADKSP-- 291
                    Q  P ++   L +N ++E ++ S+                   N D     
Sbjct: 525 ---------QTGPDDI---LVLNPDEEDVAHSSDNKIRTQDIYAHFEAAVPVNEDDEEDD 572

Query: 292 ---------SAAKAIGATPMWTNFPPFFTIFKTLTQQVDYYRSEIDGFNQFLEDRRNGLL 342
                     +AK    T  + ++PPFFT+ +TLTQQVDYYRSEI  F+  LE+RR  L+
Sbjct: 573 RSVDFGAERESAKVTRPT-FFKSYPPFFTLLRTLTQQVDYYRSEIPSFDDMLEERRKALM 631

Query: 343 DAD 345
             D
Sbjct: 632 MGD 634



>gi|336364087|gb|EGN92451.1| hypothetical protein SERLA73DRAFT_117334 [Serpula lacrymans var.
           lacrymans S7.3]
          Length = 1037

 Score =  137 bits (344), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 107/381 (28%), Positives = 173/381 (45%), Gaps = 108/381 (28%)

Query: 1   FSRLRSSSQQAVIATLKLLHTVISKHCRYSL-KLLNIELDENATCFPRPNYL---LESSF 56
            + LRS  QQ   A L+LL +++ +HC+  + +LL +  D  AT +P P  +   L+S  
Sbjct: 556 LANLRSKHQQTATAALQLLQSILDQHCQLCVDRLLVVISDPQATNYPEPPMIPPSLDSQI 615

Query: 57  NVEQ---PGPTSSGQPKLTTISHHLRELDLFFDLISAIDPTQNMEIFTNGYDSYVRDAEM 113
           +      PGP    QP+ TT S H RE+ L+  L+S +DP+ N + F+ GYD Y+RDA  
Sbjct: 616 SPASAVPPGPVFL-QPE-TTYSTHEREMGLYLTLVSRVDPSHNEDAFSTGYDHYLRDALQ 673

Query: 114 IIEADRCYINGQDVEWTEDGPIRPKSNKSNRQKLLTYNPGKGAESAFKCMSKVPKHRLVP 173
            I++  C+  G D++                                  ++K+ KHRL  
Sbjct: 674 SIQSQNCFHLGDDID---------------------------------LVTKM-KHRL-- 697

Query: 174 TNPGDSLLQILVGTLSNFFAHSPELNLTLTGVLSALSVCPYRSLEGWLVFSGVD------ 227
            N  D +L +++ +L  FF+++PE N++LTG+L+AL++CPYRSL GWL  +  D      
Sbjct: 698 -NVNDPILSLVLESLRAFFSNTPEFNISLTGLLAALAICPYRSLAGWLTCAPSDTPLVNE 756

Query: 228 -------RLDNRRDSSTKDF---ERLQHEPKNLEPSLGINNQEGISTSNGXXXXXXXXXX 277
                   LD   D  + DF   E+L H+   L P+  ++ Q                  
Sbjct: 757 GDDEGNISLDGDGDDRSIDFQIEEKLAHD-SILLPASRLDEQ------------------ 797

Query: 278 XXXXXXXYNADKSPSAAKAIGATPMWTNFPPFFTIFKTLTQQVDYYRSEIDGFNQFLEDR 337
                                      + P   +IF+ L  Q++ YR  +D F+++L +R
Sbjct: 798 ---------------------------SRPVVHSIFQGLVGQLERYRQLVDNFDKYLLER 830

Query: 338 RNGLLDADDEIDENFFKQQPT 358
           R GLL +++  D      +P 
Sbjct: 831 RQGLLFSENLTDALTLTLEPV 851



>gi|336377416|gb|EGO18578.1| hypothetical protein SERLADRAFT_454152 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 1093

 Score =  132 bits (332), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 106/400 (26%), Positives = 174/400 (43%), Gaps = 125/400 (31%)

Query: 1   FSRLRSSSQQAVIATLKLLHTVISKHCRYSL-KLLNIELDENATCFPRPNYL---LESSF 56
            + LRS  QQ   A L+LL +++ +HC+  + +LL +  D  AT +P P  +   L+S  
Sbjct: 591 LANLRSKHQQTATAALQLLQSILDQHCQLCVDRLLVVISDPQATNYPEPPMIPPSLDSQI 650

Query: 57  NVEQ----------PGPTSSGQPKL------------TTISHHLRELDLFFDLISAIDPT 94
           +V +          PG   + +P              TT S H RE+ L+  L+S +DP+
Sbjct: 651 SVVEEEDDEEEFIYPGAEENAKPASAVPPGPVFLQPETTYSTHEREMGLYLTLVSRVDPS 710

Query: 95  QNMEIFTNGYDSYVRDAEMIIEADRCYINGQDVEWTEDGPIRPKSNKSNRQKLLTYNPGK 154
            N + F+ GYD Y+RDA   I++  C+  G D++                          
Sbjct: 711 HNEDAFSTGYDHYLRDALQSIQSQNCFHLGDDID-------------------------- 744

Query: 155 GAESAFKCMSKVPKHRLVPTNPGDSLLQILVGTLSNFFAHSPELNLTLTGVLSALSVCPY 214
                   ++K+ KHRL   N  D +L +++ +L  FF+++PE N++LTG+L+AL++CPY
Sbjct: 745 -------LVTKM-KHRL---NVNDPILSLVLESLRAFFSNTPEFNISLTGLLAALAICPY 793

Query: 215 RSLEGWLVFSGVD-------------RLDNRRDSSTKDF---ERLQHEPKNLEPSLGINN 258
           RSL GWL  +  D              LD   D  + DF   E+L H+   L P+  ++ 
Sbjct: 794 RSLAGWLTCAPSDTPLVNEGDDEGNISLDGDGDDRSIDFQIEEKLAHD-SILLPASRLDE 852

Query: 259 QEGISTSNGXXXXXXXXXXXXXXXXXYNADKSPSAAKAIGATPMWTNFPPFFTIFKTLTQ 318
           Q                                             + P   +IF+ L  
Sbjct: 853 Q---------------------------------------------SRPVVHSIFQGLVG 867

Query: 319 QVDYYRSEIDGFNQFLEDRRNGLLDADDEIDENFFKQQPT 358
           Q++ YR  +D F+++L +RR GLL +++  D      +P 
Sbjct: 868 QLERYRQLVDNFDKYLLERRQGLLFSENLTDALTLTLEPV 907



>gi|392595877|gb|EIW85200.1| hypothetical protein CONPUDRAFT_141878 [Coniophora puteana
           RWD-64-598 SS2]
          Length = 1087

 Score =  117 bits (294), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 107/383 (27%), Positives = 170/383 (44%), Gaps = 96/383 (25%)

Query: 1   FSRLRSSSQQAVIATLKLLHTVISKHCRYSLK-LLNIELDENATCFPRPNYL-------- 51
            S LRSS+Q    AT +LL +V++  CR+S+  LL +  DE AT FP+P  L        
Sbjct: 604 LSNLRSSNQATATATFQLLQSVVTICCRHSVDGLLLVIRDERATSFPQPIMLTPPATPSG 663

Query: 52  ---LESSFNVEQPGPTSSGQPKL-------------TTISHHLRELDLFFDLISAIDPTQ 95
              L    + ++     SG+ K+              TIS H RE+ L+  L+S +DP  
Sbjct: 664 GKRLLGDDDSDEEFIYPSGEDKMHSVPAGPFFAQPTVTISTHEREMGLYLTLVSRVDPAH 723

Query: 96  NMEIFTNGYDSYVRDAEMIIEADRCYINGQDVEWTEDGPIRPKSNKSNRQKLLTYNPGKG 155
           + + F+ GYD Y+RDA + I++  C+ N   ++               RQ          
Sbjct: 724 HEDAFSTGYDHYLRDAMLSIQSHSCFFNDISMDL-------------RRQH--------- 761

Query: 156 AESAFKCMSKVPKHRLVPTNPGDSLLQILVGTLSNFFAHSPELNLTLTGVLSALSVCPYR 215
                       KHRL  T+P   +L +L+ ++  FFA+SP+LN++LT  L+AL+VCP R
Sbjct: 762 ------------KHRLNVTDP---ILSLLLESMRKFFANSPKLNISLTAALAALAVCPDR 806

Query: 216 SLEGWLVFSGVDRLDNRRDSSTKDFERLQHEPKNLEPSLGINNQEGISTSNGXXXXXXXX 275
           SL GWL F+ VD   +R D ++              P   + N     + +         
Sbjct: 807 SLSGWLTFA-VDET-SRMDITS--------------PVFAVGNDGDDRSMDWEIE----- 845

Query: 276 XXXXXXXXXYNADKSPSAAKAIGATPMWTNFPPFF-TIFKTLTQQVDYYRSEIDGFNQFL 334
                       DK  +    + A+ M     P    I + L  Q++ YR  ++ F+++L
Sbjct: 846 ------------DKLVTETNILPASKMDDRSRPIVHAIIQGLVGQLERYRQVVEDFDKYL 893

Query: 335 EDRRNGLLDADDEIDENFFKQQP 357
            +RR GLL +++  D      +P
Sbjct: 894 LERRQGLLFSENLTDAMTLALEP 916



>gi|170088324|ref|XP_001875385.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164650585|gb|EDR14826.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 1072

 Score =  102 bits (255), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 99/379 (26%), Positives = 157/379 (41%), Gaps = 97/379 (25%)

Query: 1   FSRLRSSSQQAVIATLKLLHTVISKHCRYSL-KLLNIELDENATCFP---------RPNY 50
            S LRS SQ    + L+LL +++  H   ++ +LL +  D  AT FP            +
Sbjct: 581 LSNLRSKSQATATSALQLLQSMLVYHPELTVARLLLVIPDPMATAFPCLVLLKQRRESTH 640

Query: 51  LL--------------------ESSFNVEQPGPTSSGQPKLTTISHHLRELDLFFDLISA 90
           L                     E+SF+      +   QP  TT S H RE+ L+  LIS 
Sbjct: 641 LFESAEEDDEESFRYPGEEKEDETSFS-SSTNDSMFSQPD-TTYSTHEREMGLYLTLISR 698

Query: 91  IDPTQNMEIFTNGYDSYVRDAEMIIEADRCYINGQDVEWTEDGPIRPKSNKSNRQKLLTY 150
           +D +   + F+ GYD Y+RDA + +++       Q V W                 L   
Sbjct: 699 VDSSHKNDGFSTGYDHYLRDALISVQS-------QPVYW-----------------LACQ 734

Query: 151 NPGKGAESAFKCMSKVPKHRLVPTNPGDSLLQILVGTLSNFFAHSPELNLTLTGVLSALS 210
           N  + A +      +  KHRL   NP D +L  L+ ++  FF+++P+ N+TLTGVL+ L+
Sbjct: 735 NSDEAAST------RPLKHRL---NPNDPVLSRLLESMRAFFSNTPDFNITLTGVLATLA 785

Query: 211 VCPYRSLEGWLVFSGVDRLDNRRDSSTKDFERLQHEPKNLEPSLGINNQEGISTSNGXXX 270
           + PYRSL GWL  +         D ++ D                   Q  +        
Sbjct: 786 IHPYRSLAGWLTVA--------HDDTSSDV------------------QSAVQDVEDDDG 819

Query: 271 XXXXXXXXXXXXXXYNADKSPSAAKAIGATPMWTNFPPFFTIFKTLTQQVDYYRSEIDGF 330
                          +    P+A+    + P+       +TIF  L  Q++ YR  +D F
Sbjct: 820 DDRSIDFLIEEKLANDTIYLPAASMDDSSRPV------LYTIFHGLINQLERYRQLVDDF 873

Query: 331 NQFLEDRRNGLLDADDEID 349
           ++FL +RR GLL +++  D
Sbjct: 874 DKFLLERRQGLLFSENLTD 892



>gi|389748835|gb|EIM90012.1| hypothetical protein STEHIDRAFT_119076 [Stereum hirsutum FP-91666
           SS1]
          Length = 1075

 Score =  100 bits (250), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 90/334 (26%), Positives = 147/334 (44%), Gaps = 87/334 (26%)

Query: 32  KLLNIELDENATCFPRPNYLLESSF--------------NVEQPGPTSSGQPKLTTISHH 77
           +L  +  D NAT FP P  +   S                +  P P  + QP  TT S H
Sbjct: 634 RLFVVVSDPNATAFPEPTPITIPSLVADDEDDAAPDSDGELLPPIPLYA-QPA-TTFSTH 691

Query: 78  LRELDLFFDLISAIDPTQNMEIFTNGYDSYVRDAEMIIEADRCYINGQDVEWTEDGPIRP 137
            RE++L+ +L+S +DP+   + F+ GYD Y+ DA   I+     I+  D           
Sbjct: 692 EREMNLYLNLVSRVDPSHVSDTFSTGYDKYLGDALAAIQEQCLQIDLDD----------- 740

Query: 138 KSNKSNRQKLLTYNPGKGAESAFKCMSKVPKHRLVPTNPGDSLLQILVGTLSNFFAHSPE 197
                            G+ + FK       HRL   NP D +L +++ +L    +++PE
Sbjct: 741 -----------------GSNTKFK-------HRL---NPNDPILTLILDSLRRLLSNTPE 773

Query: 198 LNLTLTGVLSALSVCPYRSLEGWLVFSGVDRLDNRRDSSTKDFERLQHEPKNLEPSLGIN 257
            N+ LTGVL+ L+  P RSL GWL F+  D                  EP   +P  GI+
Sbjct: 774 FNIALTGVLATLAYDPNRSLAGWLTFAYKD------------------EPHRPKPERGIS 815

Query: 258 NQEGISTSNGXXXXXXXXXXXXXXXXXYNADKSPSA-AKAIGATPM-WTNFPPFFTIFKT 315
            ++G    +                  +  ++S S+ ++ + A+ +  ++ P   TIF+ 
Sbjct: 816 GKDGADDGD-------------DRSIDFRIEESLSSDSRTLPASSLDDSSRPVILTIFQG 862

Query: 316 LTQQVDYYRSEIDGFNQFLEDRRNGLLDADDEID 349
           L  Q++ YR  +D F++FL +RR GLL +++  D
Sbjct: 863 LVAQLERYRQMVDNFDRFLLERRQGLLFSENLTD 896



>gi|405120241|gb|AFR95012.1| hypothetical protein CNAG_01134 [Cryptococcus neoformans var.
           grubii H99]
          Length = 1162

 Score = 86.7 bits (213), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 83/346 (23%), Positives = 151/346 (43%), Gaps = 26/346 (7%)

Query: 4   LRSSSQQAVIATLKLLHTVISKHCRYSLKLLNIELDENATCFPRPNYLLESSFNVEQPGP 63
           L S  + +V A L LL T++S H   + + L   + E A         +  S + + P  
Sbjct: 549 LCSGQRNSVTAALCLLQTLLSDHPNQATRGLLSYIHEPAATALVCKNPVPRSLDFQPPDA 608

Query: 64  TS-SGQPKLTTISH-HLRELDLFFDLISAIDPTQNMEIFTNGYDSYVRDAEMIIEADRCY 121
            S    PK    +  H +E++L+  L+S +DP Q     + GY  Y+ D +  +E++  +
Sbjct: 609 ASFVPNPKPVNFTDAHFQEVELYGSLLSRLDPLQTSIEMSPGYVGYLADMQTALESNPLF 668

Query: 122 INGQDVEWTEDGPIRPKSNKSNRQKLLTYNPG-KGAESAFKCMSKVPKHRLVPTNPGDSL 180
              Q +         P  ++  + + L    G  G  +       +P H+L   NP D L
Sbjct: 669 RLAQTL---------PFMDEEIKGETLNDKIGVNGGGNRLDREDPIP-HKL---NPADPL 715

Query: 181 LQILVGTLSNFFAHSPELNLTLTGVLSALSVCPYRSLEGWLVFSGVDRLDNRRDSSTKDF 240
           L+ ++     F   + + N+ +TGVL+A++ CPYR L GWL++         ++++    
Sbjct: 716 LRAVLFEFEKFLCKTADENVAMTGVLTAIAQCPYRGLGGWLLY--------EKEAAAASS 767

Query: 241 ERLQHEPKNLEPSLGINNQEGISTSNGXXXXXXXXXXXXXXXXXY-NADKSPSAAKAIGA 299
                +  N +P      + G STS                     + D+ P AA +  +
Sbjct: 768 SSSSSQRDNDDPWAASVGEGGHSTSLADKSDSDSSSNLSLSNQHVPDEDRDPFAAPSPSS 827

Query: 300 TPMWTNFPPFFTIFKTLTQQVDYYRSEIDGFNQFLEDRRNGLLDAD 345
           +    + P  + I ++L +Q+   R+++  F++ L +RR GLL AD
Sbjct: 828 S-SSVDLPVIYQILQSLVKQISLLRTQVPQFDRLLSERRQGLLFAD 872



>gi|58266600|ref|XP_570456.1| hypothetical protein [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|134111010|ref|XP_775969.1| hypothetical protein CNBD3760 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50258635|gb|EAL21322.1| hypothetical protein CNBD3760 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57226689|gb|AAW43149.1| conserved hypothetical protein [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 1121

 Score = 83.6 bits (205), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 88/352 (25%), Positives = 150/352 (42%), Gaps = 61/352 (17%)

Query: 4   LRSSSQQAVIATLKLLHTVISKHCRYSLK-LLNIELDENATCFPRPNYLLESSFNVEQPG 62
           L S    +V A L LL T++S H   + + LL+   +  AT   R    +  S N++ P 
Sbjct: 549 LCSGQWNSVTAALCLLQTLLSNHPHQATRGLLSYIHEPAATALVRNP--IPRSLNLQSP- 605

Query: 63  PTSSGQPKLTTISHHLRELDLFFDLISAIDPTQNMEIFTNGYDSYVRDAEMIIEADRCYI 122
             +S  PK    S   RE++L+  L+S +DP Q     + GY  Y+ D +  +E++  + 
Sbjct: 606 -DASFLPKPVNFSDA-REVELYGSLLSLLDPLQTSIEMSPGYVGYLADMQTALESNPSF- 662

Query: 123 NGQDVEWTEDGPIRPKSNKSNRQKLLTYNPGK----GAESAFKCMSKVPKHRLVPTNPGD 178
                      PI P  ++ +  +  T+N       G          +P H+L P +P  
Sbjct: 663 --------RLAPILPFVDEEDVGET-TFNKASVNGGGGGGRLDGDDPIP-HKLSPADP-- 710

Query: 179 SLLQILVGTLSNFFAHSPELNLTLTGVLSALSVCPYRSLEGWLVFSGVDRLDNRRDSSTK 238
            LL+ ++G    F   + + N+ +TGVL+A++ CPYR+L GWL++               
Sbjct: 711 -LLRAVLGEFEKFLCKTADENVAMTGVLTAMASCPYRALGGWLLY--------------- 754

Query: 239 DFERLQHEPKNLEPSLGINNQEGISTSNGXXXXXXXXXXXXXXXXXYNADKSPSAAKAIG 298
                + E      SLG           G                  + D+ P   +  G
Sbjct: 755 -----EKEASVGHMSLG-----------GDESDSDASSDVSFSRHVSDGDRDPFVGR--G 796

Query: 299 ATPMWTNFPPFFTIFKTLTQQVDYYRSEIDGFNQFLEDRRNGLLDADDEIDE 350
           ++    + P  + I ++L +Q+   R ++  F++ L +RR GLL A D +DE
Sbjct: 797 SS---VDLPVIYQILRSLVKQISLLRRQVPQFDRLLSERRQGLLFA-DHLDE 844



>gi|296423327|ref|XP_002841206.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295637441|emb|CAZ85397.1| unnamed protein product [Tuber melanosporum]
          Length = 949

 Score = 80.9 bits (198), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 88/370 (23%), Positives = 149/370 (40%), Gaps = 88/370 (23%)

Query: 1   FSRLRSSSQQAVIATLKLLHTVISKHCRYS----LKLLNIELDENATCFPRPNYLLESSF 56
            + L+S SQQ V ATLKL+ T++ KH  YS    LK++ +  D                 
Sbjct: 488 LTSLKSKSQQTVSATLKLISTILRKHHPYSISTLLKVIPVAADA---------------- 531

Query: 57  NVEQPGPTSSGQPKLTTISHHLRELDLFFDLISAIDPTQNMEIFTNGYDSYVRDAEMIIE 116
                        +L T+  H +E++LFF L+  I    ++   +  Y  +++D   ++E
Sbjct: 532 -------------QLRTLGAHNKEMELFFSLVGDISEDGDV---SESYGEHLKDVLSLLE 575

Query: 117 ADRCYINGQDVEWTEDGPIRPKSNKSNRQKLLTYNPGKGAESAFKCMSKVPKHRLVPTN- 175
           +  C +            +    N +            GAE A +   + PK R + T+ 
Sbjct: 576 SHPCSMK-----------VLALKNSAF---------AGGAEDARE--PENPKVRDMYTHT 613

Query: 176 --PGDSLLQILVGTLSNFFAHSPELNLTLTGVLSALSVCPYRSLEGWLVF--SGVDRLDN 231
             P D LL+ +V  L +FF+++ E NLTLT V+  L+ C +   EGWL+F  +  +  D+
Sbjct: 614 VHPNDPLLRSVVDLLKSFFSNTVETNLTLTAVIVDLATCSFMRPEGWLLFDPTSYEFDDS 673

Query: 232 RRDSSTKDFERLQHEPKNLEPSLGINNQEGISTSNGXXXXXXXXXXXXXXXXXYNADKSP 291
             +    ++++L+     L   +G ++++                            K  
Sbjct: 674 DDERDGDEWDQLEDVENELTSIMGDSDEQAYRRKE---------------------KKRA 712

Query: 292 SAAKAIGATPMWTNFPPFFTIFKTLTQQVDYYRSEIDGFNQFLEDRRNGLLDADDEIDEN 351
              K     P WTN PP     + L  QV  YR  I   +  L +R+       DE+++ 
Sbjct: 713 KDLKRANRQPRWTNTPPILQAIEDLVSQVQAYRRAIPDLDDKLSERKRA-FQFTDELNDA 771

Query: 352 FFKQ---QPT 358
                  QPT
Sbjct: 772 LLSSPLPQPT 781



>gi|321257549|ref|XP_003193627.1| hypothetical protein CGB_D5130W [Cryptococcus gattii WM276]
 gi|317460097|gb|ADV21840.1| Conserved hypothetical protein [Cryptococcus gattii WM276]
          Length = 1161

 Score = 80.5 bits (197), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 61/221 (27%), Positives = 110/221 (49%), Gaps = 19/221 (8%)

Query: 4   LRSSSQQAVIATLKLLHTVISKHCRYSLK-LLNIELDENATCFPRPNYLLESSFNVEQPG 62
           L S    +V A L LLHT++S H   + + L++   D +AT   R    +  S +++ P 
Sbjct: 549 LCSEQPNSVTAALCLLHTLLSDHPNQATRALISYIRDPSATALVRNP--IPRSLDLQSPD 606

Query: 63  PTSSGQPKLTTISHHLRELDLFFDLISAIDPTQNMEIFTNGYDSYVRDAEMIIEADRCYI 122
             S     +     HL+E++L+  L+S +DP+Q     + GY  Y+ D +  +E++  + 
Sbjct: 607 DISFLPKPVNFTDVHLQEVELYGSLLSRLDPSQTCIEMSPGYMGYLADMQTALESNPLFR 666

Query: 123 NGQDVEWTEDGPIRPKSNKSNRQKLLTYNPGKGAESAFKCMSKVPKHRLVPTNPGDSLLQ 182
             Q         I P +N+ ++  L   N G   ++       +P H+    +P D LL+
Sbjct: 667 LAQ---------ILPFTNEEDKDAL---NNGGKLDNDNPIAIAIP-HK---PSPADPLLR 710

Query: 183 ILVGTLSNFFAHSPELNLTLTGVLSALSVCPYRSLEGWLVF 223
            ++     F   + + N+ +TGVL+A+++CPYR L GWL++
Sbjct: 711 AVLFEFEKFLYKTADENVAMTGVLTAVALCPYRGLGGWLLY 751



>gi|402216763|gb|EJT96847.1| hypothetical protein DACRYDRAFT_59996 [Dacryopinax sp. DJM-731 SS1]
          Length = 1009

 Score = 76.3 bits (186), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 71/245 (28%), Positives = 107/245 (43%), Gaps = 52/245 (21%)

Query: 1   FSRLRSSSQQAVIATLKLLHTVISKHCRYSLK------------LLNIELDENATCFPRP 48
            S L S SQ    A LKLL+T++++H   +L             L    LDE+    PRP
Sbjct: 564 LSNLESKSQPTASAALKLLNTLLTQHGLLALPRIFTLLPETNLYLNGHALDEDELKTPRP 623

Query: 49  NYLL-ESSFNVEQPGP---TSSGQPKLTTISH---HLRELDLFFDLISAIDPTQNMEIFT 101
            +L  E  F      P    S  +  L  + H    + + D +  L++ IDP    E   
Sbjct: 624 GFLSPEDDFFSTAYSPRANASKSEDDLMALRHVPLEIDDADSWRHLVARIDPKFAAEAQR 683

Query: 102 NGYDSYVRDAEMIIEADRCYINGQDVEWTEDGPIRPKSNKSNRQKLLTYNPGKGAESAFK 161
            G   Y++DA+               +W E              +LL  NP   +E+  +
Sbjct: 684 GGNTQYLQDAQ---------------DWLE-------------TQLLWSNPLLDSEADTE 715

Query: 162 CMSKVP--KHRLVPTNPGDSLLQILVGTLSNFFAHSPELNLTLTGVLSALSVCPYRSLEG 219
            +  +P  K+RL PT+P   LL  L+     FF+HSP++NL+LTGV+ A++  P  SL  
Sbjct: 716 QILSLPDRKYRLSPTDP---LLAQLLNVTQRFFSHSPDMNLSLTGVIHAIACSPQLSLAD 772

Query: 220 WLVFS 224
           W+  S
Sbjct: 773 WITHS 777



>gi|472587100|gb|EMS24599.1| retinoic acid induced 16-like protein family protein
           [Rhodosporidium toruloides NP11]
          Length = 1217

 Score = 75.1 bits (183), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 88/301 (29%), Positives = 132/301 (43%), Gaps = 34/301 (11%)

Query: 66  SGQPKLTTISHHLRELDLFFDLISAIDPT--------QNMEIFTNGYDSYVRDAEMIIEA 117
           S  P   + S H   LD    LI  IDP+           EI   G+ +Y+RDAE  + A
Sbjct: 693 SALPATPSASLHRDTLDTLLSLIGIIDPSYRKMRSAGGGSEITKTGFANYLRDAEASLAA 752

Query: 118 DRCYINGQDVEWTEDGPIRPKSNKSNRQKLLTYNPGK-GAESAF---KCMSKVP--KHRL 171
           +  +  G      E   +R  S  S R +      G  GA  +    +C       +H+L
Sbjct: 753 EAGFRRGLMASMDE---VREASEASERLQWDRRRTGLFGASRSVTGQECADAKTGYRHKL 809

Query: 172 VPTNPGDSLLQILVGTLSNFFAHSPELNLTLTGVLSALSVCPYRSLEGWLVFSGVDRLDN 231
            P++    L+ +L+ + S FF+H P++NL LT VL+AL++ PYRSLEGWL+   V + ++
Sbjct: 810 RPSS---KLIALLLDSFSAFFSHPPDVNLALTAVLAALALSPYRSLEGWLL--PVVKPNS 864

Query: 232 RRDSSTKDFERLQHEPKNLEPSLGINNQEGISTSNGXXXXXXXXXXXXXXXXXYNA---D 288
           R   S    ++L H    L  S   ++ +  S  +                   N    D
Sbjct: 865 RAVLS----DQLLHRDGRLGESSRSDDGDDRSVDHELEERSRRDALFAPLSPSPNVFTED 920

Query: 289 KSPSAAKAIGATPMWTNFPPFFTIFKTLTQQVDYYRSEIDGFNQFLEDRRNGLLDADDEI 348
             PSA +A  AT          +I   L + ++ YRS I  F+ +L  RR GL  AD+  
Sbjct: 921 PPPSATRAALATSDC-----LLSILDALAKSIERYRSTIPQFDDYLSQRRQGLFFADNLA 975

Query: 349 D 349
           D
Sbjct: 976 D 976