BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10166_c0_seq1-m.66 complete 174-566(+) 131 (+)
         (130 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|384498781|gb|EIE89272.1| hypothetical protein RO3G_13983 [Rhi...   101   7e-20   Rhizopus delemar RA 99-880
gi|511000686|gb|EPB82207.1| hypothetical protein HMPREF1544_1105...   101   8e-20   Mucor circinelloides f. circinelloides 1006PhL
gi|154309676|ref|XP_001554171.1| hypothetical protein BC1G_07308...    78   6e-13   Botrytis cinerea B05.10
gi|406867808|gb|EKD20846.1| 50S ribosomal protein [Marssonina br...    75   7e-12   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|485927177|gb|EOD51259.1| putative 50s ribosomal protein [Neof...    74   1e-11   Neofusicoccum parvum UCRNP2
gi|452978122|gb|EME77886.1| hypothetical protein MYCFIDRAFT_2361...    74   2e-11   Cercospora fijiensis CIRAD86
gi|398390097|ref|XP_003848509.1| hypothetical protein MYCGRDRAFT...    73   3e-11   Zymoseptoria tritici IPO323
gi|482812923|gb|EOA89627.1| hypothetical protein SETTUDRAFT_1674...    72   6e-11   Setosphaeria turcica Et28A
gi|470316738|gb|EMR08484.1| hypothetical protein PNEG_03310 [Pne...    71   7e-11   Pneumocystis murina B123


>gi|384498781|gb|EIE89272.1| hypothetical protein RO3G_13983 [Rhizopus delemar RA 99-880]
          Length = 123

 Score =  101 bits (251), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 69/105 (65%), Gaps = 9/105 (8%)

Query: 30  TKSFIR-------PRLFTQQIVLTNGATYTLRTTSP-KPRIKLIKDTRNHPLWNPSQLSQ 81
           TK F+R       P  F Q IVL+NGATYT+RTTSP +  I+L KDTRNHPLWNPS L +
Sbjct: 5   TKPFVRHASTSTKPEKFLQTIVLSNGATYTVRTTSPTRSHIRLTKDTRNHPLWNPSMLKE 64

Query: 82  ALDDDSGQLSKFIKKFGDEEY-DLEFMESDENLPVLTSNDMKSSG 125
            + D+S QLSKF K+FGD +  D+ ++ESDE +       + S G
Sbjct: 65  GVTDESEQLSKFQKRFGDLDLADISWIESDEAVSTTMKKAVASGG 109



>gi|511000686|gb|EPB82207.1| hypothetical protein HMPREF1544_11051 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 131

 Score =  101 bits (251), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 56/108 (51%), Positives = 76/108 (70%), Gaps = 8/108 (7%)

Query: 20  STLYKRSYATTKSFIRPRLFTQQIVLTNGATYTLRTTSP-KPRIKLIKDTRNHPLWNPSQ 78
           S L +   A+T+S  +P  F Q IVL+NGATYT+RTTSP + +I+L KDTRNHPLWNPS 
Sbjct: 14  SQLVQIRKASTQS--KPEKFLQTIVLSNGATYTVRTTSPTRAQIRLTKDTRNHPLWNPSM 71

Query: 79  LSQALDDDSGQLSKFIKKFGDEEY-DLEFMESDENLPVLTSNDMKSSG 125
           L + + D+S QL+KF K+FGD +  D+ ++ESDE +    SN MK + 
Sbjct: 72  LKEGVTDESEQLTKFQKRFGDLDLGDISWIESDEAV----SNAMKKAA 115



>gi|154309676|ref|XP_001554171.1| hypothetical protein BC1G_07308 [Botryotinia fuckeliana B05.10]
 gi|347827149|emb|CCD42846.1| hypothetical protein BofuT4_P071420.1 [Botryotinia fuckeliana T4]
 gi|472239748|gb|EMR84545.1| putative 50s ribosomal protein [Botryotinia fuckeliana BcDW1]
          Length = 173

 Score = 78.2 bits (191), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 46/116 (39%), Positives = 66/116 (56%), Gaps = 3/116 (2%)

Query: 1   MNITKLSIITKLYIPPNYPSTLYKRSYATTKSFIRPRLFTQQIVLTNGATYTLRTTSPKP 60
           + + + S IT   +P N   T   R     K  IRP  FTQ + L++G+TY  R+TSP P
Sbjct: 6   LTLRRTSSITSNTLPINSTLTHQIRHATLLKRPIRPYTFTQLVTLSDGSTYLTRSTSPAP 65

Query: 61  RIKLIKDTRNHPLWNPS--QLSQALDDDSGQLSKFIKKFGDE-EYDLEFMESDENL 113
             +  KDTRNHPLW PS   L    +D++G+LS F ++FG   + ++E  E +E L
Sbjct: 66  IYRSTKDTRNHPLWQPSLDSLRNVENDEAGRLSAFRERFGRGWDGEVEKAEGEEKL 121



>gi|406867808|gb|EKD20846.1| 50S ribosomal protein [Marssonina brunnea f. sp. 'multigermtubi'
           MB_m1]
          Length = 191

 Score = 74.7 bits (182), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 43/98 (43%), Positives = 56/98 (57%), Gaps = 9/98 (9%)

Query: 16  PNYPSTLYK------RSYATTKSFIRPRLFTQQIVLTNGATYTLRTTSPKPRIKLIKDTR 69
           P++PS ++       R  +  K   RP  FTQ + L++G+TY  RTTSP P  +  KDTR
Sbjct: 16  PSHPSHIHTCRTQQTRHASLLKRPHRPYTFTQLVTLSDGSTYMQRTTSPAPIYRSTKDTR 75

Query: 70  NHPLWNPS--QLSQALDDDSGQLSKFIKKFGDEEYDLE 105
           NHPLW PS   L     DD+G+L  F KKFG   +D E
Sbjct: 76  NHPLWQPSLDSLRNVEQDDAGRLKAFRKKFG-RGWDAE 112



>gi|485927177|gb|EOD51259.1| putative 50s ribosomal protein [Neofusicoccum parvum UCRNP2]
          Length = 125

 Score = 73.9 bits (180), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 50/81 (61%), Gaps = 3/81 (3%)

Query: 35  RPRLFTQQIVLTNGATYTLRTTSPKPRIKLIKDTRNHPLWNPS--QLSQALDDDSGQLSK 92
           RP  FTQ I L++G+TY  RTTSP P  +  KD RNHPLWNPS  +L    +D++G+L  
Sbjct: 38  RPYTFTQLITLSDGSTYLQRTTSPAPVYRSTKDIRNHPLWNPSSQKLMNVEEDEAGRLRA 97

Query: 93  FIKKFGDEEYDLEFMESDENL 113
           F  KFG   +D E  E  E +
Sbjct: 98  FRAKFG-RGWDSEITEDPEEV 117



>gi|452978122|gb|EME77886.1| hypothetical protein MYCFIDRAFT_23619, partial [Pseudocercospora
           fijiensis CIRAD86]
          Length = 126

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 52/81 (64%), Gaps = 3/81 (3%)

Query: 35  RPRLFTQQIVLTNGATYTLRTTSPKPRIKLIKDTRNHPLWNPS--QLSQALDDDSGQLSK 92
           RP  FTQ I L++G+T T RT+SP P  K  KDT+NH +WNPS  +L    +D++G+L K
Sbjct: 11  RPYQFTQLITLSDGSTLTHRTSSPAPIYKSTKDTKNHAMWNPSSQKLLNVEEDEAGRLRK 70

Query: 93  FIKKFGDEEYDLEFMESDENL 113
           F  KFG   YD E M  +E +
Sbjct: 71  FRAKFG-RGYDAETMSGEEEV 90



>gi|398390097|ref|XP_003848509.1| hypothetical protein MYCGRDRAFT_77116, partial [Zymoseptoria
           tritici IPO323]
 gi|339468384|gb|EGP83485.1| hypothetical protein MYCGRDRAFT_77116 [Zymoseptoria tritici IPO323]
          Length = 163

 Score = 72.8 bits (177), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 54/80 (67%), Gaps = 3/80 (3%)

Query: 35  RPRLFTQQIVLTNGATYTLRTTSPKPRIKLIKDTRNHPLWNPS--QLSQALDDDSGQLSK 92
           RP  FTQ I L++G+T+T RTTSP+P  +  KDT+N  LWNPS  +L    +D++G+L  
Sbjct: 32  RPYTFTQLITLSDGSTFTHRTTSPQPVYRSAKDTKNSLLWNPSSAKLQNVEEDEAGRLRN 91

Query: 93  FIKKFGDEEYDLEFMESDEN 112
           F K+FG   +D E +E++E 
Sbjct: 92  FRKRFG-RGFDAEAVEAEEG 110



>gi|482812923|gb|EOA89627.1| hypothetical protein SETTUDRAFT_167473 [Setosphaeria turcica Et28A]
          Length = 160

 Score = 71.6 bits (174), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 62/97 (63%), Gaps = 6/97 (6%)

Query: 35  RPRLFTQQIVLTNGATYTLRTTSPKPRIKLIKDTRNHPLWNPS--QLSQALDDDSGQLSK 92
           RP  FTQ I L++G+++TLRTT+P+P  K  KD RN PLWNPS  +L    +D++G+L+ 
Sbjct: 39  RPYTFTQLITLSDGSSFTLRTTNPQPVYKSAKDIRNSPLWNPSSQKLLNVEEDEAGKLAA 98

Query: 93  FIKKFG---DEEYDLE-FMESDENLPVLTSNDMKSSG 125
           F  KFG   D E D +   +++++L  L S+  K  G
Sbjct: 99  FRAKFGRGWDAERDADKGKQTEDHLLDLISSHGKPPG 135



>gi|470316738|gb|EMR08484.1| hypothetical protein PNEG_03310 [Pneumocystis murina B123]
          Length = 101

 Score = 71.2 bits (173), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 48/65 (73%), Gaps = 1/65 (1%)

Query: 35 RPRLFTQQIVLTNGATYTLRTTSPKPRIKLIKDTRNHPLWNPSQLSQA-LDDDSGQLSKF 93
          RPR F Q +VL++ +T+T+ TTSPKP I + KD RNHPLWNP++  Q   +D+  +LSKF
Sbjct: 31 RPRQFQQIVVLSDKSTFTIPTTSPKPVIWITKDQRNHPLWNPNKKQQIDENDNESRLSKF 90

Query: 94 IKKFG 98
           ++FG
Sbjct: 91 KQRFG 95