BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10170_c0_seq1-m.67 complete 52-1146(+) 365 (+)
         (364 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|384492980|gb|EIE83471.1| hypothetical protein RO3G_08176 [Rhi...   422   e-116   Rhizopus delemar RA 99-880
gi|511008926|gb|EPB90181.1| hypothetical protein HMPREF1544_0301...   408   e-111   Mucor circinelloides f. circinelloides 1006PhL
gi|494660458|ref|WP_007418402.1| prephenate dehydratase [Pedosph...   314   3e-83   Pedosphaera parvula
gi|383766274|ref|YP_005445255.1| chorismate mutase/prephenate de...   313   4e-83   
gi|497198983|ref|WP_009513245.1| prephenate dehydratase [Opituta...   294   2e-77   Opitutaceae bacterium TAV5
gi|512551870|ref|YP_008089776.1| chorismate mutase [Chthonomonas...   293   5e-77   
gi|494604817|ref|WP_007363065.1| prephenate dehydratase [Opituta...   292   1e-76   Opitutaceae bacterium TAV1
gi|15606269|ref|NP_213648.1| chorismate mutase/prephenate dehydr...   291   2e-76   Aquifex aeolicus VF5
gi|302341917|ref|YP_003806446.1| prephenate dehydratase [Desulfa...   289   7e-76   
gi|182414836|ref|YP_001819902.1| chorismate mutase [Opitutus ter...   288   2e-75   
gi|404493524|ref|YP_006717630.1| chorismate mutase and prephenat...   287   4e-75   
gi|357405840|ref|YP_004917764.1| bifunctional chorismate mutase ...   286   5e-75   
gi|108804084|ref|YP_644021.1| prephenate dehydratase/chorismate ...   286   6e-75   
gi|217968022|ref|YP_002353528.1| prephenate dehydratase [Dictyog...   286   7e-75   Dictyoglomus turgidum DSM 6724
gi|206891160|ref|YP_002249554.1| P-protein [Thermodesulfovibrio ...   286   9e-75   Thermodesulfovibrio yellowstonii DSM 11347
gi|302035800|ref|YP_003796122.1| p-protein, bifunctional chorism...   285   1e-74   
gi|494424781|ref|WP_007222243.1| chorismate mutase [planctomycet...   283   5e-74   Candidatus Jettenia caeni
gi|313672055|ref|YP_004050166.1| chorismate mutase [Calditerrivi...   283   5e-74   
gi|291280471|ref|YP_003497306.1| bifunctional chorismate mutase/...   282   1e-73   
gi|189425209|ref|YP_001952386.1| chorismate mutase [Geobacter lo...   280   3e-73   
gi|294055859|ref|YP_003549517.1| prephenate dehydratase [Coralio...   280   3e-73   
gi|319790561|ref|YP_004152194.1| chorismate mutase [Thermovibrio...   280   3e-73   
gi|494040215|ref|WP_006982340.1| prephenate dehydratase [Chthoni...   280   4e-73   Chthoniobacter flavus
gi|158521961|ref|YP_001529831.1| prephenate dehydratase [Desulfo...   280   5e-73   
gi|206901457|ref|YP_002251348.1| P-protein [Dictyoglomus thermop...   280   5e-73   
gi|322420785|ref|YP_004200008.1| chorismate mutase [Geobacter sp...   280   6e-73   
gi|512439757|ref|WP_016415576.1| prephenate dehydratase [Halomon...   279   9e-73   Halomonas anticariensis
gi|317050905|ref|YP_004112021.1| chorismate mutase [Desulfurispi...   279   9e-73   
gi|307545309|ref|YP_003897788.1| chorismate mutase [Halomonas el...   278   1e-72   
gi|383784291|ref|YP_005468860.1| prephenate dehydratase [Leptosp...   278   1e-72   
gi|496218196|ref|WP_008932233.1| prephenate dehydratase [Ectothi...   278   1e-72   Ectothiorhodospira sp. PHS-1
gi|291288848|ref|YP_003505664.1| chorismate mutase [Denitrovibri...   278   2e-72   
gi|496386438|ref|WP_009095428.1| prephenate dehydratase [Halomon...   278   2e-72   Halomonas sp. GFAJ-1
gi|497410560|ref|WP_009724758.1| prephenate dehydratase [Halomon...   277   3e-72   Halomonas sp. TD01
gi|430742432|ref|YP_007201561.1| prephenate dehydratase [Singuli...   277   4e-72   
gi|92114288|ref|YP_574216.1| chorismate mutase / prephenate dehy...   277   4e-72   
gi|495562081|ref|WP_008286660.1| prephenate dehydratase [Hydroge...   276   6e-72   Hydrogenivirga sp. 128-5-R1-1
gi|496086295|ref|WP_008810802.1| chorismate mutase [Burkholderia...   276   7e-72   
gi|496138890|ref|WP_008863397.1| chorismate mutase [Parasutterel...   276   8e-72   Parasutterella excrementihominis
gi|253699624|ref|YP_003020813.1| chorismate mutase [Geobacter sp...   275   2e-71   
gi|491146214|ref|WP_005004614.1| prephenate dehydratase [Nitroco...   275   2e-71   Nitrococcus mobilis
gi|304310668|ref|YP_003810266.1| Chorismate mutase/prephenate de...   274   3e-71   
gi|110834610|ref|YP_693469.1| chorismate mutase/prephenate dehyd...   274   4e-71   
gi|197119626|ref|YP_002140053.1| bifunctional chorismate mutase/...   273   5e-71   
gi|490426873|ref|WP_004299037.1| chorismate mutase [Thauera amin...   272   9e-71   Thauera aminoaromatica
gi|119897359|ref|YP_932572.1| chorismate mutase/prephenate dehyd...   272   9e-71   
gi|498314651|ref|WP_010628807.1| prephenate dehydratase [Halomon...   272   1e-70   Halomonas sp. KM-1
gi|496243939|ref|WP_008957324.1| prephenate dehydratase [Halomon...   272   1e-70   Halomonas sp. HAL1
gi|495570021|ref|WP_008294600.1| prephenate dehydratase [Congreg...   272   1e-70   
gi|114331557|ref|YP_747779.1| chorismate mutase [Nitrosomonas eu...   272   1e-70   
gi|496587959|ref|WP_009286587.1| Bifunctional P-protein, chorism...   272   1e-70   Halomonas
gi|496313960|ref|WP_009023138.1| prephenate dehydratase [gamma p...   271   2e-70   
gi|289208386|ref|YP_003460452.1| chorismate mutase [Thioalkalivi...   271   3e-70   
gi|494175002|ref|WP_007114120.1| prephenate dehydratase [Halomon...   270   5e-70   Halomonas boliviensis
gi|495322228|ref|WP_008046974.1| prephenate dehydratase [Reineke...   270   5e-70   Reinekea blandensis
gi|292492655|ref|YP_003528094.1| chorismate mutase [Nitrosococcu...   270   6e-70   
gi|495221040|ref|WP_007945815.1| prephenate dehydratase [Pseudom...   270   6e-70   Pseudomonas sp. GM21
gi|498135587|ref|WP_010449743.1| prephenate dehydratase [Pseudom...   270   7e-70   Pseudomonas fuscovaginae
gi|407696801|ref|YP_006821589.1| prephenate dehydratase domain-c...   270   7e-70   
gi|291614523|ref|YP_003524680.1| chorismate mutase [Sideroxydans...   269   8e-70   
gi|495646147|ref|WP_008370726.1| prephenate dehydratase [Pseudom...   269   9e-70   Pseudomonas sp. M47T1
gi|495375548|ref|WP_008100260.1| prephenate dehydratase [Verruco...   269   9e-70   Verrucomicrobiae bacterium DG1235
gi|328952379|ref|YP_004369713.1| prephenate dehydratase [Desulfo...   269   1e-69   
gi|337289011|ref|YP_004628483.1| prephenate dehydratase [Thermod...   269   1e-69   
gi|70731662|ref|YP_261404.1| chorismate mutase [Pseudomonas prot...   269   1e-69   
gi|333983583|ref|YP_004512793.1| chorismate mutase [Methylomonas...   269   1e-69   
gi|489311406|ref|WP_003218812.1| prephenate dehydratase [Pseudom...   269   1e-69   Pseudomonas
gi|237653700|ref|YP_002890014.1| chorismate mutase [Thauera sp. ...   268   1e-69   
gi|490495468|ref|WP_004361651.1| chorismate mutase [Thauera phen...   268   1e-69   Thauera phenylacetica
gi|229589166|ref|YP_002871285.1| chorismate mutase/prephenate de...   268   1e-69   
gi|489542414|ref|WP_003447098.1| prephenate dehydratase [Pseudom...   268   1e-69   Pseudomonas
gi|495183614|ref|WP_007908404.1| prephenate dehydratase [Pseudom...   268   1e-69   Pseudomonas
gi|378949569|ref|YP_005207057.1| protein PheA [Pseudomonas fluor...   268   1e-69   
gi|495346883|ref|WP_008071613.1| prephenate dehydratase [Pseudom...   268   1e-69   Pseudomonas
gi|498147528|ref|WP_010461684.1| prephenate dehydratase [Pseudom...   268   2e-69   Pseudomonas mandelii
gi|494256103|ref|WP_007150027.1| prephenate dehydratase [Alcaniv...   268   2e-69   Alcanivorax sp. DG881
gi|496215645|ref|WP_008929887.1| prephenate dehydratase [Alcaniv...   268   2e-69   Alcanivorax hongdengensis
gi|497899232|ref|WP_010213388.1| prephenate dehydratase [Pseudom...   268   2e-69   Pseudomonas amygdali
gi|495260633|ref|WP_007985388.1| prephenate dehydratase [Pseudom...   268   2e-69   Pseudomonas sp. GM48
gi|498252345|ref|WP_010566501.1| prephenate dehydratase [Pseudom...   268   2e-69   Pseudomonas extremaustralis
gi|495174932|ref|WP_007899727.1| prephenate dehydratase [Pseudom...   268   2e-69   Pseudomonas
gi|330808289|ref|YP_004352751.1| prephenate dehydratase [Pseudom...   268   2e-69   
gi|489276198|ref|WP_003183886.1| prephenate dehydratase [Pseudom...   268   2e-69   Pseudomonas fluorescens
gi|495238857|ref|WP_007963622.1| prephenate dehydratase [Pseudom...   268   2e-69   Pseudomonas sp. GM30
gi|495275176|ref|WP_007999931.1| prephenate dehydratase [Pseudom...   268   2e-69   Pseudomonas sp. GM49
gi|490379971|ref|WP_004259491.1| chorismate mutase [Thauera sp. ...   268   3e-69   Thauera sp. 63
gi|492046956|ref|WP_005731287.1| prephenate dehydratase [Pseudom...   268   3e-69   Pseudomonas amygdali
gi|492787454|ref|WP_005963800.1| prephenate dehydratase [endosym...   267   3e-69   sulfur-oxidizing symbionts
gi|496914535|ref|WP_009407557.1| chorismate mutase/prephenate de...   267   3e-69   Pseudomonas putida
gi|163856195|ref|YP_001630493.1| chorismate mutase/prephenate de...   267   3e-69   
gi|392374264|ref|YP_003206097.1| bifunctional chorismate mutase/...   267   4e-69   
gi|489319565|ref|WP_003226907.1| prephenate dehydratase [Pseudom...   267   4e-69   Pseudomonas
gi|491022414|ref|WP_004884111.1| chorismate mutase [Pseudomonas ...   267   4e-69   Pseudomonas syringae group
gi|494461885|ref|WP_007251444.1| prephenate dehydratase [Pseudom...   267   4e-69   Pseudomonas syringae group
gi|327398203|ref|YP_004339072.1| prephenate dehydratase [Hippea ...   266   5e-69   
gi|496335832|ref|WP_009045010.1| prephenate dehydratase [Pseudom...   266   5e-69   Pseudomonas chlororaphis
gi|510308638|gb|EPA94075.1| chorismate mutase, clade 2 [Pseudomo...   266   5e-69   Pseudomonas sp. G5(2012)
gi|426408272|ref|YP_007028371.1| chorismate mutase/prephenate de...   266   5e-69   
gi|494244269|ref|WP_007144887.1| prephenate dehydratase [Methylo...   266   5e-69   Methylophaga aminisulfidivorans
gi|488617716|ref|WP_002554565.1| prephenate dehydratase [Pseudom...   266   6e-69   Pseudomonas
gi|492572125|ref|WP_005889752.1| prephenate dehydratase [Pseudom...   266   6e-69   Pseudomonas syringae group
gi|387127950|ref|YP_006296555.1| chorismate mutase I / Prephenat...   266   7e-69   
gi|218779607|ref|YP_002430925.1| prephenate dehydratase [Desulfa...   266   7e-69   
gi|170720562|ref|YP_001748250.1| chorismate mutase [Pseudomonas ...   266   7e-69   
gi|289548700|ref|YP_003473688.1| prephenate dehydratase [Thermoc...   266   7e-69   
gi|28868953|ref|NP_791572.1| chorismate mutase/prephenate dehydr...   266   7e-69   [Pseudomonas syringae] pv. tomato str. DC3000
gi|497306737|ref|WP_009620954.1| chorismate mutase [Pseudomonas ...   266   8e-69   Pseudomonas
gi|390950440|ref|YP_006414199.1| chorismate mutase, clade 2 [Thi...   266   8e-69   
gi|498119470|ref|WP_010433626.1| prephenate dehydratase [Pseudom...   266   8e-69   Pseudomonas
gi|489408664|ref|WP_003314657.1| chorismate mutasea [Pseudomonas...   266   9e-69   Pseudomonas syringae
gi|472326585|ref|YP_007658831.1| chorismate mutase [Pseudomonas ...   266   9e-69   
gi|491148260|ref|WP_005006656.1| P-protein, bifunctional chorism...   265   1e-68   Nitrospina gracilis
gi|490803834|ref|WP_004665960.1| prephenate dehydratase [Pseudom...   265   1e-68   Pseudomonas syringae group
gi|492124670|ref|WP_005755158.1| prephenate dehydratase [Pseudom...   265   1e-68   Pseudomonas syringae group
gi|490795154|ref|WP_004657300.1| chorismate mutase/prephenate de...   265   1e-68   
gi|451948226|ref|YP_007468821.1| prephenate dehydratase [Desulfo...   265   1e-68   
gi|66046874|ref|YP_236715.1| chorismate mutase [Pseudomonas syri...   265   1e-68   Pseudomonas syringae pv. syringae B728a
gi|77163712|ref|YP_342237.1| chorismate mutase [Nitrosococcus oc...   265   1e-68   
gi|498169126|ref|WP_010483282.1| prephenate dehydratase [Pseudom...   265   1e-68   
gi|495365645|ref|WP_008090361.1| prephenate dehydratase [Pseudom...   265   1e-68   Pseudomonas sp. GM84
gi|104780670|ref|YP_607168.1| bifunctional chorismate mutase/pre...   265   1e-68   
gi|77460297|ref|YP_349804.1| prephenate dehydratase [Pseudomonas...   265   2e-68   
gi|496224010|ref|WP_008938045.1| chorismate mutase / prephenate ...   265   2e-68   Marinobacter santoriniensis
gi|404495721|ref|YP_006719827.1| chorismate mutase and prephenat...   265   2e-68   
gi|507096835|ref|WP_016167477.1| chorismate mutase [Acinetobacte...   265   2e-68   Bacteria
gi|511757923|ref|WP_016391193.1| bifunctional chorismate mutase/...   265   2e-68   Pseudomonas plecoglossicida
gi|489464548|ref|WP_003369723.1| prephenate dehydratase [Pseudom...   265   2e-68   Pseudomonas
gi|300112893|ref|YP_003759468.1| chorismate mutase [Nitrosococcu...   264   2e-68   
gi|497909984|ref|WP_010224140.1| prephenate dehydratase [Pseudom...   264   2e-68   Pseudomonas
gi|496010486|ref|WP_008735065.1| prephenate dehydratase [Alcaniv...   264   2e-68   Alcanivorax pacificus
gi|489553806|ref|WP_003458404.1| Chorismate mutase I / Prephenat...   264   3e-68   Pseudomonas pseudoalcaligenes
gi|490962715|ref|WP_004824524.1| prephenate dehydratase [Acineto...   264   3e-68   Acinetobacter
gi|490857198|ref|WP_004719240.1| chorismate mutase [Acinetobacte...   264   3e-68   Acinetobacter
gi|489013292|ref|WP_002923817.1| chorismate mutase [Thauera sp. ...   264   3e-68   Thauera
gi|495842535|ref|WP_008567114.1| prephenate dehydratase [Pseudom...   264   3e-68   Pseudomonas sp. Chol1
gi|488794399|ref|WP_002706805.1| prephenate dehydratase [Thiothr...   264   3e-68   Thiothrix nivea
gi|431930683|ref|YP_007243729.1| chorismate mutase, clade 2 [Thi...   264   4e-68   
gi|339486337|ref|YP_004700865.1| chorismate mutase [Pseudomonas ...   264   4e-68   
gi|447915930|ref|YP_007396498.1| P-protein [Pseudomonas poae RE*...   263   4e-68   
gi|308273466|emb|CBX30068.1| P-protein [uncultured Desulfobacter...   263   5e-68   uncultured Desulfobacterium sp.
gi|501089186|ref|WP_012139430.1| chorismate mutase / prephenate ...   263   5e-68   Marinobacter lipolyticus
gi|489328066|ref|WP_003235353.1| P-protein [Pseudomonas fluoresc...   263   5e-68   Pseudomonas
gi|283778631|ref|YP_003369386.1| prephenate dehydratase [Pirellu...   263   5e-68   
gi|493839332|ref|WP_006786486.1| prephenate dehydratase [Thiorho...   263   5e-68   Thiorhodospira sibirica
gi|489563772|ref|WP_003468293.1| P-protein [Xanthomonas transluc...   263   6e-68   Xanthomonas translucens
gi|325295590|ref|YP_004282104.1| chorismate mutase [Desulfurobac...   263   6e-68   
gi|21431808|sp|P27603.2|PHEA_PSEST RecName: Full=P-protein; Incl...   263   6e-68   Pseudomonas stutzeri
gi|512619570|ref|YP_008104254.1| chorismate mutase/prephenate de...   263   6e-68   
gi|114320087|ref|YP_741770.1| chorismate mutase/prephenate dehyd...   263   6e-68   
gi|452943342|ref|YP_007499507.1| prephenate dehydratase [Hydroge...   263   6e-68   
gi|497288422|ref|WP_009602639.1| bifunctional chorismate mutase ...   263   6e-68   Xanthomonas translucens
gi|497371787|ref|WP_009686000.1| prephenate dehydratase [Pseudom...   263   7e-68   Pseudomonas
gi|397687385|ref|YP_006524704.1| chorismate mutase [Pseudomonas ...   263   7e-68   
gi|336324083|ref|YP_004604050.1| chorismate mutase [Flexistipes ...   263   7e-68   
gi|82703310|ref|YP_412876.1| chorismate mutase [Nitrosospira mul...   263   7e-68   
gi|512577189|ref|YP_008093098.1| prephenate dehydratase [Pseudom...   263   8e-68   
gi|288818701|ref|YP_003433049.1| chorismate mutase/prephenate de...   262   9e-68   
gi|512687059|ref|YP_008115039.1| chorismate mutase/prephenate de...   262   9e-68   
gi|167032372|ref|YP_001667603.1| chorismate mutase [Pseudomonas ...   262   9e-68   
gi|490283937|ref|WP_004179779.1| Chorismate mutase I / Prephenat...   262   1e-67   Nitrosospira lacus
gi|410663082|ref|YP_006915453.1| chorismate mutase/prephenate de...   262   1e-67   
gi|490712972|ref|WP_004575796.1| chorismate mutase [Pseudomonas ...   262   1e-67   Pseudomonas
gi|251771399|gb|EES51978.1| prephenate dehydratase [Leptospirill...   262   1e-67   Leptospirillum ferrodiazotrophum
gi|195952501|ref|YP_002120791.1| prephenate dehydratase [Hydroge...   262   1e-67   
gi|71734689|ref|YP_275807.1| chorismate mutase [Pseudomonas syri...   262   1e-67   
gi|490786418|ref|WP_004648580.1| chorismate mutase [Acinetobacte...   262   1e-67   Acinetobacter bohemicus
gi|385331103|ref|YP_005885054.1| chorismate mutase / prephenate ...   262   1e-67   
gi|489382992|ref|WP_003289656.1| prephenate dehydratase [Pseudom...   261   1e-67   Pseudomonas stutzeri
gi|489390102|ref|WP_003296669.1| chorismate mutase [Pseudomonas ...   261   2e-67   Pseudomonas stutzeri
gi|146306881|ref|YP_001187346.1| prephenate dehydratase [Pseudom...   261   2e-67   
gi|493949997|ref|WP_006893888.1| prephenate dehydratase [Methylo...   261   2e-67   Methylobacter tundripaludum
gi|118579773|ref|YP_901023.1| chorismate mutase [Pelobacter prop...   261   2e-67   
gi|431927119|ref|YP_007240153.1| chorismate mutase, clade 2 [Pse...   261   2e-67   
gi|392421535|ref|YP_006458139.1| chorismate mutase [Pseudomonas ...   261   2e-67   
gi|148263528|ref|YP_001230234.1| prephenate dehydratase [Geobact...   261   2e-67   
gi|146282685|ref|YP_001172838.1| chorismate mutase [Pseudomonas ...   261   2e-67   
gi|288941798|ref|YP_003444038.1| chorismate mutase [Allochromati...   261   2e-67   
gi|261855934|ref|YP_003263217.1| chorismate mutase [Halothiobaci...   261   3e-67   
gi|514091364|gb|EPF71466.1| chorismate mutase [Acinetobacter rud...   261   3e-67   Acinetobacter rudis CIP 110305
gi|489569390|ref|WP_003473864.1| chorismate mutase [Xanthomonas ...   261   3e-67   Xanthomonas translucens
gi|497799133|ref|WP_010113317.1| prephenate dehydratase [Acineto...   261   3e-67   Acinetobacter sp. P8-3-8
gi|148549151|ref|YP_001269253.1| chorismate mutase [Pseudomonas ...   261   3e-67   
gi|226943700|ref|YP_002798773.1| chorismate mutase [Azotobacter ...   261   3e-67   
gi|91776039|ref|YP_545795.1| chorismate mutase / prephenate dehy...   260   4e-67   
gi|26988500|ref|NP_743925.1| chorismate mutase [Pseudomonas puti...   260   4e-67   Pseudomonas putida KT2440
gi|490834039|ref|WP_004696123.1| prephenate dehydratase [Acineto...   260   4e-67   Acinetobacter
gi|489473874|ref|WP_003378949.1| chorismate mutase/prephenate de...   260   4e-67   Pseudomonas syringae
gi|15598362|ref|NP_251856.1| chorismate mutase [Pseudomonas aeru...   260   4e-67   Pseudomonas aeruginosa PAO1
gi|387220740|gb|EIJ75384.1| Prephenate dehydratase [Leptospirill...   260   4e-67   Leptospirillum sp. Group II 'C75'
gi|489395984|ref|WP_003302483.1| chorismate mutase [Pseudomonas ...   260   5e-67   Pseudomonas stutzeri
gi|490999853|ref|WP_004861576.1| chorismate mutase [Acinetobacte...   260   5e-67   Acinetobacter gerneri
gi|473829644|ref|YP_007682927.1| P-protein [Thalassolituus oleiv...   260   5e-67   
gi|490462887|ref|WP_004333445.1| chorismate mutase [Thauera lina...   260   5e-67   Thauera linaloolentis
gi|49086200|gb|AAT51335.1| PA3166, partial [synthetic construct]      260   5e-67   synthetic construct
gi|218890642|ref|YP_002439506.1| chorismate mutase [Pseudomonas ...   260   5e-67   
gi|410478994|ref|YP_006766631.1| prephenate dehydratase [Leptosp...   259   6e-67   
gi|496442730|ref|WP_009151575.1| prephenate dehydratase [Thiorho...   259   6e-67   
gi|494267139|ref|WP_007154696.1| prephenate dehydratase [Marinob...   259   6e-67   Marinobacter algicola
gi|430761096|ref|YP_007216953.1| Chorismate mutase I / Prephenat...   259   6e-67   
gi|492840682|ref|WP_005994636.1| chorismate mutase [Desulfovibri...   259   8e-67   Desulfovibrio fructosivorans
gi|470171933|ref|YP_007552819.1| chorismate mutase/prephenate de...   259   1e-66   
gi|187734525|ref|YP_001876637.1| chorismate mutase [Akkermansia ...   259   1e-66   
gi|39997702|ref|NP_953653.1| chorismate mutase and prephenate de...   259   1e-66   Geobacter sulfurreducens PCA
gi|498497129|ref|WP_010797857.1| P-protein [Pseudomonas sp. HPB0...   259   1e-66   Pseudomonas
gi|498233016|ref|WP_010547172.1| prephenate dehydratase [gamma p...   259   1e-66   gamma proteobacterium HIMB30
gi|152989646|ref|YP_001347344.1| chorismate mutase [Pseudomonas ...   259   1e-66   
gi|496396923|ref|WP_009105913.1| chorismate mutase [Desulfovibri...   259   1e-66   
gi|491086245|ref|WP_004947859.1| chorismate mutase [Acinetobacte...   259   1e-66   Acinetobacter soli
gi|491239238|ref|WP_005097461.1| chorismate mutase [Acinetobacte...   258   1e-66   Acinetobacter lwoffii
gi|491312251|ref|WP_005170229.1| chorismate mutase [Acinetobacte...   258   1e-66   Acinetobacter sp. NIPH 713
gi|492845594|ref|WP_005999548.1| prephenate dehydratase [Desulfu...   258   1e-66   Desulfuromonas acetoxidans
gi|319787317|ref|YP_004146792.1| chorismate mutase [Pseudoxantho...   258   2e-66   
gi|493496499|ref|WP_006451090.1| prephenate dehydratase [Xanthom...   258   2e-66   Xanthomonas gardneri
gi|491128477|ref|WP_004986906.1| prephenate dehydratase [Acineto...   258   2e-66   Acinetobacter ursingii
gi|489555252|ref|WP_003459835.1| prephenate dehydratase [Pseudom...   258   2e-66   
gi|53804245|ref|YP_113875.1| chorismate mutase/prephenate dehydr...   258   3e-66   
gi|330502870|ref|YP_004379739.1| prephenate dehydratase [Pseudom...   258   3e-66   
gi|491138341|ref|WP_004996757.1| chorismate mutase [Acinetobacte...   257   3e-66   Acinetobacter
gi|262199994|ref|YP_003271203.1| chorismate mutase [Haliangium o...   257   3e-66   
gi|285018478|ref|YP_003376189.1| chorismate mutase prephenate de...   257   3e-66   
gi|333900210|ref|YP_004474083.1| chorismate mutase [Pseudomonas ...   257   4e-66   
gi|489091170|ref|WP_003001065.1| chorismate mutase [Leptospira w...   256   6e-66   Leptospira weilii
gi|30248352|ref|NP_840422.1| prephenate dehydratase/chorismate m...   256   7e-66   
gi|491152593|ref|WP_005010987.1| chorismate mutase [Acinetobacte...   256   7e-66   Acinetobacter bouvetii
gi|241995648|gb|ACS75019.1| PheA [Methylophilus methylotrophus]       256   7e-66   Methylophilus methylotrophus
gi|384419789|ref|YP_005629149.1| P-protein [Xanthomonas oryzae p...   256   8e-66   
gi|492837226|ref|WP_005991180.1| prephenate dehydratase [Xanthom...   256   8e-66   Xanthomonas vesicatoria
gi|491146542|ref|WP_005004942.1| chorismate mutase [Acinetobacte...   256   8e-66   Acinetobacter ursingii
gi|58582010|ref|YP_201026.1| P-protein [Xanthomonas oryzae pv. o...   256   8e-66   
gi|488893452|ref|WP_002804594.1| P-protein [Xanthomonas fragaria...   256   9e-66   Xanthomonas fragariae
gi|495244572|ref|WP_007969335.1| prephenate dehydratase [Xanthom...   256   9e-66   Xanthomonas fuscans
gi|494181049|ref|WP_007116671.1| prephenate dehydratase [Enhydro...   256   9e-66   Enhydrobacter aerosaccus
gi|78047246|ref|YP_363421.1| P-protein [Xanthomonas campestris p...   256   1e-65   
gi|3153199|gb|AAC38578.1| P-protein [Xanthomonas campestris]          256   1e-65   Xanthomonas campestris
gi|384427524|ref|YP_005636883.1| P-protein [Xanthomonas campestr...   256   1e-65   
gi|21231044|ref|NP_636961.1| P-protein [Xanthomonas campestris p...   255   1e-65   Xanthomonas campestris pv. campestris str. ATCC 33913
gi|495239304|ref|WP_007964068.1| prephenate dehydratase [Xanthom...   255   1e-65   Xanthomonas
gi|192360645|ref|YP_001982589.1| chorismate mutase/prephenate de...   255   1e-65   
gi|21242399|ref|NP_641981.1| P-protein [Xanthomonas axonopodis p...   255   1e-65   
gi|495850346|ref|WP_008574925.1| prephenate dehydratase [Xanthom...   255   1e-65   
gi|489871523|ref|WP_003775063.1| prephenate dehydratase [Neisser...   255   1e-65   
gi|494278464|ref|WP_007160465.1| prephenate dehydratase [Pseudom...   255   1e-65   Pseudomonas psychrotolerans
gi|494432337|ref|WP_007225643.1| prephenate dehydratase [marine ...   255   1e-65   marine gamma proteobacterium HTCC2143
gi|498270009|ref|WP_010584165.1| prephenate dehydratase [Schlesn...   255   2e-65   
gi|497817253|ref|WP_010131409.1| prephenate dehydratase [Alterom...   255   2e-65   Microbulbifer agarilyticus
gi|498028411|ref|WP_010342567.1| prephenate dehydratase [Xanthom...   255   2e-65   Xanthomonas sacchari
gi|492677240|ref|WP_005919697.1| P-protein [Xanthomonas axonopod...   254   2e-65   Xanthomonas axonopodis
gi|497412582|ref|WP_009726780.1| Chorismate mutase I / Prephenat...   254   2e-65   
gi|492698495|ref|WP_005926335.1| prephenate dehydratase [Xanthom...   254   3e-65   Xanthomonas axonopodis
gi|357417464|ref|YP_004930484.1| putative bifunctional chorismat...   254   3e-65   
gi|490187277|ref|WP_004085878.1| prephenate dehydratase [Xylella...   254   4e-65   Xylella fastidiosa
gi|220934710|ref|YP_002513609.1| chorismate mutase [Thioalkalivi...   254   4e-65   
gi|116750149|ref|YP_846836.1| chorismate mutase [Syntrophobacter...   254   4e-65   
gi|170730609|ref|YP_001776042.1| P-protein (prephenate dehydrata...   253   4e-65   
gi|74316969|ref|YP_314709.1| chorismate mutase [Thiobacillus den...   253   4e-65   
gi|383316491|ref|YP_005377333.1| chorismate mutase, clade 2 [Fra...   253   4e-65   
gi|91201954|emb|CAJ75014.1| strongly similar to chorismate mutas...   253   8e-65   Candidatus Kuenenia stuttgartiensis
gi|488761981|ref|WP_002685184.1| prephenate dehydratase [Beggiat...   253   8e-65   Beggiatoa alba
gi|189485549|ref|YP_001956490.1| chorismate mutase/prephenate de...   252   9e-65   uncultured Termite group 1 bacterium phylotype Rs-D17
gi|222055452|ref|YP_002537814.1| chorismate mutase [Geobacter da...   252   1e-64   
gi|120553951|ref|YP_958302.1| chorismate mutase [Marinobacter aq...   252   1e-64   
gi|71729860|gb|EAO31957.1| Chorismate mutase, gamma, beta and ep...   252   1e-64   
gi|374300230|ref|YP_005051869.1| chorismate mutase [Desulfovibri...   252   1e-64   
gi|15838916|ref|NP_299604.1| P-protein [Xylella fastidiosa 9a5c]...   252   1e-64   
gi|170286949|dbj|BAG13473.1| chorismate mutase/prephenate dehydr...   252   1e-64   uncultured Termite group 1 bacterium
gi|387129108|ref|YP_006291998.1| Chorismate mutase I / Prephenat...   252   1e-64   
gi|492831638|ref|WP_005985592.1| chorismate mutase [Desulfovibri...   252   1e-64   
gi|494914912|ref|WP_007640950.1| prephenate dehydratase [Cellvib...   252   1e-64   Cellvibrio sp. BR
gi|225848309|ref|YP_002728472.1| chorismate mutase/prephenate de...   252   1e-64   
gi|491114519|ref|WP_004972976.1| chorismate mutase [Acinetobacte...   251   2e-64   Acinetobacter towneri
gi|514351836|ref|WP_016543572.1| chorismate mutase [Leptospira w...   251   2e-64   Leptospira wolffii
gi|494097963|ref|WP_007038765.1| prephenate dehydratase [Thiorho...   251   2e-64   Thiorhodococcus drewsii
gi|188996737|ref|YP_001930988.1| chorismate mutase [Sulfurihydro...   251   2e-64   
gi|490601023|ref|WP_004466043.1| chorismate mutase [Leptospira s...   251   2e-64   
gi|490593278|ref|WP_004458298.1| bifunctional prephenate dehydra...   251   3e-64   Leptospira
gi|307730625|ref|YP_003907849.1| chorismate mutase [Burkholderia...   251   3e-64   
gi|297568600|ref|YP_003689944.1| prephenate dehydratase [Desulfu...   251   3e-64   
gi|406891448|gb|EKD37070.1| hypothetical protein ACD_75C01270G00...   251   3e-64   uncultured bacterium
gi|313667833|ref|YP_004048117.1| chorismate mutase [Neisseria la...   251   3e-64   
gi|463325408|gb|EMJ90970.1| chorismate mutase [Leptospira alston...   250   4e-64   
gi|493977413|ref|WP_006920430.1| prephenate dehydratase [Desulfo...   250   4e-64   
gi|495559029|ref|WP_008283608.1| prephenate dehydratase [gamma p...   250   4e-64   
gi|490953554|ref|WP_004815372.1| chorismate mutase [Acinetobacte...   250   5e-64   
gi|121997369|ref|YP_001002156.1| chorismate mutase [Halorhodospi...   250   5e-64   
gi|490888535|ref|WP_004750488.1| putative chorismate mutase [Lep...   250   5e-64   
gi|508730082|emb|CCK75567.1| Chorismate mutase [Oleispira antarc...   249   7e-64   
gi|494593634|ref|WP_007352225.1| prephenate dehydratase [Marinob...   249   7e-64   
gi|489890974|ref|WP_003794424.1| prephenate dehydratase [Kingell...   249   7e-64   
gi|488179884|ref|WP_002251092.1| chorismate mutase [Neisseria me...   249   8e-64   
gi|507098769|emb|CCH04356.1| Chorismate mutase I [Achromobacter ...   249   8e-64   
gi|392409692|ref|YP_006446299.1| prephenate dehydratase [Desulfo...   249   8e-64   
gi|494635480|ref|WP_007393424.1| prephenate dehydratase [Psychro...   249   8e-64   
gi|15676357|ref|NP_273493.1| chorismate mutase [Neisseria mening...   249   9e-64   
gi|494044901|ref|WP_006987019.1| prephenate dehydratase [Cardiob...   249   9e-64   
gi|254785509|ref|YP_003072938.1| P-protein [Teredinibacter turne...   249   1e-63   
gi|302878367|ref|YP_003846931.1| chorismate mutase [Gallionella ...   249   1e-63   
gi|56475925|ref|YP_157514.1| chorismate mutase [Aromatoleum arom...   249   1e-63   
gi|385327797|ref|YP_005882100.1| chorismate mutase [Neisseria me...   249   1e-63   
gi|296113107|ref|YP_003627045.1| bifunctional prephenate dehydra...   249   1e-63   
gi|376297977|ref|YP_005169207.1| chorismate mutase [Desulfovibri...   249   1e-63   
gi|490606916|ref|WP_004471925.1| chorismate mutase [Leptospira s...   249   1e-63   
gi|488190344|ref|WP_002261552.1| prephenate dehydratase [Neisser...   249   1e-63   
gi|488145352|ref|WP_002216560.1| prephenate dehydratase [Neisser...   249   1e-63   
gi|489806548|ref|WP_003710420.1| prephenate dehydratase [Neisser...   249   1e-63   
gi|489810712|ref|WP_003714567.1| prephenate dehydratase [Neisser...   248   1e-63   
gi|489754264|ref|WP_003658255.1| prephenate dehydratase [Moraxel...   248   1e-63   
gi|198283147|ref|YP_002219468.1| chorismate mutase [Acidithiobac...   248   2e-63   
gi|496472815|ref|WP_009181660.1| chorismate mutase [Desulfovibri...   248   2e-63   
gi|463332224|gb|EMJ97136.1| chorismate mutase [Leptospira sp. B5...   248   2e-63   
gi|496411131|ref|WP_009119995.1| prephenate dehydratase [Neisser...   248   2e-63   
gi|490720071|ref|WP_004582636.1| chorismate mutase / prephenate ...   248   2e-63   
gi|345560684|gb|EGX43809.1| hypothetical protein AOL_s00215g545 ...   248   2e-63   
gi|493799725|ref|WP_006747661.1| prephenate dehydratase [Thioalk...   248   2e-63   
gi|493438130|ref|WP_006393614.1| chorismate mutase [Achromobacte...   248   2e-63   
gi|495084123|ref|WP_007808947.1| prephenate dehydratase [Rhodano...   248   2e-63   
gi|313201331|ref|YP_004039989.1| chorismate mutase [Methylovorus...   248   2e-63   
gi|491378575|ref|WP_005236466.1| chorismate mutase [Acinetobacte...   248   2e-63   
gi|392405369|ref|YP_006441981.1| chorismate mutase, prephenate d...   248   2e-63   
gi|495577972|ref|WP_008302551.1| prephenate dehydratase [Acineto...   248   2e-63   
gi|254671055|emb|CBA07923.1| chorismate mutase/prephenate dehydr...   248   2e-63   
gi|218768789|ref|YP_002343301.1| chorismate mutase [Neisseria me...   248   3e-63   
gi|383757245|ref|YP_005436230.1| chorismate mutase/prephenate de...   247   3e-63   
gi|488141328|ref|WP_002212536.1| prephenate dehydratase [Neisser...   247   3e-63   
gi|490605077|ref|WP_004470097.1| chorismate mutase [Leptospira s...   247   3e-63   
gi|317152669|ref|YP_004120717.1| chorismate mutase [Desulfovibri...   247   3e-63   
gi|337286294|ref|YP_004625767.1| Prephenate dehydratase [Thermod...   247   3e-63   
gi|152990138|ref|YP_001355860.1| chorismate mutase/prephenate de...   247   3e-63   
gi|83719222|ref|YP_442172.1| chorismate mutase/prephenate dehydr...   247   3e-63   
gi|493262688|ref|WP_006225150.1| chorismate mutase [Achromobacte...   247   3e-63   
gi|497260764|ref|WP_009574981.1| prephenate dehydratase [gamma p...   247   3e-63   
gi|488161646|ref|WP_002232854.1| prephenate dehydratase [Neisser...   247   4e-63   
gi|121635411|ref|YP_975656.1| chorismate mutase [Neisseria menin...   247   4e-63   
gi|490922360|ref|WP_004784230.1| chorismate mutase [Acinetobacte...   247   4e-63   
gi|493432682|ref|WP_006388258.1| chorismate mutase [Achromobacte...   247   4e-63   
gi|253999242|ref|YP_003051305.1| chorismate mutase [Methylovorus...   247   4e-63   
gi|254805525|ref|YP_003083746.1| chorismate mutase/prephenate de...   247   4e-63   
gi|53720128|ref|YP_109114.1| chorismate mutase/prephenate dehydr...   247   4e-63   
gi|494789149|ref|WP_007524557.1| chorismate mutase [Desulfovibri...   247   4e-63   
gi|494028690|ref|WP_006970830.1| chorismate mutase [Plesiocystis...   247   5e-63   
gi|399544564|ref|YP_006557872.1| P-protein [Marinobacter sp. BSs...   247   5e-63   
gi|489797702|ref|WP_003701593.1| prephenate dehydratase [Neisser...   247   5e-63   
gi|488031913|ref|WP_002103310.1| chorismate mutase [Leptospira i...   246   5e-63   
gi|452852140|ref|YP_007493824.1| bifunctional chorismate mutase/...   246   5e-63   
gi|488030666|ref|WP_002102065.1| chorismate mutase [Leptospira i...   246   6e-63   
gi|206602807|gb|EDZ39288.1| Prephenate dehydratase [Leptospirill...   246   6e-63   
gi|447204039|ref|WP_001281295.1| bifunctional prephenate dehydra...   246   6e-63   
gi|45658294|ref|YP_002380.1| chorismate mutase and prephenate de...   246   6e-63   
gi|294827827|ref|NP_711437.2| bifunctional prephenate dehydratas...   246   6e-63   
gi|498046542|ref|WP_010360698.1| prephenate dehydratase [Neisser...   246   7e-63   
gi|239905173|ref|YP_002951912.1| chorismate mutase/prephenate de...   246   7e-63   
gi|491038523|ref|WP_004900192.1| chorismate mutase [Acinetobacte...   246   7e-63   
gi|490783401|ref|WP_004645570.1| chorismate mutase [Acinetobacte...   246   7e-63   
gi|490404802|ref|WP_004278987.1| prephenate dehydratase [Acineto...   246   7e-63   
gi|225849791|ref|YP_002730025.1| chorismate mutase/prephenate de...   246   7e-63   
gi|148653054|ref|YP_001280147.1| chorismate mutase [Psychrobacte...   246   7e-63   
gi|447204033|ref|WP_001281289.1| bifunctional prephenate dehydra...   246   7e-63   
gi|490869587|ref|WP_004731602.1| chorismate mutase [Acinetobacte...   246   8e-63   
gi|498261372|ref|WP_010575528.1| chorismate mutase and prephenat...   246   8e-63   
gi|491030836|ref|WP_004892523.1| chorismate mutase [Acinetobacte...   246   8e-63   
gi|320353118|ref|YP_004194457.1| chorismate mutase [Desulfobulbu...   246   8e-63   
gi|447204038|ref|WP_001281294.1| bifunctional prephenate dehydra...   246   8e-63   
gi|491321039|ref|WP_005179005.1| chorismate mutase [Acinetobacte...   246   9e-63   
gi|489850552|ref|WP_003754233.1| prephenate dehydratase [Neisser...   246   9e-63   
gi|495337863|ref|WP_008062599.1| prephenate dehydratase [Methylo...   246   9e-63   
gi|497791347|ref|WP_010105531.1| chorismate mutase [Burkholderia...   246   1e-62   
gi|171057649|ref|YP_001789998.1| chorismate mutase [Leptothrix c...   246   1e-62   
gi|494490894|ref|WP_007280364.1| prephenate dehydratase [Lentisp...   246   1e-62   
gi|495869501|ref|WP_008594080.1| chorismate mutase [Leptospira l...   246   1e-62   
gi|507524619|ref|YP_008046232.1| chorismate mutase [Spiribacter ...   246   1e-62   
gi|385854611|ref|YP_005901124.1| chorismate mutase/prephenate de...   246   1e-62   
gi|493505836|ref|WP_006460273.1| prephenate dehydratase [Thioalk...   245   1e-62   
gi|51246023|ref|YP_065907.1| P-protein [Desulfotalea psychrophil...   245   1e-62   
gi|491076777|ref|WP_004938399.1| chorismate mutase [Acinetobacte...   245   1e-62   
gi|469817904|ref|YP_007589988.1| chorismate mutase, clade 2 [Rho...   245   1e-62   
gi|488172069|ref|WP_002243277.1| prephenate dehydratase [Neisser...   245   1e-62   
gi|489043139|ref|WP_002953439.1| P-protein [Campylobacter showae...   245   1e-62   
gi|91784816|ref|YP_560022.1| prephenate dehydratase / chorismate...   245   1e-62   
gi|493250332|ref|WP_006218203.1| chorismate mutase [Achromobacte...   245   1e-62   
gi|186475506|ref|YP_001856976.1| chorismate mutase [Burkholderia...   245   1e-62   
gi|447204036|ref|WP_001281292.1| bifunctional prephenate dehydra...   245   2e-62   
gi|495806584|ref|WP_008531163.1| Chorismate mutase I / Prephenat...   245   2e-62   
gi|491301781|ref|WP_005159784.1| chorismate mutase [Acinetobacte...   245   2e-62   
gi|494442369|ref|WP_007235648.1| prephenate dehydratase [marine ...   245   2e-62   
gi|224369346|ref|YP_002603510.1| PheA [Desulfobacterium autotrop...   245   2e-62   
gi|8134631|sp|Q9ZHY3.2|PHEA_NEIG1 RecName: Full=P-protein; Inclu...   244   2e-62   
gi|161870628|ref|YP_001599801.1| chorismate mutase [Neisseria me...   244   2e-62   
gi|490889268|ref|WP_004751221.1| chorismate mutase [Acinetobacte...   244   2e-62   
gi|491436953|ref|WP_005294746.1| chorismate mutase [Acinetobacte...   244   2e-62   
gi|59801848|ref|YP_208560.1| chorismate mutase [Neisseria gonorr...   244   2e-62   
gi|498166399|ref|WP_010480555.1| prephenate dehydratase [Pseudom...   244   2e-62   
gi|497168179|ref|WP_009495044.1| Chorismate mutase I / Prephenat...   244   2e-62   
gi|386719056|ref|YP_006185382.1| chorismate mutase I [Stenotroph...   244   2e-62   
gi|489791662|ref|WP_003695553.1| prephenate dehydratase [Neisser...   244   2e-62   
gi|491357990|ref|WP_005215908.1| chorismate mutase [Acinetobacte...   244   2e-62   
gi|491384043|ref|WP_005241924.1| prephenate dehydratase [Acineto...   244   2e-62   
gi|491346327|ref|WP_005204264.1| chorismate mutase [Acinetobacte...   244   3e-62   
gi|491295550|ref|WP_005153565.1| chorismate mutase [Acinetobacte...   244   3e-62   
gi|495540578|ref|WP_008265157.1| prephenate dehydratase [Stenotr...   244   3e-62   
gi|190574991|ref|YP_001972836.1| bifunctional chorismate mutase/...   244   3e-62   
gi|344207957|ref|YP_004793098.1| chorismate mutase [Stenotrophom...   244   3e-62   
gi|491552591|ref|WP_005410182.1| prephenate dehydratase [Stenotr...   244   3e-62   
gi|488083451|ref|WP_002154848.1| putative chorismate mutase [Lep...   244   3e-62   
gi|491100694|ref|WP_004962294.1| chorismate mutase [Acinetobacte...   244   3e-62   
gi|493497922|ref|WP_006452477.1| chorismate mutase [Stenotrophom...   244   3e-62   
gi|490578739|ref|WP_004443759.1| putative chorismate mutase [Lep...   244   3e-62   
gi|385340627|ref|YP_005894499.1| chorismate mutase/prephenate de...   244   3e-62   
gi|488169097|ref|WP_002240305.1| prephenate dehydratase [Neisser...   244   3e-62   
gi|446219732|ref|WP_000297587.1| bifunctional prephenate dehydra...   244   3e-62   
gi|372488590|ref|YP_005028155.1| chorismate mutase, clade 2 [Dec...   244   3e-62   
gi|238026532|ref|YP_002910763.1| Prephenate dehydratase [Burkhol...   244   3e-62   
gi|194366312|ref|YP_002028922.1| chorismate mutase [Stenotrophom...   244   3e-62   
gi|490562387|ref|WP_004427434.1| putative chorismate mutase [Lep...   244   3e-62   
gi|488173239|ref|WP_002244447.1| chorismate mutase [Neisseria me...   244   3e-62   
gi|491511558|ref|WP_005369192.1| prephenate dehydratase [Methylo...   244   3e-62   
gi|491559711|ref|WP_005417297.1| chorismate mutase [Stenotrophom...   244   3e-62   
gi|496981210|ref|WP_009426687.1| chorismate mutase [Neisseria sp...   244   3e-62   
gi|489779276|ref|WP_003683167.1| prephenate dehydratase [Neisser...   244   3e-62   
gi|296136326|ref|YP_003643568.1| chorismate mutase [Thiomonas in...   244   3e-62   
gi|488190606|ref|WP_002261814.1| prephenate dehydratase [Neisser...   244   3e-62   
gi|491362360|ref|WP_005220272.1| prephenate dehydratase [Marichr...   244   3e-62   
gi|410694137|ref|YP_003624759.1| P-protein [Includes: Chorismate...   244   3e-62   
gi|490589147|ref|WP_004454167.1| putative chorismate mutase [Lep...   244   3e-62   
gi|497535058|ref|WP_009849256.1| chorismate mutase/prephenate de...   244   3e-62   
gi|505587841|ref|WP_015680371.1| chorismate mutase [Leptospira w...   244   4e-62   
gi|488105851|ref|WP_002177248.1| putative chorismate mutase [Lep...   244   4e-62   
gi|333907592|ref|YP_004481178.1| chorismate mutase [Marinomonas ...   244   4e-62   
gi|162456114|ref|YP_001618481.1| chorismate mutase [Sorangium ce...   244   4e-62   
gi|71906871|ref|YP_284458.1| prephenate dehydratase [Dechloromon...   244   4e-62   
gi|489777179|ref|WP_003681071.1| prephenate dehydratase [Neisser...   244   4e-62   
gi|490555256|ref|WP_004420342.1| putative chorismate mutase [Lep...   244   4e-62   
gi|490910646|ref|WP_004772565.1| chorismate mutase [Acinetobacte...   244   4e-62   
gi|297538380|ref|YP_003674149.1| chorismate mutase [Methylotener...   243   4e-62   
gi|494325617|ref|WP_007180883.1| chorismate mutase [Burkholderia...   243   4e-62   
gi|340782130|ref|YP_004748737.1| chorismate mutase I / Prephenat...   243   5e-62   
gi|429462688|ref|YP_007184151.1| chorismate mutase / prephenate ...   243   5e-62   
gi|489036942|ref|WP_002947284.1| chloride transporter [Campyloba...   243   5e-62   
gi|491049976|ref|WP_004911627.1| prephenate dehydratase [Acineto...   243   5e-62   
gi|488178795|ref|WP_002250003.1| chorismate mutase [Neisseria me...   243   5e-62   
gi|497101633|ref|WP_009470320.1| prephenate dehydratase [gamma p...   243   6e-62   
gi|495522497|ref|WP_008247142.1| prephenate dehydratase [gamma p...   243   6e-62   
gi|495711873|ref|WP_008436452.1| prephenate dehydratase [Rhodano...   243   6e-62   
gi|498264347|ref|WP_010578503.1| bifunctional prephenate dehydra...   243   6e-62   
gi|497355207|ref|WP_009669420.1| prephenate dehydratase [gamma p...   243   6e-62   
gi|489842323|ref|WP_003746022.1| prephenate dehydratase [Neisser...   243   7e-62   
gi|497733387|ref|WP_010047571.1| prephenate dehydratase [Gemmata...   243   7e-62   
gi|456063815|ref|YP_007502785.1| chorismate mutase [beta proteob...   243   8e-62   
gi|495144676|ref|WP_007869483.1| chorismate mutase [Polaromonas ...   243   8e-62   
gi|90021792|ref|YP_527619.1| prephenate dehydratase [Saccharopha...   243   8e-62   
gi|490817594|ref|WP_004679698.1| prephenate dehydratase [Acineto...   243   8e-62   
gi|490937452|ref|WP_004799289.1| chorismate mutase [Acinetobacte...   243   8e-62   
gi|299769374|ref|YP_003731400.1| P-protein [Acinetobacter oleivo...   243   8e-62   
gi|489772785|ref|WP_003676687.1| prephenate dehydratase [Neisser...   243   9e-62   
gi|497544311|ref|WP_009858509.1| chorismate mutase [Rubrivivax b...   243   9e-62   
gi|489895688|ref|WP_003799136.1| chorismate mutase [Alcaligenes ...   243   9e-62   
gi|490409847|ref|WP_004282841.1| prephenate dehydratase [Neisser...   242   1e-61   
gi|494502564|ref|WP_007292025.1| prephenate dehydratase [delta p...   242   1e-61   
gi|6449095|gb|AAF08824.1|AF194079_11 PheA [Neisseria meningitidis]    242   1e-61   
gi|463295039|gb|EMJ63948.1| putative chorismate mutase [Leptospi...   242   1e-61   
gi|296413004|ref|XP_002836208.1| hypothetical protein [Tuber mel...   242   1e-61   
gi|488173650|ref|WP_002244858.1| chorismate mutase [Neisseria me...   242   1e-61   
gi|490799767|ref|WP_004661904.1| chorismate mutase [Acinetobacte...   242   1e-61   
gi|494850336|ref|WP_007576436.1| chorismate mutase [Burkholderia...   242   1e-61   
gi|451823139|ref|YP_007459413.1| prephenate dehydratase [Candida...   242   1e-61   
gi|91787674|ref|YP_548626.1| chorismate mutase/prephenate dehydr...   242   1e-61   
gi|257094471|ref|YP_003168112.1| chorismate mutase [Candidatus A...   242   1e-61   
gi|330815893|ref|YP_004359598.1| Prephenate dehydratase [Burkhol...   242   1e-61   
gi|490791771|ref|WP_004653917.1| chorismate mutase [Acinetobacte...   242   2e-61   
gi|490639596|ref|WP_004504594.1| chorismate mutase [Leptospira w...   241   2e-61   
gi|50085331|ref|YP_046841.1| bifuctional chorismate mutase P/pre...   241   2e-61   
gi|491187751|ref|WP_005046108.1| chorismate mutase [Acinetobacte...   241   2e-61   
gi|496201568|ref|WP_008921405.1| chorismate mutase [Burkholderia...   241   2e-61   
gi|187924982|ref|YP_001896624.1| chorismate mutase [Burkholderia...   241   2e-61   
gi|491329915|ref|WP_005187876.1| chorismate mutase [Acinetobacte...   241   2e-61   
gi|152996870|ref|YP_001341705.1| chorismate mutase [Marinomonas ...   241   2e-61   
gi|514355834|ref|WP_016547549.1| chorismate mutase [Leptospira f...   241   2e-61   
gi|491161202|ref|WP_005019589.1| prephenate dehydratase [Acineto...   241   2e-61   
gi|488708082|ref|WP_002632011.1| putative chorismate mutase [Lep...   241   2e-61   
gi|491168335|ref|WP_005026705.1| prephenate dehydratase [Acineto...   241   3e-61   
gi|408419446|ref|YP_006760860.1| bifunctional chorismate mutase/...   241   3e-61   
gi|495489192|ref|WP_008213875.1| prephenate dehydratase [Rhodano...   241   3e-61   
gi|498051041|ref|WP_010365197.1| prephenate dehydratase [Xanthom...   241   3e-61   
gi|511756367|ref|WP_016389687.1| prephenate dehydratase domain-c...   241   3e-61   
gi|497235528|ref|WP_009549790.1| chorismate mutase [Burkholderia...   241   3e-61   
gi|490639163|ref|WP_004504161.1| putative chorismate mutase [Lep...   241   3e-61   
gi|490634042|ref|WP_004499042.1| putative chorismate mutase [Lep...   241   3e-61   
gi|169795337|ref|YP_001713130.1| bifunctional chorismate mutase ...   241   3e-61   
gi|407715946|ref|YP_006837226.1| prephenate dehydratase domain-c...   241   3e-61   
gi|491200403|ref|WP_005058746.1| chorismate mutase [Acinetobacte...   241   3e-61   
gi|334143913|ref|YP_004537069.1| chorismate mutase [Thioalkalimi...   241   3e-61   
gi|446529017|ref|WP_000606363.1| Prephenate dehydratase [Acineto...   241   3e-61   
gi|496497647|ref|WP_009206183.1| prephenate dehydratase [Sulfuri...   240   4e-61   
gi|493340252|ref|WP_006297156.1| chorismate mutase [Hylemonella ...   240   4e-61   
gi|495567696|ref|WP_008292275.1| prephenate dehydratase [Methylo...   240   4e-61   
gi|489065245|ref|WP_002975260.1| chorismate mutase [Leptospira t...   240   4e-61   
gi|494142126|ref|WP_007081875.1| prephenate dehydratase [Rhodano...   240   4e-61   
gi|495439324|ref|WP_008164019.1| chorismate mutase [Achromobacte...   240   5e-61   
gi|496407692|ref|WP_009116556.1| prephenate dehydratase [Neisser...   240   5e-61   
gi|490776510|ref|WP_004638697.1| prephenate dehydratase [Acineto...   240   5e-61   
gi|296122297|ref|YP_003630075.1| prephenate dehydratase [Plancto...   240   5e-61   
gi|490808623|ref|WP_004670744.1| chorismate mutase [Acinetobacte...   240   5e-61   


>gi|384492980|gb|EIE83471.1| hypothetical protein RO3G_08176 [Rhizopus delemar RA 99-880]
          Length = 366

 Score =  422 bits (1085), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 201/360 (55%), Positives = 272/360 (75%), Gaps = 3/360 (0%)

Query: 7   TFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYX---XXXXXXXVYVSGKENQIFDRI 63
           +  ++IDS+DT LV +L+ERARVSL++  AK+ +            VY  G+E +I++++
Sbjct: 6   SLRKKIDSLDTTLVNILSERARVSLDIGAAKKKATTGIVDEENDVHVYRPGREKEIYEKL 65

Query: 64  HRLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPK 123
            RLN GPL++ESL +I++EI+SAS++ QKD+SIAY GP G+++HQAA  RFGDS+ Y+P+
Sbjct: 66  SRLNQGPLNNESLHAIFREIMSASIALQKDISIAYLGPSGTFSHQAAYNRFGDSVAYVPQ 125

Query: 124 STINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS 183
             I+D+FD+VEKG TTYGI+PFENST+G+VV TLDRFIS    + AETYL +  CLLS S
Sbjct: 126 KQISDVFDAVEKGQTTYGIIPFENSTFGTVVETLDRFISSTVRVRAETYLTVHQCLLSNS 185

Query: 184 KFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAE 243
           K   I KVYSHPQG GQ QK+L +H+  A+RI   ST++AAE AA E  +AA+ S  CAE
Sbjct: 186 KLDKITKVYSHPQGLGQTQKWLSAHIPNARRITVKSTAEAAEKAALETGAAAVCSEICAE 245

Query: 244 LYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKD 303
           LYGLE +  +I+D   N TRF I+G++S+ P+ +D T I FTVDH++PGALCDGL VFKD
Sbjct: 246 LYGLETIESNIEDGSANKTRFLIIGTASDSPTQDDHTLITFTVDHRQPGALCDGLKVFKD 305

Query: 304 HGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYPDQRP 363
           +G+NL KIDSRPS Q+PWHYVFFVE  GH E+E ++ A+  ++ +CLDV +LGS+P+QRP
Sbjct: 306 YGLNLFKIDSRPSGQRPWHYVFFVECSGHFENEDMKSAIKDLDNYCLDVVVLGSFPNQRP 365



>gi|511008926|gb|EPB90181.1| hypothetical protein HMPREF1544_03015 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 374

 Score =  408 bits (1049), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 201/367 (54%), Positives = 264/367 (71%), Gaps = 11/367 (2%)

Query: 8   FSQQIDSIDTKLVQLLNERARVSLNLEKAKE---GSYXXXXXXXXVYVSGKENQIFDRIH 64
             Q+IDS+DT LV +LNERARVSL++  AK    G+         V+  G+E +I+ ++ 
Sbjct: 7   LRQKIDSLDTTLVNILNERARVSLDIGAAKRKDTGAQETAEADVQVFRPGREKEIYKKLT 66

Query: 65  RLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKS 124
           RLN+GPL+ +SL +I++EI+SAS++ QKD+SIAY GP G+++HQAA  R GDS+ Y+P+ 
Sbjct: 67  RLNSGPLNDDSLHAIFREIMSASIALQKDVSIAYLGPPGTFSHQAAYKRLGDSVAYVPQK 126

Query: 125 TI--------NDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRIS 176
            I        N    +VEKG TTYGIVPFENST+GSVV TLD FI     + AETYL + 
Sbjct: 127 QIDGKSCNNPNYALYAVEKGQTTYGIVPFENSTFGSVVETLDYFIHTSVRVRAETYLTVH 186

Query: 177 HCLLSKSKFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAI 236
            CLLS SK   I KVYSHPQG GQ QK+L +H+  A+RI   ST++AAE AA E  +AA+
Sbjct: 187 QCLLSNSKLDKITKVYSHPQGLGQTQKWLSAHIPNAKRIAVKSTAEAAEKAALETGAAAV 246

Query: 237 ASITCAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCD 296
            S  CAELYGLE++  +I+D   N TRF ++G++S+ P+ +D T I FTVDH++PGALCD
Sbjct: 247 CSEICAELYGLEIVEANIEDLAANTTRFLLIGAASDSPTNDDHTLITFTVDHRQPGALCD 306

Query: 297 GLSVFKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILG 356
           GL VFKD+G+NL KIDSRPS Q+PWHYVFFVE  GH E E ++KAL  + EFCLD+ +LG
Sbjct: 307 GLKVFKDYGLNLFKIDSRPSGQRPWHYVFFVECSGHFESEDIKKALKDLEEFCLDIVVLG 366

Query: 357 SYPDQRP 363
           S+P+QRP
Sbjct: 367 SFPNQRP 373



>gi|494660458|ref|WP_007418402.1| prephenate dehydratase [Pedosphaera parvula]
 gi|223891037|gb|EEF57540.1| chorismate mutase [bacterium Ellin514]
          Length = 353

 Score =  314 bits (804), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 155/353 (43%), Positives = 226/353 (64%), Gaps = 11/353 (3%)

Query: 10  QQIDSIDTKLVQLLNERARVSLNLE--KAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLN 67
           + IDS+D ++V+LLNER +  L +   K K G          +Y   +E  + +RI +LN
Sbjct: 8   KAIDSLDAQIVKLLNERTKHVLEIGDIKLKAGE--------EIYAPHRERAVLERICKLN 59

Query: 68  NGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTIN 127
           +GP+++ESL +IY+E++S+++S +K ++IAY GP  ++THQAAI RFG S+ Y  + T+ 
Sbjct: 60  HGPITNESLRAIYREVMSSALSLEKSMTIAYLGPEATFTHQAAIRRFGASLKYSAQKTVA 119

Query: 128 DIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKSKFSS 187
           D+F  V K    YG+VP ENST G V  TLD F+     I+A+  L I HCL+S  K   
Sbjct: 120 DVFSEVTKNRADYGVVPIENSTEGVVTHTLDMFVDSDLKIVAQIVLPIQHCLVSTCKREQ 179

Query: 188 INKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGL 247
           I K+YSHPQ  GQC+ ++ +HL  A+ I+  S +++AE AA E  SAAIA    AE YGL
Sbjct: 180 IKKLYSHPQSLGQCRIWVQTHLPNAEIIETSSNARSAEFAAKEKNSAAIAGSLAAEHYGL 239

Query: 248 EVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGIN 307
            +L  DIQD   N TRF +LG     P+G D+T I+ ++ H+  GAL   L+ F+   +N
Sbjct: 240 RILESDIQDNSANATRFLVLGRQCSPPTGKDRTSIMLSLSHE-VGALYKALAAFRRFKLN 298

Query: 308 LLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYPD 360
           + KI+SRPS ++ W Y FFV+ +GHKED+ V KA+ ++ + C  VK+LGSYP+
Sbjct: 299 MTKIESRPSKRKAWEYYFFVDCEGHKEDKRVAKAIVELQKECNFVKVLGSYPN 351



>gi|383766274|ref|YP_005445255.1| chorismate mutase/prephenate dehydratase [Phycisphaera mikurensis
           NBRC 102666]
 gi|504249475|ref|WP_014436577.1| chorismate mutase [Phycisphaera mikurensis]
 gi|381386542|dbj|BAM03358.1| chorismate mutase/prephenate dehydratase [Phycisphaera mikurensis
           NBRC 102666]
          Length = 370

 Score =  313 bits (802), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 151/350 (43%), Positives = 221/350 (63%), Gaps = 6/350 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID++D K+V LLN RARV + + + K            +Y   +E  + +++ +LN+GP
Sbjct: 24  EIDALDEKIVGLLNARARVVVKVGEVKRAG----GEDVPIYAPDREQAVLEKVRKLNHGP 79

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L    L ++++E++S S + ++ L I Y GP GS++H AA+ +FG S+ Y   S    IF
Sbjct: 80  LPDRCLEAVWRELMSGSFALERPLRIGYLGPAGSFSHLAAVSKFGQSVEYDELSDFPAIF 139

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKSKFSSINK 190
           D+V +GH  YG++P ENST+G V  +LD F+     + AE  L I H LLS+     I  
Sbjct: 140 DAVARGHADYGLIPIENSTHGGVTASLDCFLESGVPVCAEILLPIHHNLLSRVPLERIKT 199

Query: 191 VYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEP-YSAAIASITCAELYGLEV 249
           VYSHPQ  GQCQ++L + L  A+R+DA S+S+AA I A  P  SAAI S   ++LY L V
Sbjct: 200 VYSHPQVLGQCQRWLTAQLPHAKRLDAASSSQAARIVAENPSESAAIGSTLASQLYRLPV 259

Query: 250 LGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINLL 309
           L  +I+D  NN TRF I+G  S +P+G DKT ++FT +H R GAL D L+VF+DHG+NL 
Sbjct: 260 LFDNIEDNPNNTTRFSIIGRQSPRPTGEDKTALVFTTEH-RAGALTDVLNVFRDHGLNLT 318

Query: 310 KIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           ++  RPS +  W Y FF++L GH E+  V+ AL++    CL +K+LGS+P
Sbjct: 319 RLAERPSQRMNWEYYFFIDLLGHAEEPEVKAALDEARGHCLQLKVLGSFP 368



>gi|497198983|ref|WP_009513245.1| prephenate dehydratase [Opitutaceae bacterium TAV5]
 gi|372471805|gb|EHP31817.1| chorismate mutase [Opitutaceae bacterium TAV5]
          Length = 361

 Score =  294 bits (753), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 147/364 (40%), Positives = 220/364 (60%), Gaps = 11/364 (3%)

Query: 1   MENVDLTFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIF 60
           M +  L   + ID +D ++V+LLN+R      L  A E           +YV  +E+ + 
Sbjct: 1   MSDPLLPLRENIDRLDRQIVELLNQR------LAHATEIGRHKRSTGGQIYVPEREDAVL 54

Query: 61  DRIHRLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINY 120
            ++   N GP+  E+L +IY EI+SA+++ +K L IAY GP  + THQAA+ +FG S++Y
Sbjct: 55  RKVVSFNQGPIKDEALRAIYSEIMSAAIALEKPLRIAYLGPEATNTHQAALKKFGASVDY 114

Query: 121 LPKSTINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL 180
           L  +T  DIF SVEKG T YGI+P ENST GSV   LD+F++    ++A+T+L I++CL+
Sbjct: 115 LALTTFADIFTSVEKGETDYGIIPIENSTEGSVRDALDQFVTSDLKVVAQTHLEIAYCLI 174

Query: 181 SKSKFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASIT 240
           ++     I +V S  Q   QC+ +L SHL  A  +DA ST++A +IA +EP  AA+A+  
Sbjct: 175 TREPLEKITRVLSKDQALAQCRLWLQSHLPHATLVDAPSTARAVQIAGAEPGVAAVATEL 234

Query: 241 CAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKP--SGNDKTFILFTVDHQ---RPGALC 295
            A  Y + +  K+IQD   N TRFF++G     P   G D T +L ++  +   +PGAL 
Sbjct: 235 AATHYNVPIAAKNIQDKAGNTTRFFVIGKKPTGPVGGGRDMTSLLISLGEEGSVQPGALL 294

Query: 296 DGLSVFKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKIL 355
             L  F   GINL KI+SRPS  +PW Y F++++ GH  D ++++A+ ++  FC  VK L
Sbjct: 295 RMLDPFAKRGINLSKIESRPSKLRPWDYYFYLDVTGHYSDALMKEAVAELRTFCPLVKWL 354

Query: 356 GSYP 359
           GSYP
Sbjct: 355 GSYP 358



>gi|512551870|ref|YP_008089776.1| chorismate mutase [Chthonomonas calidirosea T49]
 gi|512725190|ref|WP_016483197.1| chorismate mutase [Chthonomonas calidirosea]
 gi|510023616|emb|CCW35671.1| chorismate mutase [Chthonomonas calidirosea T49]
          Length = 354

 Score =  293 bits (750), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 144/354 (40%), Positives = 224/354 (63%), Gaps = 8/354 (2%)

Query: 8   FSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLN 67
           + ++ID ID +++ LLN RA ++  +  AK  +          +   +E+ +F R+ ++N
Sbjct: 6   WRKEIDQIDEQILHLLNRRAELARQIGHAKSRT------RSHYFTPEREHTVFRRLVQMN 59

Query: 68  NGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTIN 127
            GPL ++++ +IY+EIISA  + +K L++A+ GP G+++H A I RFG S  ++P   I 
Sbjct: 60  PGPLEAQAVRAIYREIISACRALEKPLTVAFLGPEGTFSHLAGIARFGSSSEFVPVERIA 119

Query: 128 DIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSK-SKFS 186
           D+F  VE+G   YG+VP ENS  G+V  TLD F++    ++ E Y  I H LLS+ +   
Sbjct: 120 DVFAQVERGLCDYGVVPVENSWAGAVPETLDSFLNSNLRVVWEIYQPIYHNLLSRCTSLE 179

Query: 187 SINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYG 246
            I ++YSH Q   QC+++L +HL   + I+A ST+KAAE+A+ +P SAAIA+   AE Y 
Sbjct: 180 EIKRLYSHFQPLAQCRQWLRNHLPHVEEIEASSTAKAAELASRDPESAAIATYLAAEKYD 239

Query: 247 LEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGI 306
           L +L + I+D   N TRF +LG +  +P+G DKT ++FTV + R G L   L+ F+ + +
Sbjct: 240 LPILCEHIEDDPTNRTRFLVLGYNEPEPTGKDKTSLIFTVPN-RAGELAHALNAFEKYDV 298

Query: 307 NLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYPD 360
           NL  I++RP+   PW Y F+V+LQGH +D  V KALN + E  L V++LGSYP+
Sbjct: 299 NLTMIETRPTRSAPWQYFFYVDLQGHVKDTAVSKALNLLKEHSLFVRVLGSYPE 352



>gi|494604817|ref|WP_007363065.1| prephenate dehydratase [Opitutaceae bacterium TAV1]
 gi|391221687|gb|EIQ00108.1| chorismate mutase, clade 2 [Opitutaceae bacterium TAV1]
          Length = 361

 Score =  292 bits (748), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 146/357 (40%), Positives = 217/357 (60%), Gaps = 11/357 (3%)

Query: 8   FSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLN 67
             + ID +D ++V+LLN+R      L  A E           +YV  +E+ +  ++   N
Sbjct: 8   LRENIDRLDRQIVELLNQR------LAHATEIGRHKRSTGGQIYVPEREDAVLRKVVSFN 61

Query: 68  NGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTIN 127
            GP+  E+L +IY EI+SA+++ +K L IAY GP  + THQAA+ +FG S++YL  +T  
Sbjct: 62  QGPIKDEALRAIYSEIMSAAIALEKPLRIAYLGPEATNTHQAALKKFGASVDYLALTTFA 121

Query: 128 DIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKSKFSS 187
           DIF SVEKG T YGI+P ENST GSV   LD+F++    I+A+T+L I++CL+++     
Sbjct: 122 DIFTSVEKGETDYGIIPIENSTEGSVRDALDQFVTSGLKIVAQTHLEIAYCLITREPLEK 181

Query: 188 INKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGL 247
           I +V S  Q   QC+ +L SHL  A  +DA ST++A +IA +EP  AA+A+   A  Y +
Sbjct: 182 ITRVLSKDQALAQCRLWLQSHLPHATLVDAPSTARAVQIAGAEPGVAAVATELAATHYNV 241

Query: 248 EVLGKDIQDAKNNVTRFFILGSSSEKP--SGNDKTFILFTVDHQ---RPGALCDGLSVFK 302
            +  K+IQD   N TRFF++G     P   G D T +L ++  +   +PGAL   L  F 
Sbjct: 242 PIAAKNIQDKAGNTTRFFVIGKKPTGPVGGGRDMTSLLISLGEEGSVQPGALLRMLDPFA 301

Query: 303 DHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
             GINL KI+SRPS  +PW Y F++++ GH  D ++++A+ ++  FC  VK LGSYP
Sbjct: 302 KRGINLSKIESRPSKLRPWDYYFYLDVTGHYSDALMKEAVAELRTFCPLVKWLGSYP 358



>gi|15606269|ref|NP_213648.1| chorismate mutase/prephenate dehydratase [Aquifex aeolicus VF5]
 gi|499183046|ref|WP_010880586.1| chorismate mutase/prephenate dehydratase [Aquifex aeolicus]
 gi|8134616|sp|O67085.1|PHEA_AQUAE RecName: Full=P-protein; Includes: RecName: Full=Chorismate mutase;
           Short=CM; Includes: RecName: Full=Prephenate
           dehydratase; Short=PDT
 gi|2983461|gb|AAC07041.1| chorismate mutase/prephenate dehydratase [Aquifex aeolicus VF5]
          Length = 362

 Score =  291 bits (745), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 155/357 (43%), Positives = 221/357 (61%), Gaps = 12/357 (3%)

Query: 8   FSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLN 67
             ++ID ID ++++LLNERA+++  + + K  +         ++V  +E +IF++I RLN
Sbjct: 7   LRKEIDRIDEEILRLLNERAKLAKRIGEIKSKA------NLPIHVPEREREIFEKILRLN 60

Query: 68  N----GPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPK 123
                G    E+LV IY+EIISA +S +K + +AY GP  ++THQAA+  FG S +Y P 
Sbjct: 61  KEVYGGVFPQEALVHIYREIISACLSLEKKIKVAYLGPKATFTHQAALEFFGFSAHYTPC 120

Query: 124 STINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS 183
           STI D+F  VE     YG+VP EN+  G V  TLD F+     I  E  + I+  LLS S
Sbjct: 121 STIRDVFVEVETKRADYGVVPVENTIEGVVNYTLDMFLESDVKIAGEIVIPITLHLLSAS 180

Query: 184 -KFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCA 242
               ++ KVYSH     QC+ +L+ +L   Q I+  ST+KA EIA  +  + A+AS   A
Sbjct: 181 DSIENVEKVYSHKMALAQCRSWLEKNLPSVQVIEVESTAKACEIALEDERAGAVASEVAA 240

Query: 243 ELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFK 302
             Y L +L ++IQD+ +N TRF ++     KP+G+DKT ILF V  + PGAL   L VF 
Sbjct: 241 YTYHLNILARNIQDSGDNFTRFLVIAKRDLKPTGSDKTSILFGVKDE-PGALYKALEVFY 299

Query: 303 DHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            HGINL KI+SRPS ++ W YVFFV+L+GHKE+E V+KAL ++ E    +K+LGSYP
Sbjct: 300 KHGINLTKIESRPSKKKAWDYVFFVDLEGHKEEERVEKALKELKEKTQFLKVLGSYP 356



>gi|302341917|ref|YP_003806446.1| prephenate dehydratase [Desulfarculus baarsii DSM 2075]
 gi|503022332|ref|WP_013257308.1| prephenate dehydratase [Desulfarculus baarsii]
 gi|301638530|gb|ADK83852.1| prephenate dehydratase [Desulfarculus baarsii DSM 2075]
          Length = 410

 Score =  289 bits (740), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 152/355 (42%), Positives = 211/355 (59%), Gaps = 8/355 (2%)

Query: 10  QQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNG 69
           Q+ID ID ++V LLNERA  ++ + ++K             +   +E  I D + R N G
Sbjct: 53  QRIDEIDRQIVDLLNERALCAMAIGRSKNAGGLPE------FAPEREQAIIDALERHNQG 106

Query: 70  PLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDI 129
           PLS +SL  I+ EIISA  + Q+ L +A+ GP  +++HQAA+  FG S  + P  +I D+
Sbjct: 107 PLSGQSLRGIFAEIISACRAVQRPLRVAFLGPATTFSHQAAMRHFGSSCEFAPHRSIIDV 166

Query: 130 FDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSK-SKFSSI 188
           F  VE+ H   G+VP ENS+ G V  TLD F+    ++  E Y RIS  L+SK +    I
Sbjct: 167 FHEVERSHAQVGVVPVENSSEGQVSVTLDLFLESDLNVCGEIYARISQVLMSKEAAIEGI 226

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            +VYSHPQ   QC+ +L  ++  A  I++ ST+ AA+ AA E  SAA+ SI  A   GL 
Sbjct: 227 QRVYSHPQALNQCRNWLARNMPMATLIESTSTAAAAQKAAQEDGSAAVGSILAARQGGLN 286

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L  DIQD  +N TRFF++G     P+GNDKT ILF V H +PG L   L  F D GINL
Sbjct: 287 ALAIDIQDNPHNTTRFFVIGRQKCPPTGNDKTSILF-VTHHKPGMLFSALKHFADSGINL 345

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYPDQRP 363
            +I+SRP    PW YVFF+++ GH ED  V++ +N ++E    +K+LGSYP   P
Sbjct: 346 TRIESRPLKNTPWEYVFFIDMAGHVEDAQVRQVINTLDEETRLLKVLGSYPMGEP 400



>gi|182414836|ref|YP_001819902.1| chorismate mutase [Opitutus terrae PB90-1]
 gi|501344196|ref|WP_012375831.1| prephenate dehydratase [Opitutus terrae]
 gi|177842050|gb|ACB76302.1| chorismate mutase [Opitutus terrae PB90-1]
          Length = 360

 Score =  288 bits (736), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 151/362 (41%), Positives = 224/362 (61%), Gaps = 18/362 (4%)

Query: 7   TFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRL 66
              ++ID++D ++V +LNER +++  + K K            +YV+ +E  +  ++   
Sbjct: 5   AIREKIDALDREMVAVLNERLKLAAEIGKLKRSQ------GGQIYVAEREEAVLRKVIEQ 58

Query: 67  NNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTI 126
           N GP+ +E+L +IY+EI+SA+++ +K L IAY GP  + THQAA+ +FG S++Y   +TI
Sbjct: 59  NQGPIKNEALRAIYREIMSAAIALEKPLLIAYLGPEATNTHQAAMKKFGASVDYHAMATI 118

Query: 127 NDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKSKFS 186
           +DIF +VEKG + YG++P ENST GSV   LD F+     I+A+ YL ISH L+S S   
Sbjct: 119 SDIFTAVEKGESDYGVIPIENSTEGSVRDALDLFVESDLKIVAQIYLEISHHLISNSPLE 178

Query: 187 SINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYG 246
           +I +VYS  Q   QC+ +L  HL  AQ I+A ST++A +IA  EP +AA+A    A  +G
Sbjct: 179 AIERVYSKDQALAQCRHWLQRHLPHAQLIEASSTARAVQIAKEEPGAAAVAGELAATAHG 238

Query: 247 LEVLGKDIQDAKNNVTRFFILGSSSEKPSGN------DKTFILFTVDHQ---RPGALCDG 297
           + ++ K+IQD  +N TRFF++G    KPSG       D T  + ++  Q    PGAL   
Sbjct: 239 VPIVAKNIQDKADNTTRFFVVG---RKPSGRSTGDGKDMTSFVISLGDQASANPGALLKM 295

Query: 298 LSVFKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGS 357
           L    + GINL KI+SRPS ++PW Y FFV++ GH ED  +++AL  +  FC  VK LGS
Sbjct: 296 LMPMAERGINLSKIESRPSKKRPWDYYFFVDVTGHFEDPKMKEALADLQRFCPLVKWLGS 355

Query: 358 YP 359
           YP
Sbjct: 356 YP 357



>gi|404493524|ref|YP_006717630.1| chorismate mutase and prephenate dehydratase [Pelobacter
           carbinolicus DSM 2380]
 gi|499660898|ref|WP_011341632.1| prephenate dehydratase [Pelobacter carbinolicus]
 gi|77545566|gb|ABA89128.1| chorismate mutase and prephenate dehydratase [Pelobacter
           carbinolicus DSM 2380]
          Length = 360

 Score =  287 bits (734), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 159/367 (43%), Positives = 220/367 (59%), Gaps = 12/367 (3%)

Query: 1   MENVDL----TFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKE 56
           ME  DL        +ID+ID +++ LLNERARV+ ++  AK G           Y  G+E
Sbjct: 1   MEKKDLEVLSKLRHKIDTIDDEILDLLNERARVAQDIGHAKAGQ------GLEFYNPGRE 54

Query: 57  NQIFDRIHRLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGD 116
             +F+R+   N+GP  SE++  +Y+EIISAS+S ++ + +A+FGP  ++THQAA  +FG 
Sbjct: 55  LAVFERLIARNSGPFPSEAIRRVYREIISASLSLEQPMKVAFFGPSATFTHQAAQKQFGF 114

Query: 117 SINYLPKSTINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRIS 176
           S   + + +I  +F+ V +G   YG+VP EN+T G V  TLD F+     I AE  L IS
Sbjct: 115 SAQLVAQKSIPAVFEEVRRGRADYGVVPVENTTEGIVSHTLDMFVESDLKINAEILLEIS 174

Query: 177 HCLLSKS-KFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAA 235
           H LLS S K   I KV SHPQ   QC+ +L+ +L +   +DA ST+ AA  AA +   AA
Sbjct: 175 HDLLSLSGKMEDIEKVLSHPQALAQCRHWLEENLPDVPLVDASSTAMAARQAAEDSSVAA 234

Query: 236 IASITCAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALC 295
           IAS   A LYGL ++   IQD  NN+TRF ++G     P+G+DKT +LF V  + PG LC
Sbjct: 235 IASEIAASLYGLRIVKPKIQDNTNNLTRFLVVGRQLTSPTGHDKTSVLFIVADE-PGVLC 293

Query: 296 DGLSVFKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKIL 355
             L  F   GINL KI+SRP   + W Y+FF++L+GH ED  V +AL  +   C   K+L
Sbjct: 294 RMLGPFNKRGINLSKIESRPIKTKAWEYIFFLDLEGHVEDAAVAEALEDLQACCRSFKVL 353

Query: 356 GSYPDQR 362
           GSYP  R
Sbjct: 354 GSYPRCR 360



>gi|357405840|ref|YP_004917764.1| bifunctional chorismate mutase /prephenate dehydratase
           [Methylomicrobium alcaliphilum 20Z]
 gi|503914958|ref|WP_014148952.1| prephenate dehydratase [Methylomicrobium alcaliphilum]
 gi|351718505|emb|CCE24176.1| bifunctional P-protein [Includes: Chorismate mutase (CM);
           Prephenate dehydratase (PDT)] [Methylomicrobium
           alcaliphilum 20Z]
          Length = 361

 Score =  286 bits (733), Expect = 5e-75,   Method: Compositional matrix adjust.
 Identities = 147/352 (41%), Positives = 215/352 (61%), Gaps = 10/352 (2%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAK--EGSYXXXXXXXXVYVSGKENQIFDRIHRLNN 68
           +ID+ID +++QL+N+RA  ++ + K K  EG           Y   +E+ +  R+  LN 
Sbjct: 13  RIDAIDEQILQLINQRASCAIEVAKTKMAEGE------SGCFYRPDRESLVLRRVKALNQ 66

Query: 69  GPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTIND 128
           GPL+ E+ +  ++E++SA ++ +K L +A+ GP G++T QAAI  FG ++N +P  TI +
Sbjct: 67  GPLADETAMRFFRELMSACLALEKPLDVAFLGPEGTFTQQAAIKHFGHAVNAVPAMTIAE 126

Query: 129 IFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSS 187
           IF++VE  H  +G+VP ENST G V  TLDRF+S    I  E  LR+ H L+  +   + 
Sbjct: 127 IFNAVENEHCQFGVVPVENSTEGVVNHTLDRFVSSPLKICGEVELRVHHNLIGNAGSLAD 186

Query: 188 INKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGL 247
           I +V+SH Q   QC+++LD HL +A+R    S  +AA +AA     AAIA    AELYGL
Sbjct: 187 IAEVFSHQQSLAQCRQWLDLHLPDAKRTAVNSNGEAARLAAGSKDKAAIAGKFAAELYGL 246

Query: 248 EVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGIN 307
            V+ ++I+D  NN TRF I+G     P+G DKT +L +  +Q PGAL   L  F  HGI 
Sbjct: 247 SVIERNIEDESNNTTRFIIIGRQISGPTGKDKTSLLVSTGNQ-PGALYRVLEPFAHHGIG 305

Query: 308 LLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           ++ I+SRPS Q  W YVFF++++GH EDE V  AL  +      + ILGSYP
Sbjct: 306 MMHIESRPSRQGLWDYVFFIDIEGHAEDENVAAALKMLGARVSMLNILGSYP 357



>gi|108804084|ref|YP_644021.1| prephenate dehydratase/chorismate mutase [Rubrobacter xylanophilus
           DSM 9941]
 gi|499883493|ref|WP_011564227.1| prephenate dehydratase [Rubrobacter xylanophilus]
 gi|108765327|gb|ABG04209.1| prephenate dehydratase / chorismate mutase [Rubrobacter
           xylanophilus DSM 9941]
          Length = 371

 Score =  286 bits (732), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 141/352 (40%), Positives = 210/352 (59%), Gaps = 8/352 (2%)

Query: 12  IDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGPL 71
           ID ID ++V+LL+ RAR++  + + K             YV  +E  + DR+ R++ G  
Sbjct: 22  IDEIDAEIVRLLDRRARLARKIGEFKR------RNGLEAYVPARERAVLDRVLRISEGDF 75

Query: 72  SSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIFD 131
               L ++++EIIS+S+S ++ + +AY GP  ++TH+AA+  FG S+   P++T++D+F 
Sbjct: 76  PRRGLETVFREIISSSISLEERMKVAYLGPETTFTHEAALRAFGASVELEPQATVSDVFA 135

Query: 132 SVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSSINK 190
            VE+G   +G+VP ENS  G+V  TLD  ++    I  E YL I   LLS+      +  
Sbjct: 136 RVERGEAQHGVVPLENSMEGAVTHTLDELMNSPLKICGEVYLPIMQNLLSREDSLEKVRV 195

Query: 191 VYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLEVL 250
           V SHP    Q   +L  +L  A+  +  ST +AA +AAS P  AA+ S   AE YGL+VL
Sbjct: 196 VCSHPMALAQSAPWLRKNLPAARLQEVESTGEAARMAASRPGFAAVGSALAAESYGLKVL 255

Query: 251 GKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINLLK 310
            + IQDA+ N TRF +LG      +G DKT ++F+V   RPG L D LS F + GINL +
Sbjct: 256 ARGIQDARTNTTRFIVLGRKWAGRTGRDKTSVVFSV-KDRPGVLRDALSAFAEEGINLTR 314

Query: 311 IDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYPDQR 362
           I+SRPS ++ W YVFF + QGH E+E V +AL  + E C  V ++G+YP+ R
Sbjct: 315 IESRPSRKRAWTYVFFADFQGHPEEERVGRALEALEEHCPYVVLIGAYPEAR 366



>gi|217968022|ref|YP_002353528.1| prephenate dehydratase [Dictyoglomus turgidum DSM 6724]
 gi|501579659|ref|WP_012583989.1| prephenate dehydratase [Dictyoglomus turgidum]
 gi|217337121|gb|ACK42914.1| prephenate dehydratase [Dictyoglomus turgidum DSM 6724]
          Length = 356

 Score =  286 bits (732), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 143/355 (40%), Positives = 220/355 (61%), Gaps = 11/355 (3%)

Query: 8   FSQQIDSIDTKLVQLLNERARVSLNLEKAK-EGSYXXXXXXXXVYVSGKENQIFDRIHRL 66
             ++ID +D KL++++N+RA++ L +   K + +Y        ++   +E ++ +R+ + 
Sbjct: 7   LRREIDELDRKLLEIINKRAQIVLQIRNWKIKNNYP-------IFDPSREKELLERLVKE 59

Query: 67  NNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTI 126
           N GPL  ++++ I+K I+S   + +KD+ + Y GP GS+THQAA+  FG+ + + P   +
Sbjct: 60  NQGPLDEKAIIGIFKTIMSYLRALEKDIEVLYLGPEGSFTHQAAVKFFGEGVKFKPLLLV 119

Query: 127 NDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLS-KSKF 185
            DIF S+E+G + Y +VP ENS  G+V +T+D        ++ E YL + H L+S +   
Sbjct: 120 EDIFKSLEEG-SEYAVVPIENSLEGTVGSTMDLLAVTTKKVIGEVYLDVRHSLISSEDSM 178

Query: 186 SSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELY 245
           + + +VYSHPQ   QC+++L  +L   Q I   STS AA+I   E  SAAIAS   AE++
Sbjct: 179 NKVKRVYSHPQALAQCKRWLRQNLPNVQEIPTSSTSFAAKIVKEEKESAAIASNFAAEVF 238

Query: 246 GLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHG 305
           GL +L ++IQD+ NN TRF +LG    KP+G DKT I+F+V HQ  GAL   L    D G
Sbjct: 239 GLNILAENIQDSWNNKTRFLVLGKDIPKPTGKDKTSIIFSVKHQ-AGALYRALRPLHDFG 297

Query: 306 INLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYPD 360
           +N+  I SRP   +P+ Y FFV+ QGH  DE V +AL ++ E C+D KILGSYP+
Sbjct: 298 LNMTLIQSRPVPAKPFEYRFFVDFQGHIWDEKVSQALERVKEECIDFKILGSYPE 352



>gi|206891160|ref|YP_002249554.1| P-protein [Thermodesulfovibrio yellowstonii DSM 11347]
 gi|501541725|ref|WP_012546845.1| prephenate dehydratase [Thermodesulfovibrio yellowstonii]
 gi|206743098|gb|ACI22155.1| P-protein [Thermodesulfovibrio yellowstonii DSM 11347]
          Length = 357

 Score =  286 bits (731), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 147/361 (40%), Positives = 225/361 (62%), Gaps = 9/361 (2%)

Query: 1   MENVDL-TFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQI 59
           MEN  L     +ID ID ++++LLN+RA++++ + + K+            Y   +E  I
Sbjct: 1   MENEKLQNLRDKIDKIDKEILKLLNDRAKLAIKIAEIKK------TQGLSFYDPVREKNI 54

Query: 60  FDRIHRLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSIN 119
            ++I +LN GP S E + ++++EI+SA+++ Q+   I+Y GP G++TH AAI  FG    
Sbjct: 55  INKILKLNKGPFSDEVIKTLFREILSATLALQESQKISYLGPEGTFTHLAAIKYFGSFAQ 114

Query: 120 YLPKSTINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCL 179
           + P+  I +IF+SVEKG T +G+VP ENS  G+V  TLD F+  +  I  E  + I+H L
Sbjct: 115 FEPEDNIKNIFESVEKGITKFGVVPIENSNEGTVTYTLDMFMQYEVKIAGEIIIPITHNL 174

Query: 180 LS-KSKFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIAS 238
           LS   +   I K+YSHP    QC+++L  ++ +    D  ST++AA  A+ +   AAIAS
Sbjct: 175 LSLTGEKEKIKKIYSHPHARAQCREWLRKNMPDIPVYDVASTAEAARQASLDEDVAAIAS 234

Query: 239 ITCAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGL 298
              A +YGL+ + K I+D KNN TRFFILG +    +G+DKT I+F++   +PG L + L
Sbjct: 235 EFAANIYGLKFVAKHIEDYKNNYTRFFILGKTFPNKTGSDKTSIMFSL-QDKPGTLYNAL 293

Query: 299 SVFKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSY 358
             FKD G+NL KI+SRP+  + W Y+FFV+  GH EDE V+K L ++  +C+++  LGSY
Sbjct: 294 KPFKDSGLNLTKIESRPAKMRKWEYIFFVDFMGHIEDEKVRKTLEEVKNYCIELVHLGSY 353

Query: 359 P 359
           P
Sbjct: 354 P 354



>gi|302035800|ref|YP_003796122.1| p-protein, bifunctional chorismate mutase/prephenate dehydratase
           [Candidatus Nitrospira defluvii]
 gi|503012046|ref|WP_013247022.1| prephenate dehydratase [Candidatus Nitrospira defluvii]
 gi|300603864|emb|CBK40196.1| P-protein, bifunctional chorismate mutase/prephenate dehydratase
           [Candidatus Nitrospira defluvii]
          Length = 358

 Score =  285 bits (730), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 137/351 (39%), Positives = 222/351 (63%), Gaps = 6/351 (1%)

Query: 10  QQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNG 69
           Q+ID ID ++++LLNER++  + + K K+           ++   +E  IF+R+ + N G
Sbjct: 10  QEIDRIDDQILRLLNERSKSVIEIGKLKK----QRDAEAHLHTPAREAAIFERLSKQNTG 65

Query: 70  PLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDI 129
           P  ++++ ++Y+EI+SAS+S +    +AY GP  ++TH A + +FG S  Y+P ++I D+
Sbjct: 66  PFPTDAIRAVYREIMSASLSLEGPQKVAYLGPRATFTHMACMQKFGSSAQYIPVNSIKDV 125

Query: 130 FDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKSKFSS-I 188
           F  VE+G   +G+VP EN+T G V  TLD F+     I  E    ++H L+SKS  +  I
Sbjct: 126 FSEVERGRAHFGVVPIENTTEGVVNHTLDMFVDSSLLIYGEVLQEVAHHLMSKSGVAGDI 185

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            +VYSHP    QC+ +L+++L      +  ST++AAE++  +P +AAIAS   ++LYGL+
Sbjct: 186 KRVYSHPHAIAQCRNWLETNLPHVPVSEVASTARAAELSVDDPSAAAIASELASQLYGLK 245

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
           V+   I+D  NN TRF +L   + + +G DKT ++ +V   + GAL D L  F  HG+N+
Sbjct: 246 VITARIEDNINNFTRFLVLSQKAPERTGRDKTSLMLSVK-DKVGALYDLLRPFASHGLNM 304

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            KI+SRPS ++ W Y+FFV+++GH ++E V+KA  ++   CL +KILGSYP
Sbjct: 305 TKIESRPSRRKAWEYIFFVDIEGHIDEERVKKAAEEVKSRCLFMKILGSYP 355



>gi|494424781|ref|WP_007222243.1| chorismate mutase [planctomycete KSU-1]
 gi|386405316|dbj|GAB63152.1| chorismate mutase [planctomycete KSU-1]
          Length = 360

 Score =  283 bits (725), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 141/360 (39%), Positives = 224/360 (62%), Gaps = 14/360 (3%)

Query: 7   TFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRL 66
           +  ++ID++D+K+V+LLNERAR+ L + + K+ +         VYV  +E +++ RI   
Sbjct: 5   SLRREIDTLDSKIVELLNERARIVLKIGEIKKQN------RAQVYVPNREQEVYFRITSQ 58

Query: 67  NNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTI 126
           N GPL++E L+++Y+E+++ S+  +K + ++Y GP G++++ AA  +FG S+ ++P   I
Sbjct: 59  NKGPLTNECLMAVYRELMAGSLVLEKAIKVSYLGPEGTFSYFAARQKFGSSVEFIPTRGI 118

Query: 127 NDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKSKFS 186
           +D+F  V  G + YGIVP ENST G +  TL+ F+     I AE  L I H L++     
Sbjct: 119 DDVFRDVAGGRSDYGIVPVENSTEGGIRETLNMFVGFDVKICAEIILPIHHNLMANCAKE 178

Query: 187 SINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASE-------PYSAAIASI 239
            I KVYS PQ   QC+ +L S+L  A+ ++  S+++AA I            Y A IA+ 
Sbjct: 179 EIKKVYSKPQILSQCKNWLASNLPSAELVEVSSSAEAARIVKRALESENEGRYYAVIANA 238

Query: 240 TCAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLS 299
             A+ YGL +L K+I+D  NNVTRFF+LG     PSG DKT ++  + +Q  GAL + L 
Sbjct: 239 EMAQQYGLNILFKNIEDNPNNVTRFFVLGKEYSAPSGRDKTAVMCYIKNQ-AGALLEILE 297

Query: 300 VFKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            FK + INL  I+S P+ +  W Y F+++ +GH  +E+VQKAL +I++ C ++KILGS+P
Sbjct: 298 PFKTYHINLTNIESLPTRKNAWEYCFYLDFEGHASNEIVQKALKEISKRCFEIKILGSFP 357



>gi|313672055|ref|YP_004050166.1| chorismate mutase [Calditerrivibrio nitroreducens DSM 19672]
 gi|503215559|ref|WP_013450220.1| prephenate dehydratase [Calditerrivibrio nitroreducens]
 gi|312938811|gb|ADR18003.1| chorismate mutase; prephenate dehydratase [Calditerrivibrio
           nitroreducens DSM 19672]
          Length = 356

 Score =  283 bits (724), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 144/353 (40%), Positives = 219/353 (62%), Gaps = 8/353 (2%)

Query: 8   FSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLN 67
             QQID ID  ++ LLN RAR+ + +   K+           +YV  +E  I++R+  LN
Sbjct: 7   LRQQIDEIDNTILDLLNRRARLVIEIGHIKKSQ------NAPLYVPSREKAIYERLKALN 60

Query: 68  NGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTIN 127
            GP  +++L ++++EIISAS+S ++   +AY GP G++TH AAI  FG S+  +P  +I 
Sbjct: 61  PGPFPNDALRNVFREIISASLSLEEVQKVAYLGPQGTFTHLAAIKHFGLSVKPIPCRSIP 120

Query: 128 DIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFS 186
           ++F+ VEK    YG+VP ENS  G V  TLD F      I  E +L +SH L++K+ K  
Sbjct: 121 EVFEDVEKKRCDYGVVPIENSLEGVVNHTLDMFSQSNLKICGEIFLEVSHHLMNKTGKIE 180

Query: 187 SINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYG 246
            + +VYSHP    QC+K++  ++     ++  ST+KAAEIA+++   AAI+S      Y 
Sbjct: 181 DVKRVYSHPHAIAQCRKWITENIPNVPIVEVESTAKAAEIASTDETIAAISSEMAELQYN 240

Query: 247 LEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGI 306
           L+++ K+I+D  NN TRF ++G+   +P+GNDKT ILF+V H R G+L   L  F +  I
Sbjct: 241 LKIIYKNIEDMSNNFTRFLVIGNFEPEPTGNDKTSILFSVTH-RSGSLFHALKAFAEEEI 299

Query: 307 NLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           N+ KI+SRPS  + W Y+F+V++ GH + E ++KAL K +E    +KILGSYP
Sbjct: 300 NMTKIESRPSKLKAWEYIFYVDIDGHSKTEKIKKALEKFSENVSFMKILGSYP 352



>gi|291280471|ref|YP_003497306.1| bifunctional chorismate mutase/prephenate dehydratase
           [Deferribacter desulfuricans SSM1]
 gi|502773813|ref|WP_013008795.1| prephenate dehydratase [Deferribacter desulfuricans]
 gi|290755173|dbj|BAI81550.1| bifunctional chorismate mutase/prephenate dehydratase
           [Deferribacter desulfuricans SSM1]
          Length = 356

 Score =  282 bits (722), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 143/353 (40%), Positives = 219/353 (62%), Gaps = 8/353 (2%)

Query: 8   FSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLN 67
             ++ID ID ++++LLNERA++ + + K K+           +YV  +E  I++R+  +N
Sbjct: 7   LRKEIDKIDEQILKLLNERAKLVIEIGKIKK------EQNKPLYVPSREKAIYERLKSIN 60

Query: 68  NGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTIN 127
            GP   E + ++++EIISAS+S ++   IAY GP G++TH A I  FG +   +P S I+
Sbjct: 61  TGPFPDEYIKNVFREIISASLSLEEVQKIAYLGPEGTFTHLAGIKHFGLAAKLIPLSNIS 120

Query: 128 DIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFS 186
           D+F+ VEK    YG++P ENS  G V  TLD F+     I  E +L +SH L++ S KF 
Sbjct: 121 DVFEYVEKKRCAYGVIPIENSLEGVVNHTLDMFMDSALKICGEIFLEVSHHLMNLSGKFE 180

Query: 187 SINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYG 246
            I K+YSHP    QC+K+L  + +    ++  ST+KAAEIA  +   AAIAS      YG
Sbjct: 181 DIRKIYSHPHAIAQCRKWLSKNARNITIVEVESTAKAAEIAKGDASVAAIASEMAEIQYG 240

Query: 247 LEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGI 306
           L+++ K I+D  NN TRF ++G +    +GNDKT I+F++ H + G+L + L  F +  I
Sbjct: 241 LKIVEKSIEDYTNNYTRFLVIGFNEPAKTGNDKTSIMFSLAH-KAGSLYNALKAFAEENI 299

Query: 307 NLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           N+ KI+SRPS ++ W Y+F+V++ GH +DE V+KAL   ++    +KILGSYP
Sbjct: 300 NMTKIESRPSKRKAWEYIFYVDIDGHIDDEPVKKALENFSKNVNMLKILGSYP 352



>gi|189425209|ref|YP_001952386.1| chorismate mutase [Geobacter lovleyi SZ]
 gi|501446755|ref|WP_012470204.1| prephenate dehydratase [Geobacter lovleyi]
 gi|189421468|gb|ACD95866.1| chorismate mutase [Geobacter lovleyi SZ]
          Length = 358

 Score =  280 bits (717), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 145/353 (41%), Positives = 221/353 (62%), Gaps = 8/353 (2%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID ID++LV+LLN+RARV+ ++ + K G           +V  +E ++ +R+ R+N GP
Sbjct: 13  EIDQIDSRLVELLNQRARVASDVGRLKAGQ------DRDFHVPSREREVHERVARMNQGP 66

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L  E+L SI++EI+SA +S +  L +AY GP  +++H A + +FG S    P+ +I  +F
Sbjct: 67  LPEEALHSIFREIMSACLSLESPLKVAYMGPKATFSHLATMQQFGLSAQLEPQKSIPAVF 126

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSSIN 189
           + VEKG   YG+VP ENST G V  TLD F+     I++E  L I H LLS++ +   I 
Sbjct: 127 EEVEKGKALYGVVPVENSTEGVVTHTLDMFVDSNLQIISEIILDIHHDLLSRTGRLEDIR 186

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLEV 249
           KVYSHPQ   QC+ +L+ +L     +D  ST+ AA+I + +  +AAIAS   A +Y L++
Sbjct: 187 KVYSHPQPIAQCRHWLEENLPNVPLVDVASTAVAAQIVSEDYTAAAIASELAASMYDLKM 246

Query: 250 LGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINLL 309
           +   I+D  NNVTRF ++     +P+GNDKT I+F+V  + PG L   L  F   G+NL 
Sbjct: 247 VRSRIEDQVNNVTRFLVISRKPAEPTGNDKTSIMFSVRDE-PGILYRMLEPFARRGVNLS 305

Query: 310 KIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYPDQR 362
           KI+SRP   + W Y+FF+++ GH  +  V++A++++  FC  +KILGSYP  R
Sbjct: 306 KIESRPVKTKAWEYIFFLDMSGHVSEAPVREAIDELKSFCQFLKILGSYPKAR 358



>gi|294055859|ref|YP_003549517.1| prephenate dehydratase [Coraliomargarita akajimensis DSM 45221]
 gi|502809093|ref|WP_013044069.1| prephenate dehydratase [Coraliomargarita akajimensis]
 gi|293615192|gb|ADE55347.1| prephenate dehydratase [Coraliomargarita akajimensis DSM 45221]
          Length = 431

 Score =  280 bits (717), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 139/352 (39%), Positives = 215/352 (61%), Gaps = 9/352 (2%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           ++D +D +++ LL+ER + +  + K K  +          Y   +E Q+  ++  LN GP
Sbjct: 82  KVDGLDQQVINLLSERVQHAGEIGKIKHAN------GADYYDPTREAQVMAKVAALNPGP 135

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           +++ +L S+Y+E+IS S+  +K L I + GP  +YTHQAA+  FG S++Y   STI D+F
Sbjct: 136 IANGTLQSVYREVISGSIGLEKRLVIGFLGPEATYTHQAAVRNFGVSLDYRALSTIPDVF 195

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKSKFSSINK 190
            +VE G   YG++P ENST G+V  ++D  +    HI ++ YL I HCL+S+S  S I +
Sbjct: 196 TAVESGSADYGVIPIENSTEGAVFHSMDMLVESDLHICSQVYLPIEHCLISRSPLSEIKE 255

Query: 191 VYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLEVL 250
           V+S  Q  GQC+++L +HL +AQ ++ +ST +A   A+  P  AA+A +  A+ YG+ + 
Sbjct: 256 VHSKDQALGQCREWLHAHLHDAQLVNVVSTVEAVRTASERPEVAAVAGLLSAQRYGVPIQ 315

Query: 251 GKDIQDAKNNVTRFFILGSSSEKP--SGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            + IQD  +NVTRF ++G +  KP   G DKT ++ ++  +  GAL   L  F   GINL
Sbjct: 316 QRSIQDRDDNVTRFLVIGKTRAKPLGDGKDKTSLVISLKDE-VGALERALRAFAARGINL 374

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYPD 360
            KI+SRPS ++ W Y+FF++  GH ED  VQ AL  +   C  VK LGSYP+
Sbjct: 375 SKIESRPSRKKAWDYLFFIDFIGHYEDASVQAALKDLEGHCSFVKWLGSYPN 426



>gi|319790561|ref|YP_004152194.1| chorismate mutase [Thermovibrio ammonificans HB-1]
 gi|503303677|ref|WP_013538338.1| prephenate dehydratase [Thermovibrio ammonificans]
 gi|317115063|gb|ADU97553.1| chorismate mutase [Thermovibrio ammonificans HB-1]
          Length = 358

 Score =  280 bits (717), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 150/354 (42%), Positives = 221/354 (62%), Gaps = 9/354 (2%)

Query: 8   FSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLN 67
             ++ID ID +L+ LLN RA++      A+E            YV G+E +I  ++  LN
Sbjct: 7   LREEIDRIDRELLTLLNRRAKL------AQEVGEIKKKKGLPFYVPGREAKILSKLEELN 60

Query: 68  NGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTIN 127
            GPL  ES+ +I++EIISA  + ++   +A+ GP  ++TH AA+ +FG S +  PK +I 
Sbjct: 61  QGPLPPESVRAIFREIISACRALEEPTKVAFLGPQATFTHLAALKQFGTSSDLRPKESIE 120

Query: 128 DIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFS 186
           D+FD VEKG   YG+VP ENS  G V  T+D F+     I  E ++ ++  L+SK  + S
Sbjct: 121 DVFDEVEKGRVDYGVVPIENSIEGVVNYTIDMFLDTDLKISGEVFVPVNLHLMSKEGELS 180

Query: 187 SINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYG 246
            + +VYSH     Q +K+L  +L  A+ I+  ST+KAAEIA++EP SAA+AS   A LY 
Sbjct: 181 KVKRVYSHRHALAQARKWLSENLPGAELIEVSSTAKAAEIASAEPGSAAVASEAAALLYD 240

Query: 247 LEVLGKDIQDAKNNVTRFFILGSS-SEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHG 305
           L +L K++Q+   N TRF ++G S SE PSG DKT ++F+  H+  GAL   L  F  + 
Sbjct: 241 LNILAKNVQELSRNFTRFLVIGKSDSEYPSGRDKTSVMFSTRHE-AGALFKALQPFAVYD 299

Query: 306 INLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           +NL KI+SRP+ ++PW YVFFV+L GH++++ V KAL ++ E C   K+LGSYP
Sbjct: 300 VNLTKIESRPTKKKPWEYVFFVDLDGHRKEDRVAKALKELEESCSFFKVLGSYP 353



>gi|494040215|ref|WP_006982340.1| prephenate dehydratase [Chthoniobacter flavus]
 gi|196222981|gb|EDY17502.1| chorismate mutase [Chthoniobacter flavus Ellin428]
          Length = 358

 Score =  280 bits (717), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 153/360 (42%), Positives = 228/360 (63%), Gaps = 14/360 (3%)

Query: 10  QQIDSIDTKLVQLLNERARV--SLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLN 67
           ++ID+ID +L++LLNERA +   + L K  EGS         +Y   +E  +   +   N
Sbjct: 8   RKIDAIDDQLLKLLNERADLVHEVGLVKRAEGS--------EIYAPEREEAVLRSLTEKN 59

Query: 68  ---NGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKS 124
               G L  +S+ +IY+EI+SAS++ +KDL+IAYFGP  + THQAA  +FG S+NY PK+
Sbjct: 60  AQLQGRLPEKSIRAIYREIMSASLALEKDLTIAYFGPESTNTHQAARSKFGASVNYTPKT 119

Query: 125 TINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKSK 184
           TI+D+FD V +G+  YG+VP ENST G+V  TLD F+  +  I A+  ++I + L++   
Sbjct: 120 TISDVFDVVARGNADYGVVPIENSTEGAVNHTLDVFMESELRICAQVLMKIENHLVANIP 179

Query: 185 FSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAEL 244
              I +VYSHPQ FGQC+ +L  +L   + I+  ST++AAE+AA E  +AAI     AE 
Sbjct: 180 REKIKRVYSHPQVFGQCRNWLRQNLPHVELIEVSSTARAAELAAGEADAAAITGPMAAET 239

Query: 245 YGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDH 304
           +GL++L   IQD   N TRF ++G +   P+G+D+T ++F V   +PGAL   L  F   
Sbjct: 240 HGLQILAPSIQDIATNTTRFLVIGKTPSPPTGDDRTSLMFCV-QDKPGALFHALEPFNRL 298

Query: 305 GINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYPDQRPS 364
            I++ KI+SRPS ++ W Y FFV++ GH  +E VQ+AL  +++ C  VKILG+YP   P+
Sbjct: 299 KISMSKIESRPSKRKAWEYFFFVDIDGHASEEKVQQALEGLSQHCTFVKILGTYPKTLPT 358



>gi|158521961|ref|YP_001529831.1| prephenate dehydratase [Desulfococcus oleovorans Hxd3]
 gi|501126297|ref|WP_012175366.1| prephenate dehydratase [Desulfococcus oleovorans]
 gi|158510787|gb|ABW67754.1| Prephenate dehydratase [Desulfococcus oleovorans Hxd3]
          Length = 366

 Score =  280 bits (716), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 154/355 (43%), Positives = 216/355 (60%), Gaps = 12/355 (3%)

Query: 8   FSQQIDSIDTKLVQLLNERARVS--LNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHR 65
             + ID ID  ++ LLN R  ++  +   K + G+         V    +E  I  R+  
Sbjct: 15  LRRSIDEIDDTILDLLNRRVSLAEAIGTLKTQTGN--------RVMDKAREESILQRLAG 66

Query: 66  LNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKST 125
           LN GPLSSE L  I+ +II+AS  +Q+   I++ GP  ++TH AA+  F +   ++P  +
Sbjct: 67  LNPGPLSSEMLRRIFVDIIAASRQAQEPKRISFLGPEATFTHVAALAFFNELDTFVPHPS 126

Query: 126 INDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-K 184
           I D+FD VEKG + YG+VP ENS  G+V  TLD F+  + HI AE+YL ISH LLSKS  
Sbjct: 127 IRDVFDDVEKGTSRYGVVPVENSIEGAVNHTLDLFLESELHICAESYLAISHDLLSKSGD 186

Query: 185 FSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAEL 244
              I+ +YSHPQ F QC+ +L +HL  A+ ++  STS+AA+ A     +AAIA    A L
Sbjct: 187 LEKIHTIYSHPQPFAQCRTWLKTHLPHAELVECGSTSQAAQKALLADDAAAIAGSAAARL 246

Query: 245 YGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDH 304
           Y L+V    IQDA  N TRF ++G  + +P+GNDKT ILF   H  PGAL   L      
Sbjct: 247 YDLKVAAPAIQDAVRNTTRFLVIGRDAPRPTGNDKTSILFVTAHI-PGALFKALEPIAAS 305

Query: 305 GINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           G+N+LK++SRP+  + W YVFFV+L+GH E+E V++ L K+  FC  +KILG+YP
Sbjct: 306 GLNMLKLESRPARHKNWSYVFFVDLEGHVENEKVKQCLAKMEAFCQFIKILGAYP 360



>gi|206901457|ref|YP_002251348.1| P-protein [Dictyoglomus thermophilum H-6-12]
 gi|501543134|ref|WP_012548250.1| P-protein [Dictyoglomus thermophilum]
 gi|206740560|gb|ACI19618.1| P-protein [Dictyoglomus thermophilum H-6-12]
          Length = 356

 Score =  280 bits (716), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 148/353 (41%), Positives = 212/353 (60%), Gaps = 11/353 (3%)

Query: 10  QQIDSIDTKLVQLLNERARVSLNLEKAK-EGSYXXXXXXXXVYVSGKENQIFDRIHRLNN 68
           ++ID +D KL+ +LN RA++ L +   K + +Y         +   +E ++ DR+ + N 
Sbjct: 9   KEIDELDKKLLDILNRRAQIVLQIRDWKIKNNYP-------TFDPSREKELLDRLVKENK 61

Query: 69  GPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTIND 128
           GPL  ++++ I+K IIS   S +K++ + Y GP GS+THQAA+  FG+   + P   + D
Sbjct: 62  GPLDKDAVIGIFKTIISYLRSLEKEIEVLYLGPEGSFTHQAAVKFFGEGSKFKPLLLVED 121

Query: 129 IFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLS-KSKFSS 187
           IF S+E+G   Y +VP ENS  G+V +T+D        ++ E YL + H L+S +     
Sbjct: 122 IFKSLEEG-AEYAVVPIENSLEGTVGSTMDLLAITTKKVIGEVYLDVKHSLISFEDSIDK 180

Query: 188 INKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGL 247
           I KVYSHPQ   QC+K+L  +L   + I   STS AA++   E  SAAIAS   A ++GL
Sbjct: 181 IRKVYSHPQALAQCKKWLRQNLPNVEEIPTSSTSFAAKLVKEERGSAAIASNFAANIFGL 240

Query: 248 EVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGIN 307
            +L ++IQD  NN TRF +LG    KP+G DKT I+F+V HQ  GAL   L    D G+N
Sbjct: 241 NILAENIQDFWNNKTRFLVLGREIPKPTGKDKTSIIFSVKHQ-AGALYRALRPLHDFGLN 299

Query: 308 LLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYPD 360
           +  I SRP   +P+ Y FFV+ QGH EDE V  AL KI E C+D K+LGSYP+
Sbjct: 300 MTLIQSRPVPAKPFEYRFFVDFQGHIEDEKVSCALEKIKEECIDFKVLGSYPE 352



>gi|322420785|ref|YP_004200008.1| chorismate mutase [Geobacter sp. M18]
 gi|505932230|ref|WP_015721560.1| prephenate dehydratase [Geobacter sp. M18]
 gi|320127172|gb|ADW14732.1| chorismate mutase [Geobacter sp. M18]
          Length = 359

 Score =  280 bits (715), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 139/356 (39%), Positives = 221/356 (62%), Gaps = 8/356 (2%)

Query: 8   FSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLN 67
             Q+ID++D ++++LLNERA++ + +   K             +V  +E +I++R+   N
Sbjct: 10  LRQEIDAVDDRILELLNERAKLVMRVGAVK------TENRSDFHVPSREREIYERLTAAN 63

Query: 68  NGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTIN 127
            GP  +E++  +++EIISAS++ +K L +A+ GP  +++H AA+  FG S +  P+ +I 
Sbjct: 64  PGPFPAEAVRGVFREIISASLALEKPLKVAFLGPSATFSHLAAMQHFGLSASLSPERSIP 123

Query: 128 DIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFS 186
            +F++VEKG   YG+VP EN+T G +  TLD F+  +  I AE  L +SH LLS++ +F 
Sbjct: 124 AVFEAVEKGEAYYGVVPVENTTEGMISHTLDMFMESELKINAEVLLEVSHFLLSRTGRFE 183

Query: 187 SINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYG 246
            I KVYSHPQ   QC+K+L  +L     +D  ST+ AA+I A +  +AAIAS   + +Y 
Sbjct: 184 DIKKVYSHPQPLAQCRKWLAENLPNVPLVDVASTTLAAQIVAEDYTAAAIASEYASSIYN 243

Query: 247 LEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGI 306
           L+++   I+D  NN TRF ++G    + SG+DKT ++F+V  + PG L   L  F   GI
Sbjct: 244 LKIVKARIEDQVNNFTRFLVIGRKMAERSGDDKTSLMFSVRDE-PGILHRMLEPFAKRGI 302

Query: 307 NLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYPDQR 362
           NL KI+SRP  ++ W Y+F+++L GH  D  V +A+ +++  C  VK+LGSYP  R
Sbjct: 303 NLSKIESRPLKKKAWEYIFYLDLSGHMSDHEVGEAVQELSACCQFVKVLGSYPRAR 358



>gi|512439757|ref|WP_016415576.1| prephenate dehydratase [Halomonas anticariensis]
 gi|511275338|gb|EPC03459.1| prephenate dehydratase [Halomonas anticariensis FP35 = DSM 16096]
          Length = 363

 Score =  279 bits (714), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 143/359 (39%), Positives = 219/359 (61%), Gaps = 8/359 (2%)

Query: 3   NVDLTFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDR 62
           N+D    ++ID +D  +++L++ERA  +  + + K  +          Y   +E Q+  R
Sbjct: 7   NLD-ELRERIDHLDGDILRLISERAECAKQVAEIKTKA----DPDTVFYRPEREAQVLRR 61

Query: 63  IHRLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLP 122
           I  LN GPL SE +  +++EI+SA ++ ++ + +AY GP G++T QAA+  FG+S   LP
Sbjct: 62  IMALNKGPLDSEEMARLFREIMSACLALERPIKVAYLGPEGTFTQQAALKHFGESAISLP 121

Query: 123 KSTINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRI-SHCLLS 181
            + I+++F  VE G   YG+VP ENST G V  TLD F+     I  E  LRI  H L+S
Sbjct: 122 MAAIDEVFREVEAGAANYGVVPVENSTEGVVNHTLDSFMDSSMRICGEVVLRIHQHLLIS 181

Query: 182 -KSKFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASIT 240
             ++   +++VYSHPQ F QC+K+LD+H   A+R+   S ++AA +  SE +SAAIA   
Sbjct: 182 HNTRRDKVSRVYSHPQSFAQCRKWLDAHFPSAERVPVASNAEAARLVKSEWHSAAIAGDM 241

Query: 241 CAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSV 300
            A+LY LE + + I+D  +N TRF I+G+     SG DKT I+  + +Q PGAL D L  
Sbjct: 242 AAKLYDLEKIAEKIEDRPDNSTRFLIIGNQDVPMSGEDKTSIVVAMRNQ-PGALHDLLEP 300

Query: 301 FKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           F  H I+L ++++RPS    W+YVFF++ +GH ED VV+  L ++     ++K+LGSYP
Sbjct: 301 FHRHQIDLTRLETRPSRTGVWNYVFFIDFKGHCEDPVVEAVLEEVRLRAAELKVLGSYP 359



>gi|317050905|ref|YP_004112021.1| chorismate mutase [Desulfurispirillum indicum S5]
 gi|503270692|ref|WP_013505353.1| prephenate dehydratase [Desulfurispirillum indicum]
 gi|316945989|gb|ADU65465.1| chorismate mutase [Desulfurispirillum indicum S5]
          Length = 364

 Score =  279 bits (714), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 145/349 (41%), Positives = 216/349 (61%), Gaps = 8/349 (2%)

Query: 12  IDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGPL 71
           ID+ID KL++LLN RA +++ + K K G+          YV  +E QI+ R+ R N GP+
Sbjct: 14  IDAIDDKLLELLNSRAELAVQVGKYKSGN------PSEFYVPSREKQIYTRLLRENPGPI 67

Query: 72  SSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIFD 131
             E++ +I++EIISA ++ ++ L+IA+ GP  ++TH A++  FG S  YL   +I D+F 
Sbjct: 68  PDEAVRAIFREIISACLNLEQPLTIAFLGPEATFTHIASMEHFGQSARYLASPSIRDVFS 127

Query: 132 SVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSSINK 190
            V++G   YG+ P ENST G V  TLD  +     I AE  L I+H L+S S K  ++ +
Sbjct: 128 EVDRGRAHYGVAPIENSTEGVVNYTLDCLVETDLSICAEIELGITHHLMSTSGKMENVKR 187

Query: 191 VYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLEVL 250
           VYSHP    QC+++L+ +L + + +D  ST++AAEIA+    +AAI S    +LY L  +
Sbjct: 188 VYSHPHAIAQCRQWLELNLPDVELVDITSTARAAEIASDNDDAAAICSELAGKLYSLVPV 247

Query: 251 GKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINLLK 310
            + I+D  NN TRF ++G +  K SGNDKT ++F + H   G+L   L +     IN+ K
Sbjct: 248 MRKIEDKTNNFTRFIVVGKTRTKRSGNDKTSVVFGLSHA-VGSLYHALEIISKFRINMTK 306

Query: 311 IDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           I+SRPS  + W Y+F V+L+GH+EDE V  AL  + E  L +KILGSYP
Sbjct: 307 IESRPSKIKAWEYLFHVDLEGHREDENVAAALKMLEERSLFMKILGSYP 355



>gi|307545309|ref|YP_003897788.1| chorismate mutase [Halomonas elongata DSM 2581]
 gi|503097670|ref|WP_013332475.1| prephenate dehydratase [Halomonas elongata]
 gi|307217333|emb|CBV42603.1| chorismate mutase [Halomonas elongata DSM 2581]
          Length = 363

 Score =  278 bits (712), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 135/354 (38%), Positives = 218/354 (61%), Gaps = 7/354 (1%)

Query: 8   FSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLN 67
             Q+ID +D+ +++L++ERA  + ++ + K             Y   +E Q+  RI  LN
Sbjct: 11  LRQRIDQLDSDIMRLISERAECARSVAETK----TKDDPQAVFYRPEREAQVLRRIMELN 66

Query: 68  NGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTIN 127
           +GPL SE +  +++EI+SA ++ ++ + +AY GP G++T QAA+  FG+S   LP + I+
Sbjct: 67  DGPLDSEEMARLFREIMSACLALEQPVKVAYLGPEGTFTQQAALKHFGESAISLPMAAID 126

Query: 128 DIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKF 185
           ++F  VE G   YG+VP ENST G +  TLD F+     I  E  LRI H LL    ++ 
Sbjct: 127 EVFREVEAGAVNYGVVPVENSTEGVINHTLDSFMDSSMRICGEVVLRIHHHLLVSDNTRR 186

Query: 186 SSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELY 245
             ++++YSHPQ F QC+K+LD+H  +A+R+   S ++AA +  +E +SAAIA    A+LY
Sbjct: 187 DKVSRIYSHPQSFAQCRKWLDAHYPQAERVPVSSNAEAARLVKTEWHSAAIAGDMAAKLY 246

Query: 246 GLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHG 305
           GL  + + I+D  +N TRF I+G+     SG+DKT I+  + +Q PGAL D L  F  H 
Sbjct: 247 GLTRVAEKIEDRPDNSTRFLIIGNQDVPMSGDDKTSIVVAMRNQ-PGALHDLLEPFHRHQ 305

Query: 306 INLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           I+L ++++RPS    W+YVFF++ +GH+++  V   L ++     ++K+LGS+P
Sbjct: 306 IDLTRLETRPSRSGVWNYVFFIDFRGHRDEPRVAAVLEEVQVRAAELKVLGSFP 359



>gi|383784291|ref|YP_005468860.1| prephenate dehydratase [Leptospirillum ferrooxidans C2-3]
 gi|504262119|ref|WP_014449221.1| prephenate dehydratase [Leptospirillum ferrooxidans]
 gi|383083203|dbj|BAM06730.1| prephenate dehydratase [Leptospirillum ferrooxidans C2-3]
          Length = 361

 Score =  278 bits (712), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 140/355 (39%), Positives = 218/355 (61%), Gaps = 9/355 (2%)

Query: 12  IDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGPL 71
           ID IDT++V LL +RA ++     A+ G Y         +V  +E +I DRI  L + P 
Sbjct: 12  IDEIDTRIVGLLRDRAAIA-----ARVGDYKKARALP-FHVVSREREILDRITELESAPF 65

Query: 72  SSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIFD 131
             ES+ +I++EI+SA +S ++ + I+Y GP  +YTHQAA+  FG S+ ++P +T+ ++F 
Sbjct: 66  PKESIRTIFREILSACLSLEEPVVISYMGPPATYTHQAALKHFGHSLKHVPAATVREVFR 125

Query: 132 SVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKSKFS-SINK 190
           +VE G   YG+VP ENST G V  TLD  +     I  E  L I HCLL+++  +  I  
Sbjct: 126 AVESGEALYGVVPIENSTEGMVNNTLDTLVESDLRICGEIILPIHHCLLTRATSAKEIRT 185

Query: 191 VYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLEVL 250
           VY+HPQ   QC+ YL + L +A   +  S +KA E+A  +P+SAAIA    AE+Y + + 
Sbjct: 186 VYAHPQALAQCRIYLSNALPDASTGETTSNTKAVEMALEDPHSAAIAGEMAAEVYNIPIF 245

Query: 251 GKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINLLK 310
            + I+D  +N TRF ++G+     +  D+T I+ ++   R GAL + LS+    GINL +
Sbjct: 246 SRHIEDFPDNQTRFLVIGTIDPGKTRKDQTSIMVSI-LDRVGALSEILSLIATEGINLTR 304

Query: 311 IDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYPDQ-RPS 364
           ++SRPS ++ W Y+FF++++GH+ DE +++ L K+   C  V+ILGSYP Q +PS
Sbjct: 305 LESRPSRKKAWDYIFFMDIEGHQADENIRQLLTKLQTLCPYVRILGSYPLQDKPS 359



>gi|496218196|ref|WP_008932233.1| prephenate dehydratase [Ectothiorhodospira sp. PHS-1]
 gi|373942121|gb|EHQ52666.1| chorismate mutase [Ectothiorhodospira sp. PHS-1]
          Length = 363

 Score =  278 bits (712), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 147/351 (41%), Positives = 221/351 (62%), Gaps = 6/351 (1%)

Query: 10  QQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNG 69
           ++ID++D ++++L++ERA  +  + + K  +          Y   +E Q+  RI   N G
Sbjct: 14  RRIDALDDEIMRLISERADCAQEVARIKRAA----DARAEFYRPEREAQVLRRIQAANPG 69

Query: 70  PLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDI 129
           PL+SE +  +++EI+SA ++ ++ LSIA+ GP G++T  AA+  FG S+N +P + I+++
Sbjct: 70  PLNSEEMARLFREIMSACLALEQQLSIAFLGPEGTFTQAAALKHFGHSVNTVPMNAIDEV 129

Query: 130 FDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSSI 188
           F  VE G   YG+VP ENST G V  TLDRF+     I  E  LRI H LLS +   S +
Sbjct: 130 FREVESGSAHYGVVPVENSTEGVVTHTLDRFMQSPLSICGEVELRIHHHLLSTADALSRV 189

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+++LD+ L  A+R+   S + AA  A+ EP +AAIAS   AELYGL 
Sbjct: 190 ERIYSHQQSLAQCREWLDARLPHAERLSVSSNADAARRASREPGAAAIASEAAAELYGLN 249

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
           VL  +I+D+ +N TRF ++G  S  PSGNDKT +L +    RPG+L   LS F D+ ++L
Sbjct: 250 VLAANIEDSPDNTTRFLVIGPRSSGPSGNDKTSLLVSA-RNRPGSLHGLLSPFADNDVSL 308

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I+SRPS    W YVFF++++GH +D  V KAL ++ +    VK+LGSYP
Sbjct: 309 TRIESRPSHCVNWEYVFFMDIEGHAQDTHVAKALVELKQEAELVKVLGSYP 359



>gi|291288848|ref|YP_003505664.1| chorismate mutase [Denitrovibrio acetiphilus DSM 12809]
 gi|502777217|ref|WP_013012193.1| prephenate dehydratase [Denitrovibrio acetiphilus]
 gi|290886008|gb|ADD69708.1| chorismate mutase [Denitrovibrio acetiphilus DSM 12809]
          Length = 356

 Score =  278 bits (711), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 145/360 (40%), Positives = 228/360 (63%), Gaps = 9/360 (2%)

Query: 1   MENVDLTFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIF 60
           M+ +D T    ID+ID ++++LLN+RA+ ++++ + K+           +YV  +E +IF
Sbjct: 1   MKELD-THRINIDTIDKEILELLNKRAKEAMSIGEIKKAE------GAPLYVPSREKKIF 53

Query: 61  DRIHRLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINY 120
           +R+  +N+GP  +++L ++++EIISAS+S ++   + Y GP G++T+ AA+ +FG S   
Sbjct: 54  ERLTSINSGPFPNDALKAVFREIISASLSLEEVQKVGYLGPEGTFTNLAALKQFGLSAEL 113

Query: 121 LPKSTINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL 180
           +P  TI ++FD+VE+G   +GIVP ENS  G V  TLD F++    I  E +L ++H L+
Sbjct: 114 VPVRTIPEVFDNVERGRMGFGIVPVENSLEGVVNHTLDTFVTSHLKISGEIFLEVTHNLM 173

Query: 181 SKS-KFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASI 239
           ++S     I  +YSH Q  GQC+K+L  +       +  ST+KAAE+A+ +  +AAIAS 
Sbjct: 174 NRSGDIGDIKHIYSHIQAIGQCRKWLAENCPNIPVQEVESTAKAAEMASRDDSTAAIASE 233

Query: 240 TCAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLS 299
                Y L  + + I+D  +N TRF I+G     P+GNDKT I+F   H + G+L + LS
Sbjct: 234 MAVLKYSLRFVERSIEDNSSNYTRFLIIGDFEPLPTGNDKTSIVFAAAH-KAGSLYEVLS 292

Query: 300 VFKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           +F    IN+ KI+SRPS Q+ W YVFFV+L GHK+DE + +ALN++ E    VK+LGSYP
Sbjct: 293 IFARKNINMTKIESRPSRQKAWEYVFFVDLDGHKDDEPIAEALNELIEHTAFVKVLGSYP 352



>gi|496386438|ref|WP_009095428.1| prephenate dehydratase [Halomonas sp. GFAJ-1]
 gi|359298326|gb|EHK62542.1| chorismate mutase [Halomonas sp. GFAJ-1]
          Length = 363

 Score =  278 bits (710), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 138/354 (38%), Positives = 215/354 (60%), Gaps = 7/354 (1%)

Query: 8   FSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLN 67
             Q+ID +D  +++L++ERA  +  +   K             Y   +E Q+  RI  LN
Sbjct: 11  LRQRIDQLDGDILRLISERASCAQQVAHVK----LAEDKDAVFYRPEREAQVLRRIMALN 66

Query: 68  NGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTIN 127
           +GPL +E +  +++EI+SA ++ ++ + +AY GP G++T QAA+  FG+S   LP + I+
Sbjct: 67  SGPLDAEEMARLFREIMSACLALEQPVKVAYLGPEGTFTQQAALKHFGESAVSLPMAAID 126

Query: 128 DIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKF 185
           ++F  VE G   YG+VP ENST G V  TLD F+     I  E  LRI H LL    ++ 
Sbjct: 127 EVFREVEAGAVNYGVVPVENSTEGVVNHTLDTFMDSSIKICGEVVLRIHHHLLISETTRK 186

Query: 186 SSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELY 245
             ++++YSHPQ FGQC+K+LD+H   A+R+   S ++AA++  +E +SAAIA    A+LY
Sbjct: 187 DKVSRIYSHPQSFGQCRKWLDAHYPHAERVPVSSNAEAAKLVKTEWHSAAIAGDMAAKLY 246

Query: 246 GLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHG 305
           GLE +   I+D  +N TRF I+G+     SG DKT I+  + +Q PGAL D L  F  H 
Sbjct: 247 GLERIADKIEDRPDNSTRFLIIGNQDVPMSGEDKTSIVVAMRNQ-PGALHDLLEPFHRHK 305

Query: 306 INLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           I+L +I++RPS    W+YVFF++ +GH+++  V   L ++     ++++LGSYP
Sbjct: 306 IDLTRIETRPSRTGAWNYVFFIDFKGHRDEPQVAAVLEEVKLRASELRVLGSYP 359



>gi|497410560|ref|WP_009724758.1| prephenate dehydratase [Halomonas sp. TD01]
 gi|338763333|gb|EGP18329.1| chorismate mutase [Halomonas sp. TD01]
          Length = 363

 Score =  277 bits (708), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 140/359 (38%), Positives = 218/359 (60%), Gaps = 8/359 (2%)

Query: 3   NVDLTFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDR 62
           N+D    Q+ID +D  +++L++ERA  +  +   K             Y   +E Q+  R
Sbjct: 7   NLD-DLRQRIDQLDGDILRLISERANCAQQVAHVK----LAQDKDAIFYRPEREAQVLRR 61

Query: 63  IHRLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLP 122
           I  LN GPL SE +  +++EI+SA ++ ++ + +AY GP G++T QAA+  FG+S   +P
Sbjct: 62  IMSLNQGPLDSEEMARLFREIMSACLALEQPVKVAYLGPEGTFTQQAALKHFGESAVSMP 121

Query: 123 KSTINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL-- 180
            + I+++F  VE G   YG+VP ENST G V  TLD F+     I  E  LRI H LL  
Sbjct: 122 MAAIDEVFREVEAGAVHYGVVPVENSTEGVVNHTLDTFMDSSIKICGEVVLRIHHHLLIS 181

Query: 181 SKSKFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASIT 240
             ++   ++++YSHPQ FGQC+K+LD+H   A+R+   S ++AA++  +E +SAAIA   
Sbjct: 182 ETTRRDKVSRIYSHPQSFGQCRKWLDAHYPHAERVPVSSNAEAAKLVKTEWHSAAIAGDM 241

Query: 241 CAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSV 300
            A+LYGLE + + I+D  +N TRF I+G+     SG DKT I+  + +Q PGAL D L  
Sbjct: 242 AAKLYGLERIAEKIEDRPDNSTRFLIIGNQDVPISGEDKTSIVVAMRNQ-PGALHDLLEP 300

Query: 301 FKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           F  H I+L +I++RPS    W+YVFF++ +GH+++  V   L ++     ++++LGSYP
Sbjct: 301 FHRHRIDLTRIETRPSRTGVWNYVFFIDFKGHRDEPQVAAVLEEVRLRASELRVLGSYP 359



>gi|430742432|ref|YP_007201561.1| prephenate dehydratase [Singulisphaera acidiphila DSM 18658]
 gi|505057934|ref|WP_015245036.1| prephenate dehydratase [Singulisphaera acidiphila]
 gi|430014152|gb|AGA25866.1| prephenate dehydratase [Singulisphaera acidiphila DSM 18658]
          Length = 385

 Score =  277 bits (708), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 139/359 (38%), Positives = 225/359 (62%), Gaps = 14/359 (3%)

Query: 7   TFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRL 66
           +F  +ID ID +L+ LLN RA ++L + + K+           V+ + +E+++  R    
Sbjct: 28  SFRSEIDRIDKELITLLNHRAEIALQIGQLKQ------KQGLEVWSAAREDEVIARALAT 81

Query: 67  NNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTI 126
           + GPL +E+L  I++E++S S S Q+ + IA  GP  SY+H AA+ +FG+++ ++P  +I
Sbjct: 82  SRGPLPAETLRLIFRELMSGSRSLQRTMRIACLGPKYSYSHLAAVAKFGEAVEHVPVGSI 141

Query: 127 NDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCK-THILAETYLRISHCLLSKSKF 185
             +F+ V + H  +GIVP ENST G +  TLD F+      I AE  LR+ HCLLS+S++
Sbjct: 142 AAVFEEVNRRHVQFGIVPLENSTDGRIADTLDMFVRLPGLKIRAEIRLRVHHCLLSRSEW 201

Query: 186 SSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELY 245
             + ++YS  Q   QC+ ++  +L EA+ ID +ST+ AAE A  E +SAA+AS      Y
Sbjct: 202 GQVQRIYSKSQALSQCRHWIGKNLPEARLIDVVSTAAAAEHAQREEFSAAVASQAAGVSY 261

Query: 246 GLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHG 305
           GL+VL  +I+D  +N+TRF ++   SE+ +G DKT ++  V +Q PG L + +S+FK +G
Sbjct: 262 GLKVLAANIEDQPHNITRFAVISERSEERTGRDKTTLMLRVPNQ-PGGLVEAISLFKKNG 320

Query: 306 INLLKIDSRPSS-----QQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           IN+  I+S P+S       P +Y+FF+++ GH +DE V+K L+ + + C  ++ILGSYP
Sbjct: 321 INMTWIESFPTSDGASDSDP-NYLFFLDIDGHADDEPVKKTLDLVRKKCERLEILGSYP 378



>gi|92114288|ref|YP_574216.1| chorismate mutase / prephenate dehydratase [Chromohalobacter
           salexigens DSM 3043]
 gi|499826729|ref|WP_011507463.1| prephenate dehydratase [Chromohalobacter salexigens]
 gi|91797378|gb|ABE59517.1| chorismate mutase / prephenate dehydratase [Chromohalobacter
           salexigens DSM 3043]
          Length = 373

 Score =  277 bits (708), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 137/355 (38%), Positives = 215/355 (60%), Gaps = 7/355 (1%)

Query: 7   TFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRL 66
              ++ID++D+++++L++ERA  +  + + K  S          Y   +E Q+  RI  L
Sbjct: 20  ALRERIDALDSQILELISERAHCAQQVAQVKTDS----DPQATFYRPEREAQVLRRIMAL 75

Query: 67  NNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTI 126
           N GPL  E +  +++EI+SA ++ ++ + +AY GP G++T QAA+  FGDS   LP + I
Sbjct: 76  NKGPLDDEEMARLFREIMSACLALERPVKVAYLGPEGTFTQQAALKHFGDSAVSLPMAAI 135

Query: 127 NDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSK 184
           +++F  VE G   +G+VP ENST G V +TLD F+     I  E  LRI H LL    ++
Sbjct: 136 DEVFREVEAGAAHFGVVPVENSTEGIVNSTLDTFMDASLRICGEVVLRIHHHLLVSDTTR 195

Query: 185 FSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAEL 244
              I+++YSHPQ   QC+K+LD+H   A+R+   S ++AA +  SE +SAAIA    A+ 
Sbjct: 196 RDKISRIYSHPQSLAQCRKWLDAHYPNAERVPVSSNAEAARLIKSEWHSAAIAGDMAAKR 255

Query: 245 YGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDH 304
           Y L+ + + I+D  +N TRF I+G      SG+DKT I+  + +Q PGAL D L  F  H
Sbjct: 256 YALDKVAEKIEDRPDNSTRFLIIGHQDTPISGDDKTSIVVAMRNQ-PGALHDLLEPFHRH 314

Query: 305 GINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            I+L ++++RPS    W+YVFF++ +GH++D  V   L +I     ++K+LGSYP
Sbjct: 315 KIDLTRVETRPSRTGVWNYVFFIDFKGHRDDPQVAAVLEEITLRAAELKVLGSYP 369



>gi|495562081|ref|WP_008286660.1| prephenate dehydratase [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882447|gb|EDP75953.1| chorismate mutase/prephenate dehydratase [Hydrogenivirga sp.
           128-5-R1-1]
          Length = 362

 Score =  276 bits (707), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 154/357 (43%), Positives = 216/357 (60%), Gaps = 12/357 (3%)

Query: 8   FSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLN 67
             ++ID ID ++++LLNERA++      A+E           ++V  +E  IF++I  LN
Sbjct: 7   LREKIDRIDEEILRLLNERAKL------AREIGDIKKRNNLEIHVPERERAIFEKILSLN 60

Query: 68  NGPLS----SESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPK 123
                    SE+LV IY+EIISA +S +K L IAY GP  ++THQAA+  FG S  Y+P 
Sbjct: 61  REKFGEEFPSEALVHIYREIISACLSLEKPLRIAYLGPKATFTHQAALEYFGFSAQYVPC 120

Query: 124 STINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRIS-HCLLSK 182
           +TI D+F  VE   T YG+VP EN+  G V  TLD F+  +  I  E  + I+ H L S 
Sbjct: 121 ATIRDVFVEVESERTDYGVVPVENTIEGVVNYTLDMFLESELKISGEVVIPINLHLLSSS 180

Query: 183 SKFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCA 242
              S I +VYSH    GQC+ +L+ +L +AQ I+  ST+KA EIA  E  S A+AS   +
Sbjct: 181 ESLSDIRRVYSHKMALGQCRSWLEKNLPDAQLIETESTAKACEIALEEEGSGAVASEVAS 240

Query: 243 ELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFK 302
             Y L ++  +IQ++ +N TRF I+     KP+G  KT ++F V  + PGAL   L  F 
Sbjct: 241 YTYHLNIVASNIQESSDNFTRFLIVSKREMKPTGKGKTSLIFAVRDE-PGALYRALEAFY 299

Query: 303 DHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           + G+NL KI+SRPS ++ W YVFFV+L+GH+EDE V++ L K+ E    VKILGSYP
Sbjct: 300 EEGVNLTKIESRPSRRRAWDYVFFVDLEGHREDERVRRVLKKLGERTQMVKILGSYP 356



>gi|496086295|ref|WP_008810802.1| chorismate mutase [Burkholderiales bacterium 1_1_47]
 gi|302860323|gb|EFL83400.1| chorismate mutase [Burkholderiales bacterium 1_1_47]
          Length = 383

 Score =  276 bits (706), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 136/361 (37%), Positives = 215/361 (59%), Gaps = 11/361 (3%)

Query: 6   LTFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHR 65
           L    +ID +D++LV+LLNERA V      AKE           VY   +E ++  +I  
Sbjct: 18  LPLRNKIDGLDSELVRLLNERAEV------AKEIGEIKARAGLPVYRPEREAEVLRKICG 71

Query: 66  LNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKST 125
            N GPL +ESLV+I++E++ A    + +L +AY GP G+++ QA I +FG  +  +P  +
Sbjct: 72  KNEGPLPNESLVAIWREVMCACRGLESELKVAYLGPRGTFSEQAMIRQFGSGVVGMPSGS 131

Query: 126 INDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-K 184
           I ++F  VE G   YGIVP ENST G+V  T+D  +     I+ E  + I H L+++S  
Sbjct: 132 IEEVFRKVESGDAAYGIVPIENSTEGAVNRTMDYLLKTSLFIVGECSIPIQHNLMTRSGT 191

Query: 185 FSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAEL 244
              I +VYSHPQ  GQC ++L+ ++   +R+ A S  +AA +A+  P  AAIA    A++
Sbjct: 192 MEGITRVYSHPQSLGQCVQWLNRNVPSLERLTAESNGEAARLASENPAYAAIAGEVAAKI 251

Query: 245 YGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGN---DKTFILFTVDHQRPGALCDGLSVF 301
           +GL+++  +IQD+  N TRF ILG    +PS N   DKT ++F+V H R G+L   L  F
Sbjct: 252 FGLQIVAANIQDSNTNRTRFLILGREPAEPSANPQEDKTSLIFSVPH-RAGSLYQALKPF 310

Query: 302 KDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYPDQ 361
            D G++++++DSRP+ +  W Y F+ +++G+  +  +++AL    E C  +K LGSYP +
Sbjct: 311 DDFGVSMMRLDSRPAKRGTWEYFFYTDIEGNMSEPKIREALEIFREGCASLKCLGSYPTE 370

Query: 362 R 362
           +
Sbjct: 371 K 371



>gi|496138890|ref|WP_008863397.1| chorismate mutase [Parasutterella excrementihominis]
 gi|329576135|gb|EGG57654.1| chorismate mutase [Parasutterella excrementihominis YIT 11859]
          Length = 373

 Score =  276 bits (705), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 136/361 (37%), Positives = 215/361 (59%), Gaps = 11/361 (3%)

Query: 6   LTFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHR 65
           L    +ID +D++LV+LLNERA V      AKE           VY   +E ++  +I  
Sbjct: 8   LPLRNKIDGLDSELVRLLNERAEV------AKEIGEIKARVGLPVYRPEREAEVLKKICG 61

Query: 66  LNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKST 125
            N GPL +ESLV+I++E++ A    + +L +AY GP G+++ QA I +FG  +  +P  +
Sbjct: 62  KNEGPLPNESLVAIWREVMCACRGLESELKVAYLGPRGTFSEQAMIRQFGSGVVGMPSGS 121

Query: 126 INDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-K 184
           I ++F  VE G   YGIVP ENST G+V  T+D  +     I+ E  + I H L+++S  
Sbjct: 122 IEEVFRKVESGDAAYGIVPIENSTEGAVNRTMDYLLKTSLFIVGECSIPIQHNLMTRSGT 181

Query: 185 FSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAEL 244
              I +VYSHPQ  GQC ++L+ ++   +R+ A S  +AA +A+  P  AAIA    A++
Sbjct: 182 MEGITRVYSHPQSLGQCVQWLNRNVPSLERLTAESNGEAARLASENPAYAAIAGEVAAKI 241

Query: 245 YGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGN---DKTFILFTVDHQRPGALCDGLSVF 301
           +GL+++  +IQD+  N TRF ILG    +PS N   DKT ++F+V H R G+L   L  F
Sbjct: 242 FGLQIVATNIQDSNTNRTRFLILGREPAEPSANPQEDKTSLIFSVPH-RAGSLYQALKPF 300

Query: 302 KDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYPDQ 361
            D G++++++DSRP+ +  W Y F+ +++G+  +  +++AL    E C  +K LGSYP +
Sbjct: 301 DDFGVSMMRLDSRPAKRGTWEYFFYTDIEGNMSEPKIREALEIFREGCASLKCLGSYPTE 360

Query: 362 R 362
           +
Sbjct: 361 K 361



>gi|253699624|ref|YP_003020813.1| chorismate mutase [Geobacter sp. M21]
 gi|502371068|ref|WP_012774668.1| prephenate dehydratase [Geobacter sp. M21]
 gi|251774474|gb|ACT17055.1| chorismate mutase [Geobacter sp. M21]
          Length = 359

 Score =  275 bits (703), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 139/356 (39%), Positives = 221/356 (62%), Gaps = 8/356 (2%)

Query: 8   FSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLN 67
             Q+ID++D  ++ LLN+RA++ + +   K  S+         +V  +E +I++R+   N
Sbjct: 10  LRQEIDTVDDHILDLLNQRAKLVMEVGAVKTKSHSD------FHVPSREREIYERLTAAN 63

Query: 68  NGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTIN 127
            GP  S+++  +++EIISAS++ +K L++A+ GP  +++H AA+  FG S +  P+ +I 
Sbjct: 64  PGPFPSDAVRGVFREIISASLALEKPLNVAFLGPSATFSHLAAMQHFGLSASLSPERSIP 123

Query: 128 DIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFS 186
            +F++VEKG   YG+VP EN+T G +  TLD F+  +  I AE  L +SH LLS++ +F 
Sbjct: 124 AVFEAVEKGEAYYGVVPVENTTEGMISHTLDMFMESELKINAEVLLEVSHFLLSRTGRFE 183

Query: 187 SINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYG 246
            I KVYSHPQ   QC+K+L  +L     +D  ST+ AA+I + +  +AAIAS   + +Y 
Sbjct: 184 DIKKVYSHPQPLAQCRKWLAENLPNVPLVDVASTTLAAQIVSEDYTAAAIASEYASSIYN 243

Query: 247 LEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGI 306
           L+V+   I+D  NN TRF ++G      SG+DKT ++F+V  + PG L   L  F   GI
Sbjct: 244 LKVVKARIEDQVNNFTRFLVIGRKMADKSGDDKTSLMFSVRDE-PGILHRMLEPFAKRGI 302

Query: 307 NLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYPDQR 362
           NL KI+SRP  ++ W Y+F+++L GH  D  V +A+ +++  C  VK+LGSYP  R
Sbjct: 303 NLSKIESRPLKRKAWEYIFYLDLSGHISDPEVAEAVKELSVCCQFVKVLGSYPRAR 358



>gi|491146214|ref|WP_005004614.1| prephenate dehydratase [Nitrococcus mobilis]
 gi|88792278|gb|EAR23388.1| Chorismate mutase [Nitrococcus mobilis Nb-231]
          Length = 361

 Score =  275 bits (703), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 143/360 (39%), Positives = 221/360 (61%), Gaps = 7/360 (1%)

Query: 2   ENVDL-TFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIF 60
           E V L +   +ID+ID ++++L+NERA+ +  + + K  +         +Y   +E ++ 
Sbjct: 3   ETVKLESVRARIDAIDDEILRLINERAQAAQEVARIKRAA----GEDGDLYRPAREVEVL 58

Query: 61  DRIHRLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINY 120
           +RI   N GPL+ E ++ +++E++SA ++ Q+ L +A+ GP G++T +AA+  FG  I  
Sbjct: 59  NRIGAANGGPLTDEDVIRLFRELMSACLALQQPLQVAFLGPQGTFTQEAALKHFGHGIRA 118

Query: 121 LPKSTINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL 180
           L   +++ +F  VE G+  YG+VP ENST G V  TLD F+     I+ E  L I HCL 
Sbjct: 119 LALESVDAVFREVESGNADYGVVPVENSTEGVVTHTLDCFMVSPLQIVGELELPIRHCLA 178

Query: 181 SK-SKFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASI 239
           SK + +S+I +V+SHPQG  QC+ +LD HL   QR+   ST++AA  AA  P SAA+A  
Sbjct: 179 SKETDWSAICQVFSHPQGLAQCRAWLDQHLPGVQRLPVSSTAEAARRAAETPQSAAVAGQ 238

Query: 240 TCAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLS 299
              + YGL VL  +IQD   N TRF +LG  S  P+G DKT I+ +    +PG L   L+
Sbjct: 239 AAMQHYGLTVLYSNIQDGAANTTRFLVLGDHSPPPTGADKTSIVVS-RADKPGGLATLLA 297

Query: 300 VFKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
               +G+N+ +I+SRPS Q  W YVFF+++ GH ED  +++AL+++ +    +KILGSYP
Sbjct: 298 PLVRYGLNMSRIESRPSRQGMWQYVFFIDILGHAEDSNLRRALDEMQQLASLLKILGSYP 357



>gi|304310668|ref|YP_003810266.1| Chorismate mutase/prephenate dehydratase [gamma proteobacterium
           HdN1]
 gi|503026132|ref|WP_013261108.1| prephenate dehydratase [gamma proteobacterium HdN1]
 gi|301796401|emb|CBL44609.1| Chorismate mutase/prephenate dehydratase [gamma proteobacterium
           HdN1]
          Length = 376

 Score =  274 bits (700), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 136/354 (38%), Positives = 214/354 (60%), Gaps = 4/354 (1%)

Query: 8   FSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLN 67
             QQID++DT+L+ L+N+RA+++  + + K  +          +   +E Q+  RI   N
Sbjct: 21  LRQQIDTLDTELLALVNQRAKLAQAVARIKTDALEKGEKPV-FFRPEREAQVLRRIKERN 79

Query: 68  NGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTIN 127
            GPL  ES+  +++E++SA ++ ++ + IAY GP G+YTH A +  FG +++  P++TI+
Sbjct: 80  QGPLGDESVAWLFRELMSACLALEEPMRIAYLGPEGTYTHAATLKHFGHAVHLAPQTTID 139

Query: 128 DIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKF 185
           ++F  VE G   YG+VP ENST G V  TLD F+     +  E  LRI H LL    ++ 
Sbjct: 140 EVFREVEAGAAHYGVVPVENSTEGMVNNTLDSFMQSNVKVCGEVALRIHHHLLVGPATRT 199

Query: 186 SSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELY 245
           S I ++YSH Q   QC+K+LDSH    +RI   S ++AA     E ++AAIA    +ELY
Sbjct: 200 SGITRIYSHQQSLAQCRKWLDSHYPNVERIAVSSNAEAARRLRDEWHAAAIAGDMASELY 259

Query: 246 GLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHG 305
           GLE L  +I+D+ +N TRF ++G  S   SG+DKT I+ +    +PGAL + L+ F+   
Sbjct: 260 GLEKLASNIEDSPHNTTRFLVVGQESVAASGDDKTSIIVST-RDKPGALYNLLTPFRREN 318

Query: 306 INLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           I+L +I++RPS    W YVFF++  GH+ D+ + + L+ +    + +K LGSYP
Sbjct: 319 ISLTRIETRPSRDGAWAYVFFMDFDGHETDDAIVRILDDLGSEAVYLKRLGSYP 372



>gi|110834610|ref|YP_693469.1| chorismate mutase/prephenate dehydratase [Alcanivorax borkumensis
           SK2]
 gi|499908296|ref|WP_011589030.1| prephenate dehydratase [Alcanivorax borkumensis]
 gi|110647721|emb|CAL17197.1| P-protein, chorismate mutase/prephenate dehydratase [Alcanivorax
           borkumensis SK2]
          Length = 360

 Score =  274 bits (700), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 138/361 (38%), Positives = 210/361 (58%), Gaps = 7/361 (1%)

Query: 1   MENVDLTFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIF 60
           M N       +ID +D KL  LLN+RA ++  + + K  +          Y   +E Q+ 
Sbjct: 1   MTNTLDDLRNEIDELDQKLQDLLNQRAALAHKVAEVKTAT----DPNPVFYRPEREAQVL 56

Query: 61  DRIHRLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINY 120
            R+   N GPL  E++   ++E++SA ++ ++ + +A+ GP G++T QAA+  FG ++  
Sbjct: 57  RRVKERNQGPLDGETMARFFREVMSACLALEQRMKVAFLGPEGTFTQQAALKHFGHAVES 116

Query: 121 LPKSTINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL 180
           LP + I+++F  VE G   YG+VP ENST G V  TLD F++    I  E  LRI H LL
Sbjct: 117 LPLAAIDEVFREVESGAANYGVVPVENSTEGVVNHTLDTFMTSSLKICGEVELRIHHHLL 176

Query: 181 S--KSKFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIAS 238
           +   ++   + +VYSH Q   QC+++LD+H+   +RI   S ++AA     E  + AIA 
Sbjct: 177 AGEHTRQDKVTRVYSHQQTLAQCRQWLDAHMPGVERIAVSSNAEAARRLKDEWNALAIAG 236

Query: 239 ITCAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGL 298
               ELYGL  + ++I+D  +N TRF I+G     PSG DKT ++ +    RPG L + L
Sbjct: 237 EMAEELYGLTAVQRNIEDRPDNTTRFIIIGRQDTPPSGCDKTSLMIS-GKNRPGLLYEVL 295

Query: 299 SVFKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSY 358
           S F+D GINL +++SRPS    W YVFFV+ +GHKED+ +Q  L+K+      +K+LGSY
Sbjct: 296 SPFRDEGINLTRLESRPSRTANWSYVFFVDCEGHKEDDTLQAVLDKLEAAGNTIKLLGSY 355

Query: 359 P 359
           P
Sbjct: 356 P 356



>gi|197119626|ref|YP_002140053.1| bifunctional chorismate mutase/prephenate dehydratase [Geobacter
           bemidjiensis Bem]
 gi|501523751|ref|WP_012531688.1| prephenate dehydratase [Geobacter bemidjiensis]
 gi|197088986|gb|ACH40257.1| chorismate mutase and prephenate dehydratase [Geobacter
           bemidjiensis Bem]
          Length = 359

 Score =  273 bits (699), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 139/356 (39%), Positives = 220/356 (61%), Gaps = 8/356 (2%)

Query: 8   FSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLN 67
             Q+ID++D  ++ LLN+RA++ + +   K  S+         +V  +E +I++R+   N
Sbjct: 10  LRQEIDTVDDHILDLLNQRAKLVMEVGAVKAKSHSD------FHVPSREREIYERLTAQN 63

Query: 68  NGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTIN 127
            GP  S+++  +++EIISAS++ +K L++A+ GP  +++H AA+  FG S +  P+ +I 
Sbjct: 64  PGPFPSDAVRGVFREIISASLALEKPLNVAFLGPSATFSHLAAMQHFGLSASLSPERSIP 123

Query: 128 DIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFS 186
            +F++VEKG   YG+VP EN+T G +  TLD F+  +  I AE  L +SH LLS++ +F 
Sbjct: 124 AVFEAVEKGEAYYGVVPVENTTEGMISHTLDMFMESELKINAEVLLEVSHFLLSRTGRFE 183

Query: 187 SINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYG 246
            I KVYSHPQ   QC+K+L  +L     +D  ST+ AA+I + +  +AAIAS   + +Y 
Sbjct: 184 DIKKVYSHPQPLAQCRKWLAENLPNVPLVDVASTTLAAQIVSEDYTAAAIASEYASSIYN 243

Query: 247 LEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGI 306
           L+V+   I+D  NN TRF ++G      SG+DKT ++F+V  + PG L   L  F   GI
Sbjct: 244 LKVVKARIEDQVNNFTRFLVIGRKMADKSGDDKTSLMFSVRDE-PGILHRMLEPFAQRGI 302

Query: 307 NLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYPDQR 362
           NL KI+SRP  ++ W Y+F+++L GH  D  V  A+ +++  C  VK+LGSYP  R
Sbjct: 303 NLSKIESRPLKRKAWEYIFYLDLSGHISDLEVADAVKELSVCCQFVKVLGSYPRAR 358



>gi|490426873|ref|WP_004299037.1| chorismate mutase [Thauera aminoaromatica]
 gi|479300349|gb|ENO88449.1| chorismate mutase [Thauera aminoaromatica S2]
          Length = 355

 Score =  272 bits (696), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 133/360 (36%), Positives = 213/360 (59%), Gaps = 10/360 (2%)

Query: 1   MENVDLTFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIF 60
           M +  L    +ID ID +++  L ERAR +  + + K G           Y   +E Q+ 
Sbjct: 1   MSDELLKLRNEIDRIDEEILARLAERARCAQRVGEIKRG--------VMYYRPEREAQVL 52

Query: 61  DRIHRLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINY 120
            R+  LN GPLSS+++ +I++E++SA +  ++ L +AY GP G+++  A+   FG + N+
Sbjct: 53  RRLAELNPGPLSSDAVKTIFREVMSACLGLEQPLRVAYLGPAGTFSESASRKHFGSAPNF 112

Query: 121 LPKSTINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL 180
           LP + I+D+F +VE G+  YG+VP ENST G+V  TLD  ++    +  E  LRI   L+
Sbjct: 113 LPMAAIDDVFRAVEAGNADYGVVPVENSTEGAVGGTLDLLLANPLKVCGEVRLRIHQQLM 172

Query: 181 SKSK-FSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASI 239
           S+++   +  ++YSH Q   QC ++L+ +L    RI   S ++AA +A+ +P S AIA  
Sbjct: 173 SRAEGIGAARRIYSHAQSLAQCHEWLNRNLPHLPRIPVASNAEAARMASEDPESCAIAGD 232

Query: 240 TCAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLS 299
             A+LYGL +L  +I+D  NN TRF ++      PSG D+T ++F+  + RPGA+   L 
Sbjct: 233 AAAQLYGLNILAPNIEDDPNNTTRFLVIADHDAGPSGKDRTSLVFSAPN-RPGAIHSLLE 291

Query: 300 VFKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
               HG+++ K+ SRP+    W YVF+ ++ GH+ED  V  AL +++E    VKI+GSYP
Sbjct: 292 PMARHGVDMTKLQSRPARSGLWEYVFYADINGHREDPEVAAALRELDERAAFVKIIGSYP 351



>gi|119897359|ref|YP_932572.1| chorismate mutase/prephenate dehydratase [Azoarcus sp. BH72]
 gi|500088789|ref|WP_011764802.1| prephenate dehydratase [Azoarcus sp. BH72]
 gi|119669772|emb|CAL93685.1| chorismate mutase/prephenate dehydratase [Azoarcus sp. BH72]
          Length = 354

 Score =  272 bits (696), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 138/360 (38%), Positives = 210/360 (58%), Gaps = 11/360 (3%)

Query: 1   MENVDLTFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIF 60
           M +  L    QID +D +++  L ERAR +  + + K G+         +Y   +E Q+ 
Sbjct: 1   MSDELLNLRNQIDRLDEEILARLAERARCAQRVGEIKHGN---------IYRPEREAQVL 51

Query: 61  DRIHRLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINY 120
            R+  LN GPL   ++  I++EI+SA +  ++ L +AY GP G+++  A+   FG + N 
Sbjct: 52  RRLADLNGGPLPDVAVQKIFREIMSACLGLEQPLKVAYLGPAGTFSESASRKHFGAAPNV 111

Query: 121 LPKSTINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL 180
           LP  +I+++F +VE G+  YG+VP ENST G+V  TLD  ++    +  E  LRI   LL
Sbjct: 112 LPTPSIDEVFRAVESGNADYGVVPVENSTEGAVGGTLDLLLANPLKVCGEVKLRIHQNLL 171

Query: 181 SKSK-FSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASI 239
           S+++      ++YSH Q   QC ++L+ +L    RI   S ++AA +AA +P S AIA  
Sbjct: 172 SRAEGIGGAKRLYSHAQSLAQCHEWLNRNLAHLPRIPVASNAEAARLAAEDPESCAIAGE 231

Query: 240 TCAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLS 299
             AELYGL  L  +I+D  NN TRF ++ S    PSGNDKT ++ +    RPGA+   L 
Sbjct: 232 AAAELYGLNKLATNIEDDPNNTTRFLVIASHDAGPSGNDKTSLVCSA-QNRPGAMHALLE 290

Query: 300 VFKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
               HG+++ K++SRP+    W YVF+V++QGH+ D  V  AL ++NE    VK+LGSYP
Sbjct: 291 PLARHGVDMSKLESRPARSGLWEYVFYVDIQGHQTDAAVAAALRELNERAAFVKVLGSYP 350



>gi|498314651|ref|WP_010628807.1| prephenate dehydratase [Halomonas sp. KM-1]
          Length = 363

 Score =  272 bits (696), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 141/359 (39%), Positives = 214/359 (59%), Gaps = 8/359 (2%)

Query: 3   NVDLTFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDR 62
           N+D T  Q+ID ID  +++L++ RA  +  + + K  S          Y   +E Q+  R
Sbjct: 7   NLD-TLRQRIDEIDNDILRLISARAECAKQVAEVKTKS----DKGAVFYRPEREAQVLRR 61

Query: 63  IHRLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLP 122
           I  LN GPL+SE +  +++EI+SA ++ ++   +AY GP G++T QAA+  FG S   +P
Sbjct: 62  IMELNQGPLNSEEMARLFREIMSACLALEQPTKVAYLGPEGTFTQQAALKHFGASAVSMP 121

Query: 123 KSTINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL-- 180
            + I+++F  VE G   YG+VP ENST G V  TLD F+     I  E  LRI H LL  
Sbjct: 122 MAAIDEVFREVEAGAVNYGVVPVENSTEGVVSHTLDSFMDSSIRICGEVVLRIHHHLLVA 181

Query: 181 SKSKFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASIT 240
             +    +++VYSHPQ   QC+K+LD+H   A+R+   S ++AA++   E +SAAIA   
Sbjct: 182 DTTLRDKVSRVYSHPQSLAQCRKWLDAHYPRAERVPVSSNAEAAKMIKGEWHSAAIAGDM 241

Query: 241 CAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSV 300
            A+LYGLE + + I+D  +N TRF I+GS     SG DKT I+  + +Q PGAL + L  
Sbjct: 242 AAKLYGLEKVAEKIEDRPDNSTRFLIIGSQHVPMSGEDKTSIVVAMRNQ-PGALHELLEP 300

Query: 301 FKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           F  H I+L ++++RPS    W+YVFF++ +GH ++  V   L ++     ++K+LGSYP
Sbjct: 301 FHRHSIDLTRLETRPSRTGVWNYVFFIDFKGHVDEPRVAAVLEEVRLRASELKVLGSYP 359



>gi|496243939|ref|WP_008957324.1| prephenate dehydratase [Halomonas sp. HAL1]
 gi|350600247|gb|EHA16316.1| chorismate mutase [Halomonas sp. HAL1]
          Length = 363

 Score =  272 bits (696), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 137/359 (38%), Positives = 216/359 (60%), Gaps = 8/359 (2%)

Query: 3   NVDLTFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDR 62
           N+D    Q+ID +D+ ++ L++ERA  +  +   K             Y   +E Q+  R
Sbjct: 7   NLD-ELRQRIDQLDSDILNLISERASCAQQVAHVK----LAEDKDAVFYRPEREAQVLRR 61

Query: 63  IHRLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLP 122
           I  LN GPL SE +  +++EI+SA ++ ++ + +AY GP G++T QAA+  FG+S   LP
Sbjct: 62  IMALNKGPLDSEEMARLFREIMSACLALEQPVKVAYLGPEGTFTQQAALKHFGESAVSLP 121

Query: 123 KSTINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL-- 180
            + I+++F  VE G   YG+VP ENST G V  TLD F+     I  E  LRI H LL  
Sbjct: 122 MAAIDEVFREVEAGAVHYGVVPVENSTEGVVNHTLDTFMDSSIKICGEVVLRIHHHLLVS 181

Query: 181 SKSKFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASIT 240
             ++   ++++YSHPQ F QC+K+LD+H   A+R+   S ++AA++  +E +SAAIA   
Sbjct: 182 ETTRRDKVSRIYSHPQSFAQCRKWLDAHYPHAERVPVSSNAEAAKLVKTEWHSAAIAGDM 241

Query: 241 CAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSV 300
            A+LYGLE + + I+D+ +N TRF I+G+     +G DKT I+  + +Q PG L   L  
Sbjct: 242 AAKLYGLEHIAEKIEDSPDNSTRFLIIGNQDVPMAGEDKTSIVVAMRNQ-PGTLHALLEP 300

Query: 301 FKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           F  H I+L ++++RPS    W+YVFF++ +GH+++  V   L ++     D+++LGSYP
Sbjct: 301 FHRHQIDLTRLETRPSRTGVWNYVFFIDFKGHRDEPKVAAVLEEVQLRAADLRVLGSYP 359



>gi|495570021|ref|WP_008294600.1| prephenate dehydratase [Congregibacter litoralis]
 gi|88699676|gb|EAQ96787.1| chorismate mutase/prephenate dehydratase [Congregibacter litoralis
           KT71]
          Length = 392

 Score =  272 bits (695), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 138/356 (38%), Positives = 211/356 (59%), Gaps = 9/356 (2%)

Query: 12  IDSIDTKLVQLLNERAR-----VSLNLEKAKEGSYXXXXXXXXVYVSG-KENQIFDRIHR 65
           ID++D K+  L+ ERAR      ++ L++ +            VY    +E Q+  RI  
Sbjct: 34  IDAVDAKIQALIAERARCAQRVAAIKLDEVQAARARGESDQEVVYYRPEREAQVLRRIME 93

Query: 66  LNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKST 125
            ++GPL   ++  +++EI+SA ++ +K L +AY GP G++T  AA+  FG +   +P+ T
Sbjct: 94  RDSGPLEGPTVAHVFREIMSACLALEKPLQVAYLGPEGTFTQAAALKHFGHAAICVPQVT 153

Query: 126 INDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSK--S 183
           I+ +F  VE GH  YGIVP ENST G V  TLD FI     I  E  LRISH L++   +
Sbjct: 154 IDTVFSEVESGHCNYGIVPVENSTEGMVSHTLDSFIDSPLKIAGEVELRISHHLMAAPGT 213

Query: 184 KFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAE 243
           K   ++++ +H Q   QC+ +LD+H  + +R+   S  +AA +AA    +AAIA    AE
Sbjct: 214 KMEEVSRICAHQQALAQCRNWLDAHWPKTERLAVSSNGEAARMAAEHSGTAAIAGDMAAE 273

Query: 244 LYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKD 303
           +Y L+VL + I+DA +N TRF ++G S   PSG DKT I+ +    +PGAL   L  F+ 
Sbjct: 274 VYQLDVLAEHIEDAADNTTRFLVIGRSEVPPSGMDKTSIVVS-SRNKPGALFTLLDPFRR 332

Query: 304 HGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           HG++L +ID+RPS  + W YVFF+E +GH +D  V + + ++ E  + +K LGSYP
Sbjct: 333 HGVSLTRIDTRPSRTEKWAYVFFIEFEGHVQDPAVLEIMRELEEQSILLKPLGSYP 388



>gi|114331557|ref|YP_747779.1| chorismate mutase [Nitrosomonas eutropha C91]
 gi|499953886|ref|WP_011634620.1| prephenate dehydratase [Nitrosomonas eutropha]
 gi|114308571|gb|ABI59814.1| prephenate dehydratase / chorismate mutase [Nitrosomonas eutropha
           C91]
          Length = 352

 Score =  272 bits (695), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 137/350 (39%), Positives = 217/350 (62%), Gaps = 11/350 (3%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID+ID +L++L+N RAR++  + + K G+          Y   +E+QIF R+ + N+GP
Sbjct: 11  EIDAIDDELLRLINTRARLAQQIGRQKSGT---------AYRPERESQIFSRLQQANSGP 61

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L  E +V ++ E+IS   + ++ L +AY GP G+++ +A   RFG ++  +P S+I+DIF
Sbjct: 62  LRDEHIVHLFTEVISICRALEEPLVVAYLGPQGTFSEEAVTKRFGSAVTSIPCSSIDDIF 121

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSK-SKFSSIN 189
             VE G   YG+VP ENST G+V  T+D  +     I  E  L I  CL+++ +  +SI 
Sbjct: 122 RKVESGAANYGVVPVENSTEGAVGRTMDLLLLTPLKICGELQLPIHQCLMAQHADLASIR 181

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLEV 249
           +VYSHPQ F QCQ +L+ +L  A RI+A S + AA   A++  +AAIA    AE++GL++
Sbjct: 182 RVYSHPQSFAQCQAWLNENLTAADRINAASNADAARQVAADSSAAAIAGKKAAEVFGLKI 241

Query: 250 LGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINLL 309
              +I+D+ NN TRF ++G     PSG DKT +     H RPG++ + L+ F  H +++ 
Sbjct: 242 CATNIEDSPNNTTRFLVVGMQEVAPSGKDKTSLAMAT-HNRPGSVHELLAPFAQHCVSMT 300

Query: 310 KIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           +++SRPS    W YVFF +++GH+EDE V +AL  + +    +K+ GSYP
Sbjct: 301 RLESRPSRASLWEYVFFTDIEGHQEDENVARALQMLRDNATFLKVFGSYP 350



>gi|496587959|ref|WP_009286587.1| Bifunctional P-protein, chorismate mutase/prephenate dehydra
           [Halomonas titanicae]
 gi|445566170|gb|ELY22277.1| Bifunctional P-protein, chorismate mutase/prephenate dehydra
           [Halomonas titanicae BH1]
          Length = 363

 Score =  272 bits (695), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 137/359 (38%), Positives = 216/359 (60%), Gaps = 8/359 (2%)

Query: 3   NVDLTFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDR 62
           N+D    Q+ID +D+ ++ L++ERA  +  +   K             Y   +E Q+  R
Sbjct: 7   NLD-ELRQRIDQLDSDILNLISERASCAQQVAHVK----LAEDKDAVFYRPEREAQVLRR 61

Query: 63  IHRLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLP 122
           I  LN GPL SE +  +++EI+SA ++ ++ + +AY GP G++T QAA+  FG+S   LP
Sbjct: 62  IMALNKGPLDSEEMARLFREIMSACLALEQPVKVAYLGPEGTFTQQAALKHFGESAVSLP 121

Query: 123 KSTINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL-- 180
            + I+++F  VE G   YG+VP ENST G V  TLD F+     I  E  LRI H LL  
Sbjct: 122 MAAIDEVFREVEAGAVHYGVVPVENSTEGVVNHTLDTFMDSSIKICGEVVLRIHHHLLVS 181

Query: 181 SKSKFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASIT 240
             ++   ++++YSHPQ F QC+K+LD+H   A+R+   S ++AA++  +E +SAAIA   
Sbjct: 182 ETTRRDKVSRIYSHPQSFAQCRKWLDAHYPHAERVPVSSNAEAAKLVKTEWHSAAIAGDM 241

Query: 241 CAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSV 300
            A+LYGLE + + I+D+ +N TRF I+G+     +G DKT I+  + +Q PG L   L  
Sbjct: 242 AAKLYGLEHIAEKIEDSPDNSTRFLIIGNQDVPMAGEDKTSIVVAMRNQ-PGTLHALLEP 300

Query: 301 FKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           F  H I+L ++++RPS    W+YVFF++ +GH+++  V   L ++     D+++LGSYP
Sbjct: 301 FHRHQIDLTRLETRPSRTGVWNYVFFIDFKGHRDEPEVAAVLEEVQLRAADLRVLGSYP 359



>gi|496313960|ref|WP_009023138.1| prephenate dehydratase [gamma proteobacterium NOR5-3]
 gi|219677400|gb|EED33765.1| P-protein [gamma proteobacterium NOR5-3]
          Length = 380

 Score =  271 bits (694), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 138/356 (38%), Positives = 209/356 (58%), Gaps = 9/356 (2%)

Query: 12  IDSIDTKLVQLLNERAR-----VSLNLEKAKEGSYXXXXXXXXVYVSG-KENQIFDRIHR 65
           ID++D K+  L+ ERAR      ++ L + +            VY    +E Q+  RI  
Sbjct: 22  IDAVDAKIQALIAERARCAQRVAAIKLAEVQAARARGEPDQEVVYYRPEREAQVLRRIME 81

Query: 66  LNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKST 125
            ++GPL   ++  +++EI+SA ++ +K L +AY GP G++T  AA+  FG +   +P+ T
Sbjct: 82  RDSGPLDGPTVAHVFREIMSACLALEKPLQVAYLGPEGTFTQAAALKHFGHAAICVPQVT 141

Query: 126 INDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSK--S 183
           I+ +F  VE GH  YGIVP ENST G V  TLD FI     I  E  +RISH LL+   +
Sbjct: 142 IDSVFSEVESGHCNYGIVPVENSTEGMVSHTLDSFIDSPLKIAGEVEMRISHHLLASPGT 201

Query: 184 KFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAE 243
           +  S+ ++ +H Q   QC+ +LD+H  + +R+   S  +AA +AA  P +AAIA    AE
Sbjct: 202 QMDSVTRICAHQQALAQCRNWLDAHWPKIERLAVSSNGEAARMAAENPGTAAIAGDMAAE 261

Query: 244 LYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKD 303
            Y L+ L + I+DA +N TRF ++G S   PSG DKT I+ +    +PGAL   L  F+ 
Sbjct: 262 AYHLDRLAEHIEDAADNTTRFLVIGRSEVPPSGQDKTSIVVS-SRNKPGALFTLLDPFRR 320

Query: 304 HGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           HG++L +ID+RPS  + W YVFF+E +GH +D  V + + ++ E  + +K LGSYP
Sbjct: 321 HGVSLTRIDTRPSRTEKWAYVFFIEFEGHVQDPAVVEIMRELEEQSILLKPLGSYP 376



>gi|289208386|ref|YP_003460452.1| chorismate mutase [Thioalkalivibrio sp. K90mix]
 gi|502747622|ref|WP_012982606.1| prephenate dehydratase [Thioalkalivibrio sp. K90mix]
 gi|288944017|gb|ADC71716.1| chorismate mutase [Thioalkalivibrio sp. K90mix]
          Length = 371

 Score =  271 bits (692), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 134/354 (37%), Positives = 217/354 (61%), Gaps = 6/354 (1%)

Query: 7   TFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRL 66
           +   +ID++D +L++LL+ERAR +  + + K             Y   +E +I  R+   
Sbjct: 19  SLRNRIDALDGQLLELLSERARCAEAVARVKR----DFEPNPVFYRPEREAEILRRVREE 74

Query: 67  NNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTI 126
           N GPLS E++V +++EI+S  ++ +  L++AY GP G++TH AA   FG ++   P ++I
Sbjct: 75  NPGPLSGEAVVRLFREIMSECLALEHPLTVAYLGPEGTFTHLAARKHFGHAVETTPLTSI 134

Query: 127 NDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKSK-F 185
           + +F +VE G   +G+VP ENS+ G V  T+D F+     I  E    I H LL++++  
Sbjct: 135 DQVFGAVEAGRAQFGVVPIENSSEGVVTHTVDCFLDSPLQICGEVVTPIHHHLLAQAEDL 194

Query: 186 SSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELY 245
           S + +V +H Q   QC+++LD+HL  A+R    S ++AAE+AA +P SAAIAS   AE Y
Sbjct: 195 SQVRRVRAHAQALAQCRQWLDTHLPHAEREAVSSNARAAEVAAKDPESAAIASRVAAEHY 254

Query: 246 GLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHG 305
           G+ +  + ++D  +N TRF I+G++S +PSG D+T I+ +  + RPG+L   L    + G
Sbjct: 255 GVPLRVQHVEDRADNTTRFLIIGTASTEPSGADRTSIMLSTAN-RPGSLYALLKPIAEAG 313

Query: 306 INLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           I+L +I+SRPS    W YVFF++L GH++D  +Q  L ++ +    VK+LGSYP
Sbjct: 314 ISLTRIESRPSRCTQWTYVFFLDLVGHQKDPAIQDCLEQLRQTADTVKVLGSYP 367



>gi|494175002|ref|WP_007114120.1| prephenate dehydratase [Halomonas boliviensis]
 gi|357969183|gb|EHJ91631.1| P-protein [Halomonas boliviensis LC1]
          Length = 363

 Score =  270 bits (690), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 136/359 (37%), Positives = 216/359 (60%), Gaps = 8/359 (2%)

Query: 3   NVDLTFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDR 62
           N+D    Q+ID +D+ ++ L++ERA  +  +   K             Y   +E Q+  R
Sbjct: 7   NLD-ELRQRIDQLDSDILNLISERASCAQQVAHVK----LAEDKDAVFYRPEREAQVLRR 61

Query: 63  IHRLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLP 122
           I  LN GPL SE +  +++EI+SA ++ ++ + +AY GP G++T QAA+  FG+S   LP
Sbjct: 62  IMALNKGPLDSEEMARLFREIMSACLALEQPVKVAYLGPEGTFTQQAALKHFGESAVSLP 121

Query: 123 KSTINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL-- 180
            + I+++F  VE G   YG+VP ENST G V  TLD F+     I  E  LRI H LL  
Sbjct: 122 MAAIDEVFREVEAGAVHYGVVPVENSTEGVVNHTLDTFMDSSIKICGEVVLRIHHHLLVS 181

Query: 181 SKSKFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASIT 240
             ++   ++++YSHPQ F QC+K+LD+H   A+R+   S ++AA++  +E +SAAIA   
Sbjct: 182 ETTRRDKVSRIYSHPQSFAQCRKWLDAHYPHAERVPVSSNAEAAKLVKTEWHSAAIAGDM 241

Query: 241 CAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSV 300
            A+LYGLE + + I+D+ +N TRF I+G+     +G DKT I+  + +Q PG L   L  
Sbjct: 242 AAKLYGLEHIAEKIEDSPDNSTRFLIIGNQDVPMAGEDKTSIVVAMRNQ-PGTLHALLEP 300

Query: 301 FKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           F  H I+L ++++RPS    W+YVFF++ +GH+++  V   L ++     ++++LGSYP
Sbjct: 301 FHRHQIDLTRLETRPSRTGVWNYVFFIDFKGHRDEPNVAAVLEEVQLRAAELRVLGSYP 359



>gi|495322228|ref|WP_008046974.1| prephenate dehydratase [Reinekea blandensis]
 gi|88776536|gb|EAR07753.1| Chorismate mutase [Reinekea sp. MED297]
          Length = 372

 Score =  270 bits (690), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 136/356 (38%), Positives = 211/356 (59%), Gaps = 6/356 (1%)

Query: 6   LTFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHR 65
           L   Q+ID +D +++ L++ RA+ +L + + K             Y   +E Q+  R+  
Sbjct: 17  LQLRQEIDQLDQEILNLISRRAQCALRVAEVK---MKADPGQAVFYRPEREAQVLSRVME 73

Query: 66  LNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKST 125
            N GPL +E +  +++EI+SA ++ ++ L +AY GP G++T QAA   FG  +   P   
Sbjct: 74  RNPGPLGNEDMARLFREIMSACLALERPLEVAYLGPEGTFTQQAAKKHFGQWVKTKPMPA 133

Query: 126 INDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLS--KS 183
           I+++F  V+ G   YG+VP ENST G V  TLD FI+    I+ E  LRI H L++   +
Sbjct: 134 IDEVFREVDAGAVQYGVVPIENSTEGVVNHTLDTFITSNIKIVGEVELRIHHHLMAGPNT 193

Query: 184 KFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAE 243
               I +VYSH Q   QC+K+LD+H+ +A+RI   S ++AA     E  SAAIA    +E
Sbjct: 194 NRDKITRVYSHQQSLAQCRKWLDAHMPQAERIAVNSNAEAARRVQGEWNSAAIAGEMASE 253

Query: 244 LYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKD 303
           LY LE++   I+D+ +N TRF I+G+     SG DKT ++ ++ ++ PGAL   L  F D
Sbjct: 254 LYDLEIIETKIEDSPDNSTRFLIIGAQEVDTSGADKTSLVVSMRNE-PGALYHLLKPFND 312

Query: 304 HGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            G+++ +++SRPS    W YVFF++  GH  D  VQ+AL+ I +  ++VK+LGSYP
Sbjct: 313 FGVDMTRLESRPSPSGNWTYVFFIDFVGHTRDANVQEALSAIRKTAVEVKVLGSYP 368



>gi|292492655|ref|YP_003528094.1| chorismate mutase [Nitrosococcus halophilus Nc 4]
 gi|502798591|ref|WP_013033567.1| prephenate dehydratase [Nitrosococcus halophilus]
 gi|291581250|gb|ADE15707.1| chorismate mutase [Nitrosococcus halophilus Nc 4]
          Length = 361

 Score =  270 bits (689), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 139/350 (39%), Positives = 212/350 (60%), Gaps = 6/350 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID++D ++ +LLNERA ++    + K+ +          +   +E +I  R+   N GP
Sbjct: 13  RIDALDEQIQRLLNERAELARQTAQIKQAA----GLGENCFRPEREAEILRRVIARNPGP 68

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS + +  +++EI+SA ++ +  L IAY GP G++T  AA+  FG S+   P   I++IF
Sbjct: 69  LSGQEMARLFREIMSACLALETPLMIAYLGPEGTFTEAAALKHFGHSVKTRPLIAIDEIF 128

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKSK-FSSIN 189
             VE G   YG+VP ENST G+V  TLD+F+     I  E  LRI H LLS+SK  + +N
Sbjct: 129 REVEAGTAHYGVVPVENSTEGAVTHTLDQFLISPLQICGEVELRIHHHLLSRSKTLAEVN 188

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLEV 249
           ++Y+H Q   QC+ +LD+HL   +RI   S ++AA  A +EP  AAIAS    E+YGL+ 
Sbjct: 189 RLYAHQQTLAQCRGWLDAHLAGCERIPVSSNAEAARRAGNEPDCAAIASDRAREIYGLQA 248

Query: 250 LGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINLL 309
           L  +I+D   N TRF ++GS +  PSGNDKT +L +    R G L D L    D+ I++ 
Sbjct: 249 LAINIEDEPGNTTRFLVIGSQAVVPSGNDKTSLLLS-GPNRSGLLYDLLRPLADNEISMT 307

Query: 310 KIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           +++SRPS ++ W YVFF++++GH +D  V  AL  + +    +K+LGSYP
Sbjct: 308 RLESRPSRRKLWEYVFFIDVEGHVDDPKVATALAALKDQASFLKLLGSYP 357



>gi|495221040|ref|WP_007945815.1| prephenate dehydratase [Pseudomonas sp. GM21]
 gi|398130003|gb|EJM19355.1| chorismate mutase, clade 2 [Pseudomonas sp. GM21]
          Length = 364

 Score =  270 bits (689), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 214/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID++DTK+++L++ERAR +  + + K  S          Y   +E Q+  R+   N GP
Sbjct: 12  RIDALDTKVLELISERARCAQEVARVKMASLAEGEVPV-FYRPEREAQVLKRVMERNKGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LGNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISKPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 SRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++GS    P+G+DKT I+ ++ + +PGAL + L  F D+GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGSQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHDNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +++  L KI++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLIKGVLEKISQEAVALKVLGSYP 360



>gi|498135587|ref|WP_010449743.1| prephenate dehydratase [Pseudomonas fuscovaginae]
          Length = 364

 Score =  270 bits (689), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 137/351 (39%), Positives = 212/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L++ERAR +  + + K  S          Y   +E Q+  R+   N GP
Sbjct: 12  RIDSLDEKILELISERARCAQEVARVKMASLAEGEVPV-FYRPEREAQVLKRVMERNQGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L SE +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LGSEDMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISKPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 TRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAAGLYGLV 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++GS    P+G+DKT I+ ++ + +PGAL + L  F D+GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGSQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHDNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +V+  L KI++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLVKGVLEKISQEAVALKVLGSYP 360



>gi|407696801|ref|YP_006821589.1| prephenate dehydratase domain-containing protein [Alcanivorax
           dieselolei B5]
 gi|504808210|ref|WP_014995312.1| prephenate dehydratase [Alcanivorax dieselolei]
 gi|407254139|gb|AFT71246.1| Prephenate dehydratase domain protein [Alcanivorax dieselolei B5]
          Length = 360

 Score =  270 bits (689), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 135/355 (38%), Positives = 205/355 (57%), Gaps = 7/355 (1%)

Query: 7   TFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRL 66
           +   QID++D +L  LLN RA ++  +   K             Y   +E Q+  RI   
Sbjct: 7   SLRDQIDALDQQLQTLLNRRAELAHAVADVKR----REDSNPVFYRPEREAQVLQRIKER 62

Query: 67  NNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTI 126
           N GP+  E++  +++E++S  ++ ++ + +A+ GP G++T QAA+  FG ++  +P   I
Sbjct: 63  NQGPIDGEAMARLFREVMSICLALEQPMRVAFLGPEGTFTQQAALKHFGHAVESVPLGAI 122

Query: 127 NDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLS--KSK 184
           +++F  VE G   YG+VP ENST G V  TLD F+S    I  E  LRI H LL+   ++
Sbjct: 123 DEVFREVEAGAAHYGVVPVENSTEGMVSHTLDTFMSSSLKICGEVELRIHHHLLAGPHTR 182

Query: 185 FSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAEL 244
              + +VYSH Q   QC+++LD+HL   +RI   S ++AA     E  + AIA    AEL
Sbjct: 183 RDKVTRVYSHQQTLAQCRQWLDAHLPTVERIPVSSNAEAARRLRDEWNALAIAGDMAAEL 242

Query: 245 YGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDH 304
           YGLE +  +I+D  +N TRF ++G     PSG DKT +L T    RPG L D L  F++ 
Sbjct: 243 YGLERVQSNIEDRPDNTTRFLVIGRQDTPPSGRDKTSMLVT-GKNRPGLLSDMLLPFREQ 301

Query: 305 GINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           GINL +++SRPS    W YVFF++ +GHKED +++  L ++      ++ILGSYP
Sbjct: 302 GINLTRLESRPSRTANWSYVFFIDCEGHKEDPLLKNVLERLEGDGNTIRILGSYP 356



>gi|291614523|ref|YP_003524680.1| chorismate mutase [Sideroxydans lithotrophicus ES-1]
 gi|502795215|ref|WP_013030191.1| prephenate dehydratase [Sideroxydans lithotrophicus]
 gi|291584635|gb|ADE12293.1| chorismate mutase [Sideroxydans lithotrophicus ES-1]
          Length = 354

 Score =  269 bits (688), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 135/353 (38%), Positives = 216/353 (61%), Gaps = 10/353 (2%)

Query: 8   FSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLN 67
           + +QID ID +L++L+N+RA ++  +   K            V    +E Q+  R+ R N
Sbjct: 8   YREQIDRIDDELLKLINQRAGLAQQIGHVKGNG--------AVLRPEREAQVLQRMARAN 59

Query: 68  NGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTIN 127
            GPLS++ + +++ EI+S   + +  L +AY GP G+++  A   RFG +   +P  +I+
Sbjct: 60  AGPLSNQGVTTLFTEIMSQCRALEAPLRVAYLGPHGTFSEAAVFQRFGQATEGVPVDSID 119

Query: 128 DIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLS-KSKFS 186
            +FD+VE G   YG+VP ENST G++  TLD  ++   +I  E  L++  C+LS ++  S
Sbjct: 120 GVFDAVEGGMANYGLVPVENSTEGAIGRTLDLLLNSNLNICGEVLLQVHQCVLSNENDLS 179

Query: 187 SINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYG 246
            I KVYSHPQ FGQCQ +L++HL  ++RI A S + AA +AA E ++AA+A     E + 
Sbjct: 180 LIRKVYSHPQSFGQCQGWLNAHLPHSERITASSNADAARLAAEESFAAAVAGEQAGEHFK 239

Query: 247 LEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGI 306
           L+VL ++I+D   N TRF ++G     PSG DKT +  +  + RPGA+ D L+ F  +G+
Sbjct: 240 LKVLARNIEDDARNTTRFLVIGKQDVAPSGKDKTSLAMSAAN-RPGAMHDLLTPFAQNGV 298

Query: 307 NLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           ++ K++SRPS    W YVF+V+++GH+ D  V  +L ++ +    VK+LGSYP
Sbjct: 299 SMTKMESRPSRTGLWEYVFYVDIEGHQSDAKVAASLAQLKQIASFVKVLGSYP 351



>gi|495646147|ref|WP_008370726.1| prephenate dehydratase [Pseudomonas sp. M47T1]
 gi|388276065|gb|EIK95648.1| prephenate dehydratase [Pseudomonas sp. M47T1]
          Length = 364

 Score =  269 bits (688), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 213/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID++D K+++L+++RAR +  + + K  S          Y   +E Q+  R+   N GP
Sbjct: 12  RIDALDEKILELISDRARCAEEVARVKMASLAEGEVPV-FYRPEREAQVLKRVMERNKGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS+E +  +++E++S+ ++ +  L +AY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LSNEEMARLFREVMSSCLALENPLKVAYLGPEGTFTQAAAMKHFGHAVISKPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLIGDSTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +RI   S ++AA+    E  SAAIA    A LYGL+
Sbjct: 191 TRIYSHAQSLAQCRKWLDAHYPNVERIAVSSNAEAAKRVKGEWNSAAIAGDMAASLYGLQ 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+GS    P+G+DKT I+ ++ + RPGAL + L  F D+GI+L
Sbjct: 251 RLAEKIEDRPDNATRFLIIGSQEVPPTGDDKTSIIVSMSN-RPGALHELLVPFHDNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +++  L +I++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLIKGVLEQISQEAVALKVLGSYP 360



>gi|495375548|ref|WP_008100260.1| prephenate dehydratase [Verrucomicrobiae bacterium DG1235]
 gi|198258147|gb|EDY82455.1| prephenate dehydratase domain protein [Verrucomicrobiae bacterium
           DG1235]
          Length = 355

 Score =  269 bits (687), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 148/360 (41%), Positives = 220/360 (61%), Gaps = 13/360 (3%)

Query: 7   TFSQQIDSIDTKLVQLLNERARVSLNLEKAK--EGSYXXXXXXXXVYVSGKENQIFDRIH 64
           T  ++ID ID +++ LLNER R +  +   K  EGS         +YV+ +E Q+  ++ 
Sbjct: 5   TLRKKIDEIDKEVLTLLNERVRTAAEIGHVKRLEGS--------PIYVASREEQVLRKLG 56

Query: 65  RLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKS 124
            LN GPLS +++ +IY+EI+SA+++ +K + IAY GP  +YTHQAA+ +FG SI Y+   
Sbjct: 57  ALNQGPLSDDAIRAIYREIMSAAIALEKPMRIAYLGPEATYTHQAALKKFGASIEYIVAP 116

Query: 125 TINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKSK 184
            I D+F  V KG   +G++P ENST G+V  ++D F      I A+ +  I HCL+S+S+
Sbjct: 117 AIPDVFHMVAKGEADHGVIPIENSTEGAVSHSMDMFFESDLKICAQIFTPIVHCLISQSE 176

Query: 185 FSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAEL 244
            S I +VYS  Q  GQC+K+L +HL  A      ST++A +IA  EP +AAIASI  A+L
Sbjct: 177 PSEIERVYSKDQAIGQCRKWLHTHLGNASLHTCDSTTQAVQIAKVEPKAAAIASILAADL 236

Query: 245 YGLEVLGKDIQDAKNNVTRFFILG--SSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFK 302
           YG+ V+   IQD  +N TRF ++G  SS   P    K+  L ++D    GAL   L VF 
Sbjct: 237 YGVPVVADGIQDRVDNTTRFLVIGKESSGYAPGVEFKSSFLISID-DTVGALEKTLHVFS 295

Query: 303 DHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYPDQR 362
              +NL KI+SRPS +  W Y FF+++ GH ++  + +A+ ++  FC  VK LGSYP+ +
Sbjct: 296 SRKLNLSKIESRPSGKTAWEYCFFIDVLGHHDEAPIIEAVEELKTFCPFVKWLGSYPNAK 355



>gi|328952379|ref|YP_004369713.1| prephenate dehydratase [Desulfobacca acetoxidans DSM 11109]
 gi|503470984|ref|WP_013705645.1| prephenate dehydratase [Desulfobacca acetoxidans]
 gi|328452703|gb|AEB08532.1| prephenate dehydratase [Desulfobacca acetoxidans DSM 11109]
          Length = 361

 Score =  269 bits (687), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 142/351 (40%), Positives = 210/351 (59%), Gaps = 8/351 (2%)

Query: 10  QQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNG 69
           +QID  D +L+ L+N+R +++  + + K                 +E ++ DR+ R N G
Sbjct: 9   RQIDITDEQLLTLINQRLQLAQTIGEIKN------REDLATLDPKREQEVLDRLKRFNTG 62

Query: 70  PLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDI 129
           PL+ E L +I++EIISA+   Q+ LS+A+ GP  ++TH AAI +FG S  + P  TI+++
Sbjct: 63  PLTEEGLRNIFREIISAARQVQRPLSVAFLGPEATFTHLAAIKKFGRSTFFKPLPTISEV 122

Query: 130 FDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSSI 188
           F +VEK +   G++P ENST G V  TLD+F+  K  I  E YL ISH L+S+S + + I
Sbjct: 123 FMAVEKSNHHLGVIPIENSTEGVVNETLDQFVETKLQICGEIYLEISHDLISRSGQINDI 182

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
             +Y+HP   GQC+K+L  HL +   ++  ST  AA+ AA  P SAAIAS   A LY L 
Sbjct: 183 EIIYTHPHAHGQCRKWLQGHLPQIPVLEVSSTGLAAQKAAHNPNSAAIASGFAASLYELR 242

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
           V+   I+D + N T FFI+G  +   +G DKT I+F V    PGAL + L    + GIN+
Sbjct: 243 VVESRIEDHRENATHFFIIGPYAPGATGADKTSIIFAVA-DTPGALYNMLRPLAERGINM 301

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I SRP     W Y+FFV+L GH ++  +Q+ L+++ E     KILGS+P
Sbjct: 302 TRIVSRPMKTVAWRYLFFVDLDGHLQESALQECLHEMEEMSAFFKILGSFP 352



>gi|337289011|ref|YP_004628483.1| prephenate dehydratase [Thermodesulfobacterium geofontis OPF15]
 gi|503676177|ref|WP_013910253.1| prephenate dehydratase [Thermodesulfobacterium geofontis]
 gi|334902749|gb|AEH23555.1| prephenate dehydratase [Thermodesulfobacterium geofontis OPF15]
          Length = 358

 Score =  269 bits (687), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 144/361 (39%), Positives = 211/361 (58%), Gaps = 9/361 (2%)

Query: 1   MENVDLT-FSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQI 59
           M+N  L    ++ID IDT++V+LL ER  V+  + K KE                +E +I
Sbjct: 1   MKNNKLQELREKIDKIDTQIVELLKERIEVAKEIGKLKENMGYESFDLL------REKEI 54

Query: 60  FDRIHRLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSIN 119
            +++ ++N      ++L  IY EII A  S+Q+ + +AY GP  +++H AA+  FG S  
Sbjct: 55  LNKVLKINQKVFPEDALKVIYSEIIKACRSAQQKIKVAYLGPEATFSHIAALNYFGTSAE 114

Query: 120 YLPKSTINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCL 179
            +P  TI D+F+ V      +G+VP ENS  G V TTLD        +  E Y  ISH L
Sbjct: 115 LIPVETITDVFEEVSSERVNFGVVPIENSIEGVVATTLDAIYEYGLKVCGEIYESISHHL 174

Query: 180 LSKS-KFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIAS 238
           ++++ K   I KV SHPQ   QC+K+L   L         ST+ AA+ AA +    AIAS
Sbjct: 175 MNQTGKIEDIKKVLSHPQAIAQCRKWLRKKLPSVPIETVPSTALAAKWAAVDESVGAIAS 234

Query: 239 ITCAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGL 298
           +  A+LY L+++ K+I+D K N TRF+I+G +  +P+G+DKT +LF+V   RPGAL D L
Sbjct: 235 LVAAKLYHLQIVAKNIEDIKGNSTRFWIIGKTEVQPTGDDKTSLLFSV-ADRPGALFDVL 293

Query: 299 SVFKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSY 358
             F    INL KI+SRPS  +PW YVFF++ +GH +DE +++ L ++  +CL V  LGSY
Sbjct: 294 RCFAVRKINLTKIESRPSKDEPWKYVFFLDCEGHIKDEKIKECLEEMQNYCLQVVWLGSY 353

Query: 359 P 359
           P
Sbjct: 354 P 354



>gi|70731662|ref|YP_261404.1| chorismate mutase [Pseudomonas protegens Pf-5]
 gi|501681821|ref|YP_008001647.1| P-protein PheA [Pseudomonas protegens CHA0]
 gi|499375005|ref|WP_011062583.1| prephenate dehydratase [Pseudomonas protegens]
 gi|68345961|gb|AAY93567.1| chorismate mutase/prephenate dehydratase [Pseudomonas protegens
           Pf-5]
 gi|500243985|gb|AGL86143.1| P-protein PheA [Pseudomonas protegens CHA0]
          Length = 364

 Score =  269 bits (687), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 214/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID++D K+++L++ERAR +  + + K GS          Y   +E Q+  R+   N GP
Sbjct: 12  RIDALDEKVLELISERARCAQEVARVKMGSLAEGEVPV-FYRPEREAQVLKRVMERNQGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LGNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISKPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 SRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++G+    P+G+DKT I+ ++ + +PGAL + L  F D+GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGNQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHDNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +V+  L KI++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLVKGVLEKISQEAVALKVLGSYP 360



>gi|333983583|ref|YP_004512793.1| chorismate mutase [Methylomonas methanica MC09]
 gi|503584469|ref|WP_013818545.1| prephenate dehydratase [Methylomonas methanica]
 gi|333807624|gb|AEG00294.1| chorismate mutase [Methylomonas methanica MC09]
          Length = 361

 Score =  269 bits (687), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 139/350 (39%), Positives = 212/350 (60%), Gaps = 6/350 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           QID+ID +++QL+N+RA  ++ + K K+            Y   +E Q+  RI  LN GP
Sbjct: 13  QIDAIDQQILQLINQRANCAIEVAKTKQAE----GETGSFYRPDREAQVLRRIKELNPGP 68

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS ++   +++E++SA ++ +K L +AY GP G++T QA    FG ++  +P  TI++IF
Sbjct: 69  LSDDAAARLFREVMSACLALEKPLEVAYLGPQGTFTQQATFKHFGHAVKDVPVPTIHEIF 128

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSK-SKFSSIN 189
            +VE GH  +G+VP ENST G +  TLDRFI+    I  E  +R+   LL K      I+
Sbjct: 129 QAVETGHCQFGVVPVENSTEGVIAHTLDRFINSPLKICGEVEIRVHQNLLGKMDDLIGID 188

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLEV 249
           +V+SH Q   QC+++L+++L         S ++AA +A+ +   AAIA +  AELY L +
Sbjct: 189 EVFSHQQSLAQCRQWLNTYLPGVTVTAVSSNAEAARLASLDHSKAAIAGLVAAELYDLNI 248

Query: 250 LGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINLL 309
           + K+I+D  NN TRF I+G+     +G DKT IL +  +Q  GAL   L  F ++GI++ 
Sbjct: 249 IEKNIEDEANNTTRFIIIGAQQPVSTGLDKTSILVSTGNQS-GALHRILGPFAEYGISMA 307

Query: 310 KIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            I+SRPS Q  W YVFF++++GH +DE V KAL  +      +KILGSYP
Sbjct: 308 HIESRPSRQGLWDYVFFIDIEGHCDDEHVAKALKVLQNNVKMLKILGSYP 357



>gi|489311406|ref|WP_003218812.1| prephenate dehydratase [Pseudomonas sp. Ag1]
 gi|395337330|gb|EJF69187.1| P-protein [Pseudomonas sp. Ag1]
 gi|404505216|gb|EKA19247.1| histidinol-phosphate aminotransferase [Pseudomonas fluorescens
           BBc6R8]
          Length = 364

 Score =  269 bits (687), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 136/351 (38%), Positives = 213/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L++ERAR +  + + K  S          Y   +E Q+  R+   N GP
Sbjct: 12  RIDSLDEKVLELISERARCAQEVARVKMASLAEGEVPV-FYRPEREAQVLKRVMERNKGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LGNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISKPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 SRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++GS    P+G+DKT I+ ++ + +PGAL + L  F D+GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGSQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHDNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +V+  L KI++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLVKGVLEKISQEAVALKVLGSYP 360



>gi|237653700|ref|YP_002890014.1| chorismate mutase [Thauera sp. MZ1T]
 gi|501581473|ref|WP_012585794.1| prephenate dehydratase [Thauera sp. MZ1T]
 gi|237624947|gb|ACR01637.1| chorismate mutase [Thauera sp. MZ1T]
          Length = 355

 Score =  268 bits (686), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 132/360 (36%), Positives = 212/360 (58%), Gaps = 10/360 (2%)

Query: 1   MENVDLTFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIF 60
           M +  L    +ID ID +++  L ERAR +  + + K G           Y   +E Q+ 
Sbjct: 1   MSDELLKLRNEIDRIDEEILARLAERARCAQRVGEIKRG--------VMYYRPEREAQVL 52

Query: 61  DRIHRLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINY 120
            R+  LN GPLSS+++ +I++E++SA +  ++ L +AY GP G+++  A+   FG + N+
Sbjct: 53  RRLAELNPGPLSSDAVKTIFREVMSACLGLEQPLRVAYLGPAGTFSESASRKHFGSAPNF 112

Query: 121 LPKSTINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL 180
           L  + I+D+F +VE G+  YG+VP ENST G+V  TLD  ++    +  E  LRI   L+
Sbjct: 113 LAMAAIDDVFRAVEAGNADYGVVPVENSTEGAVGGTLDLLLANPLKVCGEVRLRIHQQLM 172

Query: 181 SKSK-FSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASI 239
           S+++   +  ++YSH Q   QC ++L+ +L    RI   S ++AA +A+ +P S AIA  
Sbjct: 173 SRAEGIGAARRIYSHAQSLAQCHEWLNRNLPHLPRIPVASNAEAARMASEDPESCAIAGD 232

Query: 240 TCAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLS 299
             A+LYGL +L  +I+D  NN TRF ++      PSG D+T ++F+  + RPGA+   L 
Sbjct: 233 AAAQLYGLNILAPNIEDDPNNTTRFLVIADHDAGPSGKDRTSLVFSAPN-RPGAIHSLLE 291

Query: 300 VFKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
               HG+++ K+ SRP+    W YVF+ ++ GH+ED  V  AL +++E    VKI+GSYP
Sbjct: 292 PMARHGVDMTKLQSRPARSGLWEYVFYADINGHREDPEVAAALRELDERAAFVKIIGSYP 351



>gi|490495468|ref|WP_004361651.1| chorismate mutase [Thauera phenylacetica]
 gi|479309198|gb|ENO97298.1| chorismate mutase [Thauera phenylacetica B4P]
          Length = 355

 Score =  268 bits (686), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 131/360 (36%), Positives = 212/360 (58%), Gaps = 10/360 (2%)

Query: 1   MENVDLTFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIF 60
           M +  L    +ID ID +++  L ERAR +  + + K G           Y   +E Q+ 
Sbjct: 1   MSDELLKLRNEIDRIDEEILARLAERARCAQRVGEIKRG--------VMYYRPEREAQVL 52

Query: 61  DRIHRLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINY 120
            R+  LN GPLS++++ +I++E++SA +  ++ L +AY GP G+++  A+   FG + N 
Sbjct: 53  RRLAELNPGPLSADAVKTIFREVMSACLGLEQPLRVAYLGPAGTFSESASRKHFGSAPNL 112

Query: 121 LPKSTINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL 180
           LP + I+D+F +VE G+  YG+VP ENST G+V  TLD  ++    +  E  LRI   L+
Sbjct: 113 LPMAAIDDVFRAVEAGNADYGVVPVENSTEGAVGGTLDLLLANPLKVCGEVRLRIHQQLM 172

Query: 181 SKSK-FSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASI 239
           S+++   +  ++YSH Q   QC ++L+ +L    RI   S ++AA +A+ +P S AIA  
Sbjct: 173 SRAEGIGAARRIYSHAQSLAQCHEWLNRNLPHLPRIPVASNAEAARMASEDPESCAIAGE 232

Query: 240 TCAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLS 299
             A+LYGL +L  +I+D  NN TRF ++      PSG D+T ++F+  + RPGA+   L 
Sbjct: 233 AAAQLYGLNILAPNIEDDPNNTTRFLVIADHDAGPSGKDRTSLVFSAPN-RPGAIHSLLE 291

Query: 300 VFKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
               HG+++ K+ SRP+    W YVF+ ++ GH++D  V  AL +++E    VKI+GSYP
Sbjct: 292 PMARHGVDMTKLQSRPARSGLWEYVFYADINGHRDDPEVAAALRELDERAAFVKIIGSYP 351



>gi|229589166|ref|YP_002871285.1| chorismate mutase/prephenate dehydratase [Pseudomonas fluorescens
           SBW25]
 gi|387892906|ref|YP_006323203.1| P-protein [Pseudomonas fluorescens A506]
 gi|489264826|ref|WP_003172650.1| prephenate dehydratase [Pseudomonas fluorescens]
 gi|229361032|emb|CAY47894.1| chorismate mutase/prephenate dehydratase [Pseudomonas fluorescens
           SBW25]
 gi|311286417|gb|EFQ64981.1| chorismate mutase/prephenate dehydrogenase [Pseudomonas fluorescens
           WH6]
 gi|387160220|gb|AFJ55419.1| P-protein [Pseudomonas fluorescens A506]
 gi|388001482|gb|EIK62811.1| P-protein [Pseudomonas fluorescens SS101]
 gi|388006799|gb|EIK68065.1| P-protein [Pseudomonas synxantha BG33R]
          Length = 364

 Score =  268 bits (686), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 136/351 (38%), Positives = 213/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L++ERAR +  + + K  S          Y   +E Q+  R+   N GP
Sbjct: 12  RIDSLDEKVLELISERARCAQEVARVKMASLAEGEVPV-FYRPEREAQVLKRVMERNKGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LGNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISKPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 SRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++GS    P+G+DKT I+ ++ + +PGAL + L  F D+GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGSQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHDNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +V+  L KI++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFIGHHRDPLVKGVLEKISQEAVALKVLGSYP 360



>gi|489542414|ref|WP_003447098.1| prephenate dehydratase [Pseudomonas sp. Lz4W]
 gi|459958801|gb|EMI04810.1| P-protein [Pseudomonas sp. Lz4W]
          Length = 364

 Score =  268 bits (686), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 213/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L++ERAR +  + + K  S          Y   +E Q+  R+   N GP
Sbjct: 12  RIDSLDEKVLELISERARCAQEVARVKMASLAEGEVPV-FYRPEREAQVLKRVMERNKGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LGNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISKPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 SRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++GS    P+G+DKT I+ ++ + RPGAL + L  F ++GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGSQEVPPTGDDKTSIIVSMSN-RPGALHELLVPFHENGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +V+  L +I++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFAGHHRDPLVKSVLEQISQEAVALKVLGSYP 360



>gi|495183614|ref|WP_007908404.1| prephenate dehydratase [Pseudomonas sp. GM80]
 gi|398118436|gb|EJM08167.1| chorismate mutase, clade 2 [Pseudomonas sp. GM16]
 gi|398153698|gb|EJM42194.1| chorismate mutase, clade 2 [Pseudomonas sp. GM24]
 gi|398247723|gb|EJN33158.1| chorismate mutase, clade 2 [Pseudomonas sp. GM80]
          Length = 364

 Score =  268 bits (686), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 134/351 (38%), Positives = 214/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID++DTK+++L++ERAR +  + + K  S          Y   +E Q+  R+   N GP
Sbjct: 12  RIDALDTKVMELISERARCAQEVARVKMASLAEGEVPV-FYRPEREAQVLKRVMERNQGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LGNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISKPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 SRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++G+    P+G+DKT I+ ++ + +PGAL + L  F D+GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGNQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHDNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +++  L KI++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLIKGVLEKISQEAVALKVLGSYP 360



>gi|378949569|ref|YP_005207057.1| protein PheA [Pseudomonas fluorescens F113]
 gi|504103238|ref|WP_014337224.1| prephenate dehydratase [Pseudomonas fluorescens]
 gi|359759583|gb|AEV61662.1| PheA [Pseudomonas fluorescens F113]
          Length = 364

 Score =  268 bits (686), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 136/351 (38%), Positives = 213/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID++D K+++L++ERAR +  + + K  S          Y   +E Q+  R+   N GP
Sbjct: 12  RIDALDEKVLELISERARCAQEVARVKMASLAEGEVPV-FYRPEREAQVLKRVMERNKGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L IAY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LGNEEMARLFREIMSSCLALEQPLKIAYLGPEGTFTQAAAMKHFGHAVISKPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 SRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++GS    P+G+DKT I+ ++ + +PGAL + L  F D+GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGSQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHDNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +V+  L KI++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLVKGVLEKISQEAVALKVLGSYP 360



>gi|495346883|ref|WP_008071613.1| prephenate dehydratase [Pseudomonas sp. GM79]
 gi|398237709|gb|EJN23455.1| chorismate mutase, clade 2 [Pseudomonas sp. GM79]
          Length = 364

 Score =  268 bits (686), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 213/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID++D K+++L++ERAR +  + + K  S          Y   +E Q+  R+   N GP
Sbjct: 12  RIDALDEKVLELISERARCAQEVARVKMASLAEGEVPV-FYRPEREAQVLKRVMERNQGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LGNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISKPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 SRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAASLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++GS    P+G+DKT I+ ++ + +PGAL + L  F D+GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGSQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHDNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +V+  L KI++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLVKGVLEKISQEAVALKVLGSYP 360



>gi|498147528|ref|WP_010461684.1| prephenate dehydratase [Pseudomonas mandelii]
          Length = 364

 Score =  268 bits (686), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 134/351 (38%), Positives = 213/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID++D K+++L++ERAR +  + + K  S          Y   +E Q+  R+   N GP
Sbjct: 12  RIDALDAKVLELISERARCAQEVARVKMASLAEGEVPV-FYRPEREAQVLKRVMERNQGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LGNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISKPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 SRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAASLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++GS    P+G+DKT I+ ++ + +PGAL + L  F D+GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGSQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHDNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +++  L KI++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLIKGVLEKISQEAVALKVLGSYP 360



>gi|494256103|ref|WP_007150027.1| prephenate dehydratase [Alcanivorax sp. DG881]
 gi|196194660|gb|EDX89619.1| prephenate dehydratase domain protein [Alcanivorax sp. DG881]
          Length = 360

 Score =  268 bits (686), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 135/354 (38%), Positives = 205/354 (57%), Gaps = 7/354 (1%)

Query: 8   FSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLN 67
              QID +D +L  LLNERA ++  + + K  +          Y   +E Q+  R+   N
Sbjct: 8   LRHQIDELDQQLQNLLNERATLAHKVAEVKTAT----DPNPVFYRPEREAQVLRRVKERN 63

Query: 68  NGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTIN 127
            GPL  E++   ++E++SA ++ ++ + +A+ GP G++T QAA+  FG ++  LP   I+
Sbjct: 64  QGPLDGETMARFFREVMSACLALEQRMKVAFLGPEGTFTQQAALKHFGHAVESLPLGAID 123

Query: 128 DIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLS--KSKF 185
           ++F  VE G   YG+VP ENST G V  TLD F++    I  E  LRI H LL+   ++ 
Sbjct: 124 EVFREVESGAANYGVVPVENSTEGVVNHTLDTFMTSSLKICGEVELRIHHHLLAGEHTRQ 183

Query: 186 SSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELY 245
             + +VYSH Q   QC+++LD+H+   +RI   S ++AA     E  + AIA     ELY
Sbjct: 184 DKVTRVYSHQQTLAQCRQWLDAHMPGVERIAVSSNAEAARRLKDEWNALAIAGEMAEELY 243

Query: 246 GLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHG 305
           GL  + ++I+D  +N TRF I+G      SG DKT ++ +    RPG L + LS F++ G
Sbjct: 244 GLTAVQRNIEDRPDNTTRFIIIGRQDTPASGCDKTSLMIS-GKNRPGLLYEVLSPFREEG 302

Query: 306 INLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           INL +++SRPS    W YVFFV+ +GHKED  +Q  L+K+      +K+LGSYP
Sbjct: 303 INLTRLESRPSRTANWSYVFFVDCEGHKEDATLQAVLDKLEAAGNTIKLLGSYP 356



>gi|496215645|ref|WP_008929887.1| prephenate dehydratase [Alcanivorax hongdengensis]
 gi|407765019|gb|EKF73480.1| chorismate mutase/prephenate dehydratase [Alcanivorax hongdengensis
           A-11-3]
          Length = 360

 Score =  268 bits (686), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 133/355 (37%), Positives = 209/355 (58%), Gaps = 7/355 (1%)

Query: 7   TFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRL 66
           +  Q+ID++D  L +LLN+RA ++  + + K  +          Y   +E Q+  R+   
Sbjct: 7   SLRQKIDALDETLQELLNQRAALAHQVAEVKLAT----DPNPVFYRPEREAQVLRRVKER 62

Query: 67  NNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTI 126
           N GPL  E++   ++EI+SA ++ ++ + +A+ GP G++T QAA+  FG ++  +P   I
Sbjct: 63  NQGPLDGETMARFFREIMSACLALEQRMKVAFLGPEGTFTQQAALKHFGHAVETVPLGAI 122

Query: 127 NDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLS--KSK 184
           +++F  VE G   YG+VP ENST G V  TLD F++ +  I  E  LRI H LL+   ++
Sbjct: 123 DEVFREVESGAANYGVVPVENSTEGVVNHTLDTFMTSELKICGEVELRIHHHLLAGEHTQ 182

Query: 185 FSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAEL 244
              + +VYSH Q   QC+++LD+H+   +RI   S ++AA     E  + AIA     EL
Sbjct: 183 RDKVTRVYSHQQTLAQCRQWLDAHMPGVERIAVSSNAEAARRLKDEWNALAIAGEMAEEL 242

Query: 245 YGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDH 304
           YGL+ + ++I+D  +N TRF I+G      SGNDKT ++ +    RPG L + L+ F+D 
Sbjct: 243 YGLQAVQRNIEDRPDNTTRFLIIGKQDTPASGNDKTSLMVS-GKNRPGLLFEVLAPFRDQ 301

Query: 305 GINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           GINL +++SRPS    W YVFFV+ +GHKED  ++  L  +      +K+LGSYP
Sbjct: 302 GINLTRLESRPSRTANWSYVFFVDCEGHKEDGKLETVLETLENAGNSIKLLGSYP 356



>gi|497899232|ref|WP_010213388.1| prephenate dehydratase [Pseudomonas amygdali]
          Length = 364

 Score =  268 bits (685), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 212/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L++ERAR +  + + K  S          Y   +E  +  R+   N GP
Sbjct: 12  RIDSLDEKVLELISERARCAQEVARVKMSSLAEGEVPV-FYRPEREAAVLRRVMERNRGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS+E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++  LP + I+++F
Sbjct: 71  LSNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISLPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGESTKMQSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 TRIYSHAQSLAQCRKWLDAHYPNVERVAVASNAEAAKRVKGEWNSAAIAGYMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+G+    P+G+DKT I+ ++ + +PGAL + L  F + G++L
Sbjct: 251 RLAEKIEDRPDNSTRFLIIGNQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHESGLDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH +D +V+  L KI+   + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHQDPLVKAVLEKISSEAVALKVLGSYP 360



>gi|495260633|ref|WP_007985388.1| prephenate dehydratase [Pseudomonas sp. GM48]
 gi|398170737|gb|EJM58665.1| chorismate mutase, clade 2 [Pseudomonas sp. GM48]
          Length = 364

 Score =  268 bits (685), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 134/351 (38%), Positives = 214/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID++D K+++L++ERAR +  + + K  S          Y   +E Q+  R+   N GP
Sbjct: 12  RIDALDEKVLELISERARCAQEVARVKMASLAEGEVPV-FYRPEREAQVLKRVMERNQGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LGNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISKPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A+LYGL 
Sbjct: 191 SRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAADLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++G+    P+G+DKT I+ ++ + +PGAL + L  F D+GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGNQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHDNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +V+  L KI++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLVKGVLEKISQEAVALKVLGSYP 360



>gi|498252345|ref|WP_010566501.1| prephenate dehydratase [Pseudomonas extremaustralis]
          Length = 364

 Score =  268 bits (685), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 213/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L++ERAR +  + + K  S          Y   +E Q+  R+   N GP
Sbjct: 12  RIDSLDEKVLELISERARCAQEVARVKMASLAEGEVPV-FYRPEREAQVLKRVMERNKGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LGNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISKPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 SRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAASLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++G+    P+G+DKT I+ ++ + +PGAL + L  F D+GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGNQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHDNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +V+  L KI++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLVKGVLEKISQEAVALKVLGSYP 360



>gi|495174932|ref|WP_007899727.1| prephenate dehydratase [Pseudomonas sp. GM41(2012)]
 gi|398111561|gb|EJM01443.1| chorismate mutase, clade 2 [Pseudomonas sp. GM102]
 gi|398165606|gb|EJM53721.1| chorismate mutase, clade 2 [Pseudomonas sp. GM41(2012)]
 gi|398183206|gb|EJM70700.1| chorismate mutase, clade 2 [Pseudomonas sp. GM50]
 gi|398192553|gb|EJM79702.1| chorismate mutase, clade 2 [Pseudomonas sp. GM60]
 gi|398196533|gb|EJM83534.1| chorismate mutase, clade 2 [Pseudomonas sp. GM67]
          Length = 364

 Score =  268 bits (685), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 213/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID++D K+++L++ERAR +  + + K  S          Y   +E Q+  R+   N GP
Sbjct: 12  RIDALDEKVLELISERARCAQEVARVKMASLAEGEVPV-FYRPEREAQVLKRVMERNQGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LGNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISKPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 SRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++GS    P+G+DKT I+ ++ + +PGAL + L  F D+GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGSQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHDNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +V+  L KI++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLVKGVLEKISQEAVALKVLGSYP 360



>gi|330808289|ref|YP_004352751.1| prephenate dehydratase [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|489291698|ref|WP_003199233.1| prephenate dehydratase [Pseudomonas fluorescens]
 gi|327376397|gb|AEA67747.1| Prephenate dehydratase (bifunctional chorismate mutase P and
           prephenate dehydratase) [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|388004093|gb|EIK65420.1| P-protein [Pseudomonas fluorescens Q8r1-96]
          Length = 364

 Score =  268 bits (684), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 213/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID++D K+++L++ERAR +  + + K  S          Y   +E Q+  R+   N GP
Sbjct: 12  RIDALDEKVLELISERARCAQEVARVKMASLAEGEVPV-FYRPEREAQVLKRVMERNKGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LGNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISKPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 SRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++GS    P+G+DKT I+ ++ + +PGAL + L  F D+GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGSQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHDNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +V+  L KI++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLVKGVLEKISQEAVALKVLGSYP 360



>gi|489276198|ref|WP_003183886.1| prephenate dehydratase [Pseudomonas fluorescens]
 gi|397888265|gb|EJL04748.1| P-protein [Pseudomonas fluorescens Q2-87]
          Length = 364

 Score =  268 bits (684), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 213/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID++D K+++L++ERAR +  + + K  S          Y   +E Q+  R+   N GP
Sbjct: 12  RIDALDEKVLELISERARCAQEVARVKMASLAEGEMPV-FYRPEREAQVLKRVMERNKGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LGNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISKPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGESTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 SRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++GS    P+G+DKT I+ ++ + +PGAL + L  F D+GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGSQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHDNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +V+  L KI++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLVKGVLEKISQEAVALKVLGSYP 360



>gi|495238857|ref|WP_007963622.1| prephenate dehydratase [Pseudomonas sp. GM30]
 gi|398148253|gb|EJM36937.1| chorismate mutase, clade 2 [Pseudomonas sp. GM30]
          Length = 364

 Score =  268 bits (684), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 133/351 (37%), Positives = 214/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID++D+K+++L++ERAR +  + + K  S          Y   +E Q+  R+   N GP
Sbjct: 12  RIDALDSKVLELISERARCAQEVARVKMASLAEGEVPV-FYRPEREAQVLKRVMERNQGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LGNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISKPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 SRIYSHAQSLAQCRKWLDAHYPNVERVAVASNAEAAKRVKGEWNSAAIAGDMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++G+    P+G+DKT I+ ++ + +PGAL + L  F D+GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGNQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHDNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +++  L KI++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLIKGVLEKISQEAVALKVLGSYP 360



>gi|495275176|ref|WP_007999931.1| prephenate dehydratase [Pseudomonas sp. GM49]
 gi|398173034|gb|EJM60880.1| chorismate mutase, clade 2 [Pseudomonas sp. GM49]
          Length = 364

 Score =  268 bits (684), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 213/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID++D K+++L++ERAR +  + + K  S          Y   +E Q+  R+   N GP
Sbjct: 12  RIDALDEKVLELISERARCAQEVARVKMASLAEGEVPV-FYRPEREAQVLKRVMERNQGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LGNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISKPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LDSH    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 SRIYSHAQSLAQCRKWLDSHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++G+    P+G+DKT I+ ++ + +PGAL + L  F D+GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGNQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHDNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +V+  L KI++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLVKGVLEKISQEAVALKVLGSYP 360



>gi|490379971|ref|WP_004259491.1| chorismate mutase [Thauera sp. 63]
 gi|479289599|gb|ENO77699.1| chorismate mutase [Thauera sp. 63]
          Length = 356

 Score =  268 bits (684), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 129/360 (35%), Positives = 210/360 (58%), Gaps = 9/360 (2%)

Query: 1   MENVDLTFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIF 60
           M +  L    +ID +D +++  L+ERAR +  + + K+G+          Y   +E Q+ 
Sbjct: 1   MSDELLKLRNEIDRLDEEILARLSERARCAQRVGEVKKGN-------APFYRPEREAQVL 53

Query: 61  DRIHRLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINY 120
            R+  LN GPL ++++ S+++EI+S  +  +    +AY GP G+++  A+  +FG + N+
Sbjct: 54  RRLAELNPGPLPADAVKSVFREIMSVCLGLEHPQRVAYLGPAGTFSESASRKQFGSAPNF 113

Query: 121 LPKSTINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL 180
           +P +TI D+F +VE G+T YG+VP ENST G+V  TLD  ++    +  E  LRI   L+
Sbjct: 114 MPMATIEDVFRAVEAGNTDYGVVPVENSTEGAVSITLDLLLASPVKVCGEVNLRIHQQLM 173

Query: 181 SKSK-FSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASI 239
           S++    +  ++YSH Q   QC ++L+ +L    RI   S ++AA +A  +P S AIA  
Sbjct: 174 SRADGIGAAKRIYSHAQSLAQCHEWLNRNLPHLPRIPVASNAEAARLAGEDPESCAIAGE 233

Query: 240 TCAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLS 299
             A+LYGL +L  +I+D  NN TRF ++      PSG D+T ++F+  + RPGA+   L 
Sbjct: 234 AAAQLYGLNILAPNIEDDPNNTTRFLVIADHDAGPSGKDRTSLVFSAPN-RPGAIHTLLE 292

Query: 300 VFKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
               HG+++ K+ SRP+    W YVF+ ++QGH+ D  V  AL  + E    +K+LGSYP
Sbjct: 293 PLAQHGVDMTKLQSRPAQSGLWEYVFYADIQGHQCDPAVAAALKALGERAAFLKVLGSYP 352



>gi|492046956|ref|WP_005731287.1| prephenate dehydratase [Pseudomonas amygdali]
 gi|330866100|gb|EGH00809.1| chorismate mutase/prephenate dehydratase [Pseudomonas syringae pv.
           aesculi str. 0893_23]
          Length = 364

 Score =  268 bits (684), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 212/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L++ERAR +  + + K  S          Y   +E  +  R+   N GP
Sbjct: 12  RIDSLDEKVLELISERARCAQEVARVKMSSLAEGEVPV-FYRPEREAAVLRRVMERNRGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS+E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++  LP + I+++F
Sbjct: 71  LSNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISLPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGESTKMQSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 TRIYSHAQSLAQCRKWLDAHYPNVERVAVASNAEAAKRVKGEWNSAAIAGDMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+G+    P+G+DKT I+ ++ + +PGAL + L  F + G++L
Sbjct: 251 RLAEKIEDRPDNSTRFLIIGNQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHESGLDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH +D +V+  L KI+   + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHQDPLVKAVLEKISSEAVALKVLGSYP 360



>gi|492787454|ref|WP_005963800.1| prephenate dehydratase [endosymbiont of Tevnia jerichonana]
 gi|344224508|gb|EGV50899.1| prephenate dehydratase [endosymbiont of Riftia pachyptila (vent
           Ph05)]
 gi|345125540|gb|EGW55409.1| chorismate mutase I / prephenate dehydratase [endosymbiont of
           Tevnia jerichonana (vent Tica)]
          Length = 365

 Score =  267 bits (683), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 138/350 (39%), Positives = 204/350 (58%), Gaps = 6/350 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID+ID ++ +L N RA  +  + + K             Y   +E Q+  RI   N+GP
Sbjct: 17  RIDAIDEEIQRLFNARAEAAQEVARIK----LAADPQAQFYRPEREAQVLRRIKERNSGP 72

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L  E +  +++EI+SA ++ ++ L +A+ GP G++T  AA+  FG S+  LP  +I D+F
Sbjct: 73  LDPEEVARLFREIMSACLALEQPLQVAFLGPEGTFTQAAALKHFGHSVQCLPMGSIGDVF 132

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL-SKSKFSSIN 189
             VE G   YG+VP ENST G +  TLD F+S    I  E  LRI+H LL S+S    I 
Sbjct: 133 SEVESGACHYGVVPVENSTEGVISHTLDSFVSSPLLICGEVTLRINHHLLSSESGLQQIR 192

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLEV 249
            VYSH Q   QC+ +LD HL +A+R+   S ++AA +A+     AAIA  T AE+YGL  
Sbjct: 193 TVYSHQQSLAQCRGWLDRHLPQAERVAVGSNAEAARMASQHAGVAAIAGETAAEIYGLPQ 252

Query: 250 LGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINLL 309
           L  +I+D   N TRF ++G      SG+DKT +L +  + R G L   LS F +H I++ 
Sbjct: 253 LVSNIEDEAGNTTRFLVIGKKDAGASGDDKTSLLLSTQN-RAGGLHGLLSPFAEHSISMT 311

Query: 310 KIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           +I+SRPS +  W YVFFV++ GH+ D  V +AL ++ +     ++LGSYP
Sbjct: 312 RIESRPSRRGIWDYVFFVDINGHRSDPAVAEALRQLEQQASLFRVLGSYP 361



>gi|496914535|ref|WP_009407557.1| chorismate mutase/prephenate dehydrogenase [Pseudomonas putida]
 gi|428759638|gb|EKX81932.1| chorismate mutase/prephenate dehydrogenase [Pseudomonas putida
           CSV86]
          Length = 364

 Score =  267 bits (683), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 133/351 (37%), Positives = 213/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L+++RAR +  + + K GS          Y   +E Q+  R+   N GP
Sbjct: 12  RIDSLDEKILELISDRARCAQEVARVKMGSLAEGEVPV-FYRPEREAQVLKRVMERNQGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LGNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISKPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 TRIYSHAQSLAQCRKWLDAHYPNVERVAVASNAEAAKRVKGEWNSAAIAGDMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++G+    P+G+DKT I+ ++ + +PGAL + L  F ++GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGNQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHENGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +++  L KI++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLIKAVLEKISQEAVALKVLGSYP 360



>gi|163856195|ref|YP_001630493.1| chorismate mutase/prephenate dehydratase [Bordetella petrii DSM
           12804]
 gi|501205789|ref|WP_012248807.1| chorismate mutase [Bordetella petrii]
 gi|163259923|emb|CAP42224.1| chorismate mutase/prephenate dehydratase [Bordetella petrii]
          Length = 361

 Score =  267 bits (683), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 130/355 (36%), Positives = 208/355 (58%), Gaps = 6/355 (1%)

Query: 8   FSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLN 67
             ++ID++DT++++LL++RAR +L + +AK  +         V    +E ++  R+ +LN
Sbjct: 12  LRERIDALDTQILELLSQRARAALEVGEAKHAA----AADGPVLRPEREAEVIRRLQQLN 67

Query: 68  NGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTIN 127
            GP   +++  ++ EIISA    ++ +++AY GP GS++ QAA   FG S+  LP  + +
Sbjct: 68  PGPFPRDAVAFVWTEIISACRGLERGMTVAYLGPRGSFSEQAAFEHFGRSVQPLPCPSFD 127

Query: 128 DIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFS 186
           ++F +VE G    G+VP ENST G+V   LD  ++    IL E  L I HCL+++S    
Sbjct: 128 EVFRAVEAGQADVGMVPVENSTEGAVNRNLDLLLNTPLKILGERSLDIRHCLMTQSGSMD 187

Query: 187 SINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYG 246
            +  V +HPQ   QCQ +L+ H    +R+   S S+AA +AA  P  AAIA  + A  + 
Sbjct: 188 GVTAVAAHPQALAQCQAWLNRHYPGLERVAEASNSEAARVAAGNPAMAAIAGESAAPAWD 247

Query: 247 LEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGI 306
           L+++   IQD  NN TRF  LG     PSG DKT ++  V + R GA+ D L+    +G+
Sbjct: 248 LQIVAAGIQDDPNNRTRFLALGDIQPLPSGKDKTSLILAVPN-RAGAVYDMLAPLAANGV 306

Query: 307 NLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYPDQ 361
           ++ + +SRP+    W Y F+V++QGH++D  V +AL  + E    +K+LGSYP Q
Sbjct: 307 SMTRFESRPARTGQWEYYFYVDVQGHRDDPQVARALADLQEQVAFIKVLGSYPAQ 361



>gi|392374264|ref|YP_003206097.1| bifunctional chorismate mutase/prephenate dihydratase [Candidatus
           Methylomirabilis oxyfera]
 gi|506223988|ref|WP_015743763.1| prephenate dehydratase [Candidatus Methylomirabilis oxyfera]
 gi|258591957|emb|CBE68262.1| P-protein [Includes: Chorismate mutase (CM); Prephenate dehydratase
           (PDT)] [Candidatus Methylomirabilis oxyfera]
          Length = 358

 Score =  267 bits (683), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 149/359 (41%), Positives = 218/359 (60%), Gaps = 12/359 (3%)

Query: 7   TFSQQIDSIDTKLVQLLNERAR--VSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIH 64
           T  ++ID ID+++V LL ERA   VS+  EKA+            V+V  +E +I  R+ 
Sbjct: 5   TLRRKIDRIDSQIVSLLGERAELVVSIGQEKARAN--------LNVHVPQREEEIVTRLI 56

Query: 65  RLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKS 124
           R N G   + ++  +++EIISA  + Q  L +AY GP G++T+ A   RFG S +++P  
Sbjct: 57  RQNKGRFPAHAIRPVFREIISACRAVQGPLKLAYLGPEGTFTNVACARRFGGSAHFVPVH 116

Query: 125 TINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS- 183
           TI+D+F  VEKG+  YGIVP ENS+ G V  TLD F+     I  E  L +SH LLSKS 
Sbjct: 117 TISDVFAEVEKGNVEYGIVPIENSSEGVVSHTLDMFVDSDLKICGEILLGVSHSLLSKSG 176

Query: 184 KFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAE 243
               + KVYSHP  F Q +K+L+++L      +A ST+ AA++   +  +AAIAS   A 
Sbjct: 177 DLRKVKKVYSHPHAFAQSRKWLEANLPHVPLFEASSTAAAAKLVTKDTTAAAIASELAAS 236

Query: 244 LYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKD 303
           LY L V+ + I+D   NVTRF I+G +   P+ +DKT ++F++   R GAL   L  F  
Sbjct: 237 LYKLRVISRKIEDTPCNVTRFLIIGQNGPAPTDHDKTSLMFSIK-DRVGALYRILEPFAK 295

Query: 304 HGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYPDQR 362
           + INL K++SRPS  + W Y+F+++++GH  DE V+ AL  + E CL +K+LGSYP +R
Sbjct: 296 YQINLTKVESRPSKTKAWEYIFYLDIEGHIADEPVKAALALLQEECLFLKVLGSYPRER 354



>gi|489319565|ref|WP_003226907.1| prephenate dehydratase [Pseudomonas fluorescens]
 gi|404305409|gb|EJZ59371.1| chorismate mutase domain of proteobacterial P-protein [Pseudomonas
           fluorescens R124]
          Length = 364

 Score =  267 bits (682), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 133/351 (37%), Positives = 214/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID++D+K+++L++ERAR +  + + K  S          Y   +E Q+  R+   N GP
Sbjct: 12  RIDALDSKVLELISERARCAQEVARVKMASLAEGEVPV-FYRPEREAQVLKRVMERNQGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LGNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISKPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 SRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++G+    P+G+DKT I+ ++ + +PGAL + L  F D+GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGNQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHDNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +++  L KI++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLIKGVLEKISQEAVALKVLGSYP 360



>gi|491022414|ref|WP_004884111.1| chorismate mutase [Pseudomonas viridiflava]
 gi|409760414|gb|EKN45562.1| chorismate mutase [Pseudomonas viridiflava UASWS0038]
          Length = 364

 Score =  267 bits (682), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 213/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L++ERAR +  + + K  S          Y   +E  +  R+   N GP
Sbjct: 12  RIDSLDEKVLELISERARCAQEVARVKMSSLAEGEAPV-FYRPEREAAVLKRVMERNRGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS+E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++  LP + I+++F
Sbjct: 71  LSNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISLPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGESTKTESI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 SRIYSHAQSLAQCRKWLDAHYPNVERVAVASNAEAAKRVKGEWNSAAIAGDMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+GS    P+G+DKT I+ ++ + +PGAL + L  F ++G++L
Sbjct: 251 RLAEKIEDRPDNSTRFLIIGSQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHENGLDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +V+  L +I+   + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLVKAVLEQISHEAVALKVLGSYP 360



>gi|494461885|ref|WP_007251444.1| prephenate dehydratase [Pseudomonas syringae group genomosp. 3]
 gi|330960543|gb|EGH60803.1| chorismate mutase/prephenate dehydratase [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 364

 Score =  267 bits (682), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 213/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L++ERAR +  + + K  S          Y   +E  +  R+   N GP
Sbjct: 12  RIDSLDEKVLELISERARCAQEVARVKMSSLAEGEVPV-FYRPEREAAVLKRVMERNRGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS+E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++  LP + I+++F
Sbjct: 71  LSNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISLPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGESTKTQSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 SRIYSHAQSLAQCRKWLDAHYPNVERVAVASNAEAAKRVKGEWNSAAIAGDMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+G+    P+G+DKT I+ ++ + +PGAL + L  F + G++L
Sbjct: 251 RLAEKIEDRPDNSTRFLIIGNQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHESGLDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH +D +V+  L KI+   + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHQDPLVKAVLEKISHEAVALKVLGSYP 360



>gi|327398203|ref|YP_004339072.1| prephenate dehydratase [Hippea maritima DSM 10411]
 gi|503446397|ref|WP_013681058.1| prephenate dehydratase [Hippea maritima]
 gi|327180832|gb|AEA33013.1| prephenate dehydratase [Hippea maritima DSM 10411]
          Length = 372

 Score =  266 bits (681), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 146/355 (41%), Positives = 217/355 (61%), Gaps = 9/355 (2%)

Query: 10  QQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNG 69
           ++I  ID +++QLL ERA      E  KE            Y   +E +I+  I     G
Sbjct: 20  EKISDIDKRIIQLLEERA------ELVKEVGKIKRQHSLPFYSPDRETKIYKMIEANAKG 73

Query: 70  PLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDI 129
               +SL +I++EI+SAS+  ++ L+I+Y GP  ++THQAAI RFG S++Y+P+ +I D+
Sbjct: 74  EFPIKSLKTIFREIMSASIRLEEPLTISYLGPEATFTHQAAIERFGLSLHYVPEESIEDV 133

Query: 130 FDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSSI 188
           F  VE     +G+VP ENS  G V  TLD FI     I++E Y+ I H LLSK+     +
Sbjct: 134 FMDVEHERADFGVVPIENSIEGVVHYTLDMFIESSVKIVSEIYIDIRHNLLSKANNLQQV 193

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
             +YSHP   GQC+ ++  HL      + +ST+KAA+IA  +  +AAIAS   +E+YGL 
Sbjct: 194 KAIYSHPNALGQCKNWIKKHLPNVPLFETVSTAKAAKIAEKDETAAAIASKAASEIYGLN 253

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
           VL   I+D  NN+TRF ++G      +GNDKT  +F++   + GAL + L  F ++ INL
Sbjct: 254 VLASGIEDRSNNITRFLVIGKKIPSKTGNDKTSFMFSI-KDKVGALYEILQPFYNNKINL 312

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP-DQR 362
            +I+SRPS Q+ + Y+F+V+ +GH ED  +Q AL+KI +F + +KILGSYP D+R
Sbjct: 313 TRIESRPSRQKNFSYIFYVDTEGHIEDAKLQDALSKIEDFTVFLKILGSYPKDER 367



>gi|496335832|ref|WP_009045010.1| prephenate dehydratase [Pseudomonas chlororaphis]
 gi|388555090|gb|EIM18338.1| P-protein [Pseudomonas chlororaphis O6]
 gi|397883056|gb|EJK99542.1| P-protein [Pseudomonas chlororaphis subsp. aureofaciens 30-84]
          Length = 364

 Score =  266 bits (681), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 133/351 (37%), Positives = 213/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID++D K+++L++ERAR +  + + K  S          Y   +E Q+  R+   N GP
Sbjct: 12  RIDALDEKVLELISERARCAQEVARVKMASLAEGEVPV-FYRPEREAQVLKRVMERNQGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LGNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISKPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 SRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAASLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++G+    P+G+DKT I+ ++ + +PGAL + L  F D+GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGNQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHDNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +++  L KI++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLIKGVLEKISQEAVALKVLGSYP 360



>gi|510308638|gb|EPA94075.1| chorismate mutase, clade 2 [Pseudomonas sp. G5(2012)]
          Length = 364

 Score =  266 bits (681), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 134/351 (38%), Positives = 213/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID++D K+++L++ERAR +  + + K  S          Y   +E Q+  R+   N GP
Sbjct: 12  RIDALDEKVLELISERARCAQEVARVKMASLAEGEVPV-FYRPEREAQVLKRVMERNQGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LGNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAALKHFGHAVISKPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 SRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++G+    P+G+DKT I+ ++ + +PGAL + L  F D+GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGNQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHDNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +V+  L KI++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLVKGVLEKISQEAVALKVLGSYP 360



>gi|426408272|ref|YP_007028371.1| chorismate mutase/prephenate dehydrogenase [Pseudomonas sp. UW4]
 gi|495215137|ref|WP_007939916.1| prephenate dehydratase [Pseudomonas sp. UW4]
 gi|398124503|gb|EJM14011.1| chorismate mutase, clade 2 [Pseudomonas sp. GM18]
 gi|398155619|gb|EJM44058.1| chorismate mutase, clade 2 [Pseudomonas sp. GM33]
 gi|398187900|gb|EJM75224.1| chorismate mutase, clade 2 [Pseudomonas sp. GM55]
 gi|398206031|gb|EJM92804.1| chorismate mutase, clade 2 [Pseudomonas sp. GM74]
 gi|398232862|gb|EJN18814.1| chorismate mutase, clade 2 [Pseudomonas sp. GM78]
 gi|426266489|gb|AFY18566.1| chorismate mutase/prephenate dehydrogenase [Pseudomonas sp. UW4]
          Length = 364

 Score =  266 bits (681), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 134/351 (38%), Positives = 213/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID++D K+++L++ERAR +  + + K  S          Y   +E Q+  R+   N GP
Sbjct: 12  RIDALDEKVLELISERARCAQEVARVKMASLAEGEVPV-FYRPEREAQVLKRVMERNQGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LGNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISKPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 SRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++G+    P+G+DKT I+ ++ + +PGAL + L  F D+GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGNQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHDNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +V+  L KI++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLVKGVLEKISQEAVALKVLGSYP 360



>gi|494244269|ref|WP_007144887.1| prephenate dehydratase [Methylophaga aminisulfidivorans]
 gi|333789119|gb|EGL55001.1| prephenate dehydratase [Methylophaga aminisulfidivorans MP]
          Length = 362

 Score =  266 bits (681), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 146/352 (41%), Positives = 214/352 (60%), Gaps = 7/352 (1%)

Query: 10  QQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNG 69
           Q+ID ID K+ QLLN+RA ++  + + K  S          Y   +E  +   +   N G
Sbjct: 12  QKIDDIDLKIQQLLNDRAAMAQEVARIKMDS----GEQADFYRPEREAMVLRTVMERNQG 67

Query: 70  PLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDI 129
           PL+S  +  +++EI+SA ++++K L +AY GP GS+T  AA  +FG S+   P +TI D+
Sbjct: 68  PLASAEVARLFREIMSACLAAEKPLQVAYLGPEGSFTQAAAQKQFGGSVELHPMTTIADV 127

Query: 130 FDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKSK-FSSI 188
           F +VE  H  YG+VP ENST G V  TLDRFIS    I  E  LRI H LLSK K    I
Sbjct: 128 FHAVETSHACYGVVPVENSTEGMVSHTLDRFISSPLKINGEVTLRIHHYLLSKEKNLEDI 187

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPY-SAAIASITCAELYGL 247
           +KVY+HPQ   QC+++L   L +A+ +   S S+AA+  A+EP  SAAIA+   A++YGL
Sbjct: 188 SKVYAHPQAIAQCRQWLMEQLPQAELVPLNSNSEAAKRVAAEPQNSAAIAANRAADIYGL 247

Query: 248 EVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGIN 307
            +L ++I+D  +N TRF ++G+ +  PSG DKT +L    + +PGAL   L    D+ I+
Sbjct: 248 SILARNIEDEVDNTTRFLVIGTQNVGPSGVDKTALLVATKN-KPGALQTLLKPLADNSIS 306

Query: 308 LLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           + +I+SRPS +  W YVFF++++GH  +  V  AL+ +       +ILGSYP
Sbjct: 307 MTRIESRPSRKGIWEYVFFIDIEGHIHEPAVASALSLLENESSMFRILGSYP 358



>gi|488617716|ref|WP_002554565.1| prephenate dehydratase [Pseudomonas savastanoi]
 gi|298157297|gb|EFH98380.1| chorismate mutase/prephenate dehydratase [Pseudomonas savastanoi
           pv. savastanoi NCPPB 3335]
          Length = 364

 Score =  266 bits (680), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 212/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L++ERAR +  + + K  S          Y   +E  +  R+   N GP
Sbjct: 12  RIDSLDEKVLELISERARCAQEVARVKMSSLAEGEVPV-FYRPEREAAVLRRVMERNRGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS+E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++  LP + I+++F
Sbjct: 71  LSNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISLPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGESTKTQSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 TRIYSHAQSLAQCRKWLDAHYPNVERVAVASNAEAAKRVKGEWNSAAIAGDMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+G+    P+G+DKT I+ ++ + +PGAL + L  F + G++L
Sbjct: 251 RLAEKIEDRPDNSTRFLIIGNQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHESGLDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH +D +V+  L KI+   + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHQDPLVKAVLEKISSEAVALKVLGSYP 360



>gi|492572125|ref|WP_005889752.1| prephenate dehydratase [Pseudomonas coronafaciens]
 gi|331021874|gb|EGI01931.1| chorismate mutase/prephenate dehydratase [Pseudomonas syringae pv.
           oryzae str. 1_6]
          Length = 364

 Score =  266 bits (680), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 213/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L++ERAR +  + + K  S          Y   +E  +  R+   N GP
Sbjct: 12  RIDSLDEKVLELISERARCAQEVARVKMSSLAEGEVPV-FYRPEREAAVLRRVMERNRGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS+E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++  LP + I+++F
Sbjct: 71  LSNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISLPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGESTKTQSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 SRIYSHAQSLAQCRKWLDAHYPNVERVAVASNAEAAKRVKGEWNSAAIAGDMAAGLYGLS 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+G+    P+G+DKT I+ ++ + +PGAL + L  F + G++L
Sbjct: 251 RLAEKIEDRPDNSTRFLIIGNQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHESGLDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH +D +V+  L KI+   + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHQDPLVKSVLEKISSEAVALKVLGSYP 360



>gi|387127950|ref|YP_006296555.1| chorismate mutase I / Prephenate dehydratase [Methylophaga sp.
           JAM1]
 gi|504520176|ref|WP_014707278.1| prephenate dehydratase [Methylophaga sp. JAM1]
 gi|386275012|gb|AFI84910.1| Chorismate mutase I / Prephenate dehydratase [Methylophaga sp.
           JAM1]
          Length = 362

 Score =  266 bits (680), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 142/352 (40%), Positives = 208/352 (59%), Gaps = 7/352 (1%)

Query: 10  QQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNG 69
           +QID +D +L  LLNER  ++  + + K+ S          Y   +E  I  ++   NNG
Sbjct: 12  EQIDKVDKQLQDLLNERTALAHQVAEIKQQS----GEQADFYRPEREAMILRQVMARNNG 67

Query: 70  PLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDI 129
           PLS   +  +++EI+SA ++++K L +AY GP GS+T  A++  FG S+     +TI D+
Sbjct: 68  PLSDLEMARLFREIMSACLAAEKPLQVAYLGPEGSFTQAASLKHFGGSVQLHSMATIADV 127

Query: 130 FDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKSK-FSSI 188
           F +VE G   YG+VP ENST G V  TLDRF+S    I  E  +RI H LLSKS   S I
Sbjct: 128 FHAVETGQACYGVVPVENSTEGMVNHTLDRFVSSSLKINGEVTIRIHHYLLSKSADLSQI 187

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYS-AAIASITCAELYGL 247
             VY+HPQ   QC+ +L  +L  + +I   S S+AA++ A      AAIA    AE+YGL
Sbjct: 188 KTVYAHPQALAQCRHWLTENLPNSVQIPVNSNSEAAKLVAENGLDCAAIAGNRAAEIYGL 247

Query: 248 EVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGIN 307
            VL  +I+D   N TRF ++G+   +PSG DKT +L +  + +PGAL + L    D GI+
Sbjct: 248 SVLANNIEDEVGNTTRFLVIGTQLVEPSGEDKTALLVSTKN-KPGALQNLLKPLADKGIS 306

Query: 308 LLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           + +I+SRPS +  W YVFF++++GH +D  V  AL ++       ++LGSYP
Sbjct: 307 MSRIESRPSRKGIWEYVFFIDIEGHCQDPTVASALQELESESSVFRVLGSYP 358



>gi|218779607|ref|YP_002430925.1| prephenate dehydratase [Desulfatibacillum alkenivorans AK-01]
 gi|501642305|ref|WP_012610891.1| prephenate dehydratase [Desulfatibacillum alkenivorans]
 gi|218760991|gb|ACL03457.1| prephenate dehydratase [Desulfatibacillum alkenivorans AK-01]
          Length = 365

 Score =  266 bits (680), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 143/353 (40%), Positives = 205/353 (58%), Gaps = 8/353 (2%)

Query: 8   FSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLN 67
             Q I+  D K++ L+NER  ++  +   K+G          V    +E  + D++  LN
Sbjct: 15  LRQAINETDQKILALVNERLDIAQKIGAIKQGK------GLPVVDFSRERAVLDQLQELN 68

Query: 68  NGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTIN 127
            GP+  E+L+ +Y EII+AS   Q+ L + Y GP  ++TH AA+  FG S N+ P  TI+
Sbjct: 69  EGPMPDETLLLLYTEIIAASRRIQQPLEVGYLGPKATFTHMAAMKHFGRSTNFTPLGTIS 128

Query: 128 DIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLS-KSKFS 186
           D+F+ V+K    +G+VP ENS  G+V  TLD F      I  E YL I H LLS +    
Sbjct: 129 DVFEEVDKRRRPFGVVPVENSMEGAVNLTLDLFQESDVRICGEIYLPIRHDLLSAEDSLD 188

Query: 187 SINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYG 246
            I  V+SHPQ   QC+K+L  +L    +    STS+AA +A + P  AAIAS   A  Y 
Sbjct: 189 QIMVVFSHPQAIAQCRKWLGKNLPGILQNQCSSTSEAARMAVNTPGGAAIASSEAAITYE 248

Query: 247 LEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGI 306
           L  L  +IQD+  N+TRF ++G    +P+G DKT +LF + H  PGAL   L    + G+
Sbjct: 249 LNTLADNIQDSTTNITRFLVIGRDKVQPTGRDKTSLLFAIPHI-PGALHSVLQPISEEGL 307

Query: 307 NLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           N++K++SRPS    WHY+FFV+L+GH +DE V+K ++K+   C  VK LGSYP
Sbjct: 308 NMVKLESRPSKSASWHYLFFVDLEGHMKDEPVKKVVDKMRTLCSFVKWLGSYP 360



>gi|170720562|ref|YP_001748250.1| chorismate mutase [Pseudomonas putida W619]
 gi|501270270|ref|WP_012313288.1| prephenate dehydratase [Pseudomonas putida]
 gi|169758565|gb|ACA71881.1| chorismate mutase [Pseudomonas putida W619]
          Length = 364

 Score =  266 bits (680), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 134/351 (38%), Positives = 211/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L+++RAR +  + K K  S          Y   +E  +  R+   N GP
Sbjct: 12  RIDSLDEKILELISDRARCAQEVAKVKTASLAEGEQPV-FYRPEREAAVLKRVMERNKGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L IAY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LGNEEMARLFREIMSSCLALEEPLKIAYLGPEGTFTQAAAMKHFGHAVISRPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVSHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 TRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAANLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++G+    P+G+DKT I+ ++ + +PGAL + L  F D+GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGNQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHDNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +++  L KI++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLIKAVLEKISQEAVALKVLGSYP 360



>gi|289548700|ref|YP_003473688.1| prephenate dehydratase [Thermocrinis albus DSM 14484]
 gi|502756983|ref|WP_012991967.1| prephenate dehydratase [Thermocrinis albus]
 gi|289182317|gb|ADC89561.1| prephenate dehydratase [Thermocrinis albus DSM 14484]
          Length = 363

 Score =  266 bits (680), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 145/364 (39%), Positives = 217/364 (59%), Gaps = 13/364 (3%)

Query: 1   MENVDLTFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIF 60
           ME ++    ++ID ID ++V+LLN RA+++  + + K+           ++   +E QIF
Sbjct: 1   MEELE-RLREKIDQIDEQIVELLNRRAQLAQQIGEIKK------RLGLEIHAPERERQIF 53

Query: 61  DRIHRLNNG----PLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGD 116
           ++I ++N         +++L+ I++EIISA +S +K + +AY GP  ++THQAA   FG 
Sbjct: 54  EKIIQINTQRYKETFPTKALLHIFREIISACLSLEKPIKVAYLGPKATFTHQAASEYFGL 113

Query: 117 SINYLPKSTINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRIS 176
           S  Y+P  +I D+F  VE     YG+VP EN+T G V  TLD F+     I+ E  + I 
Sbjct: 114 SAQYIPAPSIRDVFQEVETDRADYGVVPVENTTEGVVNYTLDMFLESDLRIVGEIVIPIR 173

Query: 177 -HCLLSKSKFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAA 235
            H L + +  S I KV+SH Q   QC+ +L+ ++     I+  ST++A EIA  E  S+A
Sbjct: 174 LHLLSTCTDISQIKKVFSHRQALAQCRMWLEKNMPWVDLIETESTARACEIALEEEASSA 233

Query: 236 IASITCAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALC 295
           IAS   A  Y L VL ++IQD  NN TRF ++G  S K +G DKT ++F V  + PGAL 
Sbjct: 234 IASEVAAYTYHLHVLAENIQDNPNNYTRFLVIGKRSMKKTGKDKTSLIFAVKDE-PGALY 292

Query: 296 DGLSVFKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKIL 355
             L  F  + +NL KI+SRPS ++ W YVFFV+L+GH EDE V++A+  +      VK+L
Sbjct: 293 RALESFYLYNVNLTKIESRPSKKKAWDYVFFVDLEGHTEDEHVREAIELLKSRTQMVKLL 352

Query: 356 GSYP 359
           GSYP
Sbjct: 353 GSYP 356



>gi|28868953|ref|NP_791572.1| chorismate mutase/prephenate dehydratase [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|491818404|ref|WP_005616461.1| chorismate mutase [Pseudomonas syringae group genomosp. 3]
 gi|28852193|gb|AAO55267.1| chorismate mutase/prephenate dehydratase [Pseudomonas syringae pv.
           tomato str. DC3000]
 gi|213926652|gb|EEB60205.1| chorismate mutase/prephenate dehydratase [Pseudomonas syringae pv.
           tomato T1]
 gi|330877039|gb|EGH11188.1| chorismate mutase/prephenate dehydratase [Pseudomonas syringae pv.
           morsprunorum str. M302280]
 gi|331016843|gb|EGH96899.1| chorismate mutase/prephenate dehydratase [Pseudomonas syringae pv.
           lachrymans str. M302278]
 gi|407990764|gb|EKG32775.1| chorismate mutase [Pseudomonas avellanae BPIC 631]
          Length = 364

 Score =  266 bits (680), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 214/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L++ERAR +  + + K  S          Y   +E  +  R+   N GP
Sbjct: 12  RIDSLDEKVLELISERARCAQEVARVKMSSLAEGEVPV-FYRPEREAAVLRRVMDRNRGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS+E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++  LP + I+++F
Sbjct: 71  LSNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISLPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGESTKTQSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 SRIYSHAQSLAQCRKWLDAHYPNVERVAVASNAEAAKRVKGEWNSAAIAGDMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+G+    P+G+DKT I+ ++ + +PGAL + L  F ++G++L
Sbjct: 251 RLAEKIEDRPDNSTRFLIIGNQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHENGLDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH +D +V+  L KI+   + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHQDPLVKAVLEKISSEAVALKVLGSYP 360



>gi|497306737|ref|WP_009620954.1| chorismate mutase [Pseudomonas sp. M1]
 gi|428155005|gb|EKX01555.1| chorismate mutase [Pseudomonas sp. M1]
          Length = 365

 Score =  266 bits (680), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 136/351 (38%), Positives = 211/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L++ERAR + ++ + K  S          Y   +E  +   I  LN GP
Sbjct: 13  RIDSLDEKILELISERARCATDVARVKMQSLAEGEKPV-FYRPEREAWVLKHIMELNKGP 71

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 72  LGNEEVARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAALKHFGHAVISTPMAAIDEVF 131

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 132 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 191

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +R+   S + AA+   SE  SAAIA    A LYGL+
Sbjct: 192 TRIYSHAQSLAQCRKWLDAHYPNVERVAVPSNADAAKRVKSEWNSAAIAGDMAASLYGLD 251

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+G+    P+G+DKT I+ ++   +PGAL + L  F  +GI+L
Sbjct: 252 KLHEKIEDRPDNSTRFLIIGNQEVPPTGDDKTSIIVSM-RNKPGALHELLVPFHTNGIDL 310

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH +D +++  L KIN   + +K+LGSYP
Sbjct: 311 TRIETRPSRSGKWTYVFFIDFVGHHKDPLIKDVLEKINSEAVALKVLGSYP 361



>gi|390950440|ref|YP_006414199.1| chorismate mutase, clade 2 [Thiocystis violascens DSM 198]
 gi|504591423|ref|WP_014778525.1| prephenate dehydratase [Thiocystis violascens]
 gi|390427009|gb|AFL74074.1| chorismate mutase, clade 2 [Thiocystis violascens DSM 198]
          Length = 364

 Score =  266 bits (680), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 144/350 (41%), Positives = 208/350 (59%), Gaps = 5/350 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID+ID +L++L++ERAR +  +   K  S          Y   +E  +  RI   N GP
Sbjct: 15  RIDAIDQELLRLISERARYAQQVAHLKTES---NGQQVQFYRPEREVAVLRRIKDANPGP 71

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L SE +  +++EI+SA ++ ++ L+ A+ GP G++T  AAI  FG S+     +TI++IF
Sbjct: 72  LDSEEVARLFREIMSACLALERPLNAAFLGPEGTFTQAAAIKHFGHSVVTRAMATIDEIF 131

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLS-KSKFSSIN 189
             VE G   +G+VP ENST G V  TLD F+S    I  E  LRI H L+S ++  S+I 
Sbjct: 132 REVESGACDFGVVPVENSTEGVVSHTLDLFMSSPLRITGEVTLRIHHHLMSHEADPSAIR 191

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLEV 249
            +YSH Q   QC+ +LD +L  A+RI   S + AA  AASEP SAA+A +  AE+YGL V
Sbjct: 192 VLYSHQQSLAQCRGWLDRYLPHAERIAVGSNADAARTAASEPGSAAVAGLQAAEIYGLTV 251

Query: 250 LGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINLL 309
           L + I+D   N TRF ++G +   PSG DKT +L +  +Q  G L   L     HGI++ 
Sbjct: 252 LAERIEDDPGNTTRFLVIGKADSPPSGQDKTSLLLSCRNQ-AGGLHALLMPLAAHGISMT 310

Query: 310 KIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           +I+SRPS +  W YVFF+++ GH++D  V  AL  + +     KILGSYP
Sbjct: 311 RIESRPSRRGIWDYVFFIDILGHRQDLAVTAALEHLEKDAPLFKILGSYP 360



>gi|498119470|ref|WP_010433626.1| prephenate dehydratase [Pseudomonas syringae]
          Length = 364

 Score =  266 bits (679), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 213/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L++ERAR +  + + K  S          Y   +E  +  R+   N GP
Sbjct: 12  RIDSLDEKVLELISERARCAQEVARVKMSSLAEGEVPV-FYRPEREAAVLRRVMDRNRGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS+E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++  LP + I+++F
Sbjct: 71  LSNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISLPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGESTKTESI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 TRIYSHAQSLAQCRKWLDAHYPNVERVAVASNAEAAKRVKGEWNSAAIAGDMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+G+    P+G+DKT I+ ++ + +PGAL + L  F ++G++L
Sbjct: 251 RLAEKIEDRPDNSTRFLIIGNQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHENGLDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH +D +V+  L KI+   + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHKDPLVKAVLEKISSEAVALKVLGSYP 360



>gi|489408664|ref|WP_003314657.1| chorismate mutasea [Pseudomonas syringae]
 gi|330897207|gb|EGH28626.1| chorismate mutasea [Pseudomonas syringae pv. japonica str. M301072]
 gi|330939642|gb|EGH42947.1| chorismate mutasea [Pseudomonas syringae pv. pisi str. 1704B]
 gi|330980283|gb|EGH78418.1| chorismate mutasea [Pseudomonas syringae pv. aptata str. DSM 50252]
 gi|440361252|gb|ELP98484.1| chorismate mutase [Pseudomonas syringae BRIP34876]
 gi|440363630|gb|ELQ00791.1| chorismate mutase [Pseudomonas syringae BRIP34881]
 gi|443282930|gb|ELS41935.1| Chorismate mutase I / Prephenate dehydratase [Pseudomonas syringae
           pv. syringae B64]
 gi|514086967|gb|EPF67702.1| Bifunctional chorismate mutase I / prephenate dehydratase
           [Pseudomonas syringae pv. syringae SM]
          Length = 364

 Score =  266 bits (679), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 134/351 (38%), Positives = 213/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L++ERAR +  + + K  S          Y   +E  +  R+   N GP
Sbjct: 12  RIDSLDEKVLELISERARCAQEVARVKMSSLAEGEVPV-FYRPEREAAVLRRVMERNRGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS+E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++  LP + I+++F
Sbjct: 71  LSNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISLPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGESTKTESI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 TRIYSHAQSLAQCRKWLDAHYPNVERVAVASNAEAAKRVKGEWNSAAIAGDMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+G+    P+G+DKT I+ ++ + +PGAL + L  F ++G++L
Sbjct: 251 RLAEKIEDRPDNSTRFLIIGNQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHENGLDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH +D +V+  L +I+   + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHKDPLVKAVLERISSEAVALKVLGSYP 360



>gi|472326585|ref|YP_007658831.1| chorismate mutase [Pseudomonas denitrificans ATCC 13867]
 gi|505291042|ref|WP_015478144.1| chorismate mutase [Pseudomonas denitrificans]
 gi|472250577|gb|AGI25291.1| chorismate mutase [Pseudomonas denitrificans ATCC 13867]
          Length = 365

 Score =  266 bits (679), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 134/351 (38%), Positives = 213/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L++ERAR + ++ + K  +          Y   +E  +   I  LN GP
Sbjct: 13  RIDSLDEKILELISERARCATDVARVKMAALPEGEKPV-FYRPEREAWVLKHIMELNKGP 71

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 72  LDNEEVARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAALKHFGHAVISTPMAAIDEVF 131

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K S+I
Sbjct: 132 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTSNI 191

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +R+   S + AA+   SE  SAAIA    A LYGL+
Sbjct: 192 TRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIAGDMAASLYGLD 251

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++G+    P+G+DKT I+ ++   +PGAL + L  F ++GI+L
Sbjct: 252 KLHEKIEDRPDNSTRFLMIGNQEVPPTGDDKTSIIVSM-RNKPGALHELLVPFHNNGIDL 310

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH +D +++  L KIN   + +K+LGSYP
Sbjct: 311 TRIETRPSRSGKWTYVFFIDFVGHHKDPLIKDVLEKINSEAVALKVLGSYP 361



>gi|491148260|ref|WP_005006656.1| P-protein, bifunctional chorismate mutase/prephenate dehydratase
           [Nitrospina gracilis]
 gi|451762614|emb|CCQ89827.1| P-protein, bifunctional chorismate mutase/prephenate dehydratase
           [Nitrospina gracilis 3/211]
          Length = 357

 Score =  265 bits (678), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 143/350 (40%), Positives = 213/350 (60%), Gaps = 6/350 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID ID KL++L N RA +++ + K K             +V  +E +IF+R+ RLN GP
Sbjct: 10  RIDKIDEKLLELFNRRADLAIKIGKEK----SKRNESNHFHVPHREREIFERMKRLNTGP 65

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L + S+ SI++EI SA+++ +K L IAY GP  +++HQAAI  FG S  + P S+I  IF
Sbjct: 66  LPAHSIESIFREIFSATLALEKPLRIAYLGPETTFSHQAAIKAFGHSSVFEPASSIESIF 125

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSSIN 189
             VE+GH  YGIVP ENST G V  TLD F+    HI  E  L I+  LLSK+     I 
Sbjct: 126 SMVERGHVDYGIVPIENSTEGVVNLTLDCFVDSNLHISDEVLLGINLYLLSKTGNLDDIK 185

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLEV 249
           ++YSHPQ F QC+ +L+ H    ++I   ST+ AAE+A+   ++AAIA    AE Y L++
Sbjct: 186 EMYSHPQPFAQCRSWLNRHAGGIEQIPTSSTAVAAEMASKHKHAAAIAGKLAAEFYDLKI 245

Query: 250 LGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINLL 309
           + + I+D   N TRF ++G    K +  +KT ++F++  +  G+L   L VF  + INL 
Sbjct: 246 IAEKIEDRAQNTTRFLVIGKEPAKKAKRNKTSVMFSIQDE-AGSLLKILQVFGRNEINLT 304

Query: 310 KIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           KI SRP   + W Y+FFV+ +GH +D  + K +  +++ C+  ++LGSYP
Sbjct: 305 KIQSRPLRNRSWEYLFFVDFEGHIDDPGIDKVIRTVSKRCMYFRVLGSYP 354



>gi|490803834|ref|WP_004665960.1| prephenate dehydratase [Pseudomonas amygdali]
 gi|320323350|gb|EFW79438.1| chorismate mutase/prephenate dehydratase [Pseudomonas syringae pv.
           glycinea str. B076]
 gi|320327547|gb|EFW83559.1| chorismate mutase/prephenate dehydratase [Pseudomonas syringae pv.
           glycinea str. race 4]
 gi|330986664|gb|EGH84767.1| chorismate mutase/prephenate dehydratase [Pseudomonas syringae pv.
           lachrymans str. M301315]
 gi|331012934|gb|EGH92990.1| chorismate mutase/prephenate dehydratase [Pseudomonas syringae pv.
           tabaci str. ATCC 11528]
          Length = 364

 Score =  265 bits (678), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 213/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L++ERAR +  + + K  S          Y   +E  +  R+   N GP
Sbjct: 12  RIDSLDEKVLELISERARCAQEVARVKMSSLAEGEVPV-FYRPEREAAVLRRVMDRNRGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS+E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++  LP + I+++F
Sbjct: 71  LSNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISLPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGESTKTQSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 SRIYSHAQSLAQCRKWLDAHYPNVERVAVASNAEAAKRVKGEWNSAAIAGDMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+G+    P+G+DKT I+ ++ + +PGAL + L  F + G++L
Sbjct: 251 RLAEKIEDRPDNSTRFLIIGNQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHESGLDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH +D +V+  L KI+   + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHQDPLVKAVLEKISSEAVALKVLGSYP 360



>gi|492124670|ref|WP_005755158.1| prephenate dehydratase [Pseudomonas amygdali]
 gi|330889344|gb|EGH22005.1| chorismate mutase/prephenate dehydratase [Pseudomonas syringae pv.
           mori str. 301020]
          Length = 364

 Score =  265 bits (678), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 212/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L++ERAR +  + + K  S          Y   +E  +  R+   N GP
Sbjct: 12  RIDSLDEKVLELISERARCAQEVARVKMSSLAEGEVPV-FYRPEREAAVLRRVMDRNRGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS+E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++  LP + I+++F
Sbjct: 71  LSNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISLPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGESTKTQSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 SRIYSHAQSLAQCRKWLDAHYPNVERVAVASNAEAAKRVKGEWNSAAIAGDMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+G+    P+G+DKT I+ ++ + +PGAL + L  F + G++L
Sbjct: 251 RLAEKIEDRPDNSTRFLIIGNQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHESGLDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH +D +V+  L KI    + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHQDPLVKAVLEKIRSEAVALKVLGSYP 360



>gi|490795154|ref|WP_004657300.1| chorismate mutase/prephenate dehydratase [Pseudomonas savastanoi]
 gi|330876597|gb|EGH10746.1| chorismate mutase/prephenate dehydratase [Pseudomonas syringae pv.
           glycinea str. race 4]
          Length = 369

 Score =  265 bits (678), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 213/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L++ERAR +  + + K  S          Y   +E  +  R+   N GP
Sbjct: 12  RIDSLDEKVLELISERARCAQEVARVKMSSLAEGEVPV-FYRPEREAAVLRRVMDRNRGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS+E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++  LP + I+++F
Sbjct: 71  LSNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISLPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGESTKTQSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 SRIYSHAQSLAQCRKWLDAHYPNVERVAVASNAEAAKRVKGEWNSAAIAGDMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+G+    P+G+DKT I+ ++ + +PGAL + L  F + G++L
Sbjct: 251 RLAEKIEDRPDNSTRFLIIGNQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHESGLDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH +D +V+  L KI+   + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHQDPLVKAVLEKISSEAVALKVLGSYP 360



>gi|451948226|ref|YP_007468821.1| prephenate dehydratase [Desulfocapsa sulfexigens DSM 10523]
 gi|505217752|ref|WP_015404854.1| prephenate dehydratase [Desulfocapsa sulfexigens]
 gi|451907574|gb|AGF79168.1| prephenate dehydratase [Desulfocapsa sulfexigens DSM 10523]
          Length = 362

 Score =  265 bits (678), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 141/349 (40%), Positives = 204/349 (58%), Gaps = 8/349 (2%)

Query: 12  IDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGPL 71
           ID ID  +++LL ER  ++ ++ + K+ S          +   +E QI++R+ +LN+G  
Sbjct: 12  IDKIDNTILELLKERLSLAKSIGQLKDESKRAK------WDPLRERQIYERLTKLNDGVF 65

Query: 72  SSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIFD 131
              SL SI+ EII+    SQ+ +++AY GP  ++TH A +  FG S  Y P  +I D+F 
Sbjct: 66  PDNSLHSIFHEIITTCRLSQQKIAVAYLGPEATFTHLAGVKYFGQSATYSPMESIADVFS 125

Query: 132 SVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSSINK 190
            VEKG T YGIVP ENS  G+V +TLD F+  +T I  E  + I+H L+ KS   S I  
Sbjct: 126 EVEKGRTQYGIVPVENSIEGAVFSTLDSFMQYRTKICGEVRMEITHNLVCKSGDISDIQT 185

Query: 191 VYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLEVL 250
           V SH Q   QC+++L  HL     +   ST  AA++AA+ P   AIAS    + Y L+V+
Sbjct: 186 VASHTQPLAQCREWLRKHLPSCPTLPVFSTGAAAQMAANNPNIGAIASSLAIKTYDLQVV 245

Query: 251 GKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINLLK 310
            + I+D + N TRF ++G  S  PSG D+T +L  +  +RPGAL + LSV    GINL K
Sbjct: 246 VRGIEDYRGNTTRFLVIGKESPSPSGADRTSLLLGI-MERPGALNEILSVIARAGINLAK 304

Query: 311 IDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           I+SRP   + W Y+FF++L GH EDE ++     +N  C   + LGSYP
Sbjct: 305 IESRPIKGKQWKYLFFLDLMGHIEDEHIKDCCKTLNSLCSYYEWLGSYP 353



>gi|66046874|ref|YP_236715.1| chorismate mutase [Pseudomonas syringae pv. syringae B728a]
 gi|489499324|ref|WP_003404232.1| prephenate dehydratase [Pseudomonas syringae]
 gi|63257581|gb|AAY38677.1| prephenate dehydratase [Pseudomonas syringae pv. syringae B728a]
 gi|330972343|gb|EGH72409.1| chorismate mutasea [Pseudomonas syringae pv. aceris str. M302273]
 gi|407996409|gb|EKG36882.1| chorismate mutase [Pseudomonas syringae pv. avellanae str.
           ISPaVe037]
 gi|407996522|gb|EKG36991.1| chorismate mutase [Pseudomonas syringae pv. avellanae str.
           ISPaVe013]
          Length = 364

 Score =  265 bits (678), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 134/351 (38%), Positives = 213/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L++ERAR +  + + K  S          Y   +E  +  R+   N GP
Sbjct: 12  RIDSLDEKVLELISERARCAQEVARVKMSSLAEGEVPV-FYRPEREAAVLRRVMERNRGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS+E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++  LP + I+++F
Sbjct: 71  LSNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISLPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGESTKTESI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 TRIYSHAQSLAQCRKWLDAHYPNVERVAVASNAEAAKRVKGEWNSAAIAGDMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+G+    P+G+DKT I+ ++ + +PGAL + L  F ++G++L
Sbjct: 251 RLAEKIEDRPDNSTRFLIIGNQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHENGLDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH +D +V+  L +I+   + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHKDPLVKAVLEQISSEAVALKVLGSYP 360



>gi|77163712|ref|YP_342237.1| chorismate mutase [Nitrosococcus oceani ATCC 19707]
 gi|488902017|ref|WP_002813098.1| prephenate dehydratase [Nitrosococcus oceani]
 gi|76882026|gb|ABA56707.1| chorismate mutase [Nitrosococcus oceani ATCC 19707]
 gi|207088729|gb|EDZ66001.1| prephenate dehydratase domain protein [Nitrosococcus oceani AFC27]
          Length = 361

 Score =  265 bits (677), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 137/350 (39%), Positives = 209/350 (59%), Gaps = 6/350 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID++D +L  L+NERA ++    + K+ +          +   +E +I  R+   N GP
Sbjct: 13  RIDALDEQLQCLINERAELARQTAQIKQAA----GLGENCFRPEREAEILRRVIARNQGP 68

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS + +  +++EI+SA ++ +  L IAY GP G++T  AA+  FG S+   P   I+++F
Sbjct: 69  LSGQEMARLFREIMSACLALETPLVIAYLGPEGTFTEAAALKHFGHSVKTQPLMAIDEVF 128

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKSK-FSSIN 189
             VE G   YG+VP ENST G+V  TLDRF+     I  E  LRI H LLS+++  + +N
Sbjct: 129 REVEAGTAYYGVVPVENSTEGAVTHTLDRFLVSPLQICGEVELRIHHHLLSRNQTIAEVN 188

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLEV 249
           ++Y+H Q   QC+++LD+HL   +RI   S  +AA  A  E   AAIAS    E+YGL  
Sbjct: 189 RLYAHQQTLAQCREWLDAHLAGCERIPVSSNGEAARRAGDESDCAAIASDRAREIYGLHA 248

Query: 250 LGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINLL 309
           L  +I+D   N TRF ++GS +   SGNDKT +L +    R G L D LS   ++GI++ 
Sbjct: 249 LATNIEDEPGNTTRFLVIGSQAVVASGNDKTSLLVS-GPNRSGLLYDLLSPLAEYGISMT 307

Query: 310 KIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           +++SRPS +Q W YVFF++++GH +D  +  AL  + E    +K+LGSYP
Sbjct: 308 RLESRPSRRQLWEYVFFIDVEGHIDDSNLTTALATLKERASFLKLLGSYP 357



>gi|498169126|ref|WP_010483282.1| prephenate dehydratase [Pseudomonas sp. S9]
          Length = 368

 Score =  265 bits (677), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 133/351 (37%), Positives = 210/351 (59%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L+++RAR +  + + K  +          Y   +E Q+  RI   N GP
Sbjct: 16  RIDSLDEKILELISDRARCAEEVARVKMAALPEGEKPV-FYRPEREAQVLKRIMDRNAGP 74

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ +  L +AY GP G+++  AA+  FG ++  +P + I+++F
Sbjct: 75  LGNEEMARLFREIMSSCLALENPLKVAYLGPEGTFSQAAAMKHFGHAVISVPMAAIDEVF 134

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G++  TLD F+     I  E  LRI H LL    +K   I
Sbjct: 135 REVAAGAVNFGVVPVENSTEGAINHTLDSFLEHDMVICGEVELRIHHHLLVGESTKTDKI 194

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +RI   S + AA+   SE  SAAIA    A LYGL 
Sbjct: 195 TRIYSHAQSLAQCRKWLDAHFPNVERIAVSSNADAAKRVKSEWNSAAIAGDMAASLYGLT 254

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+GS    P+G+DKT ++ ++ + +PGAL + L  F  +GI+L
Sbjct: 255 KLAEKIEDRPDNSTRFLIIGSQEVPPTGDDKTSVIISMSN-KPGALHELLVPFHQNGIDL 313

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +++  L KIN+  + +K+LGSYP
Sbjct: 314 TRIETRPSRSGKWTYVFFIDFVGHHRDPLIKDVLEKINQEAVALKVLGSYP 364



>gi|495365645|ref|WP_008090361.1| prephenate dehydratase [Pseudomonas sp. GM84]
 gi|398254871|gb|EJN39928.1| chorismate mutase, clade 2 [Pseudomonas sp. GM84]
          Length = 364

 Score =  265 bits (677), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 133/351 (37%), Positives = 211/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L++ERAR +  + + K  S          Y   +E  +  R+   N GP
Sbjct: 12  RIDSLDEKILELISERARCAQEVARVKTASLAEGEKPV-FYRPEREAAVLKRVMERNKGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L IAY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LDNEEMARLFREIMSSCLALEEPLKIAYLGPEGTFTQAAAMKHFGHAVISRPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVSHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 TRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAANLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++GS    P+G+DKT I+ ++ + +PGAL + L  F ++GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGSQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHENGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +++  L +I++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLIKAVLEQISQEAVALKVLGSYP 360



>gi|104780670|ref|YP_607168.1| bifunctional chorismate mutase/prephenate dehydratase PheA
           [Pseudomonas entomophila L48]
 gi|499852039|ref|WP_011532773.1| prephenate dehydratase [Pseudomonas entomophila]
 gi|95109657|emb|CAK14358.1| bifunctional chorismate mutase/prephenate dehydratase PheA
           [Pseudomonas entomophila L48]
          Length = 364

 Score =  265 bits (677), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 133/351 (37%), Positives = 211/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L++ERAR +  + K K  +          Y   +E  +  R+   N GP
Sbjct: 12  RIDSLDEKILELISERARCAQEVAKVKTATLAEGEKPV-FYRPEREAAVLKRVMERNKGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L IAY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LDNEEMARLFREIMSSCLALEEPLKIAYLGPEGTFTQAAAMKHFGHAVVSRPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVSHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 TRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAANLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++GS    P+G+DKT I+ ++ + +PGAL + L  F ++GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGSQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHENGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +++  L +I++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLIKAVLEQISQEAVALKVLGSYP 360



>gi|77460297|ref|YP_349804.1| prephenate dehydratase [Pseudomonas fluorescens Pf0-1]
 gi|495226142|ref|WP_007950913.1| prephenate dehydratase [Pseudomonas sp. GM25]
 gi|77384300|gb|ABA75813.1| chorismate mutase/prephenate dehydratase [Pseudomonas fluorescens
           Pf0-1]
 gi|398143078|gb|EJM31960.1| chorismate mutase, clade 2 [Pseudomonas sp. GM25]
          Length = 364

 Score =  265 bits (677), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 133/351 (37%), Positives = 212/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID++D K++QL+++RAR +  + + K  S          Y   +E Q+  R+   N GP
Sbjct: 12  RIDNLDEKILQLISDRARCAEEVARVKMASLAEGEQPV-FYRPEREAQVLKRVMERNKGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ +  L +AY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LGNEEMARLFREIMSSCLALENPLKVAYLGPEGTFTQAAAMKHFGHAVISKPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 SRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++G+    P+G+DKT I+ ++ + +PGAL + L  F D+GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGNQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHDNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +++  L KI++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLIKGVLEKISQEAVALKVLGSYP 360



>gi|496224010|ref|WP_008938045.1| chorismate mutase / prephenate dehydratase [Marinobacter
           santoriniensis]
 gi|469613422|gb|EMP56555.1| chorismate mutase / prephenate dehydratase [Marinobacter
           santoriniensis NKSG1]
          Length = 365

 Score =  265 bits (677), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 144/351 (41%), Positives = 211/351 (60%), Gaps = 5/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           QIDSID +++ L++ RA  +  +   K  +          Y   +E Q+  RI   N GP
Sbjct: 14  QIDSIDQQIMDLISARAACAQEVANVKMAA--NPGQDVFFYRPEREAQVLRRIKEQNPGP 71

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L+ E +  +++EI+SA ++ +K + IA+ GP+G++T  AA+  FG S+  +P   I+ +F
Sbjct: 72  LADEEMARLFREIMSACLALEKPMHIAFLGPIGTFTQAAALKHFGHSVVSVPLPAIDAVF 131

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             VE G   YG+VP ENST G +  TLD F+S    I  E  LRI H LL   +SK   I
Sbjct: 132 REVESGAAHYGVVPVENSTEGMINHTLDMFMSSPLKICGEVQLRIHHHLLVSPESKDQEI 191

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q F QC+++LD+H    +R+   S ++AA  AA EP +AAIA    AELYGLE
Sbjct: 192 TRIYSHQQSFAQCRQWLDTHRYGIERVTVSSNAEAARRAAEEPGTAAIAGDMAAELYGLE 251

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L   I+D  +N TRF I+G      SG+DK+ IL ++   +PGAL   L  F  HGI+L
Sbjct: 252 KLANCIEDRPDNTTRFLIIGREEVSASGHDKSSILVSM-RNKPGALYQLLEPFHRHGISL 310

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVF+++ +GH EDE V+K L+ ++E  +++K LGSYP
Sbjct: 311 TRIETRPSPSGTWAYVFYIDFEGHVEDEQVRKVLSDVDEEAVELKKLGSYP 361



>gi|404495721|ref|YP_006719827.1| chorismate mutase and prephenate dehydratase [Geobacter
           metallireducens GS-15]
 gi|490648013|ref|WP_004513008.1| prephenate dehydratase [Geobacter metallireducens]
 gi|373560628|gb|EHP86885.1| chorismate mutase [Geobacter metallireducens RCH3]
 gi|403377993|gb|ABB31104.2| chorismate mutase and prephenate dehydratase [Geobacter
           metallireducens GS-15]
          Length = 355

 Score =  265 bits (676), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 140/353 (39%), Positives = 215/353 (60%), Gaps = 8/353 (2%)

Query: 8   FSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLN 67
             + ID+ID +++ LLN R+R+++ + K K G           +V  +E +I++R+   N
Sbjct: 7   LRRDIDAIDDQILDLLNSRSRLAIEVGKVKAGE------NRDFHVPSREREIYERLAAGN 60

Query: 68  NGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTIN 127
           +GP  +E++ S+++EIISAS++ +  + +A+ GP  ++TH A++  FG S   +P+ +I 
Sbjct: 61  SGPFPNEAVRSVFREIISASLALESPMKVAFLGPKATFTHLASLQHFGLSAELVPQKSIP 120

Query: 128 DIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFS 186
            +F+ V KG + YG+VP ENST G V  TLD F+     I AE  L +SH LLS++ +  
Sbjct: 121 AVFEEVSKGRSLYGVVPVENSTEGMVSHTLDMFMESDLKINAEILLEVSHDLLSRTGRLE 180

Query: 187 SINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYG 246
            + KVYSHPQ   QC+ +LD +L     +D  ST+ AA+I   +  +AAIAS   A LY 
Sbjct: 181 DVKKVYSHPQAIAQCRNWLDENLSGVPVVDVASTALAAQIVGEDYTAAAIASEFAAALYD 240

Query: 247 LEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGI 306
           L+V+   I+D  NN TRF ++G       G+DKT ++F+V  + PG L   L  F   G+
Sbjct: 241 LKVVRHRIEDQVNNFTRFLVVGRKMADRCGDDKTSLMFSVKDE-PGILHRMLEPFAKRGV 299

Query: 307 NLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           NL KI+SRP  ++ W Y+FF++L GH  D VV  A+ ++  +C  VKILGSYP
Sbjct: 300 NLSKIESRPLKKKAWEYIFFLDLAGHISDPVVSDAVQELKNYCQFVKILGSYP 352



>gi|507096835|ref|WP_016167477.1| chorismate mutase [Acinetobacter tandoii]
 gi|505762538|gb|EOR06569.1| chorismate mutase [Acinetobacter tandoii DSM 14970 = CIP 107469]
          Length = 369

 Score =  265 bits (676), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 140/360 (38%), Positives = 213/360 (59%), Gaps = 8/360 (2%)

Query: 3   NVDLT-FSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFD 61
           ++DLT   + IDS+D ++ QL+N RAR++  + KAK  S          Y   +E Q+  
Sbjct: 11  SLDLTKIREDIDSVDQQIQQLINRRARLAEAVAKAKFAS----EENPMFYRPEREAQVLR 66

Query: 62  RIHRLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYL 121
            +   N GPLS  ++  +++EI+SA ++ +   SIA+ GP+G++TH A +  FG      
Sbjct: 67  NVMERNEGPLSDVTMARLFREIMSACLALEAPQSIAFLGPVGTFTHSAVLKHFGQDAVVR 126

Query: 122 PKSTINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL- 180
           P  TI+++F  VE G   YG+VP ENS+ G V  TLD F S   +++ E  LRI H  L 
Sbjct: 127 PLPTIDEVFREVEAGSAHYGLVPVENSSEGVVNHTLDCFKSSTLNVIGEVELRIHHQFLI 186

Query: 181 -SKSKFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASI 239
              ++  SI ++Y+H Q   QC+K+LD+H    +R+   S ++AA    +E +SAAIAS 
Sbjct: 187 SENTRKDSIKQIYAHQQTLAQCRKWLDAHYPGVERVALNSNAEAARRIRNEWHSAAIASD 246

Query: 240 TCAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLS 299
             A +Y LE+L  +I+D   N TRF ++G      SGNDKT +L +  H R GAL + L+
Sbjct: 247 VAASIYELEILHSNIEDNPENTTRFLVIGREKVPQSGNDKTSLLISA-HDRAGALLEILA 305

Query: 300 VFKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            F  H I+L  I++RP+  + W YVFF++L+GH E E V+ A+ +I     +V++LGSYP
Sbjct: 306 PFAKHQISLTSIETRPALPEKWAYVFFIDLEGHIEQENVKAAIEEIRPLVKEVRVLGSYP 365



>gi|511757923|ref|WP_016391193.1| bifunctional chorismate mutase/prephenate dehydratase PheA
           [Pseudomonas plecoglossicida]
 gi|511105004|gb|EPB97866.1| bifunctional chorismate mutase/prephenate dehydratase PheA
           [Pseudomonas plecoglossicida NB2011]
          Length = 364

 Score =  265 bits (676), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 133/351 (37%), Positives = 211/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L++ERAR +  + K K  +          Y   +E  +  R+   N GP
Sbjct: 12  RIDSLDEKILELISERARCAQEVAKVKTATLAEGEKPV-FYRPEREAAVLKRVMEGNKGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L IAY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LDNEEMARLFREIMSSCLALEEPLKIAYLGPEGTFTQAAAMKHFGHAVVSRPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVSHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 TRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAANLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++GS    P+G+DKT I+ ++ + +PGAL + L  F ++GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGSQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHENGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +++  L +I++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLIKAVLEQISQEAVALKVLGSYP 360



>gi|489464548|ref|WP_003369723.1| prephenate dehydratase [Pseudomonas syringae]
 gi|330953531|gb|EGH53791.1| chorismate mutasea [Pseudomonas syringae Cit 7]
 gi|440372834|gb|ELQ09612.1| chorismate mutase [Pseudomonas syringae BRIP39023]
          Length = 364

 Score =  265 bits (676), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 134/351 (38%), Positives = 213/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L++ERAR +  + + K  S          Y   +E  +  R+   N GP
Sbjct: 12  RIDSLDEKVLELISERARCAQEVARVKMSSLAEGEVPV-FYRPEREAAVLRRVMDRNRGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS+E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++  LP + I+++F
Sbjct: 71  LSNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISLPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGESTKTESI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 TRIYSHAQSLAQCRKWLDAHYPNVERVAVASNAEAAKRVKGEWNSAAIAGDMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+G+    P+G+DKT I+ ++ + +PGAL + L  F ++G++L
Sbjct: 251 RLAEKIEDRPDNSTRFLIIGNQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHENGLDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH +D +V+  L +I+   + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHKDPLVKAVLEQISSEAVALKVLGSYP 360



>gi|300112893|ref|YP_003759468.1| chorismate mutase [Nitrosococcus watsonii C-113]
 gi|502984283|ref|WP_013219259.1| prephenate dehydratase [Nitrosococcus watsonii]
 gi|299538830|gb|ADJ27147.1| chorismate mutase [Nitrosococcus watsonii C-113]
          Length = 361

 Score =  264 bits (675), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 135/350 (38%), Positives = 208/350 (59%), Gaps = 6/350 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID++D +L  L+NERA ++    + K+            +   +E +I  R+   N GP
Sbjct: 13  RIDALDEQLQCLINERAELARQTAQIKQA----VGLGENCFRPEREAEILRRVIARNRGP 68

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS + +  +++E++SA ++ +  L IAY GP G++T  AA+  FG S+   P   I+++F
Sbjct: 69  LSGQEMARLFREVMSACLALETPLVIAYLGPEGTFTEAAALKHFGHSVKTRPLMAIDEVF 128

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKSK-FSSIN 189
             VE G   YG+VP ENST G+V  TLDRF+     I  E  LRI H LLS+++  + +N
Sbjct: 129 REVEAGTAYYGVVPVENSTEGAVTHTLDRFLVSPLQICGEVELRIHHHLLSRNETITEVN 188

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLEV 249
           ++Y+H Q   QC+++LD+HL   +RI   S  +AA  A  E   AAIAS    E+YGL  
Sbjct: 189 RLYAHQQTLAQCREWLDAHLAGCERIPVSSNGEAARRAGDESGCAAIASDRAREIYGLRA 248

Query: 250 LGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINLL 309
           L  +I+D   N TRF ++GS +   SGNDKT +L +    RPG L + L    ++GI++ 
Sbjct: 249 LASNIEDEPGNTTRFLVIGSQAVVASGNDKTSLLVS-GPNRPGLLYNLLCPLAEYGISMT 307

Query: 310 KIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           +++SRPS +Q W YVFF++++GH +D  +  AL  + E    +K+LGSYP
Sbjct: 308 RLESRPSRRQLWEYVFFIDVEGHIDDSNLTTALATLKERASFLKLLGSYP 357



>gi|497909984|ref|WP_010224140.1| prephenate dehydratase [Pseudomonas sp. HYS]
          Length = 364

 Score =  264 bits (675), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 130/351 (37%), Positives = 215/351 (61%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L+++RAR +  + + K  +          Y   +E Q+  R+ + N GP
Sbjct: 12  RIDSLDEKILELISDRARCAQEVARVKTATLAEGETPV-FYRPEREAQVLKRVMQRNQGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LGNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAALKHFGHAVISKPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A+LYGL 
Sbjct: 191 SRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAADLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++G+    P+G+DKT I+ ++ + +PGAL + L  F ++GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGNQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHENGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +++  L +I++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLIKAVLEQISQEAVALKVLGSYP 360



>gi|496010486|ref|WP_008735065.1| prephenate dehydratase [Alcanivorax pacificus]
 gi|407023739|gb|EKE35484.1| chorismate mutase/prephenate dehydratase [Alcanivorax pacificus
           W11-5]
          Length = 361

 Score =  264 bits (675), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 133/351 (37%), Positives = 211/351 (60%), Gaps = 7/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           QID +D +L  L+N+RA ++  + + K+ +          Y   +E Q+  R+   N GP
Sbjct: 12  QIDGLDDQLQTLMNQRATLAQKVAEVKQAT----DGDAVFYRPEREAQVLRRVKERNTGP 67

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L  E++  +++EI+SA ++ ++ + +A+ GP G++THQAA+  FG ++  +    I+++F
Sbjct: 68  LDGETVARLFREIMSACLALEQRMKVAFLGPEGTFTHQAALKHFGHAVEAVSLGAIDEVF 127

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             VE G   YG+VP ENST G V  TLD F+     I  E  LRI H LL    ++ + I
Sbjct: 128 REVESGAVQYGVVPVENSTEGVVNHTLDSFMDSSLKICGEVDLRIHHHLLLGEHTQENRI 187

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H+   +R+   S ++AA     E  +AAIA    AELYGL+
Sbjct: 188 TRIYSHQQTLAQCRKWLDAHMPTVERVAVSSNAQAARRLKDEWNAAAIAGEMAAELYGLK 247

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
           ++  +I+D  +N TRF I+G     PSG DKT IL  + + RPGAL   L  FK+H ++L
Sbjct: 248 IMHHNIEDRPDNTTRFIIIGRQDTPPSGQDKTSILVRMKN-RPGALYHVLKPFKEHSVDL 306

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +++SRPS    W YVFF++ +GH++D+ V + L  + +  +D++ LGSYP
Sbjct: 307 TRVESRPSRSGNWSYVFFIDFEGHRDDDRVGRVLAALEQEAMDIRFLGSYP 357



>gi|489553806|ref|WP_003458404.1| Chorismate mutase I / Prephenate dehydratase [Pseudomonas
           pseudoalcaligenes]
 gi|442905266|gb|ELS30108.1| Chorismate mutase I / Prephenate dehydratase [Pseudomonas
           pseudoalcaligenes KF707]
          Length = 364

 Score =  264 bits (675), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 210/351 (59%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L++ERAR + ++ + K  S          Y   +E  +   I   N GP
Sbjct: 12  RIDSLDEKILELISERARCAQDVARVKMASLPEGEKPV-FYRPEREAWVLKHIMERNKGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LDNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAALKHFGHAVISSPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  +I
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDNI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +R+   S + AA+   SE  SAAIA    A LYGL 
Sbjct: 191 TRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIAGDMAANLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+GS    P+G+DKT I+ ++   +PGAL + L  F ++GI+L
Sbjct: 251 KLCEKIEDRPDNSTRFLIIGSQEVPPTGDDKTSIIVSM-RNKPGALHELLVPFHNNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +++  L KIN+  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLIKDVLEKINQEAVALKVLGSYP 360



>gi|490962715|ref|WP_004824524.1| prephenate dehydratase [Acinetobacter bereziniae]
 gi|444760298|gb|ELW84751.1| chorismate mutase [Acinetobacter sp. WC-743]
 gi|479976511|gb|ENV20519.1| chorismate mutase [Acinetobacter bereziniae NIPH 3]
 gi|480056534|gb|ENV95560.1| chorismate mutase [Acinetobacter bereziniae CIP 70.12]
          Length = 368

 Score =  264 bits (675), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 136/352 (38%), Positives = 210/352 (59%), Gaps = 7/352 (1%)

Query: 10  QQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNG 69
           + IDS+D ++ QL+N RA+++  + KAK  S          Y   +E Q+  ++   N G
Sbjct: 18  EDIDSVDQQIQQLINRRAKLAEAVAKAKFAS----EENPLFYRPEREAQVLRKVMERNEG 73

Query: 70  PLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDI 129
           PLS +++  +++EI+SA ++ +   SIA+ GP+G+YTH A +  FG      P  TI+++
Sbjct: 74  PLSDQTMARLFREIMSACLALEAPQSIAFLGPVGTYTHSAVLKHFGQDAVVRPLPTIDEV 133

Query: 130 FDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSS 187
           F  VE G   YG+VP ENS+ G V  TLD F +   +++ E  LRI H  L  S ++  S
Sbjct: 134 FREVEAGSAHYGLVPVENSSEGVVNHTLDCFKASHLNVIGEVELRIHHQFLISSNTRKDS 193

Query: 188 INKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGL 247
           I ++Y+H Q   QC+K+LD+H    +R+   S ++AA    +E +SAAIAS   A +Y L
Sbjct: 194 IKQIYAHQQTLAQCRKWLDAHYPGVERVALSSNAEAARRIRNEWHSAAIASDVAASIYDL 253

Query: 248 EVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGIN 307
           E+L  +I+D   N TRF ++G      SGNDKT +L +  H R GAL + L+ F  H I+
Sbjct: 254 EILHGNIEDNPENTTRFLVIGREKVPQSGNDKTSLLISA-HDRAGALLEILAPFAKHNIS 312

Query: 308 LLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           L  I++RP+  + W YVFF++L+GH E + V+ A+  I     +V++LGSYP
Sbjct: 313 LTSIETRPALPEKWAYVFFIDLEGHVEQDNVKAAIEDIRPLVKEVRVLGSYP 364



>gi|490857198|ref|WP_004719240.1| chorismate mutase [Acinetobacter guillouiae]
 gi|479910245|gb|ENU59117.1| chorismate mutase [Acinetobacter guillouiae CIP 63.46]
 gi|479971599|gb|ENV15844.1| chorismate mutase [Acinetobacter guillouiae NIPH 991]
 gi|514265416|gb|EPH37336.1| Chorismate mutase I [Acinetobacter guillouiae MSP4-18]
          Length = 368

 Score =  264 bits (675), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 136/352 (38%), Positives = 211/352 (59%), Gaps = 7/352 (1%)

Query: 10  QQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNG 69
           + IDS+D ++ QL+N RA+++ ++ KAK  +          Y   +E Q+  ++   N G
Sbjct: 18  EDIDSVDQQIQQLINRRAKLAESVAKAKFAA----EENPLFYRPEREAQVLRQVMERNEG 73

Query: 70  PLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDI 129
           PLS +++  +++EI+SA ++ +   SIA+ GP+G+YTH A +  FG      P  TI+++
Sbjct: 74  PLSDQTMARLFREIMSACLALEAPQSIAFLGPVGTYTHSAVLKHFGQDAVVRPLPTIDEV 133

Query: 130 FDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSS 187
           F  VE G   YG+VP ENS+ G V  TLD F +   +++ E  LRI H  L  S ++  S
Sbjct: 134 FREVEAGSAHYGLVPVENSSEGVVNHTLDCFKASHLNVIGEVELRIHHQFLISSNTRKDS 193

Query: 188 INKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGL 247
           I ++Y+H Q   QC+K+LD+H    +R+   S ++AA    +E +SAAIAS   A +Y L
Sbjct: 194 IKQIYAHQQTLAQCRKWLDAHYPGVERVALSSNAEAARRIRNEWHSAAIASDVAASIYDL 253

Query: 248 EVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGIN 307
           EVL  +I+D   N TRF ++G      SGNDKT +L +  H R GAL + L+ F  H I+
Sbjct: 254 EVLHGNIEDNPENTTRFLVIGREKVPQSGNDKTSLLISA-HDRAGALLEILAPFAKHNIS 312

Query: 308 LLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           L  I++RP+  + W YVFF++L+GH E + V+ A+  I     +V++LGSYP
Sbjct: 313 LTSIETRPALPEKWAYVFFIDLEGHVEQDNVKAAIEDIRPLVKEVRVLGSYP 364



>gi|489013292|ref|WP_002923817.1| chorismate mutase [Thauera sp. 27]
 gi|479294857|gb|ENO82957.1| chorismate mutase [Thauera sp. 27]
 gi|479306677|gb|ENO94777.1| chorismate mutase [Thauera sp. 28]
          Length = 355

 Score =  264 bits (674), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 127/355 (35%), Positives = 209/355 (58%), Gaps = 10/355 (2%)

Query: 6   LTFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHR 65
           L    +ID +D +++  L+ERAR +  + + K G           Y   +E Q+  R+  
Sbjct: 6   LKLRNEIDRLDEEILARLSERARCAQRVGEIKRG--------VMYYRPEREAQVLRRLAE 57

Query: 66  LNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKST 125
           LN GPLS +++ +I++E++SA +  ++ L +AY GP G+++  A+   FG + N++  + 
Sbjct: 58  LNPGPLSPDAVKTIFREVMSACLGLEQPLRVAYLGPAGTFSESASRKHFGSAPNFMAMAA 117

Query: 126 INDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKSK- 184
           I+D+F +VE G+  YG+VP ENST G+V  TLD  ++    +  E  LRI   L+S++  
Sbjct: 118 IDDVFRAVEAGNADYGVVPVENSTEGAVGGTLDLLLANPLKVCGEVRLRIHQQLMSRADG 177

Query: 185 FSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAEL 244
             +  +VYSH Q   QC ++L+ +L    RI   S ++AA +A+ +P S AIA    A+L
Sbjct: 178 IGAARRVYSHAQSLAQCHEWLNRNLPHLPRIPVASNAEAARMASEDPESCAIAGEAAAQL 237

Query: 245 YGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDH 304
           YGL +L  +I+D  NN TRF ++      PSG D+T ++F+  + RPGA+   L     H
Sbjct: 238 YGLNILAPNIEDDPNNTTRFLVIADHDAGPSGQDRTSLVFSAPN-RPGAIHGLLEPMARH 296

Query: 305 GINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           G+++ K+ SRP+    W YVF+ ++ GH++D  V  AL ++N+    VK++GSYP
Sbjct: 297 GVDMTKLQSRPARSGLWEYVFYADINGHRDDPEVAAALAELNDRAAFVKVIGSYP 351



>gi|495842535|ref|WP_008567114.1| prephenate dehydratase [Pseudomonas sp. Chol1]
 gi|409119414|gb|EKM95798.1| chorismate mutase [Pseudomonas sp. Chol1]
 gi|409121430|gb|EKM97552.1| chorismate mutase [Pseudomonas sp. Chol1]
          Length = 365

 Score =  264 bits (674), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 134/351 (38%), Positives = 210/351 (59%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L++ERAR + ++ + K  +          Y   +E  +   I  LN GP
Sbjct: 13  RIDSLDEKILELISERARCAQDVARVKTATLAEGEQAV-FYRPEREAWVLKHIMELNKGP 71

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G+++  AA+  FG S+   P + I+++F
Sbjct: 72  LDNEEIARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHSVISTPMAAIDEVF 131

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K   I
Sbjct: 132 REVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHLLVGETTKTDRI 191

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LDSH    +R+   S + AA+   SE  SAAIA    A+LYGL+
Sbjct: 192 TRIYSHAQSLAQCRKWLDSHYPNVERVAVSSNADAAKRVKSEWNSAAIAGDMAAQLYGLQ 251

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+GS    P+G+DKT I+ ++   +PG L + L  F  +GI+L
Sbjct: 252 KLAEKIEDRPDNSTRFLIIGSQDVPPTGDDKTSIIVSM-RNKPGTLHELLMPFHANGIDL 310

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH +D +++  L KI +  + +K+LGSYP
Sbjct: 311 TRIETRPSRSGKWTYVFFIDFLGHHQDPLIKDVLEKIGKEAVALKVLGSYP 361



>gi|488794399|ref|WP_002706805.1| prephenate dehydratase [Thiothrix nivea]
 gi|386419006|gb|EIJ32841.1| chorismate mutase [Thiothrix nivea DSM 5205]
          Length = 368

 Score =  264 bits (674), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 133/353 (37%), Positives = 212/353 (60%), Gaps = 6/353 (1%)

Query: 8   FSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLN 67
             ++ID++DT+++ LLNERAR +  +   K             Y   +E QI  R+  LN
Sbjct: 17  LRERIDALDTQILGLLNERARCAEEVAHTK----LAEDPNAKFYRPEREAQILTRMQSLN 72

Query: 68  NGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTIN 127
           NGPL +E +  +++EIIS+ ++ ++ + IAY GP G++T +A    FG ++  LP  +I 
Sbjct: 73  NGPLRNEQITHLFREIISSCLALEESMRIAYLGPAGTFTQEATHKHFGQAVATLPVESIP 132

Query: 128 DIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSK-SKFS 186
            +F  VE G   YG+VP ENST G +  TLD F+     +  E  LRI   L+ + + + 
Sbjct: 133 QVFREVEAGRVRYGVVPIENSTDGVITHTLDMFVQSNLRVCGEISLRIHQNLMCQHASWQ 192

Query: 187 SINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYG 246
           S+ KVYSH Q   QC+ +LD HL +A+RI   S ++AA +A+ +  +AAI  I  A +YG
Sbjct: 193 SVQKVYSHAQSLAQCRFWLDKHLPQAERIPVSSNAEAARLASLDDTAAAIGGIQAAPIYG 252

Query: 247 LEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGI 306
           L+++  +I+D  NN TRF ++G     PSGND+T +L +  +Q PG+L   L    ++G+
Sbjct: 253 LQIVHDNIEDNPNNTTRFLVIGDQVVSPSGNDRTSLLVSTRNQ-PGSLYKLLKPLSENGV 311

Query: 307 NLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           ++ +I+SRPS    W Y FF++++GH++D  + KAL  + +    V++LGSYP
Sbjct: 312 DMTRIESRPSRTTNWEYFFFLDVRGHEQDAAISKALEALRQEAEVVRVLGSYP 364



>gi|431930683|ref|YP_007243729.1| chorismate mutase, clade 2 [Thioflavicoccus mobilis 8321]
 gi|505093141|ref|WP_015280243.1| chorismate mutase, clade 2 [Thioflavicoccus mobilis]
 gi|431828986|gb|AGA90099.1| chorismate mutase, clade 2 [Thioflavicoccus mobilis 8321]
          Length = 360

 Score =  264 bits (674), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 145/353 (41%), Positives = 212/353 (60%), Gaps = 11/353 (3%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAK--EGSYXXXXXXXXVYVSGKENQIFDRIHRLNN 68
           +ID+ID +L+ L+ ERA  +  + K K   G +         Y   +E QI  RI   N 
Sbjct: 13  RIDAIDHQLMDLITERAVCARKIAKIKIAAGDWQ-------FYRPEREAQILRRIKAENP 65

Query: 69  GPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTIND 128
           GPL  E +  +++EI+SA ++ ++ L++AY GP G++T  AA+  FG S+  +P  TI +
Sbjct: 66  GPLGDEEMTRLFREIMSACLALEQPLTVAYLGPAGTFTQTAALKHFGRSVKTVPLGTIPE 125

Query: 129 IFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSK-SKFSS 187
           IF  VE G   YG+VP ENST G V  TLD F++    I  E  +RI H LLS+ +  S+
Sbjct: 126 IFREVEAGSVHYGVVPVENSTEGVVSHTLDSFVASPLFICGEVCVRIHHFLLSRETTLSA 185

Query: 188 INKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGL 247
           +N VYSH Q   QC+ +LD +L +A+RI   S ++AA + A  P +AAIAS   AE+Y L
Sbjct: 186 VNAVYSHQQSLAQCRGWLDRNLPQAERIPVASNAEAARLVAERPGTAAIASEAAAEIYAL 245

Query: 248 EVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGIN 307
           ++L K I+D  +N TRF I+G +    SG+DKT +L    ++  G L   L+   DH I+
Sbjct: 246 DILAKRIEDEPDNTTRFLIIGRADAPMSGDDKTSLLLACRNE-AGGLHAMLTPLVDHDIS 304

Query: 308 LLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYPD 360
           + +I+SRPS +  W YVFFV++ GH+E+  V  AL  +    L VK+LGSYP+
Sbjct: 305 MTRIESRPSRRGVWDYVFFVDIMGHRENPAVLAALEHLKRETLFVKVLGSYPE 357



>gi|339486337|ref|YP_004700865.1| chorismate mutase [Pseudomonas putida S16]
 gi|431801324|ref|YP_007228227.1| chorismate mutase [Pseudomonas putida HB3267]
 gi|503737377|ref|WP_013971453.1| prephenate dehydratase [Pseudomonas putida]
 gi|338837180|gb|AEJ11985.1| chorismate mutase [Pseudomonas putida S16]
 gi|430792089|gb|AGA72284.1| chorismate mutase [Pseudomonas putida HB3267]
          Length = 364

 Score =  264 bits (674), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 133/351 (37%), Positives = 210/351 (59%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L++ERAR +  + K K  S          Y   +E  +  R+   N GP
Sbjct: 12  RIDSLDEKILELISERARCAQEVAKVKTASLAEGEKPV-FYRPEREAAVLKRVMERNKGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L IAY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LDNEEMARLFREIMSSCLALEEPLKIAYLGPEGTFTQAAAMKHFGHAVISRPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVSHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 TRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAANLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++G+    P+G+DKT I+ ++ + +PGAL + L  F  +GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGNQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHQNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +++  L +I++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLIKAVLEQISQEAVALKVLGSYP 360



>gi|447915930|ref|YP_007396498.1| P-protein [Pseudomonas poae RE*1-1-14]
 gi|505184461|ref|WP_015371563.1| P-protein [Pseudomonas poae]
 gi|445199793|gb|AGE25002.1| P-protein [Pseudomonas poae RE*1-1-14]
          Length = 364

 Score =  263 bits (673), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 133/351 (37%), Positives = 212/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L++ERAR +  + + K  +          Y   +E  +  R+   N GP
Sbjct: 12  RIDSLDEKVLELISERARCAQEVARVKMANLAEGEVPV-FYRPEREAAVLKRVMERNRGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LGNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISKPMAVIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 SRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++GS    P+G+DKT I+ ++ + +PGAL + L  F D+GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGSQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHDNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +V+  L +I++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFIGHHRDPLVKGVLEQISQEAVALKVLGSYP 360



>gi|308273466|emb|CBX30068.1| P-protein [uncultured Desulfobacterium sp.]
          Length = 378

 Score =  263 bits (673), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 153/349 (43%), Positives = 207/349 (59%), Gaps = 8/349 (2%)

Query: 12  IDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGPL 71
           ID+ID K++ L+NER      L  AKE           V    ++  I +++  LN G L
Sbjct: 32  IDNIDEKILGLINER------LLLAKEIGRMKAKKGKKVLDIARQKAIINKLTSLNKGLL 85

Query: 72  SSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIFD 131
             ++L  I+ EII+AS   Q   S+AY GP  +++H A++  FG S+NY+P+STI DIF 
Sbjct: 86  GKQALCHIFSEIIAASREIQNHHSVAYLGPEATFSHIASMSYFGRSVNYMPQSTIGDIFR 145

Query: 132 SVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSSINK 190
            V KG   YG+VP ENS  GSV  TLD F      I AE Y  ISH LLSKS   S I  
Sbjct: 146 EVGKGACLYGVVPVENSIEGSVNYTLDLFFESDLKICAELYHPISHDLLSKSDSISKIKV 205

Query: 191 VYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLEVL 250
           +YSHPQ F QC+ ++  +L +A  ++  STS AA  A+ EP SAAIAS   A +Y L+V+
Sbjct: 206 IYSHPQVFPQCRSWIQENLPKAALVECNSTSNAARRASEEPESAAIASSMAAHIYNLQVI 265

Query: 251 GKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINLLK 310
              I+D   N TRF ++G    K +G DKT I+F V    PGAL   L    + GIN++K
Sbjct: 266 ASKIEDTSKNTTRFLVIGKDETKRTGVDKTSIMF-VTPNVPGALYKILQPIAESGINMVK 324

Query: 311 IDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           ++SRP+  + W Y FFV+++GH ED VV   + K+N+ CL +K LGSYP
Sbjct: 325 LESRPTKHENWSYFFFVDIEGHIEDTVVALTIKKMNKICLYLKCLGSYP 373



>gi|501089186|ref|WP_012139430.1| chorismate mutase / prephenate dehydratase [Marinobacter
           lipolyticus]
 gi|499159832|gb|EON90932.1| chorismate mutase / prephenate dehydratase [Marinobacter
           lipolyticus SM19]
          Length = 365

 Score =  263 bits (673), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 140/354 (39%), Positives = 211/354 (59%), Gaps = 5/354 (1%)

Query: 8   FSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLN 67
             ++ID +D K+++L++ RA+ +  +   K  S          Y   +E Q+  RI   N
Sbjct: 11  LREEIDQLDQKIMELISARAKCAQEVASVKMTS--NSGQDVFFYRPEREAQVLRRIKEQN 68

Query: 68  NGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTIN 127
            GPLS E +  +++EI+SA ++ +K + IA+ GP+G++T  AA+  FG S+  +P   I+
Sbjct: 69  PGPLSGEEMARLFREIMSACLALEKPMHIAFLGPIGTFTQAAALKHFGHSVVSVPLPAID 128

Query: 128 DIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKF 185
            +F  VE G   YG+VP ENST G +  TLD F+S    I  E  LRI H LL    +K 
Sbjct: 129 AVFREVESGAAHYGVVPVENSTEGMINHTLDMFMSSPLKICGEVQLRIHHHLLVSPANKD 188

Query: 186 SSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELY 245
             I ++YSH Q F QC+++LD+H    +R+   S ++AA  AA EP +AAIA    AELY
Sbjct: 189 QEITRIYSHQQSFAQCRQWLDTHRYGIERVTVSSNAEAARRAAEEPGTAAIAGDMAAELY 248

Query: 246 GLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHG 305
           GLE++   I+D  +N TRF I+G      SG+DK+ IL ++   +PGAL   L  F  HG
Sbjct: 249 GLEIVANSIEDRPDNTTRFLIIGREEVPASGHDKSSILVSM-RNKPGALYQLLEPFHRHG 307

Query: 306 INLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           ++L +I++RPS    W YVF+++ +GH EDE V+K L  + +  +++K LGSYP
Sbjct: 308 LSLTRIETRPSPSGTWAYVFYIDFEGHVEDEQVRKVLADVEDEAVELKRLGSYP 361



>gi|489328066|ref|WP_003235353.1| P-protein [Pseudomonas fluorescens]
 gi|440379049|gb|ELQ15654.1| P-protein [Pseudomonas fluorescens BRIP34879]
          Length = 364

 Score =  263 bits (673), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 133/351 (37%), Positives = 212/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L++ERAR +  + + K  +          Y   +E  +  R+   N GP
Sbjct: 12  RIDSLDEKVLELISERARCAQEVARVKMANLAEGEVPV-FYRPEREAAVLKRVMERNRGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LGNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISKPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 SRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++GS    P+G+DKT I+ ++ + +PGAL + L  F D+GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGSQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHDNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +V+  L +I++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFIGHHRDPLVKGVLEQISQEAVALKVLGSYP 360



>gi|283778631|ref|YP_003369386.1| prephenate dehydratase [Pirellula staleyi DSM 6068]
 gi|502674022|ref|WP_012909791.1| prephenate dehydratase [Pirellula staleyi]
 gi|283437084|gb|ADB15526.1| Prephenate dehydratase [Pirellula staleyi DSM 6068]
          Length = 364

 Score =  263 bits (672), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 142/354 (40%), Positives = 211/354 (59%), Gaps = 7/354 (1%)

Query: 10  QQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNG 69
           +++D +D +LV+LL++RAR ++   ++++ S         + +S + +Q+ D    L+ G
Sbjct: 16  KELDRLDRELVKLLSDRARTAVKYAQSRQAS-----GGPLIDLSDETDQL-DAALALSKG 69

Query: 70  PLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDI 129
           PL   +L  + +E+IS   S  + + IAY GP  SY+H AAI RFGDS +  P +TI  +
Sbjct: 70  PLDERALRGVLREVISGCRSLVRPVHIAYLGPKYSYSHLAAIERFGDSTDLTPAATIKAV 129

Query: 130 FDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKSKFSSIN 189
           F++V  G   YG+VP ENST G VV TLD F      I  E  LRI H LL K   S + 
Sbjct: 130 FEAVHYGQAEYGLVPIENSTDGRVVDTLDMFAKLPLTITGEVQLRIHHHLLGKCARSEVT 189

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLEV 249
           +VYS PQ   QC+ +L  ++ +A+ I+  ST+ AA+IAA +P +AA+AS      YGL  
Sbjct: 190 EVYSKPQALSQCRDWLAKNVPQAKLIEMTSTAVAAQIAADKPGAAAVASREAGAHYGLAS 249

Query: 250 LGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINLL 309
           +  DI+D K+NVTRF I+G    K SG DKT ++  + H +PGAL D ++VFK   +NL 
Sbjct: 250 IDADIEDNKHNVTRFAIIGGQPPKRSGRDKTALMIEIPH-KPGALADAMAVFKRARLNLS 308

Query: 310 KIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYPDQRP 363
            I+S P S     Y+FF+E +GH+ D  V+ AL  + +    + ILGS+P  +P
Sbjct: 309 WIESFPMSGSKNEYLFFIEFEGHQTDGRVKSALTSLAKKTAKMHILGSFPRPQP 362



>gi|493839332|ref|WP_006786486.1| prephenate dehydratase [Thiorhodospira sibirica]
 gi|349795811|gb|EGZ49604.1| chorismate mutase [Thiorhodospira sibirica ATCC 700588]
          Length = 361

 Score =  263 bits (672), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 141/350 (40%), Positives = 214/350 (61%), Gaps = 6/350 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID+ID  ++QL++ERA+ +  +   K             Y   +E Q+  RI   N GP
Sbjct: 13  RIDAIDDSIMQLISERAQCAQAVATIKRAQ----DPQADFYRPEREAQVLRRIQSQNPGP 68

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L SE +  +++EI+SA ++ +K L IA+ GP G++T  AA+  FG S+     S I+++F
Sbjct: 69  LPSEEMTRLFREIMSACLALEKPLLIAFLGPEGTFTQAAALKHFGHSVKTQALSAIDEVF 128

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLS-KSKFSSIN 189
             VE G   YG+VP ENST G V  TLD F+     I  E  LRI H LLS ++    I 
Sbjct: 129 REVESGSAHYGVVPIENSTEGMVTHTLDMFMLSPLKICGEVQLRIHHHLLSNETDLRQIK 188

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLEV 249
           ++YSH Q   QC+++LD++L +A+R+   S ++AA  AA+EP + AIA  T AELYGL++
Sbjct: 189 RIYSHQQSLAQCREWLDANLSQAERMTCSSNAEAARRAATEPGTGAIAGETAAELYGLQM 248

Query: 250 LGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINLL 309
             ++I+D   N TRF I+G++    SG DKT +L +  + RPG L D L+    +GI++ 
Sbjct: 249 QRRNIEDHPENTTRFLIIGATQFPSSGQDKTSLLISSPN-RPGLLYDLLAPLAHNGISMT 307

Query: 310 KIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           +++SRPS +  W YVFF++ +GH+++  VQKALN +      V++LGSYP
Sbjct: 308 RLESRPSRRANWEYVFFIDCEGHQDEARVQKALNSLRHEAELVRVLGSYP 357



>gi|489563772|ref|WP_003468293.1| P-protein [Xanthomonas translucens]
 gi|440374433|gb|ELQ11163.1| P-protein [Xanthomonas translucens DAR61454]
          Length = 394

 Score =  263 bits (672), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 136/351 (38%), Positives = 209/351 (59%), Gaps = 7/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID ID  +  L+ ERA+ +  + KAK             Y   +E Q+   +   N GP
Sbjct: 45  KIDEIDRTIQALIAERAQFAHQVGKAK----GKLAAAVDYYRPEREAQVLRMVVDRNQGP 100

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS E LV +++EI+SA ++ Q+ L I Y GP G+++ QA +  FG S   LP +TI ++F
Sbjct: 101 LSDEVLVHVFREIMSACLAQQEPLKIGYLGPEGTFSQQAVLKHFGRSAVGLPMATIEEVF 160

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSSIN 189
             VE G+  +G+VP ENS  G++  TLD F++    I  ET LR+   LLS++ +  +I 
Sbjct: 161 QEVESGNADFGVVPVENSGQGTIQVTLDMFLTSNLKICGETELRVHQYLLSRNGRLDAIE 220

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGL-E 248
           ++Y+HPQ F Q   +L +HL + ++I   S ++ A  A +   +AAI   + A +Y L +
Sbjct: 221 RIYAHPQSFAQTAGWLRAHLPKVEKIPVSSNAEGARRARNAEDAAAIGGESAAHVYALKK 280

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
           V+ K I+D  +N TRF ++G     PSG+D+T +L  + H +PGAL D LS F  HGI++
Sbjct: 281 VIMKSIEDDDDNTTRFLVIGRQIFPPSGHDRTSVLVFI-HDKPGALFDVLSPFARHGISM 339

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I+SRPS Q  W Y FF++L GH EDE +++AL ++      +K+LGSYP
Sbjct: 340 NRIESRPSHQAKWEYGFFIDLAGHVEDESMKQALAELKAHSAQIKVLGSYP 390



>gi|325295590|ref|YP_004282104.1| chorismate mutase [Desulfurobacterium thermolithotrophum DSM 11699]
 gi|503404333|ref|WP_013638994.1| prephenate dehydratase [Desulfurobacterium thermolithotrophum]
 gi|325066038|gb|ADY74045.1| chorismate mutase [Desulfurobacterium thermolithotrophum DSM 11699]
          Length = 358

 Score =  263 bits (672), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 145/352 (41%), Positives = 214/352 (60%), Gaps = 9/352 (2%)

Query: 10  QQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNG 69
           ++ID ID +++ LLN RA++      A+E            YV G+E +I  ++  +N G
Sbjct: 9   EEIDKIDREVLALLNRRAKL------AQEVGEIKKQEGLPFYVPGREAKILSKLEEINQG 62

Query: 70  PLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDI 129
           PL +ES+ +I++EIISA  + ++   +AY GP  ++TH AA+ +FG S N  P  +I ++
Sbjct: 63  PLPAESVRAIFREIISACRALEEPTKVAYLGPKATFTHLAALKQFGSSSNLRPMDSIGEV 122

Query: 130 FDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSK-SKFSSI 188
           F+ VEKG   YG+VP ENS  G V  T+D F      I  E ++ ++  L+SK S  S I
Sbjct: 123 FNEVEKGRVDYGVVPIENSIEGVVNYTIDMFFDTDLKICGEIFVPVNLHLMSKESDLSQI 182

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            KVYSH     Q +K++  +L +    +  STSKAAE+A+ EP +AAIAS   A LY L 
Sbjct: 183 KKVYSHRHAIAQARKWISEYLPKVDIEEVSSTSKAAELASQEPNTAAIASEAAAYLYDLS 242

Query: 249 VLGKDIQDAKNNVTRFFILGSS-SEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGIN 307
           +L ++IQ+   N TRF ++G   SE PSG DKT I+F+  H   G+L   L  F  + +N
Sbjct: 243 ILARNIQELSKNFTRFLVIGKEDSEFPSGRDKTSIMFSTKHV-AGSLFKALQPFAIYDVN 301

Query: 308 LLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           L KI+SRP+ ++PW YVFFV+++GH+++E V KAL ++       KILGSYP
Sbjct: 302 LSKIESRPTKKRPWEYVFFVDIEGHRKNERVAKALKELQSNTTFFKILGSYP 353



>gi|21431808|sp|P27603.2|PHEA_PSEST RecName: Full=P-protein; Includes: RecName: Full=Chorismate mutase;
           Short=CM; Includes: RecName: Full=Prephenate
           dehydratase; Short=PDT
 gi|5712091|gb|AAD47360.1|AF038578_3 chorismate mutase/prephenate dehydratase [Pseudomonas stutzeri]
          Length = 365

 Score =  263 bits (672), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 134/351 (38%), Positives = 207/351 (58%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D +++ L++ERAR +  + + K  S+         Y   +E  +   I  LN GP
Sbjct: 13  RIDSLDERILDLISERARCAQEVARVKTASWPKAEEAV-FYRPEREAWVLKHIMELNKGP 71

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G+++  AA+  FG S+   P + I+++F
Sbjct: 72  LDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHSVISKPMAAIDEVF 131

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K   I
Sbjct: 132 REVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHLLVGETTKTDRI 191

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +R+   S + AA+   SE  SAAIA    A+LYGL 
Sbjct: 192 TRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIAGDMAAQLYGLS 251

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D   N TRF I+GS    P+G+DKT I+ ++   +PGAL + L  F  +GI+L
Sbjct: 252 KLAEKIEDRPVNSTRFLIIGSQEVPPTGDDKTSIIVSM-RNKPGALHELLMPFHSNGIDL 310

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH +D +++  L KI    + +K+LGSYP
Sbjct: 311 TRIETRPSRSGKWTYVFFIDCMGHHQDPLIKNVLEKIGHEAVALKVLGSYP 361



>gi|512619570|ref|YP_008104254.1| chorismate mutase/prephenate dehydratase [Pseudomonas resinovorans
           NBRC 106553]
 gi|512735954|ref|WP_016493784.1| chorismate mutase/prephenate dehydratase [Pseudomonas resinovorans]
 gi|512378184|dbj|BAN49649.1| chorismate mutase/prephenate dehydratase [Pseudomonas resinovorans
           NBRC 106553]
          Length = 364

 Score =  263 bits (672), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 133/351 (37%), Positives = 211/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID++D K+++L++ERAR + ++ + K  +          Y   +E  +  RI   N GP
Sbjct: 12  RIDNLDEKILELISERARCAQDVARVKTATLPEGEKPV-FYRPEREAWVLKRIMDRNKGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LDNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAALKHFGHAVVSSPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  +I
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGETTKTDNI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +R+   S + AA+   SE  SAAIA    A LYGL 
Sbjct: 191 TRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIAGDMAASLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+G+    P+G+DKT I+ ++   +PGAL + L  F ++GI+L
Sbjct: 251 KLCEKIEDRPDNSTRFLIIGNQEVPPTGDDKTSIIVSM-RNKPGALHELLVPFHNNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +++  L KIN+  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLIKDVLEKINQEAVALKVLGSYP 360



>gi|114320087|ref|YP_741770.1| chorismate mutase/prephenate dehydratase [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|499947941|ref|WP_011628675.1| prephenate dehydratase [Alkalilimnicola ehrlichii]
 gi|114226481|gb|ABI56280.1| chorismate mutase / prephenate dehydratase [Alkalilimnicola
           ehrlichii MLHE-1]
          Length = 367

 Score =  263 bits (672), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 141/350 (40%), Positives = 218/350 (62%), Gaps = 6/350 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID++D ++++L++ERAR++  + + K  +          Y   +E Q+  R+ + N GP
Sbjct: 20  RIDALDDEILRLISERARMAEEVARVKREA----GHSNDFYRPEREAQVLRRVRQSNPGP 75

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L  E++  +++EI+SA ++ Q  L +A+ GP G+YT +AA+  FG ++   P STI  +F
Sbjct: 76  LGEEAVTRLFREIMSACLAIQLPLQVAFLGPEGTYTQEAALKHFGHAMGTAPLSTIAAVF 135

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKSK-FSSIN 189
             VE G   YG+VP ENST G V  T+DRF++    I+ E  L I H L S+ + +++I 
Sbjct: 136 REVESGAAHYGVVPVENSTEGVVTHTVDRFLNSPLQIVGEVQLPIHHALASREQDWNAIR 195

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLEV 249
           ++YSH QG  QC+ ++D+HL   +R+   ST++AA +AA+E  +AAIAS    ELY L V
Sbjct: 196 RIYSHQQGLAQCRAWVDTHLPGVERVPVTSTAEAARLAAAERGAAAIASEAACELYDLPV 255

Query: 250 LGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINLL 309
           L   I+D   N TRF ++G  S  PSG+DKT ++ +  +Q PG L   L     +G+N+ 
Sbjct: 256 LATHIEDEPGNTTRFLVVGPESPPPSGDDKTSLVISRANQ-PGGLYRLLEPLARNGVNMT 314

Query: 310 KIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           +I+SRP+ Q  W YVFFV+L GH EDE V++AL +I E     ++LGSYP
Sbjct: 315 RIESRPAPQGVWEYVFFVDLLGHVEDEPVRQALAEIREQASLCRVLGSYP 364



>gi|452943342|ref|YP_007499507.1| prephenate dehydratase [Hydrogenobaculum sp. HO]
 gi|471263714|ref|YP_007646568.1| prephenate dehydratase [Hydrogenobaculum sp. SN]
 gi|505231668|ref|WP_015418770.1| prephenate dehydratase [Hydrogenobaculum sp. SN]
 gi|333118060|gb|AEF18534.1| prephenate dehydratase [Hydrogenobaculum sp. 3684]
 gi|334104477|gb|AEG45822.1| prephenate dehydratase [Hydrogenobaculum sp. SHO]
 gi|452881760|gb|AGG14464.1| prephenate dehydratase [Hydrogenobaculum sp. HO]
 gi|469931991|gb|AGH92768.1| prephenate dehydratase [Hydrogenobaculum sp. SN]
          Length = 356

 Score =  263 bits (672), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 147/352 (41%), Positives = 216/352 (61%), Gaps = 10/352 (2%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNN-- 68
           +ID ID K+V+LLN+RA ++  + + K+           V    +E ++   + + N   
Sbjct: 11  EIDKIDAKIVELLNKRADIAKKIGEIKK------QQNIQVRNLQREKEVISNVIKENEKY 64

Query: 69  GPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTIND 128
           G    E+L  IYKEIISA  S +  + IAYFGP  ++THQAAI  FG S +Y+   +I+ 
Sbjct: 65  GLFPKEALEIIYKEIISAISSLEGAVKIAYFGPKATFTHQAAISHFGLSSDYIACDSIST 124

Query: 129 IFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKSK-FSS 187
           +F+ VE G+  YG+VP EN+  G V  T+D  +     I+ E  + I+  LLS  +  + 
Sbjct: 125 VFELVESGNAHYGVVPIENTIEGIVNHTIDLLMDADLFIVGEIIIPINLFLLSLERDIAK 184

Query: 188 INKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGL 247
           I+KVYSH     Q +K+L+ HL  A+ ++A ST+ A EIA  EP +AAIAS   A +YGL
Sbjct: 185 ISKVYSHKHALAQSRKFLEKHLPFAEILEAKSTANACEIAQKEPGTAAIASEVAAYVYGL 244

Query: 248 EVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGIN 307
            +L K+IQD KNN TRF I+G +  KP+G DKT I+  V +Q  GAL   L +F  H IN
Sbjct: 245 NILAKNIQDQKNNFTRFLIIGKTLTKPTGKDKTSIIMGVKNQ-TGALYKALEIFYRHNIN 303

Query: 308 LLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           L KI+SRPS ++ W  +F+V+++GH ED+ V++AL ++++    +K LGSYP
Sbjct: 304 LTKIESRPSKKKAWDDIFYVDMEGHIEDKNVKEALEELDKNSHMIKFLGSYP 355



>gi|497288422|ref|WP_009602639.1| bifunctional chorismate mutase / prephenate dehydratase
           [Xanthomonas translucens]
 gi|422795967|gb|EKU24564.1| bifunctional chorismate mutase / prephenate dehydratase
           [Xanthomonas translucens pv. graminis ART-Xtg29]
          Length = 394

 Score =  263 bits (672), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 137/355 (38%), Positives = 210/355 (59%), Gaps = 7/355 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID ID  +  L+ ERA+ +  + KAK             Y   +E Q+   +   N GP
Sbjct: 45  KIDEIDRTIQALIAERAQFAHQVGKAK----GKLAAAVDYYRPEREAQVLRMVVDRNQGP 100

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS E LV +++EI+SA ++ Q+ L I Y GP G+++ QA +  FG S   LP +TI ++F
Sbjct: 101 LSDEVLVHVFREIMSACLAQQEPLKIGYLGPEGTFSQQAVLKHFGRSAVGLPMATIEEVF 160

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSSIN 189
             VE G+  +G+VP ENS  G++  TLD F++    I  ET LR+   LLS++ +  +I 
Sbjct: 161 QEVESGNADFGVVPVENSGQGTIQVTLDMFLTSNLKICGETELRVHQYLLSRNGRLDAIE 220

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGL-E 248
           ++Y+HPQ F Q   +L +HL + ++I   S ++ A  A +   +AAI   + A +Y L +
Sbjct: 221 RIYAHPQSFAQTAGWLRAHLPKVEKIPVSSNAEGARRARNAEDAAAIGGESAAHVYALKK 280

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
           V+ K I+D  +N TRF ++G     PSG+D+T +L  + H +PGAL D LS F  HGI++
Sbjct: 281 VIMKSIEDDDDNTTRFLVIGRQIFPPSGHDRTSVLVFI-HDKPGALFDVLSPFARHGISM 339

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYPDQRP 363
            +I+SRPS Q  W Y FF++L GH EDE +++AL ++      +K+LGSYP   P
Sbjct: 340 NRIESRPSHQAKWEYGFFIDLAGHVEDESMKQALAELKAHSAQIKVLGSYPVAVP 394



>gi|497371787|ref|WP_009686000.1| prephenate dehydratase [Pseudomonas sp. TJI-51]
 gi|324097910|gb|EGB96074.1| chorismate mutase [Pseudomonas sp. TJI-51]
          Length = 364

 Score =  263 bits (671), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 132/351 (37%), Positives = 210/351 (59%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L++ERAR +  + + K  S          Y   +E  +  R+   N GP
Sbjct: 12  RIDSLDEKILELISERARCAEEVARVKTASLKEGEKPV-FYRPEREAAVLKRVMERNKGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L IAY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LGNEEMARLFREIMSSCLALEEPLKIAYLGPEGTFTQAAAMKHFGHAVISRPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K +SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVSHTLDSFLEHDMVICGEVELRIHHHLLVGESTKTNSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 TRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAANLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++G     P+G+DKT I+ ++ + +PGAL + L  F  +GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGQQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHQNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +++  L +I++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLIKAVLEQISQEAVALKVLGSYP 360



>gi|397687385|ref|YP_006524704.1| chorismate mutase [Pseudomonas stutzeri DSM 10701]
 gi|504666043|ref|WP_014853145.1| prephenate dehydratase [Pseudomonas stutzeri]
 gi|395808941|gb|AFN78346.1| chorismate mutase [Pseudomonas stutzeri DSM 10701]
          Length = 365

 Score =  263 bits (671), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 134/351 (38%), Positives = 207/351 (58%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D +++ L++ERAR +  + + K  S          Y   +E  +   I  LN GP
Sbjct: 13  RIDSLDERILDLISERARCAQEVARVKTASLAEGEEAV-FYRPEREAWVLKHIMELNKGP 71

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G+++  AA+  FG S+   P + I+++F
Sbjct: 72  LDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHSVISKPMAAIDEVF 131

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K   I
Sbjct: 132 REVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHLLVGETTKTDRI 191

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +R+   S + AA+   SE  SAAIA    A+LYGL 
Sbjct: 192 TRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIAGDMAAQLYGLS 251

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+GS    P+G+DKT I+ ++   +PGAL + L  F  +GI+L
Sbjct: 252 KLAEKIEDRPDNSTRFLIIGSQEVPPTGDDKTSIIVSM-RNKPGALHELLMPFHSNGIDL 310

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH +D +++  L KI    + +K+LGSYP
Sbjct: 311 TRIETRPSRSGKWTYVFFIDCMGHHQDPLIKDVLEKIGHEAVALKVLGSYP 361



>gi|336324083|ref|YP_004604050.1| chorismate mutase [Flexistipes sinusarabici DSM 4947]
 gi|503652874|ref|WP_013886950.1| prephenate dehydratase [Flexistipes sinusarabici]
 gi|336107664|gb|AEI15482.1| chorismate mutase [Flexistipes sinusarabici DSM 4947]
          Length = 356

 Score =  263 bits (671), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 138/360 (38%), Positives = 217/360 (60%), Gaps = 9/360 (2%)

Query: 1   MENVDLTFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIF 60
           M+ +D    + ID+ID +++ LLN+RA   + + K K+ S         +YV  +E  I+
Sbjct: 1   MKRLD-ELRKNIDAIDDEILHLLNKRAEYVIEVGKIKQKS------NRPLYVPSREKAIY 53

Query: 61  DRIHRLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINY 120
           DR+ + N GP    +L S+++EIISAS+S ++   I+Y GP G++TH A I  FG S   
Sbjct: 54  DRLVKKNPGPFPPNALRSVFREIISASLSLEEVQKISYLGPEGTFTHLAGIKHFGLSSKM 113

Query: 121 LPKSTINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL 180
           +   +I ++F+ VEK    YG++P ENS  G V  TLD F+    +I  E ++ ++H L+
Sbjct: 114 ISARSIPEVFEDVEKKRADYGVIPIENSLEGVVNHTLDMFMDSDLNICGEIFIEVNHNLM 173

Query: 181 SKSK-FSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASI 239
           +KS  F  I ++YSHP    QC+ +L++++   Q  +  ST+KAAE+A+ +  +AAI S 
Sbjct: 174 NKSGVFEDIKRIYSHPHAIAQCRNWLNNNVPNIQIFEVESTAKAAEMASKDSSAAAIGSE 233

Query: 240 TCAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLS 299
               +Y L+V+ + I+D  NN TRF I+G    + +GNDKT ++F+V H+  G+L   L 
Sbjct: 234 MAEIVYSLKVVHRGIEDFANNFTRFLIIGDVKPEKTGNDKTSLVFSVTHE-AGSLYSALK 292

Query: 300 VFKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            F D  IN+ KI+SRPS  + W YVF+V++ GH  D +++KA++         KILGSYP
Sbjct: 293 AFADSDINMTKIESRPSKLKTWEYVFYVDIDGHISDPMIKKAIDSFTGNVSFFKILGSYP 352



>gi|82703310|ref|YP_412876.1| chorismate mutase [Nitrosospira multiformis ATCC 25196]
 gi|499700757|ref|WP_011381491.1| prephenate dehydratase [Nitrosospira multiformis]
 gi|82411375|gb|ABB75484.1| chorismate mutase / prephenate dehydratase [Nitrosospira
           multiformis ATCC 25196]
          Length = 355

 Score =  263 bits (671), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 132/353 (37%), Positives = 218/353 (61%), Gaps = 14/353 (3%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID+ID++L++L++ RA ++  + + K G+          Y   +E Q+  R+  LN GP
Sbjct: 11  KIDAIDSELLKLVSARADLAREIGEIKNGT---------AYRPEREAQVLARMRELNPGP 61

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  ++ EI+S   S ++ L++AY GP G+++ +AA+ RFG  +  LP ++I+D+F
Sbjct: 62  LENEQVARLFTEIMSLCRSMEEPLTVAYLGPRGTFSEEAALKRFGSVVTSLPCNSIDDVF 121

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLS-KSKFSSIN 189
             VE G   YG+VP ENST G+V  +LD  +  +  +  E  L I   LL+  +  + I 
Sbjct: 122 SKVEAGKANYGVVPVENSTEGAVGRSLDLLLQTRLKVCGEVALAIHQLLLAHHTDLARIR 181

Query: 190 KVYSHPQGFGQCQKYLD---SHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYG 246
           ++YSHPQ F QC ++L+    HL  + RI+A S + AA +AA +  +AA+A     E+YG
Sbjct: 182 RIYSHPQSFAQCHEWLNVHLPHLPASARINAASNADAARLAAEDESAAAVAGKKAGEVYG 241

Query: 247 LEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGI 306
           L V  ++I+D  +N TRF ++G     PSG DKT ++ +V   RPGA+ + L+ F  HG+
Sbjct: 242 LTVCAENIEDDPSNTTRFLVIGEQEVAPSGRDKTSLVTSV-RNRPGAIHELLAPFAHHGV 300

Query: 307 NLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           ++ +++SRPS    W YVFFV+++GH+++  V +AL ++ E    +K+LGSYP
Sbjct: 301 SMTRLESRPSRAGLWEYVFFVDVEGHQQEPKVSQALRELVEKAAFLKVLGSYP 353



>gi|512577189|ref|YP_008093098.1| prephenate dehydratase [Pseudomonas putida H8234]
 gi|512727396|ref|WP_016485356.1| prephenate dehydratase [Pseudomonas putida]
 gi|511520689|gb|AGN78230.1| prephenate dehydratase [Pseudomonas putida H8234]
          Length = 364

 Score =  263 bits (671), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 132/351 (37%), Positives = 210/351 (59%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L+++RAR +  + + K  S          Y   +E  +  R+   N GP
Sbjct: 12  RIDSLDEKILELISDRARCAEEVARVKTASLKEGEKPV-FYRPEREAAVLKRVMERNKGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L IAY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LGNEEMARLFREIMSSCLALEEPLKIAYLGPEGTFTQAAAMKHFGHAVISRPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVSHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 TRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAANLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++GS    P+G+DKT I+ ++ + +PGAL + L  F  +GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGSQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHQNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +++  L +I++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLIKAVLEQISQEAVALKVLGSYP 360



>gi|288818701|ref|YP_003433049.1| chorismate mutase/prephenate dehydratase [Hydrogenobacter
           thermophilus TK-6]
 gi|384129452|ref|YP_005512065.1| prephenate dehydratase [Hydrogenobacter thermophilus TK-6]
 gi|502729044|ref|WP_012964028.1| prephenate dehydratase [Hydrogenobacter thermophilus]
 gi|288788101|dbj|BAI69848.1| chorismate mutase/prephenate dehydratase [Hydrogenobacter
           thermophilus TK-6]
 gi|308752289|gb|ADO45772.1| prephenate dehydratase [Hydrogenobacter thermophilus TK-6]
          Length = 363

 Score =  262 bits (670), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 144/364 (39%), Positives = 222/364 (60%), Gaps = 13/364 (3%)

Query: 1   MENVDLTFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIF 60
           ME + L + ++ID ID ++++LLNER +++  + + K+ S         ++   +E +IF
Sbjct: 1   MEEIAL-WRKRIDEIDEEILRLLNERIKIAQKIGEIKKAS------GLDIHAPEREREIF 53

Query: 61  DRIHRLNN----GPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGD 116
           +R+ +LN     G    E+L  IY+EI+SA +S +K L +AY GP  ++THQAA+  FG 
Sbjct: 54  ERVLKLNEELYGGEFPKEALFHIYREIMSACLSVEKPLRVAYLGPKATFTHQAALEYFGF 113

Query: 117 SINYLPKSTINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRIS 176
           S++Y+P STI D+F+ V+ G   YG+VP EN+  G V  TLD F+     I+ E  + I 
Sbjct: 114 SVHYIPVSTIKDVFNEVDLGRADYGVVPVENTIEGVVNYTLDMFLEYDLKIVGEVVIPIK 173

Query: 177 -HCLLSKSKFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAA 235
            H L + S    + ++YSH     QC+ ++D +L +AQ I+  ST++A EI      +AA
Sbjct: 174 LHLLSNLSSLEDVKRIYSHRHAIAQCRNWIDKNLPKAQIIETESTARACEIVLELNDAAA 233

Query: 236 IASITCAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALC 295
           IAS   +  Y L +L ++IQ++ NN TRF I+G+ S K +G DKT ++  V   +PG L 
Sbjct: 234 IASEVASYTYHLNILAQNIQESANNFTRFLIVGNRSMKRTGKDKTSLILAV-RNKPGDLY 292

Query: 296 DGLSVFKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKIL 355
             L  F  +G+NL KI+SRPS ++ W YVFFV+L GH ED  V+ AL+ + +    +K+L
Sbjct: 293 KTLESFYLYGVNLTKIESRPSKKKAWDYVFFVDLDGHMEDHNVRMALDLLAKENRIIKML 352

Query: 356 GSYP 359
           GSYP
Sbjct: 353 GSYP 356



>gi|512687059|ref|YP_008115039.1| chorismate mutase/prephenate dehydratase [Pseudomonas putida NBRC
           14164]
 gi|512744325|ref|WP_016501012.1| chorismate mutase/prephenate dehydratase [Pseudomonas putida]
 gi|512385005|dbj|BAN55855.1| chorismate mutase/prephenate dehydratase [Pseudomonas putida NBRC
           14164]
          Length = 364

 Score =  262 bits (670), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 132/351 (37%), Positives = 210/351 (59%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L+++RAR +  + + K  S          Y   +E  +  R+   N GP
Sbjct: 12  RIDSLDEKILELISDRARCAEEVARVKTASLKEGEKPV-FYRPEREAAVLKRVMERNKGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L IAY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LGNEEMARLFREIMSSCLALEEPLKIAYLGPEGTFTQAAAMKHFGHAVISRPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVSHTLDSFLEHDMVICGEVELRIHHHLLVGESTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 TRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAANLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++GS    P+G+DKT I+ ++ + +PGAL + L  F  +GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGSQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHQNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +++  L +I++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLIKAVLEQISQEAVALKVLGSYP 360



>gi|167032372|ref|YP_001667603.1| chorismate mutase [Pseudomonas putida GB-1]
 gi|501228020|ref|WP_012271038.1| prephenate dehydratase [Pseudomonas putida]
 gi|166858860|gb|ABY97267.1| chorismate mutase [Pseudomonas putida GB-1]
          Length = 364

 Score =  262 bits (670), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 131/351 (37%), Positives = 210/351 (59%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L+++RAR +  + + K  S          Y   +E  +  R+   N GP
Sbjct: 12  RIDSLDEKILELISDRARCAEEVARVKTASLKEGEKPV-FYRPEREAAVLKRVMERNKGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LGNEEMARLFREIMSSCLALEEPLKVAYLGPEGTFTQAAAMKHFGHAVVSRPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVSHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 TRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAANLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++GS    P+G+DKT I+ ++ + +PGAL + L  F  +GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGSQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHQNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +++  L +I++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLIKAVLEQISQEAVALKVLGSYP 360



>gi|490283937|ref|WP_004179779.1| Chorismate mutase I / Prephenate dehydratase [Nitrosospira sp.
           APG3]
 gi|475052360|emb|CCU63403.1| Chorismate mutase I / Prephenate dehydratase [Nitrosospira sp.
           APG3]
          Length = 355

 Score =  262 bits (670), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 133/353 (37%), Positives = 218/353 (61%), Gaps = 14/353 (3%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID+ID++L++L+N RA ++  + + K G           Y   +E Q+  R+  LN GP
Sbjct: 11  RIDAIDSELLKLMNARAGLAREIGQIKNG---------MAYRPEREAQVLTRLCALNPGP 61

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L++E +V ++ EI+S   S ++ ++IAY GP G+++ +AA+ RFG  +  L  ++I+D+F
Sbjct: 62  LANEHIVRLFTEIMSLCRSLEEPMTIAYLGPQGTFSEEAALKRFGGVVTTLACNSIDDVF 121

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRI-SHCLLSKSKFSSIN 189
             VE G   YG+VP ENST G+V  +LD  +     +  E  L I  H L  ++  + + 
Sbjct: 122 RKVEAGTAGYGVVPVENSTEGAVGRSLDLLLHTPLKVCGEVKLPIHQHLLALQTDLTRVK 181

Query: 190 KVYSHPQGFGQCQKYLDS---HLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYG 246
           K+YSHPQ F QC ++L++   HL E  RI+A S + AA +AA +  +AA+A     E++G
Sbjct: 182 KIYSHPQSFSQCHEWLNANLPHLPETARINAASNADAARLAAEDETAAAVAGKKAGEVFG 241

Query: 247 LEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGI 306
           L +  ++I+D  NN TRF ++G+     SG DKT ++ +V + RPGA+ + L+    HG+
Sbjct: 242 LTICAENIEDDPNNTTRFLVIGTQEVAASGKDKTSLVMSVKN-RPGAIHELLAPLAMHGV 300

Query: 307 NLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           ++ +++SRPS    W YVFFV+++GH++D  + KAL ++ E    +KILGSYP
Sbjct: 301 SMSRLESRPSRASLWEYVFFVDIEGHQQDATIAKALQELRERAAFLKILGSYP 353



>gi|410663082|ref|YP_006915453.1| chorismate mutase/prephenate dehydratase [Simiduia agarivorans SA1
           = DSM 21679]
 gi|504858794|ref|WP_015045896.1| prephenate dehydratase [Simiduia agarivorans]
 gi|409025439|gb|AFU97723.1| chorismate mutase/prephenate dehydratase [Simiduia agarivorans SA1
           = DSM 21679]
          Length = 369

 Score =  262 bits (669), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 138/356 (38%), Positives = 214/356 (60%), Gaps = 6/356 (1%)

Query: 6   LTFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHR 65
           +    +ID+ID ++ +L++ERAR +  + + K+ +          Y   +E Q+  R   
Sbjct: 14  IALRDRIDTIDEQIGELISERARCAQEVAEVKKAA---GEPQVTFYRPEREAQVLRRAME 70

Query: 66  LNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKST 125
            N GPL+ E +  +++EI+SA ++ ++ + +A+ GP G++T QAAI  FG S    P S 
Sbjct: 71  RNKGPLNDEEMARLFREIMSACLALEEPIKVAFLGPEGTFTQQAAIKHFGHSAVTRPMSA 130

Query: 126 INDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKS 183
           I+++F  VE G   YG+VP ENS+ G V  TLD FI     I  E  LRI H L+    +
Sbjct: 131 IDEVFREVEAGAVNYGVVPVENSSEGVVTHTLDNFIGSNLKICGEVELRIHHHLMISDVT 190

Query: 184 KFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAE 243
              +I ++YSH Q   QC+K+LD+H  +A+R+   S ++AA+    E  +AAIA    AE
Sbjct: 191 HKDAITRIYSHSQSLAQCRKWLDAHYPKAERVAVNSNAEAAKRIKGEWNAAAIAGRMAAE 250

Query: 244 LYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKD 303
           LYGL +L + I+D  +N TRF I+G+     SG DKT I+ +V +  PGAL D L+ F+ 
Sbjct: 251 LYGLNMLHEKIEDEPDNSTRFLIIGTERVPASGTDKTSIVVSVKNS-PGALHDLLAPFQK 309

Query: 304 HGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           H ++L ++++RPS    W+YVFF++ +GH +D  VQ AL ++ E   D+K+LGSYP
Sbjct: 310 HKVDLTRVETRPSRTGAWNYVFFIDFKGHTDDVPVQTALAEVAERVADLKVLGSYP 365



>gi|490712972|ref|WP_004575796.1| chorismate mutase [Pseudomonas putida]
 gi|480584615|gb|ENY77609.1| chorismate mutase [Pseudomonas putida TRO1]
          Length = 364

 Score =  262 bits (669), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 132/351 (37%), Positives = 210/351 (59%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L+++RAR +  + + K  S          Y   +E  +  R+   N GP
Sbjct: 12  RIDSLDEKILELISDRARCAEEVARVKTASLKEGEKPV-FYRPEREAAVLKRVMERNKGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L IAY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LGNEEMARLFREIMSSCLALEEPLKIAYLGPEGTFTQAAAMKHFGHAVISRPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVSHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 TRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAANLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++GS    P+G+DKT I+ ++ + +PGAL + L  F  +GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGSQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFYQNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +++  L +I++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLIKAVLEQISQEAVALKVLGSYP 360



>gi|251771399|gb|EES51978.1| prephenate dehydratase [Leptospirillum ferrodiazotrophum]
          Length = 378

 Score =  262 bits (669), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 142/356 (39%), Positives = 210/356 (58%), Gaps = 13/356 (3%)

Query: 8   FSQQIDSIDTKLVQLLNERARVS--LNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHR 65
             Q+ID+ID ++V LL +RARV+  + L K + G           +V  +E +IFDR+ R
Sbjct: 23  LRQKIDAIDLQIVSLLQDRARVAHEVGLYKKERG--------LPFHVISREQEIFDRLDR 74

Query: 66  LNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKST 125
           ++  P     L  I++EI+SA +S ++ L +AY GP  SYTHQA +  FG S  +L  ST
Sbjct: 75  IDIAPFPRPVLKHIFREILSACLSLEEPLVVAYLGPPASYTHQATLKFFGTSTRHLSMST 134

Query: 126 INDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKSK- 184
           + ++F  VE+    YG+VP ENST G V  TLD  +     I  E  L I HCLLS+ + 
Sbjct: 135 VREVFLCVERKEAAYGVVPIENSTEGMVNYTLDTLVETDLKINGEVVLPIHHCLLSRGED 194

Query: 185 FSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIA-ASEPYSAAIASITCAE 243
              I KV++HPQ   QC+ +L +HL     I+  S ++A E+A   E ++AAIA    AE
Sbjct: 195 IRQITKVFAHPQSLAQCRGFLSNHLPHVPTIETTSNTRAVELALQDETHAAAIAGEMAAE 254

Query: 244 LYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKD 303
           +Y + VL + I+D  +N TRF ++G     P+  D+T I+ +V   R GAL   L +   
Sbjct: 255 VYNIPVLRRHIEDQPDNQTRFLVIGDGVPGPTSRDQTSIMVSVI-DRVGALSSILQIIAS 313

Query: 304 HGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           H +NL +++SRPS ++ W Y+FF++L GH++D  +Q  L K+ + C  VKILGSYP
Sbjct: 314 HQVNLTRLESRPSKKKAWDYIFFMDLAGHQKDPAIQTLLGKLQDLCPYVKILGSYP 369



>gi|195952501|ref|YP_002120791.1| prephenate dehydratase [Hydrogenobaculum sp. Y04AAS1]
 gi|501505051|ref|WP_012513170.1| prephenate dehydratase [Hydrogenobaculum sp. Y04AAS1]
 gi|195932113|gb|ACG56813.1| prephenate dehydratase [Hydrogenobaculum sp. Y04AAS1]
          Length = 356

 Score =  262 bits (669), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 145/352 (41%), Positives = 217/352 (61%), Gaps = 10/352 (2%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNN-- 68
           +ID ID K+V+LLN+RA ++  + + K+           V    +E ++   + + N   
Sbjct: 11  EIDKIDAKIVELLNKRAAIAKKIGEIKK------QQNIQVRNLQREREVISNVLKENEKY 64

Query: 69  GPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTIND 128
           G    E+L  IYKEIISA  S +  + IAYFGP  ++THQAAI  FG S +Y+   +I+ 
Sbjct: 65  GVFPKEALEIIYKEIISAISSLEGVVKIAYFGPKATFTHQAAISHFGLSSDYIASDSIST 124

Query: 129 IFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLS-KSKFSS 187
           +F+ VE G+  YG+VP EN+  G V  T+D  +  +  I+ E  + I+  LLS ++  + 
Sbjct: 125 VFELVESGNAHYGVVPIENTIEGVVNHTIDLLMDAELFIVGEIIIPINLFLLSLETDIAK 184

Query: 188 INKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGL 247
           I+KVYSH     Q +K+L+ +L  A+ ++A ST+ A EI   EP +AAIAS   A +YGL
Sbjct: 185 ISKVYSHKHALAQSRKFLEKYLPFAEILEAKSTANACEITQKEPGTAAIASEVAAYVYGL 244

Query: 248 EVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGIN 307
            +L K+IQD KNN TRF I+G +  KP+G DKT I+  V +Q  GAL   L +F  H IN
Sbjct: 245 NILAKNIQDQKNNFTRFLIIGKTLTKPTGKDKTSIIMGVKNQ-TGALYKALEIFYRHNIN 303

Query: 308 LLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           L KI+SRPS ++ W  +F+V+++GH ED+ V++AL ++++    +K LGSYP
Sbjct: 304 LTKIESRPSKKKAWDDIFYVDMEGHIEDKNVKEALEELDKNSHMIKFLGSYP 355



>gi|71734689|ref|YP_275807.1| chorismate mutase [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|499482581|ref|WP_011169221.1| prephenate dehydratase [Pseudomonas savastanoi]
 gi|71555242|gb|AAZ34453.1| chorismate mutase/prephenate dehydratase [Pseudomonas syringae pv.
           phaseolicola 1448A]
          Length = 364

 Score =  262 bits (669), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 134/351 (38%), Positives = 212/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L++ERAR +  + + K  S          Y   +E  +  R+   N GP
Sbjct: 12  RIDSLDEKVLELISERARCAQEVARVKMSSLAEGEVPV-FYRPEREAAVLRRVMDRNRGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS+E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++  LP + I+++F
Sbjct: 71  LSNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISLPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  L I H LL    +K  SI
Sbjct: 131 RKVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELLIHHHLLVGESTKTQSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 SRIYSHAQSLAQCRKWLDAHYPNVERVAVASNAEAAKRVKGEWNSAAIAGDMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+G+    P+G+DKT I+ ++ + +PGAL + L  F + G++L
Sbjct: 251 RLAEKIEDRPDNSTRFLIIGNQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHESGLDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH +D +V+  L KI+   + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHQDPLVKAVLEKISSEAVALKVLGSYP 360



>gi|490786418|ref|WP_004648580.1| chorismate mutase [Acinetobacter sp. ANC 3994]
 gi|479867494|gb|ENU19245.1| chorismate mutase [Acinetobacter sp. ANC 3994]
          Length = 369

 Score =  262 bits (669), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 136/352 (38%), Positives = 209/352 (59%), Gaps = 7/352 (1%)

Query: 10  QQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNG 69
           + IDS+D ++ QL+N RA+++  + KAK  S          Y   +E Q+   +   N G
Sbjct: 19  EDIDSVDQQIQQLINRRAKLAEAVAKAKFAS----EENPMFYRPEREAQVLRNVMERNEG 74

Query: 70  PLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDI 129
           PLS  ++  +++EI+SA ++ +   SIA+ GP+G+YTH A +  FG      P  TI+++
Sbjct: 75  PLSDVTMARLFREIMSACLALEAPQSIAFLGPVGTYTHSAVLKHFGQDAIVRPLPTIDEV 134

Query: 130 FDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSS 187
           F  VE G   YG+VP ENS+ G V  TLD F S   +++ E  LRI H  L  + ++  S
Sbjct: 135 FREVEAGSAHYGLVPVENSSEGVVNHTLDCFKSSHLNVIGEVELRIHHQFLVSANTRKDS 194

Query: 188 INKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGL 247
           I ++Y+H Q   QC+K+LD+H    +R+   S ++AA    +E +SAAIAS   A +Y L
Sbjct: 195 IKQIYAHQQTLAQCRKWLDAHYPGVERVALSSNAEAARRIRTEWHSAAIASDVAANIYDL 254

Query: 248 EVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGIN 307
           E+L  +I+D   N TRF ++G      SGNDKT +L +  H R GAL + L+ F  H I+
Sbjct: 255 EILHGNIEDNPENTTRFLVIGREKVPQSGNDKTSLLISA-HDRAGALLEILAPFAKHHIS 313

Query: 308 LLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           L  I++RP+  + W YVFF++L+GH E + V+ A+ +I     +V++LGSYP
Sbjct: 314 LTSIETRPALPEKWAYVFFIDLEGHVEQDNVKAAIEEIRPLVKEVRVLGSYP 365



>gi|385331103|ref|YP_005885054.1| chorismate mutase / prephenate dehydratase [Marinobacter adhaerens
           HP15]
 gi|495447373|ref|WP_008172067.1| prephenate dehydratase [Marinobacter manganoxydans]
 gi|311694253|gb|ADP97126.1| chorismate mutase / prephenate dehydratase [Marinobacter adhaerens
           HP15]
 gi|357226607|gb|EHJ05082.1| chorismate mutase [Marinobacter manganoxydans MnI7-9]
          Length = 365

 Score =  262 bits (669), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 140/351 (39%), Positives = 209/351 (59%), Gaps = 5/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID +D K+++L++ RA  +  +   K  +          Y   +E Q+  RI   N GP
Sbjct: 14  EIDQLDQKIMELISARAACAQEVAHVKMTA--NPGQDVFFYRPEREAQVLRRIKEQNPGP 71

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS E +  +++EI+SA ++ +K + IA+ GP+G++T  AA+  FG S+  +P   I+ +F
Sbjct: 72  LSGEEMARLFREIMSACLALEKPMHIAFLGPIGTFTQAAALKHFGHSVVSVPLPAIDAVF 131

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKSKFS--SI 188
             VE G   YG+VP ENST G +  TLD F+S    I  E  LRI H LL   K     I
Sbjct: 132 REVESGAAHYGVVPVENSTEGMINHTLDMFMSSPLKICGEVQLRIHHHLLVSPKHGDQEI 191

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q F QC+++LD+H    +R+   S ++AA  AA EP +AAIA    AELYGL+
Sbjct: 192 TRIYSHQQSFAQCRQWLDTHRYGIERVTVSSNAEAARRAAEEPGTAAIAGDMAAELYGLQ 251

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L   I+D  +N TRF I+G      SG+DK+ IL ++   +PGAL   L  F  HG++L
Sbjct: 252 KLANSIEDRPDNTTRFLIIGREEVPASGHDKSSILVSM-RNKPGALYQLLEPFHRHGLSL 310

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVF+++ +GH EDE V+K L +++E  +++K LGSYP
Sbjct: 311 TRIETRPSPSGTWAYVFYIDFEGHMEDEQVRKVLAEVDEEAVELKRLGSYP 361



>gi|489382992|ref|WP_003289656.1| prephenate dehydratase [Pseudomonas stutzeri]
 gi|387968042|gb|EIK52335.1| chorismate mutase [Pseudomonas stutzeri TS44]
          Length = 365

 Score =  261 bits (668), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 133/351 (37%), Positives = 209/351 (59%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D  +++L++ERAR + ++ + K  +          Y   +E  +   I  LN GP
Sbjct: 13  RIDSLDENILELISERARCAQDVARVKTATLAEGEQAV-FYRPEREAWVLKHIMELNKGP 71

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G+++  AA+  FG S+   P + I+++F
Sbjct: 72  LDNEEVARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHSVISTPMAAIDEVF 131

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K   I
Sbjct: 132 REVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHLLVGETTKTDRI 191

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LDSH    +R+   S + AA+   SE  SAAIA    A+LYGL+
Sbjct: 192 TRIYSHAQSLAQCRKWLDSHYPNVERVAVSSNADAAKRVKSEWNSAAIAGDMAAQLYGLQ 251

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+GS    P+G+DKT I+ ++   +PG L + L  F  +GI+L
Sbjct: 252 KLAEKIEDRPDNSTRFLIIGSQEVPPTGDDKTSIIVSM-RNKPGTLHELLMPFHANGIDL 310

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH +D +++  L KI +  + +K+LGSYP
Sbjct: 311 TRIETRPSRSGKWTYVFFIDFLGHHQDPLIKDVLEKIGKEAVALKVLGSYP 361



>gi|489390102|ref|WP_003296669.1| chorismate mutase [Pseudomonas stutzeri]
 gi|409778778|gb|EKN58462.1| chorismate mutase [Pseudomonas stutzeri KOS6]
          Length = 365

 Score =  261 bits (668), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 131/351 (37%), Positives = 209/351 (59%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D ++++L++ERAR +  + + K  +          Y   +E  +   I  LN GP
Sbjct: 13  RIDSLDERILELISERARCAQEVARVKTAALAEGESAV-FYRPEREAWVLKHIMELNRGP 71

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G+++  AA+  FG ++   P + I+++F
Sbjct: 72  LDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHAVISTPMAAIDEVF 131

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K   I
Sbjct: 132 REVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHLLVGETTKTDRI 191

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +R+   S + AA+   SE  SAAIA    A+LYGL 
Sbjct: 192 TRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIAGDMAAQLYGLT 251

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+GS    P+G+DKT I+ ++   +PGAL + L  F  +GI+L
Sbjct: 252 KLAEKIEDRPDNSTRFLIIGSQEVPPTGDDKTSIIVSM-RNKPGALHELLVPFHTNGIDL 310

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH +D +++  L +I +  + +K+LGSYP
Sbjct: 311 TRIETRPSRSGKWTYVFFIDFLGHHQDPLIKDVLERIGQEAVALKVLGSYP 361



>gi|146306881|ref|YP_001187346.1| prephenate dehydratase [Pseudomonas mendocina ymp]
 gi|489336327|ref|WP_003243546.1| prephenate dehydratase [Pseudomonas mendocina]
 gi|145575082|gb|ABP84614.1| prephenate dehydratase [Pseudomonas mendocina ymp]
 gi|400345476|gb|EJO93840.1| prephenate dehydratase [Pseudomonas mendocina DLHK]
          Length = 364

 Score =  261 bits (668), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 132/356 (37%), Positives = 212/356 (59%), Gaps = 14/356 (3%)

Query: 11  QIDSIDTKLVQLLNERARVS-----LNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHR 65
           +ID++D ++++L+++RAR +     + +++ KEG           Y   +E Q+  RI  
Sbjct: 12  RIDNLDERILELISDRARCAEEVARVKMKELKEGE------SPVFYRPEREAQVLKRIME 65

Query: 66  LNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKST 125
            N GPL +E +  +++EI+S+ ++ +  L +AY GP G+++  AA+  FG ++  +P + 
Sbjct: 66  RNKGPLGNEEMARLFREIMSSCLALENPLKVAYLGPEGTFSQAAAMKHFGHAVISVPMAA 125

Query: 126 INDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKS 183
           I+++F  V  G   +G+VP ENST G++  TLD F+     I  E  LRI H LL    +
Sbjct: 126 IDEVFREVAAGAVNFGVVPVENSTEGAINHTLDSFLEHDMVICGEVELRIHHHLLVGETT 185

Query: 184 KFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAE 243
           K   I ++YSH Q   QC+K+LD+H    +R+   S + AA+   SE  SAAIA    A 
Sbjct: 186 KTDKITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIAGDMAAN 245

Query: 244 LYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKD 303
           LYGL  L + I+D  +N TRF I+GS    P+G+DKT I+ ++   +PGAL + L  F +
Sbjct: 246 LYGLTKLAEKIEDRPDNSTRFLIIGSQEVPPTGDDKTSIIVSM-RNKPGALHELLVPFHN 304

Query: 304 HGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           +GI+L +I++RPS    W YVFF++  GH  D +++  L KI +  + +K+LGSYP
Sbjct: 305 NGIDLTRIETRPSRSGKWTYVFFIDFVGHHRDPLIKDVLEKIGQEAVALKVLGSYP 360



>gi|493949997|ref|WP_006893888.1| prephenate dehydratase [Methylobacter tundripaludum]
 gi|344259443|gb|EGW19716.1| chorismate mutase [Methylobacter tundripaludum SV96]
          Length = 361

 Score =  261 bits (668), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 138/355 (38%), Positives = 218/355 (61%), Gaps = 16/355 (4%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAK-----EGSYXXXXXXXXVYVSGKENQIFDRIHR 65
           +ID+ID +++ L+N+RA  ++ + K K     +GS+         Y   +E+ +  RI  
Sbjct: 13  KIDAIDKQILLLINQRASCAMEVAKTKSAQGEQGSF---------YRPDRESLVLRRIKD 63

Query: 66  LNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKST 125
           +N GPLS ++    ++E++SA ++ +K L +AY GP G++T QAAI  FG ++  +P +T
Sbjct: 64  MNQGPLSDDTTAHFFRELMSACLALEKPLDVAYLGPEGTFTQQAAIKHFGSAVKTVPAAT 123

Query: 126 INDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLS-KSK 184
           INDIF++VE G+  +G+VP ENST G +  TLDRF++    I  E  +R+   LL     
Sbjct: 124 INDIFNAVENGNCQFGVVPVENSTEGVISHTLDRFLNSPLKICGEVEIRVHQNLLGLVDS 183

Query: 185 FSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAEL 244
              + +V+SH Q   QC+++LD+HL  A+R    S ++AA +A++   + AIA I  AE+
Sbjct: 184 LDEVTEVFSHQQSLAQCRQWLDNHLPNAKRTAVNSNTEAARLASTHKQAVAIAGIVAAEI 243

Query: 245 YGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDH 304
           Y L V+ K+I+D  NN TRF I+G      +GNDKT ++ +  +Q PGAL   L  F   
Sbjct: 244 YQLNVIKKNIEDESNNTTRFIIIGQQISSSTGNDKTSLVVSTGNQ-PGALYRILEPFARF 302

Query: 305 GINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            I ++ I+SRPS Q  W YVFF++++GH ED+ V +AL  +++    +K+LGSYP
Sbjct: 303 NIGMVHIESRPSRQGLWDYVFFIDIEGHSEDDDVAQALALLDDNVNMLKLLGSYP 357



>gi|118579773|ref|YP_901023.1| chorismate mutase [Pelobacter propionicus DSM 2379]
 gi|500055341|ref|WP_011735258.1| prephenate dehydratase [Pelobacter propionicus]
 gi|118502483|gb|ABK98965.1| chorismate mutase [Pelobacter propionicus DSM 2379]
          Length = 359

 Score =  261 bits (668), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 145/350 (41%), Positives = 214/350 (61%), Gaps = 8/350 (2%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID ID ++V LLNER+RV L + + K GS          +V G+E QI++R+  +N GP
Sbjct: 14  RIDGIDDQIVALLNERSRVVLEVGRLKSGS------NMDFHVPGRERQIYERLLNVNPGP 67

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
             +++L S+Y+EIISAS+S +  + +A+ GP  +++H A + +FG S   +P  +I  +F
Sbjct: 68  FPNDALRSVYREIISASLSLESPMKVAFLGPKATFSHLATMQQFGLSAELVPLKSIPAVF 127

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSSIN 189
           + VEK    YG+VP ENST G +  TLD F+     I AE  L + H LLS++ +   + 
Sbjct: 128 EEVEKEKALYGVVPVENSTEGVISHTLDMFVDSGLKITAEILLEVHHDLLSRTGRLEDVK 187

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLEV 249
           KVYSH Q   QC+++L+ +L     +D  ST+ AA+I + +  +AAIAS   A LY L+V
Sbjct: 188 KVYSHVQPIAQCRQWLEDNLPGIPVVDVASTAVAAQIVSEDYSAAAIASELAATLYDLKV 247

Query: 250 LGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINLL 309
           +   I+D  NN TRF ++     + SGNDKT +LF+V  + PG L   L  F   GINL 
Sbjct: 248 VRSRIEDQVNNFTRFLVVSRKGCERSGNDKTSVLFSVKDE-PGILFRMLEPFAKRGINLS 306

Query: 310 KIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           KI+SRP  ++ W Y+FF++L GH  D  V +AL ++   C  +KILGSYP
Sbjct: 307 KIESRPFKKKAWEYIFFLDLFGHSSDPQVAEALEELRLCCQFLKILGSYP 356



>gi|431927119|ref|YP_007240153.1| chorismate mutase, clade 2 [Pseudomonas stutzeri RCH2]
 gi|505089713|ref|WP_015276815.1| chorismate mutase, clade 2 [Pseudomonas stutzeri]
 gi|431825406|gb|AGA86523.1| chorismate mutase, clade 2 [Pseudomonas stutzeri RCH2]
          Length = 365

 Score =  261 bits (667), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 132/351 (37%), Positives = 208/351 (59%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D +++ L++ERAR +  + + K  +          Y   +E  +   I  LN GP
Sbjct: 13  RIDSLDERILDLISERARCAQEVARVKTAALAEGESAV-FYRPEREAWVLKHIMELNRGP 71

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G+++  AA+  FG ++   P + I+++F
Sbjct: 72  LDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHAVISTPMAAIDEVF 131

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K   I
Sbjct: 132 REVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHLLVGETTKTDRI 191

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +R+   S + AA+   SE  SAAIA    A+LYGL 
Sbjct: 192 TRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIAGDMAAQLYGLT 251

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+GS    P+G+DKT I+ ++   +PGAL + L  F  +GI+L
Sbjct: 252 KLAEKIEDRPDNSTRFLIIGSQEVPPTGDDKTSIIVSM-RNKPGALHELLVPFHANGIDL 310

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH +D +++  L KI +  + +K+LGSYP
Sbjct: 311 TRIETRPSRSGKWTYVFFIDFLGHHQDPLIKDVLEKIGQEAVALKVLGSYP 361



>gi|392421535|ref|YP_006458139.1| chorismate mutase [Pseudomonas stutzeri CCUG 29243]
 gi|489375841|ref|WP_003282577.1| prephenate dehydratase [Pseudomonas stutzeri]
 gi|379064756|gb|EHY77499.1| chorismate mutase [Pseudomonas stutzeri ATCC 14405 = CCUG 16156]
 gi|390983723|gb|AFM33716.1| chorismate mutase [Pseudomonas stutzeri CCUG 29243]
          Length = 365

 Score =  261 bits (667), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 131/351 (37%), Positives = 209/351 (59%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D +++ L++ERAR +  + + K  +          Y   +E  +   I  LN GP
Sbjct: 13  RIDSLDERILDLISERARCAQEVARVKTAALAEGESAV-FYRPEREAWVLKHIMELNRGP 71

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G+++  AA+  FG ++   P + I+++F
Sbjct: 72  LDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHAVISTPMAAIDEVF 131

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K   I
Sbjct: 132 REVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHLLVGETTKTDRI 191

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +R+   S + AA+   SE  SAAIA    A+LYGL 
Sbjct: 192 TRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIAGDMAAQLYGLT 251

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+GS    P+G+DKT I+ ++   +PGAL + L  F  +GI+L
Sbjct: 252 KLAEKIEDRPDNSTRFLIIGSQEVPPTGDDKTSIIVSM-RNKPGALHELLVPFHANGIDL 310

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH +D +++ AL ++ +  + +K+LGSYP
Sbjct: 311 TRIETRPSRSGKWTYVFFIDFLGHHQDPLIKDALERLGQEAVALKVLGSYP 361



>gi|148263528|ref|YP_001230234.1| prephenate dehydratase [Geobacter uraniireducens Rf4]
 gi|500471543|ref|WP_011938377.1| prephenate dehydratase [Geobacter uraniireducens]
 gi|146397028|gb|ABQ25661.1| chorismate mutase [Geobacter uraniireducens Rf4]
          Length = 358

 Score =  261 bits (667), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 141/353 (39%), Positives = 217/353 (61%), Gaps = 8/353 (2%)

Query: 8   FSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLN 67
             ++IDS+D ++++LLNERA   + + + K GS          +V  +E +I++R+   N
Sbjct: 10  LRKEIDSLDDRMLELLNERASRVIEVGRLKAGS------KSDFHVPSREREIYERLIAQN 63

Query: 68  NGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTIN 127
            GP  S++L S+++EIISAS++ +  + +A+FGP  ++TH AA+ +FG S   +P+ +I 
Sbjct: 64  RGPFPSQALKSVFREIISASLALEAPMKVAFFGPKATFTHMAAMQQFGLSAELVPQKSIP 123

Query: 128 DIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFS 186
            +F+ VEKG   YG+VP ENST G V  TLD F+  +  + AE  L I H LLS++ +  
Sbjct: 124 AVFEEVEKGRALYGVVPVENSTEGMVSHTLDMFMESELKVNAEVLLEIHHYLLSRTGRME 183

Query: 187 SINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYG 246
            I KV SH Q   QC+ +L  +L     +D  ST+ AA+I + +  +AAIAS   A +Y 
Sbjct: 184 DIKKVCSHQQPIAQCRNWLAENLPNVPVVDVASTAVAAQIVSEDYTAAAIASELAASMYD 243

Query: 247 LEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGI 306
           L+V+ + I+D  NN TRF I+G    + SG+DKT ++F+V  +  G L   L  F   GI
Sbjct: 244 LKVVRERIEDQVNNFTRFLIIGKKMAEKSGDDKTSLMFSVKDE-VGILYHMLEPFAKRGI 302

Query: 307 NLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           NL KI+SRP  ++ W Y+FF++L GH  D V+ +A+ ++   C  VK+LGSYP
Sbjct: 303 NLSKIESRPLKKKAWEYIFFLDLVGHISDPVIAEAVQELKGCCQFVKVLGSYP 355



>gi|146282685|ref|YP_001172838.1| chorismate mutase [Pseudomonas stutzeri A1501]
 gi|339494298|ref|YP_004714591.1| chorismate mutase [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
 gi|386020969|ref|YP_005938993.1| chorismate mutase [Pseudomonas stutzeri DSM 4166]
 gi|500262577|ref|WP_011913461.1| prephenate dehydratase [Pseudomonas stutzeri]
 gi|145570890|gb|ABP79996.1| chorismate mutase [Pseudomonas stutzeri A1501]
 gi|327480941|gb|AEA84251.1| chorismate mutase [Pseudomonas stutzeri DSM 4166]
 gi|338801670|gb|AEJ05502.1| chorismate mutase [Pseudomonas stutzeri ATCC 17588 = LMG 11199]
          Length = 365

 Score =  261 bits (667), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 131/351 (37%), Positives = 209/351 (59%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D ++++L++ERAR +  + + K  +          Y   +E  +   I  LN GP
Sbjct: 13  RIDSLDERILELISERARCAQEVARVKTAALAEGESAV-FYRPEREAWVLKHIMELNRGP 71

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G+++  AA+  FG ++   P + I+++F
Sbjct: 72  LDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHAVISTPMAAIDEVF 131

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K   I
Sbjct: 132 REVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHLLVGETTKTDRI 191

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +R+   S + AA+   SE  SAAIA    A+LYGL 
Sbjct: 192 TRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIAGDMAAQLYGLT 251

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+G+    P+G+DKT I+ ++   +PGAL + L  F  +GI+L
Sbjct: 252 KLAEKIEDRPDNSTRFLIIGNQEVPPTGDDKTSIIVSM-RNKPGALHELLVPFHTNGIDL 310

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH +D +++  L KI +  + +K+LGSYP
Sbjct: 311 TRIETRPSRSGKWTYVFFIDFLGHHQDPLIKDVLEKIGQEAVALKVLGSYP 361



>gi|288941798|ref|YP_003444038.1| chorismate mutase [Allochromatium vinosum DSM 180]
 gi|502736294|ref|WP_012971278.1| prephenate dehydratase [Allochromatium vinosum]
 gi|288897170|gb|ADC63006.1| chorismate mutase [Allochromatium vinosum DSM 180]
          Length = 367

 Score =  261 bits (667), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 141/350 (40%), Positives = 211/350 (60%), Gaps = 5/350 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID+ID +++QL++ERAR +  +   K GS          Y   +E  +  RI   N GP
Sbjct: 18  RIDAIDLEILQLISERARCAQQVAHIKTGS---QSESVQFYRPEREVAVLRRIKDANPGP 74

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L  E +  +++EI+SA ++ ++ L+ A+ GP G++T  AAI  FG S+      TI++IF
Sbjct: 75  LDGEEVARLFREIMSACLALERPLNAAFLGPEGTFTQAAAIKHFGHSVVTQAMPTIDEIF 134

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKSK-FSSIN 189
             VE G   +G+VP ENST G V  TLD F++    I  E  LR+   LL+K+   +SI 
Sbjct: 135 REVESGACDFGVVPVENSTEGVVSHTLDLFMNSPLMITGEVSLRVHQHLLTKAADLASIR 194

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLEV 249
           +VYSH Q   QC+++LD HL  A+R+   S ++AA + AS+P +AA+A +  AE+YGL V
Sbjct: 195 RVYSHQQSLAQCREWLDRHLPIAERLPVGSNAEAARLVASDPEAAAVAGLQAAEIYGLRV 254

Query: 250 LGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINLL 309
           L + I+D  +N TRF ++G     PSG DKT +L +  +Q  G L   L+    HGI++ 
Sbjct: 255 LAERIEDEPSNTTRFLVIGKQDSPPSGQDKTSLLLSCKNQS-GGLHSLLAPLAVHGISMT 313

Query: 310 KIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           +I+SRPS +  W YVFFV++ GH++D  V  AL  + +  L  K+LGSYP
Sbjct: 314 RIESRPSRRGIWDYVFFVDILGHRQDPKVAYALQNLEQDALLFKVLGSYP 363



>gi|261855934|ref|YP_003263217.1| chorismate mutase [Halothiobacillus neapolitanus c2]
 gi|502586449|ref|WP_012824204.1| prephenate dehydratase [Halothiobacillus neapolitanus]
 gi|261836403|gb|ACX96170.1| chorismate mutase [Halothiobacillus neapolitanus c2]
          Length = 413

 Score =  261 bits (666), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 129/374 (34%), Positives = 218/374 (58%), Gaps = 19/374 (5%)

Query: 1   MENVDLTFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIF 60
           + N      QQIDS+D++L+ L+++RAR++   E+  E            Y   +E Q+ 
Sbjct: 22  LPNTLAEVRQQIDSLDSELIALISKRARLA---ERVAEIKQLSNEPQTSFYRPEREAQVL 78

Query: 61  DRIHRLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINY 120
            R+   N GPLS +++V +++EI+SA ++ ++ LS+A  GP G+++ QAA+  FG   + 
Sbjct: 79  SRVRERNPGPLSGDTMVWLFREIMSACLALEQPLSVACLGPSGTFSEQAALRAFGHGAHL 138

Query: 121 LPKSTINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDR-------------FISCKTHI 167
           + +  I ++F +V  G   +G+VP ENST GSV  TLD              ++  +  I
Sbjct: 139 VLEPGIPEVFRAVAAGSVDFGVVPVENSTEGSVSQTLDALAFGATGGALYGVWVPGEVRI 198

Query: 168 LAETYLRISHCLLSKSKFSSI--NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAE 225
             E  L+I   L+++     +   ++ SH Q   QC+++LD H    +RI   S S+AA 
Sbjct: 199 CGELSLKIDQQLMARQDARDVLPQRIVSHAQSLAQCREWLDVHYPGVERIAVQSNSEAAR 258

Query: 226 IAASEPYSAAIASITCAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFT 285
           +AA  P   AI     AE +GL+++  +IQD+  N TRF ++G  +  PSG DKT ++ +
Sbjct: 259 LAAESPSIMAIGPTLAAEQHGLDIVAANIQDSAFNTTRFVVIGRDTVPPSGADKTSLVLS 318

Query: 286 VDHQRPGALCDGLSVFKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKI 345
           V++  PGAL   L+   + GI++++I+SRP+ ++ W YVFF++ +GH +DE ++ AL+K+
Sbjct: 319 VNNM-PGALSRLLAPLAEAGIDVMRIESRPARERAWEYVFFIDFEGHADDERIRAALSKM 377

Query: 346 NEFCLDVKILGSYP 359
             FC  +++LGSYP
Sbjct: 378 QPFCSSLRVLGSYP 391



>gi|514091364|gb|EPF71466.1| chorismate mutase [Acinetobacter rudis CIP 110305]
          Length = 369

 Score =  261 bits (666), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 138/352 (39%), Positives = 208/352 (59%), Gaps = 7/352 (1%)

Query: 10  QQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNG 69
           ++IDS+D +L  L+N RA+++ ++ K K  S          Y   +E Q+  RI   N G
Sbjct: 19  EEIDSVDQQLQHLINRRAKLAESVAKVKFSS----EESPMFYRPEREAQVLRRIMERNEG 74

Query: 70  PLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDI 129
           PLS  ++  +++EI+SA ++ +   SIA+ GP G++TH A +  FG      P  TI+++
Sbjct: 75  PLSDLTMARLFREIMSACLALEAPQSIAFLGPEGTFTHSAVLKHFGHDALVRPLPTIDEV 134

Query: 130 FDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSS 187
           F  VE G   YG+VP ENS+ G V  TLD F S   +++ E  LRI H  L  S ++  S
Sbjct: 135 FREVEAGSAHYGLVPVENSSEGVVNHTLDCFKSSHLNVIGEVELRIHHQFLVSSNTRKDS 194

Query: 188 INKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGL 247
           I ++Y+H Q   QC+K+LD+H    + +   S ++AA    +E +SAAIAS   A LY L
Sbjct: 195 IKQIYAHQQTLAQCRKWLDAHYPGVELVALSSNAEAARRIRNEWHSAAIASDVAASLYEL 254

Query: 248 EVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGIN 307
           E+L  +I+D   N TRF ++G      SGNDKT +L +  H R GAL D L+ F  H I+
Sbjct: 255 EILHSNIEDNPENTTRFLVIGRERVPQSGNDKTSLLISA-HDRAGALLDILAPFAQHNIS 313

Query: 308 LLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           L  I++RP+  + W YVFF++L+GH E + V+ A++ I     +V++LGSYP
Sbjct: 314 LTSIETRPALPEKWAYVFFIDLEGHVEHDNVKAAIDDIRPLVKEVRVLGSYP 365



>gi|489569390|ref|WP_003473864.1| chorismate mutase [Xanthomonas translucens]
 gi|430818963|emb|CCP38349.1| chorismate mutase [Xanthomonas translucens pv. translucens DSM
           18974]
          Length = 394

 Score =  261 bits (666), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 208/351 (59%), Gaps = 7/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID ID  +  L+ ERA+ +  + KAK             Y   +E Q+   +   N GP
Sbjct: 45  KIDEIDRTIQALIAERAQFAHQVGKAK----GKLAAAVDYYRPEREAQVLRMVVDRNQGP 100

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS E LV +++EI+SA ++ Q+ L I Y GP G+++ QA +  FG S   LP +TI ++F
Sbjct: 101 LSDEVLVHVFREIMSACLAQQEPLKIGYLGPEGTFSQQAVLKHFGRSAVGLPMATIEEVF 160

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSSIN 189
             VE G+  +G+VP ENS  G++  TLD F++    I  ET LR+   LLS++ +  +I 
Sbjct: 161 QEVESGNADFGVVPVENSGQGTIQVTLDMFLTSNLKICGETELRVHQYLLSRNGRLDAIE 220

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGL-E 248
           ++Y+HPQ F Q   +L +HL + ++I   S ++ A  A +   +AAI   + A +Y L +
Sbjct: 221 RIYAHPQSFAQTAGWLRAHLPKVEKIPVSSNAEGARRARNAEDAAAIGGESAAHVYALKK 280

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
           V+ K I+D  +N TRF ++G     PSG+D+T +L  + H +PGAL D LS F  HGI++
Sbjct: 281 VIMKSIEDDDDNTTRFLVIGRQIFPPSGHDRTSVLVFI-HDKPGALFDVLSPFARHGISM 339

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I+SRPS Q  W Y FF++L GH ED  +++AL ++      +K+LGSYP
Sbjct: 340 NRIESRPSHQAKWEYGFFIDLAGHVEDASMKQALAELKAHSAQIKVLGSYP 390



>gi|497799133|ref|WP_010113317.1| prephenate dehydratase [Acinetobacter sp. P8-3-8]
          Length = 368

 Score =  261 bits (666), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 135/352 (38%), Positives = 210/352 (59%), Gaps = 7/352 (1%)

Query: 10  QQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNG 69
           + IDS+D ++ QL+N RA+++  + KAK  +          Y   +E Q+  ++   N G
Sbjct: 18  EDIDSVDQQIQQLINRRAKLAEAVAKAKFAA----EENPLFYRPEREAQVLRKVMERNEG 73

Query: 70  PLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDI 129
           PLS +++  +++EI+SA ++ +   SIA+ GP+G+YTH A +  FG      P  TI+++
Sbjct: 74  PLSDQTMARLFREIMSACLALEAPQSIAFLGPVGTYTHSAVLKHFGQDAVVRPLPTIDEV 133

Query: 130 FDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSS 187
           F  VE G   YG+VP ENS+ G V  TLD F S   +++ E  LRI H  L  S ++  S
Sbjct: 134 FREVEAGSAHYGLVPVENSSEGVVNHTLDCFKSSSLNVIGEVELRIHHQFLVSSNTRKDS 193

Query: 188 INKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGL 247
           I ++Y+H Q   QC+K+LD++    +++   S ++AA    +E +SAAIAS   A +Y L
Sbjct: 194 IKQIYAHQQTLAQCRKWLDANYPGVEQVALSSNAEAARRIRNEWHSAAIASDVAASIYDL 253

Query: 248 EVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGIN 307
           E+L  +I+D   N TRF ++G      SGNDKT +L +  H R GAL + L+ F  H I+
Sbjct: 254 EILHGNIEDNPENTTRFLVIGREKIPQSGNDKTSLLISA-HDRAGALLEILAPFAKHNIS 312

Query: 308 LLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           L  I++RP+  + W YVFF++L+GH E E V+ A+  I     +V++LGSYP
Sbjct: 313 LTSIETRPALPEKWAYVFFIDLEGHVEQENVKAAIEDIRPLVKEVRVLGSYP 364



>gi|148549151|ref|YP_001269253.1| chorismate mutase [Pseudomonas putida F1]
 gi|386013359|ref|YP_005931636.1| PheA [Pseudomonas putida BIRD-1]
 gi|397695766|ref|YP_006533649.1| P-protein [Pseudomonas putida DOT-T1E]
 gi|489345530|ref|WP_003252669.1| prephenate dehydratase [Pseudomonas putida]
 gi|148513209|gb|ABQ80069.1| prephenate dehydratase [Pseudomonas putida F1]
 gi|313500065|gb|ADR61431.1| PheA [Pseudomonas putida BIRD-1]
 gi|397332496|gb|AFO48855.1| P-protein [Pseudomonas putida DOT-T1E]
 gi|471348679|gb|EMR46643.1| chorismate mutase [Pseudomonas putida LS46]
          Length = 364

 Score =  261 bits (666), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 131/351 (37%), Positives = 210/351 (59%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L+++RAR +  + + K  S          Y   +E  +  R+   N GP
Sbjct: 12  RIDSLDEKILELISDRARCAEEVARVKTASLKEGEKPV-FYRPEREAAVLKRVMERNKGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L IAY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 71  LGNEEMARLFREIMSSCLALEEPLKIAYLGPEGTFTQAAAMKHFGHAVISRPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVSHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 TRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAANLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++G+    P+G+DKT I+ ++ + +PGAL + L  F  +GI+L
Sbjct: 251 RLAEKIEDRPDNSTRFLMIGNQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFYQNGIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +++  L +I++  + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHRDPLIKAVLEQISQEAVALKVLGSYP 360



>gi|226943700|ref|YP_002798773.1| chorismate mutase [Azotobacter vinelandii DJ]
 gi|482893912|ref|YP_007892583.1| chorismate mutase [Azotobacter vinelandii CA]
 gi|482898571|ref|YP_007897632.1| chorismate mutase [Azotobacter vinelandii CA6]
 gi|502031294|ref|WP_012700213.1| prephenate dehydratase [Azotobacter vinelandii]
 gi|226718627|gb|ACO77798.1| Chorismate mutase, gamma, beta and epsilon proteobacteria/
           Prephenate dehydratase [Azotobacter vinelandii DJ]
 gi|482530723|gb|AGK13850.1| chorismate mutase [Azotobacter vinelandii CA]
 gi|482535377|gb|AGK18503.1| chorismate mutase [Azotobacter vinelandii CA6]
          Length = 365

 Score =  261 bits (666), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 132/351 (37%), Positives = 211/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L++ERAR +  + + K  S          Y   +E  +   I  +N GP
Sbjct: 13  RIDSLDEKILELISERARCAEEVARVKMASLKPGESPV-FYRPEREAWVLRHIMEINKGP 71

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ +  L +AY GP G++T  AA+  FG ++  LP + I+++F
Sbjct: 72  LGNEEVARLFREIMSSCLALEHPLKVAYLGPEGTFTQAAALKHFGHAVISLPMAAIDEVF 131

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    ++   I
Sbjct: 132 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDLVICGEVELRIHHHLLVGENTRTDKI 191

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LD+H    +R+   S + AA    SE  SAAIA    A+LYGL 
Sbjct: 192 SRIYSHAQSLAQCRKWLDAHYPSVERVALSSNADAARRVKSEWNSAAIAGDMAAQLYGLT 251

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+G+    P G+DKT I+ ++++ +PGAL   L  F ++GI+L
Sbjct: 252 KLAEKIEDRPDNSTRFLIIGNQEVPPIGDDKTSIIVSMNN-KPGALHALLMPFHENGIDL 310

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH+ D +V+  L ++++  + +K+LGSYP
Sbjct: 311 TRIETRPSRSGKWTYVFFIDFVGHRHDPLVKSVLERLSQEVVALKVLGSYP 361



>gi|91776039|ref|YP_545795.1| chorismate mutase / prephenate dehydratase [Methylobacillus
           flagellatus KT]
 gi|499799174|ref|WP_011479908.1| prephenate dehydratase [Methylobacillus flagellatus]
 gi|91710026|gb|ABE49954.1| chorismate mutase / prephenate dehydratase [Methylobacillus
           flagellatus KT]
          Length = 355

 Score =  260 bits (665), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 134/351 (38%), Positives = 216/351 (61%), Gaps = 12/351 (3%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAK-EGSYXXXXXXXXVYVSGKENQIFDRIHRLNNG 69
           QID+ID +L++L+N RA ++  + + K EG          +Y   +E Q+  R+   N G
Sbjct: 11  QIDAIDEQLLELINARAALAREIGELKGEGP---------IYRPEREAQVLRRLLEKNTG 61

Query: 70  PLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDI 129
           PLS+E++ +I++ ++S   + +++LS+A+ GP G+Y+ +AAI +FG   N  P  +I+++
Sbjct: 62  PLSAEAVTAIFRSVMSNCRALERELSVAFLGPQGTYSEEAAIKQFGGLNNPKPCMSIDEV 121

Query: 130 FDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKSKF-SSI 188
           F  VE G+  Y +VP ENST G+V  TLD   +   HI  E  L I HCLL +      I
Sbjct: 122 FRMVESGNADYAVVPVENSTEGAVGRTLDLLTTTSLHICGEVALPIHHCLLRRRHADGEI 181

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q  GQC ++L+ +L   +R+   S ++AAE+AA + ++ AIA    A+++GL+
Sbjct: 182 RRIYSHAQSLGQCHEWLNLNLGGVERVSTGSNAQAAELAAQDAFAVAIAGRRAADIFGLD 241

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
           +L ++I+D   NVTRF +LG     PSG DKT +L    +  PGA+   L+   +HG+++
Sbjct: 242 ILAENIEDDPKNVTRFLVLGKHEAAPSGQDKTSLLLATKNV-PGAIVGLLTPLAEHGVDM 300

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            ++ SRPS    W YVFFV+++GH +D  V +AL+++ +     KILGSYP
Sbjct: 301 TELGSRPSKLGIWDYVFFVDIKGHYQDPAVARALHELEQRASMFKILGSYP 351



>gi|26988500|ref|NP_743925.1| chorismate mutase [Pseudomonas putida KT2440]
 gi|395444840|ref|YP_006385093.1| chorismate mutase [Pseudomonas putida ND6]
 gi|499255267|ref|WP_010952807.1| chorismate mutase [Pseudomonas putida]
 gi|24983265|gb|AAN67389.1|AE016365_4 chorismate mutase/prephenate dehydratase [Pseudomonas putida
           KT2440]
 gi|388558837|gb|AFK67978.1| chorismate mutase [Pseudomonas putida ND6]
          Length = 367

 Score =  260 bits (665), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 131/351 (37%), Positives = 210/351 (59%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L+++RAR +  + + K  S          Y   +E  +  R+   N GP
Sbjct: 15  RIDSLDEKILELISDRARCAEEVARVKTASLKEGEKPV-FYRPEREAAVLKRVMERNKGP 73

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L IAY GP G++T  AA+  FG ++   P + I+++F
Sbjct: 74  LGNEEMARLFREIMSSCLALEEPLKIAYLGPEGTFTQAAAMKHFGHAVISRPMAAIDEVF 133

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 134 REVAAGAVNFGVVPVENSTEGAVSHTLDSFLEHDMVICGEVELRIHHHLLVGENTKTDSI 193

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 194 TRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNAEAAKRVKGEWNSAAIAGDMAANLYGLT 253

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF ++G+    P+G+DKT I+ ++ + +PGAL + L  F  +GI+L
Sbjct: 254 RLAEKIEDRPDNSTRFLMIGNQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFYQNGIDL 312

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH  D +++  L +I++  + +K+LGSYP
Sbjct: 313 TRIETRPSRSGKWTYVFFIDFVGHHRDPLIKAVLEQISQEAVALKVLGSYP 363



>gi|490834039|ref|WP_004696123.1| prephenate dehydratase [Acinetobacter johnsonii]
 gi|262315669|gb|EEY96708.1| chorismate mutase [Acinetobacter johnsonii SH046]
 gi|479888896|gb|ENU39063.1| chorismate mutase [Acinetobacter johnsonii CIP 64.6]
 gi|480032804|gb|ENV72819.1| chorismate mutase [Acinetobacter johnsonii ANC 3681]
          Length = 369

 Score =  260 bits (665), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 135/352 (38%), Positives = 207/352 (58%), Gaps = 7/352 (1%)

Query: 10  QQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNG 69
           Q IDS+D ++ QL+N RA+++  + KAK  S          Y   +E Q+   +   N G
Sbjct: 19  QDIDSVDQQIQQLINRRAKLAEAVAKAKFAS----EENPMFYRPEREAQVLRNVMERNEG 74

Query: 70  PLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDI 129
           PLS  ++  +++EI+SA ++ +   SIA+ GP+G+YTH A +  FG      P  TI+++
Sbjct: 75  PLSDVTMARLFREIMSACLALEAPQSIAFLGPVGTYTHSAVLKHFGHDAVVRPLPTIDEV 134

Query: 130 FDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSS 187
           F  VE G   YG+VP ENS+ G V  TLD F +   +++ E  LRI H  L    ++  S
Sbjct: 135 FREVEAGSAHYGLVPVENSSEGVVNHTLDCFKASHLNVIGEVELRIHHQFLVSENTRKDS 194

Query: 188 INKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGL 247
           I ++Y+H Q   QC+ +LD+H    +R+   S ++AA    +E +SAAIAS   A +Y L
Sbjct: 195 IKQIYAHQQTLAQCRAWLDAHYPGVERVALSSNAEAARRIRTEWHSAAIASDVAASIYDL 254

Query: 248 EVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGIN 307
           E+L  +I+D   N TRF ++G      SGNDKT +L +  H R GAL + L+ F  H I+
Sbjct: 255 EILHSNIEDNPENTTRFLVIGRERIPQSGNDKTSLLISA-HDRAGALLEILAPFAKHNIS 313

Query: 308 LLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           L  I++RP+  + W YVFF++L+GH E + V+ A+ +I     +V++LGSYP
Sbjct: 314 LTSIETRPALPEKWAYVFFIDLEGHVEQDNVKAAIEEIRPLVKEVRVLGSYP 365



>gi|489473874|ref|WP_003378949.1| chorismate mutase/prephenate dehydratase, partial [Pseudomonas
           syringae]
 gi|330964799|gb|EGH65059.1| chorismate mutase/prephenate dehydratase [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 358

 Score =  260 bits (665), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 133/349 (38%), Positives = 212/349 (60%), Gaps = 4/349 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L++ERAR +  + + K  S          Y   +E  +  R+   N GP
Sbjct: 12  RIDSLDEKVLELISERARCAQEVARVKMSSLAEGEVPV-FYRPEREAAVLRRVMDRNRGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS+E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG ++  LP + I+++F
Sbjct: 71  LSNEEMARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAAMKHFGHAVISLPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGESTKTQSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           +++YSH Q   QC+K+LD+H    +R+   S ++AA+    E  SAAIA    A LYGL 
Sbjct: 191 SRIYSHAQSLAQCRKWLDAHYPNVERVAVASNAEAAKRVKGEWNSAAIAGDMAAGLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+G+    P+G+DKT I+ ++ + +PGAL + L  F ++G++L
Sbjct: 251 RLAEKIEDRPDNSTRFLIIGNQEVPPTGDDKTSIIVSMSN-KPGALHELLVPFHENGLDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGS 357
            +I++RPS    W YVFF++  GH +D +V+  L KI+   + +K+LGS
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFVGHHQDPLVKAVLEKISSEAVALKVLGS 358



>gi|15598362|ref|NP_251856.1| chorismate mutase [Pseudomonas aeruginosa PAO1]
 gi|116051155|ref|YP_790014.1| chorismate mutase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|386057873|ref|YP_005974395.1| chorismate mutase [Pseudomonas aeruginosa M18]
 gi|386067184|ref|YP_005982488.1| chorismate mutase [Pseudomonas aeruginosa NCGM2.S1]
 gi|392983109|ref|YP_006481696.1| chorismate mutase [Pseudomonas aeruginosa DK2]
 gi|478477999|ref|YP_007708650.1| chorismate mutase [Pseudomonas aeruginosa B136-33]
 gi|514410404|ref|YP_008133795.1| prephenate dehydratase [Pseudomonas aeruginosa RP73]
 gi|489181992|ref|WP_003091446.1| prephenate dehydratase [Pseudomonas aeruginosa]
 gi|81622236|sp|Q9HZ67.1|PHEA_PSEAE RecName: Full=P-protein; Includes: RecName: Full=Chorismate mutase;
           Short=CM; Includes: RecName: Full=Prephenate
           dehydratase; Short=PDT
 gi|9949282|gb|AAG06554.1|AE004740_7 chorismate mutase [Pseudomonas aeruginosa PAO1]
 gi|115586376|gb|ABJ12391.1| prephenate dehydratase [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126168059|gb|EAZ53570.1| chorismate mutase [Pseudomonas aeruginosa C3719]
 gi|126195232|gb|EAZ59295.1| chorismate mutase [Pseudomonas aeruginosa 2192]
 gi|310880984|gb|EFQ39578.1| prephenate dehydratase [Pseudomonas aeruginosa 39016]
 gi|334834245|gb|EGM13226.1| chorismate mutase [Pseudomonas aeruginosa 138244]
 gi|334834319|gb|EGM13293.1| chorismate mutase [Pseudomonas aeruginosa 152504]
 gi|346058982|dbj|GAA18865.1| chorismate mutase [Pseudomonas aeruginosa NCMG1179]
 gi|347304179|gb|AEO74293.1| chorismate mutase [Pseudomonas aeruginosa M18]
 gi|348035743|dbj|BAK91103.1| chorismate mutase [Pseudomonas aeruginosa NCGM2.S1]
 gi|354831029|gb|EHF15058.1| P-protein [Pseudomonas sp. 2_1_26]
 gi|375044688|gb|EHS37282.1| chorismate mutase [Pseudomonas aeruginosa MPAO1/P1]
 gi|375049492|gb|EHS41986.1| chorismate mutase [Pseudomonas aeruginosa MPAO1/P2]
 gi|384401051|gb|EIE47407.1| chorismate mutase [Pseudomonas aeruginosa PADK2_CF510]
 gi|392318614|gb|AFM63994.1| chorismate mutase [Pseudomonas aeruginosa DK2]
 gi|403248249|gb|EJY61835.1| chorismate mutase [Pseudomonas aeruginosa CIG1]
 gi|404347178|gb|EJZ73527.1| chorismate mutase [Pseudomonas aeruginosa PAO579]
 gi|404524598|gb|EKA34925.1| chorismate mutase [Pseudomonas aeruginosa ATCC 14886]
 gi|404535460|gb|EKA45152.1| chorismate mutase [Pseudomonas aeruginosa CI27]
 gi|404537277|gb|EKA46882.1| chorismate mutase [Pseudomonas aeruginosa ATCC 700888]
 gi|404546692|gb|EKA55734.1| chorismate mutase [Pseudomonas aeruginosa E2]
 gi|404547162|gb|EKA56176.1| chorismate mutase [Pseudomonas aeruginosa ATCC 25324]
 gi|451754458|emb|CCQ88585.1| Chorismate mutase I / Prephenate dehydratase [Pseudomonas
           aeruginosa 18A]
 gi|453043073|gb|EME90807.1| chorismate mutase [Pseudomonas aeruginosa PA21_ST175]
 gi|476650264|gb|EMZ56587.1| P-protein [Pseudomonas sp. P179]
 gi|476651622|gb|EMZ57942.1| P-protein [Pseudomonas aeruginosa str. Stone 130]
 gi|477550085|gb|AGI80726.1| chorismate mutase [Pseudomonas aeruginosa B136-33]
 gi|477559430|gb|ENH92893.1| chorismate mutase [Pseudomonas aeruginosa PA45]
 gi|500729128|gb|EOQ78518.1| chorismate mutase [Pseudomonas aeruginosa VRFPA02]
 gi|508138021|gb|EOT14894.1| P-protein [Pseudomonas aeruginosa PA14]
 gi|508140725|gb|EOT17577.1| P-protein [Pseudomonas aeruginosa MSH-10]
 gi|508142727|gb|EOT19574.1| P-protein [Pseudomonas aeruginosa PAK]
 gi|514248374|gb|AGO40755.1| prephenate dehydratase [Pseudomonas aeruginosa RP73]
          Length = 365

 Score =  260 bits (665), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 133/351 (37%), Positives = 212/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D KL++L++ERAR + ++ + K  +          Y   +E  +   I +LN GP
Sbjct: 13  RIDSLDEKLLELISERARCAQDVARVKTQTLGEGEAPV-FYRPEREAWVLKHIMQLNKGP 71

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG+++   P + I+++F
Sbjct: 72  LDNEEVARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAALKHFGNAVISTPMAAIDEVF 131

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  +I
Sbjct: 132 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGETTKTDNI 191

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LDSH    +R+   S + AA+   SE  SAAIA    A LY L 
Sbjct: 192 TRIYSHAQSLAQCRKWLDSHYPSVERVAVSSNADAAKRVKSEWNSAAIAGDMAASLYDLS 251

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+G+    P+G+DKT I+ ++   +PGAL + L  F ++GI+L
Sbjct: 252 KLHEKIEDRPDNSTRFLIIGNQEVPPTGDDKTSIIVSM-RNKPGALHELLVPFHNNGIDL 310

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH ++ +++  L KI +  + +K+LGSYP
Sbjct: 311 TRIETRPSRSGKWTYVFFIDFVGHHKEPLIKDVLEKIGQEAVALKVLGSYP 361



>gi|387220740|gb|EIJ75384.1| Prephenate dehydratase [Leptospirillum sp. Group II 'C75']
          Length = 365

 Score =  260 bits (664), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 131/353 (37%), Positives = 209/353 (59%), Gaps = 8/353 (2%)

Query: 8   FSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLN 67
             + ID +D +++ LL +RA ++  +     GSY         +V  +E +I DRI   +
Sbjct: 7   LREGIDRVDGEIIALLKKRADLAKQV-----GSYKIAHSLP-FHVVAREREIIDRILEQD 60

Query: 68  NGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTIN 127
             P   E+L  IY+EI+SA +S ++ +SI+Y GP  +YTHQAAI  FG+S+ +LP  TI 
Sbjct: 61  TAPFPKEALRHIYREILSACLSLEEPVSISYLGPPATYTHQAAIKHFGNSLRFLPAPTIR 120

Query: 128 DIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSK-SKFS 186
           ++F  VE     YG+VP ENST G V  TLD  +     ++ E  L I HCLL+K S  S
Sbjct: 121 EVFRFVESKDALYGVVPIENSTEGMVNYTLDTLVETDLKVVGEIVLPIHHCLLTKSSSLS 180

Query: 187 SINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYG 246
           +I  V++HPQ   QC+ +L +HL     ++  S ++A E+   +   AAIA    +++Y 
Sbjct: 181 NIKTVFAHPQSQAQCRSFLSTHLPNIPLVETSSNTRAVELCLEDESGAAIAGEMASDIYN 240

Query: 247 LEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGI 306
           + +L + I+D  +N TRF ++G+     +  D+T I+ ++   R GAL   L +    GI
Sbjct: 241 IPILRRHIEDYPDNQTRFLVIGTIEPGKTRKDQTSIMISII-DRVGALSSILDMIAKQGI 299

Query: 307 NLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           N+ +++SRPS ++ W Y+FF++++GH+ED+ +++ L K+   C  VKILGSYP
Sbjct: 300 NVTRLESRPSRKKAWDYIFFIDIEGHQEDQSIRELLKKLQNLCPYVKILGSYP 352



>gi|489395984|ref|WP_003302483.1| chorismate mutase [Pseudomonas stutzeri]
 gi|452006733|gb|EMD99001.1| chorismate mutase [Pseudomonas stutzeri NF13]
          Length = 365

 Score =  260 bits (664), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 132/351 (37%), Positives = 206/351 (58%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D +++ L++ERAR +  + + K  +          Y   +E  +   I  LN GP
Sbjct: 13  RIDSLDERILDLISERARCAQEVARVKTAALAEGEPAV-FYRPEREAWVLKHIMELNRGP 71

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G+++  AA+  FG ++   P + I+++F
Sbjct: 72  LDNEEMARLFREIMSSCLALEQPLRVAYLGPEGTFSQAAALKHFGHAVISTPMAAIDEVF 131

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K   I
Sbjct: 132 REVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDIVICGEVELRIHHHLLVGETTKTDRI 191

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +R+   S + AA    SE  SAAIA    A+LYGL 
Sbjct: 192 TRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAARRVKSEWNSAAIAGDMAAQLYGLT 251

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+GS    P+G+DKT I+ +    +PGAL + L  F  +GI+L
Sbjct: 252 KLAEKIEDRPDNSTRFLIIGSQEVPPTGDDKTSIIVST-RNKPGALHELLVPFHANGIDL 310

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH +D +++  L KI +  + +K+LGSYP
Sbjct: 311 TRIETRPSRSGKWTYVFFIDFLGHHQDPLIKDVLEKIGQEAVALKVLGSYP 361



>gi|490999853|ref|WP_004861576.1| chorismate mutase [Acinetobacter gerneri]
 gi|479991186|gb|ENV34079.1| chorismate mutase [Acinetobacter gerneri DSM 14967 = CIP 107464]
          Length = 369

 Score =  260 bits (664), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 135/352 (38%), Positives = 206/352 (58%), Gaps = 7/352 (1%)

Query: 10  QQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNG 69
           Q IDS+D ++ QL+N RAR++  + KAK  +          Y   +E Q+   +   N G
Sbjct: 19  QDIDSVDQQIQQLINRRARLAEAVAKAKFAA----EENPLFYRPEREAQVLRNVMERNEG 74

Query: 70  PLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDI 129
           P+S  ++  +++EI+SA ++ +   SIA+ GP G+YTH A +  FG      P  TI+++
Sbjct: 75  PISDVTMARLFREIMSACLALEAPQSIAFLGPEGTYTHSAVLKHFGHDAVIRPLPTIDEV 134

Query: 130 FDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSS 187
           F  VE G   YG+VP ENS+ G V  TLD F +   +++ E  LRI H  L    ++  S
Sbjct: 135 FREVEAGSAHYGLVPVENSSEGVVNHTLDCFKTSHLNVIGEVELRIHHQFLVSENTRKDS 194

Query: 188 INKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGL 247
           I ++Y+H Q   QC+K+LD+H    +R+   S ++AA    +E +SAAIAS   A LY L
Sbjct: 195 IKQIYAHQQTLAQCRKWLDAHYPSVERVALSSNAEAARRIRNEWHSAAIASDVAANLYNL 254

Query: 248 EVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGIN 307
           E+L  +I+D   N TRF ++G      SGNDKT +L +  H R GAL + L  F  H ++
Sbjct: 255 EILHSNIEDNPENTTRFLVIGREKVPQSGNDKTSLLVSA-HDRAGALLEILQPFAKHNLS 313

Query: 308 LLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           L  I++RP+  + W YVFF++L+GH E + V+ A+ +I     +V++LGSYP
Sbjct: 314 LTSIETRPALPEKWAYVFFIDLEGHIEQDNVKAAIEEIRPLVKEVRVLGSYP 365



>gi|473829644|ref|YP_007682927.1| P-protein [Thalassolituus oleivorans MIL-1]
 gi|505300306|ref|WP_015487408.1| P-protein [Thalassolituus oleivorans]
 gi|461493011|emb|CCU72690.1| P-protein [Thalassolituus oleivorans MIL-1]
          Length = 363

 Score =  260 bits (664), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 136/352 (38%), Positives = 210/352 (59%), Gaps = 2/352 (0%)

Query: 8   FSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLN 67
             QQID++D ++  L+NERA+ +  + + K   Y         Y   +E Q+   +   N
Sbjct: 10  LRQQIDALDQQIQLLINERAKCAQQVAEVKY-KYAEPGSLVTFYRPEREAQVLLNVMARN 68

Query: 68  NGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTIN 127
            GPL +ES+  +++EI+S  ++ ++ L+IAY GP G++T QAA+  FG ++    + +I 
Sbjct: 69  EGPLPNESIARVFREIMSQCLALEEPLTIAYLGPHGTFTQQAAVKHFGHAVTCAGQVSIA 128

Query: 128 DIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKSKFSS 187
           D+F  VE G   YG+VP ENST G V  TLD F     +I  E  LRI H +L KS   +
Sbjct: 129 DVFREVESGSAQYGVVPVENSTEGVVTHTLDSFYDSNLYICGEVTLRIHHHMLVKSLTDN 188

Query: 188 INKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGL 247
           + ++YSH Q  GQC+ +LD +    +RI   S ++AA  A+SE  +AAIA    AELY L
Sbjct: 189 VQRIYSHAQSLGQCRLWLDQNFPNVERIAVSSNAEAARRASSEVGAAAIAGEAAAELYEL 248

Query: 248 EVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGIN 307
           EV   +I+D  +N TRF I+G     PSG+DKT I+ +  +Q PGAL + L+ F + G++
Sbjct: 249 EVRNANIEDRPDNTTRFLIIGKQETIPSGDDKTSIMVSSRNQ-PGALYNVLAPFHEAGVS 307

Query: 308 LLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           L +I++RP     W+Y+FF++ +GHK D+ +   + ++ +  +D K LGSYP
Sbjct: 308 LTRIETRPDHSGTWNYLFFIDFEGHKNDQRISPLMQRLRDVAVDFKWLGSYP 359



>gi|490462887|ref|WP_004333445.1| chorismate mutase [Thauera linaloolentis]
 gi|479302040|gb|ENO90140.1| chorismate mutase [Thauera linaloolentis 47Lol = DSM 12138]
          Length = 356

 Score =  260 bits (664), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 128/360 (35%), Positives = 209/360 (58%), Gaps = 9/360 (2%)

Query: 1   MENVDLTFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIF 60
           M +  L    +ID +D +++  L+ERAR +  + + K+G           Y   +E Q+ 
Sbjct: 1   MSDELLKLRNEIDRLDEEILARLSERARCAQRVGEVKQGH-------APFYRPEREAQVL 53

Query: 61  DRIHRLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINY 120
            R+  LN GPL ++++ +I++EI+SA +  +    IAY GP G+++  A+  +FG +  +
Sbjct: 54  RRLAELNRGPLPADAVKTIFREIMSACLGLEHPQRIAYLGPAGTFSESASRKQFGSAPAF 113

Query: 121 LPKSTINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL 180
           +P +TI D+F +VE G+  YG+VP ENST G+V  TLD  ++    +  E  LRI   L+
Sbjct: 114 MPMATIEDVFRAVEAGNVDYGVVPVENSTEGAVSITLDLLLASPVKVCGELNLRIHQQLM 173

Query: 181 SKSK-FSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASI 239
           S++    +  ++YSH Q   QC ++L+ +L    RI   S ++AA +A  +  S AIA  
Sbjct: 174 SRADGIGAAKRLYSHAQSLAQCHEWLNRNLPHLPRIPVASNAEAARLAGEDAESCAIAGE 233

Query: 240 TCAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLS 299
             A+LYGL +L  +I+D  NN TRF ++ S    PSG D+T ++F+  + RPGA+   L 
Sbjct: 234 AAAQLYGLNILAPNIEDEPNNTTRFLVIASHDAGPSGKDRTSLVFSAPN-RPGAIHTLLE 292

Query: 300 VFKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
               HG+++ K+ SRP+    W YVF+ ++ GH+ED  V  AL ++ +    +K+LGSYP
Sbjct: 293 PLARHGVDMTKLQSRPAQSGLWEYVFYADINGHREDAGVAAALVELADRAAFLKVLGSYP 352



>gi|49086200|gb|AAT51335.1| PA3166, partial [synthetic construct]
          Length = 366

 Score =  260 bits (664), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 133/351 (37%), Positives = 212/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D KL++L++ERAR + ++ + K  +          Y   +E  +   I +LN GP
Sbjct: 13  RIDSLDEKLLELISERARCAQDVARVKTQTLGEGEAPV-FYRPEREAWVLKHIMQLNKGP 71

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG+++   P + I+++F
Sbjct: 72  LDNEEVARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAALKHFGNAVISTPMAAIDEVF 131

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  +I
Sbjct: 132 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGETTKTDNI 191

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LDSH    +R+   S + AA+   SE  SAAIA    A LY L 
Sbjct: 192 TRIYSHAQSLAQCRKWLDSHYPSVERVAVSSNADAAKRVKSEWNSAAIAGDMAASLYDLS 251

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+G+    P+G+DKT I+ ++   +PGAL + L  F ++GI+L
Sbjct: 252 KLHEKIEDRPDNSTRFLIIGNQEVPPTGDDKTSIIVSM-RNKPGALHELLVPFHNNGIDL 310

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH ++ +++  L KI +  + +K+LGSYP
Sbjct: 311 TRIETRPSRSGKWTYVFFIDFVGHHKEPLIKDVLEKIGQEAVALKVLGSYP 361



>gi|218890642|ref|YP_002439506.1| chorismate mutase [Pseudomonas aeruginosa LESB58]
 gi|501655374|ref|WP_012613863.1| prephenate dehydratase [Pseudomonas aeruginosa]
 gi|218770865|emb|CAW26630.1| chorismate mutase [Pseudomonas aeruginosa LESB58]
          Length = 365

 Score =  260 bits (664), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 133/351 (37%), Positives = 212/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D KL++L++ERAR + ++ + K  +          Y   +E  +   I +LN GP
Sbjct: 13  RIDSLDEKLLELISERARCAQDVARVKTQTLGEGEAPV-FYRPEREAWVLKHIMQLNKGP 71

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G++T  AA+  FG+++   P + I+++F
Sbjct: 72  LDNEEVARLFREIMSSCLALEQPLKVAYLGPEGTFTQAAALKHFGNAVISTPMAAIDEVF 131

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  +I
Sbjct: 132 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGETTKTDNI 191

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LDSH    +R+   S + AA+   SE  SAAIA    A LY L 
Sbjct: 192 TRIYSHAQSLAQCRKWLDSHYPSVERVAVSSNADAAKRVKSEWNSAAIAGDMAASLYHLS 251

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+G+    P+G+DKT I+ ++   +PGAL + L  F ++GI+L
Sbjct: 252 KLHEKIEDRPDNSTRFLIIGNQEVPPTGDDKTSIIVSM-RNKPGALHELLVPFHNNGIDL 310

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH ++ +++  L KI +  + +K+LGSYP
Sbjct: 311 TRIETRPSRSGKWTYVFFIDFVGHHKEPLIKDVLEKIGQEAVALKVLGSYP 361



>gi|410478994|ref|YP_006766631.1| prephenate dehydratase [Leptospirillum ferriphilum ML-04]
 gi|504774078|ref|WP_014961180.1| prephenate dehydratase [Leptospirillum ferriphilum]
 gi|124514307|gb|EAY55821.1| Prephenate dehydratase [Leptospirillum rubarum]
 gi|406774246|gb|AFS53671.1| prephenate dehydratase [Leptospirillum ferriphilum ML-04]
          Length = 365

 Score =  259 bits (663), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 130/353 (36%), Positives = 207/353 (58%), Gaps = 8/353 (2%)

Query: 8   FSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLN 67
             + ID +D +++ LL +RA      + AK+            +V  +E +I DRI   +
Sbjct: 7   LREGIDRVDGEIIALLKKRA------DLAKQVGAYKIAHSLPFHVVAREREIIDRILEQD 60

Query: 68  NGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTIN 127
             P   E+L  IY+EI+SA +S ++ +SI+Y GP  +YTHQAAI  FG+S+ +LP  TI 
Sbjct: 61  TAPFPKEALRHIYREILSACLSLEEPVSISYLGPPATYTHQAAIKHFGNSLRFLPAPTIR 120

Query: 128 DIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSK-SKFS 186
           ++F  VE     YG+VP ENST G V  TLD  +     ++ E  L I HCLL+K S  S
Sbjct: 121 EVFRFVESKDALYGVVPIENSTEGMVNYTLDTLVETDLKVVGEIVLPIHHCLLTKSSSLS 180

Query: 187 SINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYG 246
           +I  V++HPQ   QC+ +L +HL     ++  S ++A E+   +   AAIA    +++Y 
Sbjct: 181 NIKTVFAHPQSQAQCRSFLSTHLPNIPLVETSSNTRAVELCLEDESGAAIAGEMASDIYN 240

Query: 247 LEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGI 306
           + +L + I+D  +N TRF ++G+     +  D+T I+ ++   R GAL   L +    GI
Sbjct: 241 IPILRRHIEDYPDNQTRFLVIGTIEPGKTRKDQTSIMISII-DRVGALSSILDMIAKQGI 299

Query: 307 NLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           N+ +++SRPS ++ W Y+FF++++GH+ED+ +++ L K+   C  VKILGSYP
Sbjct: 300 NVTRLESRPSRKKAWDYIFFIDIEGHQEDQSIRELLKKLQNLCPYVKILGSYP 352



>gi|496442730|ref|WP_009151575.1| prephenate dehydratase [Thiorhodovibrio sp. 970]
 gi|380877253|gb|EIC19346.1| chorismate mutase, clade 2 [Thiorhodovibrio sp. 970]
          Length = 384

 Score =  259 bits (663), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 141/352 (40%), Positives = 205/352 (58%), Gaps = 6/352 (1%)

Query: 10  QQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNG 69
           ++ID+ D ++++LL+ERAR +  + + K             Y   +E +I  RI   N G
Sbjct: 35  ERIDATDAEILRLLSERARCAQEVAEIKSAQ----APQTHFYRPEREAEILRRIKAENPG 90

Query: 70  PLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDI 129
           PL  E +  +++EI+SA ++ +K LS+AY GP G++T  AA+  FG S++ LP   I DI
Sbjct: 91  PLHDEEVARLFREIMSACLALEKPLSVAYLGPEGTFTQAAALKHFGHSVHTLPFGAIGDI 150

Query: 130 FDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLS-KSKFSSI 188
           F  VE G   +G+VP ENST G V  TLD F+    HI  E  LRI H L+S  +  + +
Sbjct: 151 FREVEAGSCHFGVVPVENSTEGVVSHTLDTFMQSPLHIAGEVTLRIHHHLMSCATSLAGV 210

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            +VYSH Q   QC+ +LD HL +A+RI   S ++AA + A+   + A+A    AELY L 
Sbjct: 211 QRVYSHQQSLAQCRAWLDRHLPQAERIPVGSNAEAARLVANTEGAGAVAGEAAAELYQLN 270

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
           +L   I+D   N +RF I+G     PSG DKT +L +  ++  G L   L+   +H I++
Sbjct: 271 LLANRIEDDPRNTSRFLIIGPEDAPPSGKDKTSLLLSCRNE-AGGLYRLLTPMAEHAISM 329

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYPD 360
            +I+SRPS Q  W YVFFV+L GH++D  V  AL K+       KILGSYP+
Sbjct: 330 TRIESRPSRQGVWDYVFFVDLCGHRDDAQVAAALEKLKTSANLFKILGSYPE 381



>gi|494267139|ref|WP_007154696.1| prephenate dehydratase [Marinobacter algicola]
 gi|149358307|gb|EDM46785.1| Chorismate mutase, gamma, beta and epsilon proteobacteria
           [Marinobacter algicola DG893]
          Length = 365

 Score =  259 bits (663), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 139/350 (39%), Positives = 210/350 (60%), Gaps = 5/350 (1%)

Query: 12  IDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGPL 71
           ID +D +++ L+++RA  +  + + K  +          Y   +E Q+  RI   N GPL
Sbjct: 15  IDRLDQEIMDLISKRAECAQEVARVKMEA--NPGEDVFFYRPEREAQVLRRIKESNPGPL 72

Query: 72  SSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIFD 131
           S E +  +++EI+SA ++ +K + IA+ GP+G++T  AA+  FG S+  +P   I+ +F 
Sbjct: 73  SGEEMARLFREIMSACLALEKPMHIAFLGPIGTFTQAAALKHFGHSVVSVPLPAIDAVFR 132

Query: 132 SVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSIN 189
            VE G   YG+VP ENST G +  TLD F+S    I  E  LRI H L+   K +   I 
Sbjct: 133 EVESGAAHYGVVPVENSTEGMINHTLDMFMSSPLKICGEVQLRIHHHLMVSPKHQGQDIV 192

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLEV 249
           ++YSH Q F QC+++LD+H    +R+   S ++AA  AA EP +AAIA    AELYGLE+
Sbjct: 193 RIYSHQQSFAQCRQWLDTHRYGIERVTVSSNAEAARRAAEEPGTAAIAGDMAAELYGLEM 252

Query: 250 LGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINLL 309
           L   I+D  +N TRF I+G      SGNDK+ IL ++   +PGAL   L  F  HG++L 
Sbjct: 253 LATSIEDRPDNTTRFLIIGREEVPASGNDKSSILVSM-RNKPGALYQLLEPFHKHGLSLT 311

Query: 310 KIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           +I++RPS    W YVF+++ +GH +D  V K L++I+E  +++K LGSYP
Sbjct: 312 RIETRPSPSGTWAYVFYIDFEGHVDDAQVSKVLSEIDEEAVELKRLGSYP 361



>gi|430761096|ref|YP_007216953.1| Chorismate mutase I / Prephenate dehydratase [Thioalkalivibrio
           nitratireducens DSM 14787]
 gi|505071497|ref|WP_015258599.1| Chorismate mutase I / Prephenate dehydratase [Thioalkalivibrio
           nitratireducens]
 gi|430010720|gb|AGA33472.1| Chorismate mutase I / Prephenate dehydratase [Thioalkalivibrio
           nitratireducens DSM 14787]
          Length = 360

 Score =  259 bits (663), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 133/351 (37%), Positives = 203/351 (57%), Gaps = 7/351 (1%)

Query: 10  QQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNG 69
           ++ID ID  L++LLNERAR + ++   K G           Y   +E  I  ++   N G
Sbjct: 12  ERIDWIDADLLRLLNERARCAEDVAAVKRGQ-----GNPVFYRPEREAVILRQVRERNPG 66

Query: 70  PLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDI 129
           PL  +++V +++EI+S  ++ ++ L +AY GP G++TH A    FG +   LP ++I+ +
Sbjct: 67  PLPGDAVVRLFREIMSECLALEQPLQVAYLGPEGTFTHLATRKHFGHAATLLPLASIDSV 126

Query: 130 FDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSSI 188
           F  V  G   +G+VP ENST G V  T+D F+     I  E  L + H LLS S +   +
Sbjct: 127 FREVASGRVQFGVVPIENSTEGVVSHTVDCFLESPVLICGEVVLPVQHHLLSSSARLEDV 186

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
             V +HPQ   QC+++LD  L   +R  A S ++AA+ AA  P +A IAS   AE YGLE
Sbjct: 187 RLVMAHPQALAQCRQWLDRRLPGVERRHAPSNARAADDAAGVPGAAVIASEVAAERYGLE 246

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
           +L ++I+D  +N TRF ++G     P+G D+T I+ +  + RPG+L   L    + GI+L
Sbjct: 247 ILARNIEDRGDNTTRFLVIGRIETDPTGRDRTSIMLSTAN-RPGSLFRLLKPIAEAGISL 305

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I+SRPS    W YVFF++L GH++D  +   L ++ E    +KILGSYP
Sbjct: 306 TRIESRPSRCVNWEYVFFLDLIGHQQDPAIAACLEELRESAEMLKILGSYP 356



>gi|492840682|ref|WP_005994636.1| chorismate mutase [Desulfovibrio fructosovorans]
 gi|302490655|gb|EFL50558.1| chorismate mutase [Desulfovibrio fructosovorans JJ]
          Length = 385

 Score =  259 bits (662), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 141/363 (38%), Positives = 206/363 (56%), Gaps = 8/363 (2%)

Query: 1   MENVDLTFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIF 60
           +E   L     ID++D +++ LLN+RA +SL + + K G          V+   +E ++ 
Sbjct: 16  LEEALLELRNGIDAVDGQILTLLNKRAGLSLEVGRRKAGR------QSAVFKPFREQEVM 69

Query: 61  DRIHRLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINY 120
           +R+   N GPL    L++IY+EI+S+S   Q+   +AY GP G+++H AA+   G S ++
Sbjct: 70  ERLAAKNPGPLPVPHLLAIYREILSSSRRLQRPERVAYLGPEGTFSHFAAMAALGHSPDF 129

Query: 121 LPKSTINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL 180
           LP++TI D+F++V       G+VP ENS  G+V  +LD F   +  I AE   R+SH LL
Sbjct: 130 LPQTTIGDVFEAVADRRADLGVVPLENSLQGTVGQSLDHFQRHEVFIQAEISCRVSHALL 189

Query: 181 SKS-KFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASI 239
           S +     I  VYSHPQ   QC  +L +HL  A+ I   ST+ AA   A EP +A+I  +
Sbjct: 190 STAGDIERIETVYSHPQPLAQCAAWLKTHLPGARIIPTDSTAAAALRLAGEPTAASIGHV 249

Query: 240 TCAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLS 299
             A ++GL +L   I+D  +N TRFFI+G    K    DKT +LFTV + +PG+L   LS
Sbjct: 250 RLAAMHGLNILASPIEDMPDNWTRFFIIGPEDTKQQTRDKTSVLFTVPN-KPGSLYQVLS 308

Query: 300 VFKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
                GINL K++SRP   + W YVFF +LQ     E  +K L  + E  L ++ILG YP
Sbjct: 309 HLAGEGINLTKLESRPIRGEKWQYVFFADLQCDLTREEYKKLLATLREQTLSLRILGCYP 368

Query: 360 DQR 362
             R
Sbjct: 369 VGR 371



>gi|470171933|ref|YP_007552819.1| chorismate mutase/prephenate dehydratase [Azoarcus sp. KH32C]
 gi|505250043|ref|WP_015437145.1| chorismate mutase/prephenate dehydratase [Azoarcus sp. KH32C]
 gi|358638546|dbj|BAL25843.1| chorismate mutase/prephenate dehydratase [Azoarcus sp. KH32C]
          Length = 354

 Score =  259 bits (661), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 133/360 (36%), Positives = 208/360 (57%), Gaps = 11/360 (3%)

Query: 1   MENVDLTFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIF 60
           M +  L   ++ID +D +++  L ERA+ +  + + K G+         +Y   +E Q+ 
Sbjct: 1   MSDELLNLRKKIDHLDEEILARLAERAQCAKRIGEVKRGN---------LYRPEREAQVL 51

Query: 61  DRIHRLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINY 120
            R+   N GPL   ++  I++EI+SA ++ +  L +AY GP G+++  A+   FG +   
Sbjct: 52  RRLGEANPGPLPDVAVQRIFREIMSACLALEHPLKVAYLGPAGTFSESASRKHFGSAPTL 111

Query: 121 LPKSTINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL 180
           +P + I+D+F  VE G+  YG+VP ENST G+V  TLD  ++    I  E  LRI   LL
Sbjct: 112 VPTAAIDDVFREVEAGNADYGVVPVENSTEGAVGGTLDLLLANPLMICGEVKLRIHQHLL 171

Query: 181 SKSK-FSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASI 239
           SKS+   +  ++YSH Q   QC ++L+ +L    R+   S ++AA +A+ +  S AIA  
Sbjct: 172 SKSEGIGAAKRLYSHAQSLAQCHEWLNRNLAHLSRVPVASNAEAARLASEDAESCAIAGE 231

Query: 240 TCAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLS 299
              ELYGL VL K+I+D  NN TRF ++      PSG DKT ++ +  + RPGA+   L 
Sbjct: 232 AAGELYGLNVLAKNIEDDPNNTTRFLVIARHDAGPSGRDKTSLVCSAPN-RPGAMHMLLE 290

Query: 300 VFKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
               HG+++ K+ SRP+    W YVF+V+++GH+ED  V  AL ++N+    VKILGSYP
Sbjct: 291 PLARHGVDMTKLQSRPARGGLWEYVFYVDIEGHREDPEVAAALKELNDRAAFVKILGSYP 350



>gi|187734525|ref|YP_001876637.1| chorismate mutase [Akkermansia muciniphila ATCC BAA-835]
 gi|501387505|ref|WP_012419071.1| chorismate mutase [Akkermansia muciniphila]
 gi|187424577|gb|ACD03856.1| chorismate mutase [Akkermansia muciniphila ATCC BAA-835]
          Length = 385

 Score =  259 bits (661), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 131/352 (37%), Positives = 208/352 (59%), Gaps = 11/352 (3%)

Query: 12  IDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGPL 71
           ID +D ++V+LL +RA      E   E           ++V  +E  + ++++RLN G L
Sbjct: 38  IDEVDARIVELLKKRA------EWVHEVGRIKKEKNSPIFVPERETALLNKLNRLNAGVL 91

Query: 72  SSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIFD 131
              SL +IY+EIIS S   +  L+IAY GP G+++HQAA+ +FG S   +P  +  D+FD
Sbjct: 92  PEASLQAIYREIISCSFFLEGGLTIAYLGPKGTWSHQAALKQFGKSCELIPCQSFKDVFD 151

Query: 132 SVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKSKFSSINKV 191
            V++G   YG+VP ENS+ GSV   +D F++    I A+  L I + L++      I  +
Sbjct: 152 MVDRGKAQYGVVPVENSSEGSVTAVMDLFVTSPLKICAQINLNIRNSLMADIPREHIRIL 211

Query: 192 YSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITC---AELYGLE 248
           YSHPQ  GQ + ++  H   A+ ++  ST+KA+ I A E  +   AS+ C   AEL+GL 
Sbjct: 212 YSHPQVLGQTRNWIQRHFPNAELVETSSTTKAS-ILAKENAAMGAASLGCPLAAELFGLN 270

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
           +L +D+QD   N TRF ++G    +PSG D+T +L  + H +PG L + ++ F+ H  NL
Sbjct: 271 ILEEDVQDQSCNTTRFAVIGRQETQPSGRDRTSLLIRIQH-KPGTLAEVVNCFQRHNNNL 329

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYPD 360
           ++I+SRPS    W YVF+++  GH ++  +++ L ++ + C  +KILGSY D
Sbjct: 330 IRIESRPSKVINWEYVFYIDAAGHIQESPLRETLPELEQHCSMLKILGSYAD 381



>gi|39997702|ref|NP_953653.1| chorismate mutase and prephenate dehydratase [Geobacter
           sulfurreducens PCA]
 gi|409913054|ref|YP_006891519.1| chorismate mutase and prephenate dehydratase [Geobacter
           sulfurreducens KN400]
 gi|499245705|ref|WP_010943245.1| prephenate dehydratase [Geobacter sulfurreducens]
 gi|39984594|gb|AAR35980.1| chorismate mutase and prephenate dehydratase [Geobacter
           sulfurreducens PCA]
 gi|298506635|gb|ADI85358.1| chorismate mutase and prephenate dehydratase [Geobacter
           sulfurreducens KN400]
          Length = 358

 Score =  259 bits (661), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 139/358 (38%), Positives = 214/358 (59%), Gaps = 9/358 (2%)

Query: 3   NVDLTFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDR 62
           N+D    ++ID+ID  ++ LLN RA + + + + K             +V  +E +I++R
Sbjct: 6   NLD-ALRREIDAIDDAILDLLNRRAGLVMEVGQVK------TVEKRDFHVPNREREIYER 58

Query: 63  IHRLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLP 122
           +   N GP  +E++ S+++EIISAS++ +  + +A+ GP  ++TH A +  FG +   + 
Sbjct: 59  LLAHNTGPFPAEAVKSVFREIISASLALEAPMKVAFLGPRATFTHLATMQHFGLAAELVA 118

Query: 123 KSTINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSK 182
           + +I  +F+ VEKG   YG+VP ENST G V  TLD F+     I AE  L +SH LLS+
Sbjct: 119 QKSIPAVFEEVEKGRALYGVVPVENSTEGMVSHTLDMFMESDLKINAEVLLEVSHDLLSR 178

Query: 183 S-KFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITC 241
           + +   + KVYSHPQ   QC+K+LD +L     +D  ST+ AA+I + +  +AAIAS   
Sbjct: 179 TGRLDDVKKVYSHPQALAQCRKWLDDNLPGVPVVDVASTALAAQIVSEDYAAAAIASEFA 238

Query: 242 AELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVF 301
           A  Y L+V+   I+D  NN TRF ++G      SG+DKT ++F+V  + PG L   L  F
Sbjct: 239 AAQYDLKVVRTRIEDQVNNFTRFLVIGRKMADRSGDDKTSLMFSVKDE-PGILYRMLEPF 297

Query: 302 KDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
              G+NL KI+SRP  ++ W Y+F+++L GH  D VV +A+  +  +C  VKILGSYP
Sbjct: 298 ASRGVNLSKIESRPLKKKAWEYIFYLDLAGHITDPVVAEAVQDLGRYCQFVKILGSYP 355



>gi|498497129|ref|WP_010797857.1| P-protein [Pseudomonas sp. HPB0071]
 gi|476725996|gb|ENA30788.1| P-protein [Pseudomonas sp. HPB0071]
          Length = 364

 Score =  259 bits (661), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 134/351 (38%), Positives = 209/351 (59%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D ++ +L++ERAR + ++ + K  S          Y   +E Q+  R+   N GP
Sbjct: 12  RIDSLDERIQELISERARCAQDVARVKMQSLGEGESPV-FYRPEREAQVLKRVMERNQGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +AY GP G+++  A +  FG ++   P + I+++F
Sbjct: 71  LGNEDMARLFREIMSSCLALEEPLKVAYLGPEGTFSQAATLKHFGMAVKTRPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDLVICGEVELRIHHHLLVGETTKTDSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           ++VYSH Q   QC+K+LD++    +RI   S ++AA+   SE  SAAIA    A LYGL 
Sbjct: 191 SRVYSHAQSLAQCRKWLDAYFPNIERIAVSSNAEAAKRVKSEWNSAAIAGDMAASLYGLS 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+G+    PSG+DKT ++ +    +PGAL D L  F  + I+L
Sbjct: 251 KLHEKIEDRPDNSTRFLIIGNQEVPPSGDDKTSVIVST-RNKPGALHDLLMPFHANNIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH+ D +++  L KIN   + +K+LGSYP
Sbjct: 310 TRIETRPSRSGKWTYVFFIDFIGHQHDPLIKDVLEKINGDTVALKVLGSYP 360



>gi|498233016|ref|WP_010547172.1| prephenate dehydratase [gamma proteobacterium HIMB30]
          Length = 369

 Score =  259 bits (661), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 127/359 (35%), Positives = 210/359 (58%), Gaps = 6/359 (1%)

Query: 6   LTFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHR 65
           L   ++ID+ID ++ +L+N RA  ++ + + K+            Y   +E Q+  R+  
Sbjct: 8   LKIREEIDAIDQQIQELINARADCAMRVAEVKQAEMATSGEVPVYYRPEREAQVLARVME 67

Query: 66  LNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKST 125
            N GPL  E +  I++EI+S  ++ ++ L++ Y GP+G++T  AA+  FG +++  P +T
Sbjct: 68  RNQGPLPKEEVARIFREIMSGCLALERPLAVGYLGPMGTFTETAALKHFGHAVDTRPLTT 127

Query: 126 INDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSK--S 183
           I+D+F  V+ G+  YG+VP ENST G V  TL+ F+     I  E  +RI   L+ K  +
Sbjct: 128 ISDVFRDVDAGNLDYGVVPIENSTEGMVTHTLECFLDSPLVICGEVEMRIHQALMVKQGT 187

Query: 184 KFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYS---AAIASIT 240
             S++  ++SH Q   QC+ +LD++   A R    S ++AA + +    S   AA+A   
Sbjct: 188 DLSAVKTIFSHQQSLAQCRLWLDANCPNATRETVSSNAEAARLVSESSPSDGIAAVAGER 247

Query: 241 CAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSV 300
            AE YGL +L   I+D  +N TRF ++G  + +PSG DKT ++ +V ++ PGAL   L  
Sbjct: 248 AAETYGLALLAGSIEDRPDNTTRFLVIGKQTTEPSGRDKTSLIVSVKNE-PGALYRLLEP 306

Query: 301 FKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           F+ HGI++ +++SRPS    W Y FF++ +GH +D  +QK L++I     ++KILGSYP
Sbjct: 307 FEQHGIDMTRLESRPSHSGIWSYRFFIDFKGHVDDVPIQKFLDEIRAQSAELKILGSYP 365



>gi|152989646|ref|YP_001347344.1| chorismate mutase [Pseudomonas aeruginosa PA7]
 gi|489243200|ref|WP_003151401.1| prephenate dehydratase [Pseudomonas aeruginosa]
 gi|150964804|gb|ABR86829.1| chorismate mutase [Pseudomonas aeruginosa PA7]
 gi|452185818|gb|EME12836.1| chorismate mutase [Pseudomonas aeruginosa VRFPA01]
          Length = 365

 Score =  259 bits (661), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 132/351 (37%), Positives = 212/351 (60%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D KL++L++ERAR + ++ + K  +          Y   +E  +   I +LN GP
Sbjct: 13  RIDSLDEKLLELISERARCAQDVARVKTQTLGEGEAPV-FYRPEREAWVLKHIMQLNKGP 71

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ ++ L +A+ GP G++T  AA+  FG+++   P + I+++F
Sbjct: 72  LDNEEVARLFREIMSSCLALEQPLKVAFLGPEGTFTQAAALKHFGNAVISTPMAAIDEVF 131

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  +I
Sbjct: 132 REVAAGAVNFGVVPVENSTEGAVNHTLDSFLEHDMVICGEVELRIHHHLLVGETTKTDNI 191

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LDSH    +R+   S + AA+   SE  SAAIA    A LY L 
Sbjct: 192 TRIYSHAQSLAQCRKWLDSHYPNVERVAVPSNADAAKRVKSEWNSAAIAGDMAASLYDLS 251

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+G+    P+G+DKT I+ ++   +PGAL + L  F ++GI+L
Sbjct: 252 KLHEKIEDRPDNSTRFLIIGNQEVPPTGDDKTSIIVSM-RNKPGALHELLVPFHNNGIDL 310

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH ++ +++  L KI +  + +K+LGSYP
Sbjct: 311 TRIETRPSRSGKWTYVFFIDFVGHHKEPLIKDVLEKIGQEAVALKVLGSYP 361



>gi|496396923|ref|WP_009105913.1| chorismate mutase [Desulfovibrio sp. U5L]
 gi|385731693|gb|EIG51891.1| prephenate dehydratase [Desulfovibrio sp. U5L]
          Length = 396

 Score =  259 bits (661), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 144/363 (39%), Positives = 205/363 (56%), Gaps = 8/363 (2%)

Query: 1   MENVDLTFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIF 60
           +E   L   + ID+ D  +++LLN RA  SL + + K+G          ++   +E ++ 
Sbjct: 27  LEEALLDLRRGIDATDDAILELLNRRAAYSLEVGRRKDGR------DSAIFKPFREQEVL 80

Query: 61  DRIHRLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINY 120
           DR+   N GPL +  L+SIY+EI+S+S   Q+   +AY GP G+++H AA+   G S ++
Sbjct: 81  DRLTEKNPGPLPAAHLLSIYREILSSSRRLQRPERVAYLGPEGTFSHFAAMAALGHSPDF 140

Query: 121 LPKSTINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL 180
           LP+ TI D+F +V       G+VP ENS  G+V  +LD F      I AE   R+SH LL
Sbjct: 141 LPQPTIGDVFAAVAAKQADLGVVPLENSLQGTVGQSLDNFQRHAVFIQAEISCRVSHALL 200

Query: 181 SKSK-FSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASI 239
           S +    ++  VYSHPQ   QC  +L +HL  A+ I   ST+ AA   A+EP++A+I  +
Sbjct: 201 STAADLGAVKTVYSHPQPLAQCAAWLKTHLPRARVIPTDSTAAAAARLAAEPHAASIGHV 260

Query: 240 TCAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLS 299
             A ++GL VL   I+D  +N TRFFI+G    K    DKT ILFTV + RPGAL   LS
Sbjct: 261 KLAAMHGLNVLASPIEDLPDNWTRFFIIGPEDTKQQTRDKTSILFTVPN-RPGALYQVLS 319

Query: 300 VFKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
                GINL K++SRP   + W YVFF +LQ     E  +K L  + E    ++ILG YP
Sbjct: 320 HLAGEGINLTKLESRPIRGEKWQYVFFADLQCDITREEYKKLLATLKEQTHSLRILGCYP 379

Query: 360 DQR 362
             R
Sbjct: 380 AGR 382



>gi|491086245|ref|WP_004947859.1| chorismate mutase [Acinetobacter soli]
 gi|480019111|gb|ENV60139.1| chorismate mutase [Acinetobacter soli NIPH 2899]
          Length = 369

 Score =  259 bits (661), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 134/352 (38%), Positives = 210/352 (59%), Gaps = 7/352 (1%)

Query: 10  QQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNG 69
           QQIDS+D ++  L+N RA+++  + KAK  S          Y   +E Q+  ++   N G
Sbjct: 19  QQIDSVDQQIQSLINRRAKLAEAVAKAKFAS----EENPLFYRPEREAQVLRKVMERNEG 74

Query: 70  PLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDI 129
           PLS  ++  +++EI+SA ++ +   SIA+ GP G++T  AA+  FG+     P  TI+++
Sbjct: 75  PLSDVTMARLFREIMSACLALEAPQSIAFLGPEGTFTQAAALKHFGNDAVVRPLPTIDEV 134

Query: 130 FDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSS 187
           F  VE G   YG+VP ENS+ G V  TLD F + + +++ E  LRI H  L    ++  S
Sbjct: 135 FREVEAGSAHYGVVPVENSSEGVVNHTLDCFKTSQLNVIGEVELRIHHQFLVSKNTRKDS 194

Query: 188 INKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGL 247
           I ++Y+H Q   QC+++LD+H    +R+   S ++AA    +E +S AIAS   A +Y L
Sbjct: 195 IKQIYAHQQTLAQCRQWLDAHYPGVERVALNSNAEAARRIRNEWHSGAIASDIAASMYDL 254

Query: 248 EVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGIN 307
           E+  ++I+D   N TRF ++G      SGNDKT +L +  H R GAL + L+ F  H I+
Sbjct: 255 EIFHRNIEDNPENTTRFLVIGREKIPQSGNDKTSLLISA-HDRAGALLEILAPFAKHQIS 313

Query: 308 LLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           L  I++RP+  + W YVFF++L+GH + E V KAL++I     +++ILGSYP
Sbjct: 314 LTSIETRPALPEKWAYVFFIDLEGHIDQENVAKALDEIRPLVKELRILGSYP 365



>gi|491239238|ref|WP_005097461.1| chorismate mutase [Acinetobacter lwoffii]
 gi|480085128|gb|ENW23605.1| chorismate mutase [Acinetobacter lwoffii NCTC 5866 = CIP 64.10]
          Length = 369

 Score =  258 bits (660), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 134/352 (38%), Positives = 207/352 (58%), Gaps = 7/352 (1%)

Query: 10  QQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNG 69
           + IDS+D ++ QL+N RAR++  + KAK  S          Y   +E Q+   +   N G
Sbjct: 19  EDIDSVDQQIQQLINRRARLAEAVAKAKFAS----EESPLFYRPEREAQVLRNVMERNEG 74

Query: 70  PLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDI 129
           PLS  ++  +++EI+SA ++ +   SIA+ GP+G+YTH A +  FG      P  TI+++
Sbjct: 75  PLSDTTMARLFREIMSACLALEAPQSIAFLGPVGTYTHSAVLKHFGHDAVVRPLPTIDEV 134

Query: 130 FDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSS 187
           F  VE G   YG+VP ENS+ G V  TLD F +   +++ E  L I H  L    ++  S
Sbjct: 135 FREVEAGSAHYGLVPVENSSEGVVNHTLDCFKTSNLNVIGEVELPIHHQFLISENTRKDS 194

Query: 188 INKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGL 247
           I ++Y+H Q   QC+K+LD+H    +R+   S ++AA    +E +SAAIAS   + +Y L
Sbjct: 195 IKQIYAHQQTLAQCRKWLDAHYPGVERVALSSNAEAARRIQNEWHSAAIASEIASSIYNL 254

Query: 248 EVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGIN 307
           E++  +I+D   N TRF ++G      SGNDKT +L +  H R GAL + L+ F  H I+
Sbjct: 255 EIMHGNIEDNPENTTRFLVIGREKVPQSGNDKTSLLISA-HDRAGALLEILAPFAKHNIS 313

Query: 308 LLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           L  I++RP+  + W YVFF++L+GH E E V+ A+ +I     +V++LGSYP
Sbjct: 314 LTSIETRPALPEKWAYVFFIDLEGHIEQEHVKAAIAEIRPLVKEVRVLGSYP 365



>gi|491312251|ref|WP_005170229.1| chorismate mutase [Acinetobacter sp. NIPH 713]
 gi|480150623|gb|ENW87609.1| chorismate mutase [Acinetobacter sp. NIPH 713]
          Length = 369

 Score =  258 bits (660), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 134/352 (38%), Positives = 207/352 (58%), Gaps = 7/352 (1%)

Query: 10  QQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNG 69
           + IDS+D ++ QL+N RAR++  + KAK  S          Y   +E Q+   +   N G
Sbjct: 19  EDIDSVDQQIQQLINRRARLAEAVAKAKFAS----EESPLFYRPEREAQVLRNVMERNEG 74

Query: 70  PLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDI 129
           PLS  ++  +++EI+SA ++ +   SIA+ GP+G+YTH A +  FG      P  TI+++
Sbjct: 75  PLSDTTMARLFREIMSACLALEAPQSIAFLGPVGTYTHSAVLKHFGHDAVVRPLPTIDEV 134

Query: 130 FDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSS 187
           F  VE G   YG+VP ENS+ G V  TLD F +   +++ E  L I H  L    ++  S
Sbjct: 135 FREVEAGSAHYGLVPVENSSEGVVNHTLDCFKTSNLNVIGEVELPIHHQFLISENTRKDS 194

Query: 188 INKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGL 247
           I ++Y+H Q   QC+K+LD+H    +R+   S ++AA    +E +SAAIAS   + +Y L
Sbjct: 195 IKQIYAHQQTLAQCRKWLDAHYPGVERVALNSNAEAARRIQNEWHSAAIASEIASSIYNL 254

Query: 248 EVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGIN 307
           E++  +I+D   N TRF ++G      SGNDKT +L +  H R GAL + L+ F  H I+
Sbjct: 255 EIMHGNIEDNPENTTRFLVIGREKVPQSGNDKTSLLISA-HDRAGALLEILAPFAKHNIS 313

Query: 308 LLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           L  I++RP+  + W YVFF++L+GH E E V+ A+ +I     +V++LGSYP
Sbjct: 314 LTSIETRPALPEKWAYVFFIDLEGHIEQEHVKAAIAEIRPLVKEVRVLGSYP 365



>gi|492845594|ref|WP_005999548.1| prephenate dehydratase [Desulfuromonas acetoxidans]
 gi|95134613|gb|EAT16269.1| chorismate mutase [Desulfuromonas acetoxidans DSM 684]
          Length = 356

 Score =  258 bits (660), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 140/354 (39%), Positives = 219/354 (61%), Gaps = 8/354 (2%)

Query: 7   TFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRL 66
              ++ID++D +++ LLNERA+V L++ K K+GS          YV  +E  I++R+ + 
Sbjct: 7   ALREKIDTLDDQILDLLNERAKVVLDVGKTKQGS------KSAYYVPSREQAIYERLRQH 60

Query: 67  NNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTI 126
           N GP  S+++  +++EIISAS++ ++ + +A+ GP  ++TH AA+ +FG S   +P+ +I
Sbjct: 61  NPGPFPSDAIQRVFREIISASLALEQPMKVAFLGPQATFTHVAAMQQFGLSAQLVPQKSI 120

Query: 127 NDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KF 185
           + +FD V +G   YG+VP ENS  G V  TLD F+     I AE    ISH LLS S + 
Sbjct: 121 SAVFDEVARGRANYGVVPVENSNEGVVTHTLDMFMESGLKIYAEILQEISHDLLSLSARM 180

Query: 186 SSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELY 245
           S I +VYSHPQ   QC+K+L+ +L +   ID  ST+ AA++AA +  +AAIAS      Y
Sbjct: 181 SDIERVYSHPQALAQCRKWLEENLPDVPLIDVASTAAAAQLAAGDRSAAAIASAAAGAQY 240

Query: 246 GLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHG 305
            L  +  +I D  +N TRF ++ +    P G+DKT ILF +  + PG L   L  F    
Sbjct: 241 DLRQVKANIADNPSNFTRFLVISNQIPAPGGHDKTSILFLIKDE-PGILLRMLEPFSKRS 299

Query: 306 INLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           INL KI+SRP  ++ W Y+FF++++GH E   V+ A++++ ++C  +K+LGSYP
Sbjct: 300 INLSKIESRPLKKRAWEYIFFLDIEGHIETPAVRDAVDELGDYCQFIKVLGSYP 353



>gi|319787317|ref|YP_004146792.1| chorismate mutase [Pseudoxanthomonas suwonensis 11-1]
 gi|503300728|ref|WP_013535389.1| prephenate dehydratase [Pseudoxanthomonas suwonensis]
 gi|317465829|gb|ADV27561.1| chorismate mutase [Pseudoxanthomonas suwonensis 11-1]
          Length = 392

 Score =  258 bits (660), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 141/355 (39%), Positives = 213/355 (60%), Gaps = 7/355 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           QIDSID  + +L+ ERAR +L + KAK             Y   +E Q+   +   N GP
Sbjct: 43  QIDSIDRHIQELIAERARFALQVGKAK----GKLAAAVDYYRPEREAQVLRMVVDRNEGP 98

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS E LV +++EI+SA ++ Q+ L I Y GP G+++ QA +  FG S + LP  +I ++F
Sbjct: 99  LSDEVLVHVFREIMSACLAQQEPLKIGYLGPEGTFSQQAVLKHFGRSAHGLPLGSIEEVF 158

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSSIN 189
             V+ G+  +G+VP ENS  G++  TLD F++    I  E  L++   LLS+S +   I 
Sbjct: 159 QEVDAGNADFGVVPVENSGQGTIQVTLDMFLTSPLKICGEVELKVHQYLLSRSGRIEDIE 218

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGL-E 248
           ++Y+HPQ F Q   +L ++L + ++I   S ++ A  A     +AAIA  + A +YGL +
Sbjct: 219 RIYAHPQAFAQTAGWLRANLPKVEKIPVSSNAEGARRARGADDAAAIAGESAAHVYGLKK 278

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
           V+ + IQD ++N TRF ++G     PSG+D+T IL  + H +PGAL D LS F  HGI++
Sbjct: 279 VIMQPIQDDRDNTTRFLVIGRRLFPPSGHDRTSILVFI-HDKPGALFDVLSPFARHGISM 337

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYPDQRP 363
            +I+SRPS Q  W Y FF++L GH EDE +++AL  + +    VK+LGSYP   P
Sbjct: 338 NRIESRPSHQAKWEYAFFIDLAGHVEDEAMKQALADLEQHVAKVKVLGSYPVAVP 392



>gi|493496499|ref|WP_006451090.1| prephenate dehydratase [Xanthomonas gardneri]
 gi|325547530|gb|EGD18579.1| chorismate mutase ;prephenate dehydratase [Xanthomonas gardneri
           ATCC 19865]
          Length = 399

 Score =  258 bits (660), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 206/351 (58%), Gaps = 7/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID ID  + +L+ ERA  +  + KAK             Y   +E Q+   +   N GP
Sbjct: 50  KIDQIDRTIQELIAERANFAHQVGKAK----GKLAAAVDYYRPEREAQVLRMVVDRNEGP 105

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS E LV +Y+EI+SA ++ Q+ L I Y GP G+++ QA +  FG S   LP +TI ++F
Sbjct: 106 LSDEVLVHVYREIMSACLAQQEPLKIGYLGPEGTFSQQAVLKHFGRSAVGLPMATIEEVF 165

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSSIN 189
             VE G+  +G+VP ENS  G++  TLD F++    I  E  LR+   LLS++ +   I 
Sbjct: 166 QEVEAGNADFGVVPVENSGQGTIQVTLDMFLTSNLKICGEVELRVHQYLLSRTGRIEDIE 225

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE- 248
           ++Y+H Q F Q   +L SHL + +++   S ++ A  A +   +AAI   + A +YGL+ 
Sbjct: 226 RIYAHSQSFAQTAGWLRSHLPKVEKLAVSSNAEGARRARNAEDAAAIGGESAAHVYGLKK 285

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
           V+ K I+D  +N TRF ++G      SG+D+T +L  + H +PGAL D LS F  HGI++
Sbjct: 286 VIMKSIEDDDDNTTRFLVIGRQIFPSSGHDRTSVLVFI-HDKPGALFDVLSPFARHGISM 344

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I+SRPS Q  W Y FF++L GH EDE +++AL ++      +K+LGSYP
Sbjct: 345 NRIESRPSHQAKWEYGFFIDLAGHVEDEAMKQALAELEAHSAQIKVLGSYP 395



>gi|491128477|ref|WP_004986906.1| prephenate dehydratase [Acinetobacter ursingii]
 gi|480037582|gb|ENV77321.1| chorismate mutase [Acinetobacter ursingii DSM 16037 = CIP 107286]
          Length = 369

 Score =  258 bits (659), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 135/350 (38%), Positives = 207/350 (59%), Gaps = 7/350 (2%)

Query: 12  IDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGPL 71
           IDS+D ++ +L+N RA ++  + KAK  +          Y   +E Q+  R+   N GPL
Sbjct: 21  IDSVDQQIQELINRRASLAEAVAKAKFAA----EENPLFYRPEREAQVLRRVMERNKGPL 76

Query: 72  SSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIFD 131
           S  ++  +++EI+SA ++ +   SIA+ GP G++T  A +  FG      P  TI+++F 
Sbjct: 77  SDTTMARLFREIMSACLALEAPQSIAFLGPEGTFTQSAVLKHFGKDAIVRPLPTIDEVFR 136

Query: 132 SVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSIN 189
            VE G   YG+VP ENS+ G V  TLD F + + +++ E  LRI H  L    ++  SI 
Sbjct: 137 EVEAGSAHYGVVPVENSSEGIVNHTLDCFKTSQLNVIGEVELRIHHQFLVSENTRKDSIK 196

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLEV 249
           ++Y+H Q   QC+++LD+H    +R+   S ++AA    +E +SAAIAS   A LY LE+
Sbjct: 197 QIYAHQQTLAQCRQWLDAHYPGVERVALNSNAEAARRIRNEWHSAAIASDLAASLYNLEI 256

Query: 250 LGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINLL 309
           L  +I+D   N TRF ++G      SGNDKT +L +  H R GAL D L+ F  HGI+L 
Sbjct: 257 LHSNIEDNPENTTRFLVIGREKIPQSGNDKTSLLISA-HDRAGALLDILAPFAKHGISLT 315

Query: 310 KIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            I++RP+  + W YVFF++L+GH + E V+ ALN I     ++++LGSYP
Sbjct: 316 SIETRPALPEKWAYVFFIDLEGHIDQENVKAALNDIRPTVKELRVLGSYP 365



>gi|489555252|ref|WP_003459835.1| prephenate dehydratase [Pseudomonas pseudoalcaligenes]
 gi|399112035|emb|CCH37380.1| pheA [Pseudomonas pseudoalcaligenes CECT 5344]
          Length = 368

 Score =  258 bits (659), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 130/356 (36%), Positives = 211/356 (59%), Gaps = 14/356 (3%)

Query: 11  QIDSIDTKLVQLLNERARVS-----LNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHR 65
           +ID++D ++++L+++RAR +     + +++ KEG           Y   +E Q+  RI  
Sbjct: 16  RIDNLDERILELISDRARCAEEVARVKMKELKEGE------SPVFYRPEREAQVLKRIME 69

Query: 66  LNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKST 125
            N GPL +E +  +++EI+S+ ++ +  L +AY GP G+++  AA+  FG ++  +P + 
Sbjct: 70  RNKGPLGNEEMARLFREIMSSCLALENPLKVAYLGPEGTFSQAAAMKHFGHAVISVPMAA 129

Query: 126 INDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKS 183
           I+++F  V  G   +G+VP ENST G++  TLD F+     I  E  LRI H LL    +
Sbjct: 130 IDEVFREVAAGAVNFGVVPVENSTEGAINHTLDSFLEHDMVICGEVELRIHHHLLVGETT 189

Query: 184 KFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAE 243
           K   I ++YSH Q   QC+K+LD+H    +R+   S + AA    SE  SAAIA    A 
Sbjct: 190 KTDKITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAARRVKSEWNSAAIAGDMAAN 249

Query: 244 LYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKD 303
           LYGL  L + I+D  +N TRF I+G+    P+G+DKT I+ ++   +PGAL + L  F +
Sbjct: 250 LYGLTKLAEKIEDRPDNSTRFLIIGNQEVPPTGDDKTSIIVSM-RNKPGALHELLVPFHN 308

Query: 304 HGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           +GI+L +I++RPS    W YVFF++  GH  D +++  L K+ +  + +K+LGSYP
Sbjct: 309 NGIDLTRIETRPSRSGKWTYVFFIDFVGHHRDPLIKDVLEKLAQEAVALKVLGSYP 364



>gi|53804245|ref|YP_113875.1| chorismate mutase/prephenate dehydratase [Methylococcus capsulatus
           str. Bath]
 gi|499263154|ref|WP_010960694.1| prephenate dehydratase [Methylococcus capsulatus]
 gi|53758006|gb|AAU92297.1| chorismate mutase/prephenate dehydratase [Methylococcus capsulatus
           str. Bath]
          Length = 362

 Score =  258 bits (658), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 134/354 (37%), Positives = 209/354 (59%), Gaps = 7/354 (1%)

Query: 8   FSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLN 67
             ++ID +D ++++LLN+RAR +  +   K  +          Y   +E +I  R+   N
Sbjct: 10  LRKRIDELDDRVLELLNQRARCAQRVADIKVAA----GETDCFYRPEREAEILQRLTAHN 65

Query: 68  NGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTIN 127
            GPL  E++V  ++E++S  ++ +K LS+A+ GP G++T QAA   FG +I  +P   I+
Sbjct: 66  PGPLGREAVVRFFREVMSECLALEKPLSVAFLGPEGTFTQQAAYRHFGHAIQAVPMPAID 125

Query: 128 DIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKSK--F 185
           +IF +VE G   YG+VP ENST G +  TLD F+     I  E  LRI H LL ++    
Sbjct: 126 EIFRAVESGACHYGVVPVENSTEGVITHTLDSFVRFSLIIAGEVQLRIHHNLLCRTPTAL 185

Query: 186 SSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELY 245
           + + +V+SHPQ   QC+ +LD  L   +R    S ++AA  AA    +AAIA    A LY
Sbjct: 186 TELTEVFSHPQSLAQCRGWLDRFLPGVRRTPLGSNAEAARRAAETAGTAAIAGEVAAGLY 245

Query: 246 GLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHG 305
           GLE+L ++I+D  +N TRF ++G     P+G+DKT +L +  +  PGAL   +  F   G
Sbjct: 246 GLEILNRNIEDEPDNTTRFLVIGGQPVGPTGHDKTSLLLSTRND-PGALFRLIEPFARLG 304

Query: 306 INLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           I++ KI+SRPS +  W Y FF++++GH+ D  + +AL ++ E C  ++ILGSYP
Sbjct: 305 ISMTKIESRPSRRGMWDYFFFIDVEGHQADPTLAQALAEVREHCCMMRILGSYP 358



>gi|330502870|ref|YP_004379739.1| prephenate dehydratase [Pseudomonas mendocina NK-01]
 gi|503480423|ref|WP_013715084.1| prephenate dehydratase [Pseudomonas mendocina]
 gi|328917156|gb|AEB57987.1| prephenate dehydratase [Pseudomonas mendocina NK-01]
          Length = 364

 Score =  258 bits (658), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 129/356 (36%), Positives = 212/356 (59%), Gaps = 14/356 (3%)

Query: 11  QIDSIDTKLVQLLNERARVS-----LNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHR 65
           +ID++D ++++L+++RAR +     + +++ KEG           Y   +E Q+  R+  
Sbjct: 12  RIDNLDERILELISDRARCAEEVARVKMKELKEGE------SPVFYRPEREAQVLKRVME 65

Query: 66  LNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKST 125
            N GPL +E +  +++EI+S+ ++ +  L +AY GP G+++  AA+  FG ++  +P + 
Sbjct: 66  RNQGPLGNEEMARLFREIMSSCLALENPLKVAYLGPEGTFSQAAAMKHFGHAVISVPMAA 125

Query: 126 INDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKS 183
           I+++F  V  G   +G+VP ENST G++  TLD F+     I  E  LRI H LL    +
Sbjct: 126 IDEVFREVAAGAVNFGVVPVENSTEGAINHTLDSFLEHDMVICGEVELRIHHHLLVGETT 185

Query: 184 KFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAE 243
           +   I ++YSH Q   QC+K+LD+H    +R+   S + AA+   SE  SAAIA    A 
Sbjct: 186 QTDKITRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAAKRVKSEWNSAAIAGDMAAN 245

Query: 244 LYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKD 303
           LYGL  L + I+D  +N TRF I+GS    P+G+DKT I+ ++   +PGAL + L  F +
Sbjct: 246 LYGLTKLAEKIEDRPDNSTRFLIIGSQEVPPTGDDKTSIIVSM-RNKPGALHELLVPFHN 304

Query: 304 HGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           +GI+L +I++RPS    W YVFF++  GH  D +++  L K+ +  + +K+LGSYP
Sbjct: 305 NGIDLTRIETRPSRSGKWTYVFFIDFIGHHRDPLIKDVLEKLAQEAVALKVLGSYP 360



>gi|491138341|ref|WP_004996757.1| chorismate mutase [Acinetobacter ursingii]
 gi|480213795|gb|ENX49467.1| chorismate mutase [Acinetobacter ursingii NIPH 706]
          Length = 369

 Score =  257 bits (657), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 135/350 (38%), Positives = 206/350 (58%), Gaps = 7/350 (2%)

Query: 12  IDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGPL 71
           IDS+D ++ +L+N RA ++  + KAK  +          Y   +E Q+  R+   N GPL
Sbjct: 21  IDSVDQQIQELINRRASLAEAVAKAKFAA----EENPLFYRPEREAQVLRRVMERNKGPL 76

Query: 72  SSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIFD 131
           S  ++  +++EI+SA ++ +   SIA+ GP G++T  A +  FG      P  TI+++F 
Sbjct: 77  SDTTMARLFREIMSACLALEAPQSIAFLGPEGTFTQSAVLKHFGKDAIVRPLPTIDEVFR 136

Query: 132 SVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSIN 189
            VE G   YG+VP ENS+ G V  TLD F + + +++ E  LRI H  L    ++  SI 
Sbjct: 137 EVEAGSAHYGVVPVENSSEGIVNHTLDCFKTSQLNVIGEVELRIHHQFLVSENTRKDSIK 196

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLEV 249
           ++Y+H Q   QC+++LD+H    +R+   S ++AA    +E +SAAIAS   A LY LE+
Sbjct: 197 QIYAHQQTLAQCRQWLDAHYPGVERVALNSNAEAARRIRNEWHSAAIASDLAASLYNLEI 256

Query: 250 LGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINLL 309
           L  +I+D   N TRF ++G      SGNDKT +L +  H R GAL D L+ F  HGI+L 
Sbjct: 257 LHSNIEDNPENTTRFLVIGREKIPQSGNDKTSLLISA-HDRAGALLDILAPFAKHGISLT 315

Query: 310 KIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            I++RP+  + W YVFF++L+GH + E V  ALN I     ++++LGSYP
Sbjct: 316 SIETRPALPEKWAYVFFIDLEGHIDQENVTAALNDIRPTVKELRVLGSYP 365



>gi|262199994|ref|YP_003271203.1| chorismate mutase [Haliangium ochraceum DSM 14365]
 gi|502594350|ref|WP_012831902.1| chorismate mutase [Haliangium ochraceum]
 gi|262083341|gb|ACY19310.1| chorismate mutase [Haliangium ochraceum DSM 14365]
          Length = 397

 Score =  257 bits (657), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 135/361 (37%), Positives = 205/361 (56%), Gaps = 17/361 (4%)

Query: 8   FSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLN 67
             ++ID +D +LV LLNERA V + + + K  S         +Y   +E Q+  R    N
Sbjct: 39  LRRRIDELDARLVALLNERAAVVVEVGQLKRSS------DVPIYAPHREAQVLGRALAAN 92

Query: 68  NGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTIN 127
            GPL + ++  +++E++S S + ++ L I Y GP G+++H AA  +FG S+ ++    I 
Sbjct: 93  RGPLPARTIEGVFRELMSGSFALERPLRIGYLGPPGTFSHAAATAQFGSSVEFVDVHAIG 152

Query: 128 DIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRF--ISCKTHILAETYLRISHCLLSKSKF 185
            +FD+V + H  YG+VP ENST G +   LD F  ++ +  I AE  + +SH L++    
Sbjct: 153 AVFDAVSREHVDYGVVPIENSTGGGIAECLDAFLEVANQVTIYAEVLVAVSHNLIANCAP 212

Query: 186 SSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASE----P--YSAAIASI 239
             I  +YS P+ F QC ++L      A+++ A S+S+AAEIAA E    P   +AAI S 
Sbjct: 213 DQIQTIYSKPEIFTQCARWLAHQYPHARQVPAPSSSRAAEIAAQEIERDPGCGAAAIGST 272

Query: 240 TCAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILF-TVDHQRPGALCDGL 298
             A+++GL +L  DI+D   NVTRFF++   +   SG+DKT I+F T D   PGAL   L
Sbjct: 273 LAAQIHGLNLLYADIEDNPQNVTRFFVIAREAAASSGDDKTSIMFRTADS--PGALVRVL 330

Query: 299 SVFKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSY 358
           S+F   G+NL  ID RPS +  W Y FF++  GH +D  +   + +    C D  +LGSY
Sbjct: 331 SIFDRAGVNLTHIDKRPSRRTNWDYTFFIDADGHLDDPKLAHVIREAGAHCRDFTVLGSY 390

Query: 359 P 359
           P
Sbjct: 391 P 391



>gi|285018478|ref|YP_003376189.1| chorismate mutase prephenate dehydratase [Xanthomonas albilineans
           GPE PC73]
 gi|502680551|ref|WP_012916200.1| prephenate dehydratase [Xanthomonas albilineans]
 gi|283473696|emb|CBA16199.1| putative chorismate-mutase_prephenate_dehydratase protein
           [Xanthomonas albilineans GPE PC73]
          Length = 387

 Score =  257 bits (657), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 135/355 (38%), Positives = 211/355 (59%), Gaps = 7/355 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID ID  +  L+ ERA+ +  +  AK             Y   +E Q+   +   N GP
Sbjct: 38  KIDEIDRTIQALIAERAQFARQVGLAK----GKLAAAVDYYRPEREAQVLRMVVDRNQGP 93

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS E LV +++EI+SA ++ Q+ L + Y GP G+++ QA +  FG S   +P ++I ++F
Sbjct: 94  LSDEVLVHVFREIMSACLAQQEPLKVGYLGPEGTFSQQAVLKHFGRSAVGMPMASIEEVF 153

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSSIN 189
             VE G+  +G+VP ENS  G++  TLD FI+ K  I  ET LR+   LLS+S +  +I 
Sbjct: 154 QEVENGNADFGVVPVENSGQGTIQVTLDMFITSKLKICGETELRVHQFLLSRSGRLDAIE 213

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGL-E 248
           ++Y+HPQ F Q   +L +HL + ++I   S ++ A  A +   +AAI   + A++Y L +
Sbjct: 214 RIYAHPQAFAQTAGWLRAHLPKVEKIPVSSNAEGARRARNADDAAAIGGESAAQVYALKK 273

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
           V+ K I+D  +N TRF ++G     PSG+D+T +L  + H +PGAL D LS F  HGI++
Sbjct: 274 VVTKSIEDDADNTTRFLVIGRKIFPPSGHDRTSVLVFI-HDKPGALFDVLSPFARHGISM 332

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYPDQRP 363
            +I+SRPS Q  W Y FF++L GH EDE +++AL ++      +K+LG+YP   P
Sbjct: 333 NRIESRPSHQGKWEYGFFIDLAGHVEDEAMKQALAELKAHSAQIKVLGAYPVSVP 387



>gi|333900210|ref|YP_004474083.1| chorismate mutase [Pseudomonas fulva 12-X]
 gi|503557044|ref|WP_013791120.1| prephenate dehydratase [Pseudomonas fulva]
 gi|333115475|gb|AEF21989.1| chorismate mutase [Pseudomonas fulva 12-X]
          Length = 369

 Score =  257 bits (656), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 130/351 (37%), Positives = 205/351 (58%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D K+++L+++RAR +  + + K  S          Y   +E Q+  R+   N GP
Sbjct: 17  RIDSLDEKILELISDRARCAEEVARVKMASLPEGEVPV-FYRPEREAQVLKRVMERNRGP 75

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L +E +  +++EI+S+ ++ +  L +AY GP G+++  AA+  FG ++   P + I+++F
Sbjct: 76  LGNEEMARLFREIMSSCLALENPLKVAYLGPEGTFSQAAAMKHFGHAVISQPMAAIDEVF 135

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G   +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K   I
Sbjct: 136 REVVAGAVNFGVVPVENSTEGAVNHTLDSFLEHDLVICGEVELRIHHHLLVGDATKTDRI 195

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LD+H    +R+   S + AA    SE  SAAIA    A LY L 
Sbjct: 196 TRIYSHAQSLAQCRKWLDAHYPNVERVAVSSNADAARRVKSEWNSAAIAGDMAANLYDLT 255

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            L + I+D  +N TRF I+G+    P+G+DKT ++ ++   +PGAL + L  F  +GI+L
Sbjct: 256 RLAEKIEDRPDNSTRFLIIGNQQVPPTGDDKTSVIVSM-RNKPGALHELLVPFHQNGIDL 314

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W Y FF++  GH  D +++  L KIN+  + +K+LGSYP
Sbjct: 315 TRIETRPSRSGKWTYAFFIDFVGHHRDPLIKDVLEKINQEAVALKVLGSYP 365



>gi|489091170|ref|WP_003001065.1| chorismate mutase [Leptospira weilii]
 gi|476505908|gb|EMY78083.1| chorismate mutase [Leptospira weilii serovar Ranarum str. ICFT]
          Length = 363

 Score =  256 bits (655), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 137/354 (38%), Positives = 215/354 (60%), Gaps = 9/354 (2%)

Query: 8   FSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLN 67
           F  QIDS+D ++V+ +  RA  +  + + K            V+   +E +++++I  L+
Sbjct: 11  FRDQIDSLDREIVKSIQTRAEFASKIGEIKR------ERNEPVFRPDREKEVYEKIKSLS 64

Query: 68  NGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTIN 127
            GPL  + L++IY+EI+S S+S +K L + Y GP GS+++QA   RFG SIN L  ++I 
Sbjct: 65  EGPLPDKVLLAIYREIMSGSISVEKGLEVGYLGPAGSFSNQAVRARFGASINALEFNSIP 124

Query: 128 DIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLS-KSKFS 186
           D+F +VE     YG+VP ENS+ G V +TLD+F+     I +E YLRI+  LL  +   S
Sbjct: 125 DVFRAVETDKIDYGVVPVENSSEGLVNSTLDQFLISDLLIYSEHYLRINISLLGFEHDLS 184

Query: 187 SINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYS-AAIASITCAELY 245
            I  +Y       QC+ +L ++L   + ++  ST+KAA+I A +  + AA+AS   AE+Y
Sbjct: 185 KIKTLYGIKIANSQCKNWLAANLPHVEIVETSSTAKAAQIVAEKKEACAAVASSIAAEIY 244

Query: 246 GLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHG 305
           GL ++ + I+D  +N TRF ILG +   P+GNDKT ++F+    +PGAL   L  F DH 
Sbjct: 245 GLSLIRESIEDLADNTTRFLILGKNQCPPTGNDKTSVVFSCP-DKPGALYRVLKPFFDHR 303

Query: 306 INLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           +NL KI+SRP+ +  W Y FF++  GH++DE +Q  L  + E  + +++LGSYP
Sbjct: 304 LNLTKIESRPTRRNSWEYNFFIDFHGHQKDESIQNVLASLKENTIFMRVLGSYP 357



>gi|30248352|ref|NP_840422.1| prephenate dehydratase/chorismate mutase [Nitrosomonas europaea
           ATCC 19718]
 gi|499423506|ref|WP_011110970.1| prephenate dehydratase [Nitrosomonas europaea]
 gi|30138238|emb|CAD84246.1| Prephenate dehydratase (PDT):Chorismate mutase:ACT domain
           [Nitrosomonas europaea ATCC 19718]
          Length = 355

 Score =  256 bits (654), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 137/353 (38%), Positives = 217/353 (61%), Gaps = 14/353 (3%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID++D +L++L++ RAR++  + + K G+          Y   +E+QIF R+ + N GP
Sbjct: 11  EIDAVDDELLRLISTRARLAQQVGRQKSGT---------AYRPERESQIFSRLQQSNPGP 61

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           L  E +V ++ EIIS   + ++ L++AY GP G+++ +A   RFG ++  LP S+I+DIF
Sbjct: 62  LRDEHIVHLFTEIISVCRALEEPLTVAYLGPQGTFSEEAVTKRFGSAVTSLPCSSIDDIF 121

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLS-KSKFSSIN 189
             VE G  +YG+VP ENST G+V  T+D  +     I  E  L +  CL++ ++  ++I 
Sbjct: 122 RKVESGAASYGVVPVENSTEGAVGRTMDLLLQTPLKICGELELPVHQCLMAQQTDLTAIR 181

Query: 190 KVYSHPQGFGQCQKYLDSHLKE---AQRIDALSTSKAAEIAASEPYSAAIASITCAELYG 246
           K+YSHPQ F QCQ +++ +L+      RIDA S + AA  AA++  +AAIA    AE++G
Sbjct: 182 KIYSHPQSFAQCQVWINENLQSLTAVDRIDAASNADAARQAAADSSAAAIAGKKAAEVFG 241

Query: 247 LEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGI 306
           L+V   +I+D  NN TRF ++GS     SG DKT +     H RPGA+ + L+ F  + +
Sbjct: 242 LKVCAANIEDNPNNTTRFLVIGSRDVARSGRDKTSLAMAT-HNRPGAVHELLAPFARYQV 300

Query: 307 NLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           ++ +++SRPS    W YVFF ++ GH+EDE V +AL  + +    +KI GSYP
Sbjct: 301 SMTRLESRPSRASLWEYVFFTDIAGHQEDENVARALQALRDNTTFLKIFGSYP 353



>gi|491152593|ref|WP_005010987.1| chorismate mutase [Acinetobacter bouvetii]
 gi|480042947|gb|ENV82307.1| chorismate mutase [Acinetobacter bouvetii DSM 14964 = CIP 107468]
          Length = 369

 Score =  256 bits (654), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 132/352 (37%), Positives = 207/352 (58%), Gaps = 7/352 (1%)

Query: 10  QQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNG 69
           + IDS+D ++ QL+N RA+++  + KAK  +          Y   +E Q+  ++   N G
Sbjct: 19  EDIDSVDMQIQQLINRRAKLAEAVAKAKFAA----EENPLFYRPEREAQVLRKVMERNEG 74

Query: 70  PLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDI 129
           PLS  ++  +++EI+SA ++ +   SIA+ GP+G+YTH A +  FG      P  TI+++
Sbjct: 75  PLSDATMARLFREIMSACLALEAPQSIAFLGPVGTYTHSAVLKHFGQDAVIRPLPTIDEV 134

Query: 130 FDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSS 187
           F  VE G   YG+VP ENS+ G V  TLD F +   +++ E  L I H  L    ++  S
Sbjct: 135 FREVEAGSAHYGLVPVENSSEGVVNHTLDCFKTSHLNVIGEVELPIHHQFLISENTRKDS 194

Query: 188 INKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGL 247
           I ++Y+H Q   QC+ +LD+H    +R+   S ++AA    +E +SAAIAS   A +Y L
Sbjct: 195 IKQIYAHQQTLAQCRSWLDAHYPGVERVALSSNAEAARRIRNEWHSAAIASEVAANIYNL 254

Query: 248 EVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGIN 307
           E+L  +I+D   N TRF ++G      SGNDKT +L +  H R GAL + L+ F  H I+
Sbjct: 255 EILHSNIEDNPENTTRFLVIGREKIPQSGNDKTSLLISA-HDRAGALLEILAPFAKHKIS 313

Query: 308 LLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           L  I++RP+  + W YVFF++L+GH E + V+ AL +I     ++++LGSYP
Sbjct: 314 LTSIETRPALPEKWAYVFFIDLEGHVEQDNVKAALEEIRPLVKELRVLGSYP 365



>gi|241995648|gb|ACS75019.1| PheA [Methylophilus methylotrophus]
          Length = 360

 Score =  256 bits (654), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 135/365 (36%), Positives = 218/365 (59%), Gaps = 15/365 (4%)

Query: 1   MENVDLTFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIF 60
           M ++   F  +ID+ID +++ L+NERA+++  +   K+           +Y   +E QI 
Sbjct: 1   MSDLLKQFRDKIDAIDAQILALVNERAKLAREIGHLKDDGV--------IYRPEREAQII 52

Query: 61  DRIHRLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINY 120
            R+   N GPLS E++  I++ ++S   + +K+L+IA+ GPLG+Y+ +AA+ +FG+    
Sbjct: 53  RRLQAENEGPLSPEAVSHIFRAVMSNCRALEKELAIAFLGPLGTYSEEAALKQFGEGRQA 112

Query: 121 LPKSTINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL 180
           +   +I+++F +VE G   YG+VP ENST G+V  TLD  +     ++ E  L + HCLL
Sbjct: 113 VVCGSIDEVFRTVEAGQADYGVVPVENSTEGAVGITLDLLLGSALQVVGEVTLPVHHCLL 172

Query: 181 SKSK-FSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAE-----IAASEPYSA 234
           S  +    I  V+SH Q   QC ++L+  L  AQR    S ++AA+     +A    ++A
Sbjct: 173 SAQQDLQQITHVFSHAQSLSQCHEWLNKVLPSAQREAVTSNARAAQMIHELVATQGTFAA 232

Query: 235 AIASITCAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGAL 294
           AIAS   AEL+ L +L ++I+D   N TRF +LG+    PSG DKT ++ +  H +PGA+
Sbjct: 233 AIASKRAAELFDLNILAENIEDDPKNTTRFLVLGNHGVAPSGQDKTSLVMSA-HNKPGAV 291

Query: 295 CDGLSVFKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKI 354
              L     HG+++ K++SRPS Q  W+YVFFV+++GH++   VQ AL ++ E    +K+
Sbjct: 292 LQLLEPLSRHGVSMTKLESRPSRQNLWNYVFFVDIEGHQQQPSVQAALKELAERATFLKV 351

Query: 355 LGSYP 359
           LGSYP
Sbjct: 352 LGSYP 356



>gi|384419789|ref|YP_005629149.1| P-protein [Xanthomonas oryzae pv. oryzicola BLS256]
 gi|504316645|ref|WP_014503747.1| prephenate dehydratase [Xanthomonas oryzae]
 gi|353462702|gb|AEQ96981.1| P-protein [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 402

 Score =  256 bits (654), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 205/351 (58%), Gaps = 7/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID ID  +  L+ ERA  +  + KAK             Y   +E Q+   +   N GP
Sbjct: 53  KIDEIDRNIQALIAERAHFAHQVGKAK----GKLAAAVDYYRPEREAQVLRMVVDRNEGP 108

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS E LV +Y+EI+SA ++ Q+ L I Y GP G+++ QA +  FG S   LP +TI ++F
Sbjct: 109 LSDEVLVHVYREIMSACLAQQEPLKIGYLGPEGTFSQQAVLKHFGRSAVGLPMATIEEVF 168

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSSIN 189
             VE G+  +G+VP ENS  G++  TLD F++    I  E  LR+   LLS++ +   I 
Sbjct: 169 QEVEAGNADFGVVPVENSGQGTIQVTLDMFLTSNLKICGEVELRVHQYLLSRNGRLEDIE 228

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE- 248
           ++Y+H Q F Q   +L SHL + ++I   S ++ A  A +   +AAI   + A +YGL+ 
Sbjct: 229 RIYAHSQSFAQTAGWLRSHLPKVEKIAVSSNAEGARRARNAEDAAAIGGESAAHVYGLKK 288

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
           V+ K I+D  +N TRF ++G      SG+D+T +L  + H +PGAL D LS F  HGI++
Sbjct: 289 VIMKSIEDDDDNTTRFLVIGRQIFPSSGHDRTSVLVFI-HDKPGALFDVLSPFARHGISM 347

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I+SRPS Q  W Y FF++L GH ED+ +++AL ++      +K+LGSYP
Sbjct: 348 NRIESRPSHQDKWEYGFFIDLVGHVEDDAMKQALAELKAHSAQIKVLGSYP 398



>gi|492837226|ref|WP_005991180.1| prephenate dehydratase [Xanthomonas vesicatoria]
 gi|325538324|gb|EGD10006.1| chorismate mutase ;prephenate dehydratase [Xanthomonas vesicatoria
           ATCC 35937]
          Length = 411

 Score =  256 bits (654), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 205/351 (58%), Gaps = 7/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID ID  +  L+ ERA  +  + KAK             Y   +E Q+   +   N GP
Sbjct: 62  KIDEIDRTIQALIAERANFAHQVGKAK----GKLAAAVDYYRPEREAQVLRMVVDRNEGP 117

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS E LV +Y+EI+SA ++ Q+ L I Y GP G+++ QA +  FG S   LP +TI ++F
Sbjct: 118 LSDEVLVHVYREIMSACLAQQEPLKIGYLGPEGTFSQQAVLKHFGRSAVGLPMATIEEVF 177

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSSIN 189
             VE G+  +G+VP ENS  G++  TLD F++    I  E  LR+   LLS++ +   I 
Sbjct: 178 QEVEAGNADFGVVPVENSGQGTIQVTLDMFLTSNLKICGEVELRVHQYLLSRNGRLEDIE 237

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE- 248
           ++Y+H Q F Q   +L SHL + ++I   S ++ A  A +   +AAI   + A +YGL+ 
Sbjct: 238 RIYAHSQSFAQTAGWLRSHLPKVEKIAVSSNAEGARRARNAEDAAAIGGESAAHVYGLKK 297

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
           V+ K I+D  +N TRF ++G      SG+D+T +L  + H +PGAL D LS F  HGI++
Sbjct: 298 VIMKSIEDDDDNTTRFLVIGRQIFPSSGHDRTSVLVFI-HDKPGALFDVLSPFARHGISM 356

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I+SRPS Q  W Y FF++L GH ED+ +++AL ++      +K+LGSYP
Sbjct: 357 NRIESRPSHQAKWEYGFFIDLVGHVEDDAMKQALAELEAHSAQIKVLGSYP 407



>gi|491146542|ref|WP_005004942.1| chorismate mutase [Acinetobacter ursingii]
 gi|480038812|gb|ENV78418.1| chorismate mutase [Acinetobacter ursingii ANC 3649]
          Length = 369

 Score =  256 bits (654), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 134/350 (38%), Positives = 206/350 (58%), Gaps = 7/350 (2%)

Query: 12  IDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGPL 71
           IDS+D ++ +L+N RA ++  + KAK  +          Y   +E Q+  ++   N GPL
Sbjct: 21  IDSVDQQIQELINRRASLAEAVAKAKFAA----EENPLFYRPEREAQVLRKVMERNKGPL 76

Query: 72  SSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIFD 131
           S  ++  +++EI+SA ++ +   SIA+ GP G++T  A +  FG      P  TI+++F 
Sbjct: 77  SDTTMARLFREIMSACLALEAPQSIAFLGPEGTFTQSAVLKHFGKDAIVRPLPTIDEVFR 136

Query: 132 SVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSIN 189
            VE G   YG+VP ENS+ G V  TLD F + + +++ E  LRI H  L    ++  SI 
Sbjct: 137 EVEAGSAHYGVVPVENSSEGIVNHTLDCFKTSQLNVIGEVELRIHHQFLVSENTRKDSIK 196

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLEV 249
           ++Y+H Q   QC+++LD+H    +R+   S ++AA    +E +SAAIAS   A LY LE+
Sbjct: 197 QIYAHQQTLAQCRQWLDAHYPGVERVALNSNAEAARRIRNEWHSAAIASDLAASLYNLEI 256

Query: 250 LGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINLL 309
           L  +I+D   N TRF ++G      SGNDKT +L +  H R GAL D L+ F  HGI+L 
Sbjct: 257 LHSNIEDNPENTTRFLVIGREKIPQSGNDKTSLLISA-HDRAGALLDILAPFAKHGISLT 315

Query: 310 KIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            I++RP+  + W YVFF++L+GH + E V  ALN I     ++++LGSYP
Sbjct: 316 SIETRPALPEKWAYVFFIDLEGHIDQENVTAALNDIRPTVKELRVLGSYP 365



>gi|58582010|ref|YP_201026.1| P-protein [Xanthomonas oryzae pv. oryzae KACC 10331]
 gi|84623924|ref|YP_451296.1| P-protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188576379|ref|YP_001913308.1| P-protein [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|499578268|ref|WP_011259051.1| prephenate dehydratase [Xanthomonas oryzae]
 gi|58426604|gb|AAW75641.1| prephenate dehydratase [Xanthomonas oryzae pv. oryzae KACC 10331]
 gi|84367864|dbj|BAE69022.1| P-protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|188520831|gb|ACD58776.1| P-protein [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 402

 Score =  256 bits (653), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 204/351 (58%), Gaps = 7/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID ID  +  L+ ERA  +  + KAK             Y   +E Q+   +   N GP
Sbjct: 53  KIDEIDRNIQALIAERANFAHQVGKAK----GKLAAAVDYYRPEREAQVLRMVVDRNEGP 108

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS E LV +Y+EI+SA ++ Q+ L I Y GP G+++ QA +  FG S   LP +TI ++F
Sbjct: 109 LSDEVLVHVYREIMSACLAQQEPLKIGYLGPEGTFSQQAVLKHFGRSAVGLPMATIEEVF 168

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSSIN 189
             VE G+  +G+VP ENS  G++  TLD F++    I  E  LR+   LLS++ +   I 
Sbjct: 169 QEVEAGNADFGVVPVENSGQGTIQVTLDMFLTSNLKICGEVELRVHQYLLSRNGRLEDIE 228

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE- 248
           ++Y+H Q F Q   +L SHL   ++I   S ++ A  A +   +AAI   + A +YGL+ 
Sbjct: 229 RIYAHSQSFAQTAGWLRSHLPNVEKIAVSSNAEGARRARNAEDAAAIGGESAAHVYGLKK 288

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
           V+ K I+D  +N TRF ++G      SG+D+T +L  + H +PGAL D LS F  HGI++
Sbjct: 289 VIMKSIEDDDDNTTRFLVIGRQIFPSSGHDRTSVLVFI-HDKPGALFDVLSPFARHGISM 347

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I+SRPS Q  W Y FF++L GH ED+ +++AL ++      +K+LGSYP
Sbjct: 348 NRIESRPSHQDKWEYGFFIDLVGHVEDDAMKQALAELKAHAAQIKVLGSYP 398



>gi|488893452|ref|WP_002804594.1| P-protein [Xanthomonas fragariae]
 gi|481587084|gb|ENZ96453.1| P-protein [Xanthomonas fragariae LMG 25863]
          Length = 408

 Score =  256 bits (653), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 204/351 (58%), Gaps = 7/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID ID  +  L+ ERA  +  + KAK             Y   +E Q+   +   N GP
Sbjct: 59  KIDEIDRNIQALIAERANFAHQVGKAK----GKLATAVDYYRPEREAQVLRMVVDRNEGP 114

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS E LV +Y+EI+SA ++ Q+ L I Y GP G+++ QA +  FG S   LP +TI ++F
Sbjct: 115 LSDEVLVHVYREIMSACLAQQEPLKIGYLGPEGTFSQQAVLKHFGRSAVGLPMATIEEVF 174

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSSIN 189
             VE G+  +G+VP ENS  G++  TLD F++    I  E  LR+   LLS++ +   I 
Sbjct: 175 QEVEAGNADFGVVPVENSGQGTIQVTLDMFLTSNLKICGEVELRVHQYLLSRNGRLEDIE 234

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGL-E 248
           ++Y+H Q F Q   +L SHL + ++I   S ++ A    +   +AAI   + A +YGL +
Sbjct: 235 RIYAHSQSFAQTAGWLRSHLPKVEKIAVSSNAEGARRVRNAEDAAAIGGESAAHVYGLKK 294

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
           V+ K I+D  +N TRF ++G      SG+D+T +L  + H +PGAL D LS F  HGI++
Sbjct: 295 VIMKSIEDDDDNTTRFLVIGRQIFHSSGHDRTSVLVFI-HDKPGALFDVLSPFARHGISM 353

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I+SRPS Q  W Y FF++L GH EDE +++AL ++      +K+LGSYP
Sbjct: 354 NRIESRPSHQAKWEYGFFIDLVGHVEDEAMKQALAELEAHSAQIKVLGSYP 404



>gi|495244572|ref|WP_007969335.1| prephenate dehydratase [Xanthomonas fuscans]
 gi|292606334|gb|EFF49548.1| P-protein [Xanthomonas fuscans subsp. aurantifolii str. ICPB 10535]
          Length = 402

 Score =  256 bits (653), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 205/351 (58%), Gaps = 7/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID ID  +  L+ ERA  +  + KAK             Y   +E Q+   +   N GP
Sbjct: 53  KIDEIDRNIQALIAERANFAHQVGKAK----GKLAAAVDYYRPEREAQVLRMVVDRNEGP 108

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS E LV +Y+EI+SA ++ Q+ L I Y GP G+++ QA +  FG S   LP +TI ++F
Sbjct: 109 LSDEVLVHVYREIMSACLAQQEPLKIGYLGPEGTFSQQAVLKHFGRSAVGLPMATIEEVF 168

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSSIN 189
             VE G+  +G+VP ENS  G++  TLD F++    I  E  LR+   LLS++ +   I 
Sbjct: 169 QEVEAGNADFGVVPVENSGQGTIQVTLDMFLTSNLKICGEVELRVHQYLLSRNGRLEDIE 228

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE- 248
           ++Y+H Q F Q   +L SHL + ++I   S ++ A  A +   +AAI   + A +YGL+ 
Sbjct: 229 RIYAHSQSFAQTAGWLRSHLPKVEKIAVSSNAEGARRARNAEDAAAIGGESAAHVYGLKK 288

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
           V+ K I+D  +N TRF ++G      SG+D+T +L  + H +PGAL D LS F  HGI++
Sbjct: 289 VIMKSIEDDDDNTTRFLVIGRQIFPSSGHDRTSVLVFI-HDKPGALFDVLSPFARHGISM 347

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I+SRPS Q  W Y FF++L GH ED+ +++AL ++      +K+LGSYP
Sbjct: 348 NRIESRPSHQAKWEYGFFIDLIGHVEDDAMKQALAELKAHSAQIKVLGSYP 398



>gi|494181049|ref|WP_007116671.1| prephenate dehydratase [Enhydrobacter aerosaccus]
 gi|257447176|gb|EEV22184.1| chorismate mutase [Enhydrobacter aerosaccus SK60]
          Length = 366

 Score =  256 bits (653), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 134/362 (37%), Positives = 203/362 (56%), Gaps = 8/362 (2%)

Query: 1   MENVDLT-FSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQI 59
           M N +L    Q+ID +D K+ +L+NERA  ++ + KAK+            Y   +E Q+
Sbjct: 6   MSNDELIGLRQKIDEVDEKIQRLINERAGYAVQVAKAKK----TQENNPIFYRPEREAQV 61

Query: 60  FDRIHRLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSIN 119
             ++   N GPL ++ +  +++EI+S  +  +    IAY GP G++TH AA+  FG +  
Sbjct: 62  LKKVMARNEGPLPADKMARLFREIMSVCLDLEAPQKIAYLGPAGTFTHMAALKHFGKAAT 121

Query: 120 YLPKSTINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCL 179
            +P STI D+F  VE G   YG+VP ENS+ G V  TLD F+S    I+ E  L + H  
Sbjct: 122 TVPLSTIADVFREVEAGSAMYGVVPVENSSEGVVNHTLDGFLSSDLKIIGEVELPVHHQF 181

Query: 180 L--SKSKFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIA 237
           L    +K  +I+K+Y+H Q   QC+++LD+H    +R+   S  +AA    +E +SAAIA
Sbjct: 182 LVGEHTKVGAISKIYAHSQALAQCRQWLDTHYPNVERVAVSSNGEAARRIKNEWHSAAIA 241

Query: 238 SITCAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDG 297
               A  Y L  L ++I+D  +N TRF I+G  +  PSG DKT IL     Q  GAL   
Sbjct: 242 GEVAASEYNLHKLFENIEDTPSNTTRFLIIGREAVAPSGQDKTSILVAAKDQ-AGALIQI 300

Query: 298 LSVFKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGS 357
           L     HG+++  I++RP     W YVFF+++ GH +D  +Q AL +I     D+++LG+
Sbjct: 301 LQPLAKHGVSMTSIETRPERPNKWAYVFFIDMLGHIDDANMQAALAEIRPQVKDLRVLGA 360

Query: 358 YP 359
           YP
Sbjct: 361 YP 362



>gi|78047246|ref|YP_363421.1| P-protein [Xanthomonas campestris pv. vesicatoria str. 85-10]
 gi|346724529|ref|YP_004851198.1| P-protein [Xanthomonas axonopodis pv. citrumelo F1]
 gi|499666313|ref|WP_011347047.1| prephenate dehydratase [Xanthomonas euvesicatoria]
 gi|78035676|emb|CAJ23367.1| P-protein [Xanthomonas campestris pv. vesicatoria str. 85-10]
 gi|346649276|gb|AEO41900.1| P-protein [Xanthomonas axonopodis pv. citrumelo F1]
          Length = 402

 Score =  256 bits (653), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 205/351 (58%), Gaps = 7/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID ID  +  L+ ERA  +  + KAK             Y   +E Q+   +   N GP
Sbjct: 53  KIDEIDRNIQALIAERANFAHQVGKAK----GKLAAAVDYYRPEREAQVLRMVVDRNEGP 108

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS E LV +Y+EI+SA ++ Q+ L I Y GP G+++ QA +  FG S   LP +TI ++F
Sbjct: 109 LSDEVLVHVYREIMSACLAQQEPLKIGYLGPEGTFSQQAVLKHFGRSAVGLPMATIEEVF 168

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSSIN 189
             VE G+  +G+VP ENS  G++  TLD F++    I  E  LR+   LLS++ +   I 
Sbjct: 169 QEVEAGNADFGVVPVENSGQGTIQVTLDMFLTSNLKICGEVELRVHQYLLSRNGRLEDIE 228

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE- 248
           ++Y+H Q F Q   +L SHL + ++I   S ++ A  A +   +AAI   + A +YGL+ 
Sbjct: 229 RIYAHSQSFAQTAGWLRSHLPKVEKIAVSSNAEGARRARNAEDAAAIGGESAAHVYGLKK 288

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
           V+ K I+D  +N TRF ++G      SG+D+T +L  + H +PGAL D LS F  HGI++
Sbjct: 289 VIMKSIEDDDDNTTRFLVIGRQIFPSSGHDRTSVLVFI-HDKPGALFDVLSPFARHGISM 347

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I+SRPS Q  W Y FF++L GH ED+ +++AL ++      +K+LGSYP
Sbjct: 348 NRIESRPSHQAKWEYGFFIDLIGHVEDDAMKQALAELKAHSAQIKVLGSYP 398



>gi|3153199|gb|AAC38578.1| P-protein [Xanthomonas campestris]
          Length = 400

 Score =  256 bits (653), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 205/351 (58%), Gaps = 7/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID ID  +  L+ ERA  +  + KAK             Y   +E Q+   +   N GP
Sbjct: 51  KIDEIDRGIQALIAERANFAHQVGKAK----GKLAAAVDYYRPEREAQVLRMVVDRNEGP 106

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS E LV +++EI+SA ++ Q+ L I Y GP G+++ QA +  FG S   LP +TI ++F
Sbjct: 107 LSDEVLVHVFREIMSACLAQQEPLKIGYLGPEGTFSQQAVLKHFGRSAVGLPMATIEEVF 166

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSSIN 189
             VE G+  +G+VP ENS  G++  TLD F++    I  E  LR+   LLS++ +   I 
Sbjct: 167 QEVEAGNADFGVVPVENSGQGTIQVTLDMFLTSNLKICGEVELRVHQYLLSRNGRLEDIE 226

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE- 248
           ++Y+H Q F Q   +L SHL + ++I   S ++ A  A +   +AAI   + A +YGL+ 
Sbjct: 227 RIYAHSQSFAQTAGWLRSHLPKVEKIAVSSNAEGARRARNAEDAAAIGGESAAHVYGLKK 286

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
           V+ K I+D  +N TRF ++G      SG+D+T +L  + H +PGAL D LS F  HGI++
Sbjct: 287 VIMKSIEDDDDNTTRFLVIGRQIFPSSGHDRTSVLVFI-HDKPGALFDVLSPFARHGISM 345

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I+SRPS Q  W Y FF++L GH EDE +++AL ++      +K+LGSYP
Sbjct: 346 NRIESRPSHQAKWEYGFFIDLAGHVEDESMKQALAELEAHSAQIKVLGSYP 396



>gi|384427524|ref|YP_005636883.1| P-protein [Xanthomonas campestris pv. raphani 756C]
 gi|504320318|ref|WP_014507420.1| prephenate dehydratase [Xanthomonas campestris]
 gi|341936626|gb|AEL06765.1| P-protein [Xanthomonas campestris pv. raphani 756C]
          Length = 400

 Score =  256 bits (653), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 205/351 (58%), Gaps = 7/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID ID  +  L+ ERA  +  + KAK             Y   +E Q+   +   N GP
Sbjct: 51  KIDEIDRGIQALIAERANFAHQVGKAK----GKLAAAVDYYRPEREAQVLRMVVDRNEGP 106

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS E LV +++EI+SA ++ Q+ L I Y GP G+++ QA +  FG S   LP +TI ++F
Sbjct: 107 LSDEVLVHVFREIMSACLAQQEPLKIGYLGPEGTFSQQAVLKHFGRSAVGLPMATIEEVF 166

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSSIN 189
             VE G+  +G+VP ENS  G++  TLD F++    I  E  LR+   LLS++ +   I 
Sbjct: 167 QEVEAGNADFGVVPVENSGQGTIQVTLDMFLTSNLKICGEVELRVHQYLLSRNGRLEDIE 226

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE- 248
           ++Y+H Q F Q   +L SHL + ++I   S ++ A  A +   +AAI   + A +YGL+ 
Sbjct: 227 RIYAHSQSFAQTAGWLRSHLPKVEKIAVSSNAEGARRARNAEDAAAIGGESAAHVYGLKK 286

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
           V+ K I+D  +N TRF ++G      SG+D+T +L  + H +PGAL D LS F  HGI++
Sbjct: 287 VIMKSIEDDDDNTTRFLVIGRQIFPSSGHDRTSVLVFI-HDKPGALFDVLSPFARHGISM 345

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I+SRPS Q  W Y FF++L GH EDE +++AL ++      +K+LGSYP
Sbjct: 346 NRIESRPSHQAKWEYGFFIDLAGHVEDESMKQALAELEAHSAQIKVLGSYP 396



>gi|21231044|ref|NP_636961.1| P-protein [Xanthomonas campestris pv. campestris str. ATCC 33913]
 gi|66768951|ref|YP_243713.1| P-protein [Xanthomonas campestris pv. campestris str. 8004]
 gi|188992065|ref|YP_001904075.1| P-protein [Xanthomonas campestris pv. campestris str. B100]
 gi|499347233|ref|WP_011036772.1| P-protein [Xanthomonas campestris]
 gi|21112671|gb|AAM40885.1| P-protein [Xanthomonas campestris pv. campestris str. ATCC 33913]
 gi|66574283|gb|AAY49693.1| P-protein [Xanthomonas campestris pv. campestris str. 8004]
 gi|167733825|emb|CAP52031.1| P-protein, probable [Xanthomonas campestris pv. campestris]
          Length = 406

 Score =  255 bits (652), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 205/351 (58%), Gaps = 7/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID ID  +  L+ ERA  +  + KAK             Y   +E Q+   +   N GP
Sbjct: 57  KIDEIDRGIQALIAERANFAHQVGKAK----GKLAAAVDYYRPEREAQVLRMVVDRNEGP 112

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS E LV +++EI+SA ++ Q+ L I Y GP G+++ QA +  FG S   LP +TI ++F
Sbjct: 113 LSDEVLVHVFREIMSACLAQQEPLKIGYLGPEGTFSQQAVLKHFGRSAVGLPMATIEEVF 172

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSSIN 189
             VE G+  +G+VP ENS  G++  TLD F++    I  E  LR+   LLS++ +   I 
Sbjct: 173 QEVEAGNADFGVVPVENSGQGTIQVTLDMFLTSNLKICGEVELRVHQYLLSRNGRLEDIE 232

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE- 248
           ++Y+H Q F Q   +L SHL + ++I   S ++ A  A +   +AAI   + A +YGL+ 
Sbjct: 233 RIYAHSQSFAQTAGWLRSHLPKVEKIAVSSNAEGARRARNAEDAAAIGGESAAHVYGLKK 292

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
           V+ K I+D  +N TRF ++G      SG+D+T +L  + H +PGAL D LS F  HGI++
Sbjct: 293 VIMKSIEDDDDNTTRFLVIGRQIFPSSGHDRTSVLVFI-HDKPGALFDVLSPFARHGISM 351

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I+SRPS Q  W Y FF++L GH EDE +++AL ++      +K+LGSYP
Sbjct: 352 NRIESRPSHQAKWEYGFFIDLAGHVEDESMKQALAELEAHSAQIKVLGSYP 402



>gi|495239304|ref|WP_007964068.1| prephenate dehydratase [Xanthomonas fuscans]
 gi|292600526|gb|EFF44620.1| P-protein [Xanthomonas fuscans subsp. aurantifolii str. ICPB 11122]
          Length = 402

 Score =  255 bits (652), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 205/351 (58%), Gaps = 7/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID ID  +  L+ ERA  +  + KAK             Y   +E Q+   +   N GP
Sbjct: 53  KIDEIDRNIQALIAERANFAHQVGKAK----GKLAAAVDYYRPEREAQVLRMVVDRNEGP 108

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS E LV +Y+EI+SA ++ Q+ L I Y GP G+++ QA +  FG S   LP +TI ++F
Sbjct: 109 LSDEVLVHVYREIMSACLAQQEPLKIGYLGPEGTFSQQAVLKHFGRSAVGLPMATIEEVF 168

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSSIN 189
             VE G+  +G+VP ENS  G++  TLD F++    I  E  LR+   LLS++ +   I 
Sbjct: 169 QEVEAGNADFGVVPVENSGQGTIQVTLDMFLTSNLKICGEVELRVHQYLLSRNGRLEDIE 228

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE- 248
           ++Y+H Q F Q   +L SHL + ++I   S ++ A  A +   +AAI   + A +YGL+ 
Sbjct: 229 RIYAHSQSFAQTAGWLRSHLPKVEKIAVSSNAEGARRARNAEDAAAIGGESAAHVYGLKK 288

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
           V+ K I+D  +N TRF ++G      SG+D+T +L  + H +PGAL D LS F  HGI++
Sbjct: 289 VIMKSIEDDDDNTTRFLVIGRQIFPSSGHDRTSVLVFI-HDKPGALFDVLSPFARHGISM 347

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I+SRPS Q  W Y FF++L GH ED+ +++AL ++      +K+LGSYP
Sbjct: 348 NRIESRPSHQAKWEYGFFIDLIGHVEDDAMKQALAELKAHSAQIKVLGSYP 398



>gi|192360645|ref|YP_001982589.1| chorismate mutase/prephenate dehydratase [Cellvibrio japonicus
           Ueda107]
 gi|501464281|ref|WP_012487726.1| prephenate dehydratase [Cellvibrio japonicus]
 gi|190686810|gb|ACE84488.1| chorismate mutase/prephenate dehydratase [Cellvibrio japonicus
           Ueda107]
          Length = 369

 Score =  255 bits (652), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 136/356 (38%), Positives = 214/356 (60%), Gaps = 4/356 (1%)

Query: 6   LTFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHR 65
           L    QID+ID ++ +L++ RA  +  + + K+ +          Y   +E Q+  +   
Sbjct: 12  LALRDQIDAIDEEIGRLISARAECAQQVAEVKKANLPSDTSIL-FYRPEREAQVLRKAME 70

Query: 66  LNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKST 125
            N GPLS+E +  +++EI+SA ++ ++ + +AY GP G++T QAA+  FG S   +P S 
Sbjct: 71  RNRGPLSNEEIARLFREIMSACLALEQPIKVAYLGPEGTFTQQAALKHFGHSAVVIPFSA 130

Query: 126 INDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSK--S 183
           I+D+F  VE G   YG+VP ENST G V  TLD F+     I  E  LRI H L+    +
Sbjct: 131 IDDVFREVEAGAVNYGVVPVENSTEGVVNHTLDNFMGSNLKICGEVELRIHHNLMVSDVT 190

Query: 184 KFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAE 243
             +SI+++YSH Q   QC+K+LDS+  +A+RI   S ++AA     E  +AAIA    AE
Sbjct: 191 NINSISRIYSHSQSLAQCRKWLDSNYPKAERIAVSSNAEAARRLKGEWNAAAIAGSMAAE 250

Query: 244 LYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKD 303
           LY L+++ + I+D  +N TRF I+G+ S   SG DKT I+  + ++ PGAL + L  F  
Sbjct: 251 LYSLKMIAEKIEDQPDNSTRFLIIGAQSVPSSGVDKTSIVVAMRNE-PGALHNLLEPFHR 309

Query: 304 HGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           HGI+L ++++RPS    W YVFF++  GH +D ++ + + +++  C D+K+LGSYP
Sbjct: 310 HGIDLTRVETRPSRTGAWTYVFFIDFVGHVDDPLISEVMKEVSIRCADLKLLGSYP 365



>gi|21242399|ref|NP_641981.1| P-protein [Xanthomonas axonopodis pv. citri str. 306]
 gi|470471538|ref|YP_007636106.1| P-protein [Xanthomonas axonopodis Xac29-1]
 gi|471268185|ref|YP_007650650.1| Chorismate mutase [Xanthomonas citri subsp. citri Aw12879]
 gi|489581351|ref|WP_003485797.1| chorismate mutase [Xanthomonas citri]
 gi|21107839|gb|AAM36517.1| P-protein [Xanthomonas axonopodis pv. citri str. 306]
 gi|380688133|emb|CCG36996.1| chorismate mutase [Xanthomonas citri pv. mangiferaeindicae LMG 941]
 gi|410705438|gb|EKQ63911.1| P-protein [Xanthomonas axonopodis pv. malvacearum str. GSPB1386]
 gi|469766730|gb|AGH77147.1| P-protein [Xanthomonas axonopodis Xac29-1]
 gi|471211702|gb|AGI08452.1| Chorismate mutase [Xanthomonas citri subsp. citri Aw12879]
          Length = 402

 Score =  255 bits (652), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 205/351 (58%), Gaps = 7/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID ID  +  L+ ERA  +  + KAK             Y   +E Q+   +   N GP
Sbjct: 53  KIDEIDRNIQALIAERANFAHQVGKAK----GKLAAAVDYYRPEREAQVLRMVVDRNEGP 108

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS E LV +Y+EI+SA ++ Q+ L I Y GP G+++ QA +  FG S   LP +TI ++F
Sbjct: 109 LSDEVLVHVYREIMSACLAQQEPLKIGYLGPEGTFSQQAVLKHFGRSAVGLPMATIEEVF 168

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSSIN 189
             VE G+  +G+VP ENS  G++  TLD F++    I  E  LR+   LLS++ +   I 
Sbjct: 169 QEVEAGNADFGVVPVENSGQGTIQVTLDMFLTSNLKICGEVELRVHQYLLSRNGRLEDIE 228

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE- 248
           ++Y+H Q F Q   +L SHL + ++I   S ++ A  A +   +AAI   + A +YGL+ 
Sbjct: 229 RIYAHSQSFAQTAGWLRSHLPKVEKIAVSSNAEGARRARNAEDAAAIGGESAAHVYGLKK 288

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
           V+ K I+D  +N TRF ++G      SG+D+T +L  + H +PGAL D LS F  HGI++
Sbjct: 289 VIMKSIEDDDDNTTRFLVIGRQIFPSSGHDRTSVLVFI-HDKPGALFDVLSPFARHGISM 347

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I+SRPS Q  W Y FF++L GH ED+ +++AL ++      +K+LGSYP
Sbjct: 348 NRIESRPSHQAKWEYGFFIDLIGHVEDDAMKQALAELKAHSAQIKVLGSYP 398



>gi|495850346|ref|WP_008574925.1| prephenate dehydratase [Xanthomonas perforans]
 gi|325542201|gb|EGD13695.1| chorismate mutase ;prephenate dehydratase [Xanthomonas perforans
           91-118]
          Length = 364

 Score =  255 bits (652), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 136/355 (38%), Positives = 206/355 (58%), Gaps = 7/355 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID ID  +  L+ ERA  +  + KAK             Y   +E Q+   +   N GP
Sbjct: 15  KIDEIDRNIQALIAERANFAHQVGKAK----GKLAAAVDYYRPEREAQVLRMVVDRNEGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS E LV +Y+EI+SA ++ Q+ L I Y GP G+++ QA +  FG S   LP +TI ++F
Sbjct: 71  LSDEVLVHVYREIMSACLAQQEPLKIGYLGPEGTFSQQAVLKHFGRSAVGLPMATIEEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSSIN 189
             VE G+  +G+VP ENS  G++  TLD F++    I  E  LR+   LLS++ +   I 
Sbjct: 131 QEVEAGNADFGVVPVENSGQGTIQVTLDMFLTSNLKICGEVELRVHQYLLSRNGRLEDIE 190

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE- 248
           ++Y+H Q F Q   +L SHL + ++I   S ++ A  A +   +AAI   + A +YGL+ 
Sbjct: 191 RIYAHSQSFAQTAGWLRSHLPKVEKIAVSSNAEGARRARNAEDAAAIGGESAAHVYGLKK 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
           V+ K I+D  +N TRF ++G      SG+D+T +L  + H +PGAL D LS F  HGI++
Sbjct: 251 VIMKSIEDDDDNTTRFLVIGRQIFPSSGHDRTSVLVFI-HDKPGALFDVLSPFARHGISM 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYPDQRP 363
            +I+SRPS Q  W Y FF++L GH ED+ +++AL ++      +K+LGSYP   P
Sbjct: 310 NRIESRPSHQAKWEYGFFIDLIGHVEDDAMKQALAELKAHSAQIKVLGSYPVAIP 364



>gi|489871523|ref|WP_003775063.1| prephenate dehydratase [Neisseria elongata]
 gi|291307226|gb|EFE48469.1| chorismate mutase [Neisseria elongata subsp. glycolytica ATCC
           29315]
          Length = 373

 Score =  255 bits (651), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 138/361 (38%), Positives = 209/361 (57%), Gaps = 11/361 (3%)

Query: 1   MENVDLTFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIF 60
           +E   L     ID ID  +++LLNERA  +  + + K            VY   +E Q+ 
Sbjct: 18  LEKQLLPHRNAIDEIDASVLKLLNERAVHARAIGELK--------GTGAVYRPEREAQVL 69

Query: 61  DRIHRLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINY 120
            RI  LN GPLS E +  +++E++S  ++ ++ L+IAY GP G++T QAA+  FG + + 
Sbjct: 70  RRIKELNRGPLSDEGVARLFREVMSECLAVERPLTIAYLGPAGTFTQQAAVKHFGHAADT 129

Query: 121 LPKSTINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL 180
           +  +T+++     E     Y +VP ENST GSV  TLD  +S       E  LRI H LL
Sbjct: 130 VGCNTVDECMRQAESDQADYAVVPLENSTEGSVGRTLDLLVSSPLRACGEVVLRIHHQLL 189

Query: 181 -SKSKFSSINKVYSHPQGFGQCQKYLDSHLKEA-QRIDALSTSKAAEIAASEPYSAAIAS 238
            ++     +  VY H Q   QC  +L  +L ++  R+   S ++AA +AA++  + A+A 
Sbjct: 190 RNREGLDGVQTVYGHAQALAQCHDWLGKNLPDSIVRVPVSSNAEAARLAAADGSALAVAG 249

Query: 239 ITCAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGL 298
           IT AE+YGL VL ++I+D  NN TRF +LG     PSG DKT +LF+  + R GA  + L
Sbjct: 250 ITAAEIYGLTVLARNIEDEPNNTTRFLVLGKQDTAPSGRDKTSLLFSTPN-RAGAAAELL 308

Query: 299 SVFKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSY 358
           + F + GI++ K +SRPS    W YVFF++++GHK+DE V++ L +  E  + VKI+GSY
Sbjct: 309 TPFSEAGISMTKFESRPSKTGLWEYVFFIDIEGHKDDETVRRVLARFAERNVFVKIIGSY 368

Query: 359 P 359
           P
Sbjct: 369 P 369



>gi|494278464|ref|WP_007160465.1| prephenate dehydratase [Pseudomonas psychrotolerans]
 gi|359370547|gb|EHK71114.1| chorismate mutase/prephenate dehydratase [Pseudomonas
           psychrotolerans L19]
          Length = 364

 Score =  255 bits (651), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 128/351 (36%), Positives = 208/351 (59%), Gaps = 4/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDS+D ++ +L++ERAR + ++ + K G+          Y   +E Q+  R+   N GP
Sbjct: 12  RIDSLDERIQELISERARCAQDVARVKMGTLAEGEKPV-FYRPEREAQVLKRVMERNGGP 70

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           +  E +  +++EI+S  ++ ++ L +AY GP G+++  AA+  FG ++   P + I+++F
Sbjct: 71  VRDEDMARLFREIMSCCLALEEPLHVAYLGPEGTFSQAAALKHFGKAVVTRPMAAIDEVF 130

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLL--SKSKFSSI 188
             V  G + +G+VP ENST G+V  TLD F+     I  E  LRI H LL    +K  SI
Sbjct: 131 REVAAGASNFGVVPVENSTEGAVNHTLDSFLEHNLSICGEVELRIHHHLLIGENTKADSI 190

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
            ++YSH Q   QC+K+LDS+    +R+   S ++AA     E  SAAIA    A LYGL 
Sbjct: 191 TRIYSHAQSLAQCRKWLDSYYPSVERVAVASNAEAARRVKGEWNSAAIAGDMAASLYGLT 250

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
            + + I+D  +N TRF I+G+    PSG+DKT I+ ++   +PGAL + L  F  + I+L
Sbjct: 251 PVQQKIEDRPDNSTRFLIIGNQDVPPSGDDKTSIIVSM-QNKPGALHELLLPFHTNNIDL 309

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I++RPS    W YVFF++  GH+ D +++  L +++   + +K+LGSYP
Sbjct: 310 SRIETRPSRSGKWTYVFFIDFLGHQADPLIRDVLERLSTSAVALKVLGSYP 360



>gi|494432337|ref|WP_007225643.1| prephenate dehydratase [marine gamma proteobacterium HTCC2143]
 gi|119449712|gb|EAW30949.1| chorismate mutase/prephenate dehydratase [marine gamma
           proteobacterium HTCC2143]
          Length = 371

 Score =  255 bits (651), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 135/359 (37%), Positives = 206/359 (57%), Gaps = 8/359 (2%)

Query: 8   FSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXV-----YVSGKENQIFDR 62
             QQID ID ++ QL+N+RA  +  +   K  ++        V     Y   +E Q+  +
Sbjct: 10  LRQQIDDIDVQIHQLINQRATCAEQVADTKLKAFVAENGDSDVSKVTFYRPEREAQVLRK 69

Query: 63  IHRLNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLP 122
           +   N+GPL  +++  I++EI+SA ++ +K   +AYFGP G++TH A I  FG ++  LP
Sbjct: 70  VIDRNSGPLEGKTVARIFREIMSACLALEKPTEVAYFGPEGTFTHAATIKHFGQAVVSLP 129

Query: 123 KSTINDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRIS-HCLLS 181
           +++I  +F  VE G   YG+VP ENST G V  TLD F+     I  E  +RI  H L++
Sbjct: 130 QASIATVFSKVESGQCHYGVVPVENSTEGMVSHTLDNFMDSPLKICGEVEMRIQLHLLVN 189

Query: 182 K-SKFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASIT 240
             +   +I  + +H Q   Q + +LDS+    +RI   S ++AA +A  +   AA+A   
Sbjct: 190 DLANPGTIKSICAHQQALAQARNWLDSNWPNVERIAVASNAEAARMAQKDSSIAAVAGDI 249

Query: 241 CAELYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSV 300
            AE Y L  L + I+D  NN TRF I+G    +PSGNDKT ++   ++ +PGAL + L  
Sbjct: 250 AAEQYDLLKLAESIEDYANNTTRFLIIGQQHVEPSGNDKTSLIVEANN-KPGALFNLLEP 308

Query: 301 FKDHGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           F   G++L +ID+RPS    W YVFF+E +GH++D V++K L K+ E     K+LGSYP
Sbjct: 309 FHAAGVSLTRIDTRPSRTDTWAYVFFIEFEGHQQDAVIEKILVKVGENSRMSKVLGSYP 367



>gi|498270009|ref|WP_010584165.1| prephenate dehydratase [Schlesneria paludicola]
          Length = 384

 Score =  255 bits (651), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 126/351 (35%), Positives = 206/351 (58%), Gaps = 7/351 (1%)

Query: 9   SQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNN 68
           +Q++  +D ++++LLN RA  +  L +A    +         Y    ++ +  RI   N 
Sbjct: 35  AQEMARLDNEILKLLNRRAAATAKLIEADPNWWSA------TYDPRSDDDLLKRIESENQ 88

Query: 69  GPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTIND 128
           GPL ++++  ++++++SA  +  +   ++Y GP  S+TH AA+ RFG+S + +P +TI  
Sbjct: 89  GPLPADAVRGVFRQVLSAVRNRVRPRRVSYLGPAFSFTHMAAVERFGESSDLIPVNTIAA 148

Query: 129 IFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKSKFSSI 188
           +F+ V +GH  +G+VP ENST G ++ TLD F      I  E  L I H LL K     I
Sbjct: 149 VFEEVNRGHADFGVVPIENSTDGRIIDTLDMFTRLPLRICGEIQLCIHHNLLGKVSRGEI 208

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE 248
           N+VYS PQ   QC+ +L  ++ +A+ I+  STS AA++A  +P + AIAS   A  YGL+
Sbjct: 209 NEVYSKPQALSQCRDWLSRNMPQARLIEVTSTSTAAQLARDKPGAGAIASKQAAVEYGLQ 268

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
           +L   ++D KNNVTRF ++G     P+G D+T +L  +   +PGAL D L+ FK + INL
Sbjct: 269 ILADSVEDNKNNVTRFAMIGDKPIGPTGRDRTSLLLQI-GDKPGALADALASFKQNKINL 327

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
             I+S P       Y+FF++ +GH +D  V++ L+ +    + +++LGSYP
Sbjct: 328 TWIESFPLRGPESGYIFFIDCEGHSKDAKVKRTLDDLARLAVRMEVLGSYP 378



>gi|497817253|ref|WP_010131409.1| prephenate dehydratase [Alteromonas sp. S89]
          Length = 367

 Score =  255 bits (651), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 135/356 (37%), Positives = 214/356 (60%), Gaps = 7/356 (1%)

Query: 6   LTFSQQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHR 65
           L    +ID +D+ + +L++ERA  +L + + K+ +          Y   +E Q+  R  +
Sbjct: 13  LELRDRIDGLDSDIARLISERANCALEVAEVKKSN----GEDALYYRPEREAQVLRRAMQ 68

Query: 66  LNNGPLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKST 125
            N GPL+ E +  +++EI+SA ++ ++ +  AY GP G++T QAA+  FG S    P + 
Sbjct: 69  RNAGPLTDEEMARLFREIMSACLALEEPIKAAYLGPEGTFTQQAALKHFGHSAVSKPLAA 128

Query: 126 INDIFDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRI-SHCLLSK-S 183
           I+++F  VE G   YG+VP ENST G V  TLD F++    I  E  LRI  H ++S  +
Sbjct: 129 IDEVFREVEAGAVNYGVVPVENSTEGVVNHTLDNFMTSNLKICGEVELRIHQHLMISDIT 188

Query: 184 KFSSINKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAE 243
           +  SI ++YSH Q   QC+K+LDS+    +R+   S ++AA+    E  +AAIA    A+
Sbjct: 189 RKDSITRIYSHAQSLAQCRKWLDSYYPNVERVAVASNAEAAKRVKGEWNAAAIAGDMAAD 248

Query: 244 LYGLEVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKD 303
           LYGL++L + I+D  +N TRF I+GS    PSG+DKT ++ ++ ++ PGAL D L  F++
Sbjct: 249 LYGLKILNEKIEDRPDNSTRFLIIGSQEVPPSGDDKTSLMVSMRNE-PGALHDLLVPFQN 307

Query: 304 HGINLLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           H I+L ++++RPS    W YVFF++  GH++ E V  AL  +     D+K+LGSYP
Sbjct: 308 HNIDLTRVETRPSQSGNWTYVFFIDFVGHRDSENVAAALKDVGACASDMKVLGSYP 363



>gi|498028411|ref|WP_010342567.1| prephenate dehydratase [Xanthomonas sacchari]
          Length = 382

 Score =  255 bits (651), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 137/355 (38%), Positives = 209/355 (58%), Gaps = 7/355 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID ID  +  L+ ERA+ +  + KAK             Y   +E Q+   +   N GP
Sbjct: 33  KIDEIDRNIQALIAERAQFARQVGKAK----GKLAAAVDYYRPEREAQVLRMVVDRNQGP 88

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS E LV +++EI+SA ++ Q+ L I Y GP G+++ QA +  FG S   LP +TI ++F
Sbjct: 89  LSDEVLVHVFREIMSACLAQQEPLKIGYLGPEGTFSQQAVLKHFGRSAVGLPMATIEEVF 148

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSSIN 189
             VE G+  +G+VP ENS  G++  TLD F++    I  ET LR+   LLS+S +  +I 
Sbjct: 149 QEVESGNADFGVVPVENSGQGTIQVTLDMFLTSNLKICGETELRVHQFLLSRSGRLDAIE 208

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGL-E 248
           ++Y+HPQ F Q   +L ++L + ++I   S ++ A  A +   +AAI   + A +Y L +
Sbjct: 209 RIYAHPQSFAQTAGWLRANLPKVEKIPVSSNAEGARRARNADDAAAIGGESAAHVYALKK 268

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
           V+ K I+D  +N TRF ++G     PSG+D+T +L  + H +PGAL D LS F  HGI++
Sbjct: 269 VIMKSIEDDADNTTRFLVIGRQIFPPSGHDRTSVLVFI-HDKPGALFDVLSPFARHGISM 327

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYPDQRP 363
            +I+SRPS Q  W Y FF++L GH EDE ++ AL ++      +K+LGSYP   P
Sbjct: 328 NRIESRPSHQAKWEYGFFIDLAGHVEDEAMKLALAELKAHSAQIKVLGSYPVAVP 382



>gi|492677240|ref|WP_005919697.1| P-protein [Xanthomonas axonopodis]
 gi|410704541|gb|EKQ63023.1| P-protein [Xanthomonas axonopodis pv. malvacearum str. GSPB2388]
          Length = 402

 Score =  254 bits (650), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 135/351 (38%), Positives = 204/351 (58%), Gaps = 7/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID ID  +  L+ ERA  +  + KAK             Y   +E Q+   +   N GP
Sbjct: 53  KIDEIDRNIQALIAERANFAHQVGKAK----GKLAAAVDYYRPEREAQVLRMVVDRNEGP 108

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS E LV +Y+EI+SA ++ Q+ L I Y GP G+++ QA +  FG S   LP +TI ++F
Sbjct: 109 LSDEVLVHVYREIMSACLAQQEPLKIGYLGPEGTFSQQAVLKHFGRSAVGLPMATIEEVF 168

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSSIN 189
             VE G+  +G+VP ENS  G++  TLD F++    I  E  LR+   LLS++ +   I 
Sbjct: 169 QEVEAGNADFGVVPVENSGQGTIQVTLDMFLTSNLKICGEVELRVHQYLLSRNGRLEDIE 228

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE- 248
           ++Y+H Q F Q   +L SHL + ++I   S ++ A  A +   +AAI   + A +YGL+ 
Sbjct: 229 RIYAHSQSFAQTAGWLRSHLPKVEKIAVSSNAEGARRARNAEDAAAIGGESAAHVYGLKK 288

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
           V+ K I+D  +N TRF ++G      SG+D+T +L  + H +PGAL D LS F  HGI++
Sbjct: 289 VIMKSIEDDDDNTTRFLVIGRQIFPSSGHDRTSVLVFI-HDKPGALFDVLSPFARHGISM 347

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I+SRPS Q  W Y FF++L GH ED+ + +AL ++      +K+LGSYP
Sbjct: 348 NRIESRPSHQAKWEYGFFIDLIGHVEDDAMTQALAELKAHSAQIKVLGSYP 398



>gi|497412582|ref|WP_009726780.1| Chorismate mutase I / Prephenate dehydratase [Methylophaga
           lonarensis]
 gi|471182544|gb|EMR12694.1| Chorismate mutase I / Prephenate dehydratase [Methylophaga
           lonarensis MPL]
          Length = 376

 Score =  254 bits (650), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 143/352 (40%), Positives = 206/352 (58%), Gaps = 7/352 (1%)

Query: 10  QQIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNG 69
           QQID ID ++ QLLN+RA  +  + + K  S          Y   +E  I  ++   N G
Sbjct: 26  QQIDEIDQQIQQLLNQRAEFAQKVAEVKIAS----GEQVDFYRPEREAMILRKVMERNTG 81

Query: 70  PLSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDI 129
           PL    +  I++EI+SA ++++K L +AY GP GS+T  AA+  FG S+   P STI ++
Sbjct: 82  PLPDAEVGRIFREIMSACLAAEKPLQVAYLGPEGSFTQAAALKHFGGSVQLQPVSTIANV 141

Query: 130 FDSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSK-SKFSSI 188
           F +VE  +  YG+VP ENS+ G V  TLDRFIS    I  E  LRI H LL K S+ + I
Sbjct: 142 FRAVETEYARYGVVPVENSSEGMVSHTLDRFISSPLKINGEVTLRIHHYLLGKTSQLNQI 201

Query: 189 NKVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAA-EIAASEPYSAAIASITCAELYGL 247
             VY+HPQ   QC+++L   L  A+ +   S S+AA  +A      AAIA+ T A++YGL
Sbjct: 202 KTVYAHPQALAQCRQWLGDQLPHAELVALDSNSEAARRVAEMGDDVAAIAASTAADIYGL 261

Query: 248 EVLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGIN 307
           EV+  +I+D   N TRF ++G+    PSG DKT +L +  + +PGAL   L    D GI+
Sbjct: 262 EVIASNIEDEAGNTTRFLVIGTQDVGPSGEDKTALLVSTQN-KPGALQSLLKPLADSGIS 320

Query: 308 LLKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
           + +I+SRPS +  W YVFF+++ GH +   V +AL K+       ++LGSYP
Sbjct: 321 MSRIESRPSRKGMWEYVFFIDIDGHSQSPAVAEALAKLQNEASVFRVLGSYP 372



>gi|492698495|ref|WP_005926335.1| prephenate dehydratase [Xanthomonas axonopodis]
 gi|372555293|emb|CCF67310.1| chorismate mutase [Xanthomonas axonopodis pv. punicae str. LMG 859]
          Length = 402

 Score =  254 bits (648), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 134/351 (38%), Positives = 204/351 (58%), Gaps = 7/351 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +ID ID  +  L+ ERA  +  + KAK             Y   +E Q+   +   N GP
Sbjct: 53  KIDEIDRNIQALIAERANFAHQVGKAK----GKLAAAVDYYRPEREAQVLRMVVDRNEGP 108

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS E LV +Y+EI+SA ++ Q+ L I Y GP G+++ QA +  FG S   LP +TI ++F
Sbjct: 109 LSDEVLVHVYREIMSACLAQQEPLKIGYLGPEGTFSQQAVLKHFGRSAVGLPMATIEEVF 168

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSSIN 189
             VE G+  +G+VP ENS  G++  TLD F++    I  E  LR+   L S++ +   I 
Sbjct: 169 QEVEAGNADFGVVPVENSGQGTIQVTLDMFLTSNLKICGEVELRVHQYLFSRNGRLEDIE 228

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGLE- 248
           ++Y+H Q F Q   +L SHL + ++I   S ++ A  A +   +AAI   + A +YGL+ 
Sbjct: 229 RIYAHSQSFAQTAGWLRSHLPKVEKIAVSSNAEGARRARNAEDAAAIGGESAAHVYGLKK 288

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
           V+ K I+D  +N TRF ++G      SG+D+T +L  + H +PGAL D LS F  HGI++
Sbjct: 289 VIMKSIEDDDDNTTRFLVIGRQIFPSSGHDRTSVLVFI-HDKPGALFDVLSPFARHGISM 347

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYP 359
            +I+SRPS Q  W Y FF++L GH ED+ +++AL ++      +K+LGSYP
Sbjct: 348 NRIESRPSHQAKWEYGFFIDLIGHVEDDAMKQALAELKAHSAQIKVLGSYP 398



>gi|357417464|ref|YP_004930484.1| putative bifunctional chorismate mutase/prephenate dehydratase
           [Pseudoxanthomonas spadix BD-a59]
 gi|503926625|ref|WP_014160619.1| prephenate dehydratase [Pseudoxanthomonas spadix]
 gi|355335042|gb|AER56443.1| putative bifunctional chorismate mutase/prephenate dehydratase
           [Pseudoxanthomonas spadix BD-a59]
          Length = 386

 Score =  254 bits (648), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 136/355 (38%), Positives = 207/355 (58%), Gaps = 7/355 (1%)

Query: 11  QIDSIDTKLVQLLNERARVSLNLEKAKEGSYXXXXXXXXVYVSGKENQIFDRIHRLNNGP 70
           +IDSID ++  L+ ERAR +  + KAK             Y   +E Q+   +   N GP
Sbjct: 37  KIDSIDRQIQALIAERARFAHQVGKAK----GKLAAAVDYYRPEREAQVLRMVIDRNEGP 92

Query: 71  LSSESLVSIYKEIISASVSSQKDLSIAYFGPLGSYTHQAAIVRFGDSINYLPKSTINDIF 130
           LS E LV +++EI+SA ++ Q+ L I Y GP G+++ QA +  FG S   LP ++I ++F
Sbjct: 93  LSDELLVHVFREIMSACLAQQEPLKIGYLGPEGTFSQQAVLKHFGRSALGLPMASIEEVF 152

Query: 131 DSVEKGHTTYGIVPFENSTYGSVVTTLDRFISCKTHILAETYLRISHCLLSKS-KFSSIN 189
             VE G+  +G+VP ENS  G++  TLD F++    I  E  LR+   L+S+S +   I 
Sbjct: 153 QEVENGNADFGVVPVENSGQGTIQITLDMFLTSNLKICGEVELRVQQYLMSRSGRLEDIE 212

Query: 190 KVYSHPQGFGQCQKYLDSHLKEAQRIDALSTSKAAEIAASEPYSAAIASITCAELYGL-E 248
           +VY+HPQ F Q   +L ++L +A+++   S ++ A  A +   +AAI   +    YGL +
Sbjct: 213 RVYAHPQSFMQTSGWLRANLPKAEKVPVSSNAEGARRARNSDDAAAIGGESAVHAYGLKK 272

Query: 249 VLGKDIQDAKNNVTRFFILGSSSEKPSGNDKTFILFTVDHQRPGALCDGLSVFKDHGINL 308
           V+   IQD K+N TRF ++G      SG+D+T +L  + H +PGAL D LS F  HGI++
Sbjct: 273 VVMSPIQDDKDNTTRFLVVGRQIFPSSGHDRTSVLVFI-HDKPGALFDVLSPFARHGISM 331

Query: 309 LKIDSRPSSQQPWHYVFFVELQGHKEDEVVQKALNKINEFCLDVKILGSYPDQRP 363
            +I+SRPS    W Y FF++L GH EDE ++ AL ++      +K+LGSYP   P
Sbjct: 332 SRIESRPSLHAKWEYGFFIDLAGHVEDEPMKLALAELKAHSAQIKVLGSYPVAVP 386