BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10173_c0_seq1-m.68 5prime_partial 126-1010(-) 295 (-)
         (294 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|170094036|ref|XP_001878239.1| pyrroline-5-carboxylate reducta...   319   7e-85   Laccaria bicolor S238N-H82
gi|336367023|gb|EGN95368.1| hypothetical protein SERLA73DRAFT_18...   315   8e-84   Serpula lacrymans var. lacrymans S7.3
gi|449547429|gb|EMD38397.1| hypothetical protein CERSUDRAFT_1135...   310   2e-82   Gelatoporia subvermispora B
gi|402225594|gb|EJU05655.1| pyrroline-5-carboxylate reductase [D...   310   3e-82   Dacryopinax primogenitus
gi|392558509|gb|EIW51696.1| pyrroline-5-carboxylate reductase [T...   308   1e-81   Trametes versicolor FP-101664 SS1
gi|443926280|gb|ELU44983.1| glycosyltransferase family 15 protei...   307   2e-81   Rhizoctonia solani AG-1 IA
gi|395333543|gb|EJF65920.1| pyrroline-5-carboxylate reductase [D...   306   4e-81   Dichomitus squalens LYAD-421 SS1
gi|393245481|gb|EJD52991.1| pyrroline-5-carboxylate reductase [A...   306   5e-81   Auricularia subglabra TFB-10046 SS5
gi|389748731|gb|EIM89908.1| pyrroline-5-carboxylate reductase [S...   305   1e-80   Stereum hirsutum FP-91666 SS1
gi|390598038|gb|EIN07437.1| pyrroline-5-carboxylate reductase [P...   304   1e-80   Punctularia strigosozonata HHB-11173 SS5
gi|409046121|gb|EKM55601.1| hypothetical protein PHACADRAFT_2563...   303   3e-80   Phanerochaete carnosa HHB-10118-sp
gi|443896444|dbj|GAC73788.1| pyrroline-5-carboxylate reductase [...   302   7e-80   Moesziomyces antarcticus T-34
gi|328848132|gb|EGF97382.1| hypothetical protein MELLADRAFT_7373...   300   3e-79   Melampsora larici-populina 98AG31
gi|58268178|ref|XP_571245.1| pyrroline-5-carboxylate reductase [...   298   9e-79   Cryptococcus neoformans var. neoformans JEC21
gi|321260378|ref|XP_003194909.1| pyrroline-5-carboxylate reducta...   298   1e-78   Cryptococcus gattii WM276
gi|409082677|gb|EKM83035.1| hypothetical protein AGABI1DRAFT_344...   298   1e-78   Agaricus bisporus var. burnettii JB137-S8
gi|426200545|gb|EKV50469.1| hypothetical protein AGABI2DRAFT_632...   296   3e-78   Agaricus bisporus var. bisporus H97
gi|405121450|gb|AFR96219.1| pyrroline-5-carboxylate reductase [C...   296   4e-78   Cryptococcus neoformans var. grubii H99
gi|164661345|ref|XP_001731795.1| hypothetical protein MGL_1063 [...   295   9e-78   Malassezia globosa CBS 7966
gi|388581293|gb|EIM21602.1| pyrroline-5-carboxylate reductase [W...   295   1e-77   Wallemia mellicola CBS 633.66
gi|331213523|ref|XP_003319443.1| pyrroline-5-carboxylate reducta...   294   2e-77   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|302690990|ref|XP_003035174.1| hypothetical protein SCHCODRAFT...   294   2e-77   Schizophyllum commune H4-8
gi|392572612|gb|EIW65757.1| hypothetical protein TREMEDRAFT_7041...   294   2e-77   Tremella mesenterica DSM 1558
gi|358054896|dbj|GAA99109.1| hypothetical protein E5Q_05798 [Mix...   293   3e-77   Mixia osmundae IAM 14324
gi|323508089|emb|CBQ67960.1| probable PRO3-delta 1-pyrroline-5-c...   293   3e-77   Sporisorium reilianum SRZ2
gi|89267109|emb|CAJ41977.1| 1-pyrroline-5-carboxylate reductase ...   292   7e-77   Ustilago hordei
gi|71004056|ref|XP_756694.1| hypothetical protein UM00547.1 [Ust...   292   9e-77   
gi|505759556|gb|EOR03647.1| Pyrroline-5-carboxylate reductase [W...   283   4e-74   Wallemia ichthyophaga EXF-994
gi|465792850|emb|CCU98092.1| unnamed protein product [Malassezia...   280   2e-73   Malassezia sympodialis ATCC 42132
gi|472581695|gb|EMS19418.1| pyrroline-5-carboxylate reductase [R...   278   1e-72   Rhodotorula toruloides NP11
gi|501310523|dbj|GAC99281.1| pyrroline-5-carboxylate reductase [...   276   3e-72   Pseudozyma hubeiensis SY62
gi|353237245|emb|CCA69222.1| probable PRO3-delta 1-pyrroline-5-c...   275   1e-71   Serendipita indica DSM 11827
gi|501755979|emb|CCG80872.1| Pyrroline-5-carboxylate reductase [...   272   9e-71   Taphrina deformans PYCC 5710
gi|169854118|ref|XP_001833736.1| pyrroline-5-carboxylate reducta...   268   1e-69   Coprinopsis cinerea okayama7#130
gi|296417711|ref|XP_002838496.1| hypothetical protein [Tuber mel...   267   2e-69   Tuber melanosporum Mel28
gi|403415698|emb|CCM02398.1| predicted protein [Fibroporia radic...   254   1e-65   Fibroporia radiculosa
gi|345569211|gb|EGX52079.1| hypothetical protein AOL_s00043g469 ...   253   4e-65   Arthrobotrys oligospora ATCC 24927
gi|213401291|ref|XP_002171418.1| delta-1-pyrroline-5-carboxylate...   242   9e-62   
gi|494028903|ref|WP_006971043.1| pyrroline-5-carboxylate reducta...   239   6e-61   Plesiocystis pacifica
gi|19115618|ref|NP_594706.1| delta-1-pyrroline-5-carboxylate red...   238   1e-60   Schizosaccharomyces pombe 972h-
gi|295674063|ref|XP_002797577.1| pyrroline-5-carboxylate reducta...   235   1e-59   Paracoccidioides lutzii Pb01
gi|261195514|ref|XP_002624161.1| pyrroline-5-carboxylate reducta...   235   1e-59   Blastomyces gilchristii SLH14081
gi|494827426|gb|EON64376.1| pyrroline-5-carboxylate reductase [C...   231   2e-58   Coniosporium apollinis CBS 100218
gi|470303871|ref|XP_004347993.1| pyrroline-5-carboxylate reducta...   230   4e-58   
gi|367027036|ref|XP_003662802.1| hypothetical protein MYCTH_2109...   229   7e-58   Myceliophthora thermophila ATCC 42464
gi|240275961|gb|EER39474.1| pyrroline-5-carboxylate reductase [A...   228   2e-57   Histoplasma capsulatum H143
gi|303315191|ref|XP_003067603.1| pyrroline-5-carboxylate reducta...   228   2e-57   Coccidioides posadasii C735 delta SOWgp
gi|119190685|ref|XP_001245949.1| hypothetical protein CIMG_05390...   227   2e-57   Coccidioides immitis RS
gi|325093323|gb|EGC46633.1| pyrroline-5-carboxylate reductase [A...   227   2e-57   Histoplasma capsulatum H88
gi|225563366|gb|EEH11645.1| pyrroline-5-carboxylate reductase [A...   227   3e-57   Histoplasma capsulatum G186AR
gi|258565221|ref|XP_002583355.1| pyrroline-5-carboxylate reducta...   227   3e-57   Uncinocarpus reesii 1704
gi|485920331|gb|EOD46392.1| putative pyrroline-5-carboxylate red...   226   4e-57   Neofusicoccum parvum UCRNP2
gi|380494058|emb|CCF33433.1| pyrroline-5-carboxylate reductase [...   222   1e-55   Colletotrichum higginsianum
gi|3024443|sp|Q12740.1|P5CR_ZALAR RecName: Full=Pyrroline-5-carb...   222   1e-55   Zalerion arboricola
gi|378731725|gb|EHY58184.1| pyrroline-5-carboxylate reductase [E...   221   1e-55   Exophiala dermatitidis NIH/UT8656
gi|226286813|gb|EEH42326.1| pyrroline-5-carboxylate reductase [P...   221   1e-55   
gi|225684647|gb|EEH22931.1| pyrroline-5-carboxylate reductase [P...   221   2e-55   
gi|340905270|gb|EGS17638.1| pyrroline-5-carboxylate reductase-li...   220   3e-55   Chaetomium thermophilum var. thermophilum DSM 1495
gi|367050804|ref|XP_003655781.1| hypothetical protein THITE_2119...   220   3e-55   Thielavia terrestris NRRL 8126
gi|116192021|ref|XP_001221823.1| hypothetical protein CHGG_05728...   220   4e-55   Chaetomium globosum CBS 148.51
gi|327303914|ref|XP_003236649.1| pyrroline-5-carboxylate reducta...   219   7e-55   Trichophyton rubrum CBS 118892
gi|154281979|ref|XP_001541802.1| pyrroline-5-carboxylate reducta...   217   3e-54   Histoplasma capsulatum NAm1
gi|326475935|gb|EGD99944.1| pyrroline-5-carboxylate reductase [T...   217   3e-54   Trichophyton tonsurans CBS 112818
gi|296812163|ref|XP_002846419.1| pyrroline-5-carboxylate reducta...   216   5e-54   Arthroderma otae CBS 113480
gi|392595731|gb|EIW85054.1| hypothetical protein CONPUDRAFT_6998...   216   6e-54   Coniophora puteana RWD-64-598 SS2
gi|477526433|gb|ENH78300.1| pyrroline-5-carboxylate reductase [C...   216   7e-54   Colletotrichum orbiculare MAFF 240422
gi|407917759|gb|EKG11062.1| Pyrroline-5-carboxylate reductase [M...   216   7e-54   Macrophomina phaseolina MS6
gi|402079075|gb|EJT74340.1| pyrroline-5-carboxylate reductase [G...   215   9e-54   Gaeumannomyces graminis var. tritici R3-111a-1
gi|310793148|gb|EFQ28609.1| pyrroline-5-carboxylate reductase [G...   214   2e-53   Colletotrichum graminicola M1.001
gi|400599289|gb|EJP66993.1| pyrroline-5-carboxylate reductase [B...   213   4e-53   Beauveria bassiana ARSEF 2860
gi|346327268|gb|EGX96864.1| pyrroline-5-carboxylate reductase [C...   213   4e-53   Cordyceps militaris CM01
gi|50546825|ref|XP_500882.1| YALI0B14399p [Yarrowia lipolytica] ...   213   4e-53   Yarrowia lipolytica CLIB122
gi|212537219|ref|XP_002148765.1| pyrroline-5-carboxylate reducta...   212   7e-53   Talaromyces marneffei ATCC 18224
gi|429856555|gb|ELA31460.1| pyrroline-5-carboxylate reductase [C...   212   7e-53   Colletotrichum gloeosporioides Nara gc5
gi|326484756|gb|EGE08766.1| pyrroline-5-carboxylate reductase [T...   211   2e-52   Trichophyton equinum CBS 127.97
gi|302502104|ref|XP_003013043.1| pyrroline-5-carboxylate reducta...   210   4e-52   Arthroderma benhamiae CBS 112371
gi|302667838|ref|XP_003025498.1| pyrroline-5-carboxylate reducta...   210   5e-52   Trichophyton verrucosum HKI 0517
gi|482806436|gb|EOA83509.1| hypothetical protein SETTUDRAFT_1401...   209   5e-52   Setosphaeria turcica Et28A
gi|242809886|ref|XP_002485467.1| pyrroline-5-carboxylate reducta...   209   1e-51   Talaromyces stipitatus ATCC 10500
gi|491178612|ref|WP_005036975.1| pyrroline-5-carboxylate reducta...   208   2e-51   Holophaga foetida
gi|389639130|ref|XP_003717198.1| pyrroline-5-carboxylate reducta...   208   2e-51   Magnaporthe oryzae 70-15
gi|449303404|gb|EMC99412.1| hypothetical protein BAUCODRAFT_6492...   207   2e-51   Baudoinia panamericana UAMH 10762
gi|451850227|gb|EMD63529.1| hypothetical protein COCSADRAFT_3731...   207   2e-51   Bipolaris sorokiniana ND90Pr
gi|406981296|gb|EKE02789.1| hypothetical protein ACD_20C00330G00...   207   3e-51   uncultured bacterium
gi|330914642|ref|XP_003296720.1| hypothetical protein PTT_06898 ...   207   4e-51   Pyrenophora teres f. teres 0-1
gi|451993370|gb|EMD85844.1| hypothetical protein COCHEDRAFT_1228...   207   4e-51   Bipolaris maydis C5
gi|512202920|gb|EPE31746.1| 6-phosphogluconate dehydrogenase C-t...   206   4e-51   Glarea lozoyensis ATCC 20868
gi|189207428|ref|XP_001940048.1| pyrroline-5-carboxylate reducta...   205   1e-50   Pyrenophora tritici-repentis Pt-1C-BFP
gi|358378995|gb|EHK16676.1| hypothetical protein TRIVIDRAFT_4115...   204   2e-50   Trichoderma virens Gv29-8
gi|46125755|ref|XP_387431.1| hypothetical protein FG07255.1 [Fus...   202   8e-50   
gi|408400541|gb|EKJ79620.1| hypothetical protein FPSE_00180 [Fus...   202   8e-50   Fusarium pseudograminearum CS3096
gi|302916081|ref|XP_003051851.1| predicted protein [Nectria haem...   202   1e-49   Nectria haematococca mpVI 77-13-4
gi|342885847|gb|EGU85799.1| hypothetical protein FOXB_03647 [Fus...   201   1e-49   Fusarium oxysporum Fo5176
gi|322707252|gb|EFY98831.1| pyrroline-5-carboxylate reductase [M...   201   1e-49   Metarhizium robertsii ARSEF 23
gi|322701653|gb|EFY93402.1| pyrroline-5-carboxylate reductase [M...   201   2e-49   Metarhizium acridum CQMa 102
gi|340520658|gb|EGR50894.1| delta 1-pyrroline-5-carboxylate redu...   201   2e-49   Trichoderma reesei QM6a
gi|220931043|ref|YP_002507951.1| pyrroline-5-carboxylate reducta...   200   4e-49   
gi|160901706|ref|YP_001567287.1| pyrroline-5-carboxylate reducta...   199   9e-49   
gi|302036141|ref|YP_003796463.1| pyrroline-5-carboxylate reducta...   198   1e-48   
gi|358391797|gb|EHK41201.1| hypothetical protein TRIATDRAFT_1353...   198   2e-48   Trichoderma atroviride IMI 206040
gi|218511626|gb|ACK77800.1| pyrroline-5-carboxylate reductase [E...   197   2e-48   Epichloe festucae
gi|320582835|gb|EFW97052.1| Delta 1-pyrroline-5-carboxylate redu...   196   8e-48   
gi|491629570|ref|WP_005487109.1| Pyrroline-5-carboxylate reducta...   194   2e-47   Halanaerobium saccharolyticum
gi|396479339|ref|XP_003840731.1| similar to pyrroline-5-carboxyl...   194   3e-47   Leptosphaeria maculans JN3
gi|320590762|gb|EFX03205.1| pyrroline-5-carboxylate reductase [G...   192   9e-47   Grosmannia clavigera kw1407
gi|320106569|ref|YP_004182159.1| pyrroline-5-carboxylate reducta...   191   1e-46   
gi|453085040|gb|EMF13083.1| pyrroline carboxylate reductase [Myc...   191   2e-46   Sphaerulina musiva SO2202
gi|94968506|ref|YP_590554.1| pyrroline-5-carboxylate reductase [...   191   3e-46   
gi|477511765|gb|ENH64326.1| Pyrroline-5-carboxylate reductase [F...   190   3e-46   Fusarium oxysporum f. sp. cubense race 1
gi|390957275|ref|YP_006421032.1| pyrroline-5-carboxylate reducta...   190   4e-46   
gi|374311591|ref|YP_005058021.1| pyrroline-5-carboxylate reducta...   190   5e-46   
gi|296133621|ref|YP_003640868.1| pyrroline-5-carboxylate reducta...   189   6e-46   
gi|398406210|ref|XP_003854571.1| hypothetical protein MYCGRDRAFT...   189   9e-46   Zymoseptoria tritici IPO323
gi|405954084|gb|EKC21616.1| Pyrroline-5-carboxylate reductase 2 ...   188   2e-45   Crassostrea gigas
gi|399168128|emb|CCE31060.1| probable pyrroline-5-carboxylate re...   186   8e-45   Claviceps purpurea 20.1
gi|452843796|gb|EME45731.1| hypothetical protein DOTSEDRAFT_1509...   186   9e-45   Dothistroma septosporum NZE10
gi|410075812|ref|XP_003955488.1| hypothetical protein KAFR_0B005...   185   1e-44   Kazachstania africana CBS 2517
gi|262197892|ref|YP_003269101.1| pyrroline-5-carboxylate reducta...   184   2e-44   
gi|347756408|ref|YP_004863971.1| pyrroline-5-carboxylate reducta...   184   2e-44   
gi|385800505|ref|YP_005836909.1| pyrroline-5-carboxylate reducta...   184   2e-44   
gi|367017274|ref|XP_003683135.1| hypothetical protein TDEL_0H006...   184   3e-44   Torulaspora delbrueckii
gi|302036992|ref|YP_003797314.1| pyrroline-5-carboxylate reducta...   182   6e-44   
gi|226228665|ref|YP_002762771.1| pyrroline-5-carboxylate reducta...   182   8e-44   
gi|401842869|gb|EJT44893.1| PRO3-like protein [Saccharomyces kud...   182   9e-44   Saccharomyces kudriavzevii IFO 1802
gi|392376015|ref|YP_003207848.1| Pyrroline-5-carboxylate reducta...   182   1e-43   
gi|302811797|ref|XP_002987587.1| hypothetical protein SELMODRAFT...   182   1e-43   Selaginella moellendorffii
gi|302811968|ref|XP_002987672.1| hypothetical protein SELMODRAFT...   181   1e-43   Selaginella moellendorffii
gi|398364353|ref|NP_010940.3| pyrroline-5-carboxylate reductase ...   181   2e-43   Saccharomyces cerevisiae S288c
gi|401626076|gb|EJS44041.1| pro3p [Saccharomyces arboricola H-6]      181   2e-43   Saccharomyces arboricola H-6
gi|254573436|ref|XP_002493827.1| Delta 1-pyrroline-5-carboxylate...   181   2e-43   Komagataella phaffii GS115
gi|291279671|ref|YP_003496506.1| pyrroline-5-carboxylate reducta...   181   2e-43   
gi|448103539|ref|XP_004200060.1| Piso0_002622 [Millerozyma farin...   181   3e-43   Millerozyma farinosa CBS 7064
gi|225872876|ref|YP_002754333.1| pyrroline-5-carboxylate reducta...   181   3e-43   
gi|497645099|ref|WP_009959283.1| pyrroline-5-carboxylate reducta...   180   3e-43   
gi|50290353|ref|XP_447608.1| hypothetical protein [Candida glabr...   180   4e-43   Candida glabrata CBS 138
gi|470477115|ref|XP_004342330.1| pyrroline5-carboxylate reductas...   180   4e-43   Acanthamoeba castellanii str. Neff
gi|45185399|ref|NP_983116.1| ABR168Wp [Ashbya gossypii ATCC 1089...   180   4e-43   Eremothecium gossypii ATCC 10895
gi|15241505|ref|NP_196984.1| Pyrroline-5-carboxylate reductase [...   180   5e-43   Arabidopsis thaliana [mouse-ear cress]
gi|336268852|ref|XP_003349188.1| hypothetical protein SMAC_08891...   179   5e-43   Sordaria macrospora k-hell
gi|384253054|gb|EIE26529.1| pyrroline-5-carboxylate reductase [C...   179   6e-43   Coccomyxa subellipsoidea C-169
gi|448099696|ref|XP_004199207.1| Piso0_002622 [Millerozyma farin...   179   7e-43   Millerozyma farinosa CBS 7064
gi|151944733|gb|EDN62992.1| delta 1-pyrroline-5-carboxylate redu...   179   7e-43   Saccharomyces cerevisiae YJM789
gi|482557125|gb|EOA21317.1| hypothetical protein CARUB_v10001677...   179   8e-43   Capsella rubella
gi|443731335|gb|ELU16504.1| hypothetical protein CAPTEDRAFT_1665...   179   8e-43   Capitella teleta
gi|513030597|gb|AGO10622.1| AaceriABR168Wp [Saccharomycetaceae s...   179   9e-43   Saccharomycetaceae sp. 'Ashbya aceri'
gi|312283283|dbj|BAJ34507.1| unnamed protein product [Thellungie...   179   1e-42   Eutrema halophilum
gi|312144184|ref|YP_003995630.1| pyrroline-5-carboxylate reducta...   179   1e-42   
gi|297811617|ref|XP_002873692.1| predicted protein [Arabidopsis ...   177   3e-42   Arabidopsis lyrata subsp. lyrata
gi|491147273|ref|WP_005005672.1| Pyrroline-5-carboxylate reducta...   177   3e-42   Nitrospina gracilis
gi|294658299|ref|XP_460629.2| DEHA2F06182p [Debaryomyces hanseni...   177   3e-42   Debaryomyces hansenii CBS767
gi|510836295|ref|WP_016207927.1| pyrroline-5-carboxylate reducta...   177   4e-42   Clostridium
gi|68485401|ref|XP_713378.1| hypothetical protein CaO19.13095 [C...   176   6e-42   Candida albicans SC5314
gi|116871764|ref|YP_848545.1| pyrroline-5-carboxylate reductase ...   176   6e-42   
gi|333978625|ref|YP_004516570.1| pyrroline-5-carboxylate reducta...   176   6e-42   
gi|238881794|gb|EEQ45432.1| hypothetical protein CAWG_03758 [Can...   176   7e-42   Candida albicans WO-1
gi|241953964|ref|XP_002419703.1| delta 1-pyrroline-5-carboxylate...   176   7e-42   Candida dubliniensis CD36
gi|452984177|gb|EME83934.1| hypothetical protein MYCFIDRAFT_2071...   176   8e-42   Cercospora fijiensis CIRAD86
gi|296882319|gb|ADH83382.1| pyrroline-5-carboxylate reductase [A...   176   9e-42   Arabis stelleri
gi|260949641|ref|XP_002619117.1| hypothetical protein CLUG_00276...   176   9e-42   Clavispora lusitaniae ATCC 42720
gi|489814668|ref|WP_003718502.1| pyrroline-5-carboxylate reducta...   175   1e-41   Listeria ivanovii
gi|322435391|ref|YP_004217603.1| pyrroline-5-carboxylate reducta...   175   1e-41   
gi|190345405|gb|EDK37284.2| hypothetical protein PGUG_01382 [Mey...   175   1e-41   Meyerozyma guilliermondii ATCC 6260
gi|153952963|ref|YP_001393728.1| protein ProC1 [Clostridium kluy...   175   1e-41   
gi|407921134|gb|EKG14298.1| Pyrroline-5-carboxylate reductase [M...   175   2e-41   Macrophomina phaseolina MS6
gi|85859581|ref|YP_461783.1| pyrroline-5-carboxylate reductase [...   174   2e-41   
gi|449449789|ref|XP_004142647.1| PREDICTED: pyrroline-5-carboxyl...   174   2e-41   Cucumis sativus [cucumbers]
gi|294494984|ref|YP_003541477.1| pyrroline-5-carboxylate reducta...   174   2e-41   
gi|502108205|ref|XP_004493414.1| PREDICTED: pyrroline-5-carboxyl...   174   2e-41   Cicer arietinum [garbanzo]
gi|68485496|ref|XP_713331.1| hypothetical protein CaO19.5650 [Ca...   174   3e-41   Candida albicans SC5314
gi|126135592|ref|XP_001384320.1| delta 1-pyrroline-5-carboxylate...   174   3e-41   Scheffersomyces stipitis CBS 6054
gi|171686850|ref|XP_001908366.1| hypothetical protein [Podospora...   174   3e-41   Podospora anserina S mat+
gi|494658352|ref|WP_007416296.1| pyrroline-5-carboxylate reducta...   174   3e-41   Pedosphaera parvula
gi|459368904|gb|EMG47481.1| Pyrroline-5-carboxylate reductase [C...   173   4e-41   Candida maltosa Xu316
gi|255950990|ref|XP_002566262.1| Pc22g23710 [Penicillium chrysog...   173   5e-41   Penicillium rubens Wisconsin 54-1255
gi|488704297|ref|WP_002628269.1| Pyrroline-5-carboxylate reducta...   173   6e-41   Cystobacter fuscus
gi|336323350|ref|YP_004603317.1| pyrroline-5-carboxylate reducta...   172   7e-41   
gi|310822207|ref|YP_003954565.1| pyrroline-5-carboxylate reducta...   172   1e-40   
gi|146419499|ref|XP_001485711.1| hypothetical protein PGUG_01382...   171   2e-40   Meyerozyma guilliermondii ATCC 6260
gi|359482209|ref|XP_003632728.1| PREDICTED: pyrroline-5-carboxyl...   171   2e-40   Vitis vinifera
gi|508717158|gb|EOY09055.1| Pyrroline-5-carboxylate reductase is...   171   2e-40   Theobroma cacao [chocolate]
gi|153004253|ref|YP_001378578.1| pyrroline-5-carboxylate reducta...   171   2e-40   
gi|366989335|ref|XP_003674435.1| hypothetical protein NCAS_0A149...   171   2e-40   Naumovozyma castellii CBS 4309
gi|488777202|ref|YP_007946618.1| pyrroline-5-carboxylate reducta...   171   2e-40   
gi|255717398|ref|XP_002554980.1| KLTH0F18282p [Lachancea thermot...   170   3e-40   Lachancea thermotolerans CBS 6340
gi|488932336|ref|WP_002843411.1| pyrroline-5-carboxylate reducta...   170   4e-40   Peptostreptococcus anaerobius
gi|116781937|gb|ABK22304.1| unknown [Picea sitchensis]                170   5e-40   Picea sitchensis
gi|13161407|dbj|BAB33038.1| VuP5CR [Vigna unguiculata]                170   5e-40   Vigna unguiculata
gi|494423969|ref|WP_007221863.1| pyrroline-5-carboxylate reducta...   170   5e-40   Candidatus Jettenia caeni
gi|365990714|ref|XP_003672186.1| hypothetical protein NDAI_0J005...   169   6e-40   Naumovozyma dairenensis CBS 421
gi|488935027|ref|WP_002846102.1| pyrroline-5-carboxylate reducta...   169   7e-40   Peptostreptococcus anaerobius
gi|374851263|dbj|BAL54228.1| pyrroline-5-carboxylate reductase [...   169   8e-40   uncultured Acetothermia bacterium
gi|406603645|emb|CCH44846.1| Pyrroline-5-carboxylate reductase [...   169   8e-40   Wickerhamomyces ciferrii
gi|425771618|gb|EKV10056.1| hypothetical protein PDIP_61940 [Pen...   169   8e-40   Penicillium digitatum Pd1
gi|427723961|ref|YP_007071238.1| pyrroline-5-carboxylate reducta...   169   1e-39   
gi|351720961|ref|NP_001235914.1| pyrroline-5-carboxylate reducta...   169   1e-39   Glycine max [soybeans]
gi|489866774|ref|WP_003770357.1| pyrroline-5-carboxylate reducta...   169   1e-39   Listeria innocua
gi|472241047|gb|EMR85786.1| putative pyrroline-5-carboxylate red...   168   1e-39   Botrytis cinerea BcDW1
gi|495951547|ref|WP_008676126.1| pyrroline-5-carboxylate reducta...   168   1e-39   Clostridium sp. 7_2_43FAA
gi|3024430|sp|O04016.1|P5CR_ACTCH RecName: Full=Pyrroline-5-carb...   168   1e-39   Actinidia chinensis
gi|489856703|ref|WP_003760363.1| pyrroline-5-carboxylate reducta...   168   1e-39   
gi|356504710|ref|XP_003521138.1| PREDICTED: pyrroline-5-carboxyl...   168   1e-39   Glycine max [soybeans]
gi|193216290|ref|YP_001997489.1| pyrroline-5-carboxylate reducta...   168   1e-39   
gi|91203115|emb|CAJ72754.1| strongly similar to pyrroline-5-carb...   168   2e-39   Candidatus Kuenenia stuttgartiensis
gi|498163372|ref|WP_010477528.1| pyrroline-5-carboxylate reducta...   168   2e-39   Thermococcus zilligii
gi|352684240|ref|YP_004896225.1| pyrroline-5-carboxylate reducta...   168   2e-39   
gi|444321382|ref|XP_004181347.1| hypothetical protein TBLA_0F028...   168   2e-39   Tetrapisispora blattae CBS 6284
gi|255720823|ref|XP_002545346.1| hypothetical protein CTRG_00127...   168   2e-39   Candida tropicalis MYA-3404
gi|149236906|ref|XP_001524330.1| hypothetical protein LELG_04301...   167   2e-39   Lodderomyces elongisporus NRRL YB-4239
gi|221101584|ref|XP_002156499.1| PREDICTED: pyrroline-5-carboxyl...   167   2e-39   Hydra vulgaris
gi|462397960|gb|EMJ03628.1| hypothetical protein PRUPE_ppa009813...   167   3e-39   Prunus persica
gi|489542990|ref|WP_003447668.1| pyrroline-5-carboxylate reducta...   167   3e-39   Clostridium pasteurianum
gi|337286657|ref|YP_004626130.1| pyrroline-5-carboxylate reducta...   167   3e-39   
gi|496232772|ref|WP_008946807.1| pyrroline-5-carboxylate reducta...   167   3e-39   
gi|496845354|ref|WP_009383599.1| pyrroline-5-carboxylate reducta...   167   3e-39   
gi|488729092|ref|WP_002652522.1| pyrroline-5-carboxylate reducta...   167   3e-39   Blastopirellula marina
gi|367005013|ref|XP_003687239.1| hypothetical protein TPHA_0I030...   167   3e-39   Tetrapisispora phaffii CBS 4417
gi|16799491|ref|NP_469759.1| pyrroline-5-carboxylate reductase [...   167   3e-39   
gi|493547940|ref|WP_006501660.1| pyrroline-5-carboxylate reducta...   167   3e-39   Austwickia chelonae
gi|488773199|ref|YP_007942993.1| pyrroline-5-carboxylate reducta...   166   5e-39   
gi|147678161|ref|YP_001212376.1| pyrroline-5-carboxylate reducta...   166   5e-39   
gi|496135802|ref|WP_008860309.1| pyrroline-5-carboxylate reducta...   166   5e-39   Dialister succinatiphilus
gi|493857808|ref|WP_006804652.1| pyrroline-5-carboxylate reducta...   166   5e-39   
gi|325087307|gb|ADY77003.1| pyrroline-5-carboxylate reductase [I...   166   6e-39   Ipomoea batatas [batate]
gi|494038537|ref|WP_006980663.1| pyrroline-5-carboxylate reducta...   166   6e-39   
gi|511059070|ref|YP_008070955.1| pyrroline-5-carboxylate reducta...   166   6e-39   
gi|328953832|ref|YP_004371166.1| pyrroline-5-carboxylate reducta...   166   6e-39   
gi|242059889|ref|XP_002459090.1| hypothetical protein SORBIDRAFT...   166   7e-39   Sorghum bicolor [broomcorn]
gi|386713412|ref|YP_006179735.1| pyrroline-5-carboxylate reducta...   166   9e-39   
gi|159478757|ref|XP_001697467.1| pyrroline-5-carboxylate reducta...   166   1e-38   Chlamydomonas reinhardtii
gi|479159509|ref|YP_007788778.1| pyrroline-5-carboxylate reducta...   166   1e-38   
gi|323305217|gb|EGA58964.1| Pro3p [Saccharomyces cerevisiae Fost...   166   1e-38   Saccharomyces cerevisiae FostersB
gi|498273462|ref|WP_010587618.1| pyrroline-5-carboxylate reducta...   165   1e-38   Schlesneria paludicola
gi|159478755|ref|XP_001697466.1| pyrroline-5-carboxylate reducta...   165   1e-38   Chlamydomonas reinhardtii
gi|493646408|ref|WP_006598015.1| pyrroline-5-carboxylate reducta...   165   1e-38   Pseudoramibacter alactolyticus
gi|435853591|ref|YP_007314910.1| pyrroline-5-carboxylate reducta...   165   1e-38   
gi|326512934|dbj|BAK03374.1| predicted protein [Hordeum vulgare ...   165   2e-38   Hordeum vulgare subsp. vulgare [barley]
gi|488670361|ref|WP_002599165.1| pyrroline-5-carboxylate reducta...   165   2e-38   Clostridium colicanis
gi|389853012|ref|YP_006355246.1| pyrroline-5-carboxylate reducta...   164   2e-38   
gi|344300349|gb|EGW30670.1| hypothetical protein SPAPADRAFT_1418...   164   2e-38   Spathaspora passalidarum NRRL Y-27907
gi|386046056|ref|YP_005964388.1| pyrroline-5-carboxylate reducta...   164   2e-38   
gi|497918663|ref|WP_010232819.1| pyrroline-5-carboxylate reducta...   164   2e-38   Clostridium arbusti
gi|493564093|ref|WP_006517467.1| pyrroline-5-carboxylate reducta...   164   3e-38   
gi|491351902|ref|WP_005209824.1| pyrroline-5-carboxylate reducta...   164   3e-38   Clostridium celatum
gi|162459912|ref|NP_001105787.1| pyrroline 5-carboxylate reducta...   164   3e-38   Zea mays [maize]
gi|254581050|ref|XP_002496510.1| ZYRO0D01782p [Zygosaccharomyces...   164   3e-38   Zygosaccharomyces rouxii CBS 732
gi|354547684|emb|CCE44419.1| hypothetical protein CPAR2_402200 [...   164   3e-38   Candida parapsilosis
gi|321454186|gb|EFX65367.1| hypothetical protein DAPPUDRAFT_6553...   164   3e-38   Daphnia pulex
gi|196008649|ref|XP_002114190.1| hypothetical protein TRIADDRAFT...   164   3e-38   Trichoplax adhaerens
gi|492844733|ref|WP_005998687.1| pyrroline-5-carboxylate reducta...   164   3e-38   Desulfuromonas acetoxidans
gi|403216535|emb|CCK71032.1| hypothetical protein KNAG_0F03700 [...   164   4e-38   Kazachstania naganishii CBS 8797
gi|488723558|ref|WP_002647263.1| pyrroline-5-carboxylate reducta...   164   4e-38   
gi|410667634|ref|YP_006920005.1| pyrroline-5-carboxylate reducta...   164   4e-38   
gi|225717538|gb|ACO14615.1| Pyrroline-5-carboxylate reductase [C...   164   4e-38   Caligus clemensi
gi|326428636|gb|EGD74206.1| delta-1-pyrroline-5-carboxylate redu...   164   4e-38   Salpingoeca rosetta
gi|470135610|ref|XP_004303606.1| PREDICTED: pyrroline-5-carboxyl...   163   4e-38   Fragaria vesca subsp. vesca
gi|220906892|ref|YP_002482203.1| pyrroline-5-carboxylate reducta...   163   4e-38   
gi|357126786|ref|XP_003565068.1| PREDICTED: pyrroline-5-carboxyl...   163   4e-38   
gi|257126318|ref|YP_003164432.1| pyrroline-5-carboxylate reducta...   163   5e-38   
gi|471558907|gb|EMR61456.1| putative pyrroline-5-carboxylate red...   163   5e-38   Eutypa lata UCREL1
gi|347547818|ref|YP_004854146.1| putative 1-pyrroline-5-carboxyl...   163   6e-38   
gi|496458781|ref|WP_009167626.1| pyrroline-5-carboxylate reducta...   163   6e-38   Clostridium sp. DL-VIII
gi|489501765|ref|WP_003406663.1| pyrroline-5-carboxylate reducta...   163   6e-38   Clostridium butyricum
gi|488646215|ref|WP_002582847.1| pyrroline-5-carboxylate reducta...   163   6e-38   Clostridium butyricum
gi|497318361|ref|WP_009632574.1| pyrroline-5-carboxylate reducta...   163   6e-38   
gi|336477724|ref|YP_004616865.1| pyrroline-5-carboxylate reducta...   163   6e-38   
gi|460374908|ref|XP_004233250.1| PREDICTED: pyrroline-5-carboxyl...   163   6e-38   Solanum lycopersicum
gi|488696045|ref|WP_002620110.1| pyrroline-5-carboxylate reducta...   163   7e-38   
gi|494500444|ref|WP_007289907.1| pyrroline-5-carboxylate reducta...   162   7e-38   Thermosinus carboxydivorans
gi|497854018|ref|WP_010168174.1| pyrroline-5-carboxylate reducta...   162   8e-38   Epulopiscium sp. 'N.t. morphotype B'
gi|490744279|ref|WP_004606587.1| hypothetical protein [Clostridi...   162   8e-38   [Clostridium] scindens
gi|212224037|ref|YP_002307273.1| pyrroline-5-carboxylate reducta...   162   8e-38   
gi|16802441|ref|NP_463926.1| pyrroline-5-carboxylate reductase [...   162   8e-38   Listeria monocytogenes EGD-e
gi|404495759|ref|YP_006719865.1| Delta-1-pyrroline-5-carboxylate...   162   8e-38   
gi|460374910|ref|XP_004233251.1| PREDICTED: pyrroline-5-carboxyl...   162   9e-38   
gi|363755294|ref|XP_003647862.1| hypothetical protein Ecym_7197 ...   162   9e-38   Eremothecium cymbalariae DBVPG#7215
gi|489861672|ref|WP_003765300.1| pyrroline-5-carboxylate reducta...   162   9e-38   Listeria innocua
gi|497939869|ref|WP_010254025.1| pyrroline-5-carboxylate reducta...   162   9e-38   Treponema primitia
gi|58843559|gb|AAW82908.1| pyrroline-5-carboxylate reductase [Tr...   162   1e-37   Triticum aestivum [Canadian hard winter wheat]
gi|289433717|ref|YP_003463589.1| delta 1-pyrroline-5-carboxylate...   162   1e-37   
gi|156846715|ref|XP_001646244.1| hypothetical protein Kpol_1013p...   162   1e-37   
gi|18978087|ref|NP_579444.1| pyrroline-5-carboxylate reductase [...   162   1e-37   
gi|440639079|gb|ELR08998.1| pyrroline-5-carboxylate reductase [G...   162   1e-37   
gi|405958880|gb|EKC24964.1| Pyrroline-5-carboxylate reductase 1,...   162   1e-37   
gi|170759810|ref|YP_001788502.1| pyrroline-5-carboxylate reducta...   162   1e-37   
gi|493609474|ref|WP_006561876.1| pyrroline-5-carboxylate reducta...   161   1e-37   
gi|187934225|ref|YP_001887712.1| pyrroline-5-carboxylate reducta...   161   1e-37   
gi|153940868|ref|YP_001392533.1| pyrroline-5-carboxylate reducta...   161   2e-37   
gi|494820424|ref|WP_007555832.1| pyrroline-5-carboxylate reducta...   161   2e-37   
gi|392406452|ref|YP_006443060.1| pyrroline-5-carboxylate reducta...   161   2e-37   
gi|495209928|ref|WP_007934708.1| pyrroline-5-carboxylate reducta...   161   2e-37   
gi|489465161|ref|WP_003370330.1| pyrroline-5-carboxylate reducta...   161   2e-37   
gi|475525316|gb|EMT07140.1| Pyrroline-5-carboxylate reductase [A...   161   2e-37   
gi|148263052|ref|YP_001229758.1| pyrroline-5-carboxylate reducta...   161   2e-37   
gi|298674098|ref|YP_003725848.1| pyrroline-5-carboxylate reducta...   161   2e-37   
gi|494818167|ref|WP_007553575.1| pyrroline-5-carboxylate reducta...   161   2e-37   
gi|159900081|ref|YP_001546328.1| pyrroline-5-carboxylate reducta...   161   2e-37   
gi|302837163|ref|XP_002950141.1| hypothetical protein VOLCADRAFT...   161   2e-37   
gi|302880787|ref|XP_003039325.1| hypothetical protein NECHADRAFT...   160   3e-37   
gi|496091086|ref|WP_008815593.1| pyrroline-5-carboxylate reducta...   160   3e-37   
gi|511333772|gb|EFV38771.2| pyrroline-5-carboxylate reductase [E...   160   3e-37   
gi|260815383|ref|XP_002602453.1| hypothetical protein BRAFLDRAFT...   160   3e-37   
gi|493321785|ref|WP_006279099.1| pyrroline-5-carboxylate reducta...   160   3e-37   
gi|169765374|ref|XP_001817158.1| pyrroline-5-carboxylate reducta...   160   3e-37   
gi|224086867|ref|XP_002307988.1| predicted protein [Populus tric...   160   3e-37   
gi|345017671|ref|YP_004820024.1| pyrroline-5-carboxylate reducta...   160   4e-37   
gi|226950610|ref|YP_002805701.1| pyrroline-5-carboxylate reducta...   160   4e-37   
gi|387819452|ref|YP_005679799.1| pyrroline-5-carboxylate reducta...   160   4e-37   
gi|495910003|ref|WP_008634582.1| pyrroline-5-carboxylate reducta...   160   4e-37   
gi|452824564|gb|EME31566.1| pyrroline-5-carboxylate reductase [G...   160   4e-37   
gi|489834366|ref|WP_003738090.1| pyrroline-5-carboxylate reducta...   160   4e-37   
gi|156043123|ref|XP_001588118.1| hypothetical protein SS1G_10564...   160   4e-37   
gi|170755914|ref|YP_001782821.1| pyrroline-5-carboxylate reducta...   160   4e-37   
gi|496372607|ref|WP_009081597.1| pyrroline-5-carboxylate reducta...   160   4e-37   
gi|428206723|ref|YP_007091076.1| pyrroline-5-carboxylate reducta...   160   5e-37   
gi|495228307|ref|WP_007953078.1| pyrroline-5-carboxylate reducta...   160   5e-37   
gi|489456348|ref|WP_003361607.1| pyrroline-5-carboxylate reducta...   160   5e-37   
gi|242247397|ref|NP_001156103.1| pyrroline-5-carboxylate reducta...   160   5e-37   
gi|298714588|emb|CBJ27579.1| delta-1-pyrroline-5-carboxylate red...   160   5e-37   
gi|489561803|ref|WP_003466334.1| pyrroline-5-carboxylate reducta...   160   6e-37   
gi|115442227|ref|NP_001045393.1| Os01g0948400 [Oryza sativa Japo...   160   6e-37   
gi|169621367|ref|XP_001804094.1| hypothetical protein SNOG_13893...   159   6e-37   
gi|333996577|ref|YP_004529189.1| pyrroline-5-carboxylate reducta...   159   6e-37   
gi|237796637|ref|YP_002864189.1| pyrroline-5-carboxylate reducta...   159   6e-37   
gi|22830927|dbj|BAC15792.1| putative pyrroline-5-carboxylate red...   159   6e-37   
gi|217965514|ref|YP_002351192.1| pyrroline-5-carboxylate reducta...   159   7e-37   
gi|404279946|ref|YP_006680844.1| pyrroline-5-carboxylate reducta...   159   8e-37   
gi|489839869|ref|WP_003743575.1| pyrroline-5-carboxylate reducta...   159   8e-37   
gi|489841789|ref|WP_003745489.1| pyrroline-5-carboxylate reducta...   159   8e-37   
gi|491509860|ref|WP_005367494.1| pyrroline-5-carboxylate reducta...   159   9e-37   
gi|489546345|ref|WP_003450994.1| pyrroline-5-carboxylate reducta...   159   9e-37   
gi|490192554|ref|WP_004091136.1| pyrroline-5-carboxylate reducta...   159   9e-37   
gi|188590426|ref|YP_001922695.1| pyrroline-5-carboxylate reducta...   159   9e-37   
gi|496100964|ref|WP_008825471.1| pyrroline-5-carboxylate reducta...   159   9e-37   
gi|424713263|ref|YP_007013978.1| Pyrroline-5-carboxylate reducta...   159   9e-37   
gi|448529872|ref|XP_003869944.1| Pro3 Delta 1-pyrroline-5-carbox...   159   9e-37   
gi|489965862|ref|WP_003869106.1| pyrroline-5-carboxylate reducta...   159   9e-37   
gi|46906627|ref|YP_013016.1| pyrroline-5-carboxylate reductase [...   159   1e-36   
gi|477528166|gb|ENH79951.1| pyrroline-5-carboxylate reductase [C...   159   1e-36   
gi|493618227|ref|WP_006570424.1| pyrroline-5-carboxylate reducta...   159   1e-36   
gi|20807808|ref|NP_622979.1| pyrroline-5-carboxylate reductase [...   159   1e-36   
gi|302875562|ref|YP_003844195.1| pyrroline-5-carboxylate reducta...   159   1e-36   
gi|268317126|ref|YP_003290845.1| pyrroline-5-carboxylate reducta...   159   1e-36   
gi|226223020|ref|YP_002757127.1| 1-pyrroline-5-carboxylate reduc...   159   1e-36   
gi|148381130|ref|YP_001255671.1| pyrroline-5-carboxylate reducta...   159   1e-36   
gi|407474853|ref|YP_006789253.1| pyrroline-5-carboxylate reducta...   159   1e-36   
gi|494025619|ref|WP_006967831.1| pyrroline-5-carboxylate reducta...   158   1e-36   
gi|219814264|gb|ACL36428.1| pyrroline-5-carboxylate reductase, p...   158   1e-36   
gi|493502865|ref|WP_006457352.1| pyrroline-5-carboxylate reducta...   158   1e-36   
gi|417540|sp|Q04708.1|P5CR_PEA RecName: Full=Pyrroline-5-carboxy...   158   1e-36   
gi|497935721|ref|WP_010249877.1| pyrroline-5-carboxylate reducta...   158   2e-36   
gi|489824347|ref|WP_003728129.1| pyrroline-5-carboxylate reducta...   158   2e-36   
gi|490710559|ref|WP_004573462.1| pyrroline-5-carboxylate reducta...   158   2e-36   
gi|56752044|ref|YP_172745.1| pyrroline-5-carboxylate reductase [...   158   2e-36   
gi|404406865|ref|YP_006689580.1| pyrroline-5-carboxylate reducta...   158   2e-36   
gi|510798181|ref|WP_016172979.1| pyrroline-5-carboxylate reducta...   158   2e-36   
gi|169831570|ref|YP_001717552.1| pyrroline-5-carboxylate reducta...   158   2e-36   
gi|81300867|ref|YP_401075.1| pyrroline-5-carboxylate reductase [...   158   2e-36   
gi|242007054|ref|XP_002424357.1| Pyrroline-5-carboxylate reducta...   158   2e-36   
gi|253971957|gb|ACT37661.1| pyrroline-5-carboxylate reductase [P...   158   2e-36   
gi|493962334|ref|WP_006905809.1| pyrroline-5-carboxylate reducta...   158   2e-36   
gi|291233921|ref|XP_002736890.1| PREDICTED: pyrroline-5-carboxyl...   158   2e-36   
gi|488631256|ref|WP_002567943.1| pyrroline-5-carboxylate reducta...   157   2e-36   
gi|348027462|ref|YP_004767267.1| pyrroline-5-carboxylate reducta...   157   2e-36   
gi|493998872|ref|WP_006941485.1| pyrroline-5-carboxylate reducta...   157   2e-36   
gi|297617006|ref|YP_003702165.1| pyrroline-5-carboxylate reducta...   157   2e-36   
gi|489579020|ref|WP_003483466.1| pyrroline-5-carboxylate reducta...   157   2e-36   
gi|493555955|ref|WP_006509478.1| pyrroline-5-carboxylate reducta...   157   2e-36   
gi|300856882|ref|YP_003781866.1| pyrroline-5-carboxylate reducta...   157   2e-36   
gi|489571307|ref|WP_003475753.1| pyrroline-5-carboxylate reducta...   157   3e-36   
gi|18311615|ref|NP_563549.1| pyrroline-5-carboxylate reductase [...   157   3e-36   
gi|494097763|ref|WP_007038565.1| pyrroline-5-carboxylate reducta...   157   3e-36   
gi|510890786|ref|WP_016224090.1| pyrroline-5-carboxylate reducta...   157   3e-36   
gi|488635075|ref|WP_002571741.1| pyrroline-5-carboxylate reducta...   157   3e-36   
gi|489568404|ref|WP_003472891.1| pyrroline-5-carboxylate reducta...   157   3e-36   
gi|167630160|ref|YP_001680659.1| pyrroline-5-carboxylate reducta...   157   3e-36   
gi|157114971|ref|XP_001658084.1| pyrroline-5-carboxylate reducta...   157   3e-36   
gi|499009495|ref|XP_004536580.1| PREDICTED: pyrroline-5-carboxyl...   157   3e-36   
gi|54289244|gb|AAV31912.1| pyrroline-5-carboxylate reductase [Ae...   157   4e-36   
gi|110802933|ref|YP_699882.1| pyrroline-5-carboxylate reductase ...   157   4e-36   
gi|320103645|ref|YP_004179236.1| pyrroline-5-carboxylate reducta...   157   4e-36   
gi|224371124|ref|YP_002605288.1| ProC [Desulfobacterium autotrop...   157   4e-36   
gi|446282838|ref|WP_000360693.1| pyrroline-5-carboxylate reducta...   157   4e-36   
gi|148654566|ref|YP_001274771.1| pyrroline-5-carboxylate reducta...   157   4e-36   
gi|345303082|ref|YP_004824984.1| pyrroline-5-carboxylate reducta...   157   4e-36   
gi|16332139|ref|NP_442867.1| pyrroline-5-carboxylate reductase [...   156   5e-36   
gi|50307123|ref|XP_453540.1| hypothetical protein [Kluyveromyces...   156   5e-36   
gi|17569021|ref|NP_510032.1| Protein M153.1 [Caenorhabditis eleg...   156   5e-36   
gi|220916580|ref|YP_002491884.1| pyrroline-5-carboxylate reducta...   156   6e-36   
gi|488641057|ref|WP_002577715.1| pyrroline-5-carboxylate reducta...   156   6e-36   
gi|320353690|ref|YP_004195029.1| pyrroline-5-carboxylate reducta...   156   6e-36   
gi|307110366|gb|EFN58602.1| hypothetical protein CHLNCDRAFT_1407...   156   6e-36   
gi|428201604|ref|YP_007080193.1| pyrroline-5-carboxylate reducta...   156   6e-36   
gi|489461744|ref|WP_003366950.1| pyrroline-5-carboxylate reducta...   156   6e-36   
gi|168039101|ref|XP_001772037.1| predicted protein [Physcomitrel...   156   6e-36   
gi|489585469|ref|WP_003489914.1| pyrroline-5-carboxylate reducta...   156   7e-36   
gi|427720837|ref|YP_007068831.1| pyrroline-5-carboxylate reducta...   156   7e-36   
gi|384463502|ref|YP_005676097.1| pyrroline-5-carboxylate reducta...   156   7e-36   
gi|28212016|ref|NP_782960.1| pyrroline-5-carboxylate reductase [...   155   8e-36   
gi|67539710|ref|XP_663629.1| hypothetical protein AN6025.2 [Aspe...   155   9e-36   
gi|446282859|ref|WP_000360714.1| pyrroline-5-carboxylate reducta...   155   9e-36   
gi|258514371|ref|YP_003190593.1| pyrroline-5-carboxylate reducta...   155   1e-35   
gi|374295845|ref|YP_005046036.1| pyrroline-5-carboxylate reducta...   155   1e-35   
gi|490360069|ref|WP_004239832.1| Pyrroline-5-carboxylate reducta...   155   1e-35   
gi|496435620|ref|WP_009144467.1| pyrroline-5-carboxylate reducta...   155   1e-35   
gi|493484825|ref|WP_006439639.1| pyrroline-5-carboxylate reducta...   155   1e-35   
gi|357509475|ref|XP_003625026.1| Pyrroline-5-carboxylate reducta...   155   1e-35   
gi|28628211|gb|AAO32084.1| pyrroline-5-carboxylate reductase [Ho...   155   1e-35   
gi|197121787|ref|YP_002133738.1| pyrroline-5-carboxylate reducta...   155   1e-35   
gi|83814263|ref|YP_445681.1| pyrroline-5-carboxylate reductase [...   155   1e-35   
gi|496689999|ref|WP_009331542.1| pyrroline-5-carboxylate reducta...   155   1e-35   
gi|268577107|ref|XP_002643535.1| Hypothetical protein CBG16221 [...   155   1e-35   
gi|497884273|ref|WP_010198429.1| pyrroline-5-carboxylate reducta...   155   1e-35   
gi|446282858|ref|WP_000360713.1| pyrroline-5-carboxylate reducta...   155   1e-35   
gi|387890222|ref|YP_006320520.1| pyrroline-5-carboxylate reducta...   155   1e-35   
gi|489565159|ref|WP_003469670.1| pyrroline-5-carboxylate reducta...   155   1e-35   
gi|491483393|ref|WP_005341134.1| pyrroline-5-carboxylate reducta...   155   1e-35   
gi|488660731|ref|WP_002589640.1| pyrroline-5-carboxylate reducta...   155   2e-35   
gi|48478488|ref|YP_024194.1| pyrroline-5-carboxylate reductase [...   155   2e-35   
gi|496184572|ref|WP_008909079.1| Pyrroline-5-carboxylate reducta...   155   2e-35   
gi|510895321|ref|WP_016228450.1| pyrroline-5-carboxylate reducta...   155   2e-35   
gi|296123078|ref|YP_003630856.1| pyrroline-5-carboxylate reducta...   155   2e-35   
gi|325106600|ref|YP_004267668.1| pyrroline-5-carboxylate reducta...   154   2e-35   
gi|446282842|ref|WP_000360697.1| pyrroline-5-carboxylate reducta...   154   2e-35   
gi|446964059|ref|WP_001041315.1| pyrroline-5-carboxylate reducta...   154   2e-35   
gi|257064326|ref|YP_003143998.1| pyrroline-5-carboxylate reducta...   154   2e-35   
gi|380491558|emb|CCF35235.1| pyrroline-5-carboxylate reductase [...   154   2e-35   
gi|494130989|ref|WP_007070755.1| pyrroline-5-carboxylate reducta...   154   2e-35   
gi|407705417|ref|YP_006829002.1| HesB-like protein [Bacillus thu...   154   2e-35   
gi|488633981|ref|WP_002570660.1| pyrroline-5-carboxylate reducta...   154   2e-35   
gi|494635337|ref|WP_007393281.1| pyrroline-5-carboxylate reducta...   154   2e-35   
gi|358375226|dbj|GAA91811.1| pyrroline-5-carboxylate reductase [...   154   2e-35   
gi|493488721|ref|WP_006443471.1| hypothetical protein [Clostridi...   154   3e-35   
gi|91774043|ref|YP_566735.1| pyrroline-5-carboxylate reductase [...   154   3e-35   
gi|145228567|ref|XP_001388592.1| pyrroline-5-carboxylate reducta...   154   3e-35   
gi|510828881|ref|WP_016201878.1| pyrroline-5-carboxylate reducta...   154   3e-35   
gi|17227984|ref|NP_484532.1| pyrroline-5-carboxylate reductase [...   154   3e-35   
gi|434392250|ref|YP_007127197.1| pyrroline-5-carboxylate reducta...   154   3e-35   
gi|283780899|ref|YP_003371654.1| pyrroline-5-carboxylate reducta...   154   3e-35   
gi|391325421|ref|XP_003737233.1| PREDICTED: pyrroline-5-carboxyl...   154   3e-35   
gi|86158902|ref|YP_465687.1| pyrroline-5-carboxylate reductase [...   154   3e-35   
gi|27262280|gb|AAN87421.1| Pyrroline-5-carboxylate reductase [He...   154   3e-35   
gi|490176177|ref|WP_004074807.1| pyrroline-5-carboxylate reducta...   154   3e-35   
gi|507011631|ref|WP_016087390.1| pyrroline-5-carboxylate reducta...   154   3e-35   
gi|75909111|ref|YP_323407.1| pyrroline-5-carboxylate reductase [...   154   3e-35   
gi|496493418|ref|WP_009201968.1| pyrroline-5-carboxylate reducta...   154   3e-35   
gi|497473580|ref|WP_009787778.1| pyrroline-5-carboxylate reducta...   154   3e-35   
gi|497480824|ref|WP_009795022.1| pyrroline-5-carboxylate reducta...   154   3e-35   
gi|91079134|ref|XP_975446.1| PREDICTED: similar to pyrroline-5-c...   154   3e-35   
gi|511043840|ref|WP_016297808.1| pyrroline-5-carboxylate reducta...   154   3e-35   
gi|405132181|gb|AFS17324.1| pyrroline-5-carboxylate reductase [B...   154   4e-35   
gi|507036967|ref|WP_016108650.1| pyrroline-5-carboxylate reducta...   154   4e-35   
gi|495694407|ref|WP_008418986.1| pyrroline-5-carboxylate reducta...   154   4e-35   
gi|339441605|ref|YP_004707610.1| pyrroline-5-carboxylate reducta...   154   4e-35   
gi|294101782|ref|YP_003553640.1| pyrroline-5-carboxylate reducta...   154   4e-35   
gi|73668027|ref|YP_304042.1| pyrroline-5-carboxylate reductase [...   154   4e-35   
gi|83589711|ref|YP_429720.1| pyrroline-5-carboxylate reductase [...   153   4e-35   
gi|455739756|ref|YP_007506022.1| Pyrroline-5-carboxylate reducta...   153   4e-35   
gi|332157946|ref|YP_004423225.1| pyrroline-5-carboxylate reducta...   153   4e-35   
gi|170078524|ref|YP_001735162.1| pyrroline-5-carboxylate reducta...   153   4e-35   
gi|341901977|gb|EGT57912.1| hypothetical protein CAEBREN_01895 [...   153   4e-35   
gi|408417715|ref|YP_006759129.1| pyrroline-5-carboxylate reducta...   153   4e-35   
gi|390334211|ref|XP_788856.3| PREDICTED: pyrroline-5-carboxylate...   153   5e-35   
gi|494633354|ref|WP_007391298.1| pyrroline-5-carboxylate reducta...   153   5e-35   
gi|446964061|ref|WP_001041317.1| pyrroline-5-carboxylate reducta...   153   5e-35   
gi|488065588|ref|WP_002136985.1| pyrroline-5-carboxylate reducta...   153   5e-35   
gi|489473021|ref|WP_003378098.1| pyrroline-5-carboxylate reducta...   153   5e-35   
gi|487993879|ref|WP_002065990.1| pyrroline-5-carboxylate reducta...   153   5e-35   
gi|289578355|ref|YP_003476982.1| pyrroline-5-carboxylate reducta...   153   5e-35   
gi|487959511|ref|WP_002032868.1| pyrroline-5-carboxylate reducta...   153   5e-35   
gi|488628926|ref|WP_002565624.1| hypothetical protein [Clostridi...   153   5e-35   
gi|172037528|ref|YP_001804029.1| pyrroline-5-carboxylate reducta...   153   5e-35   
gi|446282857|ref|WP_000360712.1| pyrroline-5-carboxylate reducta...   153   5e-35   
gi|489469710|ref|WP_003374821.1| pyrroline-5-carboxylate reducta...   153   5e-35   
gi|491478253|ref|WP_005335994.1| pyrroline-5-carboxylate reducta...   153   6e-35   
gi|493861465|ref|WP_006808229.1| pyrroline-5-carboxylate reducta...   153   6e-35   
gi|307182204|gb|EFN69538.1| Pyrroline-5-carboxylate reductase 2 ...   153   6e-35   
gi|384253128|gb|EIE26603.1| pyrroline-5-carboxylate reductase [C...   153   6e-35   
gi|497130313|ref|WP_009482443.1| pyrroline-5-carboxylate reducta...   153   6e-35   
gi|488075644|ref|WP_002147041.1| pyrroline-5-carboxylate reducta...   153   6e-35   
gi|308482167|ref|XP_003103287.1| hypothetical protein CRE_27672 ...   153   6e-35   
gi|404491966|ref|YP_006716072.1| Delta-1-pyrroline-5-carboxylate...   153   6e-35   
gi|428313372|ref|YP_007124349.1| pyrroline-5-carboxylate reducta...   153   7e-35   
gi|344228995|gb|EGV60881.1| pyrroline-5-carboxylate reductase [C...   152   7e-35   
gi|494497193|ref|WP_007286660.1| pyrroline-5-carboxylate reducta...   152   7e-35   
gi|156363483|ref|XP_001626073.1| predicted protein [Nematostella...   152   7e-35   
gi|488876220|ref|WP_002788445.1| pyrroline-5-carboxylate reducta...   152   8e-35   
gi|446282856|ref|WP_000360711.1| pyrroline-5-carboxylate reducta...   152   8e-35   
gi|302388623|ref|YP_003824444.1| pyrroline-5-carboxylate reducta...   152   8e-35   
gi|310780315|ref|YP_003968647.1| pyrroline-5-carboxylate reducta...   152   8e-35   
gi|427739316|ref|YP_007058860.1| pyrroline-5-carboxylate reducta...   152   8e-35   
gi|428307260|ref|YP_007144085.1| pyrroline-5-carboxylate reducta...   152   8e-35   
gi|497461973|ref|WP_009776171.1| pyrroline-5-carboxylate reducta...   152   8e-35   
gi|487940044|ref|WP_002013510.1| pyrroline-5-carboxylate reducta...   152   9e-35   
gi|446282841|ref|WP_000360696.1| pyrroline-5-carboxylate reducta...   152   9e-35   
gi|479156221|ref|YP_007785816.1| pyrroline-5-carboxylate reducta...   152   1e-34   
gi|315051090|ref|XP_003174919.1| pyrroline-5-carboxylate reducta...   152   1e-34   
gi|489512326|ref|WP_003417175.1| pyrroline-5-carboxylate reducta...   152   1e-34   
gi|217960417|ref|YP_002338979.1| pyrroline-5-carboxylate reducta...   152   1e-34   
gi|21226919|ref|NP_632841.1| pyrroline-5-carboxylate reductase [...   152   1e-34   
gi|384180864|ref|YP_005566626.1| pyrroline-5-carboxylate reducta...   152   1e-34   


>gi|170094036|ref|XP_001878239.1| pyrroline-5-carboxylate reductase [Laccaria bicolor S238N-H82]
 gi|164646693|gb|EDR10938.1| pyrroline-5-carboxylate reductase [Laccaria bicolor S238N-H82]
          Length = 312

 Score =  319 bits (817), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 160/305 (52%), Positives = 211/305 (69%), Gaps = 27/305 (8%)

Query: 12  TLCVLGCGTMGRAILSGILDSLN-------------------VAPANEPPTLIPKKFIAC 52
           TLCVLGCGTMG A+LSG++DSL+                   + P   P   +P ++IAC
Sbjct: 4   TLCVLGCGTMGIAVLSGVIDSLDSTSRLFTKPSKWESHTPGTLTPVGPPDASVPAEYIAC 63

Query: 53  VSGEESAQRIKEEFN------DKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQ 106
           VS E SA R+++ F+      + + +L   NVE V+++D++LLC KPQ+  TIL E+GM+
Sbjct: 64  VSREASALRLRKVFDSLGAMGEAVQILASRNVEAVQQSDVVLLCCKPQIAHTILNEQGMK 123

Query: 107 KSLENKLIISILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSC--PTDCSKDD 164
           ++L+ KL+ISILAGVT+ Q+ +W   STR++RAMPNTPC IREGMTV+S   P+   + D
Sbjct: 124 EALDGKLLISILAGVTMRQITDWVLPSTRVVRAMPNTPCKIREGMTVVSNLPPSADEESD 183

Query: 165 RSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXX 224
           R+  + +FS++GR R L+EKH DA T LSGSGPAFAC+ +EA+ADGGVMMGLPR      
Sbjct: 184 RAIILKIFSSIGRCRFLEEKHFDACTALSGSGPAFACIFMEAMADGGVMMGLPRAEALEL 243

Query: 225 XXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVA 284
                    RMVL+ G HPA+IKDSVTTPGGCTIAGLL +EDG++RST+AR IQ AT+ A
Sbjct: 244 AAQTLQGAARMVLQGGAHPAQIKDSVTTPGGCTIAGLLALEDGRVRSTIARGIQIATERA 303

Query: 285 STLGN 289
           S LG 
Sbjct: 304 SELGQ 308



>gi|336367023|gb|EGN95368.1| hypothetical protein SERLA73DRAFT_186293 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336379748|gb|EGO20902.1| putative delta 1-pyrroline-5-carboxylate reductase [Serpula
           lacrymans var. lacrymans S7.9]
          Length = 314

 Score =  315 bits (808), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 167/311 (53%), Positives = 204/311 (65%), Gaps = 28/311 (9%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNV-------------APANEPPTL-------IPKKFIA 51
           TLCV+GCGTMG AI+SG++DSL                P    P +       +P  FIA
Sbjct: 4   TLCVIGCGTMGIAIISGVIDSLQSKDRARSFPKWESHTPGTSTPAVDIESDPSLPSYFIA 63

Query: 52  CVSGEESAQRIKEEF------NDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGM 105
           CV+ EESA+++   F        ++ +LV  NV+  + AD+I+LC KPQ V +ILTE GM
Sbjct: 64  CVTREESARKLGHTFAALGGFGSQVQILVSENVQAAQHADVIILCCKPQQVSSILTEAGM 123

Query: 106 QKSLENKLIISILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLS-CPTDCSKD- 163
             +LE KL+ISILAGVTI QL      ST+++RAMPNTPC IREGMTV+S  P     D 
Sbjct: 124 ADALEGKLVISILAGVTISQLTALVSPSTKVVRAMPNTPCRIREGMTVVSNLPQSSHADL 183

Query: 164 DRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXX 223
           DR+  + +FS++GR R LDEKH DA T LSGSGPAFAC+ LEA+ADGGVMMGLPR     
Sbjct: 184 DRTTILNIFSSIGRCRFLDEKHFDACTALSGSGPAFACIFLEAMADGGVMMGLPRAEALE 243

Query: 224 XXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQV 283
                     RM L+ G HPA+IKDSVTTPGGCTIAGLL MEDGK+RST+AR IQ AT+ 
Sbjct: 244 LASQTLQGAARMALQPGAHPAQIKDSVTTPGGCTIAGLLAMEDGKVRSTIARAIQVATER 303

Query: 284 ASTLGNIQSKK 294
           AS LG   +KK
Sbjct: 304 ASELGQPSTKK 314



>gi|449547429|gb|EMD38397.1| hypothetical protein CERSUDRAFT_113553 [Ceriporiopsis subvermispora
           B]
          Length = 312

 Score =  310 bits (795), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 162/309 (52%), Positives = 210/309 (67%), Gaps = 27/309 (8%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVA---PANEP-----------PTL-----IPKKFIAC 52
           TLCVLGCGTMG A+LSG+L SL+     P ++P           P +     +P +F+AC
Sbjct: 4   TLCVLGCGTMGVAVLSGVLASLDAQIGIPLSQPKWESHTPGTVTPRVSDDESLPARFLAC 63

Query: 53  VSGEESAQRIKEEF------NDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQ 106
           VS EE+ ++++  F         + +L G NV  V+EA++ILLC KPQ+  TIL+E GM+
Sbjct: 64  VSREETVKKLQATFFTAGSLGSSVEVLAGQNVRAVQEANVILLCCKPQLAHTILSEPGMK 123

Query: 107 KSLENKLIISILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSC--PTDCSKDD 164
           ++L+ KL+ISILAGVTI QL  W   +T++IRAMPNTPC IREGMTV+S   P+D  + +
Sbjct: 124 EALDGKLLISILAGVTISQLVAWVLPTTKVIRAMPNTPCKIREGMTVVSTLPPSDSLELE 183

Query: 165 RSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXX 224
           R   + +FS++GR R LDEKH DA T LSGSGPAFAC+ LEA+ADGGVMMGLPR      
Sbjct: 184 RMIILNIFSSIGRCRFLDEKHFDACTALSGSGPAFACIFLEAMADGGVMMGLPRAEALEL 243

Query: 225 XXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVA 284
                    RM L+ G HPA++KD+VTTPGGCTIAGLL +EDG++RST+AR IQ AT+ A
Sbjct: 244 AAQTLQGTARMTLQGGAHPAQLKDAVTTPGGCTIAGLLALEDGRVRSTIARAIQVATERA 303

Query: 285 STLGNIQSK 293
           S LG    K
Sbjct: 304 SELGQPAKK 312



>gi|402225594|gb|EJU05655.1| pyrroline-5-carboxylate reductase [Dacryopinax sp. DJM-731 SS1]
          Length = 326

 Score =  310 bits (794), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 166/313 (53%), Positives = 202/313 (64%), Gaps = 36/313 (11%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEP---------------PTL-------IPKKF 49
           TLCV+GCGTMG AILSG++D L  +P+  P               PTL       +P KF
Sbjct: 4   TLCVIGCGTMGIAILSGVVDVLK-SPSPFPNGMSQSSPSGISTPVPTLATVPDESLPSKF 62

Query: 50  IACVSGEESAQRIKEEF------NDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEE 103
            ACVS ++S +R+K  F         I ++ G+N +    ADII+LC KP   + ILT  
Sbjct: 63  TACVSRDDSVRRLKRTFEALGGLGPAIQVIAGHNADSAAHADIIILCCKPHQAEGILTAP 122

Query: 104 GMQKSLENKLIISILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPT----- 158
           GM  +LE KL+ISILAGVTI Q++ W P+STR+IRAMPNTPC IREGMTVLS P      
Sbjct: 123 GMVHALEGKLLISILAGVTISQMRGWVPASTRLIRAMPNTPCKIREGMTVLSSPDAELHT 182

Query: 159 --DCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGL 216
                  D+     +FS++GRAR LDEKH DA T LSGSGPAFAC+ LEALADGGVMMGL
Sbjct: 183 PLHLLAKDKEICTSIFSSIGRARFLDEKHFDACTALSGSGPAFACIFLEALADGGVMMGL 242

Query: 217 PREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLART 276
           PR               RM L++G HPA IKD+VTTPGGCTIAG+LT+EDG++RST+AR 
Sbjct: 243 PRAEALELAAQTLQGAARMTLQSGAHPAAIKDTVTTPGGCTIAGVLTLEDGRVRSTIARA 302

Query: 277 IQEATQVASTLGN 289
           IQ AT+ AS LG 
Sbjct: 303 IQVATERASELGQ 315



>gi|392558509|gb|EIW51696.1| pyrroline-5-carboxylate reductase [Trametes versicolor FP-101664
           SS1]
          Length = 311

 Score =  308 bits (789), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 164/308 (53%), Positives = 209/308 (67%), Gaps = 26/308 (8%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAP--ANEP-----------PTLI-----PKKFIACV 53
           TLCVLGCGTMG A+LSG+L SL+  P  A+ P           P ++     P +FIACV
Sbjct: 4   TLCVLGCGTMGIAVLSGVLASLDSKPTSAHHPKWESHTSGTVTPQVLEDESLPSRFIACV 63

Query: 54  SGEESAQRIKEEFNDKITL------LVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQK 107
           S EESA+++   F    TL          NV+ V++A+++LL  KPQ+  TIL E GM++
Sbjct: 64  SREESAKKLSSTFFHAGTLGRSVEISCARNVQAVQQANVVLLGCKPQLASTILNEPGMKE 123

Query: 108 SLENKLIISILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSC--PTDCSKDDR 165
           +LE KL+ISILAGVTI QL+    +ST+++RAMPNTPC IREGMTV+S   P+D  + +R
Sbjct: 124 ALEGKLLISILAGVTIAQLQAMVGASTKVVRAMPNTPCKIREGMTVVSTLPPSDALELER 183

Query: 166 SFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXX 225
           S  + +FS++GR R L+EKH DA T LSGSGPAFAC+ LEA+ADGGVMMGLPR       
Sbjct: 184 SIILNIFSSIGRCRFLEEKHFDACTALSGSGPAFACIFLEAMADGGVMMGLPRAEALELA 243

Query: 226 XXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVAS 285
                   RM L+ G HPA++KD+VTTPGGCTIAGLL MEDG++RST+AR IQ AT+ AS
Sbjct: 244 AQTLQGTARMTLQAGTHPAQLKDAVTTPGGCTIAGLLAMEDGRVRSTIARAIQVATERAS 303

Query: 286 TLGNIQSK 293
            LG    K
Sbjct: 304 QLGQPAKK 311



>gi|443926280|gb|ELU44983.1| glycosyltransferase family 15 protein [Rhizoctonia solani AG-1 IA]
          Length = 904

 Score =  307 bits (786), Expect = 2e-81,   Method: Composition-based stats.
 Identities = 162/331 (48%), Positives = 212/331 (64%), Gaps = 57/331 (17%)

Query: 15  VLGCGTMGRAILSGILDSL------NVAPA-------------------NEPPTL----- 44
           +LGCGTMG A+LSG++ SL      N  P+                   N P T+     
Sbjct: 556 LLGCGTMGVAVLSGVIVSLERRVPQNAGPSTPTISSPQLPPVSNGISTPNLPGTMTPNVN 615

Query: 45  --------IPKKFIACVSGEESAQRIKEEFN--------DKITLLVGNNVEGVKEADIIL 88
                   IP +F+ACV+  ESA+R+K  F         ++I ++ G N+  V+E++++L
Sbjct: 616 VDELPDASIPSRFLACVNRAESAKRLKATFRSTVGLMAAEQIEIMWGENLRAVQESNVVL 675

Query: 89  LCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIR 148
           LC KPQ+  +IL+  GM  +LE KL+ISILAGVTI QL +  P+STR++RAMPNTPC IR
Sbjct: 676 LCCKPQMAASILSAPGMATALEGKLLISILAGVTIQQLTDMVPASTRVVRAMPNTPCRIR 735

Query: 149 EGMTVLSC-PTDCS----------KDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGP 197
           EGMTV+S  P+  S          + DR+  + +FS++GR R L+EKH DA T LSGSGP
Sbjct: 736 EGMTVVSAIPSSSSLTPLAIDLQRELDRAIILAIFSSIGRCRFLEEKHFDACTALSGSGP 795

Query: 198 AFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCT 257
           AFAC+VLEA+ADGGVMMGLPR               RMVL++G+HPA++KDSVTTPGGCT
Sbjct: 796 AFACIVLEAMADGGVMMGLPRTEALELAAQTLQGTARMVLQSGQHPAQVKDSVTTPGGCT 855

Query: 258 IAGLLTMEDGKIRSTLARTIQEATQVASTLG 288
           IAGLLT+EDG++RST+AR IQ AT  AS LG
Sbjct: 856 IAGLLTLEDGRVRSTIARAIQVATDRASVLG 886



>gi|395333543|gb|EJF65920.1| pyrroline-5-carboxylate reductase [Dichomitus squalens LYAD-421
           SS1]
          Length = 312

 Score =  306 bits (785), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 158/305 (51%), Positives = 206/305 (67%), Gaps = 27/305 (8%)

Query: 12  TLCVLGCGTMGRAILSGILDSLN-------------------VAPANEPPTLIPKKFIAC 52
           TLCVLGCGTMG AILSG+L SL+                   V P       +P +FIAC
Sbjct: 4   TLCVLGCGTMGVAILSGVLASLDARHSFVPQPKKWESHTPGTVTPQTLEDESLPSRFIAC 63

Query: 53  VSGEESAQRIKEEF------NDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQ 106
           VS EE+A+++   F         + ++   NV+  +++++ILLC KPQ+ + IL+E GM+
Sbjct: 64  VSREETAKKLANAFFSAGTLGRNVEIVQARNVDAARQSNVILLCCKPQIAQKILSESGMK 123

Query: 107 KSLENKLIISILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSC--PTDCSKDD 164
           ++L+ KL+ISILAGVTI QL+     ST+++RAMPNTPC IREGMTV+S   P+D S+ +
Sbjct: 124 EALDGKLLISILAGVTIAQLEAMVLPSTKVVRAMPNTPCKIREGMTVVSTLEPSDESELE 183

Query: 165 RSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXX 224
           RS  + +FS++GR R L+EKH DA T LSGSGPAFAC+ LEA+ADGGVMMGLPR      
Sbjct: 184 RSIILNIFSSIGRCRFLEEKHFDACTALSGSGPAFACIFLEAMADGGVMMGLPRAEALEL 243

Query: 225 XXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVA 284
                    RM L+ G HPA++KD+VTTPGGCTIAGLL MEDG++RST+AR IQ AT+ A
Sbjct: 244 AAQTLQGAARMTLQAGTHPAQLKDAVTTPGGCTIAGLLAMEDGRVRSTIARAIQVATERA 303

Query: 285 STLGN 289
           S LG 
Sbjct: 304 SELGQ 308



>gi|393245481|gb|EJD52991.1| pyrroline-5-carboxylate reductase [Auricularia delicata TFB-10046
           SS5]
          Length = 321

 Score =  306 bits (783), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 159/318 (50%), Positives = 208/318 (65%), Gaps = 36/318 (11%)

Query: 12  TLCVLGCGTMGRAILSGILDSLN----------------------VAPANEPPTLIPKKF 49
           T+CVLGCGTMG AILSG+L SL                         P  +P + +P +F
Sbjct: 4   TICVLGCGTMGVAILSGVLASLESRSPAHPMQTIAEKWEVHTPGTATPVGQPDSALPSRF 63

Query: 50  IACVSGEESAQRIKEEFND------KITLLVGNNVEGVKEADIILLCTKPQVVKTILTEE 103
           IACV+ EE+A R++  F D      ++ ++ G NV  V++AD+ILLC KPQ+ +TI+ E+
Sbjct: 64  IACVNREETAARLRRTFRDLGGRGHEVEVVAGQNVLSVRQADLILLCCKPQLAQTIIEED 123

Query: 104 GMQKSLENKLIISILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSC-PTDCSK 162
           GM+++L +KL++SILAGVTI QL+ W   STR++RAMPNTP  IREGMTV+S  P + S 
Sbjct: 124 GMREALADKLLVSILAGVTISQLRGWVLPSTRVLRAMPNTPTKIREGMTVISTFPANMSA 183

Query: 163 D-------DRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMG 215
                   +++    +FS++GR R LDEKH DA T LS SGPAFAC+ LEA+ADGGVMMG
Sbjct: 184 SLYNGESLEQTRVSTIFSSIGRCRFLDEKHFDACTALSASGPAFACIFLEAMADGGVMMG 243

Query: 216 LPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLAR 275
           LPR               RM L+ G HP++IKD+VTTPGGCTIAGLL +EDG++RST+AR
Sbjct: 244 LPRAEALELASQALQGAARMALQPGAHPSQIKDAVTTPGGCTIAGLLALEDGRVRSTIAR 303

Query: 276 TIQEATQVASTLGNIQSK 293
            IQ AT+ AS LG    K
Sbjct: 304 AIQVATERASELGQPAKK 321



>gi|389748731|gb|EIM89908.1| pyrroline-5-carboxylate reductase [Stereum hirsutum FP-91666 SS1]
          Length = 315

 Score =  305 bits (780), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 162/309 (52%), Positives = 205/309 (66%), Gaps = 31/309 (10%)

Query: 12  TLCVLGCGTMGRAILSGILDSL--------NVAPANEPPTL--------------IPKKF 49
           TLCVLGCGTMG AI SG+L SL        N+    E  T               +P +F
Sbjct: 4   TLCVLGCGTMGIAITSGVLASLESRNPLHGNIHAKWESHTSGTSTPVVGPDLDHSLPSRF 63

Query: 50  IACVSGEESAQRIKEEFND-------KITLLVGNNVEGVKEADIILLCTKPQVVKTILTE 102
           IACV  EE+A++++  F +        + ++   NV  V++AD++LLC KPQ+   IL E
Sbjct: 64  IACVKREETARKLQRTFAELPGLSGHTVEVVADQNVSSVQQADVVLLCCKPQMAYLILQE 123

Query: 103 EGMQKSLENKLIISILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSC--PTDC 160
           EG++++LE KL+ISILAGVTI QL  W   ST++IRAMPNTPC IREGMTV+S    +D 
Sbjct: 124 EGIKEALEGKLLISILAGVTIPQLSNWVLPSTKVIRAMPNTPCKIREGMTVVSTLPQSDS 183

Query: 161 SKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREV 220
            + DR+  + +FS++GR R LDEKH DA T +SGSGPAFAC+ LEA+ADGGVMMGLPR  
Sbjct: 184 VELDRAIILKIFSSIGRCRFLDEKHFDACTAVSGSGPAFACLFLEAMADGGVMMGLPRAE 243

Query: 221 XXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEA 280
                        RM L+ G HPA+IKD+VTTPGGCTIAGLLT+EDGK+RST+AR IQ A
Sbjct: 244 ALELAAQTLQGAARMALQPGAHPAQIKDAVTTPGGCTIAGLLTLEDGKVRSTIARAIQVA 303

Query: 281 TQVASTLGN 289
           T+ AS LG 
Sbjct: 304 TERASELGQ 312



>gi|390598038|gb|EIN07437.1| pyrroline-5-carboxylate reductase [Punctularia strigosozonata
           HHB-11173 SS5]
          Length = 317

 Score =  304 bits (779), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 161/310 (51%), Positives = 205/310 (66%), Gaps = 32/310 (10%)

Query: 12  TLCVLGCGTMGRAILSGILDSLN------------------VAPANEPPTL------IPK 47
           TLCVLGCGTMG AILSG++DSL                   + P + P  L      +P 
Sbjct: 4   TLCVLGCGTMGIAILSGVVDSLQSVTRTKGEPKWESHTPSTLTPLHTPTPLDALEASLPS 63

Query: 48  KFIACVSGEESAQRIKEEFND------KITLLVGNNVEGVKEADIILLCTKPQVVKTILT 101
           +++ACV   E+A  +K  F         + ++  +NV   K+AD++LLC KPQ+ ++IL 
Sbjct: 64  RYLACVKRPETANELKTVFGSLGQLGRAVEVITDDNVAAAKQADVVLLCCKPQMAQSILC 123

Query: 102 EEGMQKSLENKLIISILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSC--PTD 159
           EEGM+++L+ KL+ISILAGVTI Q+  W   ST++IRAMPNTPC IREGMTV+S    T 
Sbjct: 124 EEGMKEALDGKLLISILAGVTISQMLAWVLPSTKVIRAMPNTPCKIREGMTVVSTLPATA 183

Query: 160 CSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPRE 219
            S+ DR   + +FS++GR R L+EKH DA T LSGSGPAFAC+ LEA+ADGGVMMGLPR 
Sbjct: 184 DSEIDREIILKIFSSIGRCRFLEEKHFDACTALSGSGPAFACIFLEAMADGGVMMGLPRA 243

Query: 220 VXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQE 279
                         RM L+ G HPA+IKD+VTTPGGCTIAGLLT+EDGK+RST+AR IQ 
Sbjct: 244 EALELAAQTLQGAARMSLQPGAHPAQIKDAVTTPGGCTIAGLLTLEDGKVRSTIARAIQV 303

Query: 280 ATQVASTLGN 289
           AT+ AS LG 
Sbjct: 304 ATERASELGQ 313



>gi|409046121|gb|EKM55601.1| hypothetical protein PHACADRAFT_256330 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 313

 Score =  303 bits (777), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 162/306 (52%), Positives = 205/306 (66%), Gaps = 28/306 (9%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVA--------------PANEPPTL------IPKKFIA 51
           TLCVLGCGTMG A+LSG+L SL+ A              P    P L      +P +F+A
Sbjct: 4   TLCVLGCGTMGVAVLSGVLASLDSASDPTYPGPKWESHTPGTLTPALAVSDPTLPSRFLA 63

Query: 52  CVSGEESAQRIKEEF------NDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGM 105
           CVS EESA+R++E F         + + V NNV+ V+++D+ILLC KPQ+  TIL E G+
Sbjct: 64  CVSREESAKRLRELFFSLGGPGPGVEVCVANNVQAVQQSDVILLCCKPQLAHTILGEPGL 123

Query: 106 QKSLENKLIISILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSC--PTDCSKD 163
           + +LE KL+ISILAGVTI QL       T++IRAMPNTPC IREGMTV+S    ++ ++ 
Sbjct: 124 KDALEGKLLISILAGVTILQLTAAVGPETKVIRAMPNTPCKIREGMTVISSLPQSEGAEF 183

Query: 164 DRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXX 223
           DR   + +FS++GR R LDEKH DA T LSGSGPAFAC+ LEA+ADGGVMMGLPR     
Sbjct: 184 DRRIILNIFSSIGRCRFLDEKHFDACTALSGSGPAFACIFLEAMADGGVMMGLPRAEALE 243

Query: 224 XXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQV 283
                     RM L+   HPA++KD+VTTPGGCTIAGLL +EDG++RST+AR IQ AT+ 
Sbjct: 244 LAAQTLQGAARMTLQGNTHPAQLKDAVTTPGGCTIAGLLALEDGRVRSTIARAIQIATER 303

Query: 284 ASTLGN 289
           AS LG 
Sbjct: 304 ASELGQ 309



>gi|443896444|dbj|GAC73788.1| pyrroline-5-carboxylate reductase [Pseudozyma antarctica T-34]
          Length = 306

 Score =  302 bits (773), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 160/304 (52%), Positives = 209/304 (68%), Gaps = 23/304 (7%)

Query: 12  TLCVLGCGTMGRAILSGILDS----------------LNVAPANEPPTLIPKKFIACVSG 55
           TL V+GCGTMG AILSG+LDS                L  + A +  T +P ++IA V+ 
Sbjct: 5   TLAVIGCGTMGVAILSGVLDSQRSQQALASMASSVSSLRDSTAGDDLTELPTRYIATVNR 64

Query: 56  EESAQRIKEEFND--KITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKL 113
            ES +R+K+ F D   I +  G NV+  +EAD+ILL  KPQ+V+ I+ E GM+++L+ KL
Sbjct: 65  LESVRRLKKVFADYPDIAIHAGKNVQAAQEADVILLGCKPQMVQDIIAEPGMREALDGKL 124

Query: 114 IISILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLS-CPTDC--SKDDRSFSIW 170
           +ISI AG+ I Q+ EW   +T+++RAMPNTPC IREGMT+L+  P+    ++ DR+  + 
Sbjct: 125 VISICAGLRISQMVEWVTPATKVVRAMPNTPCKIREGMTILTPLPSSLPNAELDRNILLS 184

Query: 171 VFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXX 230
           +FS +GR R LDEKH DA T L+GSGPAFACV LEA+ADGGVMMGLPR+           
Sbjct: 185 IFSAVGRCRFLDEKHFDACTALAGSGPAFACVFLEAMADGGVMMGLPRQEALELAAQTMQ 244

Query: 231 XXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGNI 290
              RMV+++G HPA IKDSVTTPGGCTIAGLL +EDGK+RST+ARTIQ A + AS LG  
Sbjct: 245 GAARMVMQSGMHPAAIKDSVTTPGGCTIAGLLNLEDGKVRSTVARTIQAAAEHASGLG-- 302

Query: 291 QSKK 294
           Q+KK
Sbjct: 303 QAKK 306



>gi|328848132|gb|EGF97382.1| hypothetical protein MELLADRAFT_73736 [Melampsora larici-populina
           98AG31]
 gi|328858758|gb|EGG07869.1| hypothetical protein MELLADRAFT_71550 [Melampsora larici-populina
           98AG31]
          Length = 311

 Score =  300 bits (769), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 156/300 (52%), Positives = 202/300 (67%), Gaps = 22/300 (7%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPA---------------NEPPTLIPKKFIACVSGE 56
           TLCVLGCGTMG AI+SG+L+SL+   +               +E P   P +FI CV+  
Sbjct: 4   TLCVLGCGTMGIAIVSGVLESLHQVDSITKSSSSSGDSTPIPSEDPDTKPHRFITCVTRS 63

Query: 57  ESAQRIKEEF----NDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENK 112
           ESA+++K+++    ++ + + +  NV+ ++E+D++LL  KPQV + IL  EGM+++  NK
Sbjct: 64  ESAKKLKKQWQSLGHEDVEVRINENVKSIQESDVVLLSCKPQVAQDILAAEGMREACANK 123

Query: 113 LIISILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSC--PTD-CSKDDRSFSI 169
           L ISILAG TI  LK W P S  ++RAMPNTPC IREGMTVLS   P D  S   R+  +
Sbjct: 124 LFISILAGTTISMLKSWLPESASVVRAMPNTPCQIREGMTVLSSLPPNDPQSHRTRNILL 183

Query: 170 WVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXX 229
            +F+ +GR R LDEKH DA T +SGSGPAF+ V+LEA+ADGGVMMGLPR           
Sbjct: 184 SLFTPIGRCRFLDEKHFDACTAVSGSGPAFSLVILEAIADGGVMMGLPRSEALELAAQTM 243

Query: 230 XXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
               RMVL+TG+HPA +KDSVTTP GCTIAGLL +EDGK+RST+AR IQ AT  AS LG 
Sbjct: 244 QGAARMVLQTGRHPAALKDSVTTPAGCTIAGLLALEDGKVRSTIARAIQTATLHASGLGK 303



>gi|58268178|ref|XP_571245.1| pyrroline-5-carboxylate reductase [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|134113356|ref|XP_774703.1| hypothetical protein CNBF3820 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50257347|gb|EAL20056.1| hypothetical protein CNBF3820 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57227480|gb|AAW43938.1| pyrroline-5-carboxylate reductase, putative [Cryptococcus
           neoformans var. neoformans JEC21]
          Length = 313

 Score =  298 bits (764), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 163/314 (51%), Positives = 206/314 (65%), Gaps = 35/314 (11%)

Query: 12  TLCVLGCGTMGRAILSGILDSL--------NVAPANEPPTLI----------------PK 47
           TL VLGCGTMG AILSG++ SL        N   ++EPP+ I                P 
Sbjct: 4   TLAVLGCGTMGIAILSGVISSLETRASLPRNPNASSEPPSGISTPTASQFLDAPEASLPS 63

Query: 48  KFIACVSGEESAQRIKEEFND------KITLLVGN-NVEGVKEADIILLCTKPQVVKTIL 100
            FIA V  EE+ ++++    D      ++ +  G  NV+ V EAD+IL+C+KPQ+ ++IL
Sbjct: 64  TFIATVGREETGRKLRRTLADMGSIGKQVQVRAGQGNVKTVDEADVILVCSKPQIARSIL 123

Query: 101 TEEGMQKSLENKLIISILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDC 160
            EEGM K+LE KL+ISI AGVTI QLK W P STR++RAMPNTPC I EGMT+++  +D 
Sbjct: 124 EEEGMSKALEGKLLISICAGVTISQLKSWVPESTRVVRAMPNTPCKIGEGMTIVTPLSDA 183

Query: 161 SKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREV 220
               R+  + +F++ GR R LDEKH DA T L+GSGPAF  +VLEA+ADGGVMMGLPR  
Sbjct: 184 L--SRTLILNIFTSCGRCRFLDEKHFDACTALAGSGPAFVALVLEAMADGGVMMGLPRSE 241

Query: 221 XXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEA 280
                        RM L+TG HPA++KDSVTTPGGCTIAGLLT+EDG++RST+AR IQ A
Sbjct: 242 ALELAAQTMQGTGRMALQTGLHPAQLKDSVTTPGGCTIAGLLTLEDGRVRSTMARAIQVA 301

Query: 281 TQVASTLGNIQSKK 294
           T  AS LG  Q KK
Sbjct: 302 TNHASGLG--QDKK 313



>gi|321260378|ref|XP_003194909.1| pyrroline-5-carboxylate reductase [Cryptococcus gattii WM276]
 gi|317461381|gb|ADV23122.1| pyrroline-5-carboxylate reductase, putative [Cryptococcus gattii
           WM276]
          Length = 313

 Score =  298 bits (764), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 160/309 (51%), Positives = 204/309 (66%), Gaps = 33/309 (10%)

Query: 12  TLCVLGCGTMGRAILSGILDSL--------NVAPANEPPTLI----------------PK 47
           TL VLGCGTMG AILSG++ SL        N   +++PP+ I                P 
Sbjct: 4   TLAVLGCGTMGVAILSGVISSLETRASLPRNPNASSQPPSGISTPTASQFFDAPEASLPS 63

Query: 48  KFIACVSGEESAQRIKEEFND------KITLLVGN-NVEGVKEADIILLCTKPQVVKTIL 100
            F+A V  EE+ ++++  F +      ++ +  G  NVE V EAD+IL+C+KPQV ++IL
Sbjct: 64  TFLATVGREETGRKLRRTFAEMGPIGKQVQVRAGQGNVETVDEADVILVCSKPQVARSIL 123

Query: 101 TEEGMQKSLENKLIISILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDC 160
            EEGM K+LE KL+ISI AGVTI QLK W P +TR++RAMPNTPC I EGMTV++  +D 
Sbjct: 124 EEEGMSKALEGKLLISICAGVTISQLKSWVPETTRVVRAMPNTPCKIGEGMTVVTPLSDA 183

Query: 161 SKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREV 220
               R+  + +F++ GR R LDEKH DA T L+GSGPAF  +VLEA+ADGGVMMGLPR  
Sbjct: 184 L--SRTLILNIFTSCGRCRFLDEKHFDACTALAGSGPAFVALVLEAMADGGVMMGLPRSE 241

Query: 221 XXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEA 280
                        RM L+TG HPA++KDSVTTPGGCTIAGLLT+EDG++RST+AR IQ A
Sbjct: 242 ALELAAQTMQGTGRMALQTGLHPAQLKDSVTTPGGCTIAGLLTLEDGRVRSTMARAIQVA 301

Query: 281 TQVASTLGN 289
           T  AS LG 
Sbjct: 302 TNHASGLGQ 310



>gi|409082677|gb|EKM83035.1| hypothetical protein AGABI1DRAFT_34400 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 324

 Score =  298 bits (762), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 159/322 (49%), Positives = 201/322 (62%), Gaps = 41/322 (12%)

Query: 12  TLCVLGCGTMGRAILSGILDSLN--------------------------------VAPAN 39
           TLCVLGCGTMG AILSG+LDSL+                                V+P  
Sbjct: 4   TLCVLGCGTMGIAILSGVLDSLDTSKHSLTNGTNGTKGTNGTNGVHKWEAHTPGTVSPVG 63

Query: 40  EPPTLIPKKFIACVSGEESAQRIKEEF------NDKITLLVGNNVEGVKEADIILLCTKP 93
            P    P +FIACVS E +A+++   F         + +L   NV+ VK+AD++LLC KP
Sbjct: 64  PPDVSTPTRFIACVSREATAKKLVSLFASMGEAASNVEVLASKNVQAVKQADVVLLCCKP 123

Query: 94  QVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTV 153
            V + IL+E+GM   L+ KL+ISILAGVTI QL +W P STR++RAMPNTPC IREGMTV
Sbjct: 124 PVAEKILSEQGMGDVLQGKLLISILAGVTISQLTDWVPPSTRVVRAMPNTPCKIREGMTV 183

Query: 154 LSC--PTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGG 211
           ++   P+   + D    + +FS++GR R LDEKH DA T L+GSGPA ACV+L+A+ADGG
Sbjct: 184 VTTLPPSPDEESDDVIILKIFSSIGRCRYLDEKHFDAATALAGSGPAIACVLLDAMADGG 243

Query: 212 VMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRS 271
           VMMGL R               RMVL+   HPA+IKD+V TPGGCTIAGLL +EDG++RS
Sbjct: 244 VMMGLSRSAALELAAQTFQGAARMVLQNA-HPAQIKDAVCTPGGCTIAGLLALEDGRVRS 302

Query: 272 TLARTIQEATQVASTLGNIQSK 293
           T+AR IQ AT+ A  LG    K
Sbjct: 303 TIARGIQAATERAGELGQFSKK 324



>gi|426200545|gb|EKV50469.1| hypothetical protein AGABI2DRAFT_63236 [Agaricus bisporus var.
           bisporus H97]
          Length = 324

 Score =  296 bits (759), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 159/322 (49%), Positives = 201/322 (62%), Gaps = 41/322 (12%)

Query: 12  TLCVLGCGTMGRAILSGILDSLN--------------------------------VAPAN 39
           TLCVLGCGTMG AILSG+LDSL+                                V+P  
Sbjct: 4   TLCVLGCGTMGIAILSGVLDSLDTSKHSLTNGTNGTKGTNGTNGVHKWEAHTPGTVSPVG 63

Query: 40  EPPTLIPKKFIACVSGEESAQRIKEEF------NDKITLLVGNNVEGVKEADIILLCTKP 93
            P    P +FIACVS E +A+++   F         + +L   NV+ VK+AD++LLC KP
Sbjct: 64  PPDVSTPTRFIACVSREATAKKLVSLFASMGEAASNVEVLALKNVQAVKQADVVLLCCKP 123

Query: 94  QVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTV 153
            V + IL+E+GM   L+ KL+ISILAGVTI QL +W P STR++RAMPNTPC IREGMTV
Sbjct: 124 PVAEKILSEQGMGDVLQGKLLISILAGVTISQLTDWVPPSTRVVRAMPNTPCKIREGMTV 183

Query: 154 LSC--PTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGG 211
           ++   P+   + D    + +FS++GR R LDEKH DA T L+GSGPA ACV+L+A+ADGG
Sbjct: 184 VTTLPPSPNEESDDVIILKIFSSIGRCRYLDEKHFDAATALAGSGPAIACVLLDAMADGG 243

Query: 212 VMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRS 271
           VMMGL R               RMVL+   HPA+IKD+V TPGGCTIAGLL +EDG++RS
Sbjct: 244 VMMGLSRSAALELAAQTFQGAARMVLQNA-HPAQIKDAVCTPGGCTIAGLLALEDGRVRS 302

Query: 272 TLARTIQEATQVASTLGNIQSK 293
           T+AR IQ AT+ A  LG    K
Sbjct: 303 TIARGIQAATERAGELGQFSKK 324



>gi|405121450|gb|AFR96219.1| pyrroline-5-carboxylate reductase [Cryptococcus neoformans var.
           grubii H99]
          Length = 313

 Score =  296 bits (758), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 162/314 (51%), Positives = 206/314 (65%), Gaps = 35/314 (11%)

Query: 12  TLCVLGCGTMGRAILSGILDSL--------NVAPANEPPTLI----------------PK 47
           TL VLGCGTMG AILSG++ SL        N   ++EPP+ I                P 
Sbjct: 4   TLAVLGCGTMGVAILSGVISSLETRASLPRNPNASSEPPSGISTPTASQFFDAPEASLPS 63

Query: 48  KFIACVSGEESAQRIKEEFND------KITLLVGN-NVEGVKEADIILLCTKPQVVKTIL 100
            FIA V  EE+ +++K    +      ++ +  G  NV+ V EAD+IL+C+KPQ+ ++IL
Sbjct: 64  TFIATVGREETGRKLKRTLAEMGPIGKQVQVRAGQGNVKTVDEADVILVCSKPQIARSIL 123

Query: 101 TEEGMQKSLENKLIISILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDC 160
            EEGM K+LE KL+ISI AGVTI QLK W P +TR++RAMPNTPC I EGMT+++  +D 
Sbjct: 124 EEEGMSKALEGKLLISICAGVTISQLKSWVPETTRVVRAMPNTPCKIGEGMTIVTPLSDA 183

Query: 161 SKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREV 220
               R+  + +F++ GR R LDEKH DA T L+GSGPAF  +VLEA+ADGGVMMGLPR  
Sbjct: 184 L--SRTLILNIFTSCGRCRFLDEKHFDACTALAGSGPAFVALVLEAMADGGVMMGLPRSE 241

Query: 221 XXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEA 280
                        RM L+TG HPA++KDSVTTPGGCTIAGLLT+EDG++RST+AR IQ A
Sbjct: 242 ALELAAQTMQGTGRMALQTGLHPAQLKDSVTTPGGCTIAGLLTLEDGRVRSTMARAIQVA 301

Query: 281 TQVASTLGNIQSKK 294
           T  AS LG  Q KK
Sbjct: 302 TNHASGLG--QDKK 313



>gi|164661345|ref|XP_001731795.1| hypothetical protein MGL_1063 [Malassezia globosa CBS 7966]
 gi|159105696|gb|EDP44581.1| hypothetical protein MGL_1063 [Malassezia globosa CBS 7966]
          Length = 300

 Score =  295 bits (755), Expect = 9e-78,   Method: Compositional matrix adjust.
 Identities = 150/297 (50%), Positives = 195/297 (65%), Gaps = 19/297 (6%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLI---------------PKKFIACVSGE 56
           T+ VL CGTMG AILSG+LD        E  T +               P+K+IA V  +
Sbjct: 2   TMAVLACGTMGTAILSGVLDCQAAMSRGEVSTDLSATSQAGETFERVPLPRKYIATVGRD 61

Query: 57  ESAQRIKEEFND----KITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENK 112
            +A+R+   F +     + +   NNVE V+++D++LLCTKPQ V   L+E GMQ++LE K
Sbjct: 62  STAKRLVRTFEEAGHTNVEVFKQNNVEAVRKSDLVLLCTKPQRVSEFLSEPGMQEALEGK 121

Query: 113 LIISILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVF 172
           +++SI AG TI ++K+  PSST+++RAMPNTPC IREGMTV+S   + S + R     +F
Sbjct: 122 MVVSIAAGTTIAKIKQCVPSSTKVVRAMPNTPCRIREGMTVISDVKELSHEQRDLLATIF 181

Query: 173 STLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXX 232
           S +GR   LDEK+ DA T L+GSGPAFA + LEA+ADGGVMMGLPR              
Sbjct: 182 SAVGRCNFLDEKYFDAATALAGSGPAFATLFLEAMADGGVMMGLPRAEALELAAQTMQGA 241

Query: 233 XRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
            RMVL++G HPA IKDSVTTPGGCTIAGLL MEDG++RST+ARTIQ A + A+ LG 
Sbjct: 242 ARMVLQSGAHPAVIKDSVTTPGGCTIAGLLQMEDGRVRSTIARTIQTAAEHAAGLGK 298



>gi|388581293|gb|EIM21602.1| pyrroline-5-carboxylate reductase [Wallemia sebi CBS 633.66]
          Length = 319

 Score =  295 bits (754), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 157/317 (49%), Positives = 204/317 (64%), Gaps = 37/317 (11%)

Query: 13  LCVLGCGTMGRAILSGILDSLNV-------------APANEPPT--------------LI 45
           LCVLGCGTMG A+LSG+++ LN              A     P                +
Sbjct: 5   LCVLGCGTMGVAVLSGVIEGLNTRKSVGMINFDNDNASGTSTPVDLSSSQAILEAKEGSL 64

Query: 46  PKKFIACVSGEESAQRIKEEFN------DKITLLVGN--NVEGVKEADIILLCTKPQVVK 97
           P KFI  V+  ESA+ +++ F+       ++ +L G   N++ V+++D++LLC KPQ+  
Sbjct: 65  PSKFICTVNRSESAKSLRKTFDALGDVGKEVNILQGKGVNIQAVRDSDVVLLCAKPQMAH 124

Query: 98  TILTEEGMQKSLENKLIISILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCP 157
           +IL+E GMQ++L NKL+ISILAGVTI Q+  W P ST+++RAMPNTPC IREGMTV+S  
Sbjct: 125 SILSEPGMQEALSNKLLISILAGVTISQISSWVPESTKVVRAMPNTPCKIREGMTVVSAL 184

Query: 158 TDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLP 217
                 ++   + +F ++GR R L+EKH DA T L GSGPAFA  VLEA+ADGGVMMGLP
Sbjct: 185 PSEWTFEKDLILAIFRSIGRCRFLEEKHFDACTALCGSGPAFAVTVLEAMADGGVMMGLP 244

Query: 218 REVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTI 277
           R               RMVL+TG HPA +KDSVTTPGGCTIAGLL +EDGK+RST+ARTI
Sbjct: 245 RAEAVELAAQSMQGIARMVLETGVHPAALKDSVTTPGGCTIAGLLALEDGKVRSTMARTI 304

Query: 278 QEATQVASTLGNIQSKK 294
           Q AT  A+ LG  Q+KK
Sbjct: 305 QVATTHAAGLG--QNKK 319



>gi|331213523|ref|XP_003319443.1| pyrroline-5-carboxylate reductase [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309298433|gb|EFP75024.1| pyrroline-5-carboxylate reductase [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 316

 Score =  294 bits (753), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 159/304 (52%), Positives = 202/304 (66%), Gaps = 27/304 (8%)

Query: 12  TLCVLGCGTMGRAILSGILDSL----NVAPANEPPTL----------------IPKKFIA 51
           +LCVLGCGTMG AILSG+++SL    +V P++  P                  IP +F+ 
Sbjct: 4   SLCVLGCGTMGVAILSGVIESLKTPKDVQPSSSVPQTPTAESDPDVDAPTEDSIPNRFVT 63

Query: 52  CVSGEESAQRIKEEF----NDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQK 107
           CVS  ESA+++K+ +     + I + V +NV GV E D+ILL  KPQ+ K +L   GMQ+
Sbjct: 64  CVSRPESARKLKKRWLELGREDIEVRVSDNVRGVAECDVILLGCKPQMAKDVLGAPGMQE 123

Query: 108 SLENKLIISILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPT-DCS--KDD 164
           +L NKL+ISILAG T  QL+ + PSSTR++RAMPNTPC IREGMT+LS  + DCS     
Sbjct: 124 ALSNKLLISILAGTTTSQLRSFVPSSTRVVRAMPNTPCQIREGMTILSALSPDCSFTTQT 183

Query: 165 RSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXX 224
           R+  + +F+ + R R LDEKH DA T +S SGPAF+ V+LEA+ADGGVMMGLPR      
Sbjct: 184 RAILLALFTPISRCRFLDEKHFDACTAVSASGPAFSLVILEAIADGGVMMGLPRAEALEL 243

Query: 225 XXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVA 284
                    RM L+TG HPA +KDSVTTP GCTIAGLL MEDG+IRST+AR IQ AT  A
Sbjct: 244 AAQAMQGAARMSLQTGLHPAALKDSVTTPAGCTIAGLLAMEDGRIRSTIARAIQTATLHA 303

Query: 285 STLG 288
           + LG
Sbjct: 304 AGLG 307



>gi|302690990|ref|XP_003035174.1| hypothetical protein SCHCODRAFT_74558 [Schizophyllum commune H4-8]
 gi|300108870|gb|EFJ00272.1| hypothetical protein SCHCODRAFT_74558 [Schizophyllum commune H4-8]
          Length = 312

 Score =  294 bits (753), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 152/308 (49%), Positives = 199/308 (64%), Gaps = 27/308 (8%)

Query: 13  LCVLGCGTMGRAILSGILDSLNVAPANEPPTL---------------------IPKKFIA 51
           LC+LGCGTMG AILSG++ SL  A +  P +                       P +FIA
Sbjct: 5   LCILGCGTMGIAILSGVVASLEAATSATPSSHKQPKWESHTPGTMTPDQDASSTPSQFIA 64

Query: 52  CVSGEESAQRIKEEFN------DKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGM 105
           CVS  E+  +++  F         + ++ G+N+  ++++D+++LC KPQ+   IL EEG+
Sbjct: 65  CVSRAETRTKLQGVFGALGPLGKTVQVVAGDNLNAIRQSDVVILCCKPQLAHVILAEEGI 124

Query: 106 QKSLENKLIISILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDR 165
             +LE KL++SILAGVT  QL  W   +TR+IRAMPNTPC IREGMTVL   +  ++ DR
Sbjct: 125 VDALEGKLLVSILAGVTQAQLVGWVRPTTRVIRAMPNTPCKIREGMTVLCNNSPITELDR 184

Query: 166 SFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXX 225
           +  + +FS++GR   LDEKH DA T LSGSGPAFAC+ LEA+ADGGVMMGLPR       
Sbjct: 185 AILLKIFSSIGRCSFLDEKHFDACTALSGSGPAFACIFLEAMADGGVMMGLPRAEALELA 244

Query: 226 XXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVAS 285
                   RMVL+ G HPA+IKD+VTTPGGCTIAGLL +EDG++RST+AR IQ AT+ AS
Sbjct: 245 AQTLQGAARMVLQHGAHPAQIKDTVTTPGGCTIAGLLALEDGRVRSTIARGIQIATERAS 304

Query: 286 TLGNIQSK 293
            LG    K
Sbjct: 305 ELGQPAKK 312



>gi|392572612|gb|EIW65757.1| hypothetical protein TREMEDRAFT_70417 [Tremella mesenterica DSM
           1558]
          Length = 311

 Score =  294 bits (752), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 154/307 (50%), Positives = 203/307 (66%), Gaps = 31/307 (10%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPAN-------EPPT----------------LIPKK 48
           TL VLGCGTMG AILSG+L SL+  P+        EPP+                ++P +
Sbjct: 4   TLAVLGCGTMGIAILSGVLTSLDSLPSRPSISEDTEPPSGISTPTNSQFLHAPDNVLPAR 63

Query: 49  FIACVSGEESAQRIKEEFN------DKITLLVGNNVEGVKEADIILLCTKPQVVKTILTE 102
           FIA V  EE+A+++++ F         + ++   NV  VK++D+IL+C+KPQ+ K+IL E
Sbjct: 64  FIATVGREETARKLRKVFGGMGERGKGVEVVSEGNVGAVKKSDVILVCSKPQIAKSILLE 123

Query: 103 EGMQKSLENKLIISILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSK 162
           EGM  +LE KL++SI AGVT+ QL+ W P S  ++RAMPNTPC IREGMTV++  +D   
Sbjct: 124 EGMADALEGKLLVSICAGVTLSQLRSWVPKSVMVVRAMPNTPCKIREGMTVVTPVSD--P 181

Query: 163 DDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXX 222
            +R+  + +F++ GR R LDEKH DA T L+GSGPAF  +VLEA+ADGGVMMGLPR    
Sbjct: 182 HNRALILAIFTSCGRCRFLDEKHFDACTALAGSGPAFVALVLEAMADGGVMMGLPRVEAL 241

Query: 223 XXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQ 282
                      RM L  G HPA++KDSVTTPGGCTIAGLLT+EDG++RST+AR IQ AT 
Sbjct: 242 ELAAQTIQGTGRMALYGGLHPAQLKDSVTTPGGCTIAGLLTLEDGRVRSTMARAIQVATN 301

Query: 283 VASTLGN 289
            A+ LG 
Sbjct: 302 HAAGLGQ 308



>gi|358054896|dbj|GAA99109.1| hypothetical protein E5Q_05798 [Mixia osmundae IAM 14324]
          Length = 316

 Score =  293 bits (751), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 160/309 (51%), Positives = 203/309 (65%), Gaps = 27/309 (8%)

Query: 13  LCVLGCGTMGRAILSGILDSL----------NVAPANEPPTLI--------PKKFIACVS 54
           LCV+GCGTMG AILSG+LDSL          N A      + I        P  F+  V+
Sbjct: 7   LCVVGCGTMGVAILSGVLDSLAHPSVESSSRNGAAETPDSSAILDPQADSSPANFVTTVN 66

Query: 55  GEESAQRIKEEFND-------KITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQK 107
            EES +R+ + + +        + ++ G+NV  V  +D+ILLC KPQ+ ++IL   GM +
Sbjct: 67  REESIKRLNKVWRETVKNSELHVDVVAGDNVGPVSRSDVILLCCKPQMAQSILQVPGMSE 126

Query: 108 SLENKLIISILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLS-CPTD-CSKDDR 165
           +L  KL+ISILAG  ++QL  W PS TR+IRAMPNTPC IREGMTV+S  PT   ++ DR
Sbjct: 127 ALAGKLVISILAGTRLEQLHSWLPSDTRVIRAMPNTPCKIREGMTVISNVPTGPNARLDR 186

Query: 166 SFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXX 225
           +    +F+ +GR R LDEK+ DA T LSGSGPAFAC++LEA+ADGGVMMGLPR       
Sbjct: 187 AILSSLFTPIGRVRFLDEKYFDACTALSGSGPAFACLMLEAMADGGVMMGLPRSEALELA 246

Query: 226 XXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVAS 285
                   RMVLK+G HPA IKDSVTTPGGCTIAGLLT+EDG++RST+AR IQ AT+ AS
Sbjct: 247 AQTMQGAARMVLKSGAHPAAIKDSVTTPGGCTIAGLLTLEDGRVRSTIARCIQTATEHAS 306

Query: 286 TLGNIQSKK 294
            LG   + K
Sbjct: 307 GLGQATTGK 315



>gi|323508089|emb|CBQ67960.1| probable PRO3-delta 1-pyrroline-5-carboxylate reductase
           [Sporisorium reilianum SRZ2]
          Length = 307

 Score =  293 bits (751), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 158/305 (51%), Positives = 209/305 (68%), Gaps = 24/305 (7%)

Query: 12  TLCVLGCGTMGRAILSGILDS-----------------LNVAPANEPPTLIPKKFIACVS 54
           TL V+GCGTMG AILSG+LDS                 L+ +   +  T +P ++IA V+
Sbjct: 5   TLAVIGCGTMGVAILSGVLDSQRSQQALASSMASSVSSLHDSTTGDDLTELPSRYIATVN 64

Query: 55  GEESAQRIKEEFND--KITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENK 112
             ES +R+K+ F +   I +  G NV+  ++AD+ILL  KPQ+V+ I+ E GM+++L+ K
Sbjct: 65  RLESVRRLKKTFVEYPDIEIHAGKNVQAARDADVILLGCKPQMVQDIIAEPGMKEALDGK 124

Query: 113 LIISILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSC--PTDCSKD-DRSFSI 169
           L+ISI AG+ I Q+ EW   +T+++RAMPNTPC IREGMT+L+   PT  + + DR+  +
Sbjct: 125 LVISICAGLRISQMVEWVTPATKVVRAMPNTPCKIREGMTILTPLPPTLPNAELDRNILL 184

Query: 170 WVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXX 229
            +FS +GR R LDEKH DA T L+GSGPAFACV LEA+ADGGVMMGLPR+          
Sbjct: 185 SIFSAVGRCRFLDEKHFDACTALAGSGPAFACVFLEAMADGGVMMGLPRQEALELAAQTM 244

Query: 230 XXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
               RMV+++G HPA IKDSVTTPGGCTIAGLL +EDGK+RST+ARTIQ A + AS LG 
Sbjct: 245 QGAARMVMQSGMHPAAIKDSVTTPGGCTIAGLLNLEDGKVRSTVARTIQAAAEHASGLG- 303

Query: 290 IQSKK 294
            Q+KK
Sbjct: 304 -QNKK 307



>gi|89267109|emb|CAJ41977.1| 1-pyrroline-5-carboxylate reductase [Ustilago hordei]
 gi|388856450|emb|CCF49999.1| probable PRO3-delta 1-pyrroline-5-carboxylate reductase [Ustilago
           hordei]
          Length = 308

 Score =  292 bits (748), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 157/306 (51%), Positives = 204/306 (66%), Gaps = 25/306 (8%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAP------------------ANEPPTLIPKKFIACV 53
           TL V+GCGTMG AILSG+LDS                       A +  T +P ++IA V
Sbjct: 5   TLAVIGCGTMGVAILSGVLDSQRSQQAQAAASMASSVSSLHDSSAGDDLTELPNRYIATV 64

Query: 54  SGEESAQRIKEEFND--KITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLEN 111
           +  ES +R+ + F     I +  G NV+  ++AD+ILL  KPQ+V+ I+ EEGM+++L+ 
Sbjct: 65  NRVESVRRLNKTFAQYPDIEIHAGKNVQAARDADVILLGCKPQMVQDIIAEEGMKEALDG 124

Query: 112 KLIISILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLS--CPTDCSKD-DRSFS 168
           KL+ISI AG+ I Q+ EW    T+++RAMPNTPC IREGMT+L+   P   + + DRS  
Sbjct: 125 KLVISICAGLRISQITEWVTPKTKVVRAMPNTPCKIREGMTILTPLSPNLPNAELDRSIL 184

Query: 169 IWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXX 228
           + +FS +G++R LDEKH DA T L+GSGPAFACV LEA+ADGGVMMGLPR          
Sbjct: 185 LSIFSAVGKSRFLDEKHFDACTALAGSGPAFACVFLEAMADGGVMMGLPRTEALELAAQT 244

Query: 229 XXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLG 288
                RMV+++G HPA IKDSVTTPGGCTIAGLL +EDGK+RST+ARTIQ A + AS LG
Sbjct: 245 MQGAARMVMQSGMHPAAIKDSVTTPGGCTIAGLLNLEDGKVRSTVARTIQAAAEHASGLG 304

Query: 289 NIQSKK 294
             Q+KK
Sbjct: 305 --QTKK 308



>gi|71004056|ref|XP_756694.1| hypothetical protein UM00547.1 [Ustilago maydis 521]
 gi|46095963|gb|EAK81196.1| hypothetical protein UM00547.1 [Ustilago maydis 521]
          Length = 307

 Score =  292 bits (747), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 155/305 (50%), Positives = 208/305 (68%), Gaps = 24/305 (7%)

Query: 12  TLCVLGCGTMGRAILSGILDS-----------------LNVAPANEPPTLIPKKFIACVS 54
           TL ++GCGTMG AILSG+LDS                 L+ +   +  + +P ++IA V+
Sbjct: 5   TLAIIGCGTMGVAILSGVLDSQRSQQAIASSMASSVSSLHDSTTCDDLSELPTRYIATVN 64

Query: 55  GEESAQRIKEEFND--KITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENK 112
             ES +R+K+ F+    I +  G NV   +EAD+ILL  KPQ+V+ I+ E GM+++L+ K
Sbjct: 65  RLESVRRLKKTFSQYPDIQIHAGQNVAAAREADVILLGCKPQMVQDIIAECGMKEALDGK 124

Query: 113 LIISILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLS-CPTDC--SKDDRSFSI 169
           L+ISI AG+ I Q+ EW   +T+++RAMPNTPC IREGMT+L+  P+    ++ DR+  +
Sbjct: 125 LVISICAGLRISQIVEWVTPATKVVRAMPNTPCKIREGMTILTPLPSTLPNAELDRNILL 184

Query: 170 WVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXX 229
            +FS +GR R LDEKH DA T L+GSGPAFACV LEA+ADGGVMMGLPR+          
Sbjct: 185 SIFSAVGRCRFLDEKHFDACTALAGSGPAFACVFLEAMADGGVMMGLPRQEALELAAQTM 244

Query: 230 XXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
               RMV+++G HPA IKDSVTTPGGCTIAGLL +EDGK+RST+ARTIQ A + AS LG 
Sbjct: 245 QGAARMVMQSGMHPAAIKDSVTTPGGCTIAGLLNLEDGKVRSTVARTIQAAAEHASGLG- 303

Query: 290 IQSKK 294
            Q++K
Sbjct: 304 -QNRK 307



>gi|505759556|gb|EOR03647.1| Pyrroline-5-carboxylate reductase [Wallemia ichthyophaga EXF-994]
          Length = 307

 Score =  283 bits (724), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 155/310 (50%), Positives = 199/310 (64%), Gaps = 39/310 (12%)

Query: 21  MGRAILSGILDSLNV-------------APANEPP--------------TLIPKKFIACV 53
           MG A+LSG++D LN              A     P              + +P KF+  V
Sbjct: 1   MGVAVLSGVIDGLNTRNSMSTSQLNTDDASGTSTPIDISSSQAIMEAKESCLPSKFLCTV 60

Query: 54  SGEESAQRIKEEFN------DKITLLVGN--NVEGVKEADIILLCTKPQVVKTILTEEGM 105
           +  ESA+ +++ F+       ++ +L G   NV+ V+++D++LLC KPQ+  TIL E GM
Sbjct: 61  NRSESAKSLRKTFDLLGDAGKQVNILQGGGVNVDAVRDSDVVLLCAKPQMAHTILNEPGM 120

Query: 106 QKSLENKLIISILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSC-PTDCSKDD 164
           Q++L NKL+ISILAGVTI Q+  W P ST+++RAMPNTPC IREGMTV+S  PTD    +
Sbjct: 121 QEALANKLLISILAGVTITQIHSWVPKSTKVVRAMPNTPCKIREGMTVVSALPTDWVF-E 179

Query: 165 RSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXX 224
           +   + +F ++GR R L+EKH DA T L GSGPAFA  VLEA+ADGGVMMGLPR      
Sbjct: 180 KELILAIFRSIGRCRFLEEKHFDACTALCGSGPAFAVTVLEAMADGGVMMGLPRAEAVEL 239

Query: 225 XXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVA 284
                    RMVL+TG HPA +KDSVTTPGGCTIAGLL +EDGK+RST+ARTIQ AT  A
Sbjct: 240 AAQSMQGIARMVLETGVHPAALKDSVTTPGGCTIAGLLALEDGKVRSTMARTIQVATSHA 299

Query: 285 STLGNIQSKK 294
           S LG  Q+KK
Sbjct: 300 SGLG--QAKK 307



>gi|465792850|emb|CCU98092.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 296

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 145/290 (50%), Positives = 192/290 (66%), Gaps = 12/290 (4%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAP--ANEP------PTLIPKKFIACVSGEESAQRIK 63
           TL VL CGTMG AILSG+++S       AN P        ++P+++I  V    +A+R+K
Sbjct: 6   TLAVLACGTMGTAILSGVMESQRAMQEGANIPVESESGHPVLPERYIVTVGRPTTAKRLK 65

Query: 64  EEF----NDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILA 119
             F    +D + +    NV   +EAD +LLC KPQ V   L+EEGM+ +L+NK+++SI A
Sbjct: 66  SMFESAGHDHVEVHTQENVVAAREADFVLLCCKPQRVGEFLSEEGMRDALKNKIVVSIAA 125

Query: 120 GVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRAR 179
           GVTI +L+++  +ST+++RAMPNTP  IREGMTV+S     S+D+R     +FS +GR  
Sbjct: 126 GVTISKLQKYLDASTKVVRAMPNTPSKIREGMTVISNVDTLSQDERDLLCSIFSAVGRCH 185

Query: 180 ILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKT 239
            LDEK  DA T L+GSGPAF  + LEA+ DGGVMMGLPR               RMVL++
Sbjct: 186 FLDEKLFDAATALAGSGPAFVTLFLEAMTDGGVMMGLPRPEALELAAQTMQGAARMVLQS 245

Query: 240 GKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           G HPA IKDSVTTPGGCTIAGLL MEDG++RST+AR+IQ A + A+ LG 
Sbjct: 246 GTHPAAIKDSVTTPGGCTIAGLLQMEDGRLRSTVARSIQTAAEHAAGLGK 295



>gi|472581695|gb|EMS19418.1| pyrroline-5-carboxylate reductase [Rhodosporidium toruloides NP11]
          Length = 315

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 150/309 (48%), Positives = 194/309 (62%), Gaps = 33/309 (10%)

Query: 13  LCVLGCGTMGRAILSGILDSLNV-------------APA----------NEPPTLIPKKF 49
           LCVLGCGTMG A+LSG+LD+L                P+          N  PT +P +F
Sbjct: 5   LCVLGCGTMGVAVLSGVLDNLRAPRSSRQSNGPDESGPSTPMGSLILDNNSNPTSLPDRF 64

Query: 50  IACVSGEESAQRIKEEFNDKITL-------LVGNNVEGVKEADIILLCTKPQVVKTILTE 102
           IA V+  ESA++++  F +               NV+ V E+D+ILLC KPQ+   +L  
Sbjct: 65  IATVNRAESAKKLRRTFFELGGFGPSVEVRQASENVKSVAESDVILLCCKPQLAAHLLLA 124

Query: 103 EGMQKSLENKLIISILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSC--PTDC 160
            GM ++LE KL+ISILAG TI  ++EW PSS  ++R+MPNTP  IREGMTV+S   P+D 
Sbjct: 125 PGMSEALEGKLLISILAGTTISMMREWVPSSCTVVRSMPNTPSKIREGMTVVSSLDPSDS 184

Query: 161 SKD-DRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPRE 219
               +R   + +F+ LG+ R +DEKH DAVT + GSGPAF CVVLEA+ADGGVMMGLPR 
Sbjct: 185 KTPVNREILMALFTPLGKCRFMDEKHFDAVTAVCGSGPAFVCVVLEAMADGGVMMGLPRS 244

Query: 220 VXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQE 279
                         RMVL+TG HPA +KDSVTTPGGCTIAGLL++ED ++RS +AR IQ 
Sbjct: 245 EALELAAQTMQGAARMVLQTGMHPAALKDSVTTPGGCTIAGLLSLEDARMRSAVARCIQL 304

Query: 280 ATQVASTLG 288
             + A+ LG
Sbjct: 305 TAEHAAGLG 313



>gi|501310523|dbj|GAC99281.1| pyrroline-5-carboxylate reductase [Pseudozyma hubeiensis SY62]
          Length = 294

 Score =  276 bits (707), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 151/296 (51%), Positives = 196/296 (66%), Gaps = 24/296 (8%)

Query: 21  MGRAILSGILDSLN-----------------VAPANEPPTLIPKKFIACVSGEESAQRIK 63
           MG AILSG+LDS                    +   +  T +P ++IA V+  ES +R+K
Sbjct: 1   MGVAILSGVLDSQRSQQAIASSMASSVSSLQDSSMGDDLTELPTRYIATVNRIESVRRLK 60

Query: 64  EEFND--KITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGV 121
           + F+    I +  G NV   + AD+ILL  KPQ+V+ I+ E GM+++L  KL+ISI AG+
Sbjct: 61  KTFSAYPDIEIHSGQNVHAAQSADVILLGCKPQMVQDIIAEPGMKEALSGKLVISICAGL 120

Query: 122 TIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLS-CPTDC--SKDDRSFSIWVFSTLGRA 178
            I Q+ EW   ST+++RAMPNTPC IREGMT+L+  P+    S+ DR+  + +FS +GR 
Sbjct: 121 RISQMLEWVTPSTKVVRAMPNTPCKIREGMTILTPLPSTLPNSELDRNILLSIFSAVGRC 180

Query: 179 RILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLK 238
           R LDEKH DA T L+GSGPAFACV LEA+ADGGVMMGLPR+              RMV++
Sbjct: 181 RFLDEKHFDACTALAGSGPAFACVFLEAMADGGVMMGLPRQEALELAAQTMQGAARMVMQ 240

Query: 239 TGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGNIQSKK 294
           +G HPA IKDSVTTPGGCTIAGLL +EDGK+RST+ARTIQ A + AS LG  Q+KK
Sbjct: 241 SGMHPAAIKDSVTTPGGCTIAGLLNLEDGKVRSTVARTIQAAAEHASGLG--QNKK 294



>gi|353237245|emb|CCA69222.1| probable PRO3-delta 1-pyrroline-5-carboxylate reductase
           [Piriformospora indica DSM 11827]
          Length = 327

 Score =  275 bits (702), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 139/263 (52%), Positives = 178/263 (67%), Gaps = 18/263 (6%)

Query: 45  IPKKFIACVSGEESAQRIKEEFND------KITLLVGNNVEGVKEADIILLCTKPQVVKT 98
           IP +F+ACVS E +A++++  F         I +    NVE  ++AD+ILLC KPQ+   
Sbjct: 61  IPTRFLACVSRESTARKLQTTFAQLGPLGAGIEVFQSANVEAAQQADVILLCCKPQIAHV 120

Query: 99  ILTEEGMQKSLENKLIISILAGVTIDQLKEWAPSSTRIIRAMPNTPCM-----IREGMTV 153
           IL EEGM+++L  KL+ISILAGVTI Q+ EW    TR++RAMPNTPC      IREGMTV
Sbjct: 121 ILNEEGMKEALHKKLVISILAGVTISQMTEWVTPETRLVRAMPNTPCKASPVDIREGMTV 180

Query: 154 LSCPTDCSKD-------DRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEA 206
           ++   D +         +++  + +FS++GR R L+EKH DA T LSGSGPAFACV LEA
Sbjct: 181 ITPSLDSAPGVSTDVELEKTIILNIFSSIGRCRFLEEKHFDACTALSGSGPAFACVFLEA 240

Query: 207 LADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMED 266
           +ADGGVMMGLPR               RMVL+ G HPA+IKD+VTTPGGCTIAGLL +ED
Sbjct: 241 IADGGVMMGLPRAEALELAAQTLQGAARMVLQDGAHPAQIKDAVTTPGGCTIAGLLALED 300

Query: 267 GKIRSTLARTIQEATQVASTLGN 289
           G++RST+AR IQ AT+ AS LG 
Sbjct: 301 GRVRSTIARAIQIATERASVLGQ 323



>gi|501755979|emb|CCG80872.1| Pyrroline-5-carboxylate reductase [Taphrina deformans PYCC 5710]
          Length = 506

 Score =  272 bits (695), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 137/284 (48%), Positives = 190/284 (66%), Gaps = 5/284 (1%)

Query: 9   TNPTLCVLGCGTMGRAILSGILDSLNVA--PANEPPTLIPKKFIACVSGEESAQRIKEEF 66
           T P LC LGCGTMGR+ILSG+LD++  +    +    L P +FIACV  E +A ++KEE+
Sbjct: 222 TGPILCALGCGTMGRSILSGVLDAIEESGITMHRSGLLPPARFIACVRREAAATKLKEEW 281

Query: 67  NDKITLLVG--NNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTID 124
            D ++++ G   N   V E+D ILL +KPQV + ILT  GM++SL  K++ISILAG TI 
Sbjct: 282 GDMVSVVRGPEGNARAVSESDYILLGSKPQVAREILTSPGMRESLHGKVLISILAGTTIG 341

Query: 125 QLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEK 184
            L+   P  T+++R MPNTP  IR+GM+V+      +  +     W+F+ +G+  ++DEK
Sbjct: 342 TLQSLCPPDTKVVRVMPNTPSRIRKGMSVIVPGEGVAGTELELVSWIFNQVGKTLVMDEK 401

Query: 185 HLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPA 244
           H+DA T + GSGPAF  V+LE++ DGGVMMG+PR+               MV + G+HPA
Sbjct: 402 HIDAATAMCGSGPAFMAVILESMTDGGVMMGIPRQQAEELAAQTMLGTASMV-QAGQHPA 460

Query: 245 EIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLG 288
            I+++V TPGGCTI GLL MEDG+IRST+ARTIQ AT +A+ LG
Sbjct: 461 LIRNAVATPGGCTIGGLLEMEDGRIRSTMARTIQTATNIAAGLG 504



>gi|169854118|ref|XP_001833736.1| pyrroline-5-carboxylate reductase [Coprinopsis cinerea
           okayama7#130]
 gi|116505203|gb|EAU88098.1| pyrroline-5-carboxylate reductase [Coprinopsis cinerea
           okayama7#130]
          Length = 306

 Score =  268 bits (685), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 152/314 (48%), Positives = 194/314 (61%), Gaps = 43/314 (13%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAP------------------------ANEPPTLIPK 47
           TLCVLGCGTMG A+LSG++ SL+ A                         A  P   IPK
Sbjct: 4   TLCVLGCGTMGIAVLSGVIASLDSAKGVSQANGVKPQKWEIHTPGTVTPTAETPDPTIPK 63

Query: 48  KFIACVSGEESAQRIKEEFN------DKITLLVGNNVEGVKEADIILLCTKPQVVKTILT 101
           KFIACV+ E SA+++ E F+        + ++   N+E V+ +D++LL  KPQV + IL 
Sbjct: 64  KFIACVNRESSAKKLAETFSALGPRGQSVEVVAKQNLESVQRSDVVLLGCKPQVAQVILG 123

Query: 102 EEGMQKSLENKLIISILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSC--PTD 159
           E GM+++L+ KL+ISILAGVT+ QL+     +TRI           REGMTV+S   P+ 
Sbjct: 124 EPGMKEALDGKLLISILAGVTMSQLEAMVLPTTRI-----------REGMTVVSNLPPSP 172

Query: 160 CSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPRE 219
            S +D    + +FS++GR R L+EKH DA T L GSGPAFAC+ LEA+ADGGVMMGLPR 
Sbjct: 173 HSDNDTEIILKIFSSIGRCRFLEEKHFDACTALGGSGPAFACLFLEAMADGGVMMGLPRA 232

Query: 220 VXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQE 279
                         RMVL    HPA+IKDSVTTPGGCTIAGLL +EDGK+RST+AR IQ 
Sbjct: 233 EALELAAQTLQGAARMVLGGSMHPAQIKDSVTTPGGCTIAGLLALEDGKVRSTIARGIQA 292

Query: 280 ATQVASTLGNIQSK 293
           AT+ AS LG   +K
Sbjct: 293 ATERASELGQPANK 306



>gi|296417711|ref|XP_002838496.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295634435|emb|CAZ82687.1| unnamed protein product [Tuber melanosporum]
          Length = 320

 Score =  267 bits (683), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 146/316 (46%), Positives = 191/316 (60%), Gaps = 35/316 (11%)

Query: 8   PTNPTLCVLGCGTMGRAIL-----------------------------SGILDSLNVAPA 38
           P + TL +LGCGTMG AIL                              G L       A
Sbjct: 5   PDSLTLTILGCGTMGVAILSGILSSLSTSLSTSLSRLPPSASGTSTPTGGALLPTRFHDA 64

Query: 39  NEPPTLIPKKFIACVSGEESAQRIKEEFND-----KITLLVGNNVEGVKEADIILLCTKP 93
           +  PT +P KFIACV   ESA R++  F        + +  G NVEGV+ AD+++L  KP
Sbjct: 65  SRTPTRLPSKFIACVKRPESASRVRRAFEGFAGAPAVEVYTGRNVEGVRGADVVILGCKP 124

Query: 94  QVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTV 153
           Q+   IL EEGM+++LE KL++SILAGV I  L+   P STR++RAMPNT  MIRE MTV
Sbjct: 125 QMYAEILREEGMREALEGKLLVSILAGVKIAALRVVVPYSTRVVRAMPNTASMIRESMTV 184

Query: 154 LSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVM 213
           +S   D S ++++   W+FS +GR+ +L EKH++A T L GSGPAF  +++EA+ADGGVM
Sbjct: 185 ISAEDDISPEEKALVSWIFSQVGRSLVLGEKHMNACTALCGSGPAFYALIVEAMADGGVM 244

Query: 214 MGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTL 273
           MGLPR               RMVL  G HPA I++ V+TP GCT  GLL +EDGK+RST+
Sbjct: 245 MGLPRAEAQMMAAQTMQGAGRMVL-AGHHPAIIREQVSTPAGCTTHGLLILEDGKVRSTI 303

Query: 274 ARTIQEATQVASTLGN 289
           ARTI+EAT +A+ LG 
Sbjct: 304 ARTIREATNMAAGLGK 319



>gi|403415698|emb|CCM02398.1| predicted protein [Fibroporia radiculosa]
          Length = 319

 Score =  254 bits (650), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 137/271 (50%), Positives = 177/271 (65%), Gaps = 27/271 (9%)

Query: 45  IPKKFIACVSGEESAQRIKEEFND------KITLLVGNNVEGVKEADIILL--------- 89
           +P +FIACV+ EESA+R++  F        ++ +LV  NV+  + +++ILL         
Sbjct: 46  LPSQFIACVTREESAKRLRNAFASPNAVGCRVEVLVSQNVKAAQASNVILLWWVFSSDLS 105

Query: 90  ---------CTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPSSTRIIRAM 140
                      KPQ    IL E GM+++L+ KL+ISILAGVTI Q+      +T++IRAM
Sbjct: 106 PCGLPSASVSCKPQQAHDILNEPGMKEALDGKLLISILAGVTIAQMSALVYPATKVIRAM 165

Query: 141 PNTPCMIREGMTVLSC--PTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPA 198
           PNTP  IREGMTV+S   P+   + DRS  + +FS++GR R L+EKH DA T LSGSGPA
Sbjct: 166 PNTPTKIREGMTVVSTLPPSSTFEIDRSIILNIFSSIGRCRFLEEKHFDACTALSGSGPA 225

Query: 199 FACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTI 258
           FAC+ LEA+ADGGVMMGLPR               RM L +G HPA++KDSVTTPGGCTI
Sbjct: 226 FACIFLEAMADGGVMMGLPRAEAIELAAQTLQGAARMTL-SGIHPAQLKDSVTTPGGCTI 284

Query: 259 AGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           AGLL +EDGK+RST+AR IQ AT+ AS LG 
Sbjct: 285 AGLLALEDGKVRSTIARAIQIATERASELGQ 315



>gi|345569211|gb|EGX52079.1| hypothetical protein AOL_s00043g469 [Arthrobotrys oligospora ATCC
           24927]
          Length = 312

 Score =  253 bits (646), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 143/302 (47%), Positives = 188/302 (62%), Gaps = 29/302 (9%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTL--------------IPKKFIACVSGEE 57
           +L  +GCGTMG A+LSGIL +L    A E  T               +P  F+ACV   E
Sbjct: 15  SLGFIGCGTMGVAVLSGILAAL----ATESKTAPPSPFPSTPSTPTHLPTSFVACVKRHE 70

Query: 58  SAQRIKEEF---------NDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKS 108
           SA R+ + F         +  +T++ G+N  G + +DII+L  KPQ+V  IL+ E  + +
Sbjct: 71  SATRLGKIFPQATLSPSTSPPVTIIAGDNTRGAQLSDIIVLGCKPQIVSEILSVEATRDA 130

Query: 109 LENKLIISILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSC-PTDCSKDDRSF 167
           L+ KL+ISI AGVT+ QL      STR+IR MPNT   IR+ MTV+SC P    +++R  
Sbjct: 131 LKGKLLISICAGVTLAQLGALVDPSTRVIRVMPNTASRIRDSMTVISCDPAVIPQEERDL 190

Query: 168 SIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXX 227
             W+FS +GRA  L EKH+DA T L GSGPAF  +VLEA+ADGGVMMGLPR         
Sbjct: 191 VFWIFSQIGRAIFLAEKHMDASTALCGSGPAFMALVLEAMADGGVMMGLPRVEAQMMAAQ 250

Query: 228 XXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
                  MVL+ G+HPA I++ V+TP GCTI GLL +EDG++RST+AR IQEAT+VAS L
Sbjct: 251 TMRGTAGMVLE-GEHPAIIREKVSTPAGCTIGGLLILEDGRLRSTIARGIQEATRVASGL 309

Query: 288 GN 289
           G+
Sbjct: 310 GS 311



>gi|213401291|ref|XP_002171418.1| delta-1-pyrroline-5-carboxylate reductase [Schizosaccharomyces
           japonicus yFS275]
 gi|211999465|gb|EEB05125.1| delta-1-pyrroline-5-carboxylate reductase [Schizosaccharomyces
           japonicus yFS275]
          Length = 281

 Score =  242 bits (617), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 129/287 (44%), Positives = 178/287 (62%), Gaps = 19/287 (6%)

Query: 13  LCVLGCGTMGRAILSGILDSL--NVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKI 70
            CVLGCGTMG+A+L+GI DS+  N  P  + P  +P K+ ACV       +  +E  D  
Sbjct: 4   FCVLGCGTMGKALLTGIFDSVAENGVP-TDVPFAVPDKYFACV-------KFAKEVEDGQ 55

Query: 71  TLLVGN--------NVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVT 122
            LL G         NV   +++  +LL  KPQV   +L   GM+++L+ KL++SILAG T
Sbjct: 56  RLLGGRAEFVQHSGNVRAAEQSQYVLLACKPQVASEVLGVAGMREALKGKLVLSILAGKT 115

Query: 123 IDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILD 182
           IDQL+     STR++R MPNT   IRE M+V+      +  D  F+ WVFS +GR   LD
Sbjct: 116 IDQLQSMVDESTRVVRIMPNTASRIRESMSVICAGPRATPTDVEFAEWVFSGIGRTMQLD 175

Query: 183 EKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKH 242
           E+ +DA T L GSGPAF   ++EA+ DGG+MMG+P                +MV+ +G+H
Sbjct: 176 ERLIDAATALCGSGPAFVATMIEAMTDGGIMMGIPFRQAQELAAQTMVGTAKMVI-SGQH 234

Query: 243 PAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           PA I++ V+TP GCTI+GLL +EDGK+RST+AR+I+EAT+ AS LG 
Sbjct: 235 PAMIRNDVSTPAGCTISGLLALEDGKLRSTIARSIEEATKRASGLGK 281



>gi|494028903|ref|WP_006971043.1| pyrroline-5-carboxylate reductase [Plesiocystis pacifica]
 gi|149820378|gb|EDM79794.1| pyrroline-5-carboxylate reductase [Plesiocystis pacifica SIR-1]
          Length = 267

 Score =  239 bits (610), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 131/280 (46%), Positives = 175/280 (62%), Gaps = 17/280 (6%)

Query: 13  LCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITL 72
           +CV+GCGTMG AI+ G++ +           L P + +        A+R+ E      T 
Sbjct: 1   MCVIGCGTMGEAIVGGLMRA---------GWLEPDRVVVTARRASVAERLHERLGVAATT 51

Query: 73  LVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPS 132
              +N+   + A ++L+C KPQ    IL  + M+++L  KL+ISI AGVT+  L +W P 
Sbjct: 52  ---DNLAACQGAQVVLVCLKPQRFAKILDNDAMREALAGKLLISIAAGVTLSSLAQWLPQ 108

Query: 133 STRIIRAMPNTPCMIREGMTVL----SCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDA 188
            T +IRAMPNTPC+I EGMTVL    + PT  S +  + +  +F ++G    ++ K +DA
Sbjct: 109 -TALIRAMPNTPCLIGEGMTVLGRRDAGPTAASDEQLALAKRIFDSVGVTAEVEPKLMDA 167

Query: 189 VTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKD 248
           VT L+GSGPAF  V+LEA+ADGGVMMGLPR+V              MVL T  HPA +KD
Sbjct: 168 VTSLNGSGPAFVYVMLEAMADGGVMMGLPRDVAVTIAAQVFRGAAGMVLDTDLHPAALKD 227

Query: 249 SVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLG 288
            VTTP GCTIAG+LTMEDG+IRS LARTIQEAT+VA +LG
Sbjct: 228 QVTTPAGCTIAGILTMEDGRIRSVLARTIQEATKVAGSLG 267



>gi|19115618|ref|NP_594706.1| delta-1-pyrroline-5-carboxylate reductase (predicted)
           [Schizosaccharomyces pombe 972h-]
 gi|20139808|sp|Q9P7Y7.1|P5CR_SCHPO RecName: Full=Pyrroline-5-carboxylate reductase; Short=P5C
           reductase; Short=P5CR
 gi|6723911|emb|CAB66314.1| delta-1-pyrroline-5-carboxylate reductase (predicted)
           [Schizosaccharomyces pombe]
          Length = 282

 Score =  238 bits (608), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 126/280 (45%), Positives = 182/280 (65%), Gaps = 6/280 (2%)

Query: 13  LCVLGCGTMGRAILSGILDSLNVAPANE--PPTLIPKKFIACVSGEESAQRIKEEFNDKI 70
            CVLGCGTMG+A+L+GI DS+     N+     +IP KF ACV   +  + +++ F D++
Sbjct: 4   FCVLGCGTMGKALLTGIFDSI-AENGNDVSDEIIIPNKFYACVKFPKEKEDVQKLFGDRV 62

Query: 71  TLLVG--NNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKE 128
            +++G   N E    ++++LL  KPQ  + +L    M+++L+ KLI+SILAG TI  L+ 
Sbjct: 63  KVVMGAKENAEMAAISNVLLLSCKPQAAEDVLNSPKMKEALKGKLILSILAGKTISSLQS 122

Query: 129 WAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDA 188
               STR+IR MPNT   IRE M+V+    + +++D  F+ WVF+ +GR+  L EK +DA
Sbjct: 123 MLDESTRVIRIMPNTASRIRESMSVICPGPNATEEDIKFAEWVFNGIGRSMKLPEKLIDA 182

Query: 189 VTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKD 248
            T + GSGPAF   ++EA+ DGGVMMG+P                RMVL+ G+HPA I++
Sbjct: 183 ATAVCGSGPAFVATMIEAMTDGGVMMGIPFPQAQELAAQTMVGTGRMVLQ-GQHPAMIRN 241

Query: 249 SVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLG 288
            V+TP GCTI+GLL +EDGKIRST+AR I++AT+ AS LG
Sbjct: 242 DVSTPAGCTISGLLALEDGKIRSTIARGIEQATKTASGLG 281



>gi|295674063|ref|XP_002797577.1| pyrroline-5-carboxylate reductase [Paracoccidioides sp. 'lutzii'
           Pb01]
 gi|226280227|gb|EEH35793.1| pyrroline-5-carboxylate reductase [Paracoccidioides sp. 'lutzii'
           Pb01]
          Length = 336

 Score =  235 bits (600), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 132/306 (43%), Positives = 193/306 (63%), Gaps = 29/306 (9%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANE---------------PPTLIPKKFIACVSGE 56
           TL VLGCGT+G AILSGI  SL  A ++                P   IP+KFIACV   
Sbjct: 22  TLTVLGCGTLGIAILSGIFASLAEAGSHSAYPSESGTTTPSEMVPQQKIPRKFIACVRRP 81

Query: 57  ESAQRIK---EEFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKL 113
           ES +R+    E F+  +T++   NV+ V++A++++L  KP +++ +L E GM K+L+ KL
Sbjct: 82  ESVKRVHKALEGFSMPLTVVQNENVKAVEQAEVVILGCKPYMLRDVLDEPGMCKALQGKL 141

Query: 114 IISILAGVTIDQLKE--WAPSST-------RIIRAMPNTPCMIREGMTVLSCPTDCSKDD 164
           +ISILAGVT++Q+ +  + P+S+       R++RAMPNT  ++RE MTV++       ++
Sbjct: 142 LISILAGVTVEQIVDTLYPPTSSVPESTRCRVVRAMPNTAALVRESMTVIATSNPPLPEE 201

Query: 165 RSFSI-WVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXX 223
            +  I W+FS +GR   L    +D  T L+GSGPAFA +++EA+ADG V MGLPR     
Sbjct: 202 WNVLISWIFSRVGRVVTLPPSMMDVCTSLAGSGPAFAALIMEAMADGAVSMGLPRAEAQM 261

Query: 224 XXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQV 283
                      MV ++G+HPA I++ V+TPGGCTI GLL +E+G++R TLAR+++EAT V
Sbjct: 262 MAAQVMRGTAGMV-QSGEHPALIREKVSTPGGCTIGGLLVLEEGRVRGTLARSVREATVV 320

Query: 284 ASTLGN 289
           AS LG 
Sbjct: 321 ASQLGQ 326



>gi|261195514|ref|XP_002624161.1| pyrroline-5-carboxylate reductase [Ajellomyces dermatitidis
           SLH14081]
 gi|239588033|gb|EEQ70676.1| pyrroline-5-carboxylate reductase [Ajellomyces dermatitidis
           SLH14081]
 gi|239610475|gb|EEQ87462.1| pyrroline-5-carboxylate reductase [Ajellomyces dermatitidis ER-3]
 gi|327349095|gb|EGE77952.1| pyrroline-5-carboxylate reductase [Ajellomyces dermatitidis ATCC
           18188]
          Length = 335

 Score =  235 bits (599), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 134/306 (43%), Positives = 190/306 (62%), Gaps = 29/306 (9%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANE---------------PPTLIPKKFIACVSGE 56
           TL VLGCGTMG AILSGIL SL+ A ++                P   IP  FIACV   
Sbjct: 21  TLTVLGCGTMGIAILSGILASLSEARSHSAYPSESGTTTPSELVPEQKIPNNFIACVRRP 80

Query: 57  ESAQRIK---EEFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKL 113
           ESA+R++   E ++  +T+L   N++ V +A++++L  KP +++ +L   GM ++LE KL
Sbjct: 81  ESAKRVRKALESYSMPLTVLQNENIKAVNDAEVVILGCKPYMLQDVLGVPGMTEALEGKL 140

Query: 114 IISILAGVTIDQLKE-WAPSST--------RIIRAMPNTPCMIREGMTVLSCPTDCSKDD 164
           +ISILAGVT+DQ++    PS++        R++RAMPNT  ++RE MTV+   T    ++
Sbjct: 141 LISILAGVTVDQIENTLYPSTSTVPESKRCRVVRAMPNTAAIVRESMTVIGTSTPPLPEE 200

Query: 165 RSFSI-WVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXX 223
            +  I W+FS +GR   L    +D  T L+GSGPAF  +V+EA+ADG V MGLPR     
Sbjct: 201 WNVLISWIFSRVGRVVTLPPSMMDVCTSLAGSGPAFVALVMEAMADGAVAMGLPRAEAQM 260

Query: 224 XXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQV 283
                      MV + G+HPA I++ V+TPGGCTI GLL +E+G++R TLAR+++EAT V
Sbjct: 261 MAAQVMRGTAGMV-QNGEHPALIREKVSTPGGCTIGGLLVLEEGRVRGTLARSVREATVV 319

Query: 284 ASTLGN 289
           AS LG 
Sbjct: 320 ASQLGQ 325



>gi|494827426|gb|EON64376.1| pyrroline-5-carboxylate reductase [Coniosporium apollinis CBS
           100218]
          Length = 329

 Score =  231 bits (589), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 131/310 (42%), Positives = 181/310 (58%), Gaps = 33/310 (10%)

Query: 12  TLCVLGCGTMGRAILSGILDSLN-----------------VAPANEPPTLIPKKFIACVS 54
           TL VLGCGTMG AIL GI+ SL                    P  E P  +P +FIACV 
Sbjct: 11  TLTVLGCGTMGVAILGGIMASLTSPSKPQSYPASTAPSGTATPTEELPPRLPSRFIACVR 70

Query: 55  GEESAQRIKE---EFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLEN 111
             ES ++++     +N     LV +N+ G ++AD++LL  KPQ+ + IL ++GM+++L  
Sbjct: 71  RPESLKKVRNALSHYNVPFKALVSDNLRGAQDADVVLLGCKPQMFRDILGQDGMREALAG 130

Query: 112 KLIISILAGVTIDQLKE-----------WAPSSTRIIRAMPNTPCMIREGMTVLSCPTDC 160
           KL+ISILAGVT +QL+E           + P   R++RAMPNT  ++RE MTV++  T  
Sbjct: 131 KLLISILAGVTTEQLEEFLYGGVLSGQNFPPDRCRVVRAMPNTASLVRESMTVVATSTPP 190

Query: 161 SKDDRSFSI-WVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPRE 219
               ++  I W+F+ +GR   L    +DA T L GSGPAF  +VLEA+ADG V MGLPR 
Sbjct: 191 LDPAQAQLINWIFTRIGRVVTLPPTAMDASTALCGSGPAFMALVLEAIADGAVAMGLPRA 250

Query: 220 VXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQE 279
                          +VL  G HPA ++D V+TPGGCTI GLL +E+G +R  +AR ++E
Sbjct: 251 EAQMMAAQTMRGTTGLVLN-GDHPAILRDKVSTPGGCTIGGLLVLEEGGVRGAVARAVRE 309

Query: 280 ATQVASTLGN 289
           AT VA+ LG 
Sbjct: 310 ATVVAAQLGK 319



>gi|470303871|ref|XP_004347993.1| pyrroline-5-carboxylate reductase [Capsaspora owczarzaki ATCC
           30864]
 gi|320169301|gb|EFW46200.1| pyrroline-5-carboxylate reductase [Capsaspora owczarzaki ATCC
           30864]
          Length = 293

 Score =  230 bits (586), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 122/282 (43%), Positives = 178/282 (63%), Gaps = 14/282 (4%)

Query: 13  LCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITL 72
           L V+GCG MG+AI+ G++D+  VAPA+           A V+ ++SA  +   F    + 
Sbjct: 26  LAVVGCGVMGKAIVKGLIDNNFVAPAH---------VTASVASDDSASALGAYFPG--ST 74

Query: 73  LVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPS 132
           +V +N+  +K AD++LLC KP  V+T+L+E  +  +L+ KL+ISI AG+T+ Q     P+
Sbjct: 75  IVRDNITAIKSADVVLLCIKPFYVRTVLSEPAIVAALQGKLLISICAGITLAQFAALIPN 134

Query: 133 STRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGL 192
            TR++RAM NTP  IR+GMT +      +K D   ++ +F  +GR   L E   D VT L
Sbjct: 135 -TRVVRAMTNTPARIRQGMTAVCGGAAATKQDVLLTVKMFQNVGRCIELPETQFDTVTAL 193

Query: 193 SGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTT 252
           +GSGPAFA + +E+LADG VMMG+PR++             ++ L +G+HPA +KDSVTT
Sbjct: 194 AGSGPAFAFMFIESLADGAVMMGMPRKIALEMAAQMVFGSAKLALDSGEHPALLKDSVTT 253

Query: 253 PGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGNIQSKK 294
           PGGCTIAGLL++ED K R ++AR I+  ++ AS LG  Q KK
Sbjct: 254 PGGCTIAGLLSLEDNKFRGSVARCIEATSRRASELG--QPKK 293



>gi|367027036|ref|XP_003662802.1| hypothetical protein MYCTH_2109970 [Myceliophthora thermophila ATCC
           42464]
 gi|347010071|gb|AEO57557.1| hypothetical protein MYCTH_2109970 [Myceliophthora thermophila ATCC
           42464]
          Length = 335

 Score =  229 bits (584), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 136/309 (44%), Positives = 178/309 (57%), Gaps = 34/309 (11%)

Query: 12  TLCVLGCGTMGRAILSGILDSLN-VAPANEPP---------------TLIPKKFIACVSG 55
           T+ VLGCGTMG AILSGIL SL+ +  AN  P               T +P +FIACV  
Sbjct: 14  TMAVLGCGTMGIAILSGILSSLDEIQDANAKPASSGTSTPLYETSATTRLPSRFIACVRR 73

Query: 56  EESAQRIKEEFNDKIT---LLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENK 112
            ESA+++K  F   ++   +   +NV  V+ AD+ILL  KP +VK +L+E GM  +LE K
Sbjct: 74  PESAKKLKNTFARHLSAVEIAQNDNVASVQRADVILLACKPYMVKEVLSEPGMAAALEGK 133

Query: 113 LIISILAGVTIDQLKEW---------APSSTRIIRAMPNTPCMIREGMTVLSC---PTDC 160
           L+ISILAGVT  Q+            AP+  R++RAMPNT  +IRE MTV+     P D 
Sbjct: 134 LLISILAGVTETQIATTLAEANGGGSAPAGCRVVRAMPNTASLIRESMTVIGISNPPLD- 192

Query: 161 SKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREV 220
             D      W+F ++G    L    +D  T L GSGPAF  ++LEA  DG V MGLPR  
Sbjct: 193 -PDTLGLVTWIFKSIGDVVYLPPSTMDVCTALCGSGPAFFALMLEAAIDGAVAMGLPRAE 251

Query: 221 XXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEA 280
                         +VL  G HPA ++D V+TPGGCTI GLL +E+G++R T+AR ++EA
Sbjct: 252 AQKMAAQTMKGAASLVLN-GDHPALLRDKVSTPGGCTIGGLLVLEEGRVRGTVARAVREA 310

Query: 281 TQVASTLGN 289
           T VAS LG 
Sbjct: 311 TVVASQLGQ 319



>gi|240275961|gb|EER39474.1| pyrroline-5-carboxylate reductase [Ajellomyces capsulatus H143]
          Length = 337

 Score =  228 bits (580), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 131/306 (42%), Positives = 186/306 (60%), Gaps = 29/306 (9%)

Query: 12  TLCVLGCGTMGRAILSGILDSLN------VAPANEPPTL---------IPKKFIACVSGE 56
           TL VLGCGT+G AILSGI  SL+        P+    T          IP KFIACV   
Sbjct: 23  TLTVLGCGTLGIAILSGIFASLSETKSHSAYPSESGTTTPSEFVSQQKIPNKFIACVRRP 82

Query: 57  ESAQRIKEE---FNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKL 113
           ES +R+ +    F   +T+L   N++ V EA++++L  KP +++ +L   GM ++L+ KL
Sbjct: 83  ESVRRVHKALDGFAVPLTVLQNENIKAVNEAEVVILGCKPYMLRDVLDVPGMTEALQGKL 142

Query: 114 IISILAGVTIDQLKE--WAPSST-------RIIRAMPNTPCMIREGMTVLSCPTDCSKDD 164
           +ISILAGVT+DQ+++  + P+ST       R++R MPNT  ++RE MTV+   T    ++
Sbjct: 143 LISILAGVTVDQIQDTLYPPTSTVPESKRCRVVRVMPNTAAIVRESMTVIGTSTPPLPEE 202

Query: 165 RSFSI-WVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXX 223
            +  I W+FS +GR   L    +D  T L+GSGPAF  +V+EA+ADG V MGLPR     
Sbjct: 203 WNMLISWIFSRVGRVVTLPPSMMDVCTSLAGSGPAFVALVMEAMADGAVAMGLPRAEAQM 262

Query: 224 XXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQV 283
                      MV + G+HPA I++ V+TPGGCTI GLL +E+G++R TLAR+++EAT V
Sbjct: 263 MAAQVMRGTAGMV-QNGEHPALIREKVSTPGGCTIGGLLVLEEGRVRGTLARSVREATVV 321

Query: 284 ASTLGN 289
           A  LG 
Sbjct: 322 AGQLGQ 327



>gi|303315191|ref|XP_003067603.1| pyrroline-5-carboxylate reductase, putative [Coccidioides posadasii
           C735 delta SOWgp]
 gi|240107273|gb|EER25458.1| pyrroline-5-carboxylate reductase, putative [Coccidioides posadasii
           C735 delta SOWgp]
 gi|320035606|gb|EFW17547.1| pyrroline-5-carboxylate reductase [Coccidioides posadasii str.
           Silveira]
          Length = 331

 Score =  228 bits (580), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 131/308 (42%), Positives = 183/308 (59%), Gaps = 29/308 (9%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVA----------------PANEPPTLIPKKFIACVSG 55
           TL VLGCG +G AILSG+L SL  A                P    P  IP +F ACV  
Sbjct: 19  TLTVLGCGNLGVAILSGVLASLAEAKKTDSRFFPGCGTATPPEEVSPHQIPSRFFACVRR 78

Query: 56  EESAQRIKE---EFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENK 112
            ESA RI++   +F   +T+L  +N+ GV+EAD+I+L  KP ++K +L   GM+++L+ K
Sbjct: 79  PESALRIQKTLKQFTQPLTILQNDNIRGVQEADVIILGCKPFMLKEVLDVPGMREALKGK 138

Query: 113 LIISILAGVTIDQLKEWAPSST--------RIIRAMPNTPCMIREGMTVLSCPT-DCSKD 163
           L+ISILAGVT +Q+++     T        R++RAMPNT  ++RE MTV+   T     +
Sbjct: 139 LLISILAGVTAEQIEDTLYGGTDTPDGDRCRVVRAMPNTAAIVRESMTVIGESTPPLPPN 198

Query: 164 DRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXX 223
             +   W+FS +GR   L    +DA T ++GSGPAFA +VLEALADGGV MGLPR     
Sbjct: 199 WETLVNWIFSRIGRVVTLPASKMDASTSIAGSGPAFAALVLEALADGGVAMGLPRAEAQV 258

Query: 224 XXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQV 283
                      MV + G HPA I++ V+TPGGCTI GL+ +E+  +R  +++ ++EAT +
Sbjct: 259 MATQVLRGTASMV-QNGDHPALIREKVSTPGGCTIGGLMVLEEAGVRGKISKAVREATAI 317

Query: 284 ASTLGNIQ 291
           AS LG  Q
Sbjct: 318 ASGLGQTQ 325



>gi|119190685|ref|XP_001245949.1| hypothetical protein CIMG_05390 [Coccidioides immitis RS]
 gi|392868786|gb|EAS34576.2| pyrroline-5-carboxylate reductase [Coccidioides immitis RS]
          Length = 331

 Score =  227 bits (579), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 131/308 (42%), Positives = 183/308 (59%), Gaps = 29/308 (9%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVA----------------PANEPPTLIPKKFIACVSG 55
           TL VLGCG +G AILSG+L SL  A                P    P  IP +F ACV  
Sbjct: 19  TLTVLGCGNLGVAILSGVLASLAEAKKTDSRFFPGCGTATPPEEVSPHQIPSRFFACVRR 78

Query: 56  EESAQRIKE---EFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENK 112
            ESA RI++   +F   +T+L  +N+ GV+EAD+I+L  KP ++K +L   GM+++L+ K
Sbjct: 79  PESALRIQKTLKQFTHPLTILQNDNIRGVQEADVIILGCKPFMLKEVLDVPGMREALKGK 138

Query: 113 LIISILAGVTIDQLKEWAPSST--------RIIRAMPNTPCMIREGMTVLSCPTD-CSKD 163
           L+ISILAGVT +Q+++     T        R++RAMPNT  ++RE MTV+   T     +
Sbjct: 139 LLISILAGVTAEQIEDTLYGGTDTPDGDRCRVVRAMPNTAAIVRESMTVIGESTPPLPPN 198

Query: 164 DRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXX 223
             +   W+FS +GR   L    +DA T ++GSGPAFA +VLEALADGGV MGLPR     
Sbjct: 199 WETLVNWIFSRIGRVVTLPASKMDASTSIAGSGPAFAALVLEALADGGVAMGLPRAEAQV 258

Query: 224 XXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQV 283
                      MV + G HPA I++ V+TPGGCTI GL+ +E+  +R  +++ ++EAT +
Sbjct: 259 MAAQVLRGTASMV-QNGDHPALIREKVSTPGGCTIGGLMVLEEAGVRGKISKAVREATAI 317

Query: 284 ASTLGNIQ 291
           AS LG  Q
Sbjct: 318 ASGLGQTQ 325



>gi|325093323|gb|EGC46633.1| pyrroline-5-carboxylate reductase [Ajellomyces capsulatus H88]
          Length = 337

 Score =  227 bits (579), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 131/306 (42%), Positives = 185/306 (60%), Gaps = 29/306 (9%)

Query: 12  TLCVLGCGTMGRAILSGILDSLN------VAPANEPPTL---------IPKKFIACVSGE 56
           TL VLGCGT+G AILSGI  SL+        P+    T          IP KFIACV   
Sbjct: 23  TLTVLGCGTLGIAILSGIFASLSETKSHSAYPSESGTTTPSEFVSQQKIPNKFIACVRRP 82

Query: 57  ESAQRIKEE---FNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKL 113
           ES +R+ +    F   +T+L   N++ V EA++++L  KP +++ +L   GM ++L+ KL
Sbjct: 83  ESVRRVHKALDGFAVPLTVLQNENIKAVNEAEVVILGCKPYMLRDVLDVPGMTEALQGKL 142

Query: 114 IISILAGVTIDQLKE--WAPSST-------RIIRAMPNTPCMIREGMTVLSCPTDCSKDD 164
           +ISILAGVT+DQ+ +  + P+ST       R++R MPNT  ++RE MTV+   T    ++
Sbjct: 143 LISILAGVTVDQIHDTLYPPTSTVPESKRCRVVRVMPNTAAIVRESMTVIGTSTPPLPEE 202

Query: 165 RSFSI-WVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXX 223
            +  I W+FS +GR   L    +D  T L+GSGPAF  +V+EA+ADG V MGLPR     
Sbjct: 203 WNMLISWIFSRVGRVVTLPPSMMDVCTSLAGSGPAFVALVMEAMADGAVAMGLPRAEAQM 262

Query: 224 XXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQV 283
                      MV + G+HPA I++ V+TPGGCTI GLL +E+G++R TLAR+++EAT V
Sbjct: 263 MAAQVMRGTAGMV-QNGEHPALIREKVSTPGGCTIGGLLVLEEGRVRGTLARSVREATVV 321

Query: 284 ASTLGN 289
           A  LG 
Sbjct: 322 AGQLGQ 327



>gi|225563366|gb|EEH11645.1| pyrroline-5-carboxylate reductase [Ajellomyces capsulatus G186AR]
          Length = 323

 Score =  227 bits (579), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 131/306 (42%), Positives = 185/306 (60%), Gaps = 29/306 (9%)

Query: 12  TLCVLGCGTMGRAILSGILDSLN------VAPANEPPTL---------IPKKFIACVSGE 56
           TL VLGCGT+G AILSGI  SL+        P+    T          IP KFIACV   
Sbjct: 9   TLAVLGCGTLGIAILSGIFASLSETKSHSAYPSESGTTTPSEFVSQQKIPNKFIACVRRP 68

Query: 57  ESAQRIKEE---FNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKL 113
           ES +R+ +    F   +T+L   N++ V EA++++L  KP +++ +L   GM  +L+ KL
Sbjct: 69  ESVRRVHKALDGFAVPLTVLQNENIKAVNEAEVVILGCKPYMLRDVLDVPGMTGALQGKL 128

Query: 114 IISILAGVTIDQLKE--WAPSST-------RIIRAMPNTPCMIREGMTVLSCPTDCSKDD 164
           +ISILAGVT+DQ+++  + P+ST       R++R MPNT  ++RE MTV+   T    ++
Sbjct: 129 LISILAGVTVDQIQDTLYPPTSTVPESKRCRVVRVMPNTAAIVRESMTVIGTSTPPLPEE 188

Query: 165 RSFSI-WVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXX 223
            +  I W+FS +GR   L    +D  T L+GSGPAF  +V+EA+ADG V MGLPR     
Sbjct: 189 WNMLISWIFSRVGRVVTLPPSMMDVCTSLAGSGPAFVALVMEAMADGAVAMGLPRAEAQM 248

Query: 224 XXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQV 283
                      MV + G+HPA I++ V+TPGGCTI GLL +E+G++R TLAR+++EAT V
Sbjct: 249 MAAQVMRGTAGMV-QNGEHPALIREKVSTPGGCTIGGLLVLEEGRVRGTLARSVREATVV 307

Query: 284 ASTLGN 289
           A  LG 
Sbjct: 308 AGQLGQ 313



>gi|258565221|ref|XP_002583355.1| pyrroline-5-carboxylate reductase [Uncinocarpus reesii 1704]
 gi|237907056|gb|EEP81457.1| pyrroline-5-carboxylate reductase [Uncinocarpus reesii 1704]
          Length = 333

 Score =  227 bits (578), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 130/311 (41%), Positives = 189/311 (60%), Gaps = 31/311 (9%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVA----------------PANEPPTLIPKKFIACVSG 55
           TL VLGCGT+G AILSG+  SL  A                P    P  IP +FIACV  
Sbjct: 19  TLTVLGCGTLGVAILSGVFASLAEAKRTDSRFFPGCGTATPPEEVSPHQIPSRFIACVRR 78

Query: 56  EESAQRIKE---EFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENK 112
            ESA RI++   +++  +T+L   N+ GV+EAD+I+L  KP ++K +L+  GM+++L+ K
Sbjct: 79  PESALRIQKTLRQYSYPLTILQNENIRGVQEADVIILGCKPFMLKDVLSVPGMREALKGK 138

Query: 113 LIISILAGVTIDQLKEWAPSST--------RIIRAMPNTPCMIREGMTVL--SCPTDCSK 162
           L++SILAGVT +Q+++     T        R++RAMPNT  M+RE MTV+  S P     
Sbjct: 139 LLVSILAGVTAEQIEDTLYKDTDIPDVDKCRVVRAMPNTAAMVRESMTVIGESNP-PLPP 197

Query: 163 DDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXX 222
              S   W+FS +GR   L    +DA T ++GSGPAFA +VLEA+ADGGV MGLPR    
Sbjct: 198 HWESLVNWIFSRIGRVVTLPAAKMDASTSVAGSGPAFAALVLEAIADGGVAMGLPRAEAQ 257

Query: 223 XXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQ 282
                       MV + G+HPA I++ V+TPGGCTI GL+ +E+  +R  +++ +++AT 
Sbjct: 258 AMAAQVLRGTASMV-QHGEHPALIREKVSTPGGCTIGGLMVLEEDGVRGKISKAVRQATV 316

Query: 283 VASTLGNIQSK 293
           +AS LG ++++
Sbjct: 317 IASQLGQVKTQ 327



>gi|485920331|gb|EOD46392.1| putative pyrroline-5-carboxylate reductase protein [Neofusicoccum
           parvum UCRNP2]
          Length = 314

 Score =  226 bits (577), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 122/295 (41%), Positives = 181/295 (61%), Gaps = 18/295 (6%)

Query: 12  TLCVLGCGTMGRAILSGILDSLN------VAPANEPPTLIPKKFIACVSGEESAQRIKE- 64
           TL VLGCG MG AIL G++ +L+       A    PP L P KF+AC + E +   I+  
Sbjct: 11  TLTVLGCGVMGNAILGGVMAALDDPSGPSTAGEQVPPRL-PTKFVACDAWEGAPDAIRSV 69

Query: 65  --EFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVT 122
             ++N  + + V +N+ G K AD++LL  KP ++  +L   GM+++L+ KLI+SILAGV+
Sbjct: 70  LGKYNKPLEIFVNDNLAGAKAADVVLLACKPYMLAEVLGAPGMREALDGKLIMSILAGVS 129

Query: 123 IDQLKEW-------APSSTRIIRAMPNTPCMIREGMTVLSCPTD-CSKDDRSFSIWVFST 174
           ++Q+++          +  R++R MPNT  ++R+ MTV+S PT   SKD  +   W+F+ 
Sbjct: 130 VEQIEQTLYPDGLPKQNPCRVVRVMPNTAALVRQSMTVISQPTPPLSKDQTALVTWIFNR 189

Query: 175 LGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXR 234
           +G+   L    +DA T L GSGPAF  ++LE LADG V MG+PR+               
Sbjct: 190 VGKVVQLPPHLMDASTALCGSGPAFVALILEGLADGAVAMGIPRKEAQLMAAQMMKGTTG 249

Query: 235 MVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           +VL+  +HP+ +KD V+TPGGCTI GLLT+E+G +R  +AR ++EAT VAS LG 
Sbjct: 250 LVLEENRHPSILKDMVSTPGGCTIGGLLTLEEGAVRGQVARAVREATVVASQLGQ 304



>gi|380494058|emb|CCF33433.1| pyrroline-5-carboxylate reductase [Colletotrichum higginsianum]
          Length = 340

 Score =  222 bits (565), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 130/310 (41%), Positives = 178/310 (57%), Gaps = 33/310 (10%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEP-----------------PTLIPKKFIACVS 54
           T+ VLGCGTMG AIL+GIL SL    A  P                 P  +P +FIACV 
Sbjct: 13  TMTVLGCGTMGIAILNGILTSLVEMQAPRPLQTPSASGTSTPLYDEVPARLPSRFIACVR 72

Query: 55  GEESAQRIKE---EFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLEN 111
             ESA+++K+   E +  + ++  +NV  V ++++I+L  KP +VK +L+E GM ++L  
Sbjct: 73  RPESAKKVKKALWEHSSVLKVVQNDNVNSVHQSEVIILACKPYMVKDVLSEPGMARALHG 132

Query: 112 KLIISILAGVTIDQLKE----WAPSST-------RIIRAMPNTPCMIREGMTVLSCPT-D 159
           KL++SI AGVT   L+E     AP+         R+IRA+PNT  +IRE MTV+  PT  
Sbjct: 133 KLLVSICAGVTETHLEEILHGAAPTKNPEEDGRCRVIRALPNTASLIRESMTVIGAPTYP 192

Query: 160 CSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPRE 219
                 S   W+F  +G    L   ++DA T L GSGPAF  +VLEA  DG V MGLPR 
Sbjct: 193 LPPQTASLVTWIFKRIGDVVYLPANNMDASTALCGSGPAFFALVLEAAIDGAVAMGLPRA 252

Query: 220 VXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQE 279
                          +V + G HPA ++D V+TPGGCTI GLL +E+G++R T+AR ++E
Sbjct: 253 EAQRMAAQTMKGAAALV-QNGDHPALLRDKVSTPGGCTIGGLLVLEEGRVRGTVARAVRE 311

Query: 280 ATQVASTLGN 289
           AT VAS LG 
Sbjct: 312 ATVVASQLGQ 321



>gi|3024443|sp|Q12740.1|P5CR_ZALAR RecName: Full=Pyrroline-5-carboxylate reductase; Short=P5C
           reductase; Short=P5CR
 gi|1377901|gb|AAC49320.1| pyrroline carboxylate reductase [Zalerion arboricola]
          Length = 320

 Score =  222 bits (565), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 130/300 (43%), Positives = 177/300 (59%), Gaps = 23/300 (7%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPA--------NEPPTLIPKKFIACVSGEESAQRIK 63
           TL V+GCGTMG AILSGIL SL+   A        +E P+ +P KFIACV   + A++IK
Sbjct: 12  TLAVIGCGTMGIAILSGILASLDEIHAPNSQSSETDETPSKLPTKFIACVRSPKGAEKIK 71

Query: 64  EE---FNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAG 120
           +    +   + ++  +NV   +EAD++LL  KP + + IL EEGM  +L+ KL+ISILAG
Sbjct: 72  KALSPYKTPVKIIQSDNVTACREADVVLLGCKPYMAEGILGEEGMVDALKGKLLISILAG 131

Query: 121 VTIDQLKEWAPSST----------RIIRAMPNTPCMIREGMTVLSCPTD-CSKDDRSFSI 169
           V  +Q+  +    T          +++RAMPNT   IRE MTV++  +   S    S   
Sbjct: 132 VPAEQIYGYMYGKTPVNPEKEGLCQVVRAMPNTASGIRESMTVIATSSPPLSATTSSLIT 191

Query: 170 WVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXX 229
           W+F  +G    L    +DA T L GSGPAF  ++LEA  DG V MGLPR           
Sbjct: 192 WIFKRIGDVVQLPAATMDASTALCGSGPAFFALILEAAIDGAVAMGLPRAEAQRMAAQTM 251

Query: 230 XXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
                +VL +G+HPA +KD VTTPGGCTI GL+ +E+G +R T+AR ++EAT VAS LG 
Sbjct: 252 KGAAGLVL-SGEHPALLKDKVTTPGGCTIGGLMVLEEGGVRGTVARAVREATVVASQLGK 310



>gi|378731725|gb|EHY58184.1| pyrroline-5-carboxylate reductase [Exophiala dermatitidis
           NIH/UT8656]
          Length = 334

 Score =  221 bits (564), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 127/301 (42%), Positives = 181/301 (60%), Gaps = 25/301 (8%)

Query: 12  TLCVLGCGTMGRAILSGILDSLN--------VAPANEPPTLIPKKFIACVSGEESAQRIK 63
           T+  LGCGT+  AIL+GIL SL          +  +      P +FIACV   ESAQRI+
Sbjct: 21  TVTFLGCGTLNTAILTGILSSLQEDATSSSSSSAESSTNVRTPSRFIACVRRPESAQRIQ 80

Query: 64  ---EEFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAG 120
              +E++  +T+L   NV+GVK AD+++L  KP +V+++L E+G+Q++L  KL++SI AG
Sbjct: 81  RAVQEYSTPVTVLQNENVKGVKAADVVILGCKPYMVESVLAEKGIQEALAGKLLVSICAG 140

Query: 121 VTIDQLK------------EWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFS 168
           V +DQ+                 +  RI+R MPNT  M RE MTV++  T     + S  
Sbjct: 141 VPVDQIGRALYGADYPDHIHIHSNPCRIVRVMPNTAAMNRESMTVIATSTSPLPSELSAI 200

Query: 169 I-WVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXX 227
           + W+F+ +GR   L    +DA T L GSGPAF  ++LE+L DG V MG+PR+        
Sbjct: 201 VEWIFTRIGRVVHLPPSAMDASTALCGSGPAFCALMLESLVDGAVAMGIPRQEAQLMAAQ 260

Query: 228 XXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
                  MVL  G+HPA I++ V+TPGGCTI GLL +E+G +R T++R+I+EAT VAS L
Sbjct: 261 TMRGTSAMVL-AGEHPAFIREKVSTPGGCTIGGLLVLEEGAVRGTISRSIREATVVASEL 319

Query: 288 G 288
           G
Sbjct: 320 G 320



>gi|226286813|gb|EEH42326.1| pyrroline-5-carboxylate reductase [Paracoccidioides brasiliensis
           Pb18]
          Length = 366

 Score =  221 bits (564), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 125/302 (41%), Positives = 187/302 (61%), Gaps = 29/302 (9%)

Query: 16  LGCGTMGRAILSGILDSLNVAPANE---------------PPTLIPKKFIACVSGEESAQ 60
           +  GT+G AILSGI  SL  A ++                P   IP KFIACV   ES +
Sbjct: 56  IASGTLGIAILSGIFASLAEAGSHSAYPSESGTTTPSEMVPQQKIPSKFIACVRRPESVK 115

Query: 61  RIKEE---FNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISI 117
           R+ +    F+  +T++   NV+ V++A++++L  KP +++ +L E GM K+L+ KL+ISI
Sbjct: 116 RVHKALDGFSMPLTVVQNENVKAVEQAEVVILGCKPYMLRDVLDEPGMCKALQGKLLISI 175

Query: 118 LAGVTIDQLKE--WAPSST-------RIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFS 168
           LAGVT++Q+ +  + P+S+       R++RAMPNT  ++RE MTV++       ++ +  
Sbjct: 176 LAGVTVEQIVDTLYPPTSSVPESNRCRVVRAMPNTAALVRESMTVIATSNPPLPEEWNVL 235

Query: 169 I-WVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXX 227
           I W+FS +GR   L    +D  T L+GSGPAFA +++EA+ADG V MGLPR         
Sbjct: 236 ISWIFSRVGRVVTLPPSMMDVCTSLAGSGPAFAALIMEAMADGAVSMGLPRAEAQMMAAQ 295

Query: 228 XXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
                  MV ++G+HPA I++ V+TPGGCTI GLL +E+G++R TLAR+++EAT VAS L
Sbjct: 296 VMRGTAGMV-QSGEHPALIREKVSTPGGCTIGGLLVLEEGRVRGTLARSVREATVVASQL 354

Query: 288 GN 289
           G 
Sbjct: 355 GQ 356



>gi|225684647|gb|EEH22931.1| pyrroline-5-carboxylate reductase [Paracoccidioides brasiliensis
           Pb03]
          Length = 366

 Score =  221 bits (564), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 125/302 (41%), Positives = 187/302 (61%), Gaps = 29/302 (9%)

Query: 16  LGCGTMGRAILSGILDSLNVAPANE---------------PPTLIPKKFIACVSGEESAQ 60
           +  GT+G AILSGI  SL  A ++                P   IP KFIACV   ES +
Sbjct: 56  IASGTLGIAILSGIFASLAEAGSHSAYPSESGTTTPSEMVPQQKIPSKFIACVRRPESVK 115

Query: 61  RIKEE---FNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISI 117
           R+ +    F+  +T++   NV+ V++A++++L  KP +++ +L E GM K+L+ KL+ISI
Sbjct: 116 RVHKALDGFSMPLTVVQNENVKAVEQAEVVILGCKPYMLRDVLDEPGMCKALQGKLLISI 175

Query: 118 LAGVTIDQLKE--WAPSST-------RIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFS 168
           LAGVT++Q+ +  + P+S+       R++RAMPNT  ++RE MTV++       ++ +  
Sbjct: 176 LAGVTVEQIVDTLYPPTSSVPESNRCRVVRAMPNTAALVRESMTVIATSNPPLPEEWNVL 235

Query: 169 I-WVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXX 227
           I W+FS +GR   L    +D  T L+GSGPAFA +++EA+ADG V MGLPR         
Sbjct: 236 ISWIFSRVGRVVTLPPSMMDVCTSLAGSGPAFAALIMEAMADGAVSMGLPRAEAQMMAAQ 295

Query: 228 XXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
                  MV ++G+HPA I++ V+TPGGCTI GLL +E+G++R TLAR+++EAT VAS L
Sbjct: 296 VMRGTAGMV-QSGEHPALIREKVSTPGGCTIGGLLVLEEGRVRGTLARSVREATVVASQL 354

Query: 288 GN 289
           G 
Sbjct: 355 GQ 356



>gi|340905270|gb|EGS17638.1| pyrroline-5-carboxylate reductase-like protein [Chaetomium
           thermophilum var. thermophilum DSM 1495]
          Length = 333

 Score =  220 bits (561), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 131/307 (42%), Positives = 175/307 (57%), Gaps = 32/307 (10%)

Query: 12  TLCVLGCGTMGRAILSGILDSLN------------VAPANE--PPTLIPKKFIACVSGEE 57
           T+ V+GCGTMG AILSGIL SL+              P  E  P T +P++FIACV   E
Sbjct: 14  TMAVIGCGTMGIAILSGILTSLDEMQDSSKESSGTSTPLYETAPTTRLPRRFIACVRRPE 73

Query: 58  SAQRIKEEFN---DKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLI 114
           + +++K  F      ++++   NV   +EADI+LL  KP + K IL+E GM  +L+ KL+
Sbjct: 74  TTKKLKATFQAHASAVSIVQNANVAAAQEADIVLLACKPYMAKEILSEPGMAFALQGKLL 133

Query: 115 ISILAGVTIDQLKEWAPSST---------RIIRAMPNTPCMIREGMTVLSC---PTDCSK 162
           ISILAGVT  Q++    ++          RI+RAMPNT  +IRE MTV+     P D   
Sbjct: 134 ISILAGVTESQIEAHLVAANGGAPLDPPCRIVRAMPNTAALIRESMTVIGITNPPLD--P 191

Query: 163 DDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXX 222
           D      W+F  +G    L    +D  T L GSGPAF  +V+EA  DG V MGLPR    
Sbjct: 192 DTMGLVTWIFKRIGDVVYLPPSTMDVCTALCGSGPAFFALVMEAAIDGAVAMGLPRAEAQ 251

Query: 223 XXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQ 282
                       +VL  G HPA ++D V+TPGGCTI GLL +E+G++R T+AR ++EAT 
Sbjct: 252 RMAAQTMKGAAALVLN-GDHPALLRDKVSTPGGCTIGGLLVLEEGRVRGTVARAVREATV 310

Query: 283 VASTLGN 289
           VAS LG 
Sbjct: 311 VASQLGQ 317



>gi|367050804|ref|XP_003655781.1| hypothetical protein THITE_2119862 [Thielavia terrestris NRRL 8126]
 gi|347003045|gb|AEO69445.1| hypothetical protein THITE_2119862 [Thielavia terrestris NRRL 8126]
          Length = 318

 Score =  220 bits (561), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 133/305 (43%), Positives = 174/305 (57%), Gaps = 31/305 (10%)

Query: 13  LCVLGCGTMGRAILSGILDSLN-------------VAPANE--PPTLIPKKFIACVSGEE 57
           + V+GCGTMG AILSGIL SL+               P  E  P T +P +FIACV   E
Sbjct: 1   MAVVGCGTMGIAILSGILASLDEMQDASKAASSGTSTPLYETAPTTRLPSRFIACVRRPE 60

Query: 58  SAQRIKEEFNDK---ITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLI 114
           SA+++K  F      +T+   +NV  V +AD++LL  KP +V+ +L+E GM  +L  KL+
Sbjct: 61  SAKKLKTTFAAHLGAVTIAQNDNVASVAKADVVLLACKPYMVQEVLSEPGMAAALRGKLL 120

Query: 115 ISILAGVTIDQLKE-------WAPSSTRIIRAMPNTPCMIREGMTVLSC---PTDCSKDD 164
           ISILAGVT  Q++          P   R++RAMPNT  +IRE MTV+     P D   D 
Sbjct: 121 ISILAGVTESQIEATLAAANGGNPLPCRVVRAMPNTASLIRESMTVIGISNPPLD--PDT 178

Query: 165 RSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXX 224
                WVF  +G    L    +DA T L GSGPAF  ++LEA  DG V MGLPR      
Sbjct: 179 LGLVTWVFKRIGDVVYLPPATMDACTALCGSGPAFFALMLEAAIDGAVAMGLPRAEAQRM 238

Query: 225 XXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVA 284
                     +VL  G HPA ++D V+TPGGCTI GLL +E+G++R T+AR ++EAT VA
Sbjct: 239 AAQTMKGAAGLVLN-GDHPALLRDKVSTPGGCTIGGLLVLEEGRVRGTVARAVREATVVA 297

Query: 285 STLGN 289
           S LG 
Sbjct: 298 SQLGK 302



>gi|116192021|ref|XP_001221823.1| hypothetical protein CHGG_05728 [Chaetomium globosum CBS 148.51]
 gi|88181641|gb|EAQ89109.1| hypothetical protein CHGG_05728 [Chaetomium globosum CBS 148.51]
          Length = 332

 Score =  220 bits (560), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 129/307 (42%), Positives = 178/307 (57%), Gaps = 32/307 (10%)

Query: 12  TLCVLGCGTMGRAILSGILDSLN-VAPANEPPTL---------------IPKKFIACVSG 55
           T+ VLGCGTMG AILSGIL S++ +  AN  P++               +P +FIACV  
Sbjct: 13  TVAVLGCGTMGIAILSGILASISEMQDANIKPSVSGTSTPLYETTTTTRLPSRFIACVRR 72

Query: 56  EESAQRIKEEFN---DKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENK 112
            ES +++K  F      +T+   NNV  V++AD+++L  KP +V+ +L+E G+  +L+ K
Sbjct: 73  PESVKKLKATFAAHLSAVTIAQNNNVASVRKADVVILACKPYMVQEVLSEAGLAAALDGK 132

Query: 113 LIISILAGVTIDQLK-------EWAPSSTRIIRAMPNTPCMIREGMTVLSC---PTDCSK 162
           L+ISILAGVT  Q++       +  P   R++RAMPNT  +IRE MTV+     P D   
Sbjct: 133 LLISILAGVTESQIESTLAAANDQKPVPCRVVRAMPNTASLIRESMTVIGISNPPLD--P 190

Query: 163 DDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXX 222
           D      W+F  +G    L    +D  T L GSGPAF  ++LEA  DG V MGLPR    
Sbjct: 191 DTLGLVTWIFKRIGEVVYLPPSTMDVCTSLCGSGPAFFALMLEAAIDGAVAMGLPRAEAQ 250

Query: 223 XXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQ 282
                       +VL  G HPA ++D V+TPGGCTI GLL +E+G++R T+AR ++EAT 
Sbjct: 251 RMAAQTMKGAAGLVLN-GDHPALLRDKVSTPGGCTIGGLLVLEEGRVRGTVARAVREATV 309

Query: 283 VASTLGN 289
           VAS LG 
Sbjct: 310 VASQLGQ 316



>gi|327303914|ref|XP_003236649.1| pyrroline-5-carboxylate reductase [Trichophyton rubrum CBS 118892]
 gi|326461991|gb|EGD87444.1| pyrroline-5-carboxylate reductase [Trichophyton rubrum CBS 118892]
          Length = 330

 Score =  219 bits (558), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 128/305 (41%), Positives = 181/305 (59%), Gaps = 28/305 (9%)

Query: 12  TLCVLGCGTMGRAILSGILDSLN---VAPANEPPT------------LIPKKFIACVSGE 56
           T+  LGCGT+G +ILSG++ SL+    + A  PP+             IP KFIACV   
Sbjct: 17  TVTFLGCGTLGTSILSGVMASLSEPRSSSAYPPPSGSATPSEGLPVHQIPSKFIACVRRP 76

Query: 57  ESAQRIKE---EFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKL 113
           ES +RI+     +N  +T+L   NV+GV + D+I+L  KP ++  +L   GM+++L+ KL
Sbjct: 77  ESVKRIQHILSPYNLPLTILQNENVKGVTDGDVIVLGCKPYMLSEVLNVPGMREALKGKL 136

Query: 114 IISILAGVTIDQLKEWAPSST--------RIIRAMPNTPCMIREGMTVL-SCPTDCSKDD 164
           +ISILAGV  +Q++E     +        R++RAMPNT  ++RE MTV+ S     S   
Sbjct: 137 LISILAGVPAEQIEEVLYKDSDIDIADRCRVVRAMPNTAAIVRESMTVIASTNPPLSHFQ 196

Query: 165 RSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXX 224
            +   W+F+ +GR   L    +DA T L+GSG AF  +VLEALADG V MGLPR      
Sbjct: 197 STIVSWIFTRVGRVITLSPHIMDASTALAGSGTAFVALVLEALADGAVAMGLPRAESQLM 256

Query: 225 XXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVA 284
                     MVL  G+HPA I++  +TPGGCTI GLL +E+G++R  +AR+++EAT VA
Sbjct: 257 AAQVMRGTAGMVLN-GEHPALIREKTSTPGGCTIGGLLVLEEGRVRGAIARSVREATVVA 315

Query: 285 STLGN 289
           S LG 
Sbjct: 316 SQLGK 320



>gi|154281979|ref|XP_001541802.1| pyrroline-5-carboxylate reductase [Ajellomyces capsulatus NAm1]
 gi|150411981|gb|EDN07369.1| pyrroline-5-carboxylate reductase [Ajellomyces capsulatus NAm1]
          Length = 332

 Score =  217 bits (553), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 129/306 (42%), Positives = 183/306 (59%), Gaps = 34/306 (11%)

Query: 12  TLCVLGCGTMGRAILSGILDSLN------VAPA----NEPPTL-----IPKKFIACVSGE 56
           TL VLGC     AILSGI  SL+        P+    N P        IP KFIACV   
Sbjct: 23  TLTVLGC-----AILSGIFASLSETKSHSAYPSESGTNTPSEFVSQQKIPNKFIACVRRP 77

Query: 57  ESAQRIKEE---FNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKL 113
           ES +R+ +    F   +T+L   N++ V EA++++L  KP +++ +L   GM ++L+ KL
Sbjct: 78  ESVRRVHKALDGFAVPLTVLQNENIKAVNEAEVVILGCKPYMLRDVLDVPGMTEALQGKL 137

Query: 114 IISILAGVTIDQLKE--WAPSST-------RIIRAMPNTPCMIREGMTVLSCPTDCSKDD 164
           +ISILAGVT+DQ+++  + P+ST       R++R MPNT  ++RE MTV+   T    ++
Sbjct: 138 LISILAGVTVDQIQDTLYPPTSTVPESKRCRVVRVMPNTAAIVRESMTVIGTSTPPLPEE 197

Query: 165 RSFSI-WVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXX 223
            +  I W+FS +GR   L    +D  T L+GSGPAF  +V+EA+ADG V MGLPR     
Sbjct: 198 WNMLISWIFSRVGRVVTLPPSMMDVCTSLAGSGPAFVALVMEAMADGAVAMGLPRAEAQM 257

Query: 224 XXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQV 283
                      MV + G+HPA I++ V+TPGGCTI GLL +E+G++R TLAR+++EAT V
Sbjct: 258 MAAQVMRGTAGMV-QNGEHPALIREKVSTPGGCTIGGLLVLEEGRVRGTLARSVREATVV 316

Query: 284 ASTLGN 289
           A  LG 
Sbjct: 317 AGQLGQ 322



>gi|326475935|gb|EGD99944.1| pyrroline-5-carboxylate reductase [Trichophyton tonsurans CBS
           112818]
          Length = 330

 Score =  217 bits (552), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 126/305 (41%), Positives = 181/305 (59%), Gaps = 28/305 (9%)

Query: 12  TLCVLGCGTMGRAILSGILDSLN---VAPANEPPT------------LIPKKFIACVSGE 56
           T+  LGCGT+G +ILSG++ SL+    + A  PP+             IP KFIACV   
Sbjct: 17  TVTFLGCGTLGTSILSGVMASLSEPRSSSAYPPPSGSATPSEGLPVHQIPSKFIACVRRP 76

Query: 57  ESAQRIKE---EFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKL 113
           ES +RI+     +N  +T+L   NV+GV + D+I+L  KP ++  +L   GM+++L+ KL
Sbjct: 77  ESVKRIQHILSPYNLPLTILQNENVKGVTDGDVIVLGCKPYMLSEVLNVPGMREALKGKL 136

Query: 114 IISILAGVTIDQLKEWAPSST--------RIIRAMPNTPCMIREGMTVL-SCPTDCSKDD 164
           ++SILAGV  +Q++E     +        R++RAMPNT  ++RE MTV+ S     +   
Sbjct: 137 LVSILAGVPAEQIEEVLYKDSDIDMADRCRVVRAMPNTAAIVRESMTVIASTNPPLTHFQ 196

Query: 165 RSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXX 224
            +   W+F+ +GR   L    +DA T L+GSG AF  +VLEALADG V MGLPR      
Sbjct: 197 STIVSWIFTRVGRVITLPPHIMDASTALAGSGTAFVALVLEALADGAVAMGLPRAESQLM 256

Query: 225 XXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVA 284
                     MVL  G+HPA I++  +TPGGCTI GLL +E+G++R  +AR+++EAT VA
Sbjct: 257 AAQVMRGTAGMVLN-GEHPALIREKTSTPGGCTIGGLLVLEEGRVRGAIARSVREATVVA 315

Query: 285 STLGN 289
           S LG 
Sbjct: 316 SQLGK 320



>gi|296812163|ref|XP_002846419.1| pyrroline-5-carboxylate reductase [Arthroderma otae CBS 113480]
 gi|238841675|gb|EEQ31337.1| pyrroline-5-carboxylate reductase [Arthroderma otae CBS 113480]
          Length = 330

 Score =  216 bits (550), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 126/304 (41%), Positives = 181/304 (59%), Gaps = 28/304 (9%)

Query: 12  TLCVLGCGTMGRAILSGILDSLN--VAPANEPP-------------TLIPKKFIACVSGE 56
           T+  LGCGT+G +ILSGI+ SL+   + +  PP               IP +FIACV   
Sbjct: 17  TVTFLGCGTLGTSILSGIMASLSEPRSSSAYPPLSGSATPSEGLPLHQIPSRFIACVRRA 76

Query: 57  ESAQRIKE---EFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKL 113
           ES +RI+     ++  +T+L   NV+GV ++D+++L  KP ++  +L   GM+ +L+ KL
Sbjct: 77  ESVKRIQHILSPYHLPLTILQNENVKGVTDSDVVILGCKPYMLNDVLNVPGMRDALKGKL 136

Query: 114 IISILAGVTIDQLKEWAPSST--------RIIRAMPNTPCMIREGMTVL-SCPTDCSKDD 164
           +ISILAGV  +Q++E     +        R++RAMPNT  ++RE MTV+ S     S   
Sbjct: 137 LISILAGVPAEQIEEVLYKDSDVDMADRCRVVRAMPNTAAIVRESMTVIASTNPPLSHIQ 196

Query: 165 RSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXX 224
            +   W+F+ +GR   L    +DA T L+GSG AF  +VLEALADG V MGLPR      
Sbjct: 197 NTMVAWIFTRVGRVITLPPHIMDASTALAGSGTAFVALVLEALADGAVAMGLPRAESQLM 256

Query: 225 XXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVA 284
                     MVL  G+HPA I++  +TPGGCTI GLL +E+G++R T+AR+++EAT VA
Sbjct: 257 AAQVMRGTAGMVLN-GEHPALIREKTSTPGGCTIGGLLVLEEGRVRGTIARSVREATVVA 315

Query: 285 STLG 288
           S LG
Sbjct: 316 SQLG 319



>gi|392595731|gb|EIW85054.1| hypothetical protein CONPUDRAFT_69980 [Coniophora puteana
           RWD-64-598 SS2]
          Length = 278

 Score =  216 bits (550), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 121/276 (43%), Positives = 162/276 (58%), Gaps = 44/276 (15%)

Query: 21  MGRAILSGILDSLNV-------------APANEPPTL------IPKKFIACVSGEESAQR 61
           MG AILSG++ SL                P    P +      +P +FIA V+  ESA++
Sbjct: 1   MGVAILSGVIASLQSRAFEQSFPKWESHTPGTTTPAIDTGDPSLPSRFIATVTRSESARK 60

Query: 62  IKEEFN------DKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLII 115
           ++   +        + ++VG+N+  V EAD++LLC KPQ   +IL+++GM  +L +KL+I
Sbjct: 61  LQATLDALGGLGSSVDIVVGDNLRAVSEADVVLLCCKPQQAYSILSQDGMSDALTSKLLI 120

Query: 116 SILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSC--PTDCSKDDRSFSIWVFS 173
           SILAGVTI QL      +T+++RAMPNTPC IREGMTV+S    +D  + DR   + +FS
Sbjct: 121 SILAGVTISQLTSLVLPTTKVVRAMPNTPCRIREGMTVVSSLPQSDDIELDRDIILKIFS 180

Query: 174 TLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPR--------------- 218
           ++GR R LDEKH DA T LSGSGPAFAC+ LEA+ADGGVMMGLPR               
Sbjct: 181 SIGRCRFLDEKHFDACTALSGSGPAFACIFLEAMADGGVMMGLPRAEALELAAQSKGYML 240

Query: 219 --EVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTT 252
             E              RM L+ G HPA+IKDSVT+
Sbjct: 241 ILERHGTDGMEALQGAARMALQAGAHPAQIKDSVTS 276



>gi|477526433|gb|ENH78300.1| pyrroline-5-carboxylate reductase [Colletotrichum orbiculare MAFF
           240422]
          Length = 339

 Score =  216 bits (549), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 126/305 (41%), Positives = 179/305 (58%), Gaps = 28/305 (9%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEP------------PTLIPKKFIACVSGEESA 59
           T+ VLGCGTMG AIL+GIL SL    A +P            P+ +P +FIACV   ESA
Sbjct: 16  TMTVLGCGTMGIAILNGILSSLQEMQAPKPLQSAGDHVEDEIPSRLPSRFIACVRRPESA 75

Query: 60  QRIKE---EFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIIS 116
           +++K+   E +  + ++  +N+  V  +++ILL  KP +VK IL+E GM ++L  KL++S
Sbjct: 76  KKVKKALWEHSSVLKVVQNDNINSVLASEVILLACKPYMVKDILSEPGMARALHGKLLVS 135

Query: 117 ILAGVTIDQLKEW----APSST-------RIIRAMPNTPCMIREGMTVLSCPT-DCSKDD 164
           I AGVT + L+E     AP+ +       R++RA+PN   +IRE MTV+   T    ++ 
Sbjct: 136 ICAGVTEEHLEEILHGVAPTKSPEEDGRCRVLRAVPNAASLIRESMTVIGTSTWPLPREV 195

Query: 165 RSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXX 224
            S   W+F  +G    L    +DA T L GSGPAF  ++LEA  DG V MGLPR      
Sbjct: 196 SSLVTWIFKRIGDVVYLPPNTMDASTALCGSGPAFFALMLEAAIDGAVAMGLPRAEAQRM 255

Query: 225 XXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVA 284
                     +VL  G HPA ++D VTTPGGCTI GLL +E+G++R T+AR ++E+  +A
Sbjct: 256 AAQTMRGAAGLVLN-GDHPALLRDKVTTPGGCTIGGLLVLEEGRVRGTVARAVRESATIA 314

Query: 285 STLGN 289
           S LG 
Sbjct: 315 SQLGQ 319



>gi|407917759|gb|EKG11062.1| Pyrroline-5-carboxylate reductase [Macrophomina phaseolina MS6]
          Length = 294

 Score =  216 bits (549), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 117/285 (41%), Positives = 178/285 (62%), Gaps = 17/285 (5%)

Query: 21  MGRAILSGILDSLN----VAPANE--PPTLIPKKFIACVSGEESAQRIKE---EFNDKIT 71
           MG AIL G++ +LN     + A+E  PP L P KF+AC + E +   I+    ++N  + 
Sbjct: 1   MGNAILGGVMAALNDPSGPSDADEAVPPRL-PTKFVACDAWEGAPDAIRSVLGKYNKPLE 59

Query: 72  LLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKE--- 128
           + V +N+ G K AD++LL  KP +++ +L   GM+++LE KLI+SILAG++++Q+++   
Sbjct: 60  IYVNDNLAGAKAADVVLLACKPYMLQEVLGAPGMREALEGKLIMSILAGISVEQIEQTLY 119

Query: 129 ---WAPSSTRIIRAMPNTPCMIREGMTVLSCPTD-CSKDDRSFSIWVFSTLGRARILDEK 184
                 +  R++R MPNT  ++R+ MTV+S PT   SKD  +   W+F+ +G+   +   
Sbjct: 120 PDGLPQNPCRVVRVMPNTAALVRQSMTVISQPTPPLSKDQTNLVTWIFNRVGKVVQMPPH 179

Query: 185 HLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPA 244
            +DA T L GSGPAF  +VLE LADG V MG+PR+               +VL+  +HP+
Sbjct: 180 LMDASTSLCGSGPAFVALVLEGLADGAVAMGIPRKEAQLMAAQMMKGTTGLVLEENRHPS 239

Query: 245 EIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
            +KD V+TPGGCTI GLLT+E+G +R  +AR ++EAT VAS LG 
Sbjct: 240 ILKDMVSTPGGCTIGGLLTLEEGAVRGHVARAVREATVVASQLGQ 284



>gi|402079075|gb|EJT74340.1| pyrroline-5-carboxylate reductase [Gaeumannomyces graminis var.
           tritici R3-111a-1]
          Length = 333

 Score =  215 bits (548), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 130/312 (41%), Positives = 180/312 (57%), Gaps = 36/312 (11%)

Query: 12  TLCVLGCGTMGRAILSGILDSLN-------VAPA-----------NEPPTLIPKKFIACV 53
           T+ VLGCGTMG AILSGIL SL        + PA            E P  +P +FIACV
Sbjct: 10  TMAVLGCGTMGIAILSGILASLQDMAGPKPLQPAPSSSGTSTPVHEEVPERLPSRFIACV 69

Query: 54  SGEESAQRIKEEF---NDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLE 110
              ESA+++K      +  + ++  +N+  V++A+++LL  KPQ+VK +L++ G+ K+L 
Sbjct: 70  RRPESAKKVKSALWAHSSVLKVVQNDNLGAVQQAEVVLLACKPQMVKDVLSQPGIAKALH 129

Query: 111 NKLIISILAGVTIDQ----LKEWAPSST-------RIIRAMPNTPCMIREGMTVLSCPTD 159
            KL+ISI AG+++ Q    L    P+         RI+RAMPNT  MIRE MTV++  TD
Sbjct: 130 GKLLISICAGISVAQIELHLHGAVPNHDPDVDGRCRIVRAMPNTASMIRESMTVIAS-TD 188

Query: 160 --CSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLP 217
                   S   W+F  +G    L    +DA T L GSGPAF  ++LEA  DG V MGLP
Sbjct: 189 PPLPAHTSSLVTWIFKRIGDVVYLPPSTMDASTALCGSGPAFFALMLEAAVDGAVAMGLP 248

Query: 218 REVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTI 277
           R V               +++ G HPA ++D V+TPGGCTI GLL +E+G++R T+AR +
Sbjct: 249 R-VEALRMAAQTMKGAAALVQHGDHPALLRDKVSTPGGCTIGGLLVLEEGRVRGTVARAV 307

Query: 278 QEATQVASTLGN 289
           +EAT VAS LG 
Sbjct: 308 REATVVASQLGR 319



>gi|310793148|gb|EFQ28609.1| pyrroline-5-carboxylate reductase [Glomerella graminicola M1.001]
          Length = 343

 Score =  214 bits (545), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 126/313 (40%), Positives = 178/313 (56%), Gaps = 36/313 (11%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEP--------------------PTLIPKKFIA 51
           T+ VLGCGTMG AIL+GIL SL    A  P                    P  +P +FIA
Sbjct: 13  TVTVLGCGTMGIAILNGILTSLVEMQAPRPLQMLHTPSASGTSTPRHDEVPARLPSRFIA 72

Query: 52  CVSGEESAQRIKE---EFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKS 108
           CV   ESA+++K+   E +  + ++  +NV  V ++++++L  KP +VK +L+E GM ++
Sbjct: 73  CVRRSESAKKVKKALWEHSSILKVVQNDNVNSVYQSEVVILACKPYMVKELLSEPGMARA 132

Query: 109 LENKLIISILAGVTIDQLKE----WAPSST-------RIIRAMPNTPCMIREGMTVLSCP 157
           L  KL+ISI AG+T   L+E      P+         R+IRA+PNT  +IREGMTV+  P
Sbjct: 133 LHGKLLISICAGLTETHLEEILHGAVPTKNPEEDGRCRVIRALPNTASLIREGMTVIGAP 192

Query: 158 T-DCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGL 216
           T        S   W+F  +G    L   ++DA T L GSGPAF  ++LEA  DG V MG+
Sbjct: 193 TYPLPPQTASLVTWIFRRIGDVVYLPANNMDASTALCGSGPAFFALMLEAAIDGAVAMGI 252

Query: 217 PREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLART 276
           PR V               +++ G HPA ++D  TTPGGCTI GLL +E+G++R T+AR 
Sbjct: 253 PR-VEAQRMAAQSMKGAACLVQNGDHPALLRDKCTTPGGCTIGGLLVLEEGRVRGTIARA 311

Query: 277 IQEATQVASTLGN 289
           ++E+T VAS LG 
Sbjct: 312 VRESTVVASQLGQ 324



>gi|400599289|gb|EJP66993.1| pyrroline-5-carboxylate reductase [Beauveria bassiana ARSEF 2860]
          Length = 314

 Score =  213 bits (543), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 123/301 (40%), Positives = 176/301 (58%), Gaps = 18/301 (5%)

Query: 5   MSLPTNPTLCVLGCGTMGRAILSGILDSL--NVAPANEPPTLIPKKFIACVSGEESAQRI 62
           MS  +  TL VLGCGTMG AI +G+L SL   V P ++ P  +P KFIACV  E+SA+R+
Sbjct: 1   MSSDSGFTLTVLGCGTMGIAIANGVLTSLAAGVTPGDDVPATLPSKFIACVRSEKSAERV 60

Query: 63  K---EEFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILA 119
           K      + ++ ++  +NV  V++A ++LL  KP +VK +L   GM  +L+ KL++S+ A
Sbjct: 61  KTALSAHSSRVEVVRNDNVASVQQAQVVLLACKPYMVKDVLGVSGMADALKGKLLVSVCA 120

Query: 120 GVTIDQLKEWAPSST-----------RIIRAMPNTPCMIREGMTVLSCPTDCSKD-DRSF 167
           G+T + ++E                 R IRAM NT  +IRE MTV+        D D + 
Sbjct: 121 GITAEAMEEAIYGKVLTGDPAEDGRCRCIRAMCNTAALIRESMTVIGISNPPLPDKDNAL 180

Query: 168 SIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXX 227
             W+F  +G    L   ++DA T L+GSGPA   ++LEA  DG V MG+PR         
Sbjct: 181 ITWIFKQIGDVVFLPANNMDASTALAGSGPAMFLLMLEAATDGAVAMGIPRAEARRMAAQ 240

Query: 228 XXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
                  +V ++G+HPA ++++V TPGGCTI GLL +EDG  R T++R I+EAT VAS L
Sbjct: 241 TMRGATGLV-QSGEHPAVLRENVCTPGGCTIGGLLVLEDGGARGTISRAIREATVVASQL 299

Query: 288 G 288
           G
Sbjct: 300 G 300



>gi|346327268|gb|EGX96864.1| pyrroline-5-carboxylate reductase [Cordyceps militaris CM01]
          Length = 315

 Score =  213 bits (543), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 125/302 (41%), Positives = 178/302 (58%), Gaps = 19/302 (6%)

Query: 5   MSLPTNPTLCVLGCGTMGRAILSGILDSL--NVAPANEPPTLIPKKFIACVSGEESAQRI 62
           M+  +  TL VLGCGTMG AI +G+L SL   VAPA + P  +P KFIACV   +SA R+
Sbjct: 1   MASDSGFTLTVLGCGTMGIAIANGVLTSLAAGVAPAADVPASLPSKFIACVRSSQSAARV 60

Query: 63  KEEFND---KITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILA 119
               +    ++ ++  +NV  VK+A ++LL  KP +V+ +L   GM  +L  KL++S+ A
Sbjct: 61  TTALSAHAARVEVVRNDNVAAVKKARVVLLACKPYMVRDVLGAPGMAAALAGKLLVSVCA 120

Query: 120 GVTIDQLK----------EWAPSSTRI--IRAMPNTPCMIREGMTVLSCPTD-CSKDDRS 166
           G+T + ++          E A  +TR   IRAM NT  +IRE MTV+   T   + +D +
Sbjct: 121 GITAEAMEAAIYDHAGQEEVAKDATRCRCIRAMCNTAALIRESMTVIGISTPPLADEDNA 180

Query: 167 FSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXX 226
              W+F  +G    L   ++DA T L+GSGPA   ++LEA  DG V MG+PR        
Sbjct: 181 LITWIFKQIGDVVFLPASNMDASTALAGSGPAMFLLMLEAATDGAVAMGIPRAEARRMAA 240

Query: 227 XXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVAST 286
                   +V ++G+HPA ++++V TPGGCTI GLL +EDG  R T+AR I+EAT VAS 
Sbjct: 241 QTMRGATGLV-QSGEHPAVLRENVCTPGGCTIGGLLVLEDGGARGTIARAIREATVVASQ 299

Query: 287 LG 288
           LG
Sbjct: 300 LG 301



>gi|50546825|ref|XP_500882.1| YALI0B14399p [Yarrowia lipolytica]
 gi|49646748|emb|CAG83133.1| YALI0B14399p [Yarrowia lipolytica CLIB122]
          Length = 299

 Score =  213 bits (542), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 118/303 (38%), Positives = 181/303 (59%), Gaps = 13/303 (4%)

Query: 1   FGIIMSLPTNPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQ 60
            G+ + L    T+C LGCGTMG A+L  +LDSL+     E     P KF+ACV+ +ESA 
Sbjct: 1   MGVDIQLKDGYTICFLGCGTMGTAVLGAVLDSLSKG-NKEGDAPKPGKFMACVTRQESAD 59

Query: 61  RIKEEFNDK-----ITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLII 115
           R+ ++         + +L+ +N    K AD+ +L +KP + + ILT   +Q+ LE K+++
Sbjct: 60  RLHKDLTSSAPDIPVEILINDNGSAYK-ADVFVLGSKPYMAEKILTP--LQQMLEGKVLV 116

Query: 116 SILAGVTIDQLKEWAPSSTR--IIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSI--WV 171
           S+LAG TI  ++ ++    +  ++RAM NTP  I  GMTVLS P + + D+   +   W+
Sbjct: 117 SLLAGKTIADIESYSGRCPKPLVVRAMTNTPSRIGAGMTVLSFPDNATVDESVVNAVSWI 176

Query: 172 FSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXX 231
           F   G+   L+EK +D  T L GS PAF  +++EALADG V MG+P              
Sbjct: 177 FEQTGKCITLEEKQMDVSTALCGSSPAFCFLIIEALADGAVRMGMPYNTAFQCAAQSMLG 236

Query: 232 XXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGNIQ 291
             +MV+++G+HPA +K +V TPGG TI GLL +ED  +RS++AR ++E+T +A +LG   
Sbjct: 237 AAKMVVESGQHPAVLKSAVCTPGGTTIGGLLALEDKGVRSSVARAVEESTNIAKSLGGGA 296

Query: 292 SKK 294
           +KK
Sbjct: 297 AKK 299



>gi|212537219|ref|XP_002148765.1| pyrroline-5-carboxylate reductase [Talaromyces marneffei ATCC
           18224]
 gi|210068507|gb|EEA22598.1| pyrroline-5-carboxylate reductase [Talaromyces marneffei ATCC
           18224]
          Length = 314

 Score =  212 bits (540), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 121/294 (41%), Positives = 180/294 (61%), Gaps = 18/294 (6%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTL---IPKKFIACVSGEESAQRIKEEFND 68
           TL +LGCG +  A+L+GIL S++  P++    L    P KFIAC+  E++A RI+     
Sbjct: 13  TLTMLGCGNLCLAVLTGILSSIS-EPSDSEEKLSFQTPTKFIACIRSEQTAARIRNAVEP 71

Query: 69  K----ITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTID 124
                + +L   NV GVKEADII+L  KP ++K +L   GM+ +L+ KL+IS+LAGV+  
Sbjct: 72  YPKFPVKILQNENVTGVKEADIIILGCKPYMLKDVLDVPGMRDALKGKLLISVLAGVSSQ 131

Query: 125 QLKEW------APSSTR--IIRAMPNTPCMIREGMTVLSCPTDC-SKDDRSFSIWVFSTL 175
           Q+++        P+S R  ++RAMPNT  M+RE MT +S P+    K+      W+F+ +
Sbjct: 132 QIEDTLYLEGSEPASERCTVVRAMPNTAAMVREAMTTISIPSPALPKEWDDLISWIFTRI 191

Query: 176 GRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRM 235
           G+   L    +D  T L+GSGPAFA +++E LADG V MGLPR                M
Sbjct: 192 GKIVRLPPSQMDVCTALAGSGPAFAALMIEGLADGAVAMGLPRAEAQLMACQVLKGTVSM 251

Query: 236 VLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           + ++G+HP+ +K+ +++PGGCTI GLL +ED  +R ++AR ++EAT VAS LG 
Sbjct: 252 I-ESGEHPSIVKEKISSPGGCTIGGLLVLEDAGVRGSVARAVREATCVASELGQ 304



>gi|429856555|gb|ELA31460.1| pyrroline-5-carboxylate reductase [Colletotrichum gloeosporioides
           Nara gc5]
          Length = 347

 Score =  212 bits (540), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 128/310 (41%), Positives = 179/310 (57%), Gaps = 33/310 (10%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEP-----------------PTLIPKKFIACVS 54
           T+ VLGCGTMG AIL+GIL SL    A +P                 P  +P +FIACV 
Sbjct: 20  TMTVLGCGTMGIAILNGILTSLQEMQAPKPLQTPSGSGTSTPLQDEVPRRLPSRFIACVR 79

Query: 55  GEESAQRIKE---EFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLEN 111
             ESA+++K+   E +  + ++   N+  V ++D+ILL  KP +VK IL+E GM ++L  
Sbjct: 80  RPESAKKVKKALWEHSSVLKVVQNENIPSVLKSDVILLACKPYMVKDILSEPGMARALHG 139

Query: 112 KLIISILAGVTIDQLKEW----APSST-------RIIRAMPNTPCMIREGMTVLSCPT-D 159
           KL++S+ AGVT   L+E     AP+ +       R+IRA+PNT  +IRE MTV+   T  
Sbjct: 140 KLLVSVCAGVTEADLEEILHGVAPTKSPEEDGRCRVIRAVPNTASLIRESMTVIGTSTWP 199

Query: 160 CSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPRE 219
            S +  S   W+F  +G    L   ++DA T L GS PA+  ++LE+  DG V MGLPR 
Sbjct: 200 LSPEISSLVTWIFRRIGDVVYLPPNNMDASTALCGSCPAYFALMLESAIDGAVAMGLPRA 259

Query: 220 VXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQE 279
                          MVL  G HPA ++D VTTPGGCTI GL+ +E+G++R T+AR ++E
Sbjct: 260 EATRMAAQTMRGTAGMVLN-GDHPALLRDKVTTPGGCTIGGLMVLEEGRVRGTIARAVRE 318

Query: 280 ATQVASTLGN 289
           +T VAS LG 
Sbjct: 319 STVVASQLGQ 328



>gi|326484756|gb|EGE08766.1| pyrroline-5-carboxylate reductase [Trichophyton equinum CBS 127.97]
          Length = 323

 Score =  211 bits (537), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 123/298 (41%), Positives = 180/298 (60%), Gaps = 21/298 (7%)

Query: 12  TLCVLGCGTMGRAILSGILDSLN---VAPANEPPT--LIPKK---FIACVSGEESAQRIK 63
           T+  LGCGT+G +ILSG++ SL+    + A  PP+    P +   FIAC+   ES +RI+
Sbjct: 17  TVTFLGCGTLGTSILSGVMASLSEPRSSSAYPPPSGSATPSEGLPFIACIRRPESVKRIQ 76

Query: 64  E---EFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAG 120
                +N  +T+L   NV+GV + D+I+L  KP ++  +L   GM+++L+ KL++SILAG
Sbjct: 77  HILSPYNLPLTILQNENVKGVTDGDVIVLGCKPYMLSEVLNVPGMREALKGKLLVSILAG 136

Query: 121 VTIDQLKEWAPSST--------RIIRAMPNTPCMIREGMTVL-SCPTDCSKDDRSFSIWV 171
           V  +Q++E     +        R++RAMPNT  ++RE MTV+ S     +    +   W+
Sbjct: 137 VPAEQIEEVLYKDSDIDMADRCRVVRAMPNTAAIVRESMTVIASTNPPLTHFQSTIVSWI 196

Query: 172 FSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXX 231
           F+ +GR   L    +DA T L+GSG AF  +VLEALADG V MGLPR             
Sbjct: 197 FTRVGRVITLPPHIMDASTALAGSGTAFVALVLEALADGAVAMGLPRAESQLMAAQVMRG 256

Query: 232 XXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
              MVL  G+HPA I++  +TPGGCTI GLL +E+G++R  +AR+++EAT VAS LG 
Sbjct: 257 TAGMVLN-GEHPALIREKTSTPGGCTIGGLLVLEEGRVRGAIARSVREATVVASQLGK 313



>gi|302502104|ref|XP_003013043.1| pyrroline-5-carboxylate reductase [Arthroderma benhamiae CBS
           112371]
 gi|291176605|gb|EFE32403.1| pyrroline-5-carboxylate reductase [Arthroderma benhamiae CBS
           112371]
          Length = 327

 Score =  210 bits (534), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 124/297 (41%), Positives = 176/297 (59%), Gaps = 28/297 (9%)

Query: 19  GTMGRAILSGILDSLN---VAPANEPPT------------LIPKKFIACVSGEESAQRIK 63
           GT+G +ILSG++ SL+    + A  PP+             IP KFIACV   ES +RI+
Sbjct: 21  GTLGTSILSGVMASLSEPRSSSAYPPPSGSATPSEGLPVHQIPSKFIACVRRPESVKRIQ 80

Query: 64  E---EFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAG 120
                +N  +T+L   NV+GV + D+I+L  KP ++  +L   GM+++L+ KL+ISILAG
Sbjct: 81  HILSPYNLPLTILQNENVKGVTDGDVIVLGCKPYMLSEVLNVPGMREALKGKLLISILAG 140

Query: 121 VTIDQLKEWAPSST--------RIIRAMPNTPCMIREGMTVL-SCPTDCSKDDRSFSIWV 171
           V  +Q++E     +        R++RAMPNT  ++RE MTV+ S     S    +   W+
Sbjct: 141 VPAEQIEEVLYKDSEIDMADRCRVVRAMPNTAAIVRESMTVIASTNPPLSHFQSTIVSWI 200

Query: 172 FSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXX 231
           F+ +GR   L    +DA T L+GSG AF  +VLEALADG V MGLPR             
Sbjct: 201 FTRVGRVITLPPHIMDASTALAGSGTAFVALVLEALADGAVAMGLPRAESQLMAAQVMRG 260

Query: 232 XXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLG 288
              MVL  G+HPA I++  +TPGGCTI GLL +E+G++R  +AR+++EAT VAS LG
Sbjct: 261 TAGMVLN-GEHPALIREKTSTPGGCTIGGLLVLEEGRVRGAIARSVREATVVASQLG 316



>gi|302667838|ref|XP_003025498.1| pyrroline-5-carboxylate reductase [Trichophyton verrucosum HKI
           0517]
 gi|291189611|gb|EFE44887.1| pyrroline-5-carboxylate reductase [Trichophyton verrucosum HKI
           0517]
          Length = 327

 Score =  210 bits (534), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 124/297 (41%), Positives = 176/297 (59%), Gaps = 28/297 (9%)

Query: 19  GTMGRAILSGILDSLN---VAPANEPPT------------LIPKKFIACVSGEESAQRIK 63
           GT+G +ILSG++ SL+    + A  PP+             IP KFIACV   ES +RI+
Sbjct: 21  GTLGTSILSGVMASLSEPRSSSAYPPPSGSATPSEGLPVHQIPSKFIACVRRPESVKRIQ 80

Query: 64  E---EFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAG 120
                +N  +T+L   NV+GV + D+I+L  KP ++  +L   GM+++L+ KL+ISILAG
Sbjct: 81  HILSPYNLPLTILQNENVKGVTDGDVIVLGCKPYMLSEVLNVPGMREALKGKLLISILAG 140

Query: 121 VTIDQLKEWAPSST--------RIIRAMPNTPCMIREGMTVL-SCPTDCSKDDRSFSIWV 171
           V  +Q++E     +        R++RAMPNT  ++RE MTV+ S     S    +   W+
Sbjct: 141 VPAEQIEEVLYKDSDLDMADRCRVVRAMPNTAAIVRESMTVIASTNPPLSHFQSTIVSWI 200

Query: 172 FSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXX 231
           F+ +GR   L    +DA T L+GSG AF  +VLEALADG V MGLPR             
Sbjct: 201 FTRVGRVITLPPHIMDASTALAGSGTAFVALVLEALADGAVAMGLPRAESQLMAAQVMRG 260

Query: 232 XXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLG 288
              MVL  G+HPA I++  +TPGGCTI GLL +E+G++R  +AR+++EAT VAS LG
Sbjct: 261 TAGMVLN-GEHPALIREKTSTPGGCTIGGLLVLEEGRVRGAIARSVREATVVASQLG 316



>gi|482806436|gb|EOA83509.1| hypothetical protein SETTUDRAFT_140120 [Setosphaeria turcica Et28A]
          Length = 317

 Score =  209 bits (533), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 124/302 (41%), Positives = 179/302 (59%), Gaps = 21/302 (6%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVA--PANEPPTLIPK------KFIAC---VSGEESAQ 60
           TL VLG GTMG AI+ G++ SL  A   A   P+  PK       F+AC      EE+ +
Sbjct: 11  TLTVLGSGTMGIAIMGGVMSSLASARTKATIDPSSAPKDVPNLSNFVACDQWAPAEENVR 70

Query: 61  RIKEEFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAG 120
           +    +N  +  L   N++GV++ADI+LL  KP   KTIL EEGM+++L+ K+++SILAG
Sbjct: 71  KALGHYNFSLQTLTNENLKGVQQADIVLLSCKPHGFKTILGEEGMREALKGKVLVSILAG 130

Query: 121 VTIDQLKEW----APSST----RIIRAMPNTPCMIREGMTVL-SCPTDCSKDDRSFSIWV 171
           VT +Q++ +     P  T    R++R MPNT   + E M+V+ +     S+  +    ++
Sbjct: 131 VTREQIEAFLYPDGPEKTEGACRVVRVMPNTASFVGESMSVIQTSDPPLSEKQQKLVEFI 190

Query: 172 FSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXX 231
           FS++GR   L   ++D  T L GSGPAF  +VLEA ADG V MGLPR             
Sbjct: 191 FSSIGRVTTLPPANMDVATALCGSGPAFFALVLEAAADGAVAMGLPRAEAQMMAAQTMRG 250

Query: 232 XXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGNIQ 291
              +VL  G+HPA +KD V+TPGGCTI GL+++E+  +R ++A+ I+EAT VAS LG  Q
Sbjct: 251 TTGLVLN-GEHPAVLKDKVSTPGGCTIGGLMSLEEDGVRGSVAKAIREATVVASRLGGEQ 309

Query: 292 SK 293
            +
Sbjct: 310 KE 311



>gi|242809886|ref|XP_002485467.1| pyrroline-5-carboxylate reductase [Talaromyces stipitatus ATCC
           10500]
 gi|218716092|gb|EED15514.1| pyrroline-5-carboxylate reductase [Talaromyces stipitatus ATCC
           10500]
          Length = 314

 Score =  209 bits (531), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 119/293 (40%), Positives = 176/293 (60%), Gaps = 16/293 (5%)

Query: 12  TLCVLGCGTMGRAILSGIL--DSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDK 69
           TL +LGCG +G A+L+GIL   S       +     P KFIAC+  E +A RI+      
Sbjct: 13  TLTMLGCGNLGLAVLTGILMSISEPSESEEKLSFQTPTKFIACIRSERTAARIRSAVEPY 72

Query: 70  ----ITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQ 125
               + +L  +NV GVKEADI++L  KP ++K +L   GM+++L+ KL+IS+LAGV+  Q
Sbjct: 73  PKFPVKILQNDNVTGVKEADIVILGCKPYMLKDVLDVPGMREALKGKLLISVLAGVSSQQ 132

Query: 126 LKEW------APSSTR--IIRAMPNTPCMIREGMTVLSCPTDC-SKDDRSFSIWVFSTLG 176
           +++        P+S R  ++RAMPNT  M+RE MT +S P+    K+      W+F+ +G
Sbjct: 133 IEDTLYSEGPQPASERCTVVRAMPNTAAMVREAMTTISIPSPALPKEWDDLVSWIFTRIG 192

Query: 177 RARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMV 236
           +   L    +D  T L+GSGPAF  +++E LADG V MGLPR                M+
Sbjct: 193 KIVHLPPSQMDVCTALAGSGPAFVALMIEGLADGAVAMGLPRAEAQLMACQVLKGTVSMI 252

Query: 237 LKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
            ++G+HP+ +K+ +++PGGCTI GLL +ED  +R T+AR ++EAT VAS LG 
Sbjct: 253 -ESGEHPSIVKEKISSPGGCTIGGLLVLEDAGVRGTVARAVREATCVASELGQ 304



>gi|491178612|ref|WP_005036975.1| pyrroline-5-carboxylate reductase [Holophaga foetida]
 gi|372005428|gb|EHP06064.1| pyrroline-5-carboxylate reductase [Holophaga foetida DSM 6591]
          Length = 272

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 119/280 (42%), Positives = 164/280 (58%), Gaps = 13/280 (4%)

Query: 11  PTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKI 70
           P++ V+G GTMG+AI +G++++    P    P   P      V+ + +A  +        
Sbjct: 5   PSVAVIGFGTMGQAISAGLVEAGGFPPERIHPA-DPNHM--AVAPKAAAMGVT------- 54

Query: 71  TLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENK-LIISILAGVTIDQLKEW 129
             L  +  E  K +D++LLC KP+ +  +L E     +L +  L+ISI AGVT+  L+  
Sbjct: 55  --LADSPAEAAKASDVVLLCVKPKEIGPVLKELSKVGALNHHPLVISIAAGVTLASLESH 112

Query: 130 APSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAV 189
            P  T ++RAMPNT C + +GM VLS     S+D  + +  +F  + R   L+EKHLDAV
Sbjct: 113 VPQGTPVVRAMPNTACSVHQGMVVLSPGQAASEDHLAKARTLFEPIARVMSLEEKHLDAV 172

Query: 190 TGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDS 249
           T LSGSGPAF  V+LEALA+GGV  GLPR V              M LK+GKH A +KD 
Sbjct: 173 TALSGSGPAFVFVILEALAEGGVQCGLPRAVAQELAAQMTLGAATMALKSGKHTAALKDE 232

Query: 250 VTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           V TP G TIAGL+ +EDGK+RST+AR I+ AT+VA  LG 
Sbjct: 233 VCTPAGSTIAGLMVLEDGKLRSTIARGIEHATRVAGGLGK 272



>gi|389639130|ref|XP_003717198.1| pyrroline-5-carboxylate reductase [Magnaporthe oryzae 70-15]
 gi|351643017|gb|EHA50879.1| pyrroline-5-carboxylate reductase [Magnaporthe oryzae 70-15]
 gi|440475699|gb|ELQ44362.1| pyrroline-5-carboxylate reductase [Magnaporthe oryzae Y34]
 gi|440490147|gb|ELQ69734.1| pyrroline-5-carboxylate reductase [Magnaporthe oryzae P131]
          Length = 329

 Score =  208 bits (529), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 127/311 (40%), Positives = 177/311 (56%), Gaps = 38/311 (12%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPAN----------------EPPTLIPKKFIACVSG 55
           TL VLGCGTMG AILSGIL SL    A+                E P  +P +FIACV  
Sbjct: 11  TLAVLGCGTMGIAILSGILTSLQDMAASGVLSASASGTSTPVHPEVPDRLPSRFIACVRR 70

Query: 56  EESAQRIKEEFNDKITLL---VGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENK 112
            ESA+++K    + ++++     +N+   ++A +++L  KPQ++  +L++ G+ ++L  K
Sbjct: 71  PESAKKVKVALAEHLSVVKVVQNDNLASARQAGVVILACKPQMIGDLLSKPGIAEALRGK 130

Query: 113 LIISILAGVTIDQLK---EWAPSST------RIIRAMPNTPCMIREGMTVLSC-----PT 158
           L+ISI AGVT+ Q++   E A  S       R++RAMPNT  MIRE MTV++      P 
Sbjct: 131 LLISICAGVTVPQIEGHLEQALGSKDVENPCRVVRAMPNTASMIRESMTVVATTEPPLPP 190

Query: 159 DCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPR 218
             S    S   W+F  +G    L    +DA T L GSGPAF  ++LEA  DG V MGLPR
Sbjct: 191 QVS----SLVTWIFKRIGDVVYLPASTMDASTALCGSGPAFFALMLEAAVDGAVAMGLPR 246

Query: 219 EVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQ 278
                           +V + G HPA ++D V+TPGGCTI GLL +E+G +R T+AR ++
Sbjct: 247 AEALRMAAQTMKGTAALV-QHGDHPALLRDKVSTPGGCTIGGLLVLEEGIVRGTVARAVR 305

Query: 279 EATQVASTLGN 289
           EAT VAS LG 
Sbjct: 306 EATVVASQLGQ 316



>gi|449303404|gb|EMC99412.1| hypothetical protein BAUCODRAFT_64926 [Baudoinia compniacensis UAMH
           10762]
          Length = 329

 Score =  207 bits (528), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 121/304 (39%), Positives = 172/304 (56%), Gaps = 24/304 (7%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANE-------------PPTLIPKKFIACVSGEES 58
           TL  LGCGTMG AIL GILDSL+                    P  +P +F ACV   ES
Sbjct: 20  TLTFLGCGTMGIAILGGILDSLSTGSQETASATASSTSTAVPTPRRLPSRFNACVRRPES 79

Query: 59  AQRIKEEFND-----KITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKL 113
           A+RI++E         +T+    N+   + AD++LL  KPQ+V  IL  EGM+++L  K+
Sbjct: 80  AKRIRKELGHYSAFQHVTIREKENLIATQAADVVLLGCKPQMVAGILHAEGMREALTGKV 139

Query: 114 IISILAGVTIDQLKEW----APSSTRIIRAMPNTPCMIREGMTVLSCPTD-CSKDDRSFS 168
           +ISI AGVT  Q++ +      S   ++R MPNT   +RE MTV++      S++     
Sbjct: 140 LISICAGVTEQQIESYLAEIGASGCTVVRVMPNTAAAVRESMTVIATSNPPLSEETDVLI 199

Query: 169 IWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXX 228
            W+F+ +GR   L    +DA T L GSGP F  V+ E+LA G + MG+PR+         
Sbjct: 200 AWIFTRIGRVVHLPSNTMDACTALCGSGPGFVAVMAESLAAGAIAMGIPRDEAYLMAAQT 259

Query: 229 XXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLG 288
                 ++L  G+HPA ++D V+TPGGCTI GLL +E+G +R T+A+ ++EAT VAS LG
Sbjct: 260 MRGTTGLLL-AGEHPAILRDKVSTPGGCTIGGLLVLEEGGVRGTIAKAVREATVVASQLG 318

Query: 289 NIQS 292
             +S
Sbjct: 319 QGKS 322



>gi|451850227|gb|EMD63529.1| hypothetical protein COCSADRAFT_37313 [Bipolaris sorokiniana
           ND90Pr]
          Length = 317

 Score =  207 bits (527), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 124/302 (41%), Positives = 179/302 (59%), Gaps = 21/302 (6%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVA--PANEPPTLIPK------KFIACVSGEESAQRIK 63
           TL VLG GTMG AI+ G++ SL  A   A   P+  PK       FIAC     + Q ++
Sbjct: 11  TLTVLGSGTMGIAIMGGVMSSLASARTKATIDPSSAPKDVPNLSNFIACDQWAPAEQNVR 70

Query: 64  E---EFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAG 120
           +    +N  +  L   N++GV++ADI+LL  KP   KTIL EEGM+ +L+ K+++SILAG
Sbjct: 71  KALGHYNFPLQTLTDENLKGVQQADIVLLSCKPHGFKTILGEEGMRDALKGKVLVSILAG 130

Query: 121 VTIDQLK--------EWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSI-WV 171
           VT +Q++        E A ++ R++R MPNT   + E M+V+        D ++  + +V
Sbjct: 131 VTREQIEAFLYPDGPEKAENACRVVRVMPNTASFVGESMSVIQTSDPPLSDAQAKLVEFV 190

Query: 172 FSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXX 231
           FS++GR   L   ++D  T L GSGPAF  ++LEA ADG V MGLPR             
Sbjct: 191 FSSIGRVTTLPPANMDVATALCGSGPAFFALMLEAAADGAVAMGLPRAEAQMMAAQTMRG 250

Query: 232 XXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGNIQ 291
              +VL  G+HPA +KD V+TPGGCTI GL+++E+  +R ++A+ I+EAT VAS LG  Q
Sbjct: 251 TTGLVLN-GEHPAVLKDKVSTPGGCTIGGLMSLEEDGVRGSVAKAIREATVVASRLGGEQ 309

Query: 292 SK 293
            +
Sbjct: 310 KE 311



>gi|406981296|gb|EKE02789.1| hypothetical protein ACD_20C00330G0003 [uncultured bacterium]
          Length = 271

 Score =  207 bits (526), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 114/283 (40%), Positives = 169/283 (59%), Gaps = 13/283 (4%)

Query: 7   LPTNPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEF 66
           +P N  +  +G G MG+AI++G+L S  V   N          IA    EE A+++ +E 
Sbjct: 1   MPENIKIGFIGAGVMGKAIINGLLKSNFVNKDN---------IIASEITEELAKKVSDET 51

Query: 67  NDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQL 126
             K    + NN E VK +D+I+L TKP ++K +L EE  +     K+++SI AG+    +
Sbjct: 52  GIK---AISNNRELVKASDVIILSTKPFIIKDVL-EEIKENLTGEKILVSIAAGINTSFI 107

Query: 127 KEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHL 186
           +E       +IR MPNTP ++ EGM+ +S     +       + +FS +GR   + EKH+
Sbjct: 108 EEIIRKEPPVIRVMPNTPAVVEEGMSAVSRGKYATDKQVELIMQIFSNVGRCIEVQEKHI 167

Query: 187 DAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEI 246
           +AVTG+SGSGPAF  +++EALADGGV +GLP++              +MVL+TGKHP+ +
Sbjct: 168 NAVTGISGSGPAFIYLIIEALADGGVKLGLPKKTAIELAAQTTLGAAKMVLETGKHPSIL 227

Query: 247 KDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           KD VTTPGGCTIAGL  MED  +R+ L++T+QE  + A+ L N
Sbjct: 228 KDEVTTPGGCTIAGLAVMEDNGVRAALSKTVQETAKTAAELCN 270



>gi|330914642|ref|XP_003296720.1| hypothetical protein PTT_06898 [Pyrenophora teres f. teres 0-1]
 gi|311330995|gb|EFQ95176.1| hypothetical protein PTT_06898 [Pyrenophora teres f. teres 0-1]
          Length = 317

 Score =  207 bits (526), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 121/297 (40%), Positives = 175/297 (58%), Gaps = 21/297 (7%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAP--ANEPPTLIPKK------FIAC---VSGEESAQ 60
           TL VLG GTMG AI+ G++ SL  A   A   P+  PK       FIAC      EE+ +
Sbjct: 11  TLTVLGSGTMGIAIMGGVMSSLASAKTTAALSPSSTPKNTPNLSNFIACDQWAPAEENVR 70

Query: 61  RIKEEFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAG 120
           +    +N  +  L   N++GV++ADI+LL  KP   KTIL E+GM+++L+ K+++SILAG
Sbjct: 71  KALSHYNFPLQTLTNQNLKGVQQADIVLLSCKPHGFKTILGEDGMKEALKGKVLVSILAG 130

Query: 121 VTIDQLKEW--------APSSTRIIRAMPNTPCMIREGMTVL-SCPTDCSKDDRSFSIWV 171
           VT +Q++ +           + R++R MPNT   + E M+V+ +     S++      +V
Sbjct: 131 VTREQIEAFLYPEGADKVEGACRVVRVMPNTASFVGESMSVIQTSDPPLSEEQYKLVEFV 190

Query: 172 FSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXX 231
           FS++GR   L   ++D  T L GSGPAF  ++LEA ADG V MGLPR             
Sbjct: 191 FSSIGRVTTLPPANMDVATALCGSGPAFFALILEAAADGAVAMGLPRAEAQMMAAQTMRG 250

Query: 232 XXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLG 288
              +VL  G+HPA +KD V+TPGGCTI GL+++E+  +R  +A+ I+EAT VAS LG
Sbjct: 251 TTGLVLN-GEHPAVLKDKVSTPGGCTIGGLMSLEEDGVRGAVAKAIREATVVASRLG 306



>gi|451993370|gb|EMD85844.1| hypothetical protein COCHEDRAFT_1228856 [Bipolaris maydis C5]
 gi|452000253|gb|EMD92714.1| hypothetical protein COCHEDRAFT_1132708 [Bipolaris maydis C5]
 gi|477587815|gb|ENI04896.1| hypothetical protein COCC4DRAFT_197490 [Bipolaris maydis ATCC
           48331]
          Length = 317

 Score =  207 bits (526), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 124/302 (41%), Positives = 177/302 (58%), Gaps = 21/302 (6%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVA--PANEPPTLIPK------KFIAC---VSGEESAQ 60
           TL VLG GTMG AI+ G++ SL  A   A   P+  PK       F+AC      E++ +
Sbjct: 11  TLTVLGSGTMGIAIMGGVMSSLASARTKATIDPSSAPKDVPNLSNFVACDQWAPAEQNVR 70

Query: 61  RIKEEFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAG 120
           +    +N  +  L   N++GV++ADI+LL  KP   KTIL EEGM+ +L+ K+++SILAG
Sbjct: 71  KALGHYNFPLQTLTNENLKGVQQADIVLLSCKPHGFKTILGEEGMRDALKGKVLVSILAG 130

Query: 121 VTIDQLK--------EWAPSSTRIIRAMPNTPCMIREGMTVL-SCPTDCSKDDRSFSIWV 171
           VT +Q++        E A S  R++R MPNT   + E M+V+ +     S+       +V
Sbjct: 131 VTREQIEAFLYPDGPEKADSPCRVVRVMPNTASFVGESMSVIQTSDPPLSEAQAKLVEFV 190

Query: 172 FSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXX 231
           FS++GR   L   ++D  T L GSGPAF  ++LEA ADG V MGLPR             
Sbjct: 191 FSSIGRVTTLPPANMDVATALCGSGPAFFALMLEAAADGAVAMGLPRAEAQMMAAQTMRG 250

Query: 232 XXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGNIQ 291
              +VL  G+HPA +KD V+TPGGCTI GL+++E+  +R ++A+ I+EAT VAS LG  Q
Sbjct: 251 TTGLVLN-GEHPAVLKDKVSTPGGCTIGGLMSLEEDGVRGSVAKAIREATVVASRLGGEQ 309

Query: 292 SK 293
            +
Sbjct: 310 KE 311



>gi|512202920|gb|EPE31746.1| 6-phosphogluconate dehydrogenase C-terminal [Glarea lozoyensis ATCC
           20868]
          Length = 300

 Score =  206 bits (525), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 123/291 (42%), Positives = 169/291 (58%), Gaps = 23/291 (7%)

Query: 21  MGRAILSGILDSLNVAPA--------NEPPTLIPKKFIACVSGEESAQRIKEE---FNDK 69
           MG AILSGIL SL+   A        +E P+ +P KFIACV   + A++IK+    +   
Sbjct: 1   MGIAILSGILASLDEIHAPNSQSSETDETPSKLPTKFIACVRSPKGAEKIKKALSPYKTP 60

Query: 70  ITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEW 129
           + ++  +NV   +EAD++LL  KP + + IL EEGM  +L+ KL+ISILAGV  +Q+  +
Sbjct: 61  VKIIQSDNVTACREADVVLLGCKPYMAEGILGEEGMVDALKGKLLISILAGVPAEQIYGY 120

Query: 130 APSST----------RIIRAMPNTPCMIREGMTVLSCPTD-CSKDDRSFSIWVFSTLGRA 178
               T          +++RAMPNT   IRE MTV++  +   S    S   W+F  +G  
Sbjct: 121 MYGKTPVNPEKEGLCQVVRAMPNTASGIRESMTVIATSSPPLSATTSSLITWIFKRIGDV 180

Query: 179 RILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLK 238
             L    +DA T L GSGPAF  ++LEA  DG V MGLPR                +VL 
Sbjct: 181 VQLPAATMDASTALCGSGPAFFALILEAAIDGAVAMGLPRAEAQRMAAQTMKGAAGLVL- 239

Query: 239 TGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           +G+HPA +KD VTTPGGCTI GL+ +E+G +R T+AR ++EAT VAS LG 
Sbjct: 240 SGEHPALLKDKVTTPGGCTIGGLMVLEEGGVRGTVARAVREATVVASQLGK 290



>gi|189207428|ref|XP_001940048.1| pyrroline-5-carboxylate reductase [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187976141|gb|EDU42767.1| pyrroline-5-carboxylate reductase [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 317

 Score =  205 bits (522), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 121/300 (40%), Positives = 173/300 (57%), Gaps = 27/300 (9%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVA-----------PANEPPTLIPKKFIAC---VSGEE 57
           TL VLG GTMG AI+ G++ SL  A           P N P       FIAC      EE
Sbjct: 11  TLTVLGSGTMGIAIMGGVMSSLASAKTAAALSSSSTPKNTPNL---SNFIACDQWAPAEE 67

Query: 58  SAQRIKEEFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISI 117
           + ++    +N  +  L   N++GV++ADIILL  KP   KTIL E+GM+++L+ K+++SI
Sbjct: 68  NVRKALSHYNFPLQTLTNQNLKGVQQADIILLSCKPHGFKTILGEDGMKEALKGKVLVSI 127

Query: 118 LAGVTIDQLKEW--------APSSTRIIRAMPNTPCMIREGMTVL-SCPTDCSKDDRSFS 168
           LAGVT +Q++ +           + R++R MPNT   + E M+V+ +     S++     
Sbjct: 128 LAGVTREQIEAFLYPEGADKVEGACRVVRVMPNTASFVGESMSVIQTSDPPLSEEQYKLV 187

Query: 169 IWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXX 228
            +VFS++GR   L   ++D  T L GSGPAF  ++LEA ADG V MGLPR          
Sbjct: 188 EFVFSSIGRVTTLPPANMDVATALCGSGPAFFALILEAAADGAVAMGLPRAEAQMMAAQT 247

Query: 229 XXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLG 288
                 +VL  G+HPA +KD V+TPGGCTI GL+++E+  +R  +A+ I+EAT VAS LG
Sbjct: 248 MRGTTGLVLN-GEHPAVLKDKVSTPGGCTIGGLMSLEEDGVRGAVAKAIREATVVASRLG 306



>gi|358378995|gb|EHK16676.1| hypothetical protein TRIVIDRAFT_41156 [Trichoderma virens Gv29-8]
          Length = 332

 Score =  204 bits (520), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 120/313 (38%), Positives = 184/313 (58%), Gaps = 29/313 (9%)

Query: 8   PTNPTLCVLGCGTMGRAILSGILDSL------------NVAPANEPPTLIPKKFIACVSG 55
           P + T+ VLGCGTMG AIL+GIL SL               P+ E P  +P +FIACV  
Sbjct: 5   PQDLTMAVLGCGTMGIAILNGILTSLVEMQGPKPLQSGASTPSEEVPRSLPSRFIACVRT 64

Query: 56  EESAQRIKE---EFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENK 112
            E+A+++K    E +  + ++  +N+  V+++ +ILL  KP +VK IL   GM K+L  K
Sbjct: 65  PETAKKVKSALWEHSSVLKVVRNDNLAAVQQSQVILLTCKPYMVKEILGAPGMAKALHGK 124

Query: 113 LIISILAGVTIDQLK----EWAPSST-------RIIRAMPNTPCMIREGMTVLSCPTD-C 160
           L+IS+ AG+T++QL+       PS         RI+RAM NT  +IRE MTV+S      
Sbjct: 125 LLISVCAGITVEQLEIALHGAVPSKDPEEDGRCRIVRAMCNTAALIRESMTVISATEPPL 184

Query: 161 SKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREV 220
            ++  +   W+F  +G    L  ++++A T L GSGPAF  + LEA  +G V MGLPR  
Sbjct: 185 PQETETLVTWIFKRVGDVVYLPARYMNASTALCGSGPAFYSLFLEAAIEGAVAMGLPRAE 244

Query: 221 XXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEA 280
                         ++ ++G+HPA +++ V TPGGCT++G+L +E+ ++R T+++ ++EA
Sbjct: 245 ATRMATQTMRGTTGLI-QSGEHPALLREKVCTPGGCTVSGVLVLEEERVRGTISKAVREA 303

Query: 281 TQVASTLG-NIQS 292
           + VAS LG NIQ+
Sbjct: 304 SLVASQLGKNIQA 316



>gi|46125755|ref|XP_387431.1| hypothetical protein FG07255.1 [Fusarium graminearum PH-1]
          Length = 335

 Score =  202 bits (514), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 116/308 (37%), Positives = 176/308 (57%), Gaps = 28/308 (9%)

Query: 9   TNPTLCVLGCGTMGRAILSGILDSL------------NVAPANEPPTLIPKKFIACVSGE 56
           T+ T+ VLGCGTMG AILSGIL+SL              +P +E P  +P +F+A V+  
Sbjct: 16  TDLTMAVLGCGTMGVAILSGILNSLAEMQGPKPLQTLTSSPGDEVPDRLPSRFVASVATP 75

Query: 57  ESAQRIKE---EFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKL 113
             A+R+K    E +  + ++  +N+  V+++++++L  KP +VK ILTE G+ K+L  KL
Sbjct: 76  AGAKRVKGALWEHSSILKVVHNDNIGAVQQSEVVILACKPWMVKEILTEPGISKALHGKL 135

Query: 114 IISILAGVTIDQLKEWAPSST-----------RIIRAMPNTPCMIREGMTVLSCPTD-CS 161
           +IS+ AG+T++ ++     +            RI+RAM NT  +IRE MTV++ P     
Sbjct: 136 LISVCAGITVEDIEIALHGAVPCKDPEEDGRCRIVRAMCNTAAVIRESMTVIASPNSPLD 195

Query: 162 KDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVX 221
               S   W+F  +G    L  +H+DA T L  SGPAF  +VLEA  DG V MG+PR   
Sbjct: 196 HATESLVTWIFKRIGDVVYLPTRHMDASTALCASGPAFFALVLEAAIDGAVAMGIPRPDA 255

Query: 222 XXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEAT 281
                        +V + G+HPA +++ V T GGCTI G+L +E+GK+R T++R ++EA 
Sbjct: 256 QRMATQSMRGTAGLV-QNGEHPALLREKVCTSGGCTIGGVLVLEEGKVRGTVSRAVREAA 314

Query: 282 QVASTLGN 289
            VA  +G 
Sbjct: 315 VVAGQIGK 322



>gi|408400541|gb|EKJ79620.1| hypothetical protein FPSE_00180 [Fusarium pseudograminearum CS3096]
          Length = 335

 Score =  202 bits (514), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 116/308 (37%), Positives = 176/308 (57%), Gaps = 28/308 (9%)

Query: 9   TNPTLCVLGCGTMGRAILSGILDSL------------NVAPANEPPTLIPKKFIACVSGE 56
           T+ T+ VLGCGTMG AILSGIL+SL              +P +E P  +P +F+A V+  
Sbjct: 16  TDLTMAVLGCGTMGVAILSGILNSLAEMQGPKPLQTLTSSPGDEVPDRLPSRFVASVATP 75

Query: 57  ESAQRIKE---EFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKL 113
             A+R+K    E +  + ++  +N+  V+++++++L  KP +VK ILTE G+ K+L  KL
Sbjct: 76  AGAKRVKGALWEHSSILKVVHNDNIGAVQQSEVVILACKPWMVKEILTEPGISKALHGKL 135

Query: 114 IISILAGVTIDQLKEWAPSST-----------RIIRAMPNTPCMIREGMTVLSCPTD-CS 161
           +IS+ AG+T++ ++     +            RI+RAM NT  +IRE MTV++ P     
Sbjct: 136 LISVCAGITVEDIEIALHGAVPCKDPEEDGRCRIVRAMCNTAAVIRESMTVIASPNSPLD 195

Query: 162 KDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVX 221
               S   W+F  +G    L  +H+DA T L  SGPAF  +VLEA  DG V MG+PR   
Sbjct: 196 HATESLVTWIFKRIGDVVYLPTRHMDASTALCASGPAFFALVLEAAIDGAVAMGIPRPDA 255

Query: 222 XXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEAT 281
                        +V + G+HPA +++ V T GGCTI G+L +E+GK+R T++R ++EA 
Sbjct: 256 QRMATQSMRGTAGLV-QNGEHPALLREKVCTSGGCTIGGVLVLEEGKVRGTVSRAVREAA 314

Query: 282 QVASTLGN 289
            VA  +G 
Sbjct: 315 VVAGQIGK 322



>gi|302916081|ref|XP_003051851.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256732790|gb|EEU46138.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 342

 Score =  202 bits (513), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 121/313 (38%), Positives = 177/313 (56%), Gaps = 35/313 (11%)

Query: 9   TNPTLCVLGCGTMGRAILSGILDSLN---------------VAPANEPPTLIPKKFIACV 53
           T+ T+ VLGCGTMG AILSGIL+SL                  P +E P  +P +FIA V
Sbjct: 16  TDLTMAVLGCGTMGVAILSGILNSLADMQGPKPLQIPRSGASTPMDEVPQRLPSRFIASV 75

Query: 54  SGEESAQRIKE---EFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLE 110
           +    A+R+K    E +  + ++  +N+  V++++++LL  KP +VK IL+E G+ K+L 
Sbjct: 76  ATAAGAKRVKGSLWEHSSILKVVHNDNLSAVQQSEVVLLTCKPWMVKEILSESGIAKALH 135

Query: 111 NKLIISILAGVTIDQ----LKEWAPSST-------RIIRAMPNTPCMIREGMTVL---SC 156
            KL+IS+  G+T++     L    PS         RI+RAM N   +IRE MTV+   S 
Sbjct: 136 GKLLISVCTGITVEDIEVALHGAVPSKDPNEDGRCRIVRAMCNAAAVIRESMTVIATSSP 195

Query: 157 PTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGL 216
           P DC+ +      W+F  +G    L  +H+DA T L  SGPAF  +VLEA  DG V MG+
Sbjct: 196 PLDCATE--GLVTWIFKRIGDVVYLPAQHMDASTALCASGPAFFALVLEAAIDGAVAMGI 253

Query: 217 PREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLART 276
           PR                +V + G+HPA +++ V T GGCTI G+L ME+G++R T++R 
Sbjct: 254 PRHDAQRMAVQSMRGMTGLV-QNGEHPALLREKVCTSGGCTIGGVLVMEEGRVRGTVSRA 312

Query: 277 IQEATQVASTLGN 289
           ++E+  VAS LG 
Sbjct: 313 VRESAVVASQLGK 325



>gi|342885847|gb|EGU85799.1| hypothetical protein FOXB_03647 [Fusarium oxysporum Fo5176]
 gi|475666229|gb|EMT64020.1| Pyrroline-5-carboxylate reductase [Fusarium oxysporum f. sp.
           cubense race 4]
          Length = 343

 Score =  201 bits (512), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 117/312 (37%), Positives = 176/312 (56%), Gaps = 32/312 (10%)

Query: 9   TNPTLCVLGCGTMGRAILSGILDSL----------------NVAPANEPPTLIPKKFIAC 52
           T+ T+ VLGCGTMG AILSGIL+SL                   P +E P  +P +F+A 
Sbjct: 17  TDLTMAVLGCGTMGVAILSGILNSLAEMQGPKPLQSLPRSGTSTPGDEVPERLPSRFVAS 76

Query: 53  VSGEESAQRIKE---EFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSL 109
           V+    A+R+K    E +  + ++  +N+  V++A+++LL  KP +VK IL+E G+ K+L
Sbjct: 77  VATAAGAKRVKGALWEHSSILKVVHNDNIGAVQQAEVVLLTCKPWMVKEILSEPGISKAL 136

Query: 110 ENKLIISILAGVTIDQ----LKEWAPSST-------RIIRAMPNTPCMIREGMTVLSCPT 158
             KL++S+ AG+T++     L    PS         RI+RAM NT  +IRE MTV++ P+
Sbjct: 137 HGKLLVSVCAGITVEDIEIALHGAVPSKDPEEDGRCRIVRAMCNTAAVIRESMTVIASPS 196

Query: 159 D-CSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLP 217
                   S   W+F  +G    L  +H+DA T L  SGPAF  +VLEA  DG V MG+P
Sbjct: 197 SPLDHATESLVTWIFRRIGDVVYLPTRHMDASTALCASGPAFFALVLEAAIDGAVAMGIP 256

Query: 218 REVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTI 277
           R                +V + G+HPA +++ V T GGCTI G+L +E+G++R +++R +
Sbjct: 257 RADAQRMATQSMRGTAGLV-QNGEHPALLREKVCTSGGCTIGGVLVLEEGRVRGSVSRAV 315

Query: 278 QEATQVASTLGN 289
           +EA  VA  +G 
Sbjct: 316 REAAVVAGQIGK 327



>gi|322707252|gb|EFY98831.1| pyrroline-5-carboxylate reductase [Metarhizium anisopliae ARSEF 23]
          Length = 329

 Score =  201 bits (512), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 122/307 (39%), Positives = 173/307 (56%), Gaps = 31/307 (10%)

Query: 12  TLCVLGCGTMGRAILSGILDSL--------------NVA-PANEPPTLIPKKFIACVSGE 56
           T+ VLGCGTMG AIL+GIL SL              N + P  E P  +P +FIACV   
Sbjct: 9   TMTVLGCGTMGIAILNGILTSLAEINGPRPLQSPSSNASTPGEERPQSLPSRFIACVRSA 68

Query: 57  ESAQRIKE---EFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKL 113
           ESA+R+K    E +  + ++  +N+  V++A ++LL  KP +V  +L E GM  +L+ KL
Sbjct: 69  ESAKRVKAALWEHSSIVKVVQNDNIAAVQQAQVVLLGCKPYMVNNVLGEPGMADALKGKL 128

Query: 114 IISILAGVTIDQ----LKEWAPSST-------RIIRAMPNTPCMIREGMTVLSCPTD-CS 161
           +IS+ AG+T D     L    P++        R++RAM NT  +IRE MTV+        
Sbjct: 129 LISVCAGITADHMEIALHGSVPTTNPEDDGRCRVVRAMCNTAALIRESMTVIGISDPPLP 188

Query: 162 KDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVX 221
            D ++   W+F  +G    L   ++DA T L GS PA   ++LEA  DG V MGLPR   
Sbjct: 189 PDMKTLVTWIFKRIGDVVYLPANNMDASTALCGSSPAMFALMLEAAIDGAVAMGLPRAEA 248

Query: 222 XXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEAT 281
                        +V ++G+HPA +++ V TPGGCTI GLL +E+G+ R T++R I+EAT
Sbjct: 249 QRMATQSMRGTTGLV-QSGEHPALLREKVCTPGGCTIGGLLVLEEGRARGTISRAIREAT 307

Query: 282 QVASTLG 288
            VAS LG
Sbjct: 308 VVASQLG 314



>gi|322701653|gb|EFY93402.1| pyrroline-5-carboxylate reductase [Metarhizium acridum CQMa 102]
          Length = 329

 Score =  201 bits (512), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 121/307 (39%), Positives = 172/307 (56%), Gaps = 31/307 (10%)

Query: 12  TLCVLGCGTMGRAILSGILDSLN---------------VAPANEPPTLIPKKFIACVSGE 56
           T+ VLGCGTMG AIL+GIL SL                  P  E P  +P +FIACV   
Sbjct: 9   TMTVLGCGTMGIAILNGILTSLAEINGPRPLQSPSSSASTPGEERPQSLPSRFIACVRSA 68

Query: 57  ESAQRIKE---EFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKL 113
           ESA+R+K    E +  + ++  +N+  V++A ++LL  KP +V  +L E GM  +L+ KL
Sbjct: 69  ESAKRVKAALWEHSSIVKVVQNDNLAAVQQAQVVLLGCKPYMVNNVLGEPGMADALKGKL 128

Query: 114 IISILAGVTIDQ----LKEWAPSST-------RIIRAMPNTPCMIREGMTVLSCPTD-CS 161
           +IS+ AG+T D     L    P+++       R++RAM NT  +IRE MTV+        
Sbjct: 129 LISVCAGITADHMEIALHGSVPTTSPEDDGRCRVVRAMCNTAALIRESMTVIGISDPPLP 188

Query: 162 KDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVX 221
            D ++   W+F  +G    L   ++DA T L GS PA   ++LEA  DG V MGLPR   
Sbjct: 189 PDMKTLVTWIFKRIGDVVYLPANNMDASTALCGSSPAMFALMLEAAIDGAVAMGLPRAEA 248

Query: 222 XXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEAT 281
                        +V ++G+HPA +++ V TPGGCTI GLL +E+G+ R T++R I+EAT
Sbjct: 249 QRMATQSMRGTTGLV-QSGEHPALLREKVCTPGGCTIGGLLVLEEGRARGTISRAIREAT 307

Query: 282 QVASTLG 288
            VAS LG
Sbjct: 308 VVASQLG 314



>gi|340520658|gb|EGR50894.1| delta 1-pyrroline-5-carboxylate reductase [Trichoderma reesei QM6a]
          Length = 339

 Score =  201 bits (510), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 117/313 (37%), Positives = 184/313 (58%), Gaps = 29/313 (9%)

Query: 8   PTNPTLCVLGCGTMGRAILSGILDSL------------NVAPANEPPTLIPKKFIACVSG 55
           P + T+ VLGCGTMG AIL+GIL SL               P+ + P  +P +FIACV  
Sbjct: 13  PQDLTMAVLGCGTMGIAILNGILTSLVEMQGPKPLQSGASTPSEDIPRSLPSRFIACVRT 72

Query: 56  EESAQRIKE---EFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENK 112
            E+A+++K    E +  + ++  +N+  V+++ +ILL  KP +V+ IL   GM K+L  K
Sbjct: 73  PETAKKVKGALWEHSSVLKVVRNDNLAAVQQSQVILLTCKPYMVRDILGAPGMAKALHGK 132

Query: 113 LIISILAGVTIDQLK----EWAPSST-------RIIRAMPNTPCMIREGMTVLSCPTD-C 160
           L+IS+ AG+T++QL+       PS         RI+RAM NT  +IRE MTV+S      
Sbjct: 133 LLISVCAGITVEQLEIALHGAVPSKDPDEDGRCRIVRAMCNTAALIRESMTVISATEPPL 192

Query: 161 SKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREV 220
            ++  +   W+F  +G    L  ++++A T L GSGPAF  + LEA  +G V MGLPR  
Sbjct: 193 PRETETLVTWIFKRVGDVVYLPARYMNASTALCGSGPAFYSLFLEAAIEGAVAMGLPRAE 252

Query: 221 XXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEA 280
                         ++ ++G+HPA +++ V TPGGCT++G+L +E+ ++R T+++ ++EA
Sbjct: 253 ATRMATQTMRGTTGLI-QSGEHPALLREKVCTPGGCTVSGVLVLEEERVRGTISKAVREA 311

Query: 281 TQVASTLG-NIQS 292
           ++VA  LG NIQ+
Sbjct: 312 SRVAGQLGKNIQA 324



>gi|220931043|ref|YP_002507951.1| pyrroline-5-carboxylate reductase [Halothermothrix orenii H 168]
 gi|501768799|ref|WP_012635154.1| pyrroline-5-carboxylate reductase [Halothermothrix orenii]
 gi|219992353|gb|ACL68956.1| pyrroline-5-carboxylate reductase [Halothermothrix orenii H 168]
          Length = 266

 Score =  200 bits (509), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 112/276 (40%), Positives = 164/276 (59%), Gaps = 14/276 (5%)

Query: 13  LCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITL 72
           LC++G G MG  +L GILD+ N+  A        K  I C    +  +  K+    + T 
Sbjct: 3   LCIIGLGKMGTTLLYGILDN-NILEA--------KDIIGCDPVVDEREHNKDYRGIRTT- 52

Query: 73  LVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPS 132
             G+N  GV++AD ILL  KPQV+K +L  +G++ + ENKL ISI AGV+ D++KE  P 
Sbjct: 53  --GSNYRGVEQADNILLAVKPQVLKNVL--QGIKPASENKLFISIAAGVSTDRIKENLPE 108

Query: 133 STRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGL 192
           S R+IR MPNTP ++ +G++ +S     + DD  F   + + +G+  +++E  +DAVTGL
Sbjct: 109 SCRVIRVMPNTPALVNQGVSAISPGEKATDDDIEFVKKICNGVGKGVVIEEHLIDAVTGL 168

Query: 193 SGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTT 252
           SGSGPA+  V++EALAD GV+ GL R++              MVLKTG+HP ++KD VT+
Sbjct: 169 SGSGPAYIYVIIEALADAGVLNGLSRDLALELAVRTVAGSAEMVLKTGQHPGQLKDMVTS 228

Query: 253 PGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLG 288
           PGG TI GL  +E   +R  L   +  A + +  LG
Sbjct: 229 PGGTTINGLQVIEKRGLRGILMEAVSRAVERSRELG 264



>gi|160901706|ref|YP_001567287.1| pyrroline-5-carboxylate reductase [Petrotoga mobilis SJ95]
 gi|501163797|ref|WP_012208071.1| pyrroline-5-carboxylate reductase [Petrotoga mobilis]
 gi|160359350|gb|ABX30964.1| pyrroline-5-carboxylate reductase [Petrotoga mobilis SJ95]
          Length = 274

 Score =  199 bits (505), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 105/272 (38%), Positives = 165/272 (60%), Gaps = 14/272 (5%)

Query: 10  NPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDK 69
           N  LCV+G G MG  ++ G++         +  TL  ++ I     E  +++    ++D 
Sbjct: 2   NEKLCVIGLGKMGSTLVKGLI---------QTKTLKREQIIGTDLFEYDSEK-NSNYSDI 51

Query: 70  ITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEW 129
            T  + +N + VKE+DI+LL  KPQV+  +L E  +  S ENK++ISI AGV++  L + 
Sbjct: 52  KT--ISDNAKAVKESDIVLLAVKPQVIDKVLEE--ISSSCENKIVISIAAGVSLRHLDKA 107

Query: 130 APSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAV 189
            P+S++IIRAMPNTP ++ EG+  +S   +  ++D      +  ++G+  +++E  +DA+
Sbjct: 108 LPTSSKIIRAMPNTPILVGEGVIAISKKKNVDENDLKRVKEILESVGKVYLVEEDIMDAI 167

Query: 190 TGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDS 249
           T LSGSGPA+  +++EAL+DGGV+MGLPRE+             RMVL+TGKHP E+KD 
Sbjct: 168 TALSGSGPAYVYMMIEALSDGGVLMGLPRELSTEFAARTLLGAARMVLETGKHPGELKDM 227

Query: 250 VTTPGGCTIAGLLTMEDGKIRSTLARTIQEAT 281
           VT+PGG  I G+  +E   +R  L   ++EAT
Sbjct: 228 VTSPGGTAIKGIEVLESHGLRGILMDAVKEAT 259



>gi|302036141|ref|YP_003796463.1| pyrroline-5-carboxylate reductase [Candidatus Nitrospira defluvii]
 gi|503012387|ref|WP_013247363.1| pyrroline-5-carboxylate reductase [Candidatus Nitrospira defluvii]
 gi|300604205|emb|CBK40537.1| Pyrroline-5-carboxylate reductase [Candidatus Nitrospira defluvii]
          Length = 268

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 113/282 (40%), Positives = 168/282 (59%), Gaps = 17/282 (6%)

Query: 9   TNPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFND 68
           T P +  LG G M  A++ G+L     A A EP ++       C +   +A+R  +    
Sbjct: 3   TKP-IAFLGGGQMAEALIGGLL----AAGACEPASI-------CATDPVAARR--DVLKS 48

Query: 69  KITLLVGN-NVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLK 127
           +  + VG+ N + V+EAD+++L  KPQ +  +L++ G  ++   KLI+SI AGVT   ++
Sbjct: 49  RFGIRVGDENAKAVREADLVVLAVKPQAMSAVLSDAG--QACAGKLIVSIAAGVTTAWIR 106

Query: 128 EWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLD 187
           E   +   I+RAMPNTP ++REG+T L+C +D   DD +    +F  +G A  ++E+ +D
Sbjct: 107 ERIVTPRGIVRAMPNTPALVREGVTALTCQSDLRSDDLAAVRTLFEAVGSAVSVEERLMD 166

Query: 188 AVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIK 247
           AVTGLSGSGPA+  V +EALADGGV MGLPR               +MVL+ G+HPA++K
Sbjct: 167 AVTGLSGSGPAYVFVAIEALADGGVRMGLPRATAELLAAQTVLGAAKMVLERGEHPAKLK 226

Query: 248 DSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           D V +PGG TIAGL  +E G +RS L   ++ AT+ +  LG 
Sbjct: 227 DQVASPGGTTIAGLYQLEAGGLRSCLMAAVEAATKRSQELGR 268



>gi|358391797|gb|EHK41201.1| hypothetical protein TRIATDRAFT_135389 [Trichoderma atroviride IMI
           206040]
          Length = 322

 Score =  198 bits (503), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 117/304 (38%), Positives = 173/304 (56%), Gaps = 28/304 (9%)

Query: 13  LCVLGCGTMGRAILSGILDSL------------NVAPANEPPTLIPKKFIACVSGEESAQ 60
           + VLGCGTMG AIL+GIL SL            +  PA + P  +P +FIACV   ESA+
Sbjct: 1   MAVLGCGTMGIAILNGILTSLVEMQGPKPLQSGSSTPAEDVPRSLPSRFIACVRTPESAK 60

Query: 61  RIKE---EFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISI 117
           ++K    E +  + ++   N+  V++A +I+L  KP +VK IL   GM KSL  KL+IS+
Sbjct: 61  KVKSALWEHSSILKVVRNENLAAVQQAQVIVLTCKPYMVKEILGAPGMAKSLHGKLLISV 120

Query: 118 LAGVTIDQLK----EWAPSST-------RIIRAMPNTPCMIREGMTVLSCPTD-CSKDDR 165
            AG+T++QL+       PS         RI+RAM NT  +IRE MTV+S        +  
Sbjct: 121 CAGITVEQLEIALHGAVPSKDPEEDGRCRIVRAMCNTAALIRESMTVISATVPPLPLETE 180

Query: 166 SFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXX 225
               W+F  +G    L  ++++A T L GSGPAF  + LEA  +G V MGLPR       
Sbjct: 181 VLVTWIFKRVGDVVYLPARYMNASTALCGSGPAFYALFLEAAVEGAVAMGLPRAEATRMA 240

Query: 226 XXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVAS 285
                    ++ ++G+HPA +++ V TPGGCT+ G+L +E+ ++R T+++ ++EAT VA 
Sbjct: 241 TQTMRGTTGLI-QSGEHPALLREKVCTPGGCTVNGVLVLEEERVRGTISKAVREATLVAG 299

Query: 286 TLGN 289
            LG 
Sbjct: 300 QLGK 303



>gi|218511626|gb|ACK77800.1| pyrroline-5-carboxylate reductase [Epichloe festucae]
 gi|218511627|gb|ACK77801.1| pyrroline-5-carboxylate reductase [Epichloe festucae]
 gi|218511628|gb|ACK77802.1| pyrroline-5-carboxylate reductase [Epichloe festucae]
          Length = 330

 Score =  197 bits (502), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 118/307 (38%), Positives = 172/307 (56%), Gaps = 31/307 (10%)

Query: 12  TLCVLGCGTMGRAILSGILDSLN---------------VAPANEPPTLIPKKFIACVSGE 56
           T+ VLGCGTMG AIL+GIL SL                  P  E P  +P +FIACV   
Sbjct: 10  TMTVLGCGTMGIAILNGILTSLAEINGPRPLQSPLPGAPTPGEERPQSLPSRFIACVRSA 69

Query: 57  ESAQRIKE---EFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKL 113
           ESA+R+K    E +  + ++  +N+  V++A ++LL  KP +V  +L + GM  +LE KL
Sbjct: 70  ESAKRVKSALWEHSSIVKVVQNDNLAAVQQAQVVLLGCKPYMVNNVLGQPGMAAALEGKL 129

Query: 114 IISILAGVTIDQLKEW----APSST-------RIIRAMPNTPCMIREGMTVLS-CPTDCS 161
           +IS+ AG+T + ++       P+S+       R++RAM NT  +IRE MTV+        
Sbjct: 130 LISVCAGITAEHMESALHGAVPTSSPDEDGRCRVVRAMCNTAALIRESMTVIGITEPPLP 189

Query: 162 KDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVX 221
              ++   W+F  +G    L   ++DA T L GS PA   ++LEA  DG + MGLPR   
Sbjct: 190 PQSKALVTWIFRCIGDVVYLPLNNMDASTALCGSSPAMFALMLEAAIDGALAMGLPRAEA 249

Query: 222 XXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEAT 281
                        +V ++G+HPA +++ V TPGGCTI GLL +E+G+ R T++R I+EAT
Sbjct: 250 QRMATQSMRGMTGLV-QSGEHPALLREKVCTPGGCTIGGLLVLEEGRARGTISRAIREAT 308

Query: 282 QVASTLG 288
            VAS LG
Sbjct: 309 VVASQLG 315



>gi|320582835|gb|EFW97052.1| Delta 1-pyrroline-5-carboxylate reductase [Ogataea parapolymorpha
           DL-1]
          Length = 277

 Score =  196 bits (497), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 111/283 (39%), Positives = 169/283 (59%), Gaps = 14/283 (4%)

Query: 10  NPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDK 69
           N TL +LGCGTMG A+L+ +L +       EP    P K I C + E+SA ++KE + DK
Sbjct: 5   NYTLTILGCGTMGTAVLAAMLQT-----KFEP---YPAKIICCTNSEKSALKLKETYGDK 56

Query: 70  ITLLVG--NNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLE-NKLIISILAGVTIDQL 126
           I +  G  NN + V +A+I++L  KP + + +  +  ++  L  ++L+IS+LAG +IDQL
Sbjct: 57  IEVSFGAANNAKAVGQAEILMLGCKPFLCEQVYDQ--VKSHLPGDQLVISLLAGWSIDQL 114

Query: 127 KEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHL 186
           + W+P + +I R M NTP     G+ V+S   +C   +  F + +   +G A  L E++ 
Sbjct: 115 RMWSPKAGKIARVMTNTPAKFGCGVAVVSFSDECLPHE-DFVLKIVGGVGTAIKLPERNQ 173

Query: 187 DAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEI 246
           DA T L GSG AF+ + +EAL +GG+ MG+P  +             +MV +TG+HP  +
Sbjct: 174 DAATALVGSGVAFSLLFMEALTEGGIRMGIPAAIAQECAAKVMEGTAKMVKETGQHPGAL 233

Query: 247 KDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           K +  TPGGCTI GLL MED  +RS ++R ++EAT +AS LG 
Sbjct: 234 KLAACTPGGCTIGGLLVMEDKGVRSGVSRAVEEATNIASQLGK 276



>gi|491629570|ref|WP_005487109.1| Pyrroline-5-carboxylate reductase [Halanaerobium saccharolyticum]
 gi|460789052|emb|CCU77739.1| Pyrroline-5-carboxylate reductase [Halanaerobium saccharolyticum
           subsp. saccharolyticum DSM 6643]
          Length = 267

 Score =  194 bits (493), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 110/276 (39%), Positives = 160/276 (57%), Gaps = 12/276 (4%)

Query: 13  LCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITL 72
           L ++G G MG+AILSGIL + N+  A E      KKF        +   I+E+F  K   
Sbjct: 3   LAIIGLGNMGQAILSGILKN-NILEA-EQIIAADKKF------ANADFEIEEKF--KEIN 52

Query: 73  LVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPS 132
           +  +N E V++AD I+L  KPQ+++ +L  E +Q S  +K+IISI AGV    L ++  +
Sbjct: 53  ITDDNKEAVQKADYIILAVKPQIIELVL--EDIQNSAASKVIISIAAGVNTRTLSQYFTA 110

Query: 133 STRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGL 192
           +T+IIR MPNTP ++ EGM+ L        D+R+F   +F++LG    + E  +DAVTGL
Sbjct: 111 NTKIIRVMPNTPALVAEGMSALYYSNLVEADERAFVEKIFNSLGETAEVKESDMDAVTGL 170

Query: 193 SGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTT 252
           SGSGPAF  + +EALAD GV+ GL R+               MVL +  HPA +KD V +
Sbjct: 171 SGSGPAFVYIFIEALADAGVLKGLARDTALKLAAQTVKGGAEMVLSSDIHPAALKDMVCS 230

Query: 253 PGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLG 288
           P G TIAG+  +E+   RS +   +Q+A + +  LG
Sbjct: 231 PAGTTIAGVAELENKAFRSAVINAVQKAAERSEELG 266



>gi|396479339|ref|XP_003840731.1| similar to pyrroline-5-carboxylate reductase [Leptosphaeria
           maculans JN3]
 gi|312217304|emb|CBX97252.1| similar to pyrroline-5-carboxylate reductase [Leptosphaeria
           maculans JN3]
          Length = 317

 Score =  194 bits (492), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 119/297 (40%), Positives = 168/297 (56%), Gaps = 21/297 (7%)

Query: 12  TLCVLGCGTMGRAILSGILDSLN-------VAPAN-EPPTLIPKKFIAC---VSGEESAQ 60
           TL VLG GTMG AI+ G++ SL        V+P++ + PT     FIAC      EE+ +
Sbjct: 11  TLTVLGAGTMGIAIMGGVMSSLASAKTAAVVSPSSTKKPTPNLSNFIACDQWAPAEENVR 70

Query: 61  RIKEEFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAG 120
           +    +   +  L   N++GV+EADIILL  KP   K IL E+GM  +L+ K+++SILAG
Sbjct: 71  KALGHYAFPLQTLTNQNLKGVQEADIILLSCKPHGYKQILGEQGMLDALKGKVLVSILAG 130

Query: 121 VTIDQLKEW--------APSSTRIIRAMPNTPCMIREGMTVLSCPTD-CSKDDRSFSIWV 171
           VT  QL+ +           + R++R MPNT   + E M+V+       S+       +V
Sbjct: 131 VTQQQLETFLYPEGAHKVEGACRVVRVMPNTASFVGESMSVIQISDPPLSEQQAELVNFV 190

Query: 172 FSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXX 231
           F ++GR   L   ++D  T L GSGPAF  ++LEA  DG V MGLPR             
Sbjct: 191 FGSIGRVVSLPPANMDVSTALCGSGPAFFALMLEAATDGAVAMGLPRAEAQMMAAQTMRG 250

Query: 232 XXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLG 288
              +VL  G+HPA +KD V+TPGGCTI GL+++E+  +R  +A+ I+EAT VAS LG
Sbjct: 251 TTGLVLN-GEHPAVLKDKVSTPGGCTIGGLMSLEEDGVRGAVAKAIREATVVASRLG 306



>gi|320590762|gb|EFX03205.1| pyrroline-5-carboxylate reductase [Grosmannia clavigera kw1407]
          Length = 1327

 Score =  192 bits (488), Expect = 9e-47,   Method: Composition-based stats.
 Identities = 120/328 (36%), Positives = 168/328 (51%), Gaps = 52/328 (15%)

Query: 12   TLCVLGCGTMGRAILSGILDSLNVAPANEP------------------------------ 41
            TL VLGCG MG AILSG+L S+    A  P                              
Sbjct: 813  TLAVLGCGAMGIAILSGMLASIAEMDAPRPLQVVASGPSSGHSSGHGGSSASGTSTPVSS 872

Query: 42   -----PTLIPKKFIACVSGEESAQRIKEEF---NDKITLLVGNNVEGVKEADIILLCTKP 93
                 P  +P +FIACV   ESA+++K      +  + ++  +NV   + AD++LL  K 
Sbjct: 873  ATDEVPERLPGRFIACVRRTESAKKVKAALWAHSSAVKVVQNDNVHAAQLADVVLLACKA 932

Query: 94   QVVKTILTEEGMQKSLENKLIISILAGVTIDQLKE-----WAPS-------STRIIRAMP 141
              V T+L E GM  +L  KL+ISI AGVT++Q++        P+         R++RAMP
Sbjct: 933  DAVPTLLAEPGMVLALHGKLLISICAGVTVEQIEADLHGGMVPTLDPAVDGRCRVVRAMP 992

Query: 142  NTPCMIREGMTVLSCPTD-CSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFA 200
            N   ++RE MTV++           +   W+F  +G    L  + +DA T L GSGPAF 
Sbjct: 993  NAAALVRESMTVIAASQPPLPPSQAALVTWIFRRIGDVAYLPREAMDASTALCGSGPAFF 1052

Query: 201  CVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAG 260
             ++LEA  DG V MGLPR                +VL  G HPA ++D +TTPGGCTI G
Sbjct: 1053 SLLLEAAIDGAVAMGLPRAEAIRMAAQSMRGTASLVLH-GDHPALLRDRITTPGGCTIGG 1111

Query: 261  LLTMEDGKIRSTLARTIQEATQVASTLG 288
            L+ +E+G +R T+AR ++E+T VAS LG
Sbjct: 1112 LMVLEEGGVRGTVARAVRESTTVASQLG 1139



>gi|320106569|ref|YP_004182159.1| pyrroline-5-carboxylate reductase [Terriglobus saanensis SP1PR4]
 gi|503333237|ref|WP_013567898.1| pyrroline-5-carboxylate reductase [Terriglobus saanensis]
 gi|319925090|gb|ADV82165.1| pyrroline-5-carboxylate reductase [Terriglobus saanensis SP1PR4]
          Length = 287

 Score =  191 bits (486), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 109/282 (38%), Positives = 163/282 (57%), Gaps = 14/282 (4%)

Query: 6   SLPTNPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEE 65
           +LP N  + +LG G MG  +L   L + N+        L+P++  A V  E+ A  +  +
Sbjct: 17  ALP-NVRVAILGAGKMGGILLQAFLKN-NL--------LLPEQITATVGHEDRAHALGTQ 66

Query: 66  FNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQ 125
           F  +++    +N    + AD+ILL  KP  V   L EE +    + KL+IS  A VT   
Sbjct: 67  FGIEVST---DNRSAAEHADVILLGVKPTQVPA-LVEEILPVLNDKKLLISFAASVTTKS 122

Query: 126 LKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKH 185
           ++        ++RAMPNTP M+  G+T L+     +    + +  +F+T+GR  I+DEKH
Sbjct: 123 IEAAIGHDAGVVRAMPNTPAMLAAGITALARGVHTTDAQLAIAQKIFATVGRTVIVDEKH 182

Query: 186 LDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAE 245
           +DAVTGLSGSGPAF  +++EALA+ GV +GLPR++             RMVL+TG HPA 
Sbjct: 183 MDAVTGLSGSGPAFIYIIIEALAEAGVNVGLPRDIATQLAAQTTYGAARMVLETGYHPAL 242

Query: 246 IKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
           +KD+VTTP GCT+ G+L +E+G +R TL + ++ AT  A  L
Sbjct: 243 LKDAVTTPAGCTVDGILELEEGGLRVTLIKAVKRATMRAKEL 284



>gi|453085040|gb|EMF13083.1| pyrroline carboxylate reductase [Mycosphaerella populorum SO2202]
          Length = 313

 Score =  191 bits (486), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 110/306 (35%), Positives = 168/306 (54%), Gaps = 36/306 (11%)

Query: 13  LCVLGCGTMGRAILSGILDSL----------NVAPANEPPTLIPKKFIACVSGEESAQRI 62
           + +LGCGTMG AILSGIL SL             PA   P+ +P +F ACV     A+R+
Sbjct: 1   MTILGCGTMGTAILSGILASLVQSAEAMDNDKSLPAERIPSRLPSRFYACVRSARGAKRV 60

Query: 63  KEE---FNDKITLLVGNNVEGVKEADIILLCTKPQVVKTIL--TEEGMQKSLENKLIISI 117
            +E   +N  + +   +NV  VK++D++L+  +P VV  +L     GMQ++LE KL+IS+
Sbjct: 61  HDELDKYNANLHVFENDNVSAVKDSDVVLVACEPHVVDDVLGVAATGMQEALEGKLLISV 120

Query: 118 LAGVTIDQLKEWAPSSTR-------------------IIRAMPNTPCMIREGMTVL-SCP 157
           L GV+  +L +     +                    I+RAMPNT   IRE MTV+ +  
Sbjct: 121 LGGVSEHRLHQIIQGDSSSSRTSKDSKGTSSSSSSCTIVRAMPNTAAAIRESMTVIVTSN 180

Query: 158 TDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLP 217
               ++      W+F+ +G+   L E H+DA T L GSGPAF  +V E++A G + MG+P
Sbjct: 181 PPLPEETADLVSWIFTRIGQIIYLPESHIDASTALCGSGPAFCALVAESMAAGAIRMGIP 240

Query: 218 REVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTI 277
           R +               +L+ G+HPA ++D V TPGG T+AGL  +E+G +R T++R +
Sbjct: 241 R-LEAYTMVAQVMRGTTGLLQHGEHPALLRDKVCTPGGGTVAGLQVLEEGAVRGTISRAV 299

Query: 278 QEATQV 283
           +E+ +V
Sbjct: 300 EESAKV 305



>gi|94968506|ref|YP_590554.1| pyrroline-5-carboxylate reductase [Candidatus Koribacter versatilis
           Ellin345]
 gi|499841548|ref|WP_011522282.1| pyrroline-5-carboxylate reductase [Candidatus Koribacter
           versatilis]
 gi|94550556|gb|ABF40480.1| pyrroline-5-carboxylate reductase [Candidatus Koribacter versatilis
           Ellin345]
          Length = 280

 Score =  191 bits (484), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 105/280 (37%), Positives = 166/280 (59%), Gaps = 15/280 (5%)

Query: 9   TNPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFND 68
           +  T+ +LG G +G  +L  +L             L PK+  A V+  +   ++ +EF  
Sbjct: 12  SQQTVAILGLGKIGSILLQAML---------REGLLSPKRVRATVNHADKTAKLTQEFGI 62

Query: 69  KITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLE-NKLIISILAGVTIDQLK 127
           ++     +N   +K ADIIL+  KPQ + T+LT   ++  ++ N+L+IS+ A V    ++
Sbjct: 63  QVGT---DNAAAIKGADIILVALKPQQIGTVLTS--LRDEIKPNQLLISVAASVPTAYME 117

Query: 128 EWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLD 187
           E   +   IIRAMPNTP M+  GMT +      +      +  +F+T+GR  I++EKH+D
Sbjct: 118 ERLAAKVPIIRAMPNTPSMLGAGMTGICKGAHATAAQLDLAQAMFNTVGRTAIVEEKHMD 177

Query: 188 AVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIK 247
           AVTGLS SGPAF  +++E+LA+ GV +GLPR++             ++VL+TG+HPA++K
Sbjct: 178 AVTGLSASGPAFIYIIIESLAEAGVKVGLPRDLATLLAAQTTMGAAQVVLETGQHPAQLK 237

Query: 248 DSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
           D+VTTP GCTI G+L +E+GK+R TL + + +A Q A  L
Sbjct: 238 DAVTTPAGCTIDGILELEEGKLRVTLIKAVVKAAQRAKEL 277



>gi|477511765|gb|ENH64326.1| Pyrroline-5-carboxylate reductase [Fusarium oxysporum f. sp.
           cubense race 1]
          Length = 325

 Score =  190 bits (483), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 114/309 (36%), Positives = 168/309 (54%), Gaps = 39/309 (12%)

Query: 9   TNPTLCVLGCGTMGRAILSGILDSL----------------NVAPANEPPTLIPKKFIAC 52
           T+ T+ VLGCGTMG AILSGIL+SL                   P +E P  +P +F+A 
Sbjct: 12  TDLTMAVLGCGTMGVAILSGILNSLAEMQGPKPLQSLPRSGTSTPGDEVPERLPSRFVAS 71

Query: 53  VSGEESAQRIKEEFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENK 112
           V+    A+R+K    +  ++L           +++LL  KP +VK IL+E G+ K+L  K
Sbjct: 72  VATAAGAKRVKGALWEHSSIL----------NEVVLLTCKPWMVKEILSEPGISKALHGK 121

Query: 113 LIISILAGVTIDQ----LKEWAPSST-------RIIRAMPNTPCMIREGMTVLSCPTD-C 160
           L++S+ AG+T++     L    PS         RI+RAM NT  +IRE MTV++ P+   
Sbjct: 122 LLVSVCAGITVEDIEIALHGAVPSKDPEEDGRCRIVRAMCNTAAVIRESMTVIASPSSPL 181

Query: 161 SKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREV 220
                S   W+F  +G    L  +H+DA T L  SGPAF  +VLEA  DG V MG+PR  
Sbjct: 182 DHATESLVTWIFRRIGDVVYLPTRHMDASTALCASGPAFFALVLEAAIDGAVAMGIPRAD 241

Query: 221 XXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEA 280
                         +V + G+HPA +++ V T GGCTI G+L +E+G++R +++R ++EA
Sbjct: 242 AQRMATQSMRGTAGLV-QNGEHPALLREKVCTSGGCTIGGVLVLEEGRVRGSVSRAVREA 300

Query: 281 TQVASTLGN 289
             VA  +G 
Sbjct: 301 AVVAGQIGK 309



>gi|390957275|ref|YP_006421032.1| pyrroline-5-carboxylate reductase [Terriglobus roseus DSM 18391]
 gi|504598164|ref|WP_014785266.1| pyrroline-5-carboxylate reductase [Terriglobus roseus]
 gi|390412193|gb|AFL87697.1| pyrroline-5-carboxylate reductase [Terriglobus roseus DSM 18391]
          Length = 286

 Score =  190 bits (483), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 109/294 (37%), Positives = 167/294 (56%), Gaps = 33/294 (11%)

Query: 7   LPTNPT------LCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQ 60
           LP  P       + +LG G MG  +L   L + N+        L P++  A V+  E A 
Sbjct: 10  LPVTPAAMPGLKVAILGAGKMGGILLQAFLKN-NL--------LHPEQITATVAHPERAH 60

Query: 61  RIKEEFNDKITLLVGNNVEGVKEADIILLCTKP-------QVVKTILTEEGMQKSLENKL 113
            +  +F+ +++    +NVE  +EAD+ILL  KP       ++++ +LT         +KL
Sbjct: 61  ALSAQFSVEVST---DNVEAAREADVILLGVKPMQVPGLVELIRPVLTP--------SKL 109

Query: 114 IISILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFS 173
           ++S  A V    +++ A     +IRAMPNTP M+  G+T L      ++   + +  +F 
Sbjct: 110 LLSFAASVKTASIEDAAGIDLGVIRAMPNTPAMLAAGITALCAGRFVTEQQMAIAQRIFG 169

Query: 174 TLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXX 233
           T+GR  ++DEKH+DAVTGLSGSGPAF  +++EALA+ GV +GLPR++             
Sbjct: 170 TVGRTVVVDEKHMDAVTGLSGSGPAFIYIIIEALAEAGVNVGLPRDIATMLAAQTTYGSA 229

Query: 234 RMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
           RMVL+TG HPA +KD+VTTP GCT+ G+L +E+G +R TL + ++ AT  A  L
Sbjct: 230 RMVLETGYHPALLKDAVTTPAGCTVDGILELEEGGLRVTLIKAVKRATARAKEL 283



>gi|374311591|ref|YP_005058021.1| pyrroline-5-carboxylate reductase [Granulicella mallensis MP5ACTX8]
 gi|504031875|ref|WP_014265869.1| pyrroline-5-carboxylate reductase [Granulicella mallensis]
 gi|358753601|gb|AEU36991.1| pyrroline-5-carboxylate reductase [Granulicella mallensis MP5ACTX8]
          Length = 274

 Score =  190 bits (482), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 103/278 (37%), Positives = 162/278 (58%), Gaps = 15/278 (5%)

Query: 13  LCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITL 72
           + +LG G MG  +L G L +           L P++  A V+ E  AQ +  +    +T 
Sbjct: 10  VAILGTGKMGGILLQGFLKA---------GFLKPEQIFATVAHEARAQALSSQLGITVTT 60

Query: 73  LVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLE-NKLIISILAGVTIDQLKEWAP 131
              +N+E  ++AD+ILL  KP  +  ++ +  ++ +L   KL++S  A V    +++ A 
Sbjct: 61  ---DNLEAAQKADVILLGVKPFQIADVVHQ--IKPALTPGKLLVSFAASVKTRAIEDAAG 115

Query: 132 SSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTG 191
           +   ++RAMPNTP M+  G+  L      + +    +  +F+T+GR  ++DEKH+DAVTG
Sbjct: 116 AEIAVVRAMPNTPSMVGAGIAALCRGRFVTDEQLRIAEQIFATVGRTVVVDEKHMDAVTG 175

Query: 192 LSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVT 251
           LSGSGPAF  +++EALA+ GV +GLPR++             +MVL+TG HPA +KD VT
Sbjct: 176 LSGSGPAFLYIIIEALAEAGVNVGLPRDIATQLAAQTTYGAAKMVLETGSHPALLKDEVT 235

Query: 252 TPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           TP GCT+ G+L +E+G +R TL + ++ ATQ A  L N
Sbjct: 236 TPAGCTVDGILELEEGGLRVTLIKAVKRATQRARELAN 273



>gi|296133621|ref|YP_003640868.1| pyrroline-5-carboxylate reductase [Thermincola potens JR]
 gi|502885992|ref|WP_013120968.1| pyrroline-5-carboxylate reductase [Thermincola potens]
 gi|296032199|gb|ADG82967.1| pyrroline-5-carboxylate reductase [Thermincola potens JR]
          Length = 274

 Score =  189 bits (481), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 108/287 (37%), Positives = 170/287 (59%), Gaps = 16/287 (5%)

Query: 5   MSLPTNPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKE 64
           MSL  + T+  +G G M  AIL+G+L S    P         K FI+ V        +K 
Sbjct: 1   MSL-ADKTIGFIGAGAMAEAILAGLLSSDLTKP--------EKVFISDVDFTRR-DYVKT 50

Query: 65  EFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLE-NKLIISILAGVTI 123
            F+  +     NN + VK +DI++L  KP +++ +LTE  +  S++ ++L++SI AG++ 
Sbjct: 51  RFSVNVA---QNNTDLVKRSDIVVLAVKPFILQDVLTE--IAGSVQTDQLMVSIAAGLST 105

Query: 124 DQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDE 183
             +  +  S   +IR MPNTP ++ EG + L+      ++  + ++ +F+++GRA  + E
Sbjct: 106 GYISSFFKSRVPVIRVMPNTPSLVGEGASALAAGEFAGEEHLALALELFNSVGRAYAVSE 165

Query: 184 KHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHP 243
           + +DAVTGLSGSGPA+  +++EA+AD GV  GLPR++             +MVL+TG+HP
Sbjct: 166 QAMDAVTGLSGSGPAYMYLIIEAMADAGVKAGLPRKIALELSAQTMLGAAKMVLETGEHP 225

Query: 244 AEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGNI 290
           A +KD VTTPGG TIAGL T+E GKIR+T+   +  A Q +  LG +
Sbjct: 226 AVLKDKVTTPGGTTIAGLHTLEQGKIRATIMDAVIAAVQKSKELGAV 272



>gi|398406210|ref|XP_003854571.1| hypothetical protein MYCGRDRAFT_99427 [Zymoseptoria tritici IPO323]
 gi|339474454|gb|EGP89547.1| hypothetical protein MYCGRDRAFT_99427 [Zymoseptoria tritici IPO323]
          Length = 284

 Score =  189 bits (479), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 105/283 (37%), Positives = 166/283 (58%), Gaps = 15/283 (5%)

Query: 21  MGRAILSGILDSLN---VAPANEPPTLIPKKFIACVSGEESAQRIK---EEFNDKITLLV 74
           MG AIL+GI+D+LN    A     P  +P KF ACV   +SA R++   E++N K+ +  
Sbjct: 1   MGIAILAGIMDALNNTSSAQDEATPDKLPTKFNACVRSSKSAHRVQRELEKYNGKLRIFE 60

Query: 75  GNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKE-WAPSS 133
            +N+  V++ADI++L   P + + +L EEG++++L  KL+ISI+AGV   Q+ +   P  
Sbjct: 61  KDNLRAVQQADIVVLGCTPDLYRDVLREEGLKEALAGKLLISIMAGVKEQQIHDALYPEG 120

Query: 134 TR------IIRAMPNTPCMIREGMTVLSCP-TDCSKDDRSFSIWVFSTLGRARILDEKHL 186
           ++      I+ AMPN    IRE +TV++ P +    + ++   W+F+ +G+   L    +
Sbjct: 121 SQEINKCSIVLAMPNPAAAIRESLTVIAIPDSPLPAETQALIDWIFTRIGKIVYLPASKM 180

Query: 187 DAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEI 246
              T L GSG AFA  + E++A G + MG P E               ++L+ G HPA +
Sbjct: 181 SVATALCGSGTAFAMTMAESMAAGAIAMGCPVEEAYTMAAQAMRGAAGLLLR-GGHPAVL 239

Query: 247 KDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           +DS TTPGGCT+AGL+ +E+G  R T+A+ I+E+ QVA+ LG 
Sbjct: 240 RDSATTPGGCTVAGLMVLEEGAFRGTVAKAIKESAQVAAQLGQ 282



>gi|405954084|gb|EKC21616.1| Pyrroline-5-carboxylate reductase 2 [Crassostrea gigas]
          Length = 308

 Score =  188 bits (477), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 108/283 (38%), Positives = 163/283 (57%), Gaps = 14/283 (4%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKIT 71
           T+  +G G M +A+  G +    V P     +    + + C+  +E   RI         
Sbjct: 16  TIGFIGAGRMAQAMSRGFISKGVVKPHKIMASDTVPQMLDCI--KEQGVRISR------- 66

Query: 72  LLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAP 131
               +N+E V+ +D+I++  KP VV  IL +E   K    KL +SI AGVT++ L++  P
Sbjct: 67  ----SNLEIVENSDLIIIAVKPHVVSPIL-QEVSSKVTREKLFLSIAAGVTLETLEKNLP 121

Query: 132 SSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTG 191
           S TR+IRAMPNTP +++ G TV++  +   + DR     +F T+G   +  E+ LDAVTG
Sbjct: 122 SQTRVIRAMPNTPALVQTGATVIAPGSSVLQGDRELIQGLFRTIGICEVGTEEQLDAVTG 181

Query: 192 LSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVT 251
           LSGSGPA+  + +E+LADGGV MGLPR++             +MVL++GKHP ++KD V 
Sbjct: 182 LSGSGPAYGFLAIESLADGGVKMGLPRDLAQKLAAQTLLGAAKMVLESGKHPGQLKDEVC 241

Query: 252 TPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGNIQSKK 294
           +PGG TIA +  +E+   RS+L   ++ AT  A  LG I+S+K
Sbjct: 242 SPGGTTIAAIHKLEETGFRSSLITAVETATNRAKELGVIESQK 284



>gi|399168128|emb|CCE31060.1| probable pyrroline-5-carboxylate reductase [Claviceps purpurea
           20.1]
          Length = 312

 Score =  186 bits (471), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 112/298 (37%), Positives = 163/298 (54%), Gaps = 31/298 (10%)

Query: 21  MGRAILSGILDSL---------------NVAPANEPPTLIPKKFIACVSGEESAQRIKE- 64
           MG AIL+GIL SL                  P  E P  +P +FIACV   ESA+R+K  
Sbjct: 1   MGIAILNGILTSLAEINGPRPLQCSTSGTSTPGEERPQSLPSRFIACVRSAESAKRVKSA 60

Query: 65  --EFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVT 122
             E +  + ++  +N+  V++A ++LL  KP +V  +L + GM  +L+ KL+IS+ AG+T
Sbjct: 61  LWEHSSIVKVVQNDNIAAVQQAQVVLLGCKPYMVNNVLGQPGMADALKGKLLISVCAGIT 120

Query: 123 IDQ----LKEWAPSST-------RIIRAMPNTPCMIREGMTVLS-CPTDCSKDDRSFSIW 170
            +     L    PS++       R++RAM NT  +IRE MTV+           ++   W
Sbjct: 121 AEHMEIALHGSVPSTSPDEDGRCRVVRAMCNTAALIRESMTVIGITEPPLPAQSKALVTW 180

Query: 171 VFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXX 230
           +F  +G    L   ++DA T L GS PA   ++LEA  DG V MGLPR            
Sbjct: 181 IFKRIGDVVYLPSNNMDASTALCGSSPAMFALMLEAAIDGAVAMGLPRAEAQRMATQSMR 240

Query: 231 XXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLG 288
               +V ++G+HPA +++ V TPGGCTI GLL +E+G+ R T++R I+EAT VAS LG
Sbjct: 241 GMTGLV-QSGEHPALLREKVCTPGGCTIGGLLVLEEGRARGTISRAIREATVVASQLG 297



>gi|452843796|gb|EME45731.1| hypothetical protein DOTSEDRAFT_150963 [Dothistroma septosporum
           NZE10]
          Length = 300

 Score =  186 bits (471), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 113/302 (37%), Positives = 167/302 (55%), Gaps = 32/302 (10%)

Query: 13  LCVLGCGTMGRAILSGILDSLNVAPAN-----------EP-PTLIPKKFIACVSGEESAQ 60
           + VLGCGTMG A+L GIL SL                 EP P   P KF ACV     A+
Sbjct: 1   MAVLGCGTMGTAVLGGILQSLQSQSEQSAAASYAMSSAEPAPQRPPSKFHACVHSAAGAE 60

Query: 61  RIKE---EFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISI 117
           R++    ++N ++ +   +NV+  K+ADI+LL     VV +IL  +GM+++L   L+ISI
Sbjct: 61  RVRSALSKYNARLKIHQSSNVDAAKDADIVLLACDTHVVASILQADGMREALAGTLLISI 120

Query: 118 LAGVTIDQLKE-----------WAPSSTRIIRAMPNTPCMIREGMTVLSCPT---DCSKD 163
            AG++   L++               + RI+RAMPNT   IRE MT+++ P    D  +D
Sbjct: 121 CAGLSETVLQDIIYGRDFTTSLADSHACRIVRAMPNTAAAIRESMTMIATPEPPLDAERD 180

Query: 164 DRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXX 223
             +   W+F+ +GR   L   ++DA T L GSG AFA V++E++A G +  G+PRE    
Sbjct: 181 --TLLTWIFTRIGRVTRLPAANMDACTALCGSGTAFAAVMVESMAAGAIGTGMPREQAYT 238

Query: 224 XXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQV 283
                      ++L+ G+HPA ++D V+TPGGCT  GL  +E+G  R T+A+ I+ AT  
Sbjct: 239 MAAQTVRGATGLLLQ-GEHPAVLRDQVSTPGGCTTVGLAALEEGGFRGTIAKAIRNATSA 297

Query: 284 AS 285
           AS
Sbjct: 298 AS 299



>gi|410075812|ref|XP_003955488.1| hypothetical protein KAFR_0B00540 [Kazachstania africana CBS 2517]
 gi|372462071|emb|CCF56353.1| hypothetical protein KAFR_0B00540 [Kazachstania africana CBS 2517]
          Length = 286

 Score =  185 bits (470), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 107/286 (37%), Positives = 163/286 (56%), Gaps = 15/286 (5%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKE---EFND 68
           TL +LGCG MG+A+LS I ++  V    E   L P K IAC     SA+++ E      +
Sbjct: 4   TLTILGCGVMGQAVLSAIYNA-PVPATTEVAQLYPSKIIACNQDAASAKQVTELIESMEN 62

Query: 69  K------ITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVT 122
           K      +    GNNVE VK++D+++L  KP + + +L E G   ++ +KL+ISI AG T
Sbjct: 63  KSPNGIVVDSTFGNNVEAVKQSDVVILGVKPYIAEMVLNEVG--PAIHSKLLISIAAGWT 120

Query: 123 IDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILD 182
           I+QL+ + P+ +R+   M NTP     G  V+S  + C+++ +     + S +G+   L 
Sbjct: 121 IEQLQAYTPTVSRV---MTNTPAKFGYGCAVISHSSACNEEQKQTVSELISHVGKCIELP 177

Query: 183 EKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKH 242
           EK++DA T L GSGPAF  ++LE + + G+ +G+P +              +MV +TG H
Sbjct: 178 EKNMDAATALVGSGPAFVLLMLEGMMESGIKLGIPLKESLEASLKVLEGTAKMVEETGMH 237

Query: 243 PAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLG 288
           P  +K  V TPGG TIAGL  MED  ++S + + I+EA  VA+ LG
Sbjct: 238 PGALKHQVCTPGGTTIAGLCVMEDNGVKSGIIKGIEEAANVAAKLG 283



>gi|262197892|ref|YP_003269101.1| pyrroline-5-carboxylate reductase [Haliangium ochraceum DSM 14365]
 gi|502592216|ref|WP_012829806.1| pyrroline-5-carboxylate reductase [Haliangium ochraceum]
 gi|262081239|gb|ACY17208.1| pyrroline-5-carboxylate reductase [Haliangium ochraceum DSM 14365]
          Length = 272

 Score =  184 bits (468), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 108/278 (38%), Positives = 157/278 (56%), Gaps = 13/278 (4%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKIT 71
           T+  LG G M  AIL G+L         E   L P +  A     E A+ +   +    T
Sbjct: 6   TIGFLGAGNMAEAILRGLL---------EGAGLEPGQIWASAPKAERAEALAARYGIHTT 56

Query: 72  LLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAP 131
               +N E V +A I++L  KPQV+  +L E G +K   N L+IS+ AG+T + ++    
Sbjct: 57  T---SNAELVAQARILVLSVKPQVMDRVLLEVG-KKIERNTLVISVAAGITTEAIEARLS 112

Query: 132 SSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTG 191
             TR++RAMPNTP ++R G T L+  +  + DD + + ++F  +G + +L+E  LDAVTG
Sbjct: 113 PGTRVVRAMPNTPALVRSGATALAGGSHATDDDLALARFMFDAVGISVVLEESQLDAVTG 172

Query: 192 LSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVT 251
           LSGSGPA+  ++LEALAD GV +GL R               +M+L T +HP  +KD VT
Sbjct: 173 LSGSGPAYIFLILEALADAGVKVGLARRHAQRLAAQTVMGAAKMLLDTDEHPGRLKDMVT 232

Query: 252 TPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           +PGG  IAGL T+E G +R+TL   ++ AT+ A  LG 
Sbjct: 233 SPGGTAIAGLHTLEQGGLRTTLINAVEAATRRAQELGR 270



>gi|347756408|ref|YP_004863971.1| pyrroline-5-carboxylate reductase [Candidatus Chloracidobacterium
           thermophilum B]
 gi|503867198|ref|WP_014101192.1| pyrroline-5-carboxylate reductase [Candidatus Chloracidobacterium
           thermophilum]
 gi|347588925|gb|AEP13454.1| pyrroline-5-carboxylate reductase [Candidatus Chloracidobacterium
           thermophilum B]
          Length = 271

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 102/278 (36%), Positives = 160/278 (57%), Gaps = 15/278 (5%)

Query: 13  LCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITL 72
           + +LG G +G A++SG++   +V   N          I  V+ + S  R+       +T 
Sbjct: 7   IAILGVGKLGEALVSGLVRRADVERTN---------LIGSVARQASLARVDLRLGIPVTT 57

Query: 73  LVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLE-NKLIISILAGVTIDQLKEWAP 131
              +N   V   DI++L  KPQ +  +L  E +  ++  ++L IS+ A V+   ++E  P
Sbjct: 58  ---DNAAAVAGRDIVILAVKPQNMTAVL--ESIAPAVSASQLFISVAASVSTSFIEERLP 112

Query: 132 SSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTG 191
               +IRAMPNTP ++ EGM+VL      + + +  +  +FS +GR   L+EK +DAVTG
Sbjct: 113 VPAAVIRAMPNTPALLNEGMSVLCAGRRATPEHQRLAEEIFSAVGRTAFLEEKLMDAVTG 172

Query: 192 LSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVT 251
           LSGSGPA+  VVLEAL++ GV +G+PR++             ++ L+TG+HPA ++DSVT
Sbjct: 173 LSGSGPAYIYVVLEALSEAGVKLGIPRDISTLLAAQTMLGAAKLALETGQHPALLRDSVT 232

Query: 252 TPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           TP GCT+ GLL +E+GK+R TL + +  A + A  L N
Sbjct: 233 TPAGCTVDGLLELEEGKLRVTLIKAVVRAAERARELVN 270



>gi|385800505|ref|YP_005836909.1| pyrroline-5-carboxylate reductase [Halanaerobium praevalens DSM
           2228]
 gi|504366667|ref|WP_014553769.1| pyrroline-5-carboxylate reductase [Halanaerobium praevalens]
 gi|309389869|gb|ADO77749.1| pyrroline-5-carboxylate reductase [Halanaerobium praevalens DSM
           2228]
          Length = 267

 Score =  184 bits (467), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 100/278 (35%), Positives = 157/278 (56%), Gaps = 12/278 (4%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKIT 71
            L ++G G MG+AILSGIL+  +V  A +   ++  K ++  + E  A+  K       T
Sbjct: 2   NLAIIGFGNMGKAILSGILEK-DVIKAEK--IIVADKKVSDPNFELEARFSK-------T 51

Query: 72  LLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAP 131
            +V +N++ V +AD+I+L  KPQ+++ +L E  ++   ++K+I+S+ AG+      ++  
Sbjct: 52  KVVADNLQAVAKADLIILAVKPQIIRKVLEE--IKNDSKDKIIVSVAAGIKKSLFSQYFG 109

Query: 132 SSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTG 191
              +I+R MPNTP ++  GM+ +         ++ F   VF  LG    + E  +DAVTG
Sbjct: 110 EKAKIVRVMPNTPALVASGMSAIYYSKTVKPHEKDFIEKVFGALGETVEISEDKMDAVTG 169

Query: 192 LSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVT 251
           LSGSGPAF  + +EALAD GV+ GL R+               MVLK+ KHPAE+KD V 
Sbjct: 170 LSGSGPAFVYLFIEALADAGVLKGLDRKTALKLAAQTVKGGAEMVLKSAKHPAELKDMVA 229

Query: 252 TPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           +P G TI GL  +E    RST+ + ++ A + +  LGN
Sbjct: 230 SPAGTTITGLAELEANSFRSTVIKAVKAAAERSEELGN 267



>gi|367017274|ref|XP_003683135.1| hypothetical protein TDEL_0H00650 [Torulaspora delbrueckii]
 gi|359750799|emb|CCE93924.1| hypothetical protein TDEL_0H00650 [Torulaspora delbrueckii]
          Length = 284

 Score =  184 bits (466), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 105/286 (36%), Positives = 169/286 (59%), Gaps = 14/286 (4%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKE---EFND 68
           TL +LGCG MG+A+LS I ++   A + E   L P   I C   E SA+++ +    F++
Sbjct: 4   TLVILGCGVMGQALLSAIYNAPK-ADSEEIAKLYPSTIITCNHDEPSAKQVDKLLATFDE 62

Query: 69  -----KITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTI 123
                K++   G N + + +A +++L TKP +V+ +L+  G+Q+ ++ KLIIS+ AG TI
Sbjct: 63  SPNAIKVSSTYGQNQDAIDKASVVILATKPFLVEKVLS--GVQEQIKGKLIISLAAGWTI 120

Query: 124 DQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDE 183
           DQL ++   + ++ R M NTP     G  V+S  +  + DD++    + S +G+   L E
Sbjct: 121 DQLTQY---TEKVSRVMTNTPAKYGYGCAVVSHSSGINNDDKAIVSQLVSHVGKYIELPE 177

Query: 184 KHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHP 243
           K++DA T L GSGPAF  +++E+L + G+ MG+P +              +MV K+G+HP
Sbjct: 178 KNMDAATALVGSGPAFVLLMIESLMESGIQMGIPLKESKECALKVLEGTVKMVEKSGEHP 237

Query: 244 AEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           + +K  V TPGG TIAGL  MED  ++S + R ++EA +VA+ LG 
Sbjct: 238 SVLKHQVCTPGGTTIAGLCVMEDKGVKSGIIRGVEEAAKVAAKLGK 283



>gi|302036992|ref|YP_003797314.1| pyrroline-5-carboxylate reductase [Candidatus Nitrospira defluvii]
 gi|503013237|ref|WP_013248213.1| pyrroline-5-carboxylate reductase [Candidatus Nitrospira defluvii]
 gi|300605056|emb|CBK41389.1| Pyrroline-5-carboxylate reductase [Candidatus Nitrospira defluvii]
          Length = 276

 Score =  182 bits (463), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 105/289 (36%), Positives = 164/289 (56%), Gaps = 19/289 (6%)

Query: 9   TNPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQR--IKEEF 66
           T   +  +G G M  A+L+G+L    VA A              VS  +  +R  + E F
Sbjct: 3   TGTRIAFIGGGNMAEALLAGLLRK-GVAAAEH----------LTVSDPDGHRRALLAERF 51

Query: 67  NDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENK-LIISILAGVTIDQ 125
              +     +N      A++++ C +PQV+  +L E  +  SL+++ L+IS+ AG  I +
Sbjct: 52  GVAVH---ADNRTAAHGAELVVFCVEPQVLDAVLDE--VVSSLQSRPLVISVAAGYPISR 106

Query: 126 LKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKH 185
           L+    ++TR++RAMPNTP  I EG+T +S     S +D+  +  +F ++G+  +++E+ 
Sbjct: 107 LQAHLGTATRLVRAMPNTPSTIGEGVTAVSLAPGLSSEDQDRTRCLFESVGKVVVVEERL 166

Query: 186 LDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAE 245
           +DAVTGLSGSGPA+   ++EALADGGV+MGLPR               RM+L+ G HPA 
Sbjct: 167 MDAVTGLSGSGPAYVFAMIEALADGGVLMGLPRGTAQVLAAQTVAGAARMLLEQGTHPAV 226

Query: 246 IKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGNIQSKK 294
           +KD V +PGG TIAGL ++E G++R+TL   +  A Q +  LG  +S  
Sbjct: 227 LKDRVASPGGTTIAGLSSLEQGRLRATLMSAVTAAAQRSQELGKEESHH 275



>gi|226228665|ref|YP_002762771.1| pyrroline-5-carboxylate reductase [Gemmatimonas aurantiaca T-27]
 gi|506375351|ref|WP_015895070.1| pyrroline-5-carboxylate reductase [Gemmatimonas aurantiaca]
 gi|226091856|dbj|BAH40301.1| pyrroline-5-carboxylate reductase [Gemmatimonas aurantiaca T-27]
          Length = 266

 Score =  182 bits (463), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 103/275 (37%), Positives = 149/275 (54%), Gaps = 15/275 (5%)

Query: 15  VLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITLLV 74
           ++G G MG A+  G+               +          EESA  ++E      T   
Sbjct: 5   IIGMGKMGEAVAQGL-----------AKYGVEATLRGSTRTEESAADVRERLGMACTT-- 51

Query: 75  GNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPSST 134
            NN E  + A+I+LLC KP   + +L E     +  ++L++SI A +T  QL EW+    
Sbjct: 52  -NNAEAAQGAEIVLLCVKPHQAERVLREIAPVIT-ADQLLLSICASITTRQLAEWSGDKA 109

Query: 135 RIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSG 194
            +IRAMPNTPC+I EGMTV S  T         +  +F  LGR  +++E  +D VTGLSG
Sbjct: 110 TVIRAMPNTPCLIGEGMTVFSAGTGVRPQHLEAAERIFGPLGRTAVVEESLMDGVTGLSG 169

Query: 195 SGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPG 254
            GPA+  +++E+L++ GV +GL RE              RMVL+ G HPA +KD VTTP 
Sbjct: 170 CGPAYVYLIIESLSEAGVKIGLSRETATLLAAQTLAGASRMVLERGVHPAALKDEVTTPA 229

Query: 255 GCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           GCTI GL+ +E+GK+R TL + +  AT+ + +L N
Sbjct: 230 GCTIDGLMALEEGKLRVTLIKGVLAATERSKSLRN 264



>gi|401842869|gb|EJT44893.1| PRO3-like protein [Saccharomyces kudriavzevii IFO 1802]
          Length = 286

 Score =  182 bits (462), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 112/291 (38%), Positives = 166/291 (57%), Gaps = 16/291 (5%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIK---EEFND 68
           TL +LGCG MG+A+LS I ++   A         P K I C   E SAQ++    E  ++
Sbjct: 4   TLAILGCGVMGQALLSAIYNAPKAAD-EATAAFYPSKIITCNHDEPSAQQVTDLVEALDE 62

Query: 69  -----KITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTI 123
                K+    G+NV  VKEA ++LL TKP + + +L  +G++  +E KL+IS+ AG TI
Sbjct: 63  SPNGIKVESTYGHNVSAVKEAAVVLLGTKPFLAEEVL--KGVEGVIEGKLLISLAAGWTI 120

Query: 124 DQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDE 183
           DQL ++   ++ + R M NTP     G  V+S   D SK+ +     + S +G+   L E
Sbjct: 121 DQLSQY---TSTVCRVMTNTPAKYGYGCAVVSYSADVSKEQKPLVKELISQVGKYVELPE 177

Query: 184 KHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHP 243
           K++DA T L GSGPAF  ++LE+L + G+ +G+P +              +MV K+G HP
Sbjct: 178 KNMDAATALVGSGPAFVLLMLESLMESGLKLGIPLQESKECAMKVXEGTVKMVEKSGAHP 237

Query: 244 AEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGNIQSKK 294
           + +K  V TPGG TIAGL  ME+  ++S +   ++EA +VAS LG  Q KK
Sbjct: 238 SVLKHQVCTPGGTTIAGLCVMEEKGVKSGIINGVEEAARVASQLG--QKKK 286



>gi|392376015|ref|YP_003207848.1| Pyrroline-5-carboxylate reductase (P5C reductase) (P5CR)
           [Candidatus Methylomirabilis oxyfera]
 gi|506225734|ref|WP_015745509.1| pyrroline-5-carboxylate reductase [Candidatus Methylomirabilis
           oxyfera]
 gi|258593708|emb|CBE70049.1| Pyrroline-5-carboxylate reductase (P5C reductase) (P5CR)
           [Candidatus Methylomirabilis oxyfera]
          Length = 271

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 106/279 (37%), Positives = 161/279 (57%), Gaps = 15/279 (5%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKIT 71
           T+  +G G M  A++ G+L         E   +   + IA    E   Q+I   +  + T
Sbjct: 6   TIGFIGAGNMAEAMIRGLL---------EAKLVTADQLIASDIVEAKRQQIHLRYGIR-T 55

Query: 72  LLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSL-ENKLIISILAGVTIDQLKEWA 130
           +  G +  G+K A I++L  KPQ ++  L  +G+  S+ E + IIS+ AG+TI  + E  
Sbjct: 56  VAEGRDA-GLK-ASILILAVKPQDMEAAL--QGIAASVDETRTIISVAAGITIAFIAERL 111

Query: 131 PSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVT 190
           P+ TRI+RAMPN P ++  G   ++     + +D   +  +F+ +G+A +++EKHLDAVT
Sbjct: 112 PARTRIVRAMPNAPALVLAGAAGIAKGEHATAEDLQIAEAIFAAVGKAVVVEEKHLDAVT 171

Query: 191 GLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSV 250
           GLSGSGPA+  + +EALAD GV +GL R+V             RMVL++G+HPAE+KD V
Sbjct: 172 GLSGSGPAYVFLFIEALADAGVKVGLTRDVAGLLAAQTVLGAARMVLESGRHPAELKDIV 231

Query: 251 TTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
            +PGG TIAGL  +E G +R TL   ++ AT  +  LG 
Sbjct: 232 ASPGGTTIAGLYALERGGLRGTLMEAVEAATIRSRELGR 270



>gi|302811797|ref|XP_002987587.1| hypothetical protein SELMODRAFT_235312 [Selaginella moellendorffii]
 gi|300144741|gb|EFJ11423.1| hypothetical protein SELMODRAFT_235312 [Selaginella moellendorffii]
          Length = 267

 Score =  182 bits (461), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 101/267 (37%), Positives = 149/267 (55%), Gaps = 15/267 (5%)

Query: 16  LGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITLLVG 75
           +G G M  AI  G+             +++P   +      E+ +R+ E+   K    V 
Sbjct: 8   VGAGAMAEAIARGL----------SRASIVPFSRMIAADVSEARRRVFEQLGVKT---VE 54

Query: 76  NNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPSSTR 135
           +N E    +D+I+L  KPQ+  +I+ ++   K  E  L++SI AGVT+D+L+EWA    R
Sbjct: 55  SNHEVASSSDVIILAVKPQIA-SIVVKDLKPKLTEEHLLVSIAAGVTLDRLQEWA-GEAR 112

Query: 136 IIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGS 195
           I+R MPNTPC++ E    +S     +  D      +F  +G+  I+DEK L+AVTG+SGS
Sbjct: 113 IVRVMPNTPCLVGETAAAMSLGLFATNKDADLVKSLFEAVGKIHIVDEKLLNAVTGVSGS 172

Query: 196 GPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGG 255
           GPA+  +V+EALADGGV  GLPR +             +MVL+TGKHP  +KD V +PGG
Sbjct: 173 GPAYIFLVIEALADGGVAAGLPRNIALSLAAQTVYGSAKMVLETGKHPGLLKDEVASPGG 232

Query: 256 CTIAGLLTMEDGKIRSTLARTIQEATQ 282
            TIAGL  +E G +R+     +  AT+
Sbjct: 233 TTIAGLHELEKGGVRAAFINAVVAATE 259



>gi|302811968|ref|XP_002987672.1| hypothetical protein SELMODRAFT_183368 [Selaginella moellendorffii]
 gi|300144564|gb|EFJ11247.1| hypothetical protein SELMODRAFT_183368 [Selaginella moellendorffii]
          Length = 267

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 101/267 (37%), Positives = 149/267 (55%), Gaps = 15/267 (5%)

Query: 16  LGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITLLVG 75
           +G G M  AI  G+             +++P   +      E+ +R+ E+   K    V 
Sbjct: 8   VGAGAMAEAIARGL----------SRASVVPFSRMIAADVSEARRRVFEQLGVKT---VE 54

Query: 76  NNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPSSTR 135
           +N E    +D+I+L  KPQ+  +I+ ++   K  E  L++SI AGVT+D+L+EWA    R
Sbjct: 55  SNHEVASSSDVIILAVKPQIA-SIVVKDLKPKLTEEHLLVSIAAGVTLDRLQEWA-GEAR 112

Query: 136 IIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGS 195
           I+R MPNTPC++ E    +S     +  D      +F  +G+  I+DEK L+AVTG+SGS
Sbjct: 113 IVRVMPNTPCLVGETAAAMSLGLFATNKDADLVKSLFEAVGKIHIVDEKLLNAVTGVSGS 172

Query: 196 GPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGG 255
           GPA+  +V+EALADGGV  GLPR +             +MVL+TGKHP  +KD V +PGG
Sbjct: 173 GPAYIFLVIEALADGGVAAGLPRNIALSLAAQTVYGSAKMVLETGKHPGLLKDEVASPGG 232

Query: 256 CTIAGLLTMEDGKIRSTLARTIQEATQ 282
            TIAGL  +E G +R+     +  AT+
Sbjct: 233 TTIAGLHELEKGGVRAAFINAVVAATE 259



>gi|398364353|ref|NP_010940.3| pyrroline-5-carboxylate reductase [Saccharomyces cerevisiae S288c]
 gi|417541|sp|P32263.1|P5CR_YEAST RecName: Full=Pyrroline-5-carboxylate reductase; Short=P5C
           reductase; Short=P5CR
 gi|172243|gb|AAA34905.1| pyrroline-5-carboxylate reductase [Saccharomyces cerevisiae]
 gi|432970|emb|CAA40614.1| deltal-pyrroline-5-carboxylate reductase [Saccharomyces cerevisiae]
 gi|603615|gb|AAB64556.1| Pro3p: delta 1-pyrroline-5-carboxylate reductase [Saccharomyces
           cerevisiae]
 gi|285811648|tpg|DAA07676.1| TPA: pyrroline-5-carboxylate reductase [Saccharomyces cerevisiae
           S288c]
 gi|349577681|dbj|GAA22849.1| K7_Pro3p [Saccharomyces cerevisiae Kyokai no. 7]
          Length = 286

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 110/291 (37%), Positives = 164/291 (56%), Gaps = 16/291 (5%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIK---EEFND 68
           TL +LGCG MG+A+LS I ++   A         P K I C   E SAQ++    E F++
Sbjct: 4   TLAILGCGVMGQALLSAIYNAPKAADET-AAAFYPSKIITCNHDEPSAQQVTDLVETFDE 62

Query: 69  -----KITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTI 123
                K+    G+NV  V+EA ++LL TKP + + +L   G++  +  KL+IS+ AG TI
Sbjct: 63  SPNGIKVESTYGHNVSAVEEASVVLLGTKPFLAEEVLN--GVKSVIGGKLLISLAAGWTI 120

Query: 124 DQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDE 183
           DQL ++   ++ + R M NTP     G  V+S   D SK+ +     + S +G+   L E
Sbjct: 121 DQLSQY---TSTVCRVMTNTPAKYGYGCAVVSYSADVSKEQKPLVNELISQVGKYVELPE 177

Query: 184 KHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHP 243
           K++DA T L GSGPAF  ++LE+L + G+ +G+P +              +MV K+G HP
Sbjct: 178 KNMDAATALVGSGPAFVLLMLESLMESGLKLGIPLQESKECAMKVLEGTVKMVEKSGAHP 237

Query: 244 AEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGNIQSKK 294
           + +K  V TPGG TIAGL  ME+  ++S +   ++EA +VAS LG  Q KK
Sbjct: 238 SVLKHQVCTPGGTTIAGLCVMEEKGVKSGIINGVEEAARVASQLG--QKKK 286



>gi|401626076|gb|EJS44041.1| pro3p [Saccharomyces arboricola H-6]
          Length = 286

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 164/291 (56%), Gaps = 16/291 (5%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIK---EEFND 68
           TL +LGCG MG+A+LS I ++   A         P K I C   E SAQ++    E F++
Sbjct: 4   TLAILGCGVMGQALLSAIYNAPK-ATDESTAAFYPSKIITCNHDEPSAQQVTDLVETFDE 62

Query: 69  -----KITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTI 123
                K+    G+NV  VKEA ++LL TKP + + +L   G++  +E KL+IS+ AG TI
Sbjct: 63  SPNGIKVDSTYGHNVSAVKEATVVLLGTKPFLAEEVLN--GVKSVIEGKLLISLAAGWTI 120

Query: 124 DQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDE 183
            QL ++   ++ + R M NTP     G  V+S   D SK+ +     + S +G+   L E
Sbjct: 121 GQLSQY---TSTVCRVMTNTPAKYGYGCAVVSYSADVSKEQKPLVNELISQVGKYVELPE 177

Query: 184 KHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHP 243
           K++DA T L GSGPAF  ++LE+L + G+ +G+P +              +MV K+G HP
Sbjct: 178 KNMDAATALVGSGPAFVLLMLESLMESGLKLGIPLQESKECAMKVLEGTVKMVEKSGAHP 237

Query: 244 AEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGNIQSKK 294
           + +K  V TPGG TIAGL  ME+  ++S +   ++EA +VAS LG  Q KK
Sbjct: 238 SVLKHQVCTPGGTTIAGLCVMEEKGVKSGIINGVEEAARVASQLG--QKKK 286



>gi|254573436|ref|XP_002493827.1| Delta 1-pyrroline-5-carboxylate reductase, catalyzes the last step
           in proline biosynthesis [Komagataella pastoris GS115]
 gi|238033626|emb|CAY71648.1| Delta 1-pyrroline-5-carboxylate reductase, catalyzes the last step
           in proline biosynthesis [Komagataella pastoris GS115]
 gi|328354351|emb|CCA40748.1| pyrroline-5-carboxylate reductase [Komagataella pastoris CBS 7435]
          Length = 274

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 108/286 (37%), Positives = 166/286 (58%), Gaps = 17/286 (5%)

Query: 6   SLPTNPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEE 65
           S+    T+ +LGCG MG A+LS IL+S   +P        P + I C   ++SA+++   
Sbjct: 3   SIGNEYTITILGCGVMGTAVLSAILNS-EFSP-------YPSRIICCTGSQKSAEKLAST 54

Query: 66  FNDKITLLVGN--NVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTI 123
           ++ KI    G+  N+  VKE+DII+L  KP   + I+  E +++ L ++L+IS+LAG T+
Sbjct: 55  YS-KIETSYGSEQNIRAVKESDIIILGCKPFYCEQIM--EQVKEGLHDQLLISLLAGWTL 111

Query: 124 DQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDE 183
            QL+ +   S  + R M NTP     GM  +S  +   + +    + +   +G+A  L E
Sbjct: 112 TQLERY---SKYVARVMTNTPAKFGCGMACVSLSSHAEQYE-DLVLKLVGPVGKAIRLPE 167

Query: 184 KHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHP 243
           K++DA T L GSGPAF  +++E+L DG V  GLP  +             RMVL+TG+HP
Sbjct: 168 KNMDAATALVGSGPAFCLLMMESLIDGAVQKGLPFAIAKDAAAKVMEGTARMVLETGEHP 227

Query: 244 AEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           A +K +V TPGG TI GL+ MED  +RS +AR ++EA  +A++LG 
Sbjct: 228 AALKSAVCTPGGTTIGGLMAMEDRGVRSGIARGVEEAANIATSLGK 273



>gi|291279671|ref|YP_003496506.1| pyrroline-5-carboxylate reductase [Deferribacter desulfuricans
           SSM1]
 gi|502773013|ref|WP_013007997.1| pyrroline-5-carboxylate reductase [Deferribacter desulfuricans]
 gi|290754373|dbj|BAI80750.1| pyrroline-5-carboxylate reductase [Deferribacter desulfuricans
           SSM1]
          Length = 275

 Score =  181 bits (459), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 105/286 (36%), Positives = 158/286 (55%), Gaps = 14/286 (4%)

Query: 9   TNPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFND 68
           T   +  +G G M  A++ GIL S  ++  +   + I           E    ++ EF  
Sbjct: 3   TGKKIGFIGSGNMATALIKGILKSGLISAEDIYTSDINI---------EKLDSLRNEFG- 52

Query: 69  KITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKE 128
            I  +  +N + V++ DII+   KPQ+   IL E       ++KL+ISI AG++ D ++ 
Sbjct: 53  -INTIFKDNAKLVEKVDIIVFSIKPQIFDKILKEIDHVVD-DSKLLISIAAGISTDYIET 110

Query: 129 WAPSSTRIIRAMPNTPCMIREGMTVLSCP-TDCSKDDRSFSIWVFSTLGRARILDEKHLD 187
                 R+IRAMPNTP ++ EG T + CP    S+DD   +  +F  +G+  ++DE  +D
Sbjct: 111 TIGKELRVIRAMPNTPALVLEGATAI-CPGAHASEDDIRMAYEIFKAVGKVVVIDETQMD 169

Query: 188 AVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIK 247
           AVTGLSGSGPA+  +++EAL+D GV MGL REV             +++L+TG HP  +K
Sbjct: 170 AVTGLSGSGPAYIFMIIEALSDAGVKMGLSREVSLKLSAQTVLGSAKLLLETGMHPGRLK 229

Query: 248 DSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGNIQSK 293
           D VT+PGG  IAGL T+E G +R+TL   ++ AT  +  LG    K
Sbjct: 230 DMVTSPGGTAIAGLHTLEQGGLRTTLINAVESATNRSKELGRKNGK 275



>gi|448103539|ref|XP_004200060.1| Piso0_002622 [Millerozyma farinosa CBS 7064]
 gi|359381482|emb|CCE81941.1| Piso0_002622 [Millerozyma farinosa CBS 7064]
          Length = 273

 Score =  181 bits (458), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 102/280 (36%), Positives = 161/280 (57%), Gaps = 15/280 (5%)

Query: 10  NPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDK 69
           N T+ VLGCG MG A++S IL S       EP    P K I C + E S+ +++ +  DK
Sbjct: 3   NYTITVLGCGVMGTAVISAILRS-----KAEP---FPSKIICCTNTESSSVKLRSKLGDK 54

Query: 70  ITLLVG--NNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLK 127
           +    G  NN + V EA++I+L  KP + ++I   EG++   +++L+IS+LAGVTI++L+
Sbjct: 55  VEYSFGPENNKKAVSEANVIILGCKPYMFQSIY--EGVKDVCKDQLVISLLAGVTIEELQ 112

Query: 128 EWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLD 187
             +P    + + M NTP     GM  ++   +         + + + +G+A  L EK++D
Sbjct: 113 VMSP---YVAKVMTNTPAQFGCGMAGIAFSPEAESKYSELVMQLINPIGKAIKLPEKNMD 169

Query: 188 AVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIK 247
           A T L GSGPAF  + LE+L DG V MG+P ++             +MV +T +HPA +K
Sbjct: 170 AATSLIGSGPAFCLLFLESLIDGAVRMGIPYDIAKESAAKVMEGTAKMVEETNEHPAVLK 229

Query: 248 DSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
             + TPGG TI GLL MED  +R  +AR ++EA +++++ 
Sbjct: 230 SKICTPGGTTIGGLLKMEDAGVRGGVARGVEEAAKISASF 269



>gi|225872876|ref|YP_002754333.1| pyrroline-5-carboxylate reductase [Acidobacterium capsulatum ATCC
           51196]
 gi|506376666|ref|WP_015896385.1| pyrroline-5-carboxylate reductase [Acidobacterium capsulatum]
 gi|225792660|gb|ACO32750.1| pyrroline-5-carboxylate reductase [Acidobacterium capsulatum ATCC
           51196]
          Length = 280

 Score =  181 bits (458), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 105/291 (36%), Positives = 166/291 (57%), Gaps = 22/291 (7%)

Query: 5   MSLPTNPTL-------CVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEE 57
           M++PT+ ++        VLG G MG  +L   L   N+        L P + +A V+ E+
Sbjct: 1   MTIPTSSSISVAQARVAVLGAGKMGGILLQAFLKQ-NI--------LRPDQIVATVAHED 51

Query: 58  SAQRIKEEFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLE-NKLIIS 116
            A  +  ++  ++T    +N+   K+A++ILL  KP  +  ++ E  ++ +L+  KL++S
Sbjct: 52  RALALSAQWGVEVTT---DNLAAAKQANVILLGVKPFQIAGLMEE--IRPALDGTKLLVS 106

Query: 117 ILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLG 176
             A V    ++E A  +  +IR MPNTP M+  G++ L    +   +    +  +F  +G
Sbjct: 107 FAASVKTAAIEEAAGMALPVIRTMPNTPSMLGAGISALCSGKNVLPEHLQLASALFEAVG 166

Query: 177 RARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMV 236
           R  ++DEKH+DAVTGLS SGPA+  ++LEALA+ GV +GLPR++             +MV
Sbjct: 167 RTVVVDEKHMDAVTGLSASGPAYIYIILEALAEAGVKVGLPRDIATLLAAQTTLGAAKMV 226

Query: 237 LKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
           L TG HPA +KD+VTTP GCTI G+L +E+G +R TL + +  ATQ A  L
Sbjct: 227 LDTGYHPALLKDAVTTPAGCTIDGILELEEGGLRVTLIKAVMRATQRAREL 277



>gi|497645099|ref|WP_009959283.1| pyrroline-5-carboxylate reductase [Verrucomicrobium spinosum]
          Length = 317

 Score =  180 bits (457), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 103/281 (36%), Positives = 159/281 (56%), Gaps = 13/281 (4%)

Query: 7   LPTNPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEF 66
           +P+   + ++GCG MG A+L G   +L    A     ++  K  A V+   + Q +  E 
Sbjct: 47  MPSQMKIGLIGCGKMGGALLRG---ALKAGLAEARGVILYDKVPAAVA---ALQEVSAEV 100

Query: 67  NDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQL 126
                 +  +  E  + AD+++L  KPQ +K +L  EG+ +S    L +SI AG+T+ QL
Sbjct: 101 Q-----VAQSPTEVAENADVVILAVKPQDMKPLL--EGLSQSDSAPLYLSIAAGLTLAQL 153

Query: 127 KEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHL 186
           + W     R++R+MPNTP ++  G +  S     + +D + +  V   +G A+ + E  L
Sbjct: 154 EGWLGGKARVVRSMPNTPALLLAGASAYSRGAQATDEDLALAKAVLGAVGSAQEVPENLL 213

Query: 187 DAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEI 246
           DAVTGLSGSGPA+   V+EALADGGV+MGLPR               +MVL+TGKHP  +
Sbjct: 214 DAVTGLSGSGPAYVYTVIEALADGGVLMGLPRATALQLAAQTVAGAAQMVLETGKHPGVL 273

Query: 247 KDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
           +D VT+PGG TIAGL  +E   +R+ L + +++AT+ +  L
Sbjct: 274 RDEVTSPGGTTIAGLEQLEAQGLRNALIQAVRKATERSKEL 314



>gi|50290353|ref|XP_447608.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49526918|emb|CAG60545.1| unnamed protein product [Candida glabrata]
          Length = 283

 Score =  180 bits (457), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 108/286 (37%), Positives = 160/286 (55%), Gaps = 15/286 (5%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFND--- 68
           TL +LGCG MG+A+LS I  +       +   L P K I C   E SAQ++ +  +    
Sbjct: 4   TLTILGCGVMGQAVLSAIYKAPKATSVIK--ALYPSKIITCNHDEPSAQQVTDLISTFET 61

Query: 69  -----KITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTI 123
                ++    G NVE VK++D+I+L TKP + + +L   G++     KLIIS+ AG TI
Sbjct: 62  SPNGIEVVSTYGKNVEAVKQSDVIILGTKPFLAEQVLN--GVKDVTSGKLIISLAAGWTI 119

Query: 124 DQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDE 183
            QL+ + PS +R+   M NTP     G  V+S     ++D +S    + S +G+   L E
Sbjct: 120 GQLQAYTPSVSRV---MTNTPAKYGYGCAVVSHSPQVTEDQKSLVSELISHVGKYVELPE 176

Query: 184 KHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHP 243
           K++DA T L GSGPAF  +VLE+L + G+ MG+P +              +MV ++G HP
Sbjct: 177 KNMDAATALVGSGPAFVLLVLESLMESGIKMGIPLKESTECALKVLEGTAKMVEESGVHP 236

Query: 244 AEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           + +K  V TPGG TIAGL  MED  ++S + R ++EA +VA+ LG 
Sbjct: 237 SVLKHQVCTPGGTTIAGLCVMEDKGVKSGIIRGVEEAARVAAELGK 282



>gi|470477115|ref|XP_004342330.1| pyrroline5-carboxylate reductase [Acanthamoeba castellanii str.
           Neff]
 gi|440799159|gb|ELR20220.1| pyrroline5-carboxylate reductase [Acanthamoeba castellanii str.
           Neff]
          Length = 274

 Score =  180 bits (457), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 100/274 (36%), Positives = 154/274 (56%), Gaps = 10/274 (3%)

Query: 9   TNPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFND 68
           + P +  LG G M  A+  G +D+ NV          P+  IA  + E    R +++   
Sbjct: 2   SEPRIAFLGAGQMATALARGFIDA-NVTR--------PENIIASDAYEPQLPRFQKDTGG 52

Query: 69  KITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKE 128
             T    +N+E V+ +D+++L  KPQV+ T+L E     +    LIISI AG+TID + +
Sbjct: 53  S-TKTTKSNLEAVENSDVVILSVKPQVMSTLLKEIKDAVASSPHLIISIAAGITIDTITK 111

Query: 129 WAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDA 188
              S TR++R MPNTPC++ +     S     + +D      + S++G    + E+ LDA
Sbjct: 112 QLGSDTRVVRVMPNTPCLVGKTAAAFSLGGKATPEDGKLVAHLLSSVGLGTEVPERLLDA 171

Query: 189 VTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKD 248
           VTGLSGSGPA+    +EAL+DGGV  GLPR+V             +MV++TG+HP  +KD
Sbjct: 172 VTGLSGSGPAYVYQFIEALSDGGVAAGLPRDVAAKLAAQTVLGAAQMVVQTGEHPGVLKD 231

Query: 249 SVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQ 282
            V +PGG TIAG+  +E+G++R+T+   +  AT+
Sbjct: 232 KVASPGGTTIAGIHALENGRLRATVMNAVLAATE 265



>gi|45185399|ref|NP_983116.1| ABR168Wp [Ashbya gossypii ATCC 10895]
 gi|44981088|gb|AAS50940.1| ABR168Wp [Ashbya gossypii ATCC 10895]
 gi|374106320|gb|AEY95230.1| FABR168Wp [Ashbya gossypii FDAG1]
          Length = 283

 Score =  180 bits (457), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 106/287 (36%), Positives = 162/287 (56%), Gaps = 19/287 (6%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPA--NEPPTLIPKKFIACVSGEESAQRIKEEFND- 68
           TL +LGCG MG+A+LS I +    AP   +E   + P + I C +  +SA+++ E     
Sbjct: 4   TLTILGCGVMGQAVLSAIYN----APKADDESRAMYPSRIITCNNNAQSAKQVTELVRGF 59

Query: 69  -------KITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGV 121
                  ++    G+N + V EA +++L TKP +V+ +L +  ++  + +KL+IS+ AG 
Sbjct: 60  GTSPNGIEVESTSGDNAKAVAEARVVVLGTKPYLVEEVLQD--VRTQVADKLLISLAAGW 117

Query: 122 TIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARIL 181
           T+DQL ++   + R+ R M NTP     G   +S   D + D+R+    +   LG    L
Sbjct: 118 TLDQLVDY---TARVARVMTNTPAKYGYGAAAVSHSPDVTADERALVSRLVGHLGLCVEL 174

Query: 182 DEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGK 241
            EK++DA T L GSGPAFA ++LE++ + GV +G+P +V             RM  +TG 
Sbjct: 175 PEKNMDAATALIGSGPAFALLMLESMMEAGVKLGIPLDVSRRCAAKVLEGTARMAEETGS 234

Query: 242 HPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLG 288
           HPA +K  V TPGG TIAGL  MED  +RS + + I+EA  VA+ LG
Sbjct: 235 HPAALKHQVCTPGGTTIAGLCVMEDSGVRSGIVKGIEEAANVAARLG 281



>gi|15241505|ref|NP_196984.1| Pyrroline-5-carboxylate reductase [Arabidopsis thaliana]
 gi|1709786|sp|P54904.1|P5CR1_ARATH RecName: Full=Pyrroline-5-carboxylate reductase; Short=P5C
           reductase; Short=P5CR; AltName: Full=Protein EMBRYO
           DEFECTIVE 2772
 gi|15294224|gb|AAK95289.1|AF410303_1 AT5g14800/T9L3_100 [Arabidopsis thaliana]
 gi|166815|gb|AAA61346.1| pyrroline carboxylate reductase [Arabidopsis thaliana]
 gi|1632776|emb|CAA70148.1| T5r protein [Arabidopsis thaliana]
 gi|9755748|emb|CAC01879.1| pyrroline-5-carboxylate reductase [Arabidopsis thaliana]
 gi|20453291|gb|AAM19884.1| AT5g14800/T9L3_100 [Arabidopsis thaliana]
 gi|21593123|gb|AAM65072.1| pyrroline-5-carboxylate reductase [Arabidopsis thaliana]
 gi|332004695|gb|AED92078.1| Pyrroline-5-carboxylate reductase [Arabidopsis thaliana]
          Length = 276

 Score =  180 bits (456), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 101/267 (37%), Positives = 148/267 (55%), Gaps = 14/267 (5%)

Query: 16  LGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITLLVG 75
           +G G M  +I  G++ S           L P +    V    + + + E F   +     
Sbjct: 16  IGAGKMAESIARGVVAS---------GVLPPNRICTAVHSNLNRRDVFESFGVNV---FS 63

Query: 76  NNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPSSTR 135
            + E VKE+D+++   KPQVVK  +TE   + S +NK+++S+ AG+ ++ L+EW+    R
Sbjct: 64  TSEEVVKESDVVIFSVKPQVVKKAVTELKSKLS-KNKILVSVAAGIKLNDLQEWS-GQDR 121

Query: 136 IIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGS 195
            IR MPNTP  + E  +V+S  T  +++D +    +F  +G+    DEK  DAVTGLSGS
Sbjct: 122 FIRVMPNTPAAVGEAASVMSLGTGATEEDGAIVAMLFGAVGKILKADEKMFDAVTGLSGS 181

Query: 196 GPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGG 255
           GPA+  + +EALADGGV  GLPRE+              MV KTGKHP  +KD VT+PGG
Sbjct: 182 GPAYIFLAIEALADGGVAAGLPRELALSLASQTVLGAATMVSKTGKHPGVLKDDVTSPGG 241

Query: 256 CTIAGLLTMEDGKIRSTLARTIQEATQ 282
            TIAG+  +E G  R+TL   +  A +
Sbjct: 242 TTIAGVHELEKGSFRATLMNAVVAAAK 268



>gi|336268852|ref|XP_003349188.1| hypothetical protein SMAC_08891 [Sordaria macrospora k-hell]
 gi|380087350|emb|CCC05397.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 331

 Score =  179 bits (455), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 119/310 (38%), Positives = 165/310 (53%), Gaps = 33/310 (10%)

Query: 12  TLCVLGCGTMGRAILSGILDSLN-----VAPANEPPTLIPKKFIACVSGEESAQRIKEEF 66
           T+ VLGCGTMG AILSGIL SL       +     P  +P+ FIA V  + S  +++   
Sbjct: 13  TMAVLGCGTMGIAILSGILTSLTSLASSPSDPPTSPPALPRHFIATVRSQSSIVKVESAL 72

Query: 67  NDKI--------TLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSL--------- 109
           +  +         L   +NV  V EADIILL  KP +V  +L+  GM+ +L         
Sbjct: 73  SPLVKPNVSTLRVLQSTSNVSAVAEADIILLGCKPYMVSGLLSASGMKDALTVNHQEGHV 132

Query: 110 -ENKLIISILAGVTIDQLKEWAPSSTR--------IIRAMPNTPCMIREGMTVLSCPTDC 160
            + K+IISI AGVT+ Q+++               ++RAMPNT   IRE MTV++     
Sbjct: 133 RKQKIIISICAGVTVPQIEQILREDVGMEGNDLPIVVRAMPNTASKIRESMTVINTVEPP 192

Query: 161 SKDDRS-FSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPRE 219
             D  +    W+F  +G    L    +DA T L  SG AF  +V+EA ADGGV MG+PR 
Sbjct: 193 LPDSVTELLTWIFEQIGEVAFLPPSLMDACTSLCASGTAFFALVMEAAADGGVAMGIPRA 252

Query: 220 VXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQE 279
                          +VL  G+HPA +++ V+TPGGCTI GLL +ED  +R  +A+ ++E
Sbjct: 253 EATKMAAQTMRGAAGLVLD-GEHPAILREKVSTPGGCTIGGLLVLEDEGVRGAVAKAVRE 311

Query: 280 ATQVASTLGN 289
           AT VAS LG+
Sbjct: 312 ATVVASLLGS 321



>gi|384253054|gb|EIE26529.1| pyrroline-5-carboxylate reductase [Coccomyxa subellipsoidea C-169]
          Length = 273

 Score =  179 bits (455), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 108/276 (39%), Positives = 154/276 (55%), Gaps = 16/276 (5%)

Query: 16  LGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITLLVG 75
           +G G M  A+  G +    V    E  ++I    +A      + + + E F+ K    V 
Sbjct: 13  IGAGQMAEALARGFISKGVV----EASSMIATDPVA------ARREVFESFDVKA---VS 59

Query: 76  NNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENK-LIISILAGVTIDQLKEWAPSST 134
            N+E VKE+DI+ +  KPQ V  +L E  ++  L +K  I+SI AG T+  LKE A    
Sbjct: 60  TNLEVVKESDIVFVAVKPQYVGPVLKE--VRGHLTDKHTIVSIAAGKTLSSLKEAAGDDV 117

Query: 135 RIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSG 194
           RI+R MPNTPC++ E  + +      + +D      +FS +GR   +DEK L AVTGLSG
Sbjct: 118 RIVRVMPNTPCLVGETASAMCLGGQANDEDAETVRTLFSAVGRIVQVDEKMLSAVTGLSG 177

Query: 195 SGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPG 254
           SGPA+A +V+EALADGGV  GLPR++             +MVL+TGKHP  +KD VT+PG
Sbjct: 178 SGPAYAFLVIEALADGGVKAGLPRDISMALAAQTVLGSAKMVLETGKHPGLLKDMVTSPG 237

Query: 255 GCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGNI 290
           G TIAG   +E G +R++L   +  AT  A  +  +
Sbjct: 238 GTTIAGYHELEKGGVRASLINAVVAATNRADEISKL 273



>gi|448099696|ref|XP_004199207.1| Piso0_002622 [Millerozyma farinosa CBS 7064]
 gi|359380629|emb|CCE82870.1| Piso0_002622 [Millerozyma farinosa CBS 7064]
          Length = 273

 Score =  179 bits (454), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 101/280 (36%), Positives = 161/280 (57%), Gaps = 15/280 (5%)

Query: 10  NPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDK 69
           N T+ VLGCG MG A++S I+ S  V P        P K I C + E S+ +++ +  DK
Sbjct: 3   NYTITVLGCGVMGTAVISAIIRS-KVEP-------FPSKIICCSNTESSSVKLRSKLGDK 54

Query: 70  ITLLVG--NNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLK 127
           +    G  NN + V EA++I+L  KP + ++I   EG++   +++L+IS+LAGVTI++L+
Sbjct: 55  VEYSFGPENNKKAVSEANVIILGCKPYMFQSIY--EGVKDVCKDQLVISLLAGVTIEELQ 112

Query: 128 EWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLD 187
             +P    + + M NTP     GM  ++   +         + + + +G+A  L EK++D
Sbjct: 113 VMSP---YVAKVMTNTPAQFGCGMAGIAFSPEAESKYSELVMQLINPIGKAIKLPEKNMD 169

Query: 188 AVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIK 247
           A T L GSGPAF  + LE+L DG V MG+P ++             +MV +T +HPA +K
Sbjct: 170 AATSLIGSGPAFCLLFLESLIDGAVRMGIPYDIAKESAAKVMEGTAKMVEETNEHPAVLK 229

Query: 248 DSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
             + TPGG TI GLL MED  +R  +AR ++EA +++++ 
Sbjct: 230 SKICTPGGTTIGGLLKMEDAGVRGGVARGVEEAAKISASF 269



>gi|151944733|gb|EDN62992.1| delta 1-pyrroline-5-carboxylate reductase [Saccharomyces cerevisiae
           YJM789]
 gi|190405585|gb|EDV08852.1| delta 1-pyrroline-5-carboxylate reductase [Saccharomyces cerevisiae
           RM11-1a]
 gi|256270780|gb|EEU05936.1| Pro3p [Saccharomyces cerevisiae JAY291]
 gi|259145930|emb|CAY79190.1| Pro3p [Saccharomyces cerevisiae EC1118]
 gi|323333911|gb|EGA75300.1| Pro3p [Saccharomyces cerevisiae AWRI796]
 gi|392299971|gb|EIW11063.1| Pro3p [Saccharomyces cerevisiae CEN.PK113-7D]
          Length = 286

 Score =  179 bits (454), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 109/291 (37%), Positives = 163/291 (56%), Gaps = 16/291 (5%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIK---EEFND 68
           TL +LGCG MG+A+LS I ++   A         P K I C   E SA ++    E F++
Sbjct: 4   TLAILGCGVMGQALLSAIYNAPKAADET-AAAFYPSKIITCNHDEPSAHQVTDLVETFDE 62

Query: 69  -----KITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTI 123
                K+    G+NV  V+EA ++LL TKP + + +L   G++  +  KL+IS+ AG TI
Sbjct: 63  SPNGIKVESTYGHNVSAVEEASVVLLGTKPFLAEEVLN--GVKSVIGGKLLISLAAGWTI 120

Query: 124 DQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDE 183
           DQL ++   ++ + R M NTP     G  V+S   D SK+ +     + S +G+   L E
Sbjct: 121 DQLSQY---TSTVCRVMTNTPAKYGYGCAVVSYSADVSKEQKPLVNELISQVGKYVELPE 177

Query: 184 KHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHP 243
           K++DA T L GSGPAF  ++LE+L + G+ +G+P +              +MV K+G HP
Sbjct: 178 KNMDAATALVGSGPAFVLLMLESLMESGLKLGIPLQESKECAMKVLEGTVKMVEKSGAHP 237

Query: 244 AEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGNIQSKK 294
           + +K  V TPGG TIAGL  ME+  ++S +   ++EA +VAS LG  Q KK
Sbjct: 238 SVLKHQVCTPGGTTIAGLCVMEEKGVKSGIINGVEEAARVASQLG--QKKK 286



>gi|482557125|gb|EOA21317.1| hypothetical protein CARUB_v10001677mg [Capsella rubella]
          Length = 276

 Score =  179 bits (454), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 101/267 (37%), Positives = 147/267 (55%), Gaps = 14/267 (5%)

Query: 16  LGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITLLVG 75
           +G G M  +I  G++ S           L P +    V    + + + E F   +     
Sbjct: 16  IGAGKMAESIARGVVAS---------GVLPPNRISTAVHSNLNRRDVFESFGVNV---FS 63

Query: 76  NNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPSSTR 135
           N+ + VKE+D+++   KPQVVK  +TE    K  +NK+++S+ AG+ +  L+EW+    R
Sbjct: 64  NSEDVVKESDVVIFSVKPQVVKKAVTEL-RSKLSKNKILVSVAAGIKLQDLQEWS-GQDR 121

Query: 136 IIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGS 195
            IR MPNTP  + E  +V+S  T  +++D +    +F  +G+    DEK  DAVTGLSGS
Sbjct: 122 FIRVMPNTPAAVGEAASVMSLGTGATEEDGAIVSKLFGAVGKILKADEKMFDAVTGLSGS 181

Query: 196 GPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGG 255
           GPA+  + +EALADGGV  GLPRE+              MV KTGKHP  +KD VT+PGG
Sbjct: 182 GPAYIFLAIEALADGGVAAGLPRELALGLASQTVLGAATMVSKTGKHPGVLKDDVTSPGG 241

Query: 256 CTIAGLLTMEDGKIRSTLARTIQEATQ 282
            TIAG+  +E G  R+TL   +  A +
Sbjct: 242 TTIAGVHELEKGSFRATLMNAVVAAAK 268



>gi|443731335|gb|ELU16504.1| hypothetical protein CAPTEDRAFT_166551 [Capitella teleta]
          Length = 276

 Score =  179 bits (454), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 101/279 (36%), Positives = 159/279 (56%), Gaps = 14/279 (5%)

Query: 16  LGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITLLVG 75
           LG G M +A+ SGI+ S  V P N          +     + +  +I  +   + T    
Sbjct: 12  LGAGQMAQALCSGIISSGLVKPNN----------VIASDPKPATLQITSKLGARTTT--- 58

Query: 76  NNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPSSTR 135
           NN E ++  D++++  KP  V  +L +E +    +N L+ SI AG+++  L+E  P +TR
Sbjct: 59  NNAEVMQNCDVVVISVKPNAVPGVL-KEILPLVTKNHLVTSIAAGISLALLEESLPPNTR 117

Query: 136 IIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGS 195
           +IR MPNTP M++ G TV+S  T  + +D   +  +FS +G  + L EK+LD V+ LSG+
Sbjct: 118 VIRVMPNTPAMVQAGATVISPGTHSTPEDAVLAEKIFSAVGICKNLPEKYLDVVSSLSGA 177

Query: 196 GPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGG 255
           GPA+A + +EAL+DGGV MGLPR++             +MVL+T  HP ++KD+V +PGG
Sbjct: 178 GPAYAFLAIEALSDGGVKMGLPRDISTQLAAQTLLGAAKMVLETNTHPGQLKDAVCSPGG 237

Query: 256 CTIAGLLTMEDGKIRSTLARTIQEATQVASTLGNIQSKK 294
            TI G+  +E G+ R++L   ++ AT     + N  SKK
Sbjct: 238 VTICGVHALESGRFRASLIDAVETATLRTREMENQMSKK 276



>gi|513030597|gb|AGO10622.1| AaceriABR168Wp [Saccharomycetaceae sp. 'Ashbya aceri']
          Length = 283

 Score =  179 bits (454), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 105/287 (36%), Positives = 161/287 (56%), Gaps = 19/287 (6%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPA--NEPPTLIPKKFIACVSGEESAQRIKEEFND- 68
           TL +LGCG MG+A+LS I +    AP   +E   + P + I C    ++A+++ E     
Sbjct: 4   TLTILGCGVMGQAVLSAIYN----APKADDESREMYPSRIITCNHSAQAAKQVTELVRGF 59

Query: 69  -------KITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGV 121
                  ++    G+N + V EA +++L TKP +V+ +L  +G++  + +KL+IS+ AG 
Sbjct: 60  GASPNGIEVQSTSGDNAKAVAEARVVVLGTKPYLVEEVL--QGVRAEVADKLLISLAAGW 117

Query: 122 TIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARIL 181
           T+ QL ++   + R+ R M NTP     G   +S   D + D+R+    +   LG    L
Sbjct: 118 TLGQLVDY---TARVARVMTNTPAKYGYGAAAVSHSADVTADERALVSRLVGHLGLCVEL 174

Query: 182 DEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGK 241
            EK++DA T L GSGPAFA ++LE++ + GV +G+P +V             RM  +TG 
Sbjct: 175 PEKNMDAATALIGSGPAFALLMLESMMEAGVKLGIPLDVSRRCAAKVLEGTARMAEETGS 234

Query: 242 HPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLG 288
           HPA +K  V TPGG TIAGL  MED  +RS + + I+EA  VA+ LG
Sbjct: 235 HPAALKHQVCTPGGTTIAGLCVMEDSGVRSGIVKGIEEAANVAARLG 281



>gi|312283283|dbj|BAJ34507.1| unnamed protein product [Thellungiella halophila]
          Length = 276

 Score =  179 bits (453), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 101/267 (37%), Positives = 149/267 (55%), Gaps = 14/267 (5%)

Query: 16  LGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITLLVG 75
           +G G M  +I  G++ S           L P +    V    + +++ E F   +     
Sbjct: 16  IGAGKMAESIARGVVAS---------GMLPPHRISTAVHSNLNRRQVFESFGVNV---FS 63

Query: 76  NNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPSSTR 135
           ++ E VKE+D+++   KPQVVK  +TE   + S ++KL++S+ AG+ +  L+EW+    R
Sbjct: 64  SSEEVVKESDVVIFSVKPQVVKKAVTELRTKLS-KDKLLVSVAAGIKLKDLQEWS-GQDR 121

Query: 136 IIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGS 195
            IR MPNTP  + E  +V+S  T  +++D +    +F ++G+    DEK  DAVTGLSGS
Sbjct: 122 FIRVMPNTPAAVGEAASVMSLGTAATEEDGALVAKLFGSVGKILRADEKMFDAVTGLSGS 181

Query: 196 GPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGG 255
           GPA+  + +EALADGGV  GLPRE+              MV KTGKHP  +KD VT+PGG
Sbjct: 182 GPAYIFLAIEALADGGVAAGLPRELALGLASQTVLGAATMVSKTGKHPGVLKDDVTSPGG 241

Query: 256 CTIAGLLTMEDGKIRSTLARTIQEATQ 282
            TIAG+  +E G  R+TL   +  A  
Sbjct: 242 TTIAGVHELEKGSFRATLMNAVVAAAN 268



>gi|312144184|ref|YP_003995630.1| pyrroline-5-carboxylate reductase [Halanaerobium hydrogeniformans]
 gi|503171686|ref|WP_013406347.1| pyrroline-5-carboxylate reductase [Halanaerobium hydrogeniformans]
 gi|311904835|gb|ADQ15276.1| pyrroline-5-carboxylate reductase [Halanaerobium hydrogeniformans]
          Length = 267

 Score =  179 bits (453), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 99/276 (35%), Positives = 156/276 (56%), Gaps = 12/276 (4%)

Query: 13  LCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITL 72
           L ++G G MG+ IL GIL + N+  A E      K      S       +K ++      
Sbjct: 3   LAIIGLGNMGQTILDGILKN-NILVAEEIAAADKKFAADDFS-------LKNKYPG--LY 52

Query: 73  LVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPS 132
               N E V +AD ++L  KPQ+   +L+E  ++   ++K IISI AG+    ++E  P+
Sbjct: 53  FTAENKEAVLKADYVILAVKPQIFSKVLSE--IKTICDDKTIISIAAGIKRAFIEEQVPN 110

Query: 133 STRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGL 192
           +T ++R MPNTP ++ EGM+ LS     ++ +++F   +F + G+   ++E+ +DAVT L
Sbjct: 111 NTGVVRVMPNTPALVGEGMSALSFSKKLAEKEKTFVKSIFKSFGKIIEIEEEQMDAVTAL 170

Query: 193 SGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTT 252
           SGSGPAF  + +EAL+D GV+ GL RE               M+L++ KHPAE+KD VT+
Sbjct: 171 SGSGPAFVYLFIEALSDAGVLNGLDREKALKLAAQTVKGGAEMILQSKKHPAELKDMVTS 230

Query: 253 PGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLG 288
           PGG TIAGL ++E+   RS + + +  A + +  LG
Sbjct: 231 PGGTTIAGLASLEESAFRSAVIKAVSAAAKRSEELG 266



>gi|297811617|ref|XP_002873692.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gi|297319529|gb|EFH49951.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
          Length = 276

 Score =  177 bits (449), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 101/267 (37%), Positives = 149/267 (55%), Gaps = 14/267 (5%)

Query: 16  LGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITLLVG 75
           +G G M  +I  G++ S  V P        P +    V    + + + E F   +     
Sbjct: 16  IGAGKMAESIARGVVAS-GVLP--------PNRISTAVHSNLNRRDVFESFGVNV---FS 63

Query: 76  NNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPSSTR 135
            + E VKE+D+++   KPQVVK  +TE   + S ++K+++S+ AG+ +  L+EW+    R
Sbjct: 64  TSEEVVKESDVVIFSVKPQVVKKAVTELKSKLS-KSKILVSVAAGIKLKDLQEWS-GQDR 121

Query: 136 IIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGS 195
            IR MPNTP  + E  +V+S  T  +++D +    +F+ +G+    DEK  DAVTGLSGS
Sbjct: 122 FIRVMPNTPAAVGEAASVMSLGTGATEEDGAIVAKLFAAVGKILKTDEKMFDAVTGLSGS 181

Query: 196 GPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGG 255
           GPA+  + +EALADGGV  GLPRE+              MV KTGKHP  +KD VT+PGG
Sbjct: 182 GPAYIFLAIEALADGGVAAGLPRELALSLASQTVLGAATMVSKTGKHPGVLKDDVTSPGG 241

Query: 256 CTIAGLLTMEDGKIRSTLARTIQEATQ 282
            TIAG+  +E G  R+TL   +  A +
Sbjct: 242 TTIAGVHELEKGSFRATLMNAVVAAAK 268



>gi|491147273|ref|WP_005005672.1| Pyrroline-5-carboxylate reductase [Nitrospina gracilis]
 gi|451763016|emb|CCQ89346.1| Pyrroline-5-carboxylate reductase [Nitrospina gracilis 3/211]
          Length = 288

 Score =  177 bits (449), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 106/289 (36%), Positives = 161/289 (55%), Gaps = 19/289 (6%)

Query: 5   MSLPTNPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKE 64
           M++ TN  +  +G G M  A++ G+L +  +    E  +L+    +      E  + +K 
Sbjct: 1   MAVLTNKRIGFIGGGNMAEAMIKGLLSASFI----EAKSLMASDMVG-----ERLEFLKH 51

Query: 65  EFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSL-ENKLIISILAGVTI 123
           EF  K T    +N E V++ DII+L  KPQ VK + +  G+ + + E KL+IS+ AGV I
Sbjct: 52  EFKIKTTT---DNQELVQKNDIIILAVKPQAVKAVCS--GIHEQVDEKKLVISVAAGVPI 106

Query: 124 DQ----LKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRAR 179
                 L   A     ++R MPNTP +++ G+T LS     SK D   +  +F  +GR  
Sbjct: 107 HAIEILLNPEADKKVGVVRTMPNTPALVQAGVTALSASDHVSKSDLKVAHRIFEAIGRTV 166

Query: 180 ILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKT 239
            + E  LDAVTGLSGSGPA+  +++EAL+D GV MGL R+V             ++  ++
Sbjct: 167 DVPEAQLDAVTGLSGSGPAYIFMIIEALSDAGVKMGLSRDVSNALTLQTVLGSAKLAQES 226

Query: 240 GKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLG 288
           G+HP E+KD V +PGG TI+GL  +E G +R+TL   ++ ATQ +  LG
Sbjct: 227 GRHPGELKDMVCSPGGTTISGLHWLEKGGLRTTLINAVEAATQRSIELG 275



>gi|294658299|ref|XP_460629.2| DEHA2F06182p [Debaryomyces hansenii CBS767]
 gi|202953026|emb|CAG88957.2| DEHA2F06182p [Debaryomyces hansenii CBS767]
          Length = 275

 Score =  177 bits (449), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 107/282 (37%), Positives = 159/282 (56%), Gaps = 17/282 (6%)

Query: 10  NPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFN-D 68
           + T+ VLGCG MG A+ S IL +       EP    P K I C + E+S+  +K + + D
Sbjct: 3   DYTIAVLGCGVMGTAVTSAILKA-----KFEP---YPSKIICCTNSEKSSTELKSKLDSD 54

Query: 69  KITLLVGN--NVEGVKEADIILLCTKPQVVKTILTEEGMQKSLE-NKLIISILAGVTIDQ 125
            I    G+  N + V +ADI++L  KP + K +   E ++ SL  ++LIIS+LAG TI++
Sbjct: 55  VIETSYGSESNNKAVSKADIVILGCKPFMFKDVY--EQVKGSLSGDQLIISLLAGTTIEE 112

Query: 126 LKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKH 185
           L   +P    + + M NTP     GM V+S   +         + +   +G+A  L EK+
Sbjct: 113 LSIMSP---YVAKVMTNTPAQFGCGMAVVSFSDEAESKYSDLVMKLIDPVGKAMKLPEKN 169

Query: 186 LDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAE 245
           +DA T L GSGPAF  +++EAL DGGV MGLP  V             +MVL+TG+HPA 
Sbjct: 170 MDAATALVGSGPAFCLLIMEALVDGGVRMGLPYAVAKESAAKVMEGTAKMVLETGEHPAA 229

Query: 246 IKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
           ++  + TPGG TI GLL MED  +R  +AR ++EA  ++++ 
Sbjct: 230 LRSKICTPGGTTIGGLLKMEDAGVRGGIARAVEEAANISASF 271



>gi|510836295|ref|WP_016207927.1| pyrroline-5-carboxylate reductase [Clostridium sartagoforme]
 gi|507131905|gb|EOR24290.1| pyrroline-5-carboxylate reductase [Clostridium sartagoforme AAU1]
          Length = 266

 Score =  177 bits (448), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 96/273 (35%), Positives = 148/273 (54%), Gaps = 15/273 (5%)

Query: 16  LGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITLLVG 75
           +GCG MG+A+L G+L S N+   N          I     EES   I  EF     L   
Sbjct: 8   IGCGNMGKAMLKGLLTSTNINKEN---------IIISTKSEESRVNIINEFKVNCVL--- 55

Query: 76  NNVEGVKEADIILLCTKPQVVKTILTE-EGMQKSLENKLIISILAGVTIDQLKEWAPSST 134
           +NVE  K A+I+ L  KP + K IL E E   KS  + +IISI AG+T++ ++ W     
Sbjct: 56  DNVEVAKVAEILFLAVKPNLYKQILKELESHIKS--DAVIISIAAGITLEDMESWLDKEY 113

Query: 135 RIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSG 194
           +IIR MPNTP ++ EGM+ +   ++  + D      +F   G+  IL+EK+ DA   L G
Sbjct: 114 KIIRTMPNTPALVGEGMSAICPNSNIEQKDLEIICALFENFGKYEILEEKYFDAFIALCG 173

Query: 195 SGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPG 254
           S PA+  + +EA+AD  V +G+PR               ++ L+TGKHPAE+KD V +PG
Sbjct: 174 SSPAYVFMFIEAMADAAVKLGIPRNKAYKMAEQSILGSAKLALETGKHPAELKDMVCSPG 233

Query: 255 GCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
           G TI  ++ +E+   RS + +++++ +  +  +
Sbjct: 234 GTTIEAVIELENSGFRSAIIKSMEKCSDKSKNM 266



>gi|68485401|ref|XP_713378.1| hypothetical protein CaO19.13095 [Candida albicans SC5314]
 gi|46434862|gb|EAK94261.1| hypothetical protein CaO19.13095 [Candida albicans SC5314]
          Length = 274

 Score =  176 bits (446), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 108/283 (38%), Positives = 160/283 (56%), Gaps = 19/283 (6%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDK-- 69
           T+ VLGCG MG A+ S IL S       +P    PKK IAC    +  Q +KE F D+  
Sbjct: 5   TITVLGCGVMGTAVTSAILKS-----KFDP---YPKKIIACTIPSQE-QSLKETFADQPL 55

Query: 70  --ITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENK-LIISILAGVTIDQL 126
             ++  V NN + V EAD+I+L  KP + + I  E  +++SL  K L+IS+LAG TI +L
Sbjct: 56  VHVSAGVENNNKAVTEADVIILGCKPYMYEGIYEE--VKESLTGKQLLISLLAGTTIKEL 113

Query: 127 KEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHL 186
             + P    + + M NTP     G   ++   + S++ +   + +  T+G    + EK++
Sbjct: 114 SIFTP---YVAKVMTNTPARFGCGTAAIAFAPEVSEESQELVMKLIDTVGMTVKIPEKNM 170

Query: 187 DAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEI 246
           D  T L GSGPAF  +++E++ DG V MG+P +V             RMVL+TG+HPA +
Sbjct: 171 DIATSLIGSGPAFCLLMMESMIDGAVRMGMPYDVASVAAAKVMEGTARMVLETGEHPAAL 230

Query: 247 KDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           K  V TPGG TI GLLTMED  +RS +AR ++EA  ++++   
Sbjct: 231 KSKVCTPGGTTIGGLLTMEDRGLRSAIARGVEEAANISASFAK 273



>gi|116871764|ref|YP_848545.1| pyrroline-5-carboxylate reductase [Listeria welshimeri serovar 6b
           str. SLCC5334]
 gi|500020478|ref|WP_011701196.1| pyrroline-5-carboxylate reductase [Listeria welshimeri]
 gi|116740642|emb|CAK19762.1| pyrroline-5-carboxylate reductase [Listeria welshimeri serovar 6b
           str. SLCC5334]
          Length = 266

 Score =  176 bits (446), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 102/273 (37%), Positives = 157/273 (57%), Gaps = 14/273 (5%)

Query: 16  LGCGTMGRAILSGILDSLNVAPANEPPTLIPKK-FIACVSGEESAQRIKEEFNDKITLLV 74
           +G G MG A++ G+      A AN    L+ K+  I C    E  Q ++ EFN    LL 
Sbjct: 7   IGAGNMGTAMIRGL------ATAN----LVEKEDIIVCGRHIEKIQPLETEFNG--LLLT 54

Query: 75  GNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPSST 134
            N  + V++ADII+L  KP  +  ILT     K   +K+IIS+ AGVTI+ L+E   S+ 
Sbjct: 55  TNPEKLVEQADIIILSVKPYTIPEILTSV-KDKLTSDKIIISVAAGVTINDLEELTSSTA 113

Query: 135 RIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSG 194
           +I+R MPNTP ++ E M+ +S   + + ++      +FS+ G + ++ E  +DAV G+SG
Sbjct: 114 KIVRVMPNTPALVGEAMSSISPNANVTSEETQQISAIFSSFGESEVVPESLMDAVVGVSG 173

Query: 195 SGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPG 254
           S PA+  + +EALADG V+ G+PR+              +MVL+TG+HP ++KD VT+PG
Sbjct: 174 SSPAYVYMFIEALADGAVLNGMPRDKAYKFAAQAVLGAAKMVLETGEHPGKLKDMVTSPG 233

Query: 255 GCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
           G TI  + ++ED   RS +   +Q A Q  S++
Sbjct: 234 GTTIEAVKSLEDNGFRSAVLSAVQAAAQKNSSM 266



>gi|333978625|ref|YP_004516570.1| pyrroline-5-carboxylate reductase [Desulfotomaculum kuznetsovii DSM
           6115]
 gi|503588208|ref|WP_013822284.1| pyrroline-5-carboxylate reductase [Desulfotomaculum kuznetsovii]
 gi|333822106|gb|AEG14769.1| pyrroline-5-carboxylate reductase [Desulfotomaculum kuznetsovii DSM
           6115]
          Length = 273

 Score =  176 bits (446), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 101/267 (37%), Positives = 150/267 (56%), Gaps = 14/267 (5%)

Query: 16  LGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITLLVG 75
           LG G M +A+L+G++ S           L  +      +  +  + +  E          
Sbjct: 11  LGGGAMAQALLTGLIKS----------GLQARNLYVSDTRRDRLEFLHRELGVHTR---E 57

Query: 76  NNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPSSTR 135
           +N + VKE+D+++L  KPQVV+ +L E G     +  LI SI AG+T   ++ +      
Sbjct: 58  SNKDLVKESDVVILAVKPQVVEEVLKETGGIFQPQQTLI-SIAAGITTQFIESFLAQPVP 116

Query: 136 IIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGS 195
           ++R MPNTPC++  G + L   T     DR  ++ +FS +GRA  + E  +DAVTGLSGS
Sbjct: 117 VVRVMPNTPCLLGAGASALCLGTHAGVRDRERAMAIFSVVGRAVEVPEGLMDAVTGLSGS 176

Query: 196 GPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGG 255
           GPA+  V+LEALAD GV +GLPR+V             RMVL+T +HP  +K+ VTTPGG
Sbjct: 177 GPAYMYVILEALADAGVRVGLPRDVALLLSAQTMLGAARMVLETNEHPGRLKNMVTTPGG 236

Query: 256 CTIAGLLTMEDGKIRSTLARTIQEATQ 282
             IAG+  +E+G +R TL R ++EAT+
Sbjct: 237 TAIAGVFALEEGGLRVTLMRAVEEATR 263



>gi|238881794|gb|EEQ45432.1| hypothetical protein CAWG_03758 [Candida albicans WO-1]
          Length = 274

 Score =  176 bits (446), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 108/283 (38%), Positives = 160/283 (56%), Gaps = 19/283 (6%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDK-- 69
           T+ VLGCG MG A+ S IL S       +P    PKK IAC    +  Q +KE F D+  
Sbjct: 5   TITVLGCGVMGTAVTSAILKS-----KFDP---YPKKIIACTIPSQE-QSLKETFADQPL 55

Query: 70  --ITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENK-LIISILAGVTIDQL 126
             ++  V NN + V EAD+I+L  KP + + I  E  +++SL  K L+IS+LAG TI +L
Sbjct: 56  VHVSAGVENNNKAVTEADVIILGCKPYMYEGIYEE--VKESLTGKQLLISLLAGTTIKEL 113

Query: 127 KEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHL 186
             + P    + + M NTP     G   ++   + S++ +   + +  T+G    + EK++
Sbjct: 114 SIFTP---YVAKVMTNTPARFGCGTAAIAFAPEVSEESQELVMKLIDTVGMTVKIPEKNM 170

Query: 187 DAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEI 246
           D  T L GSGPAF  +++E++ DG V MG+P +V             RMVL+TG+HPA +
Sbjct: 171 DIATSLIGSGPAFCLLMMESMIDGAVRMGMPYDVASVAAAKVMEGTARMVLETGEHPAAL 230

Query: 247 KDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           K  V TPGG TI GLLTMED  +RS +AR ++EA  ++++   
Sbjct: 231 KSKVCTPGGTTIGGLLTMEDRGLRSAIARGVEEAANISASFAK 273



>gi|241953964|ref|XP_002419703.1| delta 1-pyrroline-5-carboxylate reductase, putative;
           pyrroline-5-carboxylate reductase, putative [Candida
           dubliniensis CD36]
 gi|223643044|emb|CAX41918.1| delta 1-pyrroline-5-carboxylate reductase, putative [Candida
           dubliniensis CD36]
          Length = 274

 Score =  176 bits (446), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 107/283 (37%), Positives = 161/283 (56%), Gaps = 19/283 (6%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDK-- 69
           T+ VLGCG MG A+ S IL S       +P    PKK IAC    +  Q +KE F ++  
Sbjct: 5   TITVLGCGVMGTAVTSAILKS-----KFDP---YPKKIIACTIPSQE-QSLKETFANQPL 55

Query: 70  --ITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENK-LIISILAGVTIDQL 126
             ++  V NN + V EAD+I+L  KP + ++I  E  +++SL  K L+IS+LAG TI +L
Sbjct: 56  VHVSAGVENNNKAVTEADVIILGCKPYMYESIYEE--VKQSLTGKQLLISLLAGTTIKEL 113

Query: 127 KEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHL 186
             + P    + + M NTP     G   ++   + S++ +   + +  T+G    + EK++
Sbjct: 114 SIFTP---YVAKVMTNTPARFGCGTAAIAFAPEVSEESQELVMKLIDTVGMTVKIPEKNM 170

Query: 187 DAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEI 246
           D  T L GSGPAF  +++E++ DG V MG+P +V             RMVL+TG+HPA +
Sbjct: 171 DIATSLIGSGPAFCLLMMESMIDGAVRMGMPYDVASVAAAKVMEGTARMVLETGEHPAAL 230

Query: 247 KDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           K  V TPGG TI GLLTMED  +RS +AR ++EA  ++++   
Sbjct: 231 KSKVCTPGGTTIGGLLTMEDRGLRSAIARGVEEAANISASFAK 273



>gi|452984177|gb|EME83934.1| hypothetical protein MYCFIDRAFT_207105 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 351

 Score =  176 bits (445), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 104/306 (33%), Positives = 159/306 (51%), Gaps = 30/306 (9%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNV-------APANEP---PTLIPKKFIACVSGEESAQR 61
           TL VLGCGTMG AIL G++ SL +          N P   P   P KF ACV    SA+R
Sbjct: 40  TLAVLGCGTMGSAILGGVMASLQLQLQSKSDHRTNTPHAIPDRRPNKFNACVKTSSSAKR 99

Query: 62  IKEE---FNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISIL 118
           I+EE   ++  + +   +N+  VK +D I+L  +P +V  +L EEG++ +L  KL+IS+ 
Sbjct: 100 IREELGKYHADLIVWENDNLGAVKASDAIILACEPHIVGHVLREEGIRDALAGKLLISVC 159

Query: 119 AGVTIDQLKE----------------WAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSK 162
            GV    + +                   S   I+ A+PN    + E MT++S     S+
Sbjct: 160 GGVPETYIHDTLYQSAPPPPPQSQSQSHTSKCTIVIAIPNIAASVCESMTIISASAALSE 219

Query: 163 DDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXX 222
           ++ +   W+FS +GR   +    ++  T L  SGPA   V++EA+A G +  G+PR    
Sbjct: 220 ENSTLVNWIFSRVGRVANVPSSRMNPATALCASGPALCAVMMEAMASGAIAKGMPRAQAY 279

Query: 223 XXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQ 282
                       +VL+ G+HPA ++D V+TPGGCTIAG+  +E+G  R  +AR ++E+  
Sbjct: 280 EMAAQAMKGAASLVLE-GEHPALVRDRVSTPGGCTIAGIQVLEEGSFRGVVARAVRESAA 338

Query: 283 VASTLG 288
             S L 
Sbjct: 339 TLSLLA 344



>gi|296882319|gb|ADH83382.1| pyrroline-5-carboxylate reductase [Arabis stelleri]
          Length = 276

 Score =  176 bits (445), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 101/267 (37%), Positives = 145/267 (54%), Gaps = 14/267 (5%)

Query: 16  LGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITLLVG 75
           +G G M  +I  G++ S           L P +    V    + + + E F   +     
Sbjct: 16  VGAGKMAESIARGVVAS---------GVLPPNRICTAVHSNLNRRDVFESFGVNV---FS 63

Query: 76  NNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPSSTR 135
           ++ E VKE+D+++   KPQVVK  +TE   + S +NKL++S+ AG+ +  L+EW+    R
Sbjct: 64  SSEEVVKESDVVIFSVKPQVVKKAVTELSSKVS-KNKLLVSVAAGIKLKDLQEWS-GQDR 121

Query: 136 IIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGS 195
            IR MPNTP  + E  TV+S  T  +++D      +F ++G+    DEK  DAVTGLSGS
Sbjct: 122 FIRVMPNTPAAVGEAATVMSLGTAATEEDGELVAKLFGSVGKILRADEKMFDAVTGLSGS 181

Query: 196 GPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGG 255
           GPA+  + +EALADGGV  GL RE+              MV K GKHP  +KD VT+PGG
Sbjct: 182 GPAYIYLAIEALADGGVAAGLHRELALGLASQTVLGAATMVSKAGKHPGVLKDDVTSPGG 241

Query: 256 CTIAGLLTMEDGKIRSTLARTIQEATQ 282
            TIAG+  +E G  R+TL   +  A  
Sbjct: 242 TTIAGVHELEKGSFRATLMNAVVAAAN 268



>gi|260949641|ref|XP_002619117.1| hypothetical protein CLUG_00276 [Clavispora lusitaniae ATCC 42720]
 gi|238846689|gb|EEQ36153.1| hypothetical protein CLUG_00276 [Clavispora lusitaniae ATCC 42720]
          Length = 276

 Score =  176 bits (445), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 107/287 (37%), Positives = 157/287 (54%), Gaps = 17/287 (5%)

Query: 5   MSLPTNPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKE 64
           M++    T  VLG G MG A+ S I+ + NV P        P K   C     S  R++E
Sbjct: 1   MAIKEGYTFTVLGAGVMGSAVTSAIIKA-NVKP-------FPGKIYLCTQDSASVARLRE 52

Query: 65  EFNDKITLLVGNNVEG---VKEADIILLCTKPQVVKTILTEEGMQKSLENK-LIISILAG 120
            +  +   +V +  E    V E+D++LL  KP   K +  E  +  SL +K L+IS+LAG
Sbjct: 53  NYPQEYIHVVADLEEKKKCVAESDVVLLGCKPFHYKGLYEE--VSSSLSHKPLVISLLAG 110

Query: 121 VTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARI 180
           VTI QL  ++P    I R M NTP     GM  ++   +  +  +   + + +T+G A  
Sbjct: 111 VTISQLTIFSP---YIARVMTNTPAQFGCGMATVAFSPEAQEKFKDEVLALANTVGSAVE 167

Query: 181 LDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTG 240
           + EK++DA T L GSGPAF  +++EAL DGGV MGLP +V             +MVL+TG
Sbjct: 168 IAEKNMDAATALVGSGPAFCLLMMEALYDGGVRMGLPHDVAKLSAAKVMEGTAKMVLETG 227

Query: 241 KHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
           +HPA +K  V TPGG TI GLL MED  +R  ++R ++EA  ++++ 
Sbjct: 228 EHPAVLKSKVCTPGGTTIGGLLKMEDAGVRGAISRAVEEAAVISASF 274



>gi|489814668|ref|WP_003718502.1| pyrroline-5-carboxylate reductase [Listeria ivanovii]
 gi|313630183|gb|EFR98152.1| pyrroline-5-carboxylate reductase [Listeria ivanovii FSL F6-596]
          Length = 266

 Score =  175 bits (444), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 100/275 (36%), Positives = 153/275 (55%), Gaps = 18/275 (6%)

Query: 16  LGCGTMGRAILSGILDSLNVAPANEPPTLIPKK-FIACVSGEESAQRIKEEFNDKITLLV 74
           +G G MG A++ G+  +           LI KK    C    E    +  EFN    + +
Sbjct: 7   IGAGNMGTAMIRGLAKA----------KLIDKKNLFVCGRSMEKLHPLASEFNG---IQL 53

Query: 75  GNNVEGV-KEADIILLCTKPQVVKTILTEEGMQKSL-ENKLIISILAGVTIDQLKEWAPS 132
             N E + +EADII+L  KP  +  ++T   +QK L   K+IIS+ AGVTI  L++    
Sbjct: 54  TTNAENLAEEADIIILSVKPYTISEVITN--IQKKLTSEKIIISVAAGVTIADLEKLTTP 111

Query: 133 STRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGL 192
            T+IIR MPNTP ++ EGM+ +S     + ++ +    +FS+ G+A ++ E  +DAV G+
Sbjct: 112 ETKIIRVMPNTPALVGEGMSSISSNASVTTEETAIVAKIFSSFGKAEVVPESLMDAVVGV 171

Query: 193 SGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTT 252
           SGS PA+  + +EALADG V+ GLPR+              +MVL+TG+HP ++KD VT+
Sbjct: 172 SGSSPAYVYMFIEALADGAVLNGLPRDKAYKFAAQAVLGAAKMVLETGEHPGKLKDMVTS 231

Query: 253 PGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
           PGG TI  + ++ED   RS +   +Q A    S++
Sbjct: 232 PGGTTIEAVKSLEDNGFRSAVINAVQAAASKNSSM 266



>gi|322435391|ref|YP_004217603.1| pyrroline-5-carboxylate reductase [Granulicella tundricola
           MP5ACTX9]
 gi|503345481|ref|WP_013580142.1| pyrroline-5-carboxylate reductase [Granulicella tundricola]
 gi|321163118|gb|ADW68823.1| pyrroline-5-carboxylate reductase [Granulicella tundricola
           MP5ACTX9]
          Length = 301

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 107/276 (38%), Positives = 156/276 (56%), Gaps = 15/276 (5%)

Query: 13  LCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITL 72
           + VLG G MG  +L   L + N+        L P++ +A V   + A  +  +   ++T 
Sbjct: 37  VAVLGAGKMGGILLQAFLKN-NL--------LAPEQIVATVQHADRALALSAQTGVEVTT 87

Query: 73  LVGNNVEGVKEADIILLCTKP-QVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAP 131
              +N+     AD+ILL  KP QV   I T +G   +   K+I+S  A V    ++  A 
Sbjct: 88  ---DNLAAATWADVILLGVKPIQVPGLIETIKGGLTA--EKMIVSFAASVKTTAIEAAAG 142

Query: 132 SSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTG 191
               +IRAMPNTP M+  G+T L      S +  S +  +F+T+GR  ++ EKH+DAVTG
Sbjct: 143 LELAVIRAMPNTPSMLAAGVTALCGGRFASAEQMSVAQRIFATVGRTVVVAEKHMDAVTG 202

Query: 192 LSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVT 251
           LSGSGPAF  +++EALA+ GV +GLPR+V             +MVL+TG HPA +KD VT
Sbjct: 203 LSGSGPAFIYIIIEALAEAGVNVGLPRDVATLLAAQTTLGSAKMVLETGYHPALLKDQVT 262

Query: 252 TPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
           TP GCT+ G+L +E+G +R TL + ++ AT  A  L
Sbjct: 263 TPAGCTVDGILELEEGGLRVTLIKAVKRATARAKEL 298



>gi|190345405|gb|EDK37284.2| hypothetical protein PGUG_01382 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 276

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 106/288 (36%), Positives = 168/288 (58%), Gaps = 20/288 (6%)

Query: 5   MSLPTNPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKE 64
           MS+  N T+ VLGCG MG A++S IL++   +P        P K I C S EESA  +K+
Sbjct: 1   MSIKENYTITVLGCGVMGTAVVSAILNA-EFSP-------YPSKIICCTSREESALNLKK 52

Query: 65  EFNDKIT-LLVGN--NVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGV 121
           + N +I  +  G+  N +  K+ADI++L  KP + +T+L++  +       L+IS+LAGV
Sbjct: 53  KLNHEIIEVSYGSEANSKAAKKADIVILACKPYMYETVLSQAPINN---GSLLISLLAGV 109

Query: 122 TIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDR--SFSIWVFSTLGRAR 179
           T  +L+++   S  + + M NTP     G  ++S  +D   +++     + + + +G A 
Sbjct: 110 TTKELQKY---SVNVAKVMTNTPAQYGCGTAMVSF-SDPEAEEKYGDLVMKLINPVGLAM 165

Query: 180 ILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKT 239
            + EK++DA T L GSGPAF  +++E+L DGGV MG+P  V             +MVL+T
Sbjct: 166 KIPEKNMDAATALVGSGPAFCLLMMESLIDGGVRMGIPFAVAKDAAAKVMEGTAKMVLET 225

Query: 240 GKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
           G HPA +K  V TPGG TI GLL +ED  +R ++AR ++EA  ++++ 
Sbjct: 226 GDHPAALKSKVCTPGGTTIGGLLKLEDAGVRGSIARAVEEAANISASF 273



>gi|153952963|ref|YP_001393728.1| protein ProC1 [Clostridium kluyveri DSM 555]
 gi|219853621|ref|YP_002470743.1| hypothetical protein CKR_0278 [Clostridium kluyveri NBRC 12016]
 gi|500757628|ref|WP_011988895.1| pyrroline-5-carboxylate reductase [Clostridium kluyveri]
 gi|146345844|gb|EDK32380.1| ProC1 [Clostridium kluyveri DSM 555]
 gi|219567345|dbj|BAH05329.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 268

 Score =  175 bits (443), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 99/279 (35%), Positives = 161/279 (57%), Gaps = 17/279 (6%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKIT 71
           T+   G G MGRAI+ G++ S  +  A E        F+  V    + ++++ E   K  
Sbjct: 4   TIGFFGGGNMGRAIMGGLIKS-KLYKAEEI-------FVYDVYAP-TLEKLQNELGIK-- 52

Query: 72  LLVGNNVEGVKEADIILLCTKPQVVKTILTE--EGMQKSLENKLIISILAGVTIDQLKEW 129
             V  N E V+ A  +++  KP V+ T+L E  E + K   +K++ISI AGVT+++L+E 
Sbjct: 53  -PVNRNKELVENAQTLIISVKPVVLPTVLKEIKEDISK---DKIVISIAAGVTVNKLEEL 108

Query: 130 APSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAV 189
                +I+R MPNTP ++ EGM+ ++     S++++   + +FS+ G+ +I+ EK +DAV
Sbjct: 109 LSPQHKIVRVMPNTPALVGEGMSAIAVNEHLSQEEQEKVLAIFSSFGKGQIVSEKLIDAV 168

Query: 190 TGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDS 249
            G+SGS PA+  + +EALADG V+ G+PR +             +MVL+TGKHP E+KD 
Sbjct: 169 VGVSGSSPAYVYMFIEALADGAVLEGMPRNMAYEFAAQAVLGSAKMVLETGKHPGELKDM 228

Query: 250 VTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLG 288
           V +PGG T+A +  +E+   RS +  T+  AT+    +G
Sbjct: 229 VCSPGGTTMAAVKVLEEKGFRSAVIDTVHAATEKNRNMG 267



>gi|407921134|gb|EKG14298.1| Pyrroline-5-carboxylate reductase [Macrophomina phaseolina MS6]
          Length = 307

 Score =  175 bits (443), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 98/296 (33%), Positives = 163/296 (55%), Gaps = 20/296 (6%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFND--- 68
           TLCVLGCG +G AIL+ +L++    P +  P L   +F+ACV  E+S Q +++ F+    
Sbjct: 9   TLCVLGCGNLGTAILTNLLEA---GPGDAAP-LPFTRFVACVRSEKSEQALQQRFSQHST 64

Query: 69  KITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLK- 127
           K+++  G+N   V  +D+++L   P  V  +LT+ GM+ +L +KL++S++AG    QL+ 
Sbjct: 65  KLSVCRGDNTAAVDGSDVVILGADPADVDAVLTQPGMRAALGSKLLLSLVAGWPRTQLET 124

Query: 128 ---------EWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCS---KDDRSFSIWVFSTL 175
                      AP+  RI+R +PN    + + +T +  P D +       + +  +F  +
Sbjct: 125 TLYGSATTPSTAPTRARIVRTLPNIAAAVGQSLTAIEMPADAALLPDAHLALTERIFQRI 184

Query: 176 GRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRM 235
           GR + +  K +DA T L+GS PAF  V+ +AL D GV +G+PR+               +
Sbjct: 185 GRTQRIAPKLMDATTALAGSTPAFFAVICDALVDAGVAVGVPRDQASAMIFQAMRGTAAL 244

Query: 236 VLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGNIQ 291
           + + G HP  +KD  T+P GCTI GL+ +E+  +R  L R ++EA  VA  +G  +
Sbjct: 245 LQEGGVHPGVLKDQGTSPEGCTIGGLMVLEEAGVRGHLGRALREAVTVARLMGKTE 300



>gi|85859581|ref|YP_461783.1| pyrroline-5-carboxylate reductase [Syntrophus aciditrophicus SB]
 gi|499736903|ref|WP_011417637.1| pyrroline-5-carboxylate reductase [Syntrophus aciditrophicus]
 gi|85722672|gb|ABC77615.1| pyrroline-5-carboxylate reductase [Syntrophus aciditrophicus SB]
          Length = 272

 Score =  174 bits (442), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 99/279 (35%), Positives = 159/279 (56%), Gaps = 15/279 (5%)

Query: 10  NPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDK 69
           N  + ++GCG MG  +LSG+L +  VA +      + K         E  + I E + D 
Sbjct: 4   NQKIGLVGCGKMGTILLSGMLRNRLVAESQIRVADVVK---------ERLEEIHEAYPD- 53

Query: 70  ITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLEN-KLIISILAGVTIDQLKE 128
             ++  +N    +  DI++L  KPQ +  +L E  + + + + +LI+S+ AG++   +++
Sbjct: 54  --IVQESNQPLARSVDILILAVKPQNLPELLNE--LTEDIHSGQLIVSVAAGISTRLIEK 109

Query: 129 WAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDA 188
                 R++RAMPNTP ++ EG+T L+     ++ D      +F  +G    ++E  +DA
Sbjct: 110 HLSGPVRVVRAMPNTPALVGEGVTALAAGAYATQKDVETVARLFEAVGLTVKINENLMDA 169

Query: 189 VTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKD 248
           VTGLSGSGP +  V+LEALAD GV +GLPRE              ++ L+TGKHP E+KD
Sbjct: 170 VTGLSGSGPGYVFVILEALADAGVFLGLPRETALKLAAQTLLGSAKLYLRTGKHPGELKD 229

Query: 249 SVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
            VT+PGG TIAGL  +E+G++R+TL   ++ AT+ +  L
Sbjct: 230 MVTSPGGTTIAGLKALEEGRLRATLMTAVEAATRRSKVL 268



>gi|449449789|ref|XP_004142647.1| PREDICTED: pyrroline-5-carboxylate reductase-like [Cucumis sativus]
 gi|449527143|ref|XP_004170572.1| PREDICTED: pyrroline-5-carboxylate reductase-like [Cucumis sativus]
          Length = 276

 Score =  174 bits (442), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 103/276 (37%), Positives = 149/276 (53%), Gaps = 16/276 (5%)

Query: 13  LCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITL 72
           L  +G G M  +I  GI+ S           L+P   I+       ++RI  E      L
Sbjct: 13  LGFIGAGKMAESIAKGIVQS----------GLLPPSRISTAVHSNPSRRIAFESFGVRVL 62

Query: 73  LVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLE-NKLIISILAGVTIDQLKEWAP 131
              +NV  V+E+D+++L  KPQVVK ++ +  ++  L   KL++S+ AGV +  L++WA 
Sbjct: 63  PKNDNV--VEESDVVILSVKPQVVKNVVLK--LRPLLSGKKLLVSVAAGVKLKDLQDWA- 117

Query: 132 SSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTG 191
              R IR MPNTP  + E  +V+S      K+D      +F ++G+    +EK+ DAVTG
Sbjct: 118 GHNRFIRVMPNTPAAVGEAASVMSLGEGAIKEDGQLVAKLFGSVGKIWEAEEKYFDAVTG 177

Query: 192 LSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVT 251
           LSGSGPA+  + +EALADGGV  GLPRE+              MV KTGKHP ++KD VT
Sbjct: 178 LSGSGPAYIFLAIEALADGGVAAGLPRELAMGLASQTVLGAASMVTKTGKHPGQLKDDVT 237

Query: 252 TPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
           +PGG TIAG+  +E G +R      +  A +    L
Sbjct: 238 SPGGTTIAGIHELEKGGLRGMFMNAVVAAAKRGQEL 273



>gi|294494984|ref|YP_003541477.1| pyrroline-5-carboxylate reductase [Methanohalophilus mahii DSM
           5219]
 gi|502801799|ref|WP_013036775.1| pyrroline-5-carboxylate reductase [Methanohalophilus mahii]
 gi|292665983|gb|ADE35832.1| pyrroline-5-carboxylate reductase [Methanohalophilus mahii DSM
           5219]
          Length = 272

 Score =  174 bits (442), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 98/280 (35%), Positives = 155/280 (55%), Gaps = 15/280 (5%)

Query: 10  NPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDK 69
           N  + ++G G MG+++L GI+ +    PAN           A    E + Q +K+E    
Sbjct: 6   NKKVGIIGTGKMGQSLLRGIVRAGKAKPAN---------IYASDVYEPALQALKDELGIN 56

Query: 70  ITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSL-ENKLIISILAGVTIDQLKE 128
           ++    +N + V  ++II+L  KPQ+++ +L   G    + ENKLIISI AGV    ++E
Sbjct: 57  VST---DNFDTVDNSEIIILAVKPQILRNVL--RGFADHINENKLIISIAAGVPAATIEE 111

Query: 129 WAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDA 188
                TR++R MPN    + E  + +S   + S +D   ++ +FS++G A ++ E  +DA
Sbjct: 112 ELHEDTRVVRVMPNIAATVGEAASAVSAGKNASAEDAEVAMEIFSSMGSAALVPEHLMDA 171

Query: 189 VTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKD 248
           VTG+SGSGPA+   V+EA+ADGGV+ GL RE              +MVL+T KHPAE+KD
Sbjct: 172 VTGVSGSGPAYIFPVIEAMADGGVLEGLDRESALKLAAQTVLGAAKMVLETKKHPAELKD 231

Query: 249 SVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLG 288
            VT+P G TI G+  +E   IR+     +  + + +  +G
Sbjct: 232 MVTSPAGTTIHGVHALEKNGIRAAFTDAVMASAKRSREMG 271



>gi|502108205|ref|XP_004493414.1| PREDICTED: pyrroline-5-carboxylate reductase-like [Cicer arietinum]
          Length = 273

 Score =  174 bits (441), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 101/282 (35%), Positives = 161/282 (57%), Gaps = 20/282 (7%)

Query: 4   IMSLPTNP-TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRI 62
           I+ +P +  TL  +G G M  +I  G + S  ++P+             C +    A+R 
Sbjct: 3   IIPIPADSYTLGFIGAGKMAESIAKGAVRSGVLSPSR-----------ICTAHSNPARRA 51

Query: 63  KEEFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSL--ENKLIISILAG 120
             E +  +TLL  N+ + V+E+++++L  KPQ+VK ++ +    K L  +NKL++S+ AG
Sbjct: 52  AFE-SVGVTLLSSND-DVVRESNVVVLSVKPQLVKDVVLK---LKPLLTKNKLLVSVAAG 106

Query: 121 VTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARI 180
           + +  L+EWA  S R IR MPNTP  + E  +V+S     +++D +    +F ++G+   
Sbjct: 107 IKLKDLQEWA-GSNRFIRVMPNTPAAVGEAASVMSLGGAATEEDGNLISQLFGSIGKIWK 165

Query: 181 LDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTG 240
            D+K+ DA+TGLSGSGPA+  + +EALADGGV  GLPR++              M  ++G
Sbjct: 166 ADDKYFDAITGLSGSGPAYIYLAIEALADGGVAAGLPRDLALSLASQTVLGAASMATQSG 225

Query: 241 KHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQ 282
           KHP ++KD VT+PGG TIAG+  +E G  R TL   +  A +
Sbjct: 226 KHPGQLKDDVTSPGGTTIAGIHELEKGGFRGTLMNAVVAAAK 267



>gi|68485496|ref|XP_713331.1| hypothetical protein CaO19.5650 [Candida albicans SC5314]
 gi|46434814|gb|EAK94214.1| hypothetical protein CaO19.5650 [Candida albicans SC5314]
          Length = 274

 Score =  174 bits (441), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 107/283 (37%), Positives = 159/283 (56%), Gaps = 19/283 (6%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDK-- 69
           T+ VLGCG MG A+ S IL S       +P    PKK IAC    +  Q +KE F D+  
Sbjct: 5   TITVLGCGVMGTAVTSAILKS-----KFDP---YPKKIIACTIPSQE-QSLKETFADQPL 55

Query: 70  --ITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENK-LIISILAGVTIDQL 126
             ++  V NN + V EAD+I+L  KP + + I  E  +++SL  K L+IS+LAG TI +L
Sbjct: 56  VHVSAGVENNNKAVTEADVIILGCKPYMYEGIYEE--VKESLTGKQLLISLLAGTTIKEL 113

Query: 127 KEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHL 186
             + P    + + M NTP     G   ++   +  ++ +   + +  T+G    + EK++
Sbjct: 114 SIFTP---YVAKVMTNTPARFGCGTAAIAFAPEVGEESQELVMKLIDTVGMTVKIPEKNM 170

Query: 187 DAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEI 246
           D  T L GSGPAF  +++E++ DG V MG+P +V             RMVL+TG+HPA +
Sbjct: 171 DIATSLIGSGPAFCLLMMESMIDGAVRMGMPYDVASVAAAKVMEGTARMVLETGEHPAAL 230

Query: 247 KDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           K  V TPGG TI GLLTMED  +RS +AR ++EA  ++++   
Sbjct: 231 KSKVCTPGGTTIGGLLTMEDRGLRSAIARGVEEAANISASFAK 273



>gi|126135592|ref|XP_001384320.1| delta 1-pyrroline-5-carboxylate reductase [Scheffersomyces stipitis
           CBS 6054]
 gi|126091518|gb|ABN66291.1| delta 1-pyrroline-5-carboxylate reductase [Scheffersomyces stipitis
           CBS 6054]
          Length = 277

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 110/284 (38%), Positives = 155/284 (54%), Gaps = 17/284 (5%)

Query: 10  NPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDK 69
           + T+ VLGCG MG A+ S IL S  V P        P K IAC + E +A    E  N  
Sbjct: 5   DYTITVLGCGVMGTAVSSAILKS-KVEP-------FPAKLIACNTTEAAATLALETLNSP 56

Query: 70  I---TLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENK-LIISILAGVTIDQ 125
           I   +  + +N + V +AD+I+L  KP + +TI  E  ++ SL  K L+IS+LAG TI +
Sbjct: 57  IVEHSFGLESNRKAVSQADVIILACKPFMYQTIYDE--VKDSLTGKQLLISLLAGTTISE 114

Query: 126 LKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKH 185
           L  + P    + + M NTP     G   +S   +         + +  T+G A  + EK+
Sbjct: 115 LTIFTP---YVAKVMTNTPARFGCGTAGISFSPEAEAKYEDLVLKLIGTVGEAFKIPEKN 171

Query: 186 LDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAE 245
           +DA T L GSGPAF  +++E+L DGGV MGLP EV             RMVL+TG HPA 
Sbjct: 172 MDAATALIGSGPAFCLLMMESLIDGGVRMGLPFEVAKLSAAKVMEGTARMVLETGDHPAA 231

Query: 246 IKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           +K  V TPGG TI GLL MED  +R+ +AR ++EA  ++++   
Sbjct: 232 LKSMVCTPGGTTIGGLLKMEDAGVRAGIARGVEEAAVISASFAK 275



>gi|171686850|ref|XP_001908366.1| hypothetical protein [Podospora anserina S mat+]
 gi|170943386|emb|CAP69039.1| unnamed protein product [Podospora anserina S mat+]
          Length = 241

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 100/228 (43%), Positives = 133/228 (58%), Gaps = 13/228 (5%)

Query: 72  LLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKE--- 128
           +L  +N+  V+ ADIILL  KP +V  +L+E  +  SL  KL+ISILAGVT  QL +   
Sbjct: 1   ILTNSNLPAVQSADIILLACKPYMVNELLSEPSLAPSLSGKLLISILAGVTETQLSQTLT 60

Query: 129 ----WAPSSTRIIRAMPNTPCMIREGMTVLSC---PTDCSKDDRSFSIWVFSTLGRARIL 181
                 P + +I+RAMPNT  +IRE MTV+     P D   +      W+F  +G    L
Sbjct: 61  TANGGQPVNCQIVRAMPNTASLIRESMTVIGISNPPLD--PETMGTVTWIFKRIGEVVYL 118

Query: 182 DEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGK 241
              ++D  T L GSGPAF  ++LEA  DG V MGLPR                +VL  G 
Sbjct: 119 PPSNMDVCTSLCGSGPAFFALMLEAAIDGAVAMGLPRAEAQRMAAQTMKGAAGLVLN-GD 177

Query: 242 HPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           HPA ++D V+TPGGCTI GLL +E+G++R T+AR ++EAT VAS LG 
Sbjct: 178 HPALLRDKVSTPGGCTIGGLLVLEEGRVRGTVARAVREATVVASQLGQ 225



>gi|494658352|ref|WP_007416296.1| pyrroline-5-carboxylate reductase [Pedosphaera parvula]
 gi|223893159|gb|EEF59623.1| pyrroline-5-carboxylate reductase [bacterium Ellin514]
          Length = 271

 Score =  174 bits (440), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 101/278 (36%), Positives = 157/278 (56%), Gaps = 13/278 (4%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKIT 71
           T+  LG G MG A+  G + +  V+          ++ IA    E + +   +E   K+T
Sbjct: 6   TIGFLGAGKMGTALAKGFIQAGLVSA---------EQIIASDPIEAAGKSFAKEVGAKVT 56

Query: 72  LLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAP 131
               +NVE  + A+++LL  KP  V  +L E   Q + ++ LIISI AGV + +++   P
Sbjct: 57  ---SSNVEVARFANVLLLAVKPDQVSGVLAEIRDQFT-KDHLIISIAAGVPLAKIEAGLP 112

Query: 132 SSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTG 191
           +++R IR MPNTP ++ +  T  +     + +D   +  +FS +G A  + E  LDAVTG
Sbjct: 113 ANSRAIRVMPNTPAIVGQSATAYAFGKSTTPEDGQLAQKLFSAVGVAFQVKEALLDAVTG 172

Query: 192 LSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVT 251
           LSGSGPA+  +++EAL+DGGV  GLPR++             +MVL+TG HP  +KD VT
Sbjct: 173 LSGSGPAYVYMIIEALSDGGVASGLPRDIATKLAAQTLLGGAKMVLETGMHPGALKDMVT 232

Query: 252 TPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           +PGG TI G+  +E G++R TL   ++ AT+ +  LG 
Sbjct: 233 SPGGTTIEGVHELEKGQLRGTLMNAVRAATEKSKKLGQ 270



>gi|459368904|gb|EMG47481.1| Pyrroline-5-carboxylate reductase [Candida maltosa Xu316]
          Length = 274

 Score =  173 bits (439), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 108/283 (38%), Positives = 158/283 (55%), Gaps = 19/283 (6%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKIT 71
           T+ VLGCG MG A+ S IL       A   P   PKK IAC    E  +R+KE F  +  
Sbjct: 5   TITVLGCGVMGTAVTSAILK------AKFDP--YPKKIIACTVPSE-VERLKETFAGQPL 55

Query: 72  LLVG----NNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENK-LIISILAGVTIDQL 126
           + V     NN + V EAD+I+L  KP + + I  E  +++SL  K L+IS+LAG TI +L
Sbjct: 56  VQVSAGTENNNKAVAEADVIILGCKPYMYEGIYQE--VKESLTGKQLLISLLAGTTIKEL 113

Query: 127 KEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHL 186
             + P    + + M NTP     G   ++   + S++ +   + +  T+G    + EK++
Sbjct: 114 SIFTP---YVAKVMTNTPARFGCGTAAIAFAPEVSEESQDLVMKLIDTVGMTIKIPEKNM 170

Query: 187 DAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEI 246
           D  T L GSGPAF  +++EA+ DG V MG+P +V             +MVL+TG+HPA +
Sbjct: 171 DIATSLIGSGPAFCLLMMEAMIDGAVRMGMPYDVASKSAAKVMEGTAKMVLETGEHPAAL 230

Query: 247 KDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           K  V TPGG TI GLLTMED  +RS +AR ++EA  ++++   
Sbjct: 231 KSKVCTPGGTTIGGLLTMEDRGLRSAIARGVEEAANISASFAK 273



>gi|255950990|ref|XP_002566262.1| Pc22g23710 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211593279|emb|CAP99659.1| Pc22g23710 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 302

 Score =  173 bits (438), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 98/289 (33%), Positives = 164/289 (56%), Gaps = 19/289 (6%)

Query: 10  NPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFN-- 67
           N TLC+LGCG +G AI+ G+++    APA +   L   ++IACV  E S +R+ E F   
Sbjct: 5   NGTLCILGCGNLGIAIIDGLVN----APAEKSKELPFTRYIACVRSENSEKRLAERFVKY 60

Query: 68  -DKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQL 126
            DKI+L  G+NV+ V +AD+++L   P  ++T+LT+ G++++  +KLIISI AG T  +L
Sbjct: 61  LDKISLSRGHNVQAVHDADVVILGADPADIETVLTQPGLREAFADKLIISIAAGWTRQKL 120

Query: 127 KE--WAPSSTR--------IIRAMPNTPCMIREGMTVLSCPTDCSKDDR-SFSIWVFSTL 175
           +   +  ++T         ++R +PN    + + +T +        +     +  +F  +
Sbjct: 121 EATIYGSATTADNTAGRAWVVRTLPNIAAQVSQSLTAIETSEPALPEQYLQITTSIFEQI 180

Query: 176 GRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRM 235
           G+A  +D + ++A T + GS PAF  VV +A+ D  V +G+PR++              M
Sbjct: 181 GKAVHVDPRLMNATTAVGGSTPAFFAVVCDAMIDAAVAVGMPRDLAHTMIFQSMQGTATM 240

Query: 236 VLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVA 284
            L++G HPA +KD  T+P GCTI GL+ ME+  +R  + R ++EA  +A
Sbjct: 241 -LQSGIHPALLKDQGTSPEGCTIGGLMVMEEAGVRGHVGRALREAVTLA 288



>gi|488704297|ref|WP_002628269.1| Pyrroline-5-carboxylate reductase [Cystobacter fuscus]
 gi|444712845|gb|ELW53758.1| Pyrroline-5-carboxylate reductase [Cystobacter fuscus DSM 2262]
          Length = 275

 Score =  173 bits (438), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 98/278 (35%), Positives = 155/278 (55%), Gaps = 13/278 (4%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKIT 71
           T+  +G G M  A++ G+L +          T  P   IA    EE  + ++  +  + T
Sbjct: 5   TIAFIGAGNMAEALIKGLLRA---------GTARPDSIIATGRREERLEGLRRTYGVR-T 54

Query: 72  LLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAP 131
           LL  +NV  V+EAD+++L  KPQ +  +L +       + KL IS+ AGV I  ++    
Sbjct: 55  LL--DNVAAVREADVVVLAVKPQALDKVLLQVAPAAD-QKKLFISVAAGVPISVMERRLG 111

Query: 132 SSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTG 191
              R+IR MPNTP ++  G   L+     S++D + +  VF ++G   +++E  LDAVTG
Sbjct: 112 QGMRVIRTMPNTPSLVGMGACALAPGEHASEEDMAVASRVFQSVGITTVVEENLLDAVTG 171

Query: 192 LSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVT 251
           LSGSGPA+  +++EAL+D GV +GLPR               +++++T  HP ++KD VT
Sbjct: 172 LSGSGPAYIFLIIEALSDAGVKVGLPRYTAQKLAAQTVLGSAQLLIETNAHPGQLKDQVT 231

Query: 252 TPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           +PGG  IAGL T+E G +R+TL   ++ AT+ +  LG 
Sbjct: 232 SPGGTAIAGLHTLEAGGLRTTLINAVEAATRRSRELGE 269



>gi|336323350|ref|YP_004603317.1| pyrroline-5-carboxylate reductase [Flexistipes sinusarabici DSM
           4947]
 gi|503652161|ref|WP_013886237.1| pyrroline-5-carboxylate reductase [Flexistipes sinusarabici]
 gi|336106931|gb|AEI14749.1| pyrroline-5-carboxylate reductase [Flexistipes sinusarabici DSM
           4947]
          Length = 275

 Score =  172 bits (437), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 103/275 (37%), Positives = 159/275 (57%), Gaps = 16/275 (5%)

Query: 16  LGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITLLVG 75
           +G G M   ++ GIL +  V           K   A     E  + +K E+   I  +  
Sbjct: 10  IGSGNMASVLIKGILKAGLVEE---------KSVFASDIDPEKLESLKSEYG--INTVFK 58

Query: 76  NNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLEN-KLIISILAGVTIDQLKEWAPSST 134
           +N + V+++DII+L  KPQ++  IL+E  + + L++ KL+ISI AG++ + +     +  
Sbjct: 59  DNKKVVEDSDIIVLAVKPQIMSRILSE--IDEKLDSSKLVISIAAGISTEYIDSLTSNDL 116

Query: 135 RIIRAMPNTPCMIREGMTVLSCP-TDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLS 193
           +IIRAMPNTP +I EG T + CP  + S+DD   +  +FS +G   ++DE  +DAVTGLS
Sbjct: 117 KIIRAMPNTPALIMEGATAI-CPGENVSEDDLKLAREIFSAVGVVVVVDETQMDAVTGLS 175

Query: 194 GSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTP 253
           GSGPA+  +++EAL+D GV MGL R V             ++ ++TG HP  +KD VT+P
Sbjct: 176 GSGPAYIFMMIEALSDAGVKMGLSRNVSMKLAAQTVMGAAKLQIETGMHPGRLKDMVTSP 235

Query: 254 GGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLG 288
           GG  IAG+ T+E G +R+TL   ++ AT  +  LG
Sbjct: 236 GGTAIAGIHTLEQGALRTTLINAVENATLRSKELG 270



>gi|310822207|ref|YP_003954565.1| pyrroline-5-carboxylate reductase [Stigmatella aurantiaca DW4/3-1]
 gi|503141883|ref|WP_013376544.1| pyrroline-5-carboxylate reductase [Stigmatella aurantiaca]
 gi|309395279|gb|ADO72738.1| Pyrroline-5-carboxylate reductase [Stigmatella aurantiaca DW4/3-1]
          Length = 277

 Score =  172 bits (435), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 101/279 (36%), Positives = 153/279 (54%), Gaps = 15/279 (5%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKIT 71
           T+  LG G M  A++ G+L S          T  P   IA     E  Q ++  +  +  
Sbjct: 5   TIAFLGAGNMAEALIKGLLRS---------GTARPDAIIATGRRAERLQVLQSTYGVRTQ 55

Query: 72  LLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLEN-KLIISILAGVTIDQLKEWA 130
               +NV   +EA II+L  KPQ +  +L +  +   L++ KL+IS+ AGV I  L+   
Sbjct: 56  T---DNVAAAREAGIIVLSVKPQAMDKLLVQ--VAPVLDSSKLVISVAAGVPIAALERRL 110

Query: 131 PSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVT 190
            +  RI+R MPNTP ++  G   L+     S++D + +  +F  +G   ++DE  LDAVT
Sbjct: 111 GAGARIVRTMPNTPSLVGAGACALARGEHASEEDLAVASRIFEAVGITTVVDENLLDAVT 170

Query: 191 GLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSV 250
           GLSGSGPA+  +V+EAL+D GV +GLPR               +++++T  HP ++KD V
Sbjct: 171 GLSGSGPAYLFLVIEALSDAGVKVGLPRYTALKLAAQTVLGSAQLLIETNAHPGQLKDQV 230

Query: 251 TTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           T+PGG  IAGL T+E G +R+TL   ++ AT+ A  LG 
Sbjct: 231 TSPGGTAIAGLHTLEAGGLRTTLINAVEAATRRAKELGE 269



>gi|146419499|ref|XP_001485711.1| hypothetical protein PGUG_01382 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 276

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 107/289 (37%), Positives = 167/289 (57%), Gaps = 22/289 (7%)

Query: 5   MSLPTNPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKE 64
           MS+  N T+ VLGCG MG A++S IL++    P        P K I C S EE A  +K+
Sbjct: 1   MSIKENYTITVLGCGVMGTAVVSAILNA-EFLP-------YPSKIICCTSREELALNLKK 52

Query: 65  EFNDKIT-LLVGN--NVEGVKEADIILLCTKPQVVKTILTEEGMQKSLEN-KLIISILAG 120
           + N +I  +  G+  N +  K+ADI++L  KP + +T+L+    Q  + N  L+IS+LAG
Sbjct: 53  KLNHEIIEVSYGSEANSKAAKKADIVILACKPYMYETVLS----QAPINNGSLLISLLAG 108

Query: 121 VTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDR--SFSIWVFSTLGRA 178
           VT  +L+++   S  + + M NTP     G  ++S  +D   +++     + + + +G A
Sbjct: 109 VTTKELQKY---SVNVAKVMTNTPAQYGCGTAMVSF-SDPEAEEKYGDLVMKLINPVGLA 164

Query: 179 RILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLK 238
             + EK++DA T L GSGPAF  +++E+L DGGV MG+P  V             +MVL+
Sbjct: 165 MKIPEKNMDAATALVGSGPAFCLLMMESLIDGGVRMGIPFAVAKDAAAKVMEGTAKMVLE 224

Query: 239 TGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
           TG HPA +K  V TPGG TI GLL +ED  +R ++AR ++EA  ++++ 
Sbjct: 225 TGDHPAALKSKVCTPGGTTIGGLLKLEDAGVRGSIARAVEEAANISASF 273



>gi|359482209|ref|XP_003632728.1| PREDICTED: pyrroline-5-carboxylate reductase-like [Vitis vinifera]
 gi|297739905|emb|CBI30087.3| unnamed protein product [Vitis vinifera]
          Length = 276

 Score =  171 bits (434), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 98/271 (36%), Positives = 145/271 (53%), Gaps = 17/271 (6%)

Query: 13  LCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITL 72
           L  +G G M  +I  G++ S           L+P   I+      S Q   E    KI  
Sbjct: 14  LGFIGAGKMAESIAKGVVHS----------GLMPASRISTAPRSSSRQDAFESLGVKI-- 61

Query: 73  LVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSL-ENKLIISILAGVTIDQLKEWAP 131
               N   V+++D+++   KPQVV+ ++ E  ++  L + KL++S++AGV +  L+EWA 
Sbjct: 62  -FETNQRVVEDSDVVVFSVKPQVVEDVVLE--LRPLLTKKKLLVSVVAGVKLKHLQEWAG 118

Query: 132 SSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTG 191
            S R IR MPNTP  + +  +V+S     +++D      +F  +G+    DEK+ DAVTG
Sbjct: 119 HS-RFIRVMPNTPAAVGKAASVMSLGKSATEEDGGLIANLFGAIGKIWRADEKYFDAVTG 177

Query: 192 LSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVT 251
           LSGSGPA+  + +EALADGGV  GLPRE+              M + TGKHP ++KD V 
Sbjct: 178 LSGSGPAYIYIAIEALADGGVAAGLPRELAWNLASQTVLGAADMAISTGKHPGQLKDDVA 237

Query: 252 TPGGCTIAGLLTMEDGKIRSTLARTIQEATQ 282
           +PGG TIAG+  +E G  R  L   +  A +
Sbjct: 238 SPGGTTIAGIYELEKGGFRGILMNAVVAAAK 268



>gi|508717158|gb|EOY09055.1| Pyrroline-5-carboxylate reductase isoform 1 [Theobroma cacao]
          Length = 276

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 103/279 (36%), Positives = 151/279 (54%), Gaps = 22/279 (7%)

Query: 13  LCVLGCGTMGRAILSGILDSLNVAPANEPPTLI---PKKFIACVSGEESAQRIKEEFNDK 69
           L  +G G M  +I  G++ S  V P N   T I   P + IA              F   
Sbjct: 13  LGFIGAGKMAESIARGVVQS-GVLPPNRISTAINSNPNRGIA--------------FQSI 57

Query: 70  ITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSL-ENKLIISILAGVTIDQLKE 128
              L+ +N + V+++DI++   KPQVVK ++ +  ++  L + KL++SI AGV +  L+E
Sbjct: 58  GVSLLPHNSDVVEDSDIVIFSVKPQVVKNVVLQ--LRPLLSKKKLLVSIAAGVKLKDLQE 115

Query: 129 WAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDA 188
           WA    R IR MPNTP  + E  +V+S     +++D      +F ++G+    DEK  DA
Sbjct: 116 WA-GHGRFIRVMPNTPSAVGEAASVMSMGGAATEEDGELVAKLFGSVGKIWRADEKLFDA 174

Query: 189 VTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKD 248
           +TGLSGSGPA+  + +EALADGGV  GLPRE+              M + +GKHP ++KD
Sbjct: 175 ITGLSGSGPAYIYLAIEALADGGVAAGLPRELALGLASQTVLGAASMAINSGKHPGQLKD 234

Query: 249 SVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
            VT+PGG TIAG+  +E    R TL   +  AT+ +  L
Sbjct: 235 EVTSPGGTTIAGIHELEKSGFRGTLMNAVVAATKRSQEL 273



>gi|153004253|ref|YP_001378578.1| pyrroline-5-carboxylate reductase [Anaeromyxobacter sp. Fw109-5]
 gi|500746745|ref|WP_011985700.1| pyrroline-5-carboxylate reductase [Anaeromyxobacter sp. Fw109-5]
 gi|152027826|gb|ABS25594.1| pyrroline-5-carboxylate reductase [Anaeromyxobacter sp. Fw109-5]
          Length = 276

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 104/285 (36%), Positives = 163/285 (57%), Gaps = 17/285 (5%)

Query: 7   LPTNPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEF 66
           +P    +  LG G M  A++ G+L +   A A E         I C   E   +R +EE 
Sbjct: 1   MPLGKKIAFLGSGNMAEALVKGLLGA-GTASAEE---------IVCA--EPRLER-REEL 47

Query: 67  NDKITL-LVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLEN-KLIISILAGVTID 124
             +  + ++G+N+E  ++AD+++L  KPQ ++ +L E  +  ++++ KL++SI AGV+I 
Sbjct: 48  ALRYGVKVIGSNLEATEQADVVVLSVKPQTMEQLLDE--IAPAVDHRKLVVSIAAGVSIA 105

Query: 125 QLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEK 184
            +     +  RI+R MPNTP ++  G T L+     +  D   +  +F  +G   I++E 
Sbjct: 106 AIARKLGAGVRIVRTMPNTPALVGAGATALARGAHATDWDLEQARSLFQAVGTTVIVEEH 165

Query: 185 HLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPA 244
           HLDAVTGLSGSGPAF  +V+EALADGGV +GL R V             ++VL+TG+HP 
Sbjct: 166 HLDAVTGLSGSGPAFLFLVIEALADGGVKVGLARSVAMTLAAQTVLGSAKLVLETGEHPG 225

Query: 245 EIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
            +KD VT+PGG  IAG+  +E G +R+ L   ++ AT+ +  LG 
Sbjct: 226 RLKDQVTSPGGTAIAGVHALEQGGLRAALIAAVEAATRRSRELGE 270



>gi|366989335|ref|XP_003674435.1| hypothetical protein NCAS_0A14990 [Naumovozyma castellii CBS 4309]
 gi|342300298|emb|CCC68057.1| hypothetical protein NCAS_0A14990 [Naumovozyma castellii CBS 4309]
          Length = 285

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 104/286 (36%), Positives = 159/286 (55%), Gaps = 14/286 (4%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRI--------K 63
           TL +LGCG MG+A+LS I  +   A      +L P K I C     SAQ++        K
Sbjct: 4   TLAILGCGVMGQAVLSAIYKAPK-AETEAVASLYPSKIITCNHDNPSAQQVTDLIATFEK 62

Query: 64  EEFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTI 123
                ++      NV  V+EA +I+L TKP + + +L  +G++  ++ KLIIS+ AG TI
Sbjct: 63  SPNGIEVESTFDQNVRAVQEATVIILGTKPYLAEPVL--DGVRDVIDGKLIISLAAGWTI 120

Query: 124 DQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDE 183
           DQL+ +   + ++ R M NTP     G  V+S  ++ S ++R     +   +G+   L E
Sbjct: 121 DQLQNY---TRKVSRVMTNTPAKYGYGCAVVSHSSEVSAEERKVVDQLIGHVGKCIELPE 177

Query: 184 KHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHP 243
           K++DA T L GSGPAF  ++LE+L + G+ MG+P +              +MV ++G+HP
Sbjct: 178 KNMDAATALVGSGPAFVLLMLESLMESGIKMGIPLKESRECAIKVLEGTAKMVEESGEHP 237

Query: 244 AEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
             +K  V TPGG TIAGL  MED  ++S + R ++EA+ VA+ LG 
Sbjct: 238 TVLKHQVCTPGGTTIAGLCVMEDRGVKSGIIRGVEEASIVAAKLGK 283



>gi|488777202|ref|YP_007946618.1| pyrroline-5-carboxylate reductase [Desulfotomaculum gibsoniae DSM
           7213]
 gi|493567014|ref|WP_006520333.1| pyrroline-5-carboxylate reductase [Desulfotomaculum gibsoniae]
 gi|488457048|gb|AGL02942.1| pyrroline-5-carboxylate reductase [Desulfotomaculum gibsoniae DSM
           7213]
          Length = 274

 Score =  171 bits (433), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 101/266 (37%), Positives = 148/266 (55%), Gaps = 15/266 (5%)

Query: 21  MGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITLLVGN-NVE 79
           M  A++SG++ +  V+P               +  + S QR +    DK  + V N N  
Sbjct: 16  MAEALISGLISAGLVSPQQ------------ILVSDLSEQR-RTHLADKFAVEVSNANNT 62

Query: 80  GVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPSSTRIIRA 139
            V  ADI++L  KP V+  IL + G     E+  I+SI AG+T   ++ +      ++RA
Sbjct: 63  VVTGADIVILAVKPFVMSEILEDTGSYFCPEHT-IVSIAAGITTIYIERFLTGQLPVVRA 121

Query: 140 MPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGSGPAF 199
           MPNTP ++  G T + C        R  ++ +F  +GRA  + EK +DAVTGLSGSGPA+
Sbjct: 122 MPNTPALLGAGATAVCCGRWAGDRHRDLALTIFGAVGRAVPVPEKLMDAVTGLSGSGPAY 181

Query: 200 ACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGGCTIA 259
             ++ EALAD GV MGLPR+V             RM+L+TG+HP  +KD VTTPGG TI 
Sbjct: 182 MYIIAEALADAGVRMGLPRDVALTLASQTMLGAARMILETGRHPGVLKDMVTTPGGTTIE 241

Query: 260 GLLTMEDGKIRSTLARTIQEATQVAS 285
           GL  +E+G IR+ L R +++A + +S
Sbjct: 242 GLFALEEGGIRAALYRAVEKACRRSS 267



>gi|255717398|ref|XP_002554980.1| KLTH0F18282p [Lachancea thermotolerans]
 gi|238936363|emb|CAR24543.1| KLTH0F18282p [Lachancea thermotolerans CBS 6340]
          Length = 285

 Score =  170 bits (431), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 110/292 (37%), Positives = 163/292 (55%), Gaps = 17/292 (5%)

Query: 5   MSLPTNPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEES-AQRIK 63
           MS     TL +LGCG MG+A+LS I ++   +   E   L P K I C   ++S +Q +K
Sbjct: 1   MSDSARYTLTILGCGVMGQALLSAIYNAPEASA--ETKKLYPSKIITCNHDKDSTSQVVK 58

Query: 64  --EEFND-----KITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIIS 116
             E F +     ++     +N   V EA ++LL TKP + + +L+   ++K    KL+IS
Sbjct: 59  LLEGFGESPNGIEVECTYNDNERAVDEASVVLLSTKPFLAQEVLSAVPVKK----KLLIS 114

Query: 117 ILAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLG 176
           ++AG TI QL E++   TRI   M NTP     GM VLS     S+++++    +   +G
Sbjct: 115 LVAGWTIGQLGEYSQYVTRI---MTNTPAKFGYGMAVLSHSDSVSEENKALVRELVGRVG 171

Query: 177 RARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMV 236
               L EK++DA T L GSGPAFA +VLE+  + G+ +G+P +              +MV
Sbjct: 172 SCIELPEKNMDAATALVGSGPAFALLVLESFMESGLKLGIPLKESKLCAMKVLEGTIKMV 231

Query: 237 LKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLG 288
            KTG+HP+ +K  V TPGG TIAGL  ME+  +RS + + ++EA  VAS LG
Sbjct: 232 EKTGEHPSVLKHQVCTPGGTTIAGLCVMEENGVRSGIIKGVEEAAAVASRLG 283



>gi|488932336|ref|WP_002843411.1| pyrroline-5-carboxylate reductase [Peptostreptococcus anaerobius]
 gi|289156741|gb|EFD05373.1| pyrroline-5-carboxylate reductase [Peptostreptococcus anaerobius
           653-L]
          Length = 268

 Score =  170 bits (431), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 90/264 (34%), Positives = 150/264 (56%), Gaps = 15/264 (5%)

Query: 13  LCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITL 72
           L  +G G MG AIL G++ +  V+P N     +   +      + S  R+K EF   +T 
Sbjct: 4   LAFIGAGNMGSAILGGVIKAGVVSPEN---VTVADLY------QPSLDRVKSEFGVNVT- 53

Query: 73  LVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLE-NKLIISILAGVTIDQLKEWAP 131
              ++   VK+ADI++L  KP ++  ++ +  ++ S++  KLI+SI A  TI+ ++    
Sbjct: 54  --SDSSLAVKDADIVILAVKPNIINGVMKD--IRDSIDGQKLIVSIAAATTIESIENVIG 109

Query: 132 SSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTG 191
              +++R MPNTP ++ EGM+ LS   + + D+  F + +F + G+A I+ E  +DAV G
Sbjct: 110 DDKKVVRVMPNTPALVGEGMSALSPNKNVTNDEMDFVVELFESFGKAEIVGEYLMDAVVG 169

Query: 192 LSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVT 251
           +SGS PA+  + +EA+AD  V  G+PR               +MVL+TGKHP E+KD V 
Sbjct: 170 VSGSSPAYVFMFIEAMADAAVQTGMPRAQAYKFAAQSVYGAAKMVLETGKHPGELKDMVC 229

Query: 252 TPGGCTIAGLLTMEDGKIRSTLAR 275
           +PGG TI  + T+E+  +R+ + +
Sbjct: 230 SPGGTTIVAVETLEEHGLRNAVIK 253



>gi|116781937|gb|ABK22304.1| unknown [Picea sitchensis]
          Length = 272

 Score =  170 bits (430), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 104/280 (37%), Positives = 153/280 (54%), Gaps = 23/280 (8%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANE---PPTLIPKKFIACVSGEESAQRIKEEFND 68
           TL  +G G M  AI  G LD   V P++      T +P++               E F  
Sbjct: 9   TLGFIGAGKMAEAIARG-LDKSGVLPSSRMRTAHTRLPRR---------------ETFAS 52

Query: 69  KITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSL-ENKLIISILAGVTIDQLK 127
               ++ +N + V+E ++I+L  KPQVVK +L +  ++  L E+KL++SI AGV +  L+
Sbjct: 53  FGVTIMESNSKVVEECEVIVLGVKPQVVKEVLVD--LKPILSEDKLLVSIAAGVKLKDLE 110

Query: 128 EWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLD 187
           EWA    R++R MPNTPC++ E   V+S     + +D      +F  +G+     EK LD
Sbjct: 111 EWA-GKARVVRVMPNTPCLVGESAAVMSLGEKATAEDEKLVKVLFEAVGKIWTAKEKLLD 169

Query: 188 AVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIK 247
           AVTGLSGSGPA+  + +EALADGGV  GLPRE+             +MV+ T K+P ++K
Sbjct: 170 AVTGLSGSGPAYIYLAIEALADGGVAAGLPRELALSLASQTVLGAAKMVIDTKKNPGQLK 229

Query: 248 DSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
           D V +P G TI G+  +E G  R+TL   +  AT+ +  L
Sbjct: 230 DEVASPAGTTITGIHELEKGGFRATLMSAVIAATKRSEEL 269



>gi|13161407|dbj|BAB33038.1| VuP5CR [Vigna unguiculata]
          Length = 274

 Score =  170 bits (430), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 96/273 (35%), Positives = 154/273 (56%), Gaps = 18/273 (6%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKIT 71
           TL  +G G M  +I  G + S           L P +    V    + +   E F   +T
Sbjct: 12  TLGFIGAGKMAESIARGAVRS---------GVLPPSRIRTAVHSNPARRTAFESFG--VT 60

Query: 72  LLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSL--ENKLIISILAGVTIDQLKEW 129
           +L  N+ E V+++++++L  KPQ+VK ++++    K +  ++KL++S+ AGV +  L+EW
Sbjct: 61  VLSSND-EVVRQSNVVVLSVKPQLVKDVVSK---LKPIITKDKLLVSVAAGVKLKDLQEW 116

Query: 130 APSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAV 189
           A  S R IR MPNTP  + E  +V+S     +++D +    +F ++G+    +EK+ D +
Sbjct: 117 A-GSDRFIRVMPNTPAAVGEAASVMSLGAAATEEDGNVIAKLFGSIGKIWRAEEKYFDGI 175

Query: 190 TGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDS 249
           TGLSGSGPA+  + +EALADGGV  GLPR++              MV ++GKHP ++KD 
Sbjct: 176 TGLSGSGPAYIYLAIEALADGGVAAGLPRDLSLSLASQTVLGAASMVTQSGKHPGQLKDD 235

Query: 250 VTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQ 282
           VT+PGG TI G+  +E+G  R TL   +  A +
Sbjct: 236 VTSPGGTTITGIHELENGGFRGTLMNAVVAAAK 268



>gi|494423969|ref|WP_007221863.1| pyrroline-5-carboxylate reductase [planctomycete KSU-1]
 gi|386404923|dbj|GAB62759.1| pyrroline-5-carboxylate reductase [planctomycete KSU-1]
          Length = 271

 Score =  170 bits (430), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 99/277 (35%), Positives = 155/277 (55%), Gaps = 13/277 (4%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKIT 71
           T+  +G G MG A+  GI+     A  +E   ++    +A     E    + +E     T
Sbjct: 5   TIGFIGSGKMGEALCKGIIH----AQLSEIKNIMMSDVVA-----ERCAFLHKEIGIHTT 55

Query: 72  LLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAP 131
               NN +    A++I+L  KPQ++  +L +     + ++ L+ISI AG+ I  ++    
Sbjct: 56  ---QNNKDITAFANVIVLAIKPQMMNEVLRDLKTDITPQH-LVISIAAGIPIRFIESRLQ 111

Query: 132 SSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTG 191
           +  R+IR MPNTPC++    T  S     ++ D      +F+ +G+   LDEK+LDAVTG
Sbjct: 112 TGVRVIRVMPNTPCLVATSATAFSPGKYATEADAQLVSRIFNAVGKVFQLDEKYLDAVTG 171

Query: 192 LSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVT 251
           LSGSGPA+  + +EAL+DGGV MGLPR+V             +MVL+T +HPA++KD VT
Sbjct: 172 LSGSGPAYVYMFIEALSDGGVKMGLPRDVSTILAAQTVLGAAKMVLETSQHPAKLKDDVT 231

Query: 252 TPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLG 288
           +PGG TI G+  +E+G+ R++L   ++ AT  +  LG
Sbjct: 232 SPGGTTIEGISKLEEGRFRASLINAVEAATVKSKKLG 268



>gi|365990714|ref|XP_003672186.1| hypothetical protein NDAI_0J00510 [Naumovozyma dairenensis CBS 421]
 gi|343770961|emb|CCD26943.1| hypothetical protein NDAI_0J00510 [Naumovozyma dairenensis CBS 421]
          Length = 285

 Score =  169 bits (429), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 103/286 (36%), Positives = 161/286 (56%), Gaps = 14/286 (4%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFN--DK 69
           TL +LGCG MG+A+LS I ++   A + E  +L P K I C   +ESAQ++ +  N  D+
Sbjct: 4   TLAILGCGVMGQAVLSAIYNAPK-AESEEILSLYPSKIITCNHDDESAQQVTDLINTFDE 62

Query: 70  ------ITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTI 123
                 +      N   VKEA +I+L TKP + + +L  +G+   + +KL+IS+ AG TI
Sbjct: 63  SPNGIVVESTYDQNTGAVKEATVIILGTKPYLAEPVL--KGVSDVITDKLLISLAAGWTI 120

Query: 124 DQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDE 183
            QL+++   + ++ R M NTP     G  V+S   +   +++     +   +G+   L E
Sbjct: 121 GQLQDY---TKKVSRVMTNTPAKYGYGCAVVSHSPEVVTEEKQLVSQLIGHVGKYIELPE 177

Query: 184 KHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHP 243
           K++DA T L GSGPAF  ++LE+L + G+ MG+P +              +MV ++G HP
Sbjct: 178 KNMDAATALVGSGPAFVLLMLESLMESGIKMGIPLKESRECAIKVLEGTAKMVEESGMHP 237

Query: 244 AEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
             +K  V TPGG TIAGL  MED  ++S + R ++EA +VA+ LG 
Sbjct: 238 TVLKHQVCTPGGTTIAGLCVMEDKGVKSGIIRGVEEAAKVAAELGK 283



>gi|488935027|ref|WP_002846102.1| pyrroline-5-carboxylate reductase [Peptostreptococcus anaerobius]
 gi|429150644|gb|EKX93546.1| pyrroline-5-carboxylate reductase [Peptostreptococcus anaerobius
           VPI 4330]
          Length = 268

 Score =  169 bits (429), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 90/264 (34%), Positives = 150/264 (56%), Gaps = 15/264 (5%)

Query: 13  LCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITL 72
           L  +G G MG AIL G++ +  V+P N     +   +      + S  R+K EF   +T 
Sbjct: 4   LAFIGAGNMGSAILGGVIKAGVVSPEN---VTVADLY------QPSLDRVKSEFGVNVT- 53

Query: 73  LVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLE-NKLIISILAGVTIDQLKEWAP 131
              ++   VK+ADI++L  KP ++  ++ +  ++ S++  KLI+SI A  TI+ ++    
Sbjct: 54  --SDSSLAVKDADIVILAVKPNIINGVMKD--IRDSIDGQKLIVSIAAATTIESIENLIG 109

Query: 132 SSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTG 191
              +++R MPNTP ++ EGM+ LS   + + D+  F + +F + G+A I+ E  +DAV G
Sbjct: 110 DDKKVVRVMPNTPALVGEGMSALSPNKNVTNDEMDFVVELFESFGKAEIVGEYLMDAVVG 169

Query: 192 LSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVT 251
           +SGS PA+  + +EA+AD  V  G+ R               +MVL+TGKHP E+KD V 
Sbjct: 170 VSGSSPAYVFMFIEAMADAAVQTGMSRAQAYKFAAQSVYGAAKMVLETGKHPGELKDMVC 229

Query: 252 TPGGCTIAGLLTMEDGKIRSTLAR 275
           +PGG TIA + T+E+  +R+ + +
Sbjct: 230 SPGGTTIAAVETLEEHGLRNAVIK 253



>gi|374851263|dbj|BAL54228.1| pyrroline-5-carboxylate reductase [uncultured candidate division
           OP1 bacterium]
 gi|374857405|dbj|BAL60258.1| pyrroline-5-carboxylate reductase [uncultured candidate division
           OP1 bacterium]
          Length = 271

 Score =  169 bits (428), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 97/278 (34%), Positives = 163/278 (58%), Gaps = 18/278 (6%)

Query: 13  LCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITL 72
           + +LG G +G A+   ++ +  V+  N          +      +SA+   + +  K   
Sbjct: 7   IAILGLGKIGGALARSLVRNKIVSTEN---------IVGTTGHRDSAREAAKRYGIKT-- 55

Query: 73  LVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLEN-KLIISILAGVTIDQLKEWAP 131
            + +NV  + +A I++L  KPQ +K +L E  ++ ++ + +L+I++ A  T   ++E   
Sbjct: 56  -LTDNVRAIADAHIVILAVKPQTMKKVLLE--LKDAIRDGQLLITLAAARTTRFIEEIVQ 112

Query: 132 SSTRIIRAMPNTPCMIREGMTVLSCP-TDCSKDDRSFSIWVFSTLGRARILDEKHL-DAV 189
            +  ++RAMPNTPC++  GMTVL CP    +K+  + +  +F+++G   ++D + L DAV
Sbjct: 113 RAIPVVRAMPNTPCLVNAGMTVL-CPGRHATKEHVAVAREIFASVGLVAVIDNEDLMDAV 171

Query: 190 TGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDS 249
           T LSGSGPA+  +++EALA+GGV +GLPR +             +MVL+TG+HPA +KD 
Sbjct: 172 TALSGSGPAYGYIMIEALAEGGVKVGLPRSLSTVLAAQSLLGAAKMVLETGEHPALLKDE 231

Query: 250 VTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
           VTTP G TI G++ +EDG IR TL +T+  AT+ +  L
Sbjct: 232 VTTPAGVTIDGIMALEDGGIRVTLIKTVDRATEKSKEL 269



>gi|406603645|emb|CCH44846.1| Pyrroline-5-carboxylate reductase [Wickerhamomyces ciferrii]
          Length = 281

 Score =  169 bits (428), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 102/283 (36%), Positives = 157/283 (55%), Gaps = 17/283 (6%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFND--- 68
           TL VLG GT+G+A+LS  L S N       P L P K IACV  E SAQ +  ++ D   
Sbjct: 10  TLAVLGAGTIGQALLSAYLSSEN-------PELPPTKIIACVRSESSAQALVTQYKDSPI 62

Query: 69  --KITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQL 126
             + +    +N E V  + ++++ TKP V ++ L  E ++  L+ KL+IS++AG TI+Q 
Sbjct: 63  PFETSYGEESNNEAVLNSQVVIIGTKPYVTESAL--EPIKDQLKGKLLISMVAGWTIEQF 120

Query: 127 KEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHL 186
           + +   S++I R M NTP   + G  V+S   D ++D+R     + + +G+   L EK++
Sbjct: 121 ETY---SSKISRVMTNTPAKYQYGTAVISNSLDVNEDERELIKALVTPIGKVVELPEKNM 177

Query: 187 DAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEI 246
           DA T L GSGPAF   +LE L + G+ +G+P +              +M   +G HP E+
Sbjct: 178 DAATALVGSGPAFVLTMLEGLVESGLSLGIPFKESLECSIKVMEGTAKMAEISGTHPGEL 237

Query: 247 KDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           K  V TPGG TIAG + M+   ++S + + +Q A + AS LG 
Sbjct: 238 KHKVCTPGGTTIAGCVEMDSHGVKSGIIKGVQAAAKRASELGK 280



>gi|425771618|gb|EKV10056.1| hypothetical protein PDIP_61940 [Penicillium digitatum Pd1]
 gi|425777122|gb|EKV15312.1| hypothetical protein PDIG_27500 [Penicillium digitatum PHI26]
          Length = 302

 Score =  169 bits (428), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 100/290 (34%), Positives = 164/290 (56%), Gaps = 21/290 (7%)

Query: 10  NPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFN-- 67
           N TLC+LGCG +G AIL G+++    APA +   L   ++ ACV  E S +R+ E F   
Sbjct: 5   NGTLCILGCGNLGIAILDGLVN----APAEKSKELPFARYTACVRSENSEKRLSERFATS 60

Query: 68  -DKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQL 126
            D IT+  GNNV  V+ AD+I+L   P  ++ +LT+ G++++L +KLIISI AG T  +L
Sbjct: 61  LDIITISRGNNVHAVQSADVIILGADPADIEAVLTQPGLREALTDKLIISIAAGWTRQKL 120

Query: 127 KE--WAPSSTR--------IIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIW--VFST 174
           +   +  ++T         ++R +PN    + + +T +   ++ +   R   I   +F  
Sbjct: 121 EATVYGSATTADNTAGRAWVVRTLPNIAAQVSQSLTAIET-SEPALPVRYLQITTSIFEQ 179

Query: 175 LGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXR 234
           +G+A  +D + ++A T + GS PAF  V+ +A+ D  V +G+PR++              
Sbjct: 180 IGKAVHVDPRLMNATTAVGGSTPAFFAVICDAMIDAAVAVGMPRDLAHTMIFQSMQGTAT 239

Query: 235 MVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVA 284
           M L++G HPA +KD  T+P GCTI GL+ ME+  +R  + R ++EA  +A
Sbjct: 240 M-LQSGIHPALLKDQGTSPEGCTIGGLMVMEEAGVRGHVGRALREAVTLA 288



>gi|427723961|ref|YP_007071238.1| pyrroline-5-carboxylate reductase [Leptolyngbya sp. PCC 7376]
 gi|504947065|ref|WP_015134167.1| pyrroline-5-carboxylate reductase [Leptolyngbya sp. PCC 7376]
 gi|427355681|gb|AFY38404.1| pyrroline-5-carboxylate reductase [Leptolyngbya sp. PCC 7376]
          Length = 269

 Score =  169 bits (427), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 97/278 (34%), Positives = 159/278 (57%), Gaps = 19/278 (6%)

Query: 15  VLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQR--IKEEFNDKITL 72
           ++G G MG A+LS +L     AP++             VS   +A+R  +++E+   +T 
Sbjct: 7   MIGGGVMGEALLSRLLKQGLYAPSD-----------VVVSDPVAARREYLQQEYGIAVT- 54

Query: 73  LVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPS 132
              NN +    +D+++L  KPQ+ + + TE   ++ +E  L++SILAGVT+++L+     
Sbjct: 55  --ANNADAAIASDVLMLAIKPQIFEKVATELQSKELMERPLVLSILAGVTLEKLQTGF-V 111

Query: 133 STRIIRAMPNTPCMIREGMTVLSCPTD-CSKDDRSFSIWVFSTLGRARILDEKHLDAVTG 191
              ++R MPNTP ++ +GMT +  P+D  S +    +  +F+ +G+   + E  +DAVTG
Sbjct: 112 GYPVVRVMPNTPAIVGQGMTAI-APSDLVSPEQVELAKQIFTAVGQVVEVPEYLMDAVTG 170

Query: 192 LSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVT 251
           LSGSGPAF  +++EALADGGV  GLPR++              ++  +G HPA++KD VT
Sbjct: 171 LSGSGPAFVALMIEALADGGVASGLPRQIAQQLALQTVKGTAELLQDSGLHPAQLKDRVT 230

Query: 252 TPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           +PGG TI G+ T+E    RS +   ++ A Q +  LG 
Sbjct: 231 SPGGTTITGVATLEANGFRSAVIEAVKAAKQRSEELGK 268



>gi|351720961|ref|NP_001235914.1| pyrroline-5-carboxylate reductase [Glycine max]
 gi|130972|sp|P17817.1|P5CR_SOYBN RecName: Full=Pyrroline-5-carboxylate reductase; Short=P5C
           reductase; Short=P5CR
 gi|18724|emb|CAA34401.1| unnamed protein product [Glycine max]
          Length = 274

 Score =  169 bits (427), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 97/272 (35%), Positives = 155/272 (56%), Gaps = 16/272 (5%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKIT 71
           TL  +G G M  +I  G + S  V P        P +    V    + +   E F   +T
Sbjct: 12  TLGFIGAGKMAESIARGAVRS-GVLP--------PSRIRTAVHFNLARRGAFESFG--VT 60

Query: 72  LLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSL-ENKLIISILAGVTIDQLKEWA 130
           +L  N+ + V+E+D+++L  KPQ+VK ++++  +   L ++KL++S+ AG  +  L+EWA
Sbjct: 61  VLPSND-DVVRESDVVVLSVKPQLVKDVVSK--LTPLLTKHKLLVSVAAGTKLKDLQEWA 117

Query: 131 PSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVT 190
             + R IR MPNTP  + +  +V+S     +++D +    +F ++G+    +EK+ DA+T
Sbjct: 118 -GNDRFIRVMPNTPAAVGQAASVMSLGGSATEEDGNIIAQLFGSIGKIWKAEEKYFDAIT 176

Query: 191 GLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSV 250
           GLSGSGPA+  + +EALADGGV  GLPR++              MV +TGKHP ++KD V
Sbjct: 177 GLSGSGPAYVYLAIEALADGGVAAGLPRDLSLSLASQTVLGAASMVSQTGKHPGQLKDDV 236

Query: 251 TTPGGCTIAGLLTMEDGKIRSTLARTIQEATQ 282
           T+PGG TI G+  +E+G  R TL   +  A +
Sbjct: 237 TSPGGTTITGIHELENGGFRGTLMNAVVAAAK 268



>gi|489866774|ref|WP_003770357.1| pyrroline-5-carboxylate reductase [Listeria innocua]
 gi|370794084|gb|EHN61874.1| pyrroline-5-carboxylate reductase [Listeria innocua ATCC 33091]
          Length = 266

 Score =  169 bits (427), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 95/272 (34%), Positives = 154/272 (56%), Gaps = 12/272 (4%)

Query: 16  LGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITLLVG 75
           +G G MG A++ G+      A AN       +  + C    E  + +K EFN     L  
Sbjct: 7   IGAGNMGAAMIRGL------AKANLGK---EEDILVCGRDMEKLKPLKTEFNG--IQLTT 55

Query: 76  NNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPSSTR 135
           +  +  ++ADII+L  KP  +  ILT     K    K++IS+ AGVTI  L+E   + T+
Sbjct: 56  DIAQLAEQADIIILSVKPYTIPEILTAV-KDKITPEKIVISVAAGVTIKDLEELTSTETK 114

Query: 136 IIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGS 195
           I+R MPNTP ++ E M+ +S  ++ + ++ ++   +FS+ G+A ++ E  +DAV G+SGS
Sbjct: 115 IVRVMPNTPALVGEAMSSISPNSNVTAEETAYISTIFSSFGKAEVVAENLMDAVVGVSGS 174

Query: 196 GPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGG 255
            PA+  + +EALADG V+ G+PR+              +MVL+TG+HP ++KD VT+PGG
Sbjct: 175 SPAYVYMFIEALADGAVLNGMPRDKAYKFAAQAVLGAAKMVLETGEHPGKLKDMVTSPGG 234

Query: 256 CTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
            TI  + ++ED   RS++   +Q A    S++
Sbjct: 235 TTIEAVKSLEDTGFRSSVISAVQAAANKNSSM 266



>gi|472241047|gb|EMR85786.1| putative pyrroline-5-carboxylate reductase protein [Botryotinia
           fuckeliana BcDW1]
          Length = 317

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 97/296 (32%), Positives = 163/296 (55%), Gaps = 23/296 (7%)

Query: 12  TLCVLGCGTMGRAILSGILDSL-------NVAPANEPPTLIPKKFIACVSGEESAQRIK- 63
           TL +LGCG++G A+L GIL  +       +  PA+  P  +P KF+ACV    SA +++ 
Sbjct: 21  TLAILGCGSLGTALLCGILTHIEESKKANSACPASNQPH-VPNKFMACVRTAASAAQLEL 79

Query: 64  --EEFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGV 121
               ++ ++ +  G+    + EAD+I+L  +P  +++ L    ++  L++K+++S+LAGV
Sbjct: 80  SLAAYDTEVAIYHGDQRAPLHEADVIVLACQPGDLRSCLATTIIRSQLQDKVLVSLLAGV 139

Query: 122 TIDQL---------KEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVF 172
           TI  +         K + P++  I RAMPNT   +RE +TV+  P   S        W+F
Sbjct: 140 TIPDIESVLQSVGGKSYYPAT--IARAMPNTASFVRESITVIETPEATSASHLLAINWLF 197

Query: 173 STLGRARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXX 232
            ++G+ + +   + D  T L  S PAF  ++L+AL DG V +GL R+             
Sbjct: 198 ESIGKIKHISAANFDTCTALGASTPAFFAIILDALIDGAVTLGLTRKDATLMAAQSMKGC 257

Query: 233 XRMVLKTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLG 288
             +VL  G+HPA +K+++TTPGG TI G+L +E G +R+ +A  + +  + A  LG
Sbjct: 258 AALVL-AGEHPASVKENITTPGGSTIMGVLALEQGNVRAVVAGALIKCKEAAEGLG 312



>gi|495951547|ref|WP_008676126.1| pyrroline-5-carboxylate reductase [Clostridium sp. 7_2_43FAA]
 gi|226914472|gb|EEH99673.1| pyrroline-5-carboxylate reductase [Clostridium sp. 7_2_43FAA]
          Length = 267

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 90/280 (32%), Positives = 151/280 (53%), Gaps = 17/280 (6%)

Query: 10  NPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDK 69
           N  +  +GCG MG+A+L+G++ S  +   N          +     EES   I +EF  K
Sbjct: 2   NKKIGFIGCGNMGKAMLNGLISSNYINIDN---------IMVSTRSEESKSNIIDEFKVK 52

Query: 70  ITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLII-SILAGVTIDQLKE 128
            TL   +N+E  K +DI+ L  KP + K ++ E  ++ +L+  +II SI AG+ +  L+E
Sbjct: 53  CTL---DNIEVAKFSDILFLAIKPNMYKKVINE--IKGNLKKDIIIVSIAAGINLSDLEE 107

Query: 129 WAPSSTRIIRAMPNTPCMIREGMTVLSCPT-DCSKDDRSFSIWVFSTLGRARILDEKHLD 187
           W     +I++ MPNTP ++ EGM+ + CP  + +K++      +F   G+  IL+EK+ D
Sbjct: 108 WLDKDYKIVKTMPNTPALVGEGMSAI-CPNLNVNKEELRLICNIFKNFGKYEILEEKYFD 166

Query: 188 AVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIK 247
               L GS PA+  + +EA+AD  V +G+PR               ++ L TGKHPAE+K
Sbjct: 167 GFIALCGSSPAYVFMFIEAMADAAVKLGIPRNKAYKMAEQSILGSAKLALDTGKHPAELK 226

Query: 248 DSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
           D V +PGG TI  +  +E    R+ + + +++  + +  +
Sbjct: 227 DMVCSPGGTTIEAVTELESNGFRNAVIKAMEKCAEKSKNM 266



>gi|3024430|sp|O04016.1|P5CR_ACTCH RecName: Full=Pyrroline-5-carboxylate reductase; Short=P5C
           reductase; Short=P5CR
 gi|1928962|gb|AAC14482.1| pyrroline-5-carboxylate reductase [Actinidia deliciosa]
          Length = 278

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 103/278 (37%), Positives = 154/278 (55%), Gaps = 18/278 (6%)

Query: 7   LPTNPT-LCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEE 65
           +PT+   L  +G G M  +I  G++ S  V PA+   T          +   SA+R  E 
Sbjct: 9   IPTDTYKLGFIGAGKMAESIARGVVKS-GVLPASRIRT----------AHLGSARR--EA 55

Query: 66  FNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSL-ENKLIISILAGVTID 124
           F      ++  N + V+++D+I+   KPQ+VK ++ +  ++  L E +L++SI+AGV + 
Sbjct: 56  FESFGVKVLDRNDQVVEDSDVIIFSVKPQIVKEVVLQ--LRPLLSEKQLLVSIVAGVKLK 113

Query: 125 QLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEK 184
           +L++WA  S R IR MPNTP  + E  +V+S     + +D      +F  +G+    DEK
Sbjct: 114 ELEDWAGHS-RFIRVMPNTPAAVGEAASVMSLGATATGEDGELITKLFGAIGKIWKADEK 172

Query: 185 HLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPA 244
             DAVTGLSGSGPA+  + +EALADGGV  GLPRE+              MV + GKHP 
Sbjct: 173 LFDAVTGLSGSGPAYIFLAIEALADGGVAAGLPRELALGLASQTVLGAASMVARGGKHPG 232

Query: 245 EIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQ 282
           ++KD V + GG TIAG+  +E G  R TL   +  AT+
Sbjct: 233 QLKDDVASAGGTTIAGIHELEKGGFRGTLMNAVVSATK 270



>gi|489856703|ref|WP_003760363.1| pyrroline-5-carboxylate reductase [Listeria innocua]
 gi|313620613|gb|EFR91933.1| pyrroline-5-carboxylate reductase [Listeria innocua FSL S4-378]
          Length = 266

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 95/272 (34%), Positives = 153/272 (56%), Gaps = 12/272 (4%)

Query: 16  LGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITLLVG 75
           +G G MG A++ G+      A AN       +  + C    E  + +K EFN     L  
Sbjct: 7   IGAGNMGAAMIRGL------AKANLGK---EEDILVCGRDMEKLKPLKTEFNG--IQLTT 55

Query: 76  NNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPSSTR 135
           +  +  ++ADII+L  KP  +  ILT     K    K++IS+ AGVTI  L+E   + T+
Sbjct: 56  DTAQLAEQADIIILSVKPYTIPEILTAV-KDKITPEKIVISVAAGVTIKDLEELTSTETK 114

Query: 136 IIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGS 195
           I+R MPNTP ++ E M+ +S  ++ + ++ +    +FS+ G+A ++ E  +DAV G+SGS
Sbjct: 115 IVRVMPNTPALVGEAMSSISPNSNVTAEETAHISTIFSSFGKAEVVAENLMDAVVGVSGS 174

Query: 196 GPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGG 255
            PA+  + +EALADG V+ G+PR+              +MVL+TG+HP ++KD VT+PGG
Sbjct: 175 SPAYVYMFIEALADGAVLKGMPRDKAYKFAAQAVLGAAKMVLETGEHPGKLKDMVTSPGG 234

Query: 256 CTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
            TI  + ++ED   RS++   +Q A    S++
Sbjct: 235 TTIEAVKSLEDTGFRSSVISAVQAAANKNSSM 266



>gi|356504710|ref|XP_003521138.1| PREDICTED: pyrroline-5-carboxylate reductase-like [Glycine max]
          Length = 274

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 97/281 (34%), Positives = 157/281 (55%), Gaps = 17/281 (6%)

Query: 4   IMSLPTNP-TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRI 62
           I+ +P +   L  +G G M  +I  G + S           L P +    V    + +  
Sbjct: 3   IVPIPADSYNLGFIGAGKMAESIARGAVRS---------GVLPPSRIRTAVHSNPARRDT 53

Query: 63  KEEFNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSL-ENKLIISILAGV 121
            E F   +T+L  N+ + V+E+++++   KPQ+VK ++ +  +   L +NKL++S+ AG 
Sbjct: 54  FESFG--VTVLPSND-DVVRESNVVVFSVKPQLVKDVVFK--LTPLLTKNKLLVSVAAGT 108

Query: 122 TIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARIL 181
            +  L+EWA  + R IR MPNTP  + E  +V+S     +++D +    +  ++G+    
Sbjct: 109 KLKDLQEWA-GNDRFIRVMPNTPAAVGEAASVMSLGGSATEEDGNIIAKLLGSIGKIWKA 167

Query: 182 DEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGK 241
           +EK+ DA+TGLSGSGPA+  + +EALADGGV  GLPR++              MV++TGK
Sbjct: 168 EEKYFDAITGLSGSGPAYVYLAIEALADGGVAAGLPRDLSLSLASQTVLGAASMVIQTGK 227

Query: 242 HPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQ 282
           HP ++KD VT+PGG TI G+  +E+G  R TL   +  AT+
Sbjct: 228 HPGQLKDDVTSPGGTTITGIHELENGGFRGTLMNAVVAATK 268



>gi|193216290|ref|YP_001997489.1| pyrroline-5-carboxylate reductase [Chloroherpeton thalassium ATCC
           35110]
 gi|501492688|ref|WP_012501124.1| pyrroline-5-carboxylate reductase [Chloroherpeton thalassium]
 gi|193089767|gb|ACF15042.1| pyrroline-5-carboxylate reductase [Chloroherpeton thalassium ATCC
           35110]
          Length = 283

 Score =  168 bits (426), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 99/279 (35%), Positives = 153/279 (54%), Gaps = 13/279 (4%)

Query: 9   TNPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFND 68
           T   L ++G G +  AI+ G+L +           L  +     V   ES +R++     
Sbjct: 3   TGKKLGIIGLGKLAEAIVLGLLKN---------GALKREDVAGSVKHAESLERVRTRLGV 53

Query: 69  KITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKE 128
           + TL   +    + + D+I+L  KPQ V  I  E+       ++LIIS+ A VT   +++
Sbjct: 54  EATL---DTPAMIADKDVIILAVKPQNVAKI-AEQICPIVQHHQLIISVAASVTTGYIED 109

Query: 129 WAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDA 188
             P    ++RAMPNTP ++ EGMTVL      +K+  + +  +F  +GR   +DE  +D 
Sbjct: 110 RLPPDVPVVRAMPNTPAVVNEGMTVLCKGKTATKEHLALAEEIFRHVGRVATIDEHLMDG 169

Query: 189 VTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKD 248
           VT LSGSGPA+  ++LE+LAD GV +G+PR++             ++ L+T +HPA +KD
Sbjct: 170 VTALSGSGPAYMFLMLESLADAGVKLGIPRDISTLLAAQTMLGASKLALETKQHPAILKD 229

Query: 249 SVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
            VTTP GCTI GLL +EDG +R TL + + +A + AS L
Sbjct: 230 MVTTPAGCTIDGLLELEDGGLRVTLMKAVVKAAERASEL 268



>gi|91203115|emb|CAJ72754.1| strongly similar to pyrroline-5-carboxylate reductase [Candidatus
           Kuenenia stuttgartiensis]
          Length = 271

 Score =  168 bits (425), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 98/276 (35%), Positives = 157/276 (56%), Gaps = 15/276 (5%)

Query: 16  LGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITLLVG 75
           +G G M  A+  GI+ +   A +N    +I    +A     E  + +KEE   + T    
Sbjct: 9   IGGGKMAEALCKGIIRAGLSAGSN----IIVSDVLA-----ERRRLLKEEIGVQTTQ--- 56

Query: 76  NNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLE-NKLIISILAGVTIDQLKEWAPSST 134
           +N +    AD+I+L  KPQ++   L  E ++  +    LIISI AG+ +  ++     + 
Sbjct: 57  DNHDIAAFADVIILAVKPQIIGEAL--ENIKNDITPRHLIISIAAGIPLHFIESKLRENV 114

Query: 135 RIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSG 194
           R+IR MPNTPC+I    T  +     ++ D+  +  +F+ +G+   L+EK+LDAVTG+SG
Sbjct: 115 RVIRVMPNTPCLIASSATAFAPGKHTTEGDKKLAHAIFNAVGKVFQLEEKYLDAVTGVSG 174

Query: 195 SGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPG 254
           SGPA+  + +EAL+DGGV MGLPRE+             +MVL+TG+HPA++KD+VT+P 
Sbjct: 175 SGPAYVYMFIEALSDGGVKMGLPREIATALAAQTALGAAKMVLETGQHPAQLKDAVTSPA 234

Query: 255 GCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGNI 290
           G TI G+  +EDG +R+ +   ++ A   +  LG +
Sbjct: 235 GTTIEGVSKLEDGGLRAAVINAVEAAALKSKKLGEL 270



>gi|498163372|ref|WP_010477528.1| pyrroline-5-carboxylate reductase [Thermococcus zilligii]
          Length = 259

 Score =  168 bits (425), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 97/277 (35%), Positives = 154/277 (55%), Gaps = 26/277 (9%)

Query: 13  LCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKE--EFNDKI 70
           + V+G GT+G A+   + +S +                  V+     +R++E  E+  ++
Sbjct: 3   VAVIGAGTIGSAVAKALRESGH----------------EVVATRRDLERVRELEEYGVRL 46

Query: 71  TLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWA 130
           T    NN E V+ A+ + L  KP  V  +L E  + + LE K +IS+ AG+ +D LK  A
Sbjct: 47  T---SNNREAVEWAEAVFLAVKPDKVGAVLEE--VSELLEGKFLISLAAGIGLDYLKRLA 101

Query: 131 PSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVT 190
           P + +++RAMPN   ++RE  T  S  TD   +D      + S+ G    ++E+H+DA+T
Sbjct: 102 PKA-KLVRAMPNIAVLVRESFTAYS--TDLEGEDLETVEGLLSSFGEFLRVEEEHMDAIT 158

Query: 191 GLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSV 250
           GLSGSGPA+  V LEA+  GG+  GLPREV             +++++T KHPAEI++ V
Sbjct: 159 GLSGSGPAYVTVFLEAMIYGGLRAGLPREVARKASLQTLLGTAKLLMETEKHPAEIREWV 218

Query: 251 TTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
            TPGG TI G+  +E+GKIR+ + + +  AT+ +  L
Sbjct: 219 ITPGGTTIDGIFELEEGKIRTAVMKAVDAATKKSKIL 255



>gi|352684240|ref|YP_004896225.1| pyrroline-5-carboxylate reductase [Acidaminococcus intestini
           RyC-MR95]
 gi|496305630|ref|WP_009014808.1| pyrroline-5-carboxylate reductase [Acidaminococcus sp. HPA0509]
 gi|226904031|gb|EEH89949.1| pyrroline-5-carboxylate reductase [Acidaminococcus sp. D21]
 gi|350278895|gb|AEQ22085.1| pyrroline-5-carboxylate reductase [Acidaminococcus intestini
           RyC-MR95]
 gi|512074755|gb|EPD74005.1| pyrroline-5-carboxylate reductase [Acidaminococcus sp. HPA0509]
          Length = 272

 Score =  168 bits (425), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 93/278 (33%), Positives = 151/278 (54%), Gaps = 12/278 (4%)

Query: 10  NPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDK 69
           NP +  +GCG MG AIL G+L   NVA  ++    +P         ++S  R++  +   
Sbjct: 5   NPKIAFIGCGAMGEAILKGMLLG-NVASESDIALSVPS--------QKSQDRLRASYPK- 54

Query: 70  ITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEW 129
              + G N E V+ AD+++L  KPQ+    +T E ++   +   I+SI+    + +L   
Sbjct: 55  -AAVCGKNEEAVQGADLVILAVKPQMAHKAVTAEMLETLPKEAAILSIMGSFDLAKLHAL 113

Query: 130 APSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAV 189
            P+   +IRAMPNTP  +  GMT L+     ++D ++F+  +F++ G    +DE  ++A+
Sbjct: 114 VPAHA-VIRAMPNTPLAVGMGMTALTADDAVTEDMKAFAGTIFNSCGETIWVDESAMEAI 172

Query: 190 TGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDS 249
           T +SG GP +  VV++ALAD GVM GLPR +              M LKTG HPA+++D 
Sbjct: 173 TAISGCGPGYFFVVMDALADAGVMAGLPRALAIKLAAATMAGSGMMGLKTGLHPAQLRDQ 232

Query: 250 VTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
           VT+PGG TIAG+  +E+  +R      +    + ++ L
Sbjct: 233 VTSPGGTTIAGIKALENHGVRGAFYDAVDAVLKQSAAL 270



>gi|444321382|ref|XP_004181347.1| hypothetical protein TBLA_0F02890 [Tetrapisispora blattae CBS 6284]
 gi|387514391|emb|CCH61828.1| hypothetical protein TBLA_0F02890 [Tetrapisispora blattae CBS 6284]
          Length = 284

 Score =  168 bits (425), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 101/287 (35%), Positives = 158/287 (55%), Gaps = 19/287 (6%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAP--ANEPPTLIPKKFIACVSGEESAQRIKEEFND- 68
           TL +LGCG MG A+LS I      AP   +E  +L P K I C + +E+A ++ +  N  
Sbjct: 4   TLTILGCGVMGSAVLSAIYS----APKCTSEIKSLYPSKIITCNNDKEAADQVTDMINKL 59

Query: 69  -------KITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGV 121
                   I    GNN   +K++ +I+L  KP +V++++ +  ++  +  + IIS+ AG 
Sbjct: 60  GESPNCITIDSTYGNNSAAIKQSKVIILALKPYLVESVMND--IKPFIGEQHIISLAAGW 117

Query: 122 TIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARIL 181
           TID L  ++P   +I R M NTP     G  V++      +++++    + S +G+   L
Sbjct: 118 TIDGLSYYSP---KISRVMTNTPAKYGYGCAVVAHSEHIVENEKNLVCELISHVGKYVEL 174

Query: 182 DEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGK 241
            EK++DA T L GSGPAF  ++LE L + G+ MG+P +              +MV  +G 
Sbjct: 175 PEKNMDAATALVGSGPAFVLLMLEGLMESGIKMGIPLKESKECALKVLEGTAKMVELSGT 234

Query: 242 HPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLG 288
           HP+E+K  V TPGG TIAGL  MED  ++S + R ++EA  VA+ LG
Sbjct: 235 HPSELKHQVCTPGGTTIAGLCVMEDKGVKSGIIRGVEEAANVAAQLG 281



>gi|255720823|ref|XP_002545346.1| hypothetical protein CTRG_00127 [Candida tropicalis MYA-3404]
 gi|240135835|gb|EER35388.1| hypothetical protein CTRG_00127 [Candida tropicalis MYA-3404]
          Length = 274

 Score =  168 bits (425), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 107/285 (37%), Positives = 160/285 (56%), Gaps = 23/285 (8%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACV--SGEESAQRIKEEFNDK 69
           T+ VLGCG MG A+ S IL       A   P   PKK IAC   S EE+   +K+ F D+
Sbjct: 5   TIAVLGCGVMGTAVSSAILK------AKFDP--YPKKIIACTIPSQEEN---LKKTFADQ 53

Query: 70  ----ITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENK-LIISILAGVTID 124
               ++  V NN + V +AD+I+L  KP + + I  E  ++ SL  K L+IS+LAG TI 
Sbjct: 54  PLVEVSAGVENNNKAVAQADVIILGCKPYMYEGIYEE--VKGSLTGKQLLISLLAGTTIK 111

Query: 125 QLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEK 184
           +L  + P    + + M NTP     G   ++   + S++ +   + +  T+G    + EK
Sbjct: 112 ELSIFTP---YVAKVMTNTPARFGCGTAAIAFAPEVSEEYQELVMKLIGTVGMTVKIPEK 168

Query: 185 HLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPA 244
           ++D  T L GSGPAF  +++E++ DG V MG+P +V             +MVL+TG+HPA
Sbjct: 169 NMDIATSLIGSGPAFCLLMMESMIDGAVRMGMPYDVASVAAAKVMEGTAKMVLETGEHPA 228

Query: 245 EIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
            +K  V TPGG TI GLLTMED  +RS +AR ++EA  ++++   
Sbjct: 229 ALKSKVCTPGGTTIGGLLTMEDRGLRSAIARGVEEAANISASFAK 273



>gi|149236906|ref|XP_001524330.1| hypothetical protein LELG_04301 [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146451865|gb|EDK46121.1| hypothetical protein LELG_04301 [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 275

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 105/283 (37%), Positives = 156/283 (55%), Gaps = 20/283 (7%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEF----N 67
           TL VLG G MG A+ S IL+SL V P        PKK I C    +    +KE F    N
Sbjct: 7   TLTVLGAGVMGTAVSSAILNSL-VKP-------YPKKVILCTP--QPTDTLKETFAKFDN 56

Query: 68  DKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLE-NKLIISILAGVTIDQL 126
            + +     N + VKEADIILL  KP + + +  E  ++ +L  ++L+IS+LAG TI++L
Sbjct: 57  VEYSFTAEGNKKAVKEADIILLAVKPFMYQQVYDE--VKDALTGDQLLISLLAGTTINEL 114

Query: 127 KEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHL 186
             +   +  + + M NTP     G   ++   D S++ +     +   +G    + EK++
Sbjct: 115 SIF---TKNVAKVMTNTPARYGCGTAAIAFSPDVSQEQQELVKKLIEPVGLTVCIPEKNM 171

Query: 187 DAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEI 246
           D  T L GSGPAF  +++E++ DG V MG+P +V             +M+L+TG HPA +
Sbjct: 172 DIATSLIGSGPAFCLLMMESMIDGAVRMGMPYDVARVSAAKVMEGTAKMLLETGDHPAAL 231

Query: 247 KDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           K  V TPGG TI GLL MEDG +RST+AR I+EA  ++++   
Sbjct: 232 KSKVCTPGGTTIGGLLKMEDGALRSTIARGIEEAANISASFAK 274



>gi|221101584|ref|XP_002156499.1| PREDICTED: pyrroline-5-carboxylate reductase-like [Hydra
           magnipapillata]
          Length = 271

 Score =  167 bits (424), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 101/273 (36%), Positives = 144/273 (52%), Gaps = 13/273 (4%)

Query: 10  NPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDK 69
           N  +  +G G M  AI  GIL S           L PK  IA          + +E    
Sbjct: 3   NKVVGFIGAGNMAFAIAKGILSS---------GFLSPKNIIASARTRVRLDTVWKELGVA 53

Query: 70  ITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEW 129
            T    +N+E V +ADII+L  KP V+ +IL +      L +KL ISI  GVT++ ++  
Sbjct: 54  TTT---DNIEVVNQADIIILAVKPFVLSSILDQIKDVGGLTSKLFISIATGVTLETIQT- 109

Query: 130 APSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAV 189
             S  ++IR MPNTPC+++ G+ +  C + CSK+D  F    F   G    +DE H+DA+
Sbjct: 110 RLSGCKVIRTMPNTPCLVQCGVVLYVCGSLCSKEDSDFVKLFFKCTGIVEEVDENHIDAM 169

Query: 190 TGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDS 249
           T + G   A+  +V+EA++DGGVM G+PR               RM+L+TGKHP E+KD+
Sbjct: 170 TSIMGCSIAWYYMVVEAMSDGGVMNGVPRAAAYKLAAKSMEGAARMLLETGKHPGELKDA 229

Query: 250 VTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQ 282
           VT+ GG TI G+  +E   IR    R +  ATQ
Sbjct: 230 VTSAGGSTIRGVNELEASGIRGAFMRAVTSATQ 262



>gi|462397960|gb|EMJ03628.1| hypothetical protein PRUPE_ppa009813mg [Prunus persica]
          Length = 276

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 105/290 (36%), Positives = 153/290 (52%), Gaps = 20/290 (6%)

Query: 5   MSLPTNP-TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIK 63
           + +PT+   L  +G G M  +I  GI+ S  V P N   T               A  I+
Sbjct: 4   LPIPTDTFKLGFIGAGKMAESIARGIVRS-GVLPPNRISTF-------------HANPIR 49

Query: 64  EE-FNDKITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSL-ENKLIISILAGV 121
            + F      L+  N + V+++DI++   KPQVVK ++ +  ++  L + KL++SI AGV
Sbjct: 50  RQAFESFGVELLHKNDDVVEDSDIVIFSVKPQVVKDVVLQ--LRPLLSKKKLLVSIAAGV 107

Query: 122 TIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARIL 181
            +  L+EWA +S R IR MPNTP  + E  +V+S     ++ D      +F ++G+    
Sbjct: 108 KLKDLQEWAGNS-RFIRVMPNTPSAVGEAASVMSLGVGATEQDGDLIAKLFGSVGKTWKA 166

Query: 182 DEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGK 241
           DEK  DAVTG+SGSGPA+  + +EALADGGV  GLPRE+              MV  TGK
Sbjct: 167 DEKLFDAVTGVSGSGPAYIYLAIEALADGGVAAGLPRELALGLASQTVLGAASMVTSTGK 226

Query: 242 HPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGNIQ 291
           HP ++KD VT+P G TIAG+  +E G  R  L   +  A + +      Q
Sbjct: 227 HPGQLKDDVTSPAGTTIAGIHELEKGGFRGILMNAVLAAARRSREFSQSQ 276



>gi|489542990|ref|WP_003447668.1| pyrroline-5-carboxylate reductase [Clostridium pasteurianum]
 gi|440218579|gb|ELP57798.1| pyrroline-5-carboxylate reductase [Clostridium pasteurianum DSM
           525]
          Length = 268

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 91/273 (33%), Positives = 149/273 (54%), Gaps = 15/273 (5%)

Query: 16  LGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITLLVG 75
           +GCG M  A++ GI+ S             P+K +       S Q +KE+F     L   
Sbjct: 8   IGCGNMANAMIGGIVTS---------KLYSPQKIMVSNPSNPSLQEVKEKFK---VLTTN 55

Query: 76  NNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLE-NKLIISILAGVTIDQLKEWAPSST 134
           +N++  + ADI++L  KP     ++ +  ++ S++ N +I+SI AG +I+ +K++     
Sbjct: 56  DNLKVAEFADILILSVKPNKYAHVIGK--IKDSVKKNVVIVSIAAGTSIEDIKKYFERDI 113

Query: 135 RIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSG 194
           + IRAMPNTP ++ EGM  L    + + D+    + +F   GR+ +++EK +D VT + G
Sbjct: 114 KTIRAMPNTPALVGEGMASLCRNREVTDDEMQLVLNIFKAFGRSEVVEEKLMDVVTSVGG 173

Query: 195 SGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPG 254
           S PA   + +EALADGGV+ GLPRE              +MVL+TGKHP ++KD V +PG
Sbjct: 174 SSPALVYMFIEALADGGVLEGLPREKAYKMAAQAVLGSAKMVLETGKHPGQLKDEVCSPG 233

Query: 255 GCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
           G TI  +  +E  K RS +   ++  T+ +  +
Sbjct: 234 GTTIEAVYCLEKNKFRSAVIEAVRVCTEKSKNM 266



>gi|337286657|ref|YP_004626130.1| pyrroline-5-carboxylate reductase [Thermodesulfatator indicus DSM
           15286]
 gi|503673832|ref|WP_013907908.1| pyrroline-5-carboxylate reductase [Thermodesulfatator indicus]
 gi|335359485|gb|AEH45166.1| pyrroline-5-carboxylate reductase [Thermodesulfatator indicus DSM
           15286]
          Length = 280

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 96/272 (35%), Positives = 145/272 (53%), Gaps = 11/272 (4%)

Query: 16  LGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITLLVG 75
           +G G M  AI+ G++DS    P N          I      E  + +K  F      ++ 
Sbjct: 11  IGGGQMASAIIKGLIDSKAALPEN---------IIVSEPSPERREYLKNTFPG--IKIIF 59

Query: 76  NNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPSSTR 135
           +N   VKEAD+I+L  KPQ++K +L E  +       LIISI AG+ I  L+   P   +
Sbjct: 60  DNCALVKEADLIVLAVKPQIIKEVLKEITLCVDTSRHLIISIAAGIPIALLEAHLPEKIK 119

Query: 136 IIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGS 195
           ++R MPNTP +++ G++V +     S +D + +       G+A  L E + DAVTGLSGS
Sbjct: 120 VVRVMPNTPALVQAGISVYTGGRYTSSEDLALAREFLEAFGKAIELPETYFDAVTGLSGS 179

Query: 196 GPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGG 255
           GPA+    +EAL DGGV +GLPR V             +++  TGK+P E+K  VT+PGG
Sbjct: 180 GPAYVAAFVEALIDGGVKVGLPRPVAEILAQETILGTLKLMQGTGKNPYELKSMVTSPGG 239

Query: 256 CTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
            TI GL  +E+G  ++T+   ++E+   +  L
Sbjct: 240 TTICGLKALEEGAFKATVMDAVEESANRSKEL 271



>gi|496232772|ref|WP_008946807.1| pyrroline-5-carboxylate reductase [Listeria marthii]
 gi|313615462|gb|EFR88836.1| pyrroline-5-carboxylate reductase [Listeria marthii FSL S4-120]
          Length = 266

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 94/272 (34%), Positives = 153/272 (56%), Gaps = 12/272 (4%)

Query: 16  LGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITLLVG 75
           +G G MG A++ G+  +  +A  N          I C    E  + ++ EFN     L  
Sbjct: 7   IGAGNMGTAMIRGLARANLIAREN---------IIVCGRNIEKLKPLETEFNG--LALTT 55

Query: 76  NNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPSSTR 135
           +  + V++ADII+L  KP  +  ILT    + + E K++IS+ AGVTI  L+E   + T+
Sbjct: 56  DTEKLVEQADIIILSVKPYTIPEILTTVKNKLTSE-KIVISVAAGVTIKDLEELTSAETK 114

Query: 136 IIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGS 195
           I+R MPNTP ++ E M+ +S   + ++ +      +F++ G A ++ E  +DAV G+SGS
Sbjct: 115 IVRVMPNTPALVGEAMSSISPNANVTQQEIDEVSAIFASFGEAEVVSENLMDAVIGVSGS 174

Query: 196 GPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGG 255
            PA+  + +EALADG V+ G+PR+              +MVL+TG+HP ++KD VT+PGG
Sbjct: 175 SPAYVYMFIEALADGAVLNGMPRDKAYKFAAQAVLGAAKMVLETGEHPGKLKDMVTSPGG 234

Query: 256 CTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
            TI  + ++ED   RS +   +Q A +  S++
Sbjct: 235 TTIEAVKSLEDNGFRSAVINAVQAAAKKNSSM 266



>gi|496845354|ref|WP_009383599.1| pyrroline-5-carboxylate reductase [Candidatus Poribacteria sp.
           WGA-A3]
 gi|283829270|gb|EFC33677.1| NADP oxidoreductase, coenzyme F420-dependent [Candidatus
           Poribacteria sp. WGA-A3]
          Length = 284

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 93/269 (34%), Positives = 148/269 (55%), Gaps = 13/269 (4%)

Query: 13  LCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITL 72
           + ++G G M  AI+SG+L    V  A    T +  K +A           ++ F  +++ 
Sbjct: 7   IAIIGAGNMAEAIVSGLLKKRLVNAAQICATDVDSKRLA---------HFRKTFKIRVS- 56

Query: 73  LVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPS 132
              +N +    +D++LL  KPQV+  + +   + ++   +LII++ AGV I  +      
Sbjct: 57  --DDNRKSATSSDLVLLAVKPQVMSEVFSGLDLSRN-ARQLIITVAAGVPIAAIISGLHP 113

Query: 133 STRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGL 192
             R++RAMPNTP ++ EG+T L+     + +  + +  VF  +G+  ++DE HLDAVTGL
Sbjct: 114 RARVVRAMPNTPAVVLEGVTALARGPGVTAEQFTMARAVFEAMGQVVVVDESHLDAVTGL 173

Query: 193 SGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTT 252
           SG GPA+  + +EALADGGV MGL R               +MVL+T  HP  +KD V +
Sbjct: 174 SGGGPAYVYLFIEALADGGVKMGLSRAHAQLLAAQTVLGAAKMVLETKAHPGALKDQVAS 233

Query: 253 PGGCTIAGLLTMEDGKIRSTLARTIQEAT 281
            GG TIAGL  +E+G++R T+   ++ AT
Sbjct: 234 AGGTTIAGLHRLEEGRLRGTVIDAVESAT 262



>gi|488729092|ref|WP_002652522.1| pyrroline-5-carboxylate reductase [Blastopirellula marina]
 gi|87289442|gb|EAQ81333.1| pyrroline-5-carboxylate reductase [Blastopirellula marina DSM 3645]
          Length = 267

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 105/280 (37%), Positives = 146/280 (52%), Gaps = 28/280 (10%)

Query: 16  LGCGTMGRAILSGILDSLNVAPAN----EPPTLIPKKFIACVSG---EESAQRIKEEFND 68
           LG G M +A+ SG + +  V PA+    +P       F   V G    +SA ++  E   
Sbjct: 7   LGAGQMAQALASGFVRADLVHPADIIAVDPFPAARTSFGQLVPGASVSDSAAKLAAEV-- 64

Query: 69  KITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKE 128
                           D+I+L  KPQ+++  +   G+    +N L++SI AG ++ +L E
Sbjct: 65  ----------------DVIVLAVKPQMLQAAIAGLGLIG--DNVLLVSIAAGTSLARLAE 106

Query: 129 WAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDA 188
           W   STRIIR MPNTPC+I E  +        + DD +    +   +G  R +DEK +DA
Sbjct: 107 WT-RSTRIIRVMPNTPCLIGESASAFCAGEGATTDDVALVEKLLGAVGVVRKVDEKLMDA 165

Query: 189 VTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKD 248
           VTGLSGSGPA+  V++EALAD GV +GLPR+               MVL+TG HP  +KD
Sbjct: 166 VTGLSGSGPAYVYVLIEALADAGVRVGLPRDAALQLAAQTVRGAAGMVLQTGDHPGVLKD 225

Query: 249 SVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLG 288
            VT+PGG TIAGL  +E G  RS     +  AT  +  LG
Sbjct: 226 RVTSPGGTTIAGLQALEAGGFRSAAYDAVIAATARSKELG 265



>gi|367005013|ref|XP_003687239.1| hypothetical protein TPHA_0I03040 [Tetrapisispora phaffii CBS 4417]
 gi|357525542|emb|CCE64805.1| hypothetical protein TPHA_0I03040 [Tetrapisispora phaffii CBS 4417]
          Length = 285

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 108/288 (37%), Positives = 154/288 (53%), Gaps = 20/288 (6%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDK-- 69
           TL  LGCG MG+A+LS I ++  V  A     L P K IAC   +E+A  + +       
Sbjct: 4   TLTFLGCGVMGQAVLSAIYNAPKVTDA-AIAKLYPSKIIACNHNDETAMGVTKLIESLPP 62

Query: 70  ------ITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLEN---KLIISILAG 120
                 +    G N   VKEADI+ L TKP +V     EE M+K  E+   KL+ISI AG
Sbjct: 63  SPNGIIVESTFGENDRAVKEADIVFLGTKPFIV-----EETMRKVKEHMGEKLLISICAG 117

Query: 121 VTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARI 180
            TI+QL  +   S  + R M NTP     G  +++     +++ R+    + S +G+   
Sbjct: 118 WTIEQLTAY---SRNVSRVMTNTPAKYGYGCAIVAHSPTVNENQRAIVSQLISQVGKYIE 174

Query: 181 LDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTG 240
           L EK++DA T L GSGPAF  ++LE+L + G+ MG+P +              +MV  +G
Sbjct: 175 LPEKNMDAATALVGSGPAFVLLMLESLMESGIQMGIPLKESKECALKVMEGTVKMVEMSG 234

Query: 241 KHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLG 288
           +HP  +K  V TPGG TIAGL  MED  ++S + R ++EA  VA+ LG
Sbjct: 235 EHPGVLKHQVCTPGGTTIAGLCVMEDKGVKSGIIRGVEEAANVAAKLG 282



>gi|16799491|ref|NP_469759.1| pyrroline-5-carboxylate reductase [Listeria innocua Clip11262]
 gi|499299444|ref|WP_010990394.1| pyrroline-5-carboxylate reductase [Listeria innocua]
 gi|16412843|emb|CAC95647.1| lin0414 [Listeria innocua Clip11262]
          Length = 266

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 95/272 (34%), Positives = 153/272 (56%), Gaps = 12/272 (4%)

Query: 16  LGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITLLVG 75
           +G G MG A++ G+      A AN       +  + C    E  + +K EFN     L  
Sbjct: 7   IGAGNMGAAMIRGL------AKANLGKE---EDILVCGRDMEKLKPLKTEFNG--IQLTT 55

Query: 76  NNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPSSTR 135
           +  +  ++ADII+L  KP  +  ILT     K    K++IS+ AGVTI  L+E   + T+
Sbjct: 56  DIAQLAEQADIIILSVKPYTIPEILTAV-KDKITPEKIVISVAAGVTIKDLEELTSTETK 114

Query: 136 IIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGS 195
           I+R MPNTP ++ E M+ +S  ++ + ++ +    +FS+ G+A ++ E  +DAV G+SGS
Sbjct: 115 IVRVMPNTPALVGEAMSSISPNSNVTAEETAHISTIFSSFGKAEVVAENLMDAVVGVSGS 174

Query: 196 GPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGG 255
            PA+  + +EALADG V+ G+PR+              +MVL+TG+HP ++KD VT+PGG
Sbjct: 175 SPAYVYMFIEALADGAVLKGMPRDKAYKFAAQAVLGAAKMVLETGEHPGKLKDMVTSPGG 234

Query: 256 CTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
            TI  + ++ED   RS++   +Q A    S++
Sbjct: 235 TTIEAVKSLEDTGFRSSVISAVQAAANKNSSM 266



>gi|493547940|ref|WP_006501660.1| pyrroline-5-carboxylate reductase [Austwickia chelonae]
 gi|403192605|dbj|GAB76909.1| pyrroline-5-carboxylate reductase [Austwickia chelonae NBRC 105200]
          Length = 266

 Score =  167 bits (423), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 100/278 (35%), Positives = 154/278 (55%), Gaps = 16/278 (5%)

Query: 13  LCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITL 72
           L VLG G MG AILS +LD+             P++  A    ++  +R+ +E    +T 
Sbjct: 4   LAVLGAGVMGTAILSALLDA---------GAFQPEQVSASTLDDDCRRRLTDELKVSVT- 53

Query: 73  LVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSL-ENKLIISILAGVTIDQLKEWAP 131
              +N   V +A+++L+  KP VV ++L+E  ++  L E  L+IS+ AGVT+D L+   P
Sbjct: 54  ---DNARAVSDAEVVLISVKPDVVSSVLSE--IRDQLPEGALVISVAAGVTLDTLESELP 108

Query: 132 SSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTG 191
             T +IR MPNTP ++REGM VLS   +CS      +  + S  G    + EK+ D VTG
Sbjct: 109 EGTAVIRVMPNTPVVVREGMLVLSPGKECSAGQIDRAQELLSWCGSVLTVPEKYQDMVTG 168

Query: 192 LSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVT 251
           +SGSGPA+   ++EA+ +G V+ GLPR V              ++ + G HPA +++ VT
Sbjct: 169 VSGSGPAYVFALVEAMIEGAVVQGLPRAVATELTVQTLYGAASLLRQQGGHPALLREQVT 228

Query: 252 TPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           +PGG T AGL  ++ G  R  +   ++ AT+ A  LG+
Sbjct: 229 SPGGTTAAGLRALDAGGFRVAVVDAVEAATRRAGELGS 266



>gi|488773199|ref|YP_007942993.1| pyrroline-5-carboxylate reductase [Clostridium pasteurianum BC1]
 gi|505430483|ref|WP_015617585.1| pyrroline-5-carboxylate reductase [Clostridium pasteurianum]
 gi|488452614|gb|AGK99316.1| pyrroline-5-carboxylate reductase [Clostridium pasteurianum BC1]
          Length = 268

 Score =  166 bits (421), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 91/274 (33%), Positives = 149/274 (54%), Gaps = 15/274 (5%)

Query: 16  LGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITLLVG 75
           +GCG M +A++ GI+ S             P+K +       S Q +KE FN    +   
Sbjct: 8   IGCGNMAKAMIGGIVIS---------KLYSPQKIMVSNPSNPSLQEVKENFN---VITTN 55

Query: 76  NNVEGVKEADIILLCTKPQVVKTILTE-EGMQKSLENKLIISILAGVTIDQLKEWAPSST 134
           +N++  + ADI++L  KP     ++ + +   KS  N +I+SI AG++I+ +K++     
Sbjct: 56  DNMKVAEFADILILSVKPNKYAHVIDKIKAAVKS--NVVIVSIAAGMSIENIKKYFGKDI 113

Query: 135 RIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSG 194
           +I+RAMPNTP ++ EGM  L    + + D+      +F   G++ +++EK +D VT + G
Sbjct: 114 KIVRAMPNTPALVGEGMASLCRNRNVTDDEMESVSNIFKAFGKSEVVEEKLMDVVTSVGG 173

Query: 195 SGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPG 254
           S PA   + +EALADGGV+ GLPRE              +MVL+TGKHP ++KD V +PG
Sbjct: 174 SSPALVYMFIEALADGGVLEGLPREKAYKMAAQAVLGSAKMVLETGKHPGQLKDEVCSPG 233

Query: 255 GCTIAGLLTMEDGKIRSTLARTIQEATQVASTLG 288
           G TI  +  +E  K RS +   ++  T+ +  + 
Sbjct: 234 GTTIEAVYCLEKNKFRSAVIEAVRVCTEKSKNMA 267



>gi|147678161|ref|YP_001212376.1| pyrroline-5-carboxylate reductase [Pelotomaculum thermopropionicum
           SI]
 gi|500958862|ref|WP_012032984.1| pyrroline-5-carboxylate reductase [Pelotomaculum thermopropionicum]
 gi|146274258|dbj|BAF60007.1| pyrroline-5-carboxylate reductase [Pelotomaculum thermopropionicum
           SI]
          Length = 273

 Score =  166 bits (421), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 101/277 (36%), Positives = 155/277 (55%), Gaps = 17/277 (6%)

Query: 16  LGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITLLVG 75
           LG G MG A+++G+L +  V     PP +       CVS   S +   E    K+ +   
Sbjct: 11  LGGGAMGEALMTGLLRTGLV----NPPAI-------CVSDVNSGRL--EYLGKKLGVETH 57

Query: 76  NNVEGV-KEADIILLCTKPQVVKTILTEEGMQKSLE-NKLIISILAGVTIDQLKEWAPSS 133
              E V ++ADII++  KP  V  ++ E  +   L   + +ISI AGVT   ++ +  S 
Sbjct: 58  PKNEAVVRKADIIVMAVKPDAVAHLMKE--IAPLLRPGQTLISIAAGVTSAFIESFLNSP 115

Query: 134 TRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLS 193
             ++R MPNTPC++ EG + +S      +++   ++ +FS  G+A  + E+ LD VTGLS
Sbjct: 116 VPVVRVMPNTPCLVGEGASAVSAGKYAGRENMEKALAIFSAAGKAVEVPERLLDCVTGLS 175

Query: 194 GSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTP 253
           GSGPA+  V+LE L DG V +GLPR+              +MVL+TG+HPA +KD VTTP
Sbjct: 176 GSGPAYMYVILEGLIDGAVRLGLPRDQARLLAAQTMLGAAKMVLETGEHPARLKDMVTTP 235

Query: 254 GGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGNI 290
           GG TIAGL  +E+G +R+ L + ++ A + +  L  +
Sbjct: 236 GGTTIAGLFALEEGAVRALLMKAVEAAAERSRQLSGL 272



>gi|496135802|ref|WP_008860309.1| pyrroline-5-carboxylate reductase [Dialister succinatiphilus]
 gi|371934495|gb|EHO62281.1| pyrroline-5-carboxylate reductase [Dialister succinatiphilus YIT
           11850]
          Length = 265

 Score =  166 bits (421), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 98/261 (37%), Positives = 139/261 (53%), Gaps = 16/261 (6%)

Query: 13  LCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITL 72
           + + GCG MG AILSG L             L  K+ I      E A R   E   +  +
Sbjct: 4   ILIFGCGAMGGAILSGCLAK----------GLWKKEEIYVKEHSEEASR---EKASRYGV 50

Query: 73  LVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPS 132
               +    KEAD+++L  KP VV  +L E           ++SI A VT+  L+   P 
Sbjct: 51  HASMDGREAKEADLVILAVKPNVVPGVLQE---ISRYHPSRVLSIAAAVTLASLEGALPE 107

Query: 133 STRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGL 192
            T +IR MPNTP  + EGM  ++     S D    +  +FS LG+  ++ E+ LD +  L
Sbjct: 108 ETEVIRVMPNTPASVGEGMAAIAPGKKASPDFIREAEEIFSALGKEAVVTERQLDELGAL 167

Query: 193 SGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTT 252
           SG+GP +A V+++ALAD GV++GLPR++             +MVL+TGKHPAE++D VT+
Sbjct: 168 SGAGPGYAFVIIDALADAGVLIGLPRKLAIEAAAQTLYGAAKMVLETGKHPAELRDQVTS 227

Query: 253 PGGCTIAGLLTMEDGKIRSTL 273
           PGG TIAG+  ME   IR+ L
Sbjct: 228 PGGTTIAGIHAMERDGIRAAL 248



>gi|493857808|ref|WP_006804652.1| pyrroline-5-carboxylate reductase [Leptotrichia hofstadii]
 gi|260860177|gb|EEX74677.1| pyrroline-5-carboxylate reductase [Leptotrichia hofstadii F0254]
          Length = 280

 Score =  166 bits (421), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 92/271 (33%), Positives = 152/271 (56%), Gaps = 15/271 (5%)

Query: 13  LCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITL 72
           L ++G G MG +IL G+  S  +   N     + K+ I  +S E   ++ +         
Sbjct: 16  LGIIGAGNMGSSILKGVTSSNFLENKNVAIFDLDKEKIEELSKEYGVKKAE--------- 66

Query: 73  LVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENK-LIISILAGVTIDQLKEWAP 131
              N  E  KE+DI++L  KP ++  +L  + ++  L  K +++SI AG++ID ++    
Sbjct: 67  ---NEKELAKESDILILSVKPNIIPKVL--DKIKDDLSEKTIVLSIAAGISIDFIENIIG 121

Query: 132 SSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTG 191
           +  ++IR MPNTP  + EGMT +S      ++++S    + ++ G++  ++EK + A TG
Sbjct: 122 TDKKVIRTMPNTPAQVMEGMTAVSFNHSIQENEKSMIFKLLNSFGKSIEIEEKLMHAYTG 181

Query: 192 LSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVT 251
           +SGS PA+  V +EALADGGV+ G+PR+              +M+L+T KHP  +KD VT
Sbjct: 182 ISGSLPAYVYVFMEALADGGVLEGMPRDKAYEIIAQTVLGSAKMMLETKKHPGILKDEVT 241

Query: 252 TPGGCTIAGLLTMEDGKIRSTLARTIQEATQ 282
           +PGG TIA L  +EDGK R T+   ++  T+
Sbjct: 242 SPGGTTIAALKVLEDGKFRGTVMEAVKACTE 272



>gi|325087307|gb|ADY77003.1| pyrroline-5-carboxylate reductase [Ipomoea batatas]
 gi|325087309|gb|ADY77004.1| pyrroline-5-carboxylate reductase [Ipomoea batatas]
          Length = 276

 Score =  166 bits (421), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 96/271 (35%), Positives = 146/271 (53%), Gaps = 17/271 (6%)

Query: 13  LCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITL 72
           L  +G G +  +I  G++ S           L+P   I       + +   E F      
Sbjct: 14  LGFIGAGKLAESIARGVVKS----------GLLPPSRIRTAHTGPARRTAFESFG---VT 60

Query: 73  LVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSL-ENKLIISILAGVTIDQLKEWAP 131
           +  +N + V+++D+I+   KPQ+VK + ++  ++  L E +L++S+ AGV +  L+EWA 
Sbjct: 61  VYEHNKQVVEDSDVIIFSVKPQIVKEVASQ--VKPILTEKQLLVSVAAGVKLKDLQEWAG 118

Query: 132 SSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTG 191
           +S R IR MPNTP  + E  +V+S  +  +K+D      +F  +G+    DEK  DAVTG
Sbjct: 119 NS-RFIRVMPNTPAAVGEAASVISLGSGATKEDGDLISLLFGAIGKVWKADEKLFDAVTG 177

Query: 192 LSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVT 251
           LSGSGPA+  + +EALADGGV  GLPR++              M    GKHP ++KD VT
Sbjct: 178 LSGSGPAYIYLAIEALADGGVAAGLPRDLALGLASQTVLGAASMATNAGKHPGQLKDDVT 237

Query: 252 TPGGCTIAGLLTMEDGKIRSTLARTIQEATQ 282
           +PGG TIAG+  +E    R TL   +  AT+
Sbjct: 238 SPGGTTIAGVHELEKAGFRGTLMNAVVAATK 268



>gi|494038537|ref|WP_006980663.1| pyrroline-5-carboxylate reductase [Chthoniobacter flavus]
 gi|196224650|gb|EDY19161.1| pyrroline-5-carboxylate reductase [Chthoniobacter flavus Ellin428]
          Length = 257

 Score =  166 bits (420), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 87/215 (40%), Positives = 126/215 (58%), Gaps = 2/215 (0%)

Query: 74  VGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPSS 133
           V  N E   +AD ++LC KP      L    ++   + KL+ISI+AG+ +  L+E A S 
Sbjct: 42  VAKNEELAAKADALVLCVKPADALEAL--RALRDGTKGKLVISIVAGLPLAALQEAAGSK 99

Query: 134 TRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLS 193
            RIIR MPNTP +I  G    +     +  D + +  +F  +G+   + E+ LD VTGLS
Sbjct: 100 VRIIRVMPNTPALIHRGAAAYALGKTATAADGALTESLFGAVGQIVKVKEELLDVVTGLS 159

Query: 194 GSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTP 253
           GSGPA+  +V+EAL+D GV+MGLPR++              MV++TG+HPA ++D VT+P
Sbjct: 160 GSGPAYVYLVVEALSDAGVLMGLPRDLSLKLAAQTVAGAAEMVIETGRHPAALRDEVTSP 219

Query: 254 GGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLG 288
           GG TIAGL  +E G +RS     ++ AT+ A  LG
Sbjct: 220 GGTTIAGLEALEAGAVRSAFLSAVRAATERARELG 254



>gi|511059070|ref|YP_008070955.1| pyrroline-5-carboxylate reductase [Methanomassiliicoccus sp.
           Mx1-Issoire]
 gi|509091582|gb|AGN25600.1| pyrroline-5-carboxylate reductase [Methanomassiliicoccus sp.
           Mx1-Issoire]
          Length = 269

 Score =  166 bits (420), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 96/274 (35%), Positives = 148/274 (54%), Gaps = 15/274 (5%)

Query: 16  LGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITLLVG 75
           +G G M  A++ G+++   +  A E   LI  + +A          IK+     +T    
Sbjct: 8   IGAGNMAEALMKGLING-QLTTAEE---LIASEVVAA-----RRDYIKKNLGVNVT---A 55

Query: 76  NNVEGVKEADIILLCTKPQVVKTILTEEGMQKSL-ENKLIISILAGVTIDQLKEWAPSST 134
           +N + V EA +I+L  KP VV T+L E  ++ SL ++ L++SI AGV I  ++       
Sbjct: 56  SNKDVVNEAKVIVLAVKPNVVATVLDE--LKPSLTKDHLVVSIAAGVKISSIESHLNEGV 113

Query: 135 RIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSG 194
           R+IR MPN PC++    +  +  T    DD++    +   +G A  ++EK LDAVTGLSG
Sbjct: 114 RVIRVMPNQPCLVSASASAFALGTYAGDDDKALVQKMLEAVGIAYAMEEKQLDAVTGLSG 173

Query: 195 SGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPG 254
           SGPA+  +V+EAL+DGGVM GLPR+V             + +L+T  HP + KD VT+P 
Sbjct: 174 SGPAYIYLVIEALSDGGVMAGLPRDVSTALAAQTVLGAAKTILETKMHPGQAKDMVTSPA 233

Query: 255 GCTIAGLLTMEDGKIRSTLARTIQEATQVASTLG 288
           G TI G+  +E+  +R      +  AT+ +  LG
Sbjct: 234 GTTIEGMRILENSAVRGAFIDAVLAATERSKELG 267



>gi|328953832|ref|YP_004371166.1| pyrroline-5-carboxylate reductase [Desulfobacca acetoxidans DSM
           11109]
 gi|503472433|ref|WP_013707094.1| pyrroline-5-carboxylate reductase [Desulfobacca acetoxidans]
 gi|328454156|gb|AEB09985.1| pyrroline-5-carboxylate reductase [Desulfobacca acetoxidans DSM
           11109]
          Length = 273

 Score =  166 bits (420), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 97/282 (34%), Positives = 157/282 (55%), Gaps = 16/282 (5%)

Query: 13  LCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITL 72
           L V+G G MG A+    L +  + PA+            C++  ++ +R++     ++ +
Sbjct: 7   LAVIGVGNMGSALTRAWLQAGLIEPAS-----------ICLADADT-ERLRA-LAAELGV 53

Query: 73  LVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPS 132
              +N + V  ADI++L  KPQ++  +LT+    +   + LIISI AG+ +  L+E  P 
Sbjct: 54  QTADNRQAVA-ADIVILAVKPQIIPEVLTDI-RNRIGASHLIISIAAGLPLSYLEEMLPR 111

Query: 133 STRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGL 192
           + R++R MPNTP +IR G+  ++  T  +  D   +  +F ++GR+ I++EK +DAVTGL
Sbjct: 112 A-RLLRVMPNTPLLIRAGVAAIAQGTRATAQDLDLARKLFDSVGRSVIVEEKFMDAVTGL 170

Query: 193 SGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTT 252
           SGSGPA+  + LEALADGGV MGLPR+               + L++G HP  +KD V +
Sbjct: 171 SGSGPAYVFLFLEALADGGVKMGLPRQTALLLAAQTILGSAALFLESGHHPGILKDQVAS 230

Query: 253 PGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGNIQSKK 294
           PGG TI GL  +E G  R  +   ++ AT  +  L  ++  +
Sbjct: 231 PGGTTITGLHVLEAGGFRGLIMSAVEAATSRSQELATVRPTR 272



>gi|242059889|ref|XP_002459090.1| hypothetical protein SORBIDRAFT_03g045690 [Sorghum bicolor]
 gi|241931065|gb|EES04210.1| hypothetical protein SORBIDRAFT_03g045690 [Sorghum bicolor]
          Length = 285

 Score =  166 bits (420), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 98/273 (35%), Positives = 148/273 (54%), Gaps = 20/273 (7%)

Query: 13  LCVLGCGTMGRAILSGILDSLNVAPANE---PPTLIPKKFIACVSGEESAQRIKEEFNDK 69
           L  +G G +  +I  G+  S  V PA+     P   P++               E F   
Sbjct: 24  LGFVGAGNLAESIARGVAAS-GVLPASAIRTAPHRRPER--------------GEAFASF 68

Query: 70  ITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEW 129
              L+  N + V ++D+I++  KPQ+VK +L E   + S E KL++SI AG+ +  L++W
Sbjct: 69  GACLLQTNAQVVDDSDVIVISVKPQIVKQVLLELRPRLS-EEKLLVSIAAGIKMQDLQDW 127

Query: 130 APSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAV 189
           +    RIIR MPNTP  + +  +V+      ++DD +    +FS +G+    +EK+ DAV
Sbjct: 128 S-GQRRIIRVMPNTPSAVGQAASVMCLGEMATQDDENRVRKLFSAIGKVWTAEEKYFDAV 186

Query: 190 TGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDS 249
           TGLSGSGPA+  + +EA+ADGGV  GLPR++              MV +TGKHP ++KD 
Sbjct: 187 TGLSGSGPAYIFLAIEAMADGGVAAGLPRDLALGLASQTVLGAATMVSQTGKHPGQLKDQ 246

Query: 250 VTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQ 282
           VT+P G TIAG+  +E G  R TL   +  A +
Sbjct: 247 VTSPAGTTIAGIQELEKGAFRGTLISAVVAAAK 279



>gi|386713412|ref|YP_006179735.1| pyrroline-5-carboxylate reductase [Halobacillus halophilus DSM
           2266]
 gi|504455260|ref|WP_014642362.1| pyrroline-5-carboxylate reductase [Halobacillus halophilus]
 gi|384072968|emb|CCG44459.1| pyrroline-5-carboxylate reductase [Halobacillus halophilus DSM
           2266]
          Length = 270

 Score =  166 bits (419), Expect = 9e-39,   Method: Compositional matrix adjust.
 Identities = 90/274 (32%), Positives = 161/274 (58%), Gaps = 17/274 (6%)

Query: 16  LGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVS-GEESAQRIKEEFNDKITLLV 74
           +GCG MG+A++ G++D+           L+  + IA  +  +E+   + +E+   I+   
Sbjct: 8   IGCGQMGQAMIQGMIDA----------KLLKAESIAATALSDETIDFVSDEYGIHIS--- 54

Query: 75  GNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPSST 134
            +N +  +E+D++ L  KP +   ++ +E   +   + +I++I AG+T+D +KE    + 
Sbjct: 55  NDNKQLARESDLLFLAIKPYIYHGVI-QEIKDEVPPDTVIVTIAAGITLDAIKEAFGRNV 113

Query: 135 RIIRAMPNTPCMIREGMTVLSCPTD-CSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLS 193
           ++IR+MPNTP ++  GM+VL CP D  ++++ +  + VF + G A I++EK +DAV  +S
Sbjct: 114 KVIRSMPNTPSLVGAGMSVL-CPNDFVTEEELADVMEVFESFGEAEIIEEKLMDAVPAIS 172

Query: 194 GSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTP 253
           GS PAF  + +EA+AD  V  G PR+              +MV +TG+HP E+KD+V TP
Sbjct: 173 GSSPAFVYMFIEAMADTAVQQGFPRDKAYKIASQAVQGAAKMVKETGRHPGELKDAVCTP 232

Query: 254 GGCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
           GG TIAG+  +E   +RS++ + ++  T+ +  L
Sbjct: 233 GGVTIAGVTELEHSGMRSSIIQAMEACTKKSREL 266



>gi|159478757|ref|XP_001697467.1| pyrroline-5-carboxylate reductase [Chlamydomonas reinhardtii]
 gi|158274346|gb|EDP00129.1| pyrroline-5-carboxylate reductase [Chlamydomonas reinhardtii]
          Length = 276

 Score =  166 bits (419), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 96/279 (34%), Positives = 145/279 (51%), Gaps = 16/279 (5%)

Query: 10  NPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDK 69
           N  +  LG G M  A+  G++             L+  + IAC     +   + + F   
Sbjct: 10  NKRIGFLGSGQMAEALARGLMKR----------GLVSGEHIACNDPNPARTNLFKSFG-- 57

Query: 70  ITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSL-ENKLIISILAGVTIDQLKE 128
                 +N +  + AD+I +  KPQ V  +L+E  ++  L E   ++SI AG+TID+L E
Sbjct: 58  -ATPYESNADVARNADVIFVAVKPQHVAQVLSE--VRPVLTEGHTVVSIAAGITIDKLVE 114

Query: 129 WAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDA 188
            A     ++R MPNTPC++ E    +      + DD +    +F  +G+   +DEK L A
Sbjct: 115 AAGPDAHVVRVMPNTPCLVGETAAAMCLGGKANADDETLVRTIFEAVGKIYTVDEKLLAA 174

Query: 189 VTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKD 248
           VTGLSGSGPA+  +++EALADGGV  GLPR++             +MV++TG HP  +KD
Sbjct: 175 VTGLSGSGPAYVFLMIEALADGGVRAGLPRDIAQALAAQTVLGSAKMVMETGTHPGALKD 234

Query: 249 SVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
            VT+P G TIAG+  +E   IR+     +  AT  A+ L
Sbjct: 235 MVTSPAGTTIAGVHELERAGIRAAFMNAVVAATDRANQL 273



>gi|479159509|ref|YP_007788778.1| pyrroline-5-carboxylate reductase [butyrate-producing bacterium
           SSC/2]
 gi|495666959|ref|WP_008391538.1| pyrroline-5-carboxylate reductase [Lachnospiraceae bacterium
           5_1_63FAA]
 gi|167712700|gb|EDS23279.1| pyrroline-5-carboxylate reductase [Clostridium sp. SS2/1]
 gi|291558983|emb|CBL37783.1| pyrroline-5-carboxylate reductase [butyrate-producing bacterium
           SSC/2]
 gi|316894159|gb|EFV16347.1| pyrroline-5-carboxylate reductase [Lachnospiraceae bacterium
           5_1_63FAA]
 gi|429183695|gb|EKY24736.1| pyrroline-5-carboxylate reductase [Anaerostipes hadrus DSM 3319]
          Length = 270

 Score =  166 bits (419), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 92/281 (32%), Positives = 153/281 (54%), Gaps = 13/281 (4%)

Query: 13  LCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITL 72
           L  +GCG M +A+++GIL    V+P         ++ I     EE   ++K+EF     +
Sbjct: 3   LGFIGCGNMAQAMITGILTQKVVSP---------QELIVSNPREEKTAKLKDEFG---II 50

Query: 73  LVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPS 132
              +N E  K++DI++L  KPQV   ++ E   + S E ++I++I AGV+++  +     
Sbjct: 51  TTTDNKEVAKQSDILVLSVKPQVYPAVIKEIRDEVSSE-QIIVTIAAGVSMEAAERQFGK 109

Query: 133 STRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGL 192
             +I+R MPNTP ++ EGM+ L C    ++++      +F + G+A  + E  +DAV G+
Sbjct: 110 EVKIVRVMPNTPALVGEGMSGLCCNEYVTEEEFDLVHKIFESFGKAEKITENLMDAVVGV 169

Query: 193 SGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTT 252
           SGSGPA+  + +EA+AD  V  GLPR+              +MVL+TG+HP E+KD+V +
Sbjct: 170 SGSGPAYVYMFIEAMADAAVAQGLPRKQAYTFAAQTLLGSAKMVLETGQHPGELKDAVCS 229

Query: 253 PGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGNIQSK 293
           P G TI  +  +E   +RS +   +  A +    LG  + K
Sbjct: 230 PAGTTIEAVNVLEKKGMRSAVIEAVTAAAKKNHQLGKKKEK 270



>gi|323305217|gb|EGA58964.1| Pro3p [Saccharomyces cerevisiae FostersB]
 gi|323309371|gb|EGA62588.1| Pro3p [Saccharomyces cerevisiae FostersO]
 gi|323337926|gb|EGA79165.1| Pro3p [Saccharomyces cerevisiae Vin13]
 gi|323348961|gb|EGA83197.1| Pro3p [Saccharomyces cerevisiae Lalvin QA23]
 gi|323355428|gb|EGA87252.1| Pro3p [Saccharomyces cerevisiae VL3]
 gi|365766047|gb|EHN07548.1| Pro3p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 274

 Score =  166 bits (419), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 103/282 (36%), Positives = 156/282 (55%), Gaps = 16/282 (5%)

Query: 21  MGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIK---EEFND-----KITL 72
           MG+A+LS I ++   A         P K I C   E SA ++    E F++     K+  
Sbjct: 1   MGQALLSAIYNAPKAADET-AAAFYPSKIITCNHDEPSAHQVTDLVETFDESPNGIKVES 59

Query: 73  LVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPS 132
             G+NV  V+EA ++LL TKP + + +L   G++  +  KL+IS+ AG TIDQL ++   
Sbjct: 60  TYGHNVSAVEEASVVLLGTKPFLAEEVLN--GVKSVIGGKLLISLAAGWTIDQLSQY--- 114

Query: 133 STRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGL 192
           ++ + R M NTP     G  V+S   D SK+ +     + S +G+   L EK++DA T L
Sbjct: 115 TSTVCRVMTNTPAKYGYGCAVVSYSADVSKEQKPLVNELISQVGKYVELPEKNMDAATAL 174

Query: 193 SGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTT 252
            GSGPAF  ++LE+L + G+ +G+P +              +MV K+G HP+ +K  V T
Sbjct: 175 VGSGPAFVLLMLESLMESGLKLGIPLQESKECAMKVLEGTVKMVEKSGAHPSVLKHQVCT 234

Query: 253 PGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGNIQSKK 294
           PGG TIAGL  ME+  ++S +   ++EA +VAS LG  Q KK
Sbjct: 235 PGGTTIAGLCVMEEKGVKSGIINGVEEAARVASQLG--QKKK 274



>gi|498273462|ref|WP_010587618.1| pyrroline-5-carboxylate reductase [Schlesneria paludicola]
          Length = 274

 Score =  165 bits (418), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 99/278 (35%), Positives = 148/278 (53%), Gaps = 17/278 (6%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKIT 71
           ++  +G G M  A+  G + +          +L  +  +AC     + QR  E+   ++ 
Sbjct: 9   SVGFIGAGQMATALAKGFIAA---------GSLSRESIVACDVVAAAGQRFVEQTGARL- 58

Query: 72  LLVGNNVEGVKEAD-IILLCTKPQVVKTILTEEGMQKSL-ENKLIISILAGVTIDQLKEW 129
              G ++  V  A  +I L  KPQ +  +  E  ++ ++  + LI+SI AGVT+  +   
Sbjct: 59  ---GESIAEVASASSVIFLAVKPQQMSAVFHE--LRHAMTHDPLIVSIAAGVTLKSMSAG 113

Query: 130 APSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAV 189
                R+IR MPNTPC++  G +  +     +  D +    + S +G A  + EK LDAV
Sbjct: 114 LREDVRMIRVMPNTPCLVGAGASAFARGPKATAADGALVQKLLSNVGLAVEVPEKLLDAV 173

Query: 190 TGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDS 249
           TGLSGSGPA+   ++EAL+DGGV MGLPRE              +MVL TG+HP  +KD+
Sbjct: 174 TGLSGSGPAYIYQIIEALSDGGVRMGLPRETATKLAAQTVAGAAQMVLMTGQHPGALKDA 233

Query: 250 VTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
           VT+PGG TIAGL  +E G +R TL   +Q AT+ A  L
Sbjct: 234 VTSPGGTTIAGLHALERGGLRGTLMNAVQAATERAREL 271



>gi|159478755|ref|XP_001697466.1| pyrroline-5-carboxylate reductase [Chlamydomonas reinhardtii]
 gi|158274345|gb|EDP00128.1| pyrroline-5-carboxylate reductase [Chlamydomonas reinhardtii]
          Length = 347

 Score =  165 bits (418), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 96/282 (34%), Positives = 146/282 (51%), Gaps = 16/282 (5%)

Query: 10  NPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDK 69
           N  +  LG G M  A+  G++             L+  + IAC     +   + + F   
Sbjct: 81  NKRIGFLGSGQMAEALARGLMKR----------GLVSGEHIACNDPNPARTNLFKSFG-- 128

Query: 70  ITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSL-ENKLIISILAGVTIDQLKE 128
                 +N +  + AD+I +  KPQ V  +L+E  ++  L E   ++SI AG+TID+L E
Sbjct: 129 -ATPYESNADVARNADVIFVAVKPQHVAQVLSE--VRPVLTEGHTVVSIAAGITIDKLVE 185

Query: 129 WAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDA 188
            A     ++R MPNTPC++ E    +      + DD +    +F  +G+   +DEK L A
Sbjct: 186 AAGPDAHVVRVMPNTPCLVGETAAAMCLGGKANADDETLVRTIFEAVGKIYTVDEKLLAA 245

Query: 189 VTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKD 248
           VTGLSGSGPA+  +++EALADGGV  GLPR++             +MV++TG HP  +KD
Sbjct: 246 VTGLSGSGPAYVFLMIEALADGGVRAGLPRDIAQALAAQTVLGSAKMVMETGTHPGALKD 305

Query: 249 SVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGNI 290
            VT+P G TIAG+  +E   IR+     +  AT  A+ L  +
Sbjct: 306 MVTSPAGTTIAGVHELERAGIRAAFMNAVVAATDRANQLSKM 347



>gi|493646408|ref|WP_006598015.1| pyrroline-5-carboxylate reductase [Pseudoramibacter alactolyticus]
 gi|315622403|gb|EFV02361.1| pyrroline-5-carboxylate reductase [Pseudoramibacter alactolyticus
           ATCC 23263]
          Length = 268

 Score =  165 bits (418), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 99/285 (34%), Positives = 151/285 (52%), Gaps = 31/285 (10%)

Query: 13  LCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITL 72
           L  +G G M +AI  GIL +              KKF A      +   I +   DK+  
Sbjct: 5   LGFIGAGNMAQAIFKGILKT--------------KKFAA------TDIHIYDPDGDKLRQ 44

Query: 73  LV--------GNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLE-NKLIISILAGVTI 123
           L          +N+     AD++ LCTKP V  TI+ E  ++ +++ N +I++I AG +I
Sbjct: 45  LTEAYGVIGEASNIHVCTHADVLFLCTKPNVYPTIINE--IKSAVDVNTVIVTIAAGQSI 102

Query: 124 DQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDE 183
            + +        +IR MPNTP ++ EGM  L+     +  + +  + +F +LG+A I+ E
Sbjct: 103 RRTESRFEKKIHLIRVMPNTPALVGEGMAALTANALVTDAELALVLSIFRSLGKAEIVPE 162

Query: 184 KHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHP 243
             +DAVTGLSGS PAF  + +EALADG V  G+PR               +M+L++GKHP
Sbjct: 163 TLMDAVTGLSGSAPAFVFMFIEALADGAVQTGMPRTQAYTFAEQTVLGSAKMLLESGKHP 222

Query: 244 AEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLG 288
            E+KD VT+P G TI G+L++E    RS +A  +  AT+ +S +G
Sbjct: 223 GELKDMVTSPAGTTIEGVLSLEANGFRSAVADAVIAATEKSSIMG 267



>gi|435853591|ref|YP_007314910.1| pyrroline-5-carboxylate reductase [Halobacteroides halobius DSM
           5150]
 gi|505139440|ref|WP_015326542.1| pyrroline-5-carboxylate reductase [Halobacteroides halobius]
 gi|433670002|gb|AGB40817.1| pyrroline-5-carboxylate reductase [Halobacteroides halobius DSM
           5150]
          Length = 269

 Score =  165 bits (418), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 99/266 (37%), Positives = 150/266 (56%), Gaps = 13/266 (4%)

Query: 16  LGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITLLVG 75
           +G G+M  A+++GIL++  +  A+       + +I+ ++ E    R++   N     +  
Sbjct: 8   IGAGSMAEALITGILEA-ELFSAD-------RVYISDINQE----RVESLHNKYQVQIAN 55

Query: 76  NNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPSSTR 135
           NN E VK+ D I+L  KP+VVK IL   G Q     KL  SI AGVT  QL++   +   
Sbjct: 56  NNQELVKQVDYIVLAVKPRVVKKILGRVGQQIRPYQKLF-SIAAGVTTKQLEKHLSTDVP 114

Query: 136 IIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSGS 195
           ++R MPNTP +I  G T  +     ++D       +FS++G    + E  +DAVTGLSGS
Sbjct: 115 VVRLMPNTPALIGSGATAYTLGQAATEDASRVVKEIFSSVGLIVEVKEDLMDAVTGLSGS 174

Query: 196 GPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPGG 255
           GPA+  +++EAL+D GV +GLPR+V              MV +  KHPA++KD VT+PGG
Sbjct: 175 GPAYIYMIVEALSDAGVNVGLPRKVASKLAIQTLLGAGEMVQELEKHPAQLKDLVTSPGG 234

Query: 256 CTIAGLLTMEDGKIRSTLARTIQEAT 281
            TI GL  +E   +RS+L + ++ AT
Sbjct: 235 TTITGLKELEKTGLRSSLYQAVESAT 260



>gi|326512934|dbj|BAK03374.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 277

 Score =  165 bits (417), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 98/274 (35%), Positives = 149/274 (54%), Gaps = 24/274 (8%)

Query: 13  LCVLGCGTMGRAILSGILDSLNVAPANE---PPTLIPKKFIACVSGEESAQRIKEEFNDK 69
           L  +G G +  +I  G+  S  V PA+     P   P++  A              F   
Sbjct: 14  LGFVGAGNLAESIARGVAAS-GVLPASAVRTAPHRRPERAAA--------------FASL 58

Query: 70  ITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSL--ENKLIISILAGVTIDQLK 127
              ++ +N + V ++D+I++  KPQ+VK +L E    K L  E KL++SI AG+ +  L+
Sbjct: 59  GATILASNAQVVDDSDVIVISVKPQIVKQVLVE---LKPLLSEEKLLVSIAAGIKMKDLQ 115

Query: 128 EWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLD 187
           +W+    RIIR MPNTP  + +  +V+      +++D +    +FS +G+    +EK+ D
Sbjct: 116 DWS-GQRRIIRVMPNTPSAVGQAASVMCLGETATENDENRVKSLFSAIGKVWTAEEKYFD 174

Query: 188 AVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIK 247
           AVTGLSGSGPA+  + +EA+ADGGV  GLPR++              MV +TGKHP ++K
Sbjct: 175 AVTGLSGSGPAYIFLAIEAMADGGVAAGLPRDLALGLAAQTVLGAATMVSETGKHPGQLK 234

Query: 248 DSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEAT 281
           D VT+P G TIAG+  +E G  R TL   +  AT
Sbjct: 235 DQVTSPAGTTIAGVHELEKGSFRGTLINAVVAAT 268



>gi|488670361|ref|WP_002599165.1| pyrroline-5-carboxylate reductase [Clostridium colicanis]
 gi|480656105|gb|ENZ00209.1| pyrroline-5-carboxylate reductase [Clostridium colicanis 209318]
          Length = 265

 Score =  165 bits (417), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 92/269 (34%), Positives = 154/269 (57%), Gaps = 26/269 (9%)

Query: 16  LGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITLLVG 75
           +GCG MG+A+L  ++         +   +  KK +     E S ++I+EE+      ++G
Sbjct: 8   IGCGNMGKAMLGALV---------QKEFIESKKILVSTKRESSRKKIEEEYR-----VIG 53

Query: 76  --NNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPSS 133
             +N+E  KE+DI++L  KP + K+++  EG++K L+ K+IISI AG+ I+ L+      
Sbjct: 54  KESNLEVAKESDIVILAVKPYMYKSVI--EGIKKELKGKIIISIAAGIDIEDLENMLDED 111

Query: 134 TRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIW----VFSTLGRARILDEKHLDAV 189
           ++I++ MPNTP ++ EGM+ + CP   +K+   + +     +F+  G+  ILDEK   A 
Sbjct: 112 SKIVKTMPNTPALVGEGMSAI-CP---NKNITEYELKEVCDIFNVFGKYEILDEKDFHAF 167

Query: 190 TGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDS 249
             + GS PA+  +++EA+ADGGV +GL R+              +MVL+TG HP  +KD 
Sbjct: 168 IAVCGSSPAYIFMIIEAMADGGVKLGLSRDKAYKLAAQSVLGSAKMVLETGCHPGVLKDM 227

Query: 250 VTTPGGCTIAGLLTMEDGKIRSTLARTIQ 278
           V +PGG TI  +  +E   IR+T+   I+
Sbjct: 228 VCSPGGTTIEAVADLEKNGIRNTIISAIE 256



>gi|389853012|ref|YP_006355246.1| pyrroline-5-carboxylate reductase [Pyrococcus sp. ST04]
 gi|504547590|ref|WP_014734692.1| pyrroline-5-carboxylate reductase [Pyrococcus sp. ST04]
 gi|388250318|gb|AFK23171.1| pyrroline-5-carboxylate reductase [Pyrococcus sp. ST04]
          Length = 267

 Score =  164 bits (416), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 91/277 (32%), Positives = 157/277 (56%), Gaps = 25/277 (9%)

Query: 13  LCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIK--EEFNDKI 70
           + V+G GT+G A+   + ++                    ++     +++K  E +  K 
Sbjct: 6   IAVIGAGTIGSAVAKALAEA----------------GYEVIATRRKIEKVKWLENYGVK- 48

Query: 71  TLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWA 130
             L  +N +  K AD++++  KP  V  IL E  +++++ NK++IS+ AG+ I  LK++ 
Sbjct: 49  --LEKDNKKASKWADVVIIAVKPNKVGKILEE--IEENISNKIVISLAAGIPIRLLKKFV 104

Query: 131 PSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVT 190
           P + + +RAMPN   +++E  T  S   D +++D      +FS+ G+   +DE+++DA+T
Sbjct: 105 PQA-KFVRAMPNIAVLVKESFTAYSAE-DLNEEDIKTVEKIFSSFGKCLKIDEEYMDAIT 162

Query: 191 GLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSV 250
           GLSGSGPA+  V LEA+  GG+ +GLPR++             +++L+ G HPAEI+D V
Sbjct: 163 GLSGSGPAYVSVFLEAMIYGGLKVGLPRDIARLAAAQTLLGTAKLLLELGDHPAEIRDMV 222

Query: 251 TTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
            TPGG TI G+  +E+GKIR+ + + I  AT+ +  L
Sbjct: 223 ITPGGTTIDGIFELEEGKIRTAIMKAIDAATKKSKIL 259



>gi|344300349|gb|EGW30670.1| hypothetical protein SPAPADRAFT_141869 [Spathaspora passalidarum
           NRRL Y-27907]
          Length = 273

 Score =  164 bits (416), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 103/283 (36%), Positives = 155/283 (54%), Gaps = 19/283 (6%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDK-- 69
           T+ VLGCG MG A+ S IL       A   P   P K IAC    E A  +K+ F D   
Sbjct: 4   TITVLGCGVMGTAVTSAILK------AQFDP--YPTKIIACTVPSEEAN-LKKVFADNKL 54

Query: 70  --ITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENK-LIISILAGVTIDQL 126
             ++  V NN + V EAD+I+L  KP + + I  E  ++ SL  K L+IS+LAG TI +L
Sbjct: 55  VSVSAGVENNNKAVAEADVIILGCKPYMYEGIYNE--VKDSLTGKQLLISLLAGTTIKEL 112

Query: 127 KEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHL 186
             + P    + + M NTP     G   ++   + +++ +   + +  T+G    + EK++
Sbjct: 113 SIFTP---YVAKVMTNTPARFGCGTAAIAFAPEVTEEQQELVMKLIDTVGMTVKIPEKNM 169

Query: 187 DAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEI 246
           D  T L GSGPAF  +++E++ DG V MG+P ++             +MVL+TG+HPA +
Sbjct: 170 DIATSLIGSGPAFCLLMMESMIDGAVRMGMPYDIAQKSAAKVMEGTAKMVLETGEHPAAL 229

Query: 247 KDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           K  V TPGG TI GLL MED  +RS +AR ++EA  ++++   
Sbjct: 230 KAKVCTPGGTTIGGLLKMEDKGVRSAIARGVEEAAIISASFAK 272



>gi|386046056|ref|YP_005964388.1| pyrroline-5-carboxylate reductase [Listeria monocytogenes J0161]
 gi|470206051|ref|YP_007602626.1| Pyrroline-5-carboxylate reductase [Listeria monocytogenes]
 gi|470209193|ref|YP_007605767.1| Pyrroline-5-carboxylate reductase [Listeria monocytogenes N53-1]
 gi|489819296|ref|WP_003723108.1| pyrroline-5-carboxylate reductase [Listeria monocytogenes]
 gi|47015046|gb|EAL05990.1| pyrroline-5-carboxylate reductase [Listeria monocytogenes str. 1/2a
           F6854]
 gi|258610640|gb|EEW23248.1| pyrroline-5-carboxylate reductase [Listeria monocytogenes F6900]
 gi|293591654|gb|EFF99988.1| pyrroline-5-carboxylate reductase [Listeria monocytogenes J2818]
 gi|345533047|gb|AEO02488.1| pyrroline-5-carboxylate reductase [Listeria monocytogenes J0161]
 gi|441469957|emb|CCQ19712.1| Pyrroline-5-carboxylate reductase [Listeria monocytogenes]
 gi|441473099|emb|CCQ22853.1| Pyrroline-5-carboxylate reductase [Listeria monocytogenes N53-1]
          Length = 266

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 95/273 (34%), Positives = 158/273 (57%), Gaps = 14/273 (5%)

Query: 16  LGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITLLVG 75
           +G G MG A++ G+      A AN    L+ ++ I  + G  + +++K    +   L + 
Sbjct: 7   IGAGNMGTAMIRGL------AQAN----LVKREEI--IVGGRNLEKLKPLEAEFTGLQIT 54

Query: 76  NNVEG-VKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPSST 134
            + E  V++ADII+L  KP  +  ILT    +K   +K+IIS+ AGVTI  L+E   + T
Sbjct: 55  TDTEKLVEQADIIILAVKPYTIPEILTSV-KEKLTPDKIIISVAAGVTIQDLEELTSAKT 113

Query: 135 RIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSG 194
           +I+R MPNTP ++ E M+ +S  T+ + ++      +F++ G A ++ E  +DAV G+SG
Sbjct: 114 KIVRVMPNTPALVGEAMSSVSPNTNVTSEELKEVTAIFTSFGEAEVVSENLMDAVIGVSG 173

Query: 195 SGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPG 254
           S PA+  + +EALADG V+ G+PR+              + VL+TG+HP ++KD VT+PG
Sbjct: 174 SSPAYVYMFIEALADGAVLSGMPRDKAYKFAAQAVLGAAKTVLETGEHPGKLKDMVTSPG 233

Query: 255 GCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
           G TI  + ++E+   RST+   +Q A +  S++
Sbjct: 234 GTTIEAVKSLENDGFRSTVINAVQAAAKKNSSM 266



>gi|497918663|ref|WP_010232819.1| pyrroline-5-carboxylate reductase [Clostridium arbusti]
          Length = 268

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 90/273 (32%), Positives = 148/273 (54%), Gaps = 15/273 (5%)

Query: 16  LGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITLLVG 75
           +GCG M +A++ GI+ S             P+K +       S Q +KE+FN    +   
Sbjct: 8   IGCGNMAKAMIGGIVTS---------KLYSPQKIMVSNPSNSSLQEVKEKFN---IITSN 55

Query: 76  NNVEGVKEADIILLCTKP-QVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPSST 134
           +N++  + ADI++L  KP + V  I   + + KS  + +I+SI AG+ I  ++++     
Sbjct: 56  DNIKVAEFADILILSVKPNKYVHVIDKIKNLVKS--STVIVSIAAGIGIKDIEKYFGKEV 113

Query: 135 RIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSG 194
           ++IR MPNTP ++ EGM  L    +   ++      +F + G+A I++E+ +D VT +SG
Sbjct: 114 KVIRTMPNTPALVGEGMASLCRNKNVKDEEMDLVANIFKSFGKAEIVEERLMDVVTSVSG 173

Query: 195 SGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPG 254
           S PA   + +EAL DG V+ GLPRE              +MVL+TGKHP ++KD V +PG
Sbjct: 174 SSPALVYMFIEALGDGAVLEGLPREKAYKMAAQAVLGSAKMVLETGKHPGQLKDEVCSPG 233

Query: 255 GCTIAGLLTMEDGKIRSTLARTIQEATQVASTL 287
           G TI  + ++E  K R +L   I+  T+ +  +
Sbjct: 234 GTTIEAVYSLEKNKFRGSLIEAIKVCTEKSKNM 266



>gi|493564093|ref|WP_006517467.1| pyrroline-5-carboxylate reductase [Leptolyngbya sp. PCC 7375]
 gi|425762244|gb|EKV03097.1| pyrroline-5-carboxylate reductase [Leptolyngbya sp. PCC 7375]
          Length = 269

 Score =  164 bits (415), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 100/277 (36%), Positives = 153/277 (55%), Gaps = 13/277 (4%)

Query: 13  LCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITL 72
           L ++G G MG A+LS +L               P   +      E  Q + E+++ + T 
Sbjct: 5   LGIIGGGVMGEALLSCLLSK---------RMYTPDAILVSDLSHERRQLLTEQYDIRTT- 54

Query: 73  LVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPS 132
              +N+E ++ +D+I+L TKPQV  ++  +       E+ L+ISILAGV+I +L++  P 
Sbjct: 55  --HSNLEVIEHSDVIVLATKPQVFDSVARDFSRIVVSESPLVISILAGVSIVRLEQAVPG 112

Query: 133 STRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGL 192
              +IRAMPNTP  +  GMT ++  +    +    +  +FST+G    + E  LD VTGL
Sbjct: 113 WP-VIRAMPNTPATVGCGMTAIAIGSRAIAEHVEIAQQLFSTVGEVVQVAEPLLDGVTGL 171

Query: 193 SGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTT 252
           SGSGPA+  +V+EALADGGV  GL R               +++ KTG HPA +KD VT+
Sbjct: 172 SGSGPAYVAIVIEALADGGVASGLSRTTANRLALQTVLGTAQLLQKTGMHPAVLKDRVTS 231

Query: 253 PGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           PGG TI+G+  +E+  +RS L   ++ A+  +  LGN
Sbjct: 232 PGGTTISGIACLEELGLRSALIEAVRAASSRSRELGN 268



>gi|491351902|ref|WP_005209824.1| pyrroline-5-carboxylate reductase [Clostridium celatum]
 gi|429188752|gb|EKY29619.1| pyrroline-5-carboxylate reductase [Clostridium celatum DSM 1785]
          Length = 266

 Score =  164 bits (415), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 87/265 (32%), Positives = 146/265 (55%), Gaps = 15/265 (5%)

Query: 16  LGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITLLVG 75
           +GCG MG+A+L  ++ S  +A  +          I     + SA++I ++F  K T    
Sbjct: 8   IGCGNMGKAMLGAMVKSNEIALGD---------LIVSTKSKASAEKISDDFEVKTTT--- 55

Query: 76  NNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPSSTR 135
           +N E V+ +DI+ L  KP   K ++ EE      EN +IISI AG+TI Q++EW   + +
Sbjct: 56  DNKEVVRNSDILFLAVKPYFFKEVI-EEIKDLVTENTIIISIAAGITIAQIEEWFGKNIK 114

Query: 136 IIRAMPNTPCMIREGMTVLSCPT-DCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGLSG 194
           ++R MPNTP ++ EGM+ + CP  + ++++  +   ++   G+  +L+EK   A   L G
Sbjct: 115 VVRTMPNTPALVGEGMSAI-CPNKNITEEELQYVGRLYDLFGKYEVLEEKDFHAFIALCG 173

Query: 195 SGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTTPG 254
           S PA+  + +EA+AD GV +GLPR               ++  +TGKHP  +KD V +PG
Sbjct: 174 SSPAYVFMFIEAMADAGVKLGLPRVKAYKLAEQAILGSAKLAFETGKHPGVLKDEVCSPG 233

Query: 255 GCTIAGLLTMEDGKIRSTLARTIQE 279
           G TI  ++ +E    R+T+   +++
Sbjct: 234 GTTIEAVIDLEKNGFRNTVMSAVEK 258



>gi|162459912|ref|NP_001105787.1| pyrroline 5-carboxylate reductase [Zea mays]
 gi|66356280|gb|AAY45745.1| pyrroline 5-carboxylate reductase [Zea mays]
 gi|194695882|gb|ACF82025.1| unknown [Zea mays]
 gi|195642784|gb|ACG40860.1| pyrroline-5-carboxylate reductase [Zea mays]
 gi|414878708|tpg|DAA55839.1| TPA: pyrroline-5-carboxylate reductase [Zea mays]
          Length = 287

 Score =  164 bits (415), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 97/273 (35%), Positives = 147/273 (53%), Gaps = 20/273 (7%)

Query: 13  LCVLGCGTMGRAILSGILDSLNVAPANE---PPTLIPKKFIACVSGEESAQRIKEEFNDK 69
           L  +G G +  +I  G+  S  V PA+     P   P++               E F   
Sbjct: 26  LGFVGAGNLAESIARGVAAS-GVLPASAIRTAPHRRPER--------------GEAFASF 70

Query: 70  ITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEW 129
              L+  N   V ++D+I++  KPQ+VK +L +   + S E KL++SI AG+ +  L++W
Sbjct: 71  GACLLQTNAHVVDDSDVIVISVKPQIVKQVLLQLRPRLS-EKKLLVSIAAGIKMQDLQDW 129

Query: 130 APSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAV 189
           +    RIIR MPNTP  + +  +V+      ++DD +    +FS +G+    +EK+ DAV
Sbjct: 130 S-GQRRIIRVMPNTPSAVGQAASVMCLGEMATQDDENRVRKLFSAIGKVWTAEEKYFDAV 188

Query: 190 TGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDS 249
           TGLSGSGPA+  + +EA+ADGGV  GLPR++              MV +TGKHP ++KD 
Sbjct: 189 TGLSGSGPAYIFLAIEAMADGGVAAGLPRDLALGLASQTVLGAATMVSQTGKHPGQLKDQ 248

Query: 250 VTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQ 282
           VT+P G TIAG+  +E G  R TL   +  A +
Sbjct: 249 VTSPAGTTIAGIQELEKGAFRGTLISAVVAAAK 281



>gi|254581050|ref|XP_002496510.1| ZYRO0D01782p [Zygosaccharomyces rouxii]
 gi|238939402|emb|CAR27577.1| ZYRO0D01782p [Zygosaccharomyces rouxii]
          Length = 286

 Score =  164 bits (414), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 100/288 (34%), Positives = 161/288 (55%), Gaps = 18/288 (6%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKIT 71
           TL +LG G MG+A+LS + ++ +VA AN+  +  P + I   +  +S++R+K+     + 
Sbjct: 4   TLLILGAGVMGQAVLSAVYNAPHVADANKS-SQYPSQIITVNNSVKSSERVKQ-----LV 57

Query: 72  LLVGNNVEGVK-----------EADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAG 120
              GN+  G+            + +++++ TKP  ++ +L +       E + +IS+ AG
Sbjct: 58  QSFGNSPNGISVRCETKLDKSVKPEVVVVGTKPYQLEQVLKDYS-SVFREAQQVISLAAG 116

Query: 121 VTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARI 180
            TIDQ++    +   + R M NTP     G  V+S  T+ S+  +  S  +F  LG    
Sbjct: 117 WTIDQIQSKIANPPSVSRVMTNTPAKFGWGSAVISHSTNTSEFQKQRSQELFQHLGLCVE 176

Query: 181 LDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTG 240
           L EK++DA T L GSGPAFA + +E+L +GG+ MG+P E              +M+L TG
Sbjct: 177 LPEKNMDAATALVGSGPAFALLWMESLMEGGIKMGIPLEQSRRLAATVVEGTSKMLLATG 236

Query: 241 KHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLG 288
            HP+ +K  V TPGG TIAGL+ MED  ++S + R ++EAT+VA+ LG
Sbjct: 237 AHPSVLKHQVCTPGGNTIAGLVEMEDRGVKSGIIRGVEEATRVAAELG 284



>gi|354547684|emb|CCE44419.1| hypothetical protein CPAR2_402200 [Candida parapsilosis]
          Length = 272

 Score =  164 bits (414), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 104/282 (36%), Positives = 158/282 (56%), Gaps = 15/282 (5%)

Query: 10  NPTLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEES-AQRIKEEFND 68
           + T+ VLGCG MG AI S IL S       EP    PKK   C +  E+ A++  +E   
Sbjct: 3   DYTITVLGCGVMGSAITSAILKS-----KFEP---YPKKMFLCTAEPETLAKQFGDEPIV 54

Query: 69  KITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLE-NKLIISILAGVTIDQLK 127
           +++  V +N + VKEAD+I+L  KP + + +   E ++ SL  ++LIIS++AGVTI   K
Sbjct: 55  QLSSCVEDNRKAVKEADVIILGLKPFMYEEVY--EQVKDSLTGDQLIISLMAGVTI---K 109

Query: 128 EWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLD 187
           E +  S  + + M NTP     G   +S     +K+ +     +   +G    + EK++D
Sbjct: 110 ELSIFSKYVAKVMTNTPARYGCGTAAISFAPAVTKEQQDLVNKLIEPIGLTVTIPEKNMD 169

Query: 188 AVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIK 247
             T L GSGPAF  +++E++ DG V MG+  +V             +M+++TG HPA +K
Sbjct: 170 IATSLIGSGPAFCLLMMESMIDGAVRMGMSYDVARLSAAKVMEGTAKMLIETGDHPAALK 229

Query: 248 DSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
             V TPGG TI GLL MEDG +RST+AR I+EA  ++++   
Sbjct: 230 SKVCTPGGTTIGGLLKMEDGALRSTIARGIEEAANISASFAK 271



>gi|321454186|gb|EFX65367.1| hypothetical protein DAPPUDRAFT_65532 [Daphnia pulex]
          Length = 275

 Score =  164 bits (414), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 99/271 (36%), Positives = 145/271 (53%), Gaps = 22/271 (8%)

Query: 16  LGCGTMGRA-----ILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKI 70
           +GCG M +A     I SGI  S N+  ++     I   FI             EEF    
Sbjct: 12  IGCGKMAQALAKGFIASGITRSENIIGSSP---RIDSTFI-------------EEFAAIG 55

Query: 71  TLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWA 130
                 N + V++A+++++ TKP +V  +LTE     +  N LIISI  G+ +  L++  
Sbjct: 56  CSTTHENAQVVEQAEVVIVATKPPLVPKVLTEINPVVN-SNNLIISIAMGIPLINLEQML 114

Query: 131 PSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVT 190
           P  TR+IR MPNTP ++R G +V SC T     D + +  +F+ +G    + E  +DA T
Sbjct: 115 PRKTRVIRIMPNTPVLVRSGASVFSCGTATRSGDATLTKKLFTAVGLCEEVPEVLIDACT 174

Query: 191 GLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSV 250
           GLSGSGPA+  + +EALADGGV MG+PRE+             +MVL+TG+HP  +KD V
Sbjct: 175 GLSGSGPAYMYIAMEALADGGVKMGIPRELAYKLSAQTLVGAAKMVLETGRHPGALKDDV 234

Query: 251 TTPGGCTIAGLLTMEDGKIRSTLARTIQEAT 281
            +P G TI  +  +E    RS+L   ++ AT
Sbjct: 235 CSPAGSTIQAVYFLEKSGFRSSLMEAVEAAT 265



>gi|196008649|ref|XP_002114190.1| hypothetical protein TRIADDRAFT_27568 [Trichoplax adhaerens]
 gi|190583209|gb|EDV23280.1| hypothetical protein TRIADDRAFT_27568 [Trichoplax adhaerens]
          Length = 267

 Score =  164 bits (414), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 100/278 (35%), Positives = 148/278 (53%), Gaps = 12/278 (4%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKIT 71
           T+  +G G M +A+ SG + S  VA  +        K  A     ES Q IKE+ N+   
Sbjct: 2   TIGFIGAGKMAQALASGFIAS-RVASVD--------KLFASAPSMESLQGIKEKINN--I 50

Query: 72  LLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAP 131
            +  +N + V++ D+I++  KP ++  +L E       EN LIIS+ AG+ I  +++  P
Sbjct: 51  NVTTDNKDIVRKNDVIIVAVKPNILSQVLKEIAPVIRSEN-LIISVAAGIRIPAIEDPLP 109

Query: 132 SSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTG 191
           + TR++R MPNTPC++  G +  S  T     D      + S +G    + E  +DAV G
Sbjct: 110 NGTRVVRVMPNTPCLVGAGASAYSLGTYAQSRDAETVNKLMSAVGLCEKVPESLIDAVVG 169

Query: 192 LSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVT 251
           +SGSGPA+  V +EALADGGV  GLPR +             +MV++ G HPAE+KD V 
Sbjct: 170 VSGSGPAYMFVAIEALADGGVKAGLPRHLALKLAAQTLLGAGKMVMEIGAHPAELKDEVC 229

Query: 252 TPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           +PGG TIA + T+E    R  L   + E+   +  LGN
Sbjct: 230 SPGGTTIAAVHTLEKNGFRGALIDAVLESCNRSRELGN 267



>gi|492844733|ref|WP_005998687.1| pyrroline-5-carboxylate reductase [Desulfuromonas acetoxidans]
 gi|95134978|gb|EAT16632.1| pyrroline-5-carboxylate reductase [Desulfuromonas acetoxidans DSM
           684]
          Length = 268

 Score =  164 bits (414), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 101/277 (36%), Positives = 151/277 (54%), Gaps = 14/277 (5%)

Query: 13  LCVLGCGTMGRAILSGILDSLNVAPANEPPTLIPKKFIACVSGEESAQRIKEEFNDKITL 72
           L  +G G M  A++ G++ S   + A     L+P          E  Q +++ +  + T 
Sbjct: 6   LGFIGGGNMAEALIKGLIASGMDSKAILVAELMP----------ERRQFLEQTYGIETT- 54

Query: 73  LVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISILAGVTIDQLKEWAPS 132
              ++ + V E  +ILL  KPQ +   L       S ++  +ISILAGV   +++     
Sbjct: 55  --ADSSQVVAEKKVILLAVKPQALDAALMPLSEAFS-DDHCMISILAGVKTSRIEAILGG 111

Query: 133 STRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGRARILDEKHLDAVTGL 192
           S RI+R MPNTP +I  G   LS       DD   +  +F+++G   ++ EK LDAVTGL
Sbjct: 112 SPRIVRVMPNTPALIGTGAAALSGGRYVQNDDVELARQLFASVGVVEVVAEKLLDAVTGL 171

Query: 193 SGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVLKTGKHPAEIKDSVTT 252
           SGSGPA+   ++EALADGGV+ GLPR+V             +MVL TG+HPA ++D V +
Sbjct: 172 SGSGPAYVYTIIEALADGGVLEGLPRDVALNLAAKTVAGAAQMVLDTGEHPAVLRDRVCS 231

Query: 253 PGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           PGG TIA + T+E GK+R+TL   +  A+Q +  L +
Sbjct: 232 PGGTTIAAVDTLEKGKLRATLMGAVTRASQRSRELAD 268



>gi|403216535|emb|CCK71032.1| hypothetical protein KNAG_0F03700 [Kazachstania naganishii CBS
           8797]
          Length = 285

 Score =  164 bits (414), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 102/292 (34%), Positives = 155/292 (53%), Gaps = 26/292 (8%)

Query: 12  TLCVLGCGTMGRAILSGILDSLNVAPANEPPT------LIPKKFIACVSGEESAQRIKEE 65
           TL +LGCG MG+AILS I  +       E PT      L P K IAC   E +A+++ + 
Sbjct: 4   TLTILGCGVMGQAILSAIYKA-------EKPTDVAVAELYPSKIIACNGDEPAAEQVAQM 56

Query: 66  FNDK--------ITLLVGNNVEGVKEADIILLCTKPQVVKTILTEEGMQKSLENKLIISI 117
                       +    GNN E V E+ +++L TKP +V+T+L E  ++  +  KL+ISI
Sbjct: 57  IKGYGESPNGIVVESAFGNNREAVSESKVVILGTKPFLVETVLDE--VKDVVSGKLLISI 114

Query: 118 LAGVTIDQLKEWAPSSTRIIRAMPNTPCMIREGMTVLSCPTDCSKDDRSFSIWVFSTLGR 177
            AG TIDQL  + P  +R+   M NTP     G  V++     + D +     + S +G 
Sbjct: 115 AAGWTIDQLANYTPPVSRV---MTNTPAKYGYGCAVIAHSAQVTADQKKTVSQLISHVGT 171

Query: 178 ARILDEKHLDAVTGLSGSGPAFACVVLEALADGGVMMGLPREVXXXXXXXXXXXXXRMVL 237
              L EK++DA T L GSGPA+  +++E++ + G+ MG+P                +MV 
Sbjct: 172 CVELPEKNMDAATSLVGSGPAYVLLMIESMMESGIKMGIPLRESLTCSLKVLEGTCKMVE 231

Query: 238 KTGKHPAEIKDSVTTPGGCTIAGLLTMEDGKIRSTLARTIQEATQVASTLGN 289
           ++G HP+ +K  V TPGG TIAGL  ME+  ++S + + ++E   VA+ LG 
Sbjct: 232 ESGTHPSVLKHQVCTPGGTTIAGLCKMEENGVKSGIIKGVEEGAIVAAKLGK 283