BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10175_c0_seq1-m.69 complete 232-1935(+) 568 (+)
         (567 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|302693619|ref|XP_003036488.1| hypothetical protein SCHCODRAFT...   132   2e-28   Schizophyllum commune H4-8
gi|353237999|emb|CCA69958.1| related to Protein esc1 [Piriformos...   132   4e-28   Serendipita indica DSM 11827
gi|409079919|gb|EKM80280.1| hypothetical protein AGABI1DRAFT_113...   129   3e-27   Agaricus bisporus var. burnettii JB137-S8
gi|511005626|gb|EPB86960.1| hypothetical protein HMPREF1544_0628...   128   4e-27   Mucor circinelloides f. circinelloides 1006PhL
gi|395328866|gb|EJF61256.1| hypothetical protein DICSQDRAFT_6111...   128   6e-27   Dichomitus squalens LYAD-421 SS1
gi|449549744|gb|EMD40709.1| hypothetical protein CERSUDRAFT_8036...   127   1e-26   Gelatoporia subvermispora B
gi|242220608|ref|XP_002476068.1| predicted protein [Postia place...   126   1e-26   Postia placenta Mad-698-R
gi|384497360|gb|EIE87851.1| hypothetical protein RO3G_12562 [Rhi...   126   2e-26   Rhizopus delemar RA 99-880
gi|392568760|gb|EIW61934.1| hypothetical protein TRAVEDRAFT_6347...   125   3e-26   Trametes versicolor FP-101664 SS1
gi|384498794|gb|EIE89285.1| hypothetical protein RO3G_13996 [Rhi...   125   3e-26   Rhizopus delemar RA 99-880
gi|336386370|gb|EGO27516.1| hypothetical protein SERLADRAFT_4611...   125   4e-26   Serpula lacrymans var. lacrymans S7.9
gi|336373553|gb|EGO01891.1| hypothetical protein SERLA73DRAFT_17...   125   4e-26   Serpula lacrymans var. lacrymans S7.3
gi|409049600|gb|EKM59077.1| hypothetical protein PHACADRAFT_2492...   124   6e-26   Phanerochaete carnosa HHB-10118-sp
gi|443899772|dbj|GAC77101.1| upstream transcription factor 2/L-m...   124   9e-26   Moesziomyces antarcticus T-34
gi|393215741|gb|EJD01232.1| hypothetical protein FOMMEDRAFT_2165...   124   1e-25   Fomitiporia mediterranea MF3/22
gi|170091802|ref|XP_001877123.1| predicted protein [Laccaria bic...   124   1e-25   Laccaria bicolor S238N-H82
gi|390601225|gb|EIN10619.1| hypothetical protein PUNSTDRAFT_1425...   122   3e-25   Punctularia strigosozonata HHB-11173 SS5
gi|342320926|gb|EGU12864.1| hypothetical protein RTG_00886 [Rhod...   122   3e-25   Rhodotorula toruloides ATCC 204091
gi|343427972|emb|CBQ71497.1| related to Protein esc1 [Sporisoriu...   122   3e-25   Sporisorium reilianum SRZ2
gi|392586779|gb|EIW76114.1| hypothetical protein CONPUDRAFT_1581...   122   3e-25   Coniophora puteana RWD-64-598 SS2
gi|472582678|gb|EMS20356.1| transcription regulator [Rhodosporid...   122   4e-25   Rhodotorula toruloides NP11
gi|443927350|gb|ELU45852.1| HLH domain-containing protein [Rhizo...   121   7e-25   Rhizoctonia solani AG-1 IA
gi|388857640|emb|CCF48789.1| related to Protein esc1 [Ustilago h...   120   8e-25   Ustilago hordei
gi|471915314|emb|CCO26483.1| Protein esc1 [Rhizoctonia solani AG...   120   1e-24   Rhizoctonia solani AG-1 IB
gi|501305993|dbj|GAC95099.1| hypothetical protein PHSY_002674 [P...   120   1e-24   Pseudozyma hubeiensis SY62
gi|299747642|ref|XP_002911197.1| hypothetical protein CC1G_14628...   120   2e-24   Coprinopsis cinerea okayama7#130
gi|321249371|ref|XP_003191437.1| hypothetical protein CGB_A4540C...   117   1e-23   Cryptococcus gattii WM276
gi|58259511|ref|XP_567168.1| hypothetical protein [Cryptococcus ...   117   1e-23   Cryptococcus neoformans var. neoformans JEC21
gi|405117817|gb|AFR92592.1| hypothetical protein CNAG_00460 [Cry...   115   4e-23   Cryptococcus neoformans var. grubii H99
gi|71024289|ref|XP_762374.1| hypothetical protein UM06227.1 [Ust...   115   4e-23   
gi|401883331|gb|EJT47545.1| hypothetical protein A1Q1_03604 [Tri...   112   3e-22   Trichosporon asahii var. asahii CBS 2479
gi|501753066|emb|CCG83173.1| putative HLH transcription factor [...   111   7e-22   Taphrina deformans PYCC 5710
gi|345569064|gb|EGX51933.1| hypothetical protein AOL_s00043g667 ...   110   1e-21   Arthrobotrys oligospora ATCC 24927
gi|392580115|gb|EIW73242.1| hypothetical protein TREMEDRAFT_5941...   110   2e-21   Tremella mesenterica DSM 1558
gi|511011283|gb|EPB92494.1| hypothetical protein HMPREF1544_0050...   109   3e-21   Mucor circinelloides f. circinelloides 1006PhL
gi|384498115|gb|EIE88606.1| hypothetical protein RO3G_13317 [Rhi...   107   1e-20   Rhizopus delemar RA 99-880
gi|213408200|ref|XP_002174871.1| esc1 [Schizosaccharomyces japon...   106   2e-20   Schizosaccharomyces japonicus yFS275
gi|480320796|gb|AGJ81967.1| transcription factor-like protein, p...   105   4e-20   Heterobasidion annosum
gi|223557613|gb|ACM91510.1| bHLH transcription factor-like prote...   105   4e-20   Heterobasidion abietinum
gi|480320794|gb|AGJ81966.1| transcription factor-like protein, p...   105   5e-20   Heterobasidion annosum
gi|480320856|gb|AGJ81997.1| transcription factor-like protein, p...   105   5e-20   Heterobasidion abietinum
gi|223557673|gb|ACM91540.1| bHLH transcription factor-like prote...   105   5e-20   Heterobasidion parviporum
gi|480320806|gb|AGJ81972.1| transcription factor-like protein, p...   105   5e-20   Heterobasidion annosum
gi|480320776|gb|AGJ81957.1| transcription factor-like protein, p...   105   5e-20   Heterobasidion annosum
gi|480320842|gb|AGJ81990.1| transcription factor-like protein, p...   105   6e-20   Heterobasidion occidentale
gi|480320810|gb|AGJ81974.1| transcription factor-like protein, p...   104   6e-20   Heterobasidion irregulare
gi|480320782|gb|AGJ81960.1| transcription factor-like protein, p...   104   6e-20   Heterobasidion abietinum
gi|223557641|gb|ACM91524.1| bHLH transcription factor-like prote...   103   1e-19   Heterobasidion insulare
gi|223557649|gb|ACM91528.1| bHLH transcription factor-like prote...   103   1e-19   Heterobasidion araucariae
gi|223557563|gb|ACM91485.1| bHLH transcription factor-like prote...   103   1e-19   Heterobasidion annosum
gi|223557523|gb|ACM91465.1| bHLH transcription factor-like prote...   103   1e-19   Heterobasidion annosum
gi|19114142|ref|NP_593230.1| transcription factor Esc1 (predicte...   103   1e-19   Schizosaccharomyces pombe 972h-
gi|223557545|gb|ACM91476.1| bHLH transcription factor-like prote...   103   2e-19   Heterobasidion annosum
gi|465794511|emb|CCU99299.1| unnamed protein product [Malassezia...   103   2e-19   Malassezia sympodialis ATCC 42132
gi|223557543|gb|ACM91475.1| bHLH transcription factor-like prote...   103   2e-19   Heterobasidion annosum
gi|223557565|gb|ACM91486.1| bHLH transcription factor-like prote...   103   2e-19   Heterobasidion annosum
gi|480320774|gb|AGJ81956.1| transcription factor-like protein, p...   103   2e-19   Heterobasidion annosum
gi|480320798|gb|AGJ81968.1| transcription factor-like protein, p...   103   2e-19   Heterobasidion annosum
gi|223557677|gb|ACM91542.1| bHLH transcription factor-like prote...   103   2e-19   Heterobasidion annosum
gi|223557521|gb|ACM91464.1| bHLH transcription factor-like prote...   103   2e-19   Heterobasidion annosum
gi|480320808|gb|AGJ81973.1| transcription factor-like protein, p...   103   2e-19   Heterobasidion irregulare
gi|223557655|gb|ACM91531.1| bHLH transcription factor-like prote...   102   4e-19   Heterobasidion parviporum
gi|384494144|gb|EIE84635.1| hypothetical protein RO3G_09345 [Rhi...   101   6e-19   Rhizopus delemar RA 99-880
gi|223557691|gb|ACM91549.1| bHLH transcription factor-like prote...   101   7e-19   Heterobasidion annosum
gi|389747242|gb|EIM88421.1| hypothetical protein STEHIDRAFT_1101...   100   1e-18   Stereum hirsutum FP-91666 SS1
gi|326898681|gb|AEA08920.1| transcription factor-like protein [H...   100   1e-18   Heterobasidion insulare
gi|326898667|gb|AEA08913.1| transcription factor-like protein [H...   100   1e-18   Heterobasidion aff. annosum PG-2011
gi|326898665|gb|AEA08912.1| transcription factor-like protein [H...   100   2e-18   Heterobasidion aff. annosum PG-2011
gi|326898661|gb|AEA08910.1| transcription factor-like protein [H...   100   2e-18   Heterobasidion aff. annosum PG-2011
gi|326898659|gb|AEA08909.1| transcription factor-like protein [H...   100   2e-18   Heterobasidion irregulare
gi|408398095|gb|EKJ77230.1| hypothetical protein FPSE_02604 [Fus...   100   2e-18   Fusarium pseudograminearum CS3096
gi|223557665|gb|ACM91536.1| bHLH transcription factor-like prote...    99   3e-18   Heterobasidion abietinum
gi|452989168|gb|EME88923.1| hypothetical protein MYCFIDRAFT_8614...    99   3e-18   Cercospora fijiensis CIRAD86
gi|384491391|gb|EIE82587.1| hypothetical protein RO3G_07292 [Rhi...    99   4e-18   Rhizopus delemar RA 99-880
gi|164658740|ref|XP_001730495.1| hypothetical protein MGL_2291 [...    99   4e-18   Malassezia globosa CBS 7966
gi|511011405|gb|EPB92616.1| hypothetical protein HMPREF1544_0062...    99   5e-18   Mucor circinelloides f. circinelloides 1006PhL
gi|378733285|gb|EHY59744.1| hypothetical protein HMPREF1120_0772...    98   6e-18   Exophiala dermatitidis NIH/UT8656
gi|46108582|ref|XP_381349.1| hypothetical protein FG01173.1 [Fus...    98   6e-18   
gi|402226042|gb|EJU06102.1| bHLH transcription factor-like prote...    97   1e-17   Dacryopinax primogenitus
gi|327349590|gb|EGE78447.1| HLH transcription factor [Ajellomyce...    97   2e-17   Blastomyces dermatitidis ATCC 18188
gi|399163744|emb|CCE35265.1| uncharacterized protein CPUR_03253 ...    96   3e-17   Claviceps purpurea 20.1
gi|358388863|gb|EHK26456.1| hypothetical protein TRIVIDRAFT_3560...    95   5e-17   Trichoderma virens Gv29-8
gi|367042706|ref|XP_003651733.1| hypothetical protein THITE_2112...    95   5e-17   Thielavia terrestris NRRL 8126
gi|367020684|ref|XP_003659627.1| hypothetical protein MYCTH_2296...    95   6e-17   Myceliophthora thermophila ATCC 42464
gi|402084056|gb|EJT79074.1| hypothetical protein GGTG_04163 [Gae...    95   6e-17   Gaeumannomyces graminis var. tritici R3-111a-1
gi|322697996|gb|EFY89770.1| HLH transcription factor (Hpa3), put...    95   6e-17   Metarhizium acridum CQMa 102
gi|449297176|gb|EMC93194.1| hypothetical protein BAUCODRAFT_7592...    95   6e-17   Baudoinia panamericana UAMH 10762
gi|296420330|ref|XP_002839728.1| hypothetical protein [Tuber mel...    95   7e-17   Tuber melanosporum Mel28
gi|322708547|gb|EFZ00124.1| HLH transcription factor (Hpa3), put...    94   8e-17   Metarhizium robertsii ARSEF 23
gi|396472558|ref|XP_003839150.1| hypothetical protein LEMA_P0282...    94   9e-17   Leptosphaeria maculans JN3
gi|398410069|ref|XP_003856488.1| hypothetical protein MYCGRDRAFT...    94   9e-17   Zymoseptoria tritici IPO323
gi|258575349|ref|XP_002541856.1| conserved hypothetical protein ...    94   9e-17   Uncinocarpus reesii 1704
gi|389631549|ref|XP_003713427.1| hypothetical protein MGG_10837 ...    94   1e-16   Magnaporthe oryzae 70-15
gi|350295429|gb|EGZ76406.1| hypothetical protein NEUTE2DRAFT_981...    94   1e-16   Neurospora tetrasperma FGSC 2509
gi|440463729|gb|ELQ33283.1| hypothetical protein OOU_Y34scaffold...    94   1e-16   Magnaporthe oryzae Y34
gi|452847934|gb|EME49866.1| hypothetical protein DOTSEDRAFT_1646...    94   1e-16   Dothistroma septosporum NZE10
gi|512192467|gb|EPE08226.1| hlh transcription factor [Ophiostoma...    94   1e-16   Ophiostoma piceae UAMH 11346
gi|336465128|gb|EGO53368.1| hypothetical protein NEUTE1DRAFT_150...    94   1e-16   Neurospora tetrasperma FGSC 2508
gi|242819786|ref|XP_002487387.1| HLH transcription factor (Hpa3)...    94   1e-16   Talaromyces stipitatus ATCC 10500
gi|302664602|ref|XP_003023930.1| HLH transcription factor (Hpa3)...    94   1e-16   Trichophyton verrucosum HKI 0517
gi|327305503|ref|XP_003237443.1| HLH transcription factor [Trich...    94   1e-16   Trichophyton rubrum CBS 118892
gi|38566949|emb|CAE76251.1| hypothetical protein [Neurospora cra...    94   1e-16   Neurospora crassa
gi|164427599|ref|XP_965344.2| hypothetical protein NCU02957 [Neu...    94   1e-16   
gi|403164837|ref|XP_003324903.2| hypothetical protein PGTG_06440...    94   1e-16   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|340517502|gb|EGR47746.1| predicted protein [Trichoderma reese...    94   1e-16   Trichoderma reesei QM6a
gi|302498618|ref|XP_003011306.1| HLH transcription factor (Hpa3)...    94   1e-16   Arthroderma benhamiae CBS 112371
gi|358395911|gb|EHK45298.1| hypothetical protein TRIATDRAFT_2999...    94   2e-16   Trichoderma atroviride IMI 206040
gi|121716104|ref|XP_001275661.1| HLH transcription factor (Hpa3)...    93   2e-16   Aspergillus clavatus NRRL 1
gi|453088287|gb|EMF16327.1| HLH-domain-containing protein [Mycos...    93   2e-16   Sphaerulina musiva SO2202
gi|315046606|ref|XP_003172678.1| hypothetical protein MGYG_05268...    93   2e-16   Microsporum gypseum CBS 118893
gi|115401710|ref|XP_001216443.1| conserved hypothetical protein ...    93   2e-16   Aspergillus terreus NIH2624
gi|475664480|gb|EMT62275.1| Protein esc1 [Fusarium oxysporum f. ...    93   2e-16   Fusarium oxysporum f. sp. cubense race 4
gi|342874432|gb|EGU76444.1| hypothetical protein FOXB_13037 [Fus...    93   2e-16   Fusarium oxysporum Fo5176
gi|480320780|gb|AGJ81959.1| transcription factor-like protein, p...    93   3e-16   Heterobasidion annosum
gi|340992679|gb|EGS23234.1| hypothetical protein CTHT_0009000 [C...    93   3e-16   Chaetomium thermophilum var. thermophilum DSM 1495
gi|212539047|ref|XP_002149679.1| HLH transcription factor (Hpa3)...    93   3e-16   Talaromyces marneffei ATCC 18224
gi|511010394|gb|EPB91618.1| hypothetical protein HMPREF1544_0154...    93   3e-16   Mucor circinelloides f. circinelloides 1006PhL
gi|403172874|ref|XP_003332012.2| hypothetical protein PGTG_13964...    92   3e-16   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|303321824|ref|XP_003070906.1| bHLH family transcription facto...    92   4e-16   Coccidioides posadasii C735 delta SOWgp
gi|392862173|gb|EAS37208.2| hypothetical protein CIMG_02390 [Coc...    92   4e-16   
gi|400598802|gb|EJP66509.1| helix-loop-helix DNA-binding domain-...    92   4e-16   Beauveria bassiana ARSEF 2860
gi|346320985|gb|EGX90585.1| HLH transcription factor (Hpa3), put...    92   4e-16   Cordyceps militaris CM01
gi|296805778|ref|XP_002843713.1| conserved hypothetical protein ...    92   5e-16   Arthroderma otae CBS 113480
gi|407924662|gb|EKG17695.1| hypothetical protein MPH_05144 [Macr...    92   6e-16   Macrophomina phaseolina MS6
gi|67901132|ref|XP_680822.1| hypothetical protein AN7553.2 [Aspe...    92   6e-16   Aspergillus nidulans FGSC A4
gi|156063754|ref|XP_001597799.1| hypothetical protein SS1G_01995...    91   7e-16   Sclerotinia sclerotiorum 1980 UF-70
gi|20067643|emb|CAC81781.1| putative bHLH transcription factor [...    91   7e-16   Aspergillus nidulans
gi|71002262|ref|XP_755812.1| HLH transcription factor (Hpa3) [As...    91   9e-16   Aspergillus fumigatus Af293
gi|320586982|gb|EFW99645.1| hlh transcription factor [Grosmannia...    91   1e-15   Grosmannia clavigera kw1407
gi|119481827|ref|XP_001260942.1| HLH transcription factor (Hpa3)...    91   1e-15   Aspergillus fischeri NRRL 181
gi|512207553|gb|EPE36371.1| HLH, helix-loop-helix DNA-binding pr...    91   1e-15   Glarea lozoyensis ATCC 20868
gi|380487235|emb|CCF38168.1| helix-loop-helix DNA-binding domain...    91   1e-15   Colletotrichum higginsianum
gi|310793448|gb|EFQ28909.1| helix-loop-helix DNA-binding domain-...    91   1e-15   Colletotrichum graminicola M1.001
gi|358060881|dbj|GAA93397.1| hypothetical protein E5Q_00038 [Mix...    91   1e-15   Mixia osmundae IAM 14324
gi|347830660|emb|CCD46357.1| similar to transcription factor bHL...    91   1e-15   Botrytis cinerea T4
gi|358373709|dbj|GAA90305.1| HLH transcription factor [Aspergill...    91   1e-15   Aspergillus kawachii IFO 4308
gi|317035417|ref|XP_003188917.1| HLH transcription factor (Hpa3)...    90   2e-15   Aspergillus niger CBS 513.88
gi|440632503|gb|ELR02422.1| hypothetical protein GMDG_05480 [Geo...    90   2e-15   Pseudogymnoascus destructans 20631-21
gi|477531919|gb|ENH83590.1| hlh transcription factor [Colletotri...    90   2e-15   Colletotrichum orbiculare MAFF 240422
gi|336274380|ref|XP_003351944.1| hypothetical protein SMAC_00493...    90   2e-15   Sordaria macrospora k-hell
gi|350636303|gb|EHA24663.1| hypothetical protein ASPNIDRAFT_1819...    89   3e-15   Aspergillus niger ATCC 1015
gi|346978400|gb|EGY21852.1| hypothetical protein VDAG_03292 [Ver...    89   3e-15   Verticillium dahliae VdLs.17
gi|171684719|ref|XP_001907301.1| hypothetical protein [Podospora...    89   4e-15   Podospora anserina S mat+
gi|134082410|emb|CAK42424.1| unnamed protein product [Aspergillu...    89   4e-15   Aspergillus niger
gi|482812256|gb|EOA88988.1| hypothetical protein SETTUDRAFT_1837...    89   4e-15   Setosphaeria turcica Et28A
gi|451850014|gb|EMD63317.1| hypothetical protein COCSADRAFT_3400...    88   6e-15   Bipolaris sorokiniana ND90Pr
gi|302411718|ref|XP_003003692.1| conserved hypothetical protein ...    88   6e-15   Verticillium alfalfae VaMs.102
gi|452001836|gb|EMD94295.1| hypothetical protein COCHEDRAFT_1192...    88   6e-15   Bipolaris maydis C5
gi|83770063|dbj|BAE60198.1| unnamed protein product [Aspergillus...    88   7e-15   Aspergillus oryzae RIB40
gi|494824721|gb|EON61975.1| hypothetical protein W97_01193 [Coni...    88   7e-15   Coniosporium apollinis CBS 100218
gi|425767955|gb|EKV06505.1| hypothetical protein PDIG_77020 [Pen...    88   7e-15   Penicillium digitatum PHI26
gi|238495885|ref|XP_002379178.1| HLH transcription factor (Hpa3)...    88   8e-15   Aspergillus flavus NRRL3357
gi|429860568|gb|ELA35298.1| hlh transcription factor [Colletotri...    87   1e-14   Colletotrichum gloeosporioides Nara gc5
gi|255930937|ref|XP_002557025.1| Pc12g01260 [Penicillium chrysog...    87   2e-14   Penicillium rubens Wisconsin 54-1255
gi|116192347|ref|XP_001221986.1| hypothetical protein CHGG_05891...    86   2e-14   Chaetomium globosum CBS 148.51
gi|154318622|ref|XP_001558629.1| hypothetical protein BC1G_02700...    86   3e-14   Botrytis cinerea B05.10
gi|330928490|ref|XP_003302286.1| hypothetical protein PTT_14037 ...    86   3e-14   Pyrenophora teres f. teres 0-1
gi|189203825|ref|XP_001938248.1| conserved hypothetical protein ...    86   3e-14   Pyrenophora tritici-repentis Pt-1C-BFP
gi|406698084|gb|EKD01330.1| bHLH transcription factor-like prote...    86   4e-14   Trichosporon asahii var. asahii CBS 8904
gi|406868017|gb|EKD21054.1| hlh transcription factor [Marssonina...    84   1e-13   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|169624013|ref|XP_001805413.1| hypothetical protein SNOG_15257...    82   5e-13   Parastagonospora nodorum SN15
gi|325087386|gb|EGC40696.1| HLH transcription factor [Ajellomyce...    81   8e-13   Histoplasma capsulatum H88
gi|328854842|gb|EGG03972.1| hypothetical protein MELLADRAFT_8978...    80   1e-12   Melampsora larici-populina 98AG31
gi|154270149|ref|XP_001535934.1| hypothetical protein HCAG_09151...    79   3e-12   Histoplasma capsulatum NAm1
gi|225683215|gb|EEH21499.1| conserved hypothetical protein [Para...    79   5e-12   


>gi|302693619|ref|XP_003036488.1| hypothetical protein SCHCODRAFT_254923 [Schizophyllum commune H4-8]
 gi|300110185|gb|EFJ01586.1| hypothetical protein SCHCODRAFT_254923 [Schizophyllum commune H4-8]
          Length = 517

 Score =  132 bits (333), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 70/84 (83%)

Query: 473 TPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLK 532
           TPYSRSPELR+SHKLAERKRRKEMKELFDELRD LP D+ +K SKWEILSKA++F+  +K
Sbjct: 344 TPYSRSPELRVSHKLAERKRRKEMKELFDELRDQLPADRGMKASKWEILSKAIDFVQQMK 403

Query: 533 HNQDEMAKEVESLRQQLSVLKGCS 556
             Q +MA+E+E +RQ++  ++G  
Sbjct: 404 QTQADMAREMELMRQEIDAMRGGG 427



>gi|353237999|emb|CCA69958.1| related to Protein esc1 [Piriformospora indica DSM 11827]
          Length = 586

 Score =  132 bits (331), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 57/82 (69%), Positives = 73/82 (89%)

Query: 473 TPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLK 532
           TPYSRSPELRISHKLAERKRRKEMK+LFDELRD+LP D+ +K+SKWEILSKA+++IN L+
Sbjct: 461 TPYSRSPELRISHKLAERKRRKEMKDLFDELRDNLPADRGMKSSKWEILSKAIDYINQLR 520

Query: 533 HNQDEMAKEVESLRQQLSVLKG 554
             Q +MA+E+ESL+ +L  ++G
Sbjct: 521 GQQHDMAREIESLKSELDAVRG 542



>gi|409079919|gb|EKM80280.1| hypothetical protein AGABI1DRAFT_113482 [Agaricus bisporus var.
           burnettii JB137-S8]
 gi|426198314|gb|EKV48240.1| hypothetical protein AGABI2DRAFT_191870 [Agaricus bisporus var.
           bisporus H97]
          Length = 399

 Score =  129 bits (323), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 55/89 (61%), Positives = 72/89 (80%)

Query: 470 VKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFIN 529
           +  TPYSRSPELR+SHKLAERKRRKEMK+LFDELRD LP D+ +K SKWEIL+KA++F+ 
Sbjct: 240 LSATPYSRSPELRVSHKLAERKRRKEMKDLFDELRDQLPADRGMKASKWEILTKAIDFVV 299

Query: 530 TLKHNQDEMAKEVESLRQQLSVLKGCSNS 558
            LK +  +M +E++ LRQ+L + +G S S
Sbjct: 300 NLKQSHQDMVREIDRLRQELDIARGGSGS 328



>gi|511005626|gb|EPB86960.1| hypothetical protein HMPREF1544_06283 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 512

 Score =  128 bits (322), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 73/83 (87%)

Query: 471 KETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINT 530
           KETPYSRSPELRISHKLAERKRRKEMK+LFDELRDSLPV+K++KTSKWEILSKAVE+I+ 
Sbjct: 417 KETPYSRSPELRISHKLAERKRRKEMKDLFDELRDSLPVEKNMKTSKWEILSKAVEYISL 476

Query: 531 LKHNQDEMAKEVESLRQQLSVLK 553
           LK    +M  E+  LR+++ ++K
Sbjct: 477 LKRRDYDMETEISGLRREIDMIK 499



>gi|395328866|gb|EJF61256.1| hypothetical protein DICSQDRAFT_61110 [Dichomitus squalens LYAD-421
           SS1]
          Length = 675

 Score =  128 bits (321), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 56/77 (72%), Positives = 66/77 (85%)

Query: 473 TPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLK 532
           TPYSRSPELR+SHKLAERKRRKEMKELFDELRD LP D+ +K SKWEILSKA++FI TLK
Sbjct: 471 TPYSRSPELRVSHKLAERKRRKEMKELFDELRDQLPADRGMKASKWEILSKAIDFIVTLK 530

Query: 533 HNQDEMAKEVESLRQQL 549
            +  +M +E+E LR +L
Sbjct: 531 QSHQDMGREIEMLRHEL 547



>gi|449549744|gb|EMD40709.1| hypothetical protein CERSUDRAFT_80362 [Ceriporiopsis subvermispora
           B]
          Length = 610

 Score =  127 bits (318), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 55/81 (67%), Positives = 67/81 (82%)

Query: 473 TPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLK 532
           TPYSRSPELR+SHKLAERKRRKEMKELFDELRD LP D+ +K SKWEILSKA++FI  LK
Sbjct: 418 TPYSRSPELRVSHKLAERKRRKEMKELFDELRDQLPADRGMKASKWEILSKAIDFIGNLK 477

Query: 533 HNQDEMAKEVESLRQQLSVLK 553
            +  ++ +EVE LR +L  ++
Sbjct: 478 QSHQDLTREVEILRHELDSIR 498



>gi|242220608|ref|XP_002476068.1| predicted protein [Postia placenta Mad-698-R]
 gi|220724719|gb|EED78743.1| predicted protein [Postia placenta Mad-698-R]
          Length = 1758

 Score =  126 bits (317), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 67/81 (82%)

Query: 473  TPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLK 532
            TPYSRSPELR+SHKLAERKRRKEMKELFDELRD LP D+ +K SKWEILSKA++FI  LK
Sbjct: 1568 TPYSRSPELRVSHKLAERKRRKEMKELFDELRDQLPADRGMKASKWEILSKAIDFIMNLK 1627

Query: 533  HNQDEMAKEVESLRQQLSVLK 553
             +  EM +E+E LR +L  ++
Sbjct: 1628 QSHQEMGREIEMLRHELDSIR 1648



>gi|384497360|gb|EIE87851.1| hypothetical protein RO3G_12562 [Rhizopus delemar RA 99-880]
          Length = 339

 Score =  126 bits (316), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 73/85 (85%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           P KETPYSRSP LR+SHKLAERKRRKEMK LFDELRDSLPV+K++KTSKWEILSKAVE+I
Sbjct: 246 PRKETPYSRSPALRVSHKLAERKRRKEMKCLFDELRDSLPVEKNMKTSKWEILSKAVEYI 305

Query: 529 NTLKHNQDEMAKEVESLRQQLSVLK 553
           + LK    +M  E+  LR++++++K
Sbjct: 306 SLLKRRDYDMETEINKLRREINIIK 330



>gi|392568760|gb|EIW61934.1| hypothetical protein TRAVEDRAFT_63475 [Trametes versicolor
           FP-101664 SS1]
          Length = 582

 Score =  125 bits (315), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 66/77 (85%)

Query: 473 TPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLK 532
           TPYSRSPELR+SHKLAERKRRKEMKELFDELRD LP D+ +K SKWEILSKA++FI TLK
Sbjct: 382 TPYSRSPELRVSHKLAERKRRKEMKELFDELRDQLPADRGMKASKWEILSKAIDFIVTLK 441

Query: 533 HNQDEMAKEVESLRQQL 549
            +  EM ++++ LR +L
Sbjct: 442 QSHQEMGRDIDLLRHEL 458



>gi|384498794|gb|EIE89285.1| hypothetical protein RO3G_13996 [Rhizopus delemar RA 99-880]
          Length = 353

 Score =  125 bits (315), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 71/85 (83%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           P KETPYSRSP LR+SHKLAERKRRKEMK LFDELRDSLPV+K +KTSKWEILSKAVE+I
Sbjct: 255 PRKETPYSRSPALRVSHKLAERKRRKEMKGLFDELRDSLPVEKDMKTSKWEILSKAVEYI 314

Query: 529 NTLKHNQDEMAKEVESLRQQLSVLK 553
           + LK    ++  E+ SLR+++  +K
Sbjct: 315 SLLKRRDYDLENEINSLRREIDAIK 339



>gi|336386370|gb|EGO27516.1| hypothetical protein SERLADRAFT_461105 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 563

 Score =  125 bits (314), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 67/84 (79%)

Query: 470 VKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFIN 529
              TPYSRSPELR+SHKLAERKRRKEMK+LFDELRD LP D+ +K SKWEILSKA++F+ 
Sbjct: 390 AGNTPYSRSPELRVSHKLAERKRRKEMKDLFDELRDQLPADRGMKASKWEILSKAIDFVG 449

Query: 530 TLKHNQDEMAKEVESLRQQLSVLK 553
            LK +  +M +E+E LR +L  ++
Sbjct: 450 QLKQSHQDMVREIEMLRHELDSMR 473



>gi|336373553|gb|EGO01891.1| hypothetical protein SERLA73DRAFT_177482 [Serpula lacrymans var.
           lacrymans S7.3]
          Length = 560

 Score =  125 bits (313), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 67/84 (79%)

Query: 470 VKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFIN 529
              TPYSRSPELR+SHKLAERKRRKEMK+LFDELRD LP D+ +K SKWEILSKA++F+ 
Sbjct: 387 AGNTPYSRSPELRVSHKLAERKRRKEMKDLFDELRDQLPADRGMKASKWEILSKAIDFVG 446

Query: 530 TLKHNQDEMAKEVESLRQQLSVLK 553
            LK +  +M +E+E LR +L  ++
Sbjct: 447 QLKQSHQDMVREIEMLRHELDSMR 470



>gi|409049600|gb|EKM59077.1| hypothetical protein PHACADRAFT_249271 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 464

 Score =  124 bits (312), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 56/88 (63%), Positives = 69/88 (78%), Gaps = 3/88 (3%)

Query: 469 PVKE---TPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAV 525
           P KE   TPYSRSPELR+SHKLAERKRRKEMK+LFDELRD LP D+ +K SKWEILSKA+
Sbjct: 283 PSKESGSTPYSRSPELRVSHKLAERKRRKEMKDLFDELRDQLPADRGMKASKWEILSKAI 342

Query: 526 EFINTLKHNQDEMAKEVESLRQQLSVLK 553
           +FI  LK    EM++E++ LR ++   +
Sbjct: 343 DFIGQLKQTHQEMSREIDMLRHEVDGFR 370



>gi|443899772|dbj|GAC77101.1| upstream transcription factor 2/L-myc-2 protein [Pseudozyma
           antarctica T-34]
          Length = 545

 Score =  124 bits (311), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 59/87 (67%), Positives = 69/87 (79%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLKH 533
           PYSRSPELR+SHKLAERKRRKEMKELFD+LRD LPVDK  KTSKWEILSKAVE I  L  
Sbjct: 443 PYSRSPELRVSHKLAERKRRKEMKELFDDLRDQLPVDKGPKTSKWEILSKAVEHIAQLGQ 502

Query: 534 NQDEMAKEVESLRQQLSVLKGCSNSET 560
           ++D++  E E LR QL+  +G + +E 
Sbjct: 503 DRDDLEAENERLRAQLAHARGAAPTEV 529



>gi|393215741|gb|EJD01232.1| hypothetical protein FOMMEDRAFT_21659 [Fomitiporia mediterranea
           MF3/22]
          Length = 459

 Score =  124 bits (310), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 51/81 (62%), Positives = 70/81 (86%)

Query: 473 TPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLK 532
           TPYSRSPELR+SHKLAERKRRKEM++LFDELRD LP D+ +K SKWEILSKA+++I  LK
Sbjct: 310 TPYSRSPELRVSHKLAERKRRKEMRDLFDELRDQLPADRGMKASKWEILSKAIDYIQQLK 369

Query: 533 HNQDEMAKEVESLRQQLSVLK 553
            +Q++M++E++ LR ++  ++
Sbjct: 370 QSQNDMSREIDLLRHEMETVR 390



>gi|170091802|ref|XP_001877123.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164648616|gb|EDR12859.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 501

 Score =  124 bits (310), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 54/81 (66%), Positives = 68/81 (83%)

Query: 473 TPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLK 532
           TPYSRSPELR+SHKLAERKRRKEMKELFD+LRD LP D+ +K SKWEIL+KA+EF++ LK
Sbjct: 339 TPYSRSPELRVSHKLAERKRRKEMKELFDDLRDQLPADRGMKASKWEILTKAIEFVSHLK 398

Query: 533 HNQDEMAKEVESLRQQLSVLK 553
            +   M +EVE LR+++  L+
Sbjct: 399 QSHQHMVQEVELLRREVETLR 419



>gi|390601225|gb|EIN10619.1| hypothetical protein PUNSTDRAFT_142595 [Punctularia strigosozonata
           HHB-11173 SS5]
          Length = 547

 Score =  122 bits (307), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 67/84 (79%)

Query: 470 VKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFIN 529
            K TPYSRSPELR+SHKLAERKRRKEMK+LFDELRD LP D+ +K SKWEILSKA++F+ 
Sbjct: 361 TKGTPYSRSPELRVSHKLAERKRRKEMKDLFDELRDHLPADRGMKASKWEILSKAIDFVA 420

Query: 530 TLKHNQDEMAKEVESLRQQLSVLK 553
            +K +   M +E+E LR++   L+
Sbjct: 421 QMKQDHQGMMQEIEMLRRENESLR 444



>gi|342320926|gb|EGU12864.1| hypothetical protein RTG_00886 [Rhodotorula glutinis ATCC 204091]
          Length = 740

 Score =  122 bits (306), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 69/83 (83%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           P KETPYSRSPELR+SHKLAERKRRKEM +LF++LR+SLP D++LK SKWEILSKA+E++
Sbjct: 499 PSKETPYSRSPELRVSHKLAERKRRKEMAQLFEDLRESLPFDRALKASKWEILSKAIEYV 558

Query: 529 NTLKHNQDEMAKEVESLRQQLSV 551
            TLK    E+A E  S+R+  ++
Sbjct: 559 GTLKSYCHELASENRSMREHYNL 581



>gi|343427972|emb|CBQ71497.1| related to Protein esc1 [Sporisorium reilianum SRZ2]
          Length = 344

 Score =  122 bits (306), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 59/82 (71%), Positives = 67/82 (81%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLKH 533
           PYSRSPELR+SHKLAERKRRKEMKELFD+LRD LPVDK  KTSKWEILSKAVE I  L  
Sbjct: 248 PYSRSPELRVSHKLAERKRRKEMKELFDDLRDQLPVDKGPKTSKWEILSKAVEHIAHLAD 307

Query: 534 NQDEMAKEVESLRQQLSVLKGC 555
            ++E+A EV+ LR QL+  +G 
Sbjct: 308 EKNELAAEVDRLRAQLAHSRGV 329



>gi|392586779|gb|EIW76114.1| hypothetical protein CONPUDRAFT_158148 [Coniophora puteana RWD-64-598
            SS2]
          Length = 1610

 Score =  122 bits (306), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 54/81 (66%), Positives = 66/81 (81%)

Query: 473  TPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLK 532
            TPYSRSPELR+SHKLAERKRRKEMK+LFDELRD LP D+ +K SKWEILSKA++F+  LK
Sbjct: 1442 TPYSRSPELRVSHKLAERKRRKEMKDLFDELRDQLPADRGMKASKWEILSKAIDFVVNLK 1501

Query: 533  HNQDEMAKEVESLRQQLSVLK 553
             +  EM +E+E LR +L   +
Sbjct: 1502 QSHQEMLREIEMLRHELEGFR 1522



>gi|472582678|gb|EMS20356.1| transcription regulator [Rhodosporidium toruloides NP11]
          Length = 734

 Score =  122 bits (305), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 69/83 (83%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           P KETPYSRSPELR+SHKLAERKRRKEM +LF++LR+SLP D++LK SKWEILSKA+E++
Sbjct: 493 PSKETPYSRSPELRVSHKLAERKRRKEMAQLFEDLRESLPFDRALKASKWEILSKAIEYV 552

Query: 529 NTLKHNQDEMAKEVESLRQQLSV 551
            TLK    E+A E  S+R+  ++
Sbjct: 553 GTLKSYCHEVASENRSMREHYNL 575



>gi|443927350|gb|ELU45852.1| HLH domain-containing protein [Rhizoctonia solani AG-1 IA]
          Length = 1767

 Score =  121 bits (303), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 70/84 (83%)

Query: 470  VKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFIN 529
             KETPYSRSPELR+SHKLAERKRRKEMK+LFDELRD LP D+ +K SKWEILSKAV++I 
Sbjct: 1371 AKETPYSRSPELRVSHKLAERKRRKEMKDLFDELRDHLPADRGMKASKWEILSKAVDYIG 1430

Query: 530  TLKHNQDEMAKEVESLRQQLSVLK 553
             LK +  E+++E++ +R +L  ++
Sbjct: 1431 QLKQSYAEVSQELDMVRHELEAIR 1454



>gi|388857640|emb|CCF48789.1| related to Protein esc1 [Ustilago hordei]
          Length = 348

 Score =  120 bits (302), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 58/82 (70%), Positives = 65/82 (79%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLKH 533
           PYSRSPELR+SHKLAERKRRKEMKELFD+LRD LPVDK  KTSKWEIL KAVE I  L  
Sbjct: 235 PYSRSPELRVSHKLAERKRRKEMKELFDDLRDQLPVDKGPKTSKWEILRKAVEHIAHLAQ 294

Query: 534 NQDEMAKEVESLRQQLSVLKGC 555
            +D++A EV+ LR QL+   G 
Sbjct: 295 EKDDLAAEVDRLRAQLAHRAGG 316



>gi|471915314|emb|CCO26483.1| Protein esc1 [Rhizoctonia solani AG-1 IB]
          Length = 935

 Score =  120 bits (301), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 54/83 (65%), Positives = 68/83 (81%)

Query: 471 KETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINT 530
           KETPYSRSPELR+SHKLAERKRRKEMK+LFDELRD LP D+ +K SKWEILSKAV++I  
Sbjct: 799 KETPYSRSPELRVSHKLAERKRRKEMKDLFDELRDHLPADRGMKASKWEILSKAVDYIGQ 858

Query: 531 LKHNQDEMAKEVESLRQQLSVLK 553
           LK +  E+ +E++  R +L  ++
Sbjct: 859 LKQSYAEVTQELDMARHELEAIR 881



>gi|501305993|dbj|GAC95099.1| hypothetical protein PHSY_002674 [Pseudozyma hubeiensis SY62]
          Length = 345

 Score =  120 bits (301), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 64/77 (83%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLKH 533
           PYSRSPELR+SHKLAERKRRKEMKELFD+LRD LPVDK  KTSKWEILSKAVE I  L  
Sbjct: 234 PYSRSPELRVSHKLAERKRRKEMKELFDDLRDQLPVDKGPKTSKWEILSKAVEHIAQLAD 293

Query: 534 NQDEMAKEVESLRQQLS 550
            ++E+A EV+ LR QL 
Sbjct: 294 EKNELAAEVDRLRAQLG 310



>gi|299747642|ref|XP_002911197.1| hypothetical protein CC1G_14628 [Coprinopsis cinerea okayama7#130]
 gi|298407614|gb|EFI27703.1| hypothetical protein CC1G_14628 [Coprinopsis cinerea okayama7#130]
          Length = 371

 Score =  120 bits (300), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 73/90 (81%), Gaps = 2/90 (2%)

Query: 466 QPAPVKE--TPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSK 523
           QP+  KE  TPYSRSPELRISHKLAERKRRKEMKELFD+LRD LP D+ +K SKWEIL+K
Sbjct: 211 QPSKPKESTTPYSRSPELRISHKLAERKRRKEMKELFDDLRDHLPSDRGMKASKWEILTK 270

Query: 524 AVEFINTLKHNQDEMAKEVESLRQQLSVLK 553
           A+E+++ LK +Q  +  EVE+LR++   L+
Sbjct: 271 AIEYVSQLKTSQQSLMTEVENLRRENESLR 300



>gi|321249371|ref|XP_003191437.1| hypothetical protein CGB_A4540C [Cryptococcus gattii WM276]
 gi|317457904|gb|ADV19650.1| conserved hypothetical protein [Cryptococcus gattii WM276]
          Length = 437

 Score =  117 bits (292), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 51/81 (62%), Positives = 64/81 (79%)

Query: 475 YSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLKHN 534
           +SRSPELR+SHKLAERKRRKEMK+LFDELRD LP D+ +K SKWEIL+KA+E I   K  
Sbjct: 225 FSRSPELRVSHKLAERKRRKEMKDLFDELRDELPADRGMKASKWEILTKAIEHIKHTKSQ 284

Query: 535 QDEMAKEVESLRQQLSVLKGC 555
           Q EM +E+E LR++L + +  
Sbjct: 285 QVEMHREIEHLRRELEIARAG 305



>gi|58259511|ref|XP_567168.1| hypothetical protein [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|134106825|ref|XP_777954.1| hypothetical protein CNBA4230 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50260654|gb|EAL23307.1| hypothetical protein CNBA4230 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57223305|gb|AAW41349.1| conserved hypothetical protein [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 434

 Score =  117 bits (292), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 51/81 (62%), Positives = 64/81 (79%)

Query: 475 YSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLKHN 534
           +SRSPELR+SHKLAERKRRKEMK+LFDELRD LP D+ +K SKWEIL+KA+E I   K  
Sbjct: 225 FSRSPELRVSHKLAERKRRKEMKDLFDELRDELPADRGMKASKWEILTKAIEHIKHTKSQ 284

Query: 535 QDEMAKEVESLRQQLSVLKGC 555
           Q EM +E+E LR++L + +  
Sbjct: 285 QVEMHREIEHLRRELEIARAG 305



>gi|405117817|gb|AFR92592.1| hypothetical protein CNAG_00460 [Cryptococcus neoformans var.
           grubii H99]
          Length = 437

 Score =  115 bits (287), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 50/81 (61%), Positives = 64/81 (79%)

Query: 475 YSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLKHN 534
           +SRSPELR+SHKLAERKRRKEMK+LFDELR+ LP D+ +K SKWEIL+KA+E I   K  
Sbjct: 225 FSRSPELRVSHKLAERKRRKEMKDLFDELREELPADRGMKASKWEILTKAIEHIKHTKSQ 284

Query: 535 QDEMAKEVESLRQQLSVLKGC 555
           Q EM +E+E LR++L + +  
Sbjct: 285 QVEMHREIEHLRRELEIARAG 305



>gi|71024289|ref|XP_762374.1| hypothetical protein UM06227.1 [Ustilago maydis 521]
 gi|46101832|gb|EAK87065.1| hypothetical protein UM06227.1 [Ustilago maydis 521]
          Length = 341

 Score =  115 bits (287), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 56/77 (72%), Positives = 63/77 (81%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLKH 533
           PYSRSPELR+SHKLAERKRRKEMKELFD+LRD LPVDK  KTSKWEILSKAVE I  L  
Sbjct: 233 PYSRSPELRVSHKLAERKRRKEMKELFDDLRDQLPVDKGPKTSKWEILSKAVEHIAQLAD 292

Query: 534 NQDEMAKEVESLRQQLS 550
            ++E+  E++ LR QL 
Sbjct: 293 EKNELLAELDLLRAQLG 309



>gi|401883331|gb|EJT47545.1| hypothetical protein A1Q1_03604 [Trichosporon asahii var. asahii
           CBS 2479]
          Length = 463

 Score =  112 bits (281), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 50/80 (62%), Positives = 67/80 (83%)

Query: 475 YSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLKHN 534
           +SRSPELRISHKLAERKRRKEM++LFDELRD+LP D+ +K SKWEILSKA+++I  LK+ 
Sbjct: 348 FSRSPELRISHKLAERKRRKEMRDLFDELRDALPQDRGMKASKWEILSKAIDYIQALKNQ 407

Query: 535 QDEMAKEVESLRQQLSVLKG 554
            ++  ++VE L + L+V +G
Sbjct: 408 VNDSHRQVEILARDLAVARG 427



>gi|501753066|emb|CCG83173.1| putative HLH transcription factor [Taphrina deformans PYCC 5710]
          Length = 343

 Score =  111 bits (277), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 49/81 (60%), Positives = 67/81 (82%)

Query: 471 KETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINT 530
           + TPYSRSPELR+SHKLAERKRR+EMK+LFD+LRD LP+D++LKTSKWEILSKAVE +  
Sbjct: 253 ESTPYSRSPELRVSHKLAERKRRREMKDLFDDLRDKLPLDRTLKTSKWEILSKAVEHVGF 312

Query: 531 LKHNQDEMAKEVESLRQQLSV 551
           L+   + + +E + +R+ + +
Sbjct: 313 LEDQINALRRENDEIRRGVGM 333



>gi|345569064|gb|EGX51933.1| hypothetical protein AOL_s00043g667 [Arthrobotrys oligospora ATCC
           24927]
          Length = 551

 Score =  110 bits (275), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 71/101 (70%), Gaps = 14/101 (13%)

Query: 468 APVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEF 527
           AP   TPYSR+PELRISHKLAERKRRKEMKELFDELRD+LP ++  K+SKWE+L+K++E+
Sbjct: 371 APSPATPYSRTPELRISHKLAERKRRKEMKELFDELRDALPQERGGKSSKWEVLTKSIEY 430

Query: 528 INTLKHNQD--------------EMAKEVESLRQQLSVLKG 554
           +  ++ +Q                +A + E+L ++L  L+G
Sbjct: 431 LGHMRQSQSSLSQTNHELASENQNLASQNENLNRELERLRG 471



>gi|392580115|gb|EIW73242.1| hypothetical protein TREMEDRAFT_59410 [Tremella mesenterica DSM
           1558]
          Length = 337

 Score =  110 bits (274), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 47/86 (54%), Positives = 68/86 (79%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           P    P++R+PELR+SHK+AERKRRKEMKELFDELRD LP ++  K+SKWEILSKA++ +
Sbjct: 77  PSGSQPFARTPELRVSHKIAERKRRKEMKELFDELRDLLPSERGSKSSKWEILSKAIDHV 136

Query: 529 NTLKHNQDEMAKEVESLRQQLSVLKG 554
             +K++  E+ +E+E  R++L + +G
Sbjct: 137 TNMKNHNAELIREIERTRRELDMARG 162



>gi|511011283|gb|EPB92494.1| hypothetical protein HMPREF1544_00507 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 99

 Score =  109 bits (272), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 66/79 (83%)

Query: 475 YSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLKHN 534
           YSRSPELR SHKLAERKRRKEMK+LF+EL++ LPVDK+LKTSKW IL+KAVE+++ L+  
Sbjct: 20  YSRSPELRFSHKLAERKRRKEMKDLFEELKNVLPVDKTLKTSKWAILTKAVEYVSLLRDR 79

Query: 535 QDEMAKEVESLRQQLSVLK 553
              M +E+ SL+QQL  LK
Sbjct: 80  DQSMEQELISLKQQLESLK 98



>gi|384498115|gb|EIE88606.1| hypothetical protein RO3G_13317 [Rhizopus delemar RA 99-880]
          Length = 259

 Score =  107 bits (266), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 52/83 (62%), Positives = 69/83 (83%), Gaps = 8/83 (9%)

Query: 475 YSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLKH- 533
           Y+RSPELR SHKLAERKRR+EMK+LFDEL+ +LP+D+SLKTSKWEILSK++++I TL H 
Sbjct: 175 YARSPELRTSHKLAERKRRQEMKDLFDELKKTLPLDRSLKTSKWEILSKSIDYIGTLHHR 234

Query: 534 ---NQDEMAKEVESLRQQLSVLK 553
              N++E+A+    L+Q+L  LK
Sbjct: 235 IYVNENELAQ----LKQELGQLK 253



>gi|213408200|ref|XP_002174871.1| esc1 [Schizosaccharomyces japonicus yFS275]
 gi|212002918|gb|EEB08578.1| esc1 [Schizosaccharomyces japonicus yFS275]
          Length = 401

 Score =  106 bits (264), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 49/86 (56%), Positives = 66/86 (76%), Gaps = 2/86 (2%)

Query: 466 QPAPVKE--TPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSK 523
            P+P  E   PY+RS ELRISHKLAERKRRKEMKELFD+LRD+LP+DK+ K+SKW +L++
Sbjct: 306 HPSPSSEYYGPYARSSELRISHKLAERKRRKEMKELFDDLRDALPLDKNTKSSKWGVLTR 365

Query: 524 AVEFINTLKHNQDEMAKEVESLRQQL 549
           A+++I  LK  Q  +   V+SL + +
Sbjct: 366 AIQYIEQLKSEQVALEAYVKSLEKNM 391



>gi|480320796|gb|AGJ81967.1| transcription factor-like protein, partial [Heterobasidion annosum]
          Length = 108

 Score =  105 bits (262), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 55/64 (85%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           P   TPYSRSPELR+SHKLAERKRRKEM++LFDELRD LP D+ +K SKWEILSKA++F+
Sbjct: 41  PSGSTPYSRSPELRVSHKLAERKRRKEMRDLFDELRDQLPADRGMKASKWEILSKAIDFV 100

Query: 529 NTLK 532
             LK
Sbjct: 101 VHLK 104



>gi|223557613|gb|ACM91510.1| bHLH transcription factor-like protein [Heterobasidion abietinum]
 gi|223557615|gb|ACM91511.1| bHLH transcription factor-like protein [Heterobasidion abietinum]
 gi|223557617|gb|ACM91512.1| bHLH transcription factor-like protein [Heterobasidion abietinum]
 gi|223557619|gb|ACM91513.1| bHLH transcription factor-like protein [Heterobasidion abietinum]
 gi|223557621|gb|ACM91514.1| bHLH transcription factor-like protein [Heterobasidion abietinum]
 gi|223557623|gb|ACM91515.1| bHLH transcription factor-like protein [Heterobasidion abietinum]
 gi|223557625|gb|ACM91516.1| bHLH transcription factor-like protein [Heterobasidion abietinum]
 gi|223557627|gb|ACM91517.1| bHLH transcription factor-like protein [Heterobasidion abietinum]
 gi|223557683|gb|ACM91545.1| bHLH transcription factor-like protein [Heterobasidion abietinum]
 gi|223557685|gb|ACM91546.1| bHLH transcription factor-like protein [Heterobasidion abietinum]
 gi|223557687|gb|ACM91547.1| bHLH transcription factor-like protein [Heterobasidion abietinum]
 gi|223557693|gb|ACM91550.1| bHLH transcription factor-like protein [Heterobasidion abietinum]
 gi|223557695|gb|ACM91551.1| bHLH transcription factor-like protein [Heterobasidion abietinum]
          Length = 98

 Score =  105 bits (262), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           P   TPYSRSPELR+SHKLAERKRRKEM++LFDELRD LP D+ +K SKWEILSKA++F+
Sbjct: 38  PSGSTPYSRSPELRVSHKLAERKRRKEMRDLFDELRDQLPADRGMKASKWEILSKAIDFV 97



>gi|480320794|gb|AGJ81966.1| transcription factor-like protein, partial [Heterobasidion annosum]
          Length = 105

 Score =  105 bits (261), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 55/64 (85%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           P   TPYSRSPELR+SHKLAERKRRKEM++LFDELRD LP D+ +K SKWEILSKA++F+
Sbjct: 41  PSGSTPYSRSPELRVSHKLAERKRRKEMRDLFDELRDQLPADRGMKASKWEILSKAIDFV 100

Query: 529 NTLK 532
             LK
Sbjct: 101 VHLK 104



>gi|480320856|gb|AGJ81997.1| transcription factor-like protein, partial [Heterobasidion
           abietinum]
          Length = 102

 Score =  105 bits (261), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           P   TPYSRSPELR+SHKLAERKRRKEM++LFDELRD LP D+ +K SKWEILSKA++F+
Sbjct: 40  PSGSTPYSRSPELRVSHKLAERKRRKEMRDLFDELRDQLPADRGMKASKWEILSKAIDFV 99



>gi|223557673|gb|ACM91540.1| bHLH transcription factor-like protein [Heterobasidion parviporum]
          Length = 94

 Score =  105 bits (261), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           P   TPYSRSPELR+SHKLAERKRRKEM++LFDELRD LP D+ +K SKWEILSKA++F+
Sbjct: 34  PSGSTPYSRSPELRVSHKLAERKRRKEMRDLFDELRDQLPADRGMKASKWEILSKAIDFV 93



>gi|480320806|gb|AGJ81972.1| transcription factor-like protein, partial [Heterobasidion annosum]
          Length = 107

 Score =  105 bits (261), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 55/64 (85%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           P   TPYSRSPELR+SHKLAERKRRKEM++LFDELRD LP D+ +K SKWEILSKA++F+
Sbjct: 41  PSGSTPYSRSPELRVSHKLAERKRRKEMRDLFDELRDQLPADRGMKASKWEILSKAIDFV 100

Query: 529 NTLK 532
             LK
Sbjct: 101 VHLK 104



>gi|480320776|gb|AGJ81957.1| transcription factor-like protein, partial [Heterobasidion annosum]
          Length = 104

 Score =  105 bits (261), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 55/64 (85%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           P   TPYSRSPELR+SHKLAERKRRKEM++LFDELRD LP D+ +K SKWEILSKA++F+
Sbjct: 41  PSGSTPYSRSPELRVSHKLAERKRRKEMRDLFDELRDQLPADRGMKASKWEILSKAIDFV 100

Query: 529 NTLK 532
             LK
Sbjct: 101 VHLK 104



>gi|480320842|gb|AGJ81990.1| transcription factor-like protein, partial [Heterobasidion
           occidentale]
 gi|480320852|gb|AGJ81995.1| transcription factor-like protein, partial [Heterobasidion
           parviporum]
          Length = 104

 Score =  105 bits (261), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 55/64 (85%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           P   TPYSRSPELR+SHKLAERKRRKEM++LFDELRD LP D+ +K SKWEILSKA++F+
Sbjct: 41  PSGSTPYSRSPELRVSHKLAERKRRKEMRDLFDELRDQLPADRGMKASKWEILSKAIDFV 100

Query: 529 NTLK 532
             LK
Sbjct: 101 VHLK 104



>gi|480320810|gb|AGJ81974.1| transcription factor-like protein, partial [Heterobasidion
           irregulare]
 gi|480320814|gb|AGJ81976.1| transcription factor-like protein, partial [Heterobasidion
           irregulare]
 gi|480320816|gb|AGJ81977.1| transcription factor-like protein, partial [Heterobasidion
           irregulare]
 gi|480320832|gb|AGJ81985.1| transcription factor-like protein, partial [Heterobasidion
           irregulare]
 gi|480320838|gb|AGJ81988.1| transcription factor-like protein, partial [Heterobasidion
           irregulare]
          Length = 104

 Score =  104 bits (260), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 55/64 (85%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           P   TPYSRSPELR+SHKLAERKRRKEM++LFDELRD LP D+ +K SKWEILSKA++F+
Sbjct: 41  PSGSTPYSRSPELRVSHKLAERKRRKEMRDLFDELRDQLPADRGMKASKWEILSKAIDFV 100

Query: 529 NTLK 532
             LK
Sbjct: 101 VHLK 104



>gi|480320782|gb|AGJ81960.1| transcription factor-like protein, partial [Heterobasidion
           abietinum]
          Length = 104

 Score =  104 bits (260), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 47/64 (73%), Positives = 55/64 (85%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           P   TPYSRSPELR+SHKLAERKRRKEM++LFDELRD LP D+ +K SKWEILSKA++F+
Sbjct: 41  PSGSTPYSRSPELRVSHKLAERKRRKEMRDLFDELRDQLPADRGMKASKWEILSKAIDFV 100

Query: 529 NTLK 532
             LK
Sbjct: 101 VHLK 104



>gi|223557641|gb|ACM91524.1| bHLH transcription factor-like protein [Heterobasidion insulare]
          Length = 99

 Score =  103 bits (258), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           P   TPYSRSPELR+SHKLAERKRRKEM++LFDELRD LP D+ +K SKWEILSKA++F+
Sbjct: 39  PSGSTPYSRSPELRVSHKLAERKRRKEMRDLFDELRDQLPADRGMKASKWEILSKAIDFV 98



>gi|223557649|gb|ACM91528.1| bHLH transcription factor-like protein [Heterobasidion araucariae]
 gi|223557651|gb|ACM91529.1| bHLH transcription factor-like protein [Heterobasidion araucariae]
 gi|223557661|gb|ACM91534.1| bHLH transcription factor-like protein [Heterobasidion araucariae]
 gi|223557663|gb|ACM91535.1| bHLH transcription factor-like protein [Heterobasidion araucariae]
          Length = 99

 Score =  103 bits (258), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           P   TPYSRSPELR+SHKLAERKRRKEM++LFDELRD LP D+ +K SKWEILSKA++F+
Sbjct: 39  PSGSTPYSRSPELRVSHKLAERKRRKEMRDLFDELRDQLPADRGMKASKWEILSKAIDFV 98



>gi|223557563|gb|ACM91485.1| bHLH transcription factor-like protein [Heterobasidion annosum]
          Length = 88

 Score =  103 bits (257), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           P   TPYSRSPELR+SHKLAERKRRKEM++LFDELRD LP D+ +K SKWEILSKA++F+
Sbjct: 28  PSGSTPYSRSPELRVSHKLAERKRRKEMRDLFDELRDQLPADRGMKASKWEILSKAIDFV 87



>gi|223557523|gb|ACM91465.1| bHLH transcription factor-like protein [Heterobasidion annosum]
          Length = 87

 Score =  103 bits (257), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           P   TPYSRSPELR+SHKLAERKRRKEM++LFDELRD LP D+ +K SKWEILSKA++F+
Sbjct: 27  PSGSTPYSRSPELRVSHKLAERKRRKEMRDLFDELRDQLPADRGMKASKWEILSKAIDFV 86



>gi|19114142|ref|NP_593230.1| transcription factor Esc1 (predicted) [Schizosaccharomyces pombe
           972h-]
 gi|416968|sp|Q04635.1|ESC1_SCHPO RecName: Full=Protein esc1
 gi|4950|emb|CAA49186.1| Esc1 [Schizosaccharomyces pombe]
 gi|1204238|emb|CAA93587.1| transcription factor Esc1 (predicted) [Schizosaccharomyces pombe]
          Length = 413

 Score =  103 bits (257), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/86 (54%), Positives = 65/86 (75%), Gaps = 4/86 (4%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLKH 533
           PY+R+PELR SHKLAERKRRKE+KELFD+L+D+LP+DKS K+SKW +L++A+++I  LK 
Sbjct: 328 PYTRNPELRTSHKLAERKRRKEIKELFDDLKDALPLDKSTKSSKWGLLTRAIQYIEQLKS 387

Query: 534 NQDEMAKEVESLRQQL----SVLKGC 555
            Q  +   V+SL + +     V KG 
Sbjct: 388 EQVALEAYVKSLEENMQSNKEVTKGT 413



>gi|223557545|gb|ACM91476.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557547|gb|ACM91477.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557549|gb|ACM91478.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557551|gb|ACM91479.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557553|gb|ACM91480.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557555|gb|ACM91481.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557557|gb|ACM91482.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557559|gb|ACM91483.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557561|gb|ACM91484.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557593|gb|ACM91500.1| bHLH transcription factor-like protein [Heterobasidion parviporum]
 gi|223557595|gb|ACM91501.1| bHLH transcription factor-like protein [Heterobasidion parviporum]
 gi|223557597|gb|ACM91502.1| bHLH transcription factor-like protein [Heterobasidion parviporum]
 gi|223557599|gb|ACM91503.1| bHLH transcription factor-like protein [Heterobasidion parviporum]
 gi|223557601|gb|ACM91504.1| bHLH transcription factor-like protein [Heterobasidion parviporum]
 gi|223557603|gb|ACM91505.1| bHLH transcription factor-like protein [Heterobasidion parviporum]
 gi|223557605|gb|ACM91506.1| bHLH transcription factor-like protein [Heterobasidion parviporum]
 gi|223557607|gb|ACM91507.1| bHLH transcription factor-like protein [Heterobasidion parviporum]
 gi|223557609|gb|ACM91508.1| bHLH transcription factor-like protein [Heterobasidion parviporum]
 gi|223557611|gb|ACM91509.1| bHLH transcription factor-like protein [Heterobasidion parviporum]
 gi|223557629|gb|ACM91518.1| bHLH transcription factor-like protein [Heterobasidion parviporum]
 gi|223557631|gb|ACM91519.1| bHLH transcription factor-like protein [Heterobasidion parviporum]
 gi|223557633|gb|ACM91520.1| bHLH transcription factor-like protein [Heterobasidion parviporum]
 gi|223557635|gb|ACM91521.1| bHLH transcription factor-like protein [Heterobasidion parviporum]
 gi|223557637|gb|ACM91522.1| bHLH transcription factor-like protein [Heterobasidion parviporum]
 gi|223557639|gb|ACM91523.1| bHLH transcription factor-like protein [Heterobasidion parviporum]
 gi|223557643|gb|ACM91525.1| bHLH transcription factor-like protein [Heterobasidion parviporum]
 gi|223557645|gb|ACM91526.1| bHLH transcription factor-like protein [Heterobasidion parviporum]
 gi|223557647|gb|ACM91527.1| bHLH transcription factor-like protein [Heterobasidion parviporum]
 gi|223557653|gb|ACM91530.1| bHLH transcription factor-like protein [Heterobasidion parviporum]
 gi|223557657|gb|ACM91532.1| bHLH transcription factor-like protein [Heterobasidion parviporum]
 gi|223557659|gb|ACM91533.1| bHLH transcription factor-like protein [Heterobasidion parviporum]
 gi|223557669|gb|ACM91538.1| bHLH transcription factor-like protein [Heterobasidion parviporum]
 gi|223557671|gb|ACM91539.1| bHLH transcription factor-like protein [Heterobasidion parviporum]
 gi|223557679|gb|ACM91543.1| bHLH transcription factor-like protein [Heterobasidion parviporum]
 gi|223557699|gb|ACM91553.1| bHLH transcription factor-like protein [Heterobasidion parviporum]
 gi|223557701|gb|ACM91554.1| bHLH transcription factor-like protein [Heterobasidion parviporum]
 gi|223557703|gb|ACM91555.1| bHLH transcription factor-like protein [Heterobasidion parviporum]
          Length = 99

 Score =  103 bits (257), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           P   TPYSRSPELR+SHKLAERKRRKEM++LFDELRD LP D+ +K SKWEILSKA++F+
Sbjct: 39  PSGSTPYSRSPELRVSHKLAERKRRKEMRDLFDELRDQLPADRGMKASKWEILSKAIDFV 98



>gi|465794511|emb|CCU99299.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 473

 Score =  103 bits (257), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/88 (54%), Positives = 68/88 (77%)

Query: 471 KETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINT 530
           KETPYSRSP LR++HK+AERKRRKEMK+LFDEL+D +PVD+  KTSK +IL+KAV    T
Sbjct: 213 KETPYSRSPSLRVTHKIAERKRRKEMKDLFDELKDYVPVDRGPKTSKGDILTKAVLQFQT 272

Query: 531 LKHNQDEMAKEVESLRQQLSVLKGCSNS 558
           L   ++++ + +E+  Q+L+ L+  + S
Sbjct: 273 LHREREQLIEALEAAHQELNHLRQVAGS 300



>gi|223557543|gb|ACM91475.1| bHLH transcription factor-like protein [Heterobasidion annosum]
          Length = 79

 Score =  103 bits (257), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           P   TPYSRSPELR+SHKLAERKRRKEM++LFDELRD LP D+ +K SKWEILSKA++F+
Sbjct: 19  PSGSTPYSRSPELRVSHKLAERKRRKEMRDLFDELRDQLPADRGMKASKWEILSKAIDFV 78



>gi|223557565|gb|ACM91486.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557567|gb|ACM91487.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557569|gb|ACM91488.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557571|gb|ACM91489.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557573|gb|ACM91490.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557579|gb|ACM91493.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557581|gb|ACM91494.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557583|gb|ACM91495.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557585|gb|ACM91496.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557587|gb|ACM91497.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557589|gb|ACM91498.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557591|gb|ACM91499.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557667|gb|ACM91537.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557675|gb|ACM91541.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557681|gb|ACM91544.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557689|gb|ACM91548.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557697|gb|ACM91552.1| bHLH transcription factor-like protein [Heterobasidion annosum]
          Length = 99

 Score =  103 bits (257), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           P   TPYSRSPELR+SHKLAERKRRKEM++LFDELRD LP D+ +K SKWEILSKA++F+
Sbjct: 39  PSGSTPYSRSPELRVSHKLAERKRRKEMRDLFDELRDQLPADRGMKASKWEILSKAIDFV 98



>gi|480320774|gb|AGJ81956.1| transcription factor-like protein, partial [Heterobasidion annosum]
 gi|480320778|gb|AGJ81958.1| transcription factor-like protein, partial [Heterobasidion annosum]
 gi|480320784|gb|AGJ81961.1| transcription factor-like protein, partial [Heterobasidion annosum]
 gi|480320786|gb|AGJ81962.1| transcription factor-like protein, partial [Heterobasidion annosum]
 gi|480320788|gb|AGJ81963.1| transcription factor-like protein, partial [Heterobasidion annosum]
 gi|480320790|gb|AGJ81964.1| transcription factor-like protein, partial [Heterobasidion annosum]
 gi|480320792|gb|AGJ81965.1| transcription factor-like protein, partial [Heterobasidion annosum]
 gi|480320802|gb|AGJ81970.1| transcription factor-like protein, partial [Heterobasidion annosum]
 gi|480320804|gb|AGJ81971.1| transcription factor-like protein, partial [Heterobasidion annosum]
          Length = 103

 Score =  103 bits (256), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (85%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           P   TPYSRSPELR+SHKLAERKRRKEM++LFDELRD LP D+ +K SKWEILSKA++F+
Sbjct: 41  PSGSTPYSRSPELRVSHKLAERKRRKEMRDLFDELRDQLPADRGMKASKWEILSKAIDFV 100

Query: 529 NTL 531
             L
Sbjct: 101 VHL 103



>gi|480320798|gb|AGJ81968.1| transcription factor-like protein, partial [Heterobasidion annosum]
 gi|480320800|gb|AGJ81969.1| transcription factor-like protein, partial [Heterobasidion annosum]
 gi|480320840|gb|AGJ81989.1| transcription factor-like protein, partial [Heterobasidion
           occidentale]
 gi|480320844|gb|AGJ81991.1| transcription factor-like protein, partial [Heterobasidion
           occidentale]
 gi|480320846|gb|AGJ81992.1| transcription factor-like protein, partial [Heterobasidion
           occidentale]
 gi|480320848|gb|AGJ81993.1| transcription factor-like protein, partial [Heterobasidion
           occidentale]
 gi|480320850|gb|AGJ81994.1| transcription factor-like protein, partial [Heterobasidion
           parviporum]
 gi|480320854|gb|AGJ81996.1| transcription factor-like protein, partial [Heterobasidion
           parviporum]
 gi|480320858|gb|AGJ81998.1| transcription factor-like protein, partial [Heterobasidion sp.
           NL-2013]
          Length = 103

 Score =  103 bits (256), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           P   TPYSRSPELR+SHKLAERKRRKEM++LFDELRD LP D+ +K SKWEILSKA++F+
Sbjct: 41  PSGSTPYSRSPELRVSHKLAERKRRKEMRDLFDELRDQLPADRGMKASKWEILSKAIDFV 100



>gi|223557677|gb|ACM91542.1| bHLH transcription factor-like protein [Heterobasidion annosum]
          Length = 99

 Score =  103 bits (256), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           P   TPYSRSPELR+SHKLAERKRRKEM++LFDELRD LP D+ +K SKWEILSKA++F+
Sbjct: 39  PSGSTPYSRSPELRVSHKLAERKRRKEMRDLFDELRDQLPADRGMKASKWEILSKAIDFV 98



>gi|223557521|gb|ACM91464.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557525|gb|ACM91466.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557527|gb|ACM91467.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557529|gb|ACM91468.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557531|gb|ACM91469.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557533|gb|ACM91470.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557535|gb|ACM91471.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557537|gb|ACM91472.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557539|gb|ACM91473.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557541|gb|ACM91474.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557575|gb|ACM91491.1| bHLH transcription factor-like protein [Heterobasidion annosum]
 gi|223557577|gb|ACM91492.1| bHLH transcription factor-like protein [Heterobasidion annosum]
          Length = 99

 Score =  103 bits (256), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 53/60 (88%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           P   TPYSRSPELR+SHKLAERKRRKEM++LFDELRD LP D+ +K SKWEILSKA++F+
Sbjct: 39  PSGSTPYSRSPELRVSHKLAERKRRKEMRDLFDELRDQLPADRGMKASKWEILSKAIDFV 98



>gi|480320808|gb|AGJ81973.1| transcription factor-like protein, partial [Heterobasidion
           irregulare]
 gi|480320812|gb|AGJ81975.1| transcription factor-like protein, partial [Heterobasidion
           irregulare]
 gi|480320818|gb|AGJ81978.1| transcription factor-like protein, partial [Heterobasidion
           irregulare]
 gi|480320820|gb|AGJ81979.1| transcription factor-like protein, partial [Heterobasidion
           irregulare]
 gi|480320822|gb|AGJ81980.1| transcription factor-like protein, partial [Heterobasidion
           irregulare]
 gi|480320824|gb|AGJ81981.1| transcription factor-like protein, partial [Heterobasidion
           irregulare]
 gi|480320826|gb|AGJ81982.1| transcription factor-like protein, partial [Heterobasidion
           irregulare]
 gi|480320828|gb|AGJ81983.1| transcription factor-like protein, partial [Heterobasidion
           irregulare]
 gi|480320830|gb|AGJ81984.1| transcription factor-like protein, partial [Heterobasidion
           irregulare]
 gi|480320834|gb|AGJ81986.1| transcription factor-like protein, partial [Heterobasidion
           irregulare]
 gi|480320836|gb|AGJ81987.1| transcription factor-like protein, partial [Heterobasidion
           irregulare]
 gi|480320860|gb|AGJ81999.1| transcription factor-like protein, partial [Heterobasidion sp.
           NL-2013]
          Length = 103

 Score =  103 bits (256), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (85%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           P   TPYSRSPELR+SHKLAERKRRKEM++LFDELRD LP D+ +K SKWEILSKA++F+
Sbjct: 41  PSGSTPYSRSPELRVSHKLAERKRRKEMRDLFDELRDQLPADRGMKASKWEILSKAIDFV 100

Query: 529 NTL 531
             L
Sbjct: 101 VHL 103



>gi|223557655|gb|ACM91531.1| bHLH transcription factor-like protein [Heterobasidion parviporum]
          Length = 99

 Score =  102 bits (253), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEF 527
           P   TPYSRSPELR+SHKLAERKRRKEM++LFDELRD LP D+ +K SKWEILSKA++F
Sbjct: 39  PSGSTPYSRSPELRVSHKLAERKRRKEMRDLFDELRDQLPADRGMKASKWEILSKAIDF 97



>gi|384494144|gb|EIE84635.1| hypothetical protein RO3G_09345 [Rhizopus delemar RA 99-880]
          Length = 217

 Score =  101 bits (251), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 50/81 (61%), Positives = 62/81 (76%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLKH 533
           PYSRSPELR++HKLAERKRRKEM++LFD+LR  LP +K LKTSKWEILSKA+E I  L  
Sbjct: 136 PYSRSPELRLNHKLAERKRRKEMRDLFDDLRSLLPFEKGLKTSKWEILSKALEHIKALHE 195

Query: 534 NQDEMAKEVESLRQQLSVLKG 554
            ++ M +E   L  +L+ LK 
Sbjct: 196 KENLMKQEKMELINELNSLKS 216



>gi|223557691|gb|ACM91549.1| bHLH transcription factor-like protein [Heterobasidion annosum]
          Length = 59

 Score =  101 bits (251), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 44/56 (78%), Positives = 52/56 (92%)

Query: 473 TPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           TPYSRSPELR+SHKLAERKRRKEM++LFDELRD LP D+ +K SKWEILSKA++F+
Sbjct: 3   TPYSRSPELRVSHKLAERKRRKEMRDLFDELRDQLPADRGMKASKWEILSKAIDFV 58



>gi|389747242|gb|EIM88421.1| hypothetical protein STEHIDRAFT_110159 [Stereum hirsutum FP-91666
           SS1]
          Length = 593

 Score =  100 bits (249), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 46/81 (56%), Positives = 60/81 (74%), Gaps = 8/81 (9%)

Query: 473 TPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLK 532
           TPYSRSPELR+SHKLAERKRRKEMK+LFDELRD LP D+ +K +        ++FI  LK
Sbjct: 419 TPYSRSPELRVSHKLAERKRRKEMKDLFDELRDQLPADRGMKAT--------IDFIVQLK 470

Query: 533 HNQDEMAKEVESLRQQLSVLK 553
           H+  +M +E+E LR +L  ++
Sbjct: 471 HSHQDMNREIEMLRHELDSIR 491



>gi|326898681|gb|AEA08920.1| transcription factor-like protein [Heterobasidion insulare]
          Length = 89

 Score =  100 bits (249), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 50/57 (87%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAV 525
           P   TPYSRSPELR+SHKLAERKRRKEM++LFDELRD LP D+ +K SKWEILSKA+
Sbjct: 33  PSSSTPYSRSPELRVSHKLAERKRRKEMRDLFDELRDQLPADRGMKASKWEILSKAI 89



>gi|326898667|gb|AEA08913.1| transcription factor-like protein [Heterobasidion aff. annosum
           PG-2011]
          Length = 89

 Score =  100 bits (248), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 50/57 (87%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAV 525
           P   TPYSRSPELR+SHKLAERKRRKEM++LFDELRD LP D+ +K SKWEILSKA+
Sbjct: 33  PSGSTPYSRSPELRVSHKLAERKRRKEMRDLFDELRDQLPADRGMKASKWEILSKAI 89



>gi|326898665|gb|AEA08912.1| transcription factor-like protein [Heterobasidion aff. annosum
           PG-2011]
 gi|326898673|gb|AEA08916.1| transcription factor-like protein [Heterobasidion irregulare]
 gi|326898675|gb|AEA08917.1| transcription factor-like protein [Heterobasidion irregulare]
          Length = 89

 Score =  100 bits (248), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 50/57 (87%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAV 525
           P   TPYSRSPELR+SHKLAERKRRKEM++LFDELRD LP D+ +K SKWEILSKA+
Sbjct: 33  PSGSTPYSRSPELRVSHKLAERKRRKEMRDLFDELRDQLPADRGMKASKWEILSKAI 89



>gi|326898661|gb|AEA08910.1| transcription factor-like protein [Heterobasidion aff. annosum
           PG-2011]
          Length = 89

 Score = 99.8 bits (247), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 50/57 (87%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAV 525
           P   TPYSRSPELR+SHKLAERKRRKEM++LFDELRD LP D+ +K SKWEILSKA+
Sbjct: 33  PSGSTPYSRSPELRVSHKLAERKRRKEMRDLFDELRDQLPADRGMKASKWEILSKAI 89



>gi|326898659|gb|AEA08909.1| transcription factor-like protein [Heterobasidion irregulare]
 gi|326898663|gb|AEA08911.1| transcription factor-like protein [Heterobasidion irregulare]
 gi|326898669|gb|AEA08914.1| transcription factor-like protein [Heterobasidion aff. annosum
           PG-2011]
 gi|326898671|gb|AEA08915.1| transcription factor-like protein [Heterobasidion aff. annosum
           PG-2011]
 gi|326898677|gb|AEA08918.1| transcription factor-like protein [Heterobasidion irregulare]
 gi|326898679|gb|AEA08919.1| transcription factor-like protein [Heterobasidion aff. annosum
           PG-2011]
          Length = 89

 Score = 99.8 bits (247), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/57 (77%), Positives = 50/57 (87%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAV 525
           P   TPYSRSPELR+SHKLAERKRRKEM++LFDELRD LP D+ +K SKWEILSKA+
Sbjct: 33  PSGSTPYSRSPELRVSHKLAERKRRKEMRDLFDELRDQLPADRGMKASKWEILSKAI 89



>gi|408398095|gb|EKJ77230.1| hypothetical protein FPSE_02604 [Fusarium pseudograminearum CS3096]
          Length = 483

 Score = 99.8 bits (247), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 65/87 (74%), Gaps = 7/87 (8%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAV-------E 526
           PYSR+PELR+SHKLAERKRR EMKELFD+LRD +P ++  K SKWEIL+KA+       E
Sbjct: 324 PYSRTPELRVSHKLAERKRRTEMKELFDQLRDLMPQERGSKASKWEILTKAITEHQKQQE 383

Query: 527 FINTLKHNQDEMAKEVESLRQQLSVLK 553
            I  L+++ + +A E++ LR++L  L+
Sbjct: 384 HIRLLQNHYNTVASEIDLLRRELHGLR 410



>gi|223557665|gb|ACM91536.1| bHLH transcription factor-like protein [Heterobasidion abietinum]
          Length = 79

 Score = 99.4 bits (246), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 43/60 (71%), Positives = 51/60 (85%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           P   TPYSRSPELR+SHKLAER RRKEM++LFDELRD LP D+ +K SKWEILS A++F+
Sbjct: 19  PSGSTPYSRSPELRVSHKLAERXRRKEMRDLFDELRDQLPADRGMKASKWEILSXAIDFV 78



>gi|452989168|gb|EME88923.1| hypothetical protein MYCFIDRAFT_86140 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 472

 Score = 99.4 bits (246), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 40/73 (54%), Positives = 60/73 (82%)

Query: 475 YSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLKHN 534
           YSR+PELR+SHKLAERKRR EMK+LF+EL  ++P +   K SKWEIL+KA+++I +++HN
Sbjct: 305 YSRTPELRVSHKLAERKRRSEMKDLFEELNKAVPANGGTKASKWEILTKAIDYIRSVQHN 364

Query: 535 QDEMAKEVESLRQ 547
           + ++  EV+ L++
Sbjct: 365 ERQLHAEVQRLQR 377



>gi|384491391|gb|EIE82587.1| hypothetical protein RO3G_07292 [Rhizopus delemar RA 99-880]
          Length = 205

 Score = 99.0 bits (245), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 63/79 (79%)

Query: 475 YSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLKHN 534
           Y+RSPELR SHKLAER+RR+EMK+LFDEL+ +LPVDKSLKTS+WE+LSK++++I TL   
Sbjct: 121 YARSPELRTSHKLAERRRRQEMKDLFDELQKTLPVDKSLKTSRWEVLSKSIDYIGTLHRR 180

Query: 535 QDEMAKEVESLRQQLSVLK 553
                 E+  L++++  LK
Sbjct: 181 IYAKENELAQLKEEVQQLK 199



>gi|164658740|ref|XP_001730495.1| hypothetical protein MGL_2291 [Malassezia globosa CBS 7966]
 gi|159104391|gb|EDP43281.1| hypothetical protein MGL_2291 [Malassezia globosa CBS 7966]
          Length = 498

 Score = 98.6 bits (244), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 65/83 (78%)

Query: 471 KETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINT 530
           KETPYSRSP LR++HK+AERKRRKEMK+LFDEL++ +PVD+  KTSK +IL+KAV    T
Sbjct: 223 KETPYSRSPSLRVTHKIAERKRRKEMKDLFDELKEFVPVDRGPKTSKGDILTKAVLQFQT 282

Query: 531 LKHNQDEMAKEVESLRQQLSVLK 553
           L   ++++ + +E+   +L+ L+
Sbjct: 283 LHREREQLIEALEAAHHELNQLR 305



>gi|511011405|gb|EPB92616.1| hypothetical protein HMPREF1544_00629 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 300

 Score = 98.6 bits (244), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 72/95 (75%), Gaps = 3/95 (3%)

Query: 462 GYIQQPAPVK---ETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKW 518
           G  ++PA  +   ETPYSRSPELRISHKLAERKRRKEMK+LFD+LRD LPVDK+LKTSKW
Sbjct: 205 GEDERPAVSRRGSETPYSRSPELRISHKLAERKRRKEMKDLFDDLRDLLPVDKNLKTSKW 264

Query: 519 EILSKAVEFINTLKHNQDEMAKEVESLRQQLSVLK 553
           EILSK +E+I  L   +  M KE   L  +L+ LK
Sbjct: 265 EILSKTLEYIRILHQRESIMEKEKADLINELNALK 299



>gi|378733285|gb|EHY59744.1| hypothetical protein HMPREF1120_07727 [Exophiala dermatitidis
           NIH/UT8656]
          Length = 387

 Score = 98.2 bits (243), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 64/86 (74%)

Query: 468 APVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEF 527
           +P   TPYSR+PELR++HKLAERKRR EMK+ F++LR  LP  ++ K+SKWE LS+A+++
Sbjct: 231 SPNGTTPYSRTPELRVTHKLAERKRRSEMKDCFEQLRSRLPASQNNKSSKWETLSRAIDY 290

Query: 528 INTLKHNQDEMAKEVESLRQQLSVLK 553
           I  L++   +   E ES RQ+++ L+
Sbjct: 291 ITQLENQNKQHRAEYESQRQKIAELE 316



>gi|46108582|ref|XP_381349.1| hypothetical protein FG01173.1 [Fusarium graminearum PH-1]
          Length = 483

 Score = 98.2 bits (243), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 47/87 (54%), Positives = 63/87 (72%), Gaps = 7/87 (8%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAV-------E 526
           PYSR+PELR+SHKLAERKRR EMKELFD+LRD +P ++  K SKWEIL+KA+       E
Sbjct: 324 PYSRTPELRVSHKLAERKRRTEMKELFDQLRDLMPQERGSKASKWEILTKAITEHQKQQE 383

Query: 527 FINTLKHNQDEMAKEVESLRQQLSVLK 553
            I  L+ +   +A E++ LR++L  L+
Sbjct: 384 HIRLLQSHCTTVASEIDLLRRELHGLR 410



>gi|402226042|gb|EJU06102.1| bHLH transcription factor-like protein, partial [Dacryopinax sp.
           DJM-731 SS1]
          Length = 55

 Score = 97.4 bits (241), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 44/55 (80%), Positives = 49/55 (89%)

Query: 473 TPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEF 527
           TPYSRSPELR+SHKLAERKRRKEMK+LFDELRD LP D+ +K SKWEILSK + F
Sbjct: 1   TPYSRSPELRVSHKLAERKRRKEMKDLFDELRDQLPADRGMKASKWEILSKGMNF 55



>gi|327349590|gb|EGE78447.1| HLH transcription factor [Ajellomyces dermatitidis ATCC 18188]
          Length = 551

 Score = 96.7 bits (239), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/89 (51%), Positives = 61/89 (68%), Gaps = 7/89 (7%)

Query: 468 APVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEF 527
           +P   TPYSR+PELR++HKLAERKRR EMK+ F+ LR  LP ++S K+SKWE L++A+E+
Sbjct: 374 SPNGATPYSRTPELRVTHKLAERKRRSEMKDCFELLRSRLPSNQSSKSSKWETLTRAIEY 433

Query: 528 INTL-------KHNQDEMAKEVESLRQQL 549
           I  L       +H    +  EV  LRQQL
Sbjct: 434 IGQLEKTIQQSRHESVTLKAEVAELRQQL 462



>gi|399163744|emb|CCE35265.1| uncharacterized protein CPUR_03253 [Claviceps purpurea 20.1]
          Length = 499

 Score = 95.9 bits (237), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 66/100 (66%), Gaps = 16/100 (16%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAV-------- 525
           PYSR+PELR+SHKLAERKRR EMKELFD+LRD +P ++  K SKWEIL+KA+        
Sbjct: 321 PYSRTPELRVSHKLAERKRRTEMKELFDQLRDLMPQERGSKASKWEILTKAITEHQRQTE 380

Query: 526 -------EFINTLKHNQDEMAKEVESLRQQLSVLKGCSNS 558
                   F NT   N+  + +E+ S+R +++ L+G  NS
Sbjct: 381 HLRAIQLHFSNTTAENE-MLRRELSSMRMEIAQLRGELNS 419



>gi|358388863|gb|EHK26456.1| hypothetical protein TRIVIDRAFT_35604 [Trichoderma virens Gv29-8]
          Length = 493

 Score = 95.1 bits (235), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 45/87 (51%), Positives = 64/87 (73%), Gaps = 7/87 (8%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAV-------E 526
           PYSR+PELR+SHKLAERKRR EMKELFD+LRD +P ++  K SKWEIL+KA+       +
Sbjct: 336 PYSRTPELRVSHKLAERKRRTEMKELFDQLRDLMPQERGSKASKWEILTKAIAEHQRQLD 395

Query: 527 FINTLKHNQDEMAKEVESLRQQLSVLK 553
            I  L+++ ++   E + LR++LS ++
Sbjct: 396 HIRVLQNHYNQAMTENDLLRRELSGMR 422



>gi|367042706|ref|XP_003651733.1| hypothetical protein THITE_2112332 [Thielavia terrestris NRRL 8126]
 gi|346998995|gb|AEO65397.1| hypothetical protein THITE_2112332 [Thielavia terrestris NRRL 8126]
          Length = 481

 Score = 95.1 bits (235), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 58/83 (69%), Gaps = 7/83 (8%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAV-------E 526
           PYSR+PELR+SHKLAERKRR EMKELFD+LRD +P ++  K SKWEIL+KA+       E
Sbjct: 330 PYSRTPELRVSHKLAERKRRTEMKELFDQLRDLMPQERGSKASKWEILTKAISEHQRQNE 389

Query: 527 FINTLKHNQDEMAKEVESLRQQL 549
            I  L+        E+E LR++L
Sbjct: 390 LIRQLQALNSAQQNEIEMLRREL 412



>gi|367020684|ref|XP_003659627.1| hypothetical protein MYCTH_2296905 [Myceliophthora thermophila ATCC
           42464]
 gi|347006894|gb|AEO54382.1| hypothetical protein MYCTH_2296905 [Myceliophthora thermophila ATCC
           42464]
          Length = 470

 Score = 95.1 bits (235), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 61/92 (66%), Gaps = 7/92 (7%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAV-------E 526
           PYSR+PELR+SHKLAERKRR EMKELFD+LRD +P ++  K SKWEIL+KA+       +
Sbjct: 318 PYSRTPELRVSHKLAERKRRTEMKELFDQLRDLMPQERGSKASKWEILTKAISEHQRQAD 377

Query: 527 FINTLKHNQDEMAKEVESLRQQLSVLKGCSNS 558
            I  L+        E++ LR++L  + G   S
Sbjct: 378 LIRQLQTINATQQNEIDMLRRELERMHGAQQS 409



>gi|402084056|gb|EJT79074.1| hypothetical protein GGTG_04163 [Gaeumannomyces graminis var.
           tritici R3-111a-1]
          Length = 487

 Score = 94.7 bits (234), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 88/164 (53%), Gaps = 20/164 (12%)

Query: 408 ILARRASMPVMTFPSRFSD-----PIQQ---DGTMPMDVDRYRAQVXXXXXXXXXXXXXX 459
           I +RR+S+      S+F+      P Q+   DG  P   DRY +                
Sbjct: 255 IDSRRSSVAESLASSQFTSESRLPPGQRHLDDGLGP--TDRYSSASADFPAVHHHSLQHK 312

Query: 460 XXGYIQQPA---PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTS 516
             G +Q  A   P    PYSR+PELR SHKLAERKRR EMKELF+ELRD +P ++  K S
Sbjct: 313 QIGDLQNEAAGMPAGSQPYSRTPELRRSHKLAERKRRTEMKELFEELRDLMPQERGSKAS 372

Query: 517 KWEILSKAV-------EFINTLKHNQDEMAKEVESLRQQLSVLK 553
           KWEIL+KA+       + I  L  +   + +EV+ +R+++ VL+
Sbjct: 373 KWEILTKAIAEHKRQSDTIRLLHTSNSNLHQEVDVMRREMLVLR 416



>gi|322697996|gb|EFY89770.1| HLH transcription factor (Hpa3), putative [Metarhizium acridum CQMa
           102]
          Length = 501

 Score = 94.7 bits (234), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 62/93 (66%), Gaps = 7/93 (7%)

Query: 468 APVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAV-- 525
            P    PYSR+PELR+SHKLAERKRR EMKELFD+LRD +P ++  K SKWEIL+KA+  
Sbjct: 328 GPPGSQPYSRTPELRVSHKLAERKRRTEMKELFDQLRDLMPQERGSKASKWEILTKAIAE 387

Query: 526 -----EFINTLKHNQDEMAKEVESLRQQLSVLK 553
                + I  L+ + +    E E LR++L  ++
Sbjct: 388 HQRQADAIRLLQSHCNNATSENEMLRRELQAMR 420



>gi|449297176|gb|EMC93194.1| hypothetical protein BAUCODRAFT_75925 [Baudoinia compniacensis UAMH
           10762]
          Length = 472

 Score = 94.7 bits (234), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 40/73 (54%), Positives = 56/73 (76%)

Query: 475 YSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLKHN 534
           YSR+PELR+SHKLAERKRR EMK+LF+EL  ++P     K SKWEILSKA+E+I +++ N
Sbjct: 306 YSRTPELRVSHKLAERKRRSEMKDLFEELNKAVPTSGGTKASKWEILSKAIEYIRSIQQN 365

Query: 535 QDEMAKEVESLRQ 547
           +  +  E+  L++
Sbjct: 366 EGRINSELSRLQR 378



>gi|296420330|ref|XP_002839728.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295635922|emb|CAZ83919.1| unnamed protein product [Tuber melanosporum]
          Length = 363

 Score = 94.7 bits (234), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 51/57 (89%), Gaps = 1/57 (1%)

Query: 473 TPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKA-VEFI 528
           TPYSR+PELR+SHKLAERKRRKEMK+LFDELRD LP ++  K+SKWE+L+K  ++F+
Sbjct: 295 TPYSRTPELRVSHKLAERKRRKEMKDLFDELRDQLPAERGGKSSKWEVLTKGRLQFL 351



>gi|322708547|gb|EFZ00124.1| HLH transcription factor (Hpa3), putative [Metarhizium anisopliae
           ARSEF 23]
          Length = 501

 Score = 94.4 bits (233), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 49/101 (48%), Positives = 69/101 (68%), Gaps = 14/101 (13%)

Query: 468 APVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAV-- 525
            P    PYSR+PELR+SHKLAERKRR EMKELFD+LRD +P ++  K SKWEIL+KA+  
Sbjct: 328 GPPGSQPYSRTPELRVSHKLAERKRRTEMKELFDQLRDLMPQERGSKASKWEILTKAIAE 387

Query: 526 -----EFINTLKHN------QDEMA-KEVESLRQQLSVLKG 554
                + I  L+++      ++EM  +EV++LR + + L+G
Sbjct: 388 HQRLNDSIRALQNHCANASTENEMLHREVQALRMEAAQLRG 428



>gi|396472558|ref|XP_003839150.1| hypothetical protein LEMA_P028230.1 [Leptosphaeria maculans JN3]
 gi|312215719|emb|CBX95671.1| hypothetical protein LEMA_P028230.1 [Leptosphaeria maculans JN3]
          Length = 203

 Score = 94.4 bits (233), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 45/87 (51%), Positives = 58/87 (66%)

Query: 475 YSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLKHN 534
           YSR+PELRISHK+AERKRR EMK LFDEL + LP     K+SKWE+L+K++E+I  L  +
Sbjct: 24  YSRTPELRISHKMAERKRRSEMKNLFDELNNILPNSPGSKSSKWEVLTKSIEYIRNLSAS 83

Query: 535 QDEMAKEVESLRQQLSVLKGCSNSETD 561
                +EVESLR Q   ++       D
Sbjct: 84  HTRANREVESLRAQAEYVRQARQENMD 110



>gi|398410069|ref|XP_003856488.1| hypothetical protein MYCGRDRAFT_89727 [Zymoseptoria tritici IPO323]
 gi|339476373|gb|EGP91464.1| hypothetical protein MYCGRDRAFT_89727 [Zymoseptoria tritici IPO323]
          Length = 487

 Score = 94.4 bits (233), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 39/74 (52%), Positives = 57/74 (77%)

Query: 475 YSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLKHN 534
           YSR+PELR+SHKLAERKRR EMK+LF++L  ++P     K SKWEIL+KA+E+I T +H 
Sbjct: 320 YSRTPELRVSHKLAERKRRSEMKDLFEDLNKAVPSSGGTKASKWEILTKAIEYIRTTQHQ 379

Query: 535 QDEMAKEVESLRQQ 548
           +  +  E++ L+++
Sbjct: 380 ERNLHAEIQRLQRE 393



>gi|258575349|ref|XP_002541856.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237902122|gb|EEP76523.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 501

 Score = 94.4 bits (233), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 45/86 (52%), Positives = 62/86 (72%), Gaps = 7/86 (8%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           P   TPYSR+PELRISHKLAERKRR EMK+ F+ LR  LP  ++ K+SKWE L++A+++I
Sbjct: 327 PNGSTPYSRTPELRISHKLAERKRRSEMKDCFEALRTRLPSTQNNKSSKWETLNRAMDYI 386

Query: 529 NTL-------KHNQDEMAKEVESLRQ 547
           + L       +H +D++  EVE LR+
Sbjct: 387 SQLEKNLTQSQHERDQLRAEVEELRR 412



>gi|389631549|ref|XP_003713427.1| hypothetical protein MGG_10837 [Magnaporthe oryzae 70-15]
 gi|351645760|gb|EHA53620.1| hypothetical protein MGG_10837 [Magnaporthe oryzae 70-15]
          Length = 495

 Score = 94.0 bits (232), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 62/88 (70%), Gaps = 7/88 (7%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAV-------E 526
           PYSR+PELR SHKLAERKRR EMKELF+ELRD +P ++  K SKWEIL+KA+       +
Sbjct: 333 PYSRTPELRRSHKLAERKRRTEMKELFEELRDLMPQERGSKASKWEILTKAIAEHKRQAD 392

Query: 527 FINTLKHNQDEMAKEVESLRQQLSVLKG 554
            + +L      + +E+E++R+ +  L+G
Sbjct: 393 TLRSLHQTNGSLHQELEAMRRDVMALRG 420



>gi|350295429|gb|EGZ76406.1| hypothetical protein NEUTE2DRAFT_98199 [Neurospora tetrasperma FGSC
           2509]
          Length = 486

 Score = 94.0 bits (232), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 65/95 (68%), Gaps = 13/95 (13%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKA--------- 524
           PYSR+PELR+SHKLAERKRR EMKELF++LRD +P ++  K SKWEIL+KA         
Sbjct: 329 PYSRTPELRVSHKLAERKRRTEMKELFEQLRDLMPQERGSKASKWEILTKAISEHQRMSN 388

Query: 525 -VEFINTLKHNQDEMAKEVESLRQQLSVLKGCSNS 558
            ++ + +  HN+D   +E+E LR +L   +  +NS
Sbjct: 389 HIQVLTSTLHNKD---REIEHLRHELQRAQMEANS 420



>gi|440463729|gb|ELQ33283.1| hypothetical protein OOU_Y34scaffold00979g67 [Magnaporthe oryzae
           Y34]
 gi|440483681|gb|ELQ64030.1| hypothetical protein OOW_P131scaffold00888g19 [Magnaporthe oryzae
           P131]
          Length = 474

 Score = 94.0 bits (232), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 62/88 (70%), Gaps = 7/88 (7%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAV-------E 526
           PYSR+PELR SHKLAERKRR EMKELF+ELRD +P ++  K SKWEIL+KA+       +
Sbjct: 312 PYSRTPELRRSHKLAERKRRTEMKELFEELRDLMPQERGSKASKWEILTKAIAEHKRQAD 371

Query: 527 FINTLKHNQDEMAKEVESLRQQLSVLKG 554
            + +L      + +E+E++R+ +  L+G
Sbjct: 372 TLRSLHQTNGSLHQELEAMRRDVMALRG 399



>gi|452847934|gb|EME49866.1| hypothetical protein DOTSEDRAFT_164634 [Dothistroma septosporum
           NZE10]
          Length = 501

 Score = 94.0 bits (232), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 58/73 (79%)

Query: 475 YSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLKHN 534
           YSR+PELR+SHKLAERKRR EMK+LF++L  ++P +   K SKWEIL+KA+E+I   +H 
Sbjct: 335 YSRTPELRVSHKLAERKRRSEMKDLFEDLNKAVPSNGGTKASKWEILTKAIEYIRQTQHQ 394

Query: 535 QDEMAKEVESLRQ 547
           + ++ +EV+ L++
Sbjct: 395 ERQLHQEVQRLQR 407



>gi|512192467|gb|EPE08226.1| hlh transcription factor [Ophiostoma piceae UAMH 11346]
          Length = 513

 Score = 94.0 bits (232), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/88 (48%), Positives = 62/88 (70%), Gaps = 7/88 (7%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAV-------E 526
           PYSR+PELRISHKLAERKRR EMKELF++LRD +P ++  K SKWEIL+KA+       +
Sbjct: 350 PYSRTPELRISHKLAERKRRTEMKELFEQLRDLMPQERGSKASKWEILTKAITEHQRLQD 409

Query: 527 FINTLKHNQDEMAKEVESLRQQLSVLKG 554
            +   + +Q  ++ E+ S++ +L  L+ 
Sbjct: 410 VLRNTQQHQSGISAEMASMKNELHALRA 437



>gi|336465128|gb|EGO53368.1| hypothetical protein NEUTE1DRAFT_150703 [Neurospora tetrasperma
           FGSC 2508]
          Length = 486

 Score = 94.0 bits (232), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 65/95 (68%), Gaps = 13/95 (13%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKA--------- 524
           PYSR+PELR+SHKLAERKRR EMKELF++LRD +P ++  K SKWEIL+KA         
Sbjct: 329 PYSRTPELRVSHKLAERKRRTEMKELFEQLRDLMPQERGSKASKWEILTKAISEHQRMSN 388

Query: 525 -VEFINTLKHNQDEMAKEVESLRQQLSVLKGCSNS 558
            ++ + +  HN+D   +E+E LR +L   +  +NS
Sbjct: 389 HIQVLTSTLHNKD---REIEHLRHELQRAQMEANS 420



>gi|242819786|ref|XP_002487387.1| HLH transcription factor (Hpa3), putative [Talaromyces stipitatus
           ATCC 10500]
 gi|242819790|ref|XP_002487388.1| HLH transcription factor (Hpa3), putative [Talaromyces stipitatus
           ATCC 10500]
 gi|218713852|gb|EED13276.1| HLH transcription factor (Hpa3), putative [Talaromyces stipitatus
           ATCC 10500]
 gi|218713853|gb|EED13277.1| HLH transcription factor (Hpa3), putative [Talaromyces stipitatus
           ATCC 10500]
          Length = 495

 Score = 94.0 bits (232), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 62/89 (69%), Gaps = 7/89 (7%)

Query: 468 APVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEF 527
           +P   TPYSR+PELR++HKLAERKRR EMK+ F+ LR  LP  ++ K+SKWE L++A+E+
Sbjct: 340 SPNNATPYSRTPELRVTHKLAERKRRSEMKDCFEMLRMRLPQSQNNKSSKWETLTRAIEY 399

Query: 528 INTL-------KHNQDEMAKEVESLRQQL 549
           I TL       +    ++ +EV+ LR QL
Sbjct: 400 ITTLEKQVSTSRRENSDLQREVQDLRAQL 428



>gi|302664602|ref|XP_003023930.1| HLH transcription factor (Hpa3), putative [Trichophyton verrucosum
           HKI 0517]
 gi|291187950|gb|EFE43312.1| HLH transcription factor (Hpa3), putative [Trichophyton verrucosum
           HKI 0517]
          Length = 652

 Score = 94.0 bits (232), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 61/91 (67%)

Query: 464 IQQPAPVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSK 523
           I +  P   TPYSR+PELR++HKLAERKRR EMK+ F+ LR  LP  ++ K+SKWE L++
Sbjct: 425 IGEGDPNGATPYSRTPELRVTHKLAERKRRSEMKDCFEVLRARLPSSQNNKSSKWETLTR 484

Query: 524 AVEFINTLKHNQDEMAKEVESLRQQLSVLKG 554
           A+++IN L+    +   E   LR +L  ++ 
Sbjct: 485 AIDYINQLEKTASQSRAETNQLRMELEEMRA 515



>gi|327305503|ref|XP_003237443.1| HLH transcription factor [Trichophyton rubrum CBS 118892]
 gi|326460441|gb|EGD85894.1| HLH transcription factor [Trichophyton rubrum CBS 118892]
          Length = 580

 Score = 94.0 bits (232), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 61/91 (67%)

Query: 464 IQQPAPVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSK 523
           I +  P   TPYSR+PELR++HKLAERKRR EMK+ F+ LR  LP  ++ K+SKWE L++
Sbjct: 357 IGEGDPNGATPYSRTPELRVTHKLAERKRRSEMKDCFEVLRARLPSSQNNKSSKWETLTR 416

Query: 524 AVEFINTLKHNQDEMAKEVESLRQQLSVLKG 554
           A+++IN L+    +   E   LR +L  ++ 
Sbjct: 417 AIDYINQLEKTASQSRAETNQLRMELEEMRA 447



>gi|38566949|emb|CAE76251.1| hypothetical protein [Neurospora crassa]
          Length = 482

 Score = 94.0 bits (232), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 65/95 (68%), Gaps = 13/95 (13%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKA--------- 524
           PYSR+PELR+SHKLAERKRR EMKELF++LRD +P ++  K SKWEIL+KA         
Sbjct: 325 PYSRTPELRVSHKLAERKRRTEMKELFEQLRDLMPQERGSKASKWEILTKAISEHQRMSN 384

Query: 525 -VEFINTLKHNQDEMAKEVESLRQQLSVLKGCSNS 558
            ++ + +  HN+D   +E+E LR +L   +  +NS
Sbjct: 385 HIQVLTSTLHNKD---REIEHLRHELQRAQMEANS 416



>gi|164427599|ref|XP_965344.2| hypothetical protein NCU02957 [Neurospora crassa OR74A]
 gi|157071810|gb|EAA36108.2| conserved hypothetical protein [Neurospora crassa OR74A]
          Length = 480

 Score = 94.0 bits (232), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 65/95 (68%), Gaps = 13/95 (13%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKA--------- 524
           PYSR+PELR+SHKLAERKRR EMKELF++LRD +P ++  K SKWEIL+KA         
Sbjct: 323 PYSRTPELRVSHKLAERKRRTEMKELFEQLRDLMPQERGSKASKWEILTKAISEHQRMSN 382

Query: 525 -VEFINTLKHNQDEMAKEVESLRQQLSVLKGCSNS 558
            ++ + +  HN+D   +E+E LR +L   +  +NS
Sbjct: 383 HIQVLTSTLHNKD---REIEHLRHELQRAQMEANS 414



>gi|403164837|ref|XP_003324903.2| hypothetical protein PGTG_06440 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|375165332|gb|EFP80484.2| hypothetical protein PGTG_06440 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 652

 Score = 93.6 bits (231), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/85 (51%), Positives = 63/85 (74%), Gaps = 2/85 (2%)

Query: 473 TPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPV--DKSLKTSKWEILSKAVEFINT 530
           +PYSRSPEL+ISHKLAERKRRKEM++LFDELR+ LPV  ++  K SKWE LS+AV+++  
Sbjct: 543 SPYSRSPELKISHKLAERKRRKEMRDLFDELREVLPVTDERHSKGSKWETLSRAVDYMQQ 602

Query: 531 LKHNQDEMAKEVESLRQQLSVLKGC 555
           ++   + +  +   L+ +L+ L G 
Sbjct: 603 IRLENERLKADNLHLQGRLTALSGG 627



>gi|340517502|gb|EGR47746.1| predicted protein [Trichoderma reesei QM6a]
          Length = 505

 Score = 93.6 bits (231), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/87 (51%), Positives = 63/87 (72%), Gaps = 7/87 (8%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAV-------E 526
           PYSR+PELR+SHKLAERKRR EMKELFD+LRD +P ++  K SKWEIL+KA+       E
Sbjct: 340 PYSRTPELRVSHKLAERKRRTEMKELFDQLRDLMPQERGSKASKWEILTKAIAEHQKQSE 399

Query: 527 FINTLKHNQDEMAKEVESLRQQLSVLK 553
            I  L+++ + +  + E LR++L  ++
Sbjct: 400 HIRLLQNHINTVMADNEMLRRELQGIQ 426



>gi|302498618|ref|XP_003011306.1| HLH transcription factor (Hpa3), putative [Arthroderma benhamiae
           CBS 112371]
 gi|291174856|gb|EFE30666.1| HLH transcription factor (Hpa3), putative [Arthroderma benhamiae
           CBS 112371]
          Length = 638

 Score = 93.6 bits (231), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 61/91 (67%)

Query: 464 IQQPAPVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSK 523
           I +  P   TPYSR+PELR++HKLAERKRR EMK+ F+ LR  LP  ++ K+SKWE L++
Sbjct: 411 IGEGDPNGATPYSRTPELRVTHKLAERKRRSEMKDCFEVLRARLPSSQNNKSSKWETLTR 470

Query: 524 AVEFINTLKHNQDEMAKEVESLRQQLSVLKG 554
           A+++IN L+    +   E   LR +L  ++ 
Sbjct: 471 AIDYINQLEKTASQSRAETNQLRMELEEMRA 501



>gi|358395911|gb|EHK45298.1| hypothetical protein TRIATDRAFT_299973 [Trichoderma atroviride IMI
           206040]
          Length = 409

 Score = 93.6 bits (231), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 63/104 (60%), Gaps = 14/104 (13%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAV-------- 525
           PYSR+PELR+SHKLAERKRR EMKELFD+LRD +P ++  K SKWEIL+KA+        
Sbjct: 249 PYSRTPELRVSHKLAERKRRTEMKELFDQLRDLMPQERGSKASKWEILTKAIAEHQRHID 308

Query: 526 ------EFINTLKHNQDEMAKEVESLRQQLSVLKGCSNSETDTP 563
                    NT     D + +E+  LR + S L G  N ++  P
Sbjct: 309 HVRVLQSHYNTAMTENDMLRREISGLRMENSQLVGELNRQSAPP 352



>gi|121716104|ref|XP_001275661.1| HLH transcription factor (Hpa3), putative [Aspergillus clavatus
           NRRL 1]
 gi|119403818|gb|EAW14235.1| HLH transcription factor (Hpa3), putative [Aspergillus clavatus
           NRRL 1]
          Length = 503

 Score = 93.2 bits (230), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 60/89 (67%), Gaps = 7/89 (7%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           P   TPYSR+PELR++HKLAERKRR EMK+ F+ LR  LP  ++ K+SKWE L++A+E+I
Sbjct: 343 PSNSTPYSRTPELRVTHKLAERKRRSEMKDCFEALRMRLPQSQNNKSSKWETLTRAIEYI 402

Query: 529 NTL-------KHNQDEMAKEVESLRQQLS 550
             L       +   D +  E+E +R QLS
Sbjct: 403 GQLEKMLSNARRENDVLRNELEEMRSQLS 431



>gi|453088287|gb|EMF16327.1| HLH-domain-containing protein [Mycosphaerella populorum SO2202]
          Length = 441

 Score = 93.2 bits (230), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 58/73 (79%)

Query: 475 YSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLKHN 534
           YSR+PELR+SHKLAERKRR EMK+LF++L  ++P +   K SKWEIL+KA+E+I + +H+
Sbjct: 275 YSRTPELRVSHKLAERKRRSEMKDLFEDLNKAVPQNGGTKASKWEILTKAIEYIRSQQHH 334

Query: 535 QDEMAKEVESLRQ 547
           +  +  EV+ L++
Sbjct: 335 ERNLQAEVQRLQR 347



>gi|315046606|ref|XP_003172678.1| hypothetical protein MGYG_05268 [Arthroderma gypseum CBS 118893]
 gi|311343064|gb|EFR02267.1| hypothetical protein MGYG_05268 [Arthroderma gypseum CBS 118893]
          Length = 568

 Score = 93.2 bits (230), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 61/91 (67%)

Query: 464 IQQPAPVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSK 523
           I +  P   TPYSR+PELR++HKLAERKRR EMK+ F+ LR  LP  ++ K+SKWE L++
Sbjct: 345 IGEGDPNGATPYSRTPELRVTHKLAERKRRSEMKDCFEVLRARLPSSQNNKSSKWETLTR 404

Query: 524 AVEFINTLKHNQDEMAKEVESLRQQLSVLKG 554
           A+++IN L+    +   E   LR +L  ++ 
Sbjct: 405 AIDYINQLEKTASQSRAESNQLRMELEEMRA 435



>gi|115401710|ref|XP_001216443.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gi|114190384|gb|EAU32084.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 493

 Score = 93.2 bits (230), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 61/85 (71%)

Query: 473 TPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLK 532
           TPYSR+PELR++HKLAERKRR EMK+ F+ LR  LP  ++ K+SKWE L++A+E+I  L+
Sbjct: 339 TPYSRTPELRVTHKLAERKRRSEMKDCFEALRVRLPQSQNNKSSKWETLTRAIEYIGQLE 398

Query: 533 HNQDEMAKEVESLRQQLSVLKGCSN 557
                + +E E+LR +L  ++   N
Sbjct: 399 KMLTSVRRENEALRNELEDMRAQMN 423



>gi|475664480|gb|EMT62275.1| Protein esc1 [Fusarium oxysporum f. sp. cubense race 4]
 gi|475664481|gb|EMT62276.1| Protein esc1 [Fusarium oxysporum f. sp. cubense race 4]
          Length = 490

 Score = 92.8 bits (229), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/87 (51%), Positives = 59/87 (67%), Gaps = 7/87 (8%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAV-------E 526
           PYSR+PELR+SHKLAERKRR EMKELFD+LRD +P ++  K SKWEIL+KA+       +
Sbjct: 328 PYSRTPELRVSHKLAERKRRTEMKELFDQLRDLMPQERGSKASKWEILTKAIAEHQKQQD 387

Query: 527 FINTLKHNQDEMAKEVESLRQQLSVLK 553
            I  L+ +      E E LR+ +  L+
Sbjct: 388 IIRALQDHYKSNTAENEMLRRDVHALR 414



>gi|342874432|gb|EGU76444.1| hypothetical protein FOXB_13037 [Fusarium oxysporum Fo5176]
 gi|477507407|gb|ENH60701.1| Protein esc1 [Fusarium oxysporum f. sp. cubense race 1]
          Length = 490

 Score = 92.8 bits (229), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 45/87 (51%), Positives = 59/87 (67%), Gaps = 7/87 (8%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAV-------E 526
           PYSR+PELR+SHKLAERKRR EMKELFD+LRD +P ++  K SKWEIL+KA+       +
Sbjct: 328 PYSRTPELRVSHKLAERKRRTEMKELFDQLRDLMPQERGSKASKWEILTKAIAEHQKQQD 387

Query: 527 FINTLKHNQDEMAKEVESLRQQLSVLK 553
            I  L+ +      E E LR+ +  L+
Sbjct: 388 IIRALQDHYKSNTAENEMLRRDVHALR 414



>gi|480320780|gb|AGJ81959.1| transcription factor-like protein, partial [Heterobasidion annosum]
          Length = 80

 Score = 92.8 bits (229), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 46/53 (86%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEIL 521
           P   TPYSRSPELR+SHKLAERKRRKEM++LFDELRD LP D+ +K SKWEIL
Sbjct: 26  PSGSTPYSRSPELRVSHKLAERKRRKEMRDLFDELRDQLPADRGMKASKWEIL 78



>gi|340992679|gb|EGS23234.1| hypothetical protein CTHT_0009000 [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 430

 Score = 92.8 bits (229), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 59/83 (71%), Gaps = 7/83 (8%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAV-------E 526
           PYSR+PELRISHKLAERKRR EMKELF++LRD +P ++  K SKWEIL+KA+       E
Sbjct: 270 PYSRTPELRISHKLAERKRRTEMKELFEQLRDLMPQERGSKASKWEILTKAIQEHHRQNE 329

Query: 527 FINTLKHNQDEMAKEVESLRQQL 549
            I  L+ +      E+E L+++L
Sbjct: 330 LIRQLQAHAATQQAEIEMLKREL 352



>gi|212539047|ref|XP_002149679.1| HLH transcription factor (Hpa3), putative [Talaromyces marneffei
           ATCC 18224]
 gi|210069421|gb|EEA23512.1| HLH transcription factor (Hpa3), putative [Talaromyces marneffei
           ATCC 18224]
          Length = 498

 Score = 92.8 bits (229), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 43/89 (48%), Positives = 63/89 (70%), Gaps = 7/89 (7%)

Query: 468 APVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEF 527
           +P   TPYSR+PELR++HKLAERKRR EMK+ F+ LR  LP  ++ K+SKWE L++A+E+
Sbjct: 342 SPNNATPYSRTPELRVTHKLAERKRRSEMKDCFEMLRMRLPQSQNNKSSKWETLTRAIEY 401

Query: 528 INTL-------KHNQDEMAKEVESLRQQL 549
           I++L       +    ++ +EV+ LR QL
Sbjct: 402 ISSLEKQVSTSRRENSDLQREVQELRAQL 430



>gi|511010394|gb|EPB91618.1| hypothetical protein HMPREF1544_01540 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 213

 Score = 92.8 bits (229), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 68/82 (82%)

Query: 475 YSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLKHN 534
           YSRSPELRISHKLAERKRRKEMK+LFD+LRD LP+DKS+K+SKWEILSKAVE+I+ L+  
Sbjct: 129 YSRSPELRISHKLAERKRRKEMKDLFDDLRDLLPMDKSMKSSKWEILSKAVEYIDRLREK 188

Query: 535 QDEMAKEVESLRQQLSVLKGCS 556
           +     E E L+++L+ LK  S
Sbjct: 189 EVRSLHEKEELQRELAQLKESS 210



>gi|403172874|ref|XP_003332012.2| hypothetical protein PGTG_13964 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|375170032|gb|EFP87593.2| hypothetical protein PGTG_13964 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 626

 Score = 92.4 bits (228), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/85 (51%), Positives = 63/85 (74%), Gaps = 2/85 (2%)

Query: 473 TPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPV--DKSLKTSKWEILSKAVEFINT 530
           +PYSRSPEL+ISHKLAERKRRKEM++LFDELR+ LPV  ++  K SKWE LS+AV+++  
Sbjct: 517 SPYSRSPELKISHKLAERKRRKEMRDLFDELREVLPVTDERHSKGSKWETLSRAVDYMQQ 576

Query: 531 LKHNQDEMAKEVESLRQQLSVLKGC 555
           ++   + +  +   L+ +L+ L G 
Sbjct: 577 IRLENERLKADNLHLQGRLNSLSGG 601



>gi|303321824|ref|XP_003070906.1| bHLH family transcription factor [Coccidioides posadasii C735 delta
           SOWgp]
 gi|240110603|gb|EER28761.1| bHLH family transcription factor [Coccidioides posadasii C735 delta
           SOWgp]
 gi|320040410|gb|EFW22343.1| HLH transcription factor [Coccidioides posadasii str. Silveira]
          Length = 448

 Score = 92.4 bits (228), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 60/81 (74%)

Query: 473 TPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLK 532
           TPYSR+PELRISHKLAERKRR EMK+ F+ LR  LP  ++ K+SKWE L++A+++I  L+
Sbjct: 280 TPYSRTPELRISHKLAERKRRSEMKDCFEALRTRLPSTQNNKSSKWETLNRAMDYITQLE 339

Query: 533 HNQDEMAKEVESLRQQLSVLK 553
            N  +  +E + LR +L  L+
Sbjct: 340 KNLAQSQQEQDQLRAELDDLR 360



>gi|392862173|gb|EAS37208.2| hypothetical protein CIMG_02390 [Coccidioides immitis RS]
          Length = 448

 Score = 92.0 bits (227), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 60/81 (74%)

Query: 473 TPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLK 532
           TPYSR+PELRISHKLAERKRR EMK+ F+ LR  LP  ++ K+SKWE L++A+++I  L+
Sbjct: 280 TPYSRTPELRISHKLAERKRRSEMKDCFEALRTRLPSTQNNKSSKWETLNRAMDYITQLE 339

Query: 533 HNQDEMAKEVESLRQQLSVLK 553
            N  +  +E + LR +L  L+
Sbjct: 340 KNLAQSQQEQDQLRAELDDLR 360



>gi|400598802|gb|EJP66509.1| helix-loop-helix DNA-binding domain-containing protein [Beauveria
           bassiana ARSEF 2860]
          Length = 502

 Score = 92.0 bits (227), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 44/87 (50%), Positives = 61/87 (70%), Gaps = 7/87 (8%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAV-------E 526
           PYSR+PELR+SHKLAERKRR EMKELFD+LRD +P ++  K SKWEIL+KA+       +
Sbjct: 334 PYSRTPELRVSHKLAERKRRTEMKELFDQLRDLMPQERGSKASKWEILTKAITEYQRQTD 393

Query: 527 FINTLKHNQDEMAKEVESLRQQLSVLK 553
            +  L+ + +    + E LR++L  +K
Sbjct: 394 HVRILQSHYNSAVSDNELLRRELQNVK 420



>gi|346320985|gb|EGX90585.1| HLH transcription factor (Hpa3), putative [Cordyceps militaris
           CM01]
          Length = 484

 Score = 92.0 bits (227), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 44/87 (50%), Positives = 61/87 (70%), Gaps = 7/87 (8%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAV-------E 526
           PYSR+PELR+SHKLAERKRR EMKELFD+LRD +P ++  K SKWEIL+KA+       +
Sbjct: 322 PYSRTPELRVSHKLAERKRRTEMKELFDQLRDLMPQERGSKASKWEILTKAITEYQRQTD 381

Query: 527 FINTLKHNQDEMAKEVESLRQQLSVLK 553
            +  L+ + +    + E LR++L  +K
Sbjct: 382 HVRALQTHYNNAVSDNELLRRELQNVK 408



>gi|296805778|ref|XP_002843713.1| conserved hypothetical protein [Arthroderma otae CBS 113480]
 gi|238845015|gb|EEQ34677.1| conserved hypothetical protein [Arthroderma otae CBS 113480]
          Length = 510

 Score = 92.0 bits (227), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 59/85 (69%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           P   TPYSR+PELR++HKLAERKRR EMK+ F+ LR  LP  ++ K+SKWE L++A+++I
Sbjct: 299 PNGATPYSRTPELRVTHKLAERKRRSEMKDCFEVLRARLPSAQNNKSSKWETLTRAIDYI 358

Query: 529 NTLKHNQDEMAKEVESLRQQLSVLK 553
           N L+    +   E   LR ++  ++
Sbjct: 359 NQLEKTASQSRAETNQLRLEIEEMR 383



>gi|407924662|gb|EKG17695.1| hypothetical protein MPH_05144 [Macrophomina phaseolina MS6]
          Length = 348

 Score = 91.7 bits (226), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 56/74 (75%)

Query: 475 YSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLKHN 534
           YSR+PELR+SHK+AERKRR EMK+LFDEL   LP     K+SKWEIL+K++E+I +L+ N
Sbjct: 176 YSRTPELRVSHKMAERKRRSEMKQLFDELNGILPNSPGNKSSKWEILTKSIEYIRSLQRN 235

Query: 535 QDEMAKEVESLRQQ 548
            D +  +   +RQ+
Sbjct: 236 FDRIQNDNNRMRQE 249



>gi|67901132|ref|XP_680822.1| hypothetical protein AN7553.2 [Aspergillus nidulans FGSC A4]
 gi|40742943|gb|EAA62133.1| conserved hypothetical protein [Aspergillus nidulans FGSC A4]
 gi|259483872|tpe|CBF79619.1| TPA: Putative bHLH transcription factor
           [Source:UniProtKB/TrEMBL;Acc:Q8TFJ8] [Aspergillus
           nidulans FGSC A4]
          Length = 313

 Score = 91.7 bits (226), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 41/81 (50%), Positives = 59/81 (72%)

Query: 473 TPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLK 532
           TPYSR+PELR++HKLAERKRR EMK+ F+ LR  LP  ++ K+SKWE L++A+E+IN L+
Sbjct: 155 TPYSRTPELRVTHKLAERKRRSEMKDCFEALRLRLPSSQNNKSSKWETLTRAIEYINNLE 214

Query: 533 HNQDEMAKEVESLRQQLSVLK 553
                  ++ E L Q+L  ++
Sbjct: 215 KQVANFRRDNELLHQELQEMR 235



>gi|156063754|ref|XP_001597799.1| hypothetical protein SS1G_01995 [Sclerotinia sclerotiorum 1980]
 gi|154697329|gb|EDN97067.1| hypothetical protein SS1G_01995 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 443

 Score = 91.3 bits (225), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 45/82 (54%), Positives = 59/82 (71%), Gaps = 7/82 (8%)

Query: 468 APVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEF 527
           +P    PYSR+PELR+SHKLAERKRR EMKELF+ LRD +P ++  K SKWEIL+KA+  
Sbjct: 263 SPNSGQPYSRTPELRVSHKLAERKRRTEMKELFENLRDLMPQERGNKASKWEILTKAI-- 320

Query: 528 INTLKHNQDEMAKEVESLRQQL 549
               +HN    AKE++ L+ +L
Sbjct: 321 ---AEHN--AQAKEIQELKARL 337



>gi|20067643|emb|CAC81781.1| putative bHLH transcription factor [Emericella nidulans]
          Length = 313

 Score = 91.3 bits (225), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 41/81 (50%), Positives = 59/81 (72%)

Query: 473 TPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLK 532
           TPYSR+PELR++HKLAERKRR EMK+ F+ LR  LP  ++ K+SKWE L++A+E+IN L+
Sbjct: 155 TPYSRTPELRVTHKLAERKRRSEMKDCFEALRLRLPSSQNNKSSKWETLTRAIEYINNLE 214

Query: 533 HNQDEMAKEVESLRQQLSVLK 553
                  ++ E L Q+L  ++
Sbjct: 215 KQVANFRRDNELLHQELQEMR 235



>gi|71002262|ref|XP_755812.1| HLH transcription factor (Hpa3) [Aspergillus fumigatus Af293]
 gi|66853450|gb|EAL93774.1| HLH transcription factor (Hpa3), putative [Aspergillus fumigatus
           Af293]
 gi|159129869|gb|EDP54983.1| HLH transcription factor (Hpa3), putative [Aspergillus fumigatus
           A1163]
          Length = 525

 Score = 90.9 bits (224), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 59/85 (69%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           P   TPYSR+PELR++HKLAERKRR EMK+ F+ LR  LP  ++ K+SKWE L++A+E+I
Sbjct: 360 PTSSTPYSRTPELRVTHKLAERKRRSEMKDCFEALRMRLPQSQNNKSSKWETLTRAIEYI 419

Query: 529 NTLKHNQDEMAKEVESLRQQLSVLK 553
             L+       +E + LR ++  ++
Sbjct: 420 GQLEKMLSNARRENDVLRSEVEEMR 444



>gi|320586982|gb|EFW99645.1| hlh transcription factor [Grosmannia clavigera kw1407]
          Length = 516

 Score = 90.9 bits (224), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 61/87 (70%), Gaps = 7/87 (8%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAV-------E 526
           PYSR+PELRISHKLAERKRR EMKELF++LRD +P ++  K SKWEIL+KA+       E
Sbjct: 344 PYSRTPELRISHKLAERKRRTEMKELFEQLRDLMPQERGSKASKWEILTKAITEHQRLQE 403

Query: 527 FINTLKHNQDEMAKEVESLRQQLSVLK 553
            I + + +   ++ +V  L+ ++  L+
Sbjct: 404 TIRSAQQHSAALSSDVSILKNEVHALR 430



>gi|119481827|ref|XP_001260942.1| HLH transcription factor (Hpa3), putative [Neosartorya fischeri
           NRRL 181]
 gi|119409096|gb|EAW19045.1| HLH transcription factor (Hpa3), putative [Neosartorya fischeri
           NRRL 181]
          Length = 506

 Score = 90.9 bits (224), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 59/85 (69%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFI 528
           P   TPYSR+PELR++HKLAERKRR EMK+ F+ LR  LP  ++ K+SKWE L++A+E+I
Sbjct: 343 PTSSTPYSRTPELRVTHKLAERKRRSEMKDCFEALRMRLPQSQNNKSSKWETLTRAIEYI 402

Query: 529 NTLKHNQDEMAKEVESLRQQLSVLK 553
             L+       +E + LR ++  ++
Sbjct: 403 GQLEKMLSNARRENDVLRSEVEEMR 427



>gi|512207553|gb|EPE36371.1| HLH, helix-loop-helix DNA-binding protein [Glarea lozoyensis ATCC
           20868]
          Length = 524

 Score = 90.9 bits (224), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 57/82 (69%)

Query: 468 APVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEF 527
           +P    PYSR+PELR+SHKLAERKRR EMK+LFD+LRD +P ++  K SKWEIL+KA+  
Sbjct: 338 SPGGSQPYSRTPELRVSHKLAERKRRTEMKDLFDQLRDLMPQERGSKASKWEILTKAISE 397

Query: 528 INTLKHNQDEMAKEVESLRQQL 549
                 +   +  ++ S+ Q+L
Sbjct: 398 YGRAMTDISRLTVKIRSVEQEL 419



>gi|380487235|emb|CCF38168.1| helix-loop-helix DNA-binding domain-containing protein
           [Colletotrichum higginsianum]
          Length = 490

 Score = 90.5 bits (223), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 57/81 (70%), Gaps = 7/81 (8%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAV-------E 526
           PYSR+PELR SHKLAERKRR EMKELFD+LRD +P ++  K SKWEIL+KA+       E
Sbjct: 317 PYSRTPELRKSHKLAERKRRTEMKELFDQLRDLMPQERGSKASKWEILTKAISEHQRMAE 376

Query: 527 FINTLKHNQDEMAKEVESLRQ 547
            +  ++     +A+E + LRQ
Sbjct: 377 VMRIVQSQNTTLAQENDGLRQ 397



>gi|310793448|gb|EFQ28909.1| helix-loop-helix DNA-binding domain-containing protein [Glomerella
           graminicola M1.001]
          Length = 487

 Score = 90.5 bits (223), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 57/81 (70%), Gaps = 7/81 (8%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAV-------E 526
           PYSR+PELR SHKLAERKRR EMKELFD+LRD +P ++  K SKWEIL+KA+       E
Sbjct: 316 PYSRTPELRKSHKLAERKRRTEMKELFDQLRDLMPQERGSKASKWEILTKAISEHQRMAE 375

Query: 527 FINTLKHNQDEMAKEVESLRQ 547
            +  ++     +A+E + LRQ
Sbjct: 376 VMRIVQSQNTTLAQENDGLRQ 396



>gi|358060881|dbj|GAA93397.1| hypothetical protein E5Q_00038 [Mixia osmundae IAM 14324]
          Length = 2122

 Score = 90.5 bits (223), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 65/87 (74%)

Query: 470  VKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFIN 529
            VKETPYSRSPELR+SHK+AERKRRKEMK+LF+EL+DSLP +K  K+SKWE L+ A+++I 
Sbjct: 1907 VKETPYSRSPELRVSHKIAERKRRKEMKDLFEELKDSLPGEKKSKSSKWESLTAAIDYIG 1966

Query: 530  TLKHNQDEMAKEVESLRQQLSVLKGCS 556
             LK   D + +  + L  QL    G +
Sbjct: 1967 YLKEENDRLQQHNDQLVWQLGGSSGIA 1993



>gi|347830660|emb|CCD46357.1| similar to transcription factor bHLH [Botryotinia fuckeliana T4]
 gi|472235926|gb|EMR80874.1| putative hlh transcription factor protein [Botryotinia fuckeliana
           BcDW1]
          Length = 506

 Score = 90.5 bits (223), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 48/93 (51%), Positives = 65/93 (69%), Gaps = 7/93 (7%)

Query: 468 APVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAV-E 526
           +P    PYSR+PELR+SHKLAERKRR EMKELF+ LRD +P ++  K SKWEIL+KA+ E
Sbjct: 325 SPNNGQPYSRTPELRVSHKLAERKRRTEMKELFETLRDLMPQERGNKASKWEILTKAIAE 384

Query: 527 FINTLKHNQDEMAK------EVESLRQQLSVLK 553
             +  K  QD  ++      E ESLR++ +V++
Sbjct: 385 HHSQTKEIQDLKSRLHNSQLENESLRRENNVIR 417



>gi|358373709|dbj|GAA90305.1| HLH transcription factor [Aspergillus kawachii IFO 4308]
          Length = 503

 Score = 90.5 bits (223), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 60/85 (70%), Gaps = 7/85 (8%)

Query: 473 TPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFIN--- 529
           TPYSR+PELR++HKLAERKRR EMK+ F+ LR  LP  ++ K+SKWE L++A+E+I+   
Sbjct: 348 TPYSRTPELRVTHKLAERKRRSEMKDCFEALRVRLPQSQNNKSSKWETLTRAIEYISHLE 407

Query: 530 ----TLKHNQDEMAKEVESLRQQLS 550
               T +   D +  E++ +R QLS
Sbjct: 408 KMVTTTRRENDVLRSELDEMRAQLS 432



>gi|317035417|ref|XP_003188917.1| HLH transcription factor (Hpa3) [Aspergillus niger CBS 513.88]
          Length = 503

 Score = 90.1 bits (222), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 60/85 (70%), Gaps = 7/85 (8%)

Query: 473 TPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFIN--- 529
           TPYSR+PELR++HKLAERKRR EMK+ F+ LR  LP  ++ K+SKWE L++A+E+I+   
Sbjct: 348 TPYSRTPELRVTHKLAERKRRSEMKDCFEALRVRLPQSQNNKSSKWETLTRAIEYISHLE 407

Query: 530 ----TLKHNQDEMAKEVESLRQQLS 550
               T +   D +  E++ +R QLS
Sbjct: 408 KMVTTTRRENDVLRSELDEMRAQLS 432



>gi|440632503|gb|ELR02422.1| hypothetical protein GMDG_05480 [Geomyces destructans 20631-21]
          Length = 530

 Score = 90.1 bits (222), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 49/115 (42%), Positives = 69/115 (60%), Gaps = 28/115 (24%)

Query: 468 APVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAV-- 525
           +P    PYSR+PELR SHKLAERKRR EMKEL+DELR+ LP ++  KTSKWEILSK++  
Sbjct: 333 SPGSTQPYSRTPELRKSHKLAERKRRNEMKELYDELREMLPSERGNKTSKWEILSKSIAQ 392

Query: 526 -----------------------EFINTLKHNQDEMAK---EVESLRQQLSVLKG 554
                                     + L+ ++DE+A+   EV ++R + S+++G
Sbjct: 393 HKAQEDRCQNLEQHYRQLQTDNARKDSQLQRSRDEIAELRAEVRTMRHEFSLIRG 447



>gi|477531919|gb|ENH83590.1| hlh transcription factor [Colletotrichum orbiculare MAFF 240422]
          Length = 760

 Score = 90.1 bits (222), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 57/81 (70%), Gaps = 7/81 (8%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAV-------E 526
           PYSR+PELR SHKLAERKRR EMKELFD+LRD +P ++  K SKWEIL+KA+       +
Sbjct: 317 PYSRTPELRKSHKLAERKRRTEMKELFDQLRDLMPQERGSKASKWEILTKAISEHQRMAD 376

Query: 527 FINTLKHNQDEMAKEVESLRQ 547
            +  ++     +A+E + LRQ
Sbjct: 377 MVRMVQTQNTSLAQENDGLRQ 397



>gi|336274380|ref|XP_003351944.1| hypothetical protein SMAC_00493 [Sordaria macrospora k-hell]
 gi|380096228|emb|CCC06275.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 504

 Score = 89.7 bits (221), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 61/86 (70%), Gaps = 13/86 (15%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKA--------- 524
           PYSR+PELR+SHKLAERKRR EMKELF++LRD +P ++  K SKWEIL+KA         
Sbjct: 347 PYSRTPELRVSHKLAERKRRTEMKELFEQLRDLMPQERGSKASKWEILTKAISEHQRMSN 406

Query: 525 -VEFINTLKHNQDEMAKEVESLRQQL 549
            ++ + +  H++D   +E+E LR ++
Sbjct: 407 HIQVLTSTLHSKD---REIEHLRHEV 429



>gi|350636303|gb|EHA24663.1| hypothetical protein ASPNIDRAFT_181931 [Aspergillus niger ATCC
           1015]
          Length = 319

 Score = 89.4 bits (220), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 60/85 (70%), Gaps = 7/85 (8%)

Query: 473 TPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFIN--- 529
           TPYSR+PELR++HKLAERKRR EMK+ F+ LR  LP  ++ K+SKWE L++A+E+I+   
Sbjct: 164 TPYSRTPELRVTHKLAERKRRSEMKDCFEALRVRLPQSQNNKSSKWETLTRAIEYISHLE 223

Query: 530 ----TLKHNQDEMAKEVESLRQQLS 550
               T +   D +  E++ +R QLS
Sbjct: 224 KMVTTTRRENDVLRSELDEMRAQLS 248



>gi|346978400|gb|EGY21852.1| hypothetical protein VDAG_03292 [Verticillium dahliae VdLs.17]
          Length = 475

 Score = 89.4 bits (220), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 59/86 (68%), Gaps = 7/86 (8%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAV-------E 526
           PYSR+PELR SHKLAERKRR EMKELFD+LRD +P ++  K SKWEIL+KA+       +
Sbjct: 322 PYSRTPELRKSHKLAERKRRTEMKELFDQLRDLMPQERGSKASKWEILTKAITEHQRMAD 381

Query: 527 FINTLKHNQDEMAKEVESLRQQLSVL 552
            +  +++    +A E + LR++   L
Sbjct: 382 AVRVMQNQNASIASENDQLRRENHAL 407



>gi|171684719|ref|XP_001907301.1| hypothetical protein [Podospora anserina S mat+]
 gi|170942320|emb|CAP67972.1| unnamed protein product [Podospora anserina S mat+]
          Length = 501

 Score = 89.0 bits (219), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 64/97 (65%), Gaps = 17/97 (17%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKA-------VE 526
           PYSR+PELRI+HKLAERKRR EMKELF++LRD +P ++  K SKWEIL+K          
Sbjct: 329 PYSRTPELRITHKLAERKRRTEMKELFEQLRDLMPQERGTKASKWEILTKGWFVFGTMCL 388

Query: 527 FINTLKHNQD---EMAKEV-------ESLRQQLSVLK 553
           F NT++  Q    ++A+EV       E +R+Q+  L+
Sbjct: 389 FTNTIRDLQSHVQQLAEEVTKRDAQMEDMRRQIQELQ 425



>gi|134082410|emb|CAK42424.1| unnamed protein product [Aspergillus niger]
          Length = 2165

 Score = 89.0 bits (219), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 60/85 (70%), Gaps = 7/85 (8%)

Query: 473 TPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFIN--- 529
           TPYSR+PELR++HKLAERKRR EMK+ F+ LR  LP  ++ K+SKWE L++A+E+I+   
Sbjct: 365 TPYSRTPELRVTHKLAERKRRSEMKDCFEALRVRLPQSQNNKSSKWETLTRAIEYISHLE 424

Query: 530 ----TLKHNQDEMAKEVESLRQQLS 550
               T +   D +  E++ +R QLS
Sbjct: 425 KMVTTTRRENDVLRSELDEMRAQLS 449



>gi|482812256|gb|EOA88988.1| hypothetical protein SETTUDRAFT_183743 [Setosphaeria turcica Et28A]
          Length = 531

 Score = 89.0 bits (219), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 40/72 (55%), Positives = 51/72 (70%)

Query: 475 YSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLKHN 534
           YSR+PELR+SHK+AERKRR EMK LFD+L + LP     K+SKWEIL+KA+E+I  L   
Sbjct: 353 YSRTPELRVSHKMAERKRRSEMKTLFDDLNNILPNSPGSKSSKWEILTKAIEYIRNLTRA 412

Query: 535 QDEMAKEVESLR 546
                +E+  LR
Sbjct: 413 HQNAREEISRLR 424



>gi|451850014|gb|EMD63317.1| hypothetical protein COCSADRAFT_340084 [Bipolaris sorokiniana
           ND90Pr]
          Length = 509

 Score = 88.2 bits (217), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 40/72 (55%), Positives = 51/72 (70%)

Query: 475 YSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLKHN 534
           YSR+PELR+SHK+AERKRR EMK LFD+L + LP     K+SKWEIL+KA+E+I  L   
Sbjct: 331 YSRTPELRVSHKMAERKRRSEMKTLFDDLNNILPNSPGSKSSKWEILTKAIEYIRNLTRA 390

Query: 535 QDEMAKEVESLR 546
                +E+  LR
Sbjct: 391 HQTAREEIGRLR 402



>gi|302411718|ref|XP_003003692.1| conserved hypothetical protein [Verticillium albo-atrum VaMs.102]
 gi|261357597|gb|EEY20025.1| conserved hypothetical protein [Verticillium albo-atrum VaMs.102]
          Length = 357

 Score = 88.2 bits (217), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 59/86 (68%), Gaps = 7/86 (8%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAV-------E 526
           PYSR+PELR SHKLAERKRR EMKELFD+LRD +P ++  K SKWEIL+KA+       +
Sbjct: 204 PYSRTPELRKSHKLAERKRRTEMKELFDQLRDLMPQERGSKASKWEILTKAITEHQRMAD 263

Query: 527 FINTLKHNQDEMAKEVESLRQQLSVL 552
            +  +++    +A E + LR++   L
Sbjct: 264 AVRVMQNQNASIASENDQLRRENHAL 289



>gi|452001836|gb|EMD94295.1| hypothetical protein COCHEDRAFT_1192418 [Bipolaris maydis C5]
 gi|477590333|gb|ENI07407.1| hypothetical protein COCC4DRAFT_70036 [Bipolaris maydis ATCC 48331]
          Length = 507

 Score = 88.2 bits (217), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 40/72 (55%), Positives = 51/72 (70%)

Query: 475 YSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLKHN 534
           YSR+PELR+SHK+AERKRR EMK LFD+L + LP     K+SKWEIL+KA+E+I  L   
Sbjct: 331 YSRTPELRVSHKMAERKRRSEMKTLFDDLNNILPNSPGSKSSKWEILTKAIEYIRNLTRA 390

Query: 535 QDEMAKEVESLR 546
                +E+  LR
Sbjct: 391 HQTAREEIGRLR 402



>gi|83770063|dbj|BAE60198.1| unnamed protein product [Aspergillus oryzae RIB40]
          Length = 510

 Score = 88.2 bits (217), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 58/81 (71%)

Query: 473 TPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLK 532
           TPYSR+PELR++HKLAERKRR EMK+ F+ LR  LP  ++ K+SKWE L++A+E+I  L+
Sbjct: 351 TPYSRTPELRVTHKLAERKRRSEMKDCFEALRMRLPQSQNNKSSKWETLTRAIEYIGQLE 410

Query: 533 HNQDEMAKEVESLRQQLSVLK 553
                  +E + LR ++  ++
Sbjct: 411 KMLSNARRENDLLRTEVDDMR 431



>gi|494824721|gb|EON61975.1| hypothetical protein W97_01193 [Coniosporium apollinis CBS 100218]
          Length = 483

 Score = 88.2 bits (217), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 54/155 (34%), Positives = 76/155 (49%), Gaps = 11/155 (7%)

Query: 410 ARRASMPVM--TFPSRFSDPIQQDGTMPMDVDRYRAQVXXXXXXXXX---XXXXXXXGYI 464
           A R+++P    +F + F+D I  D  +PM   R    +                   G  
Sbjct: 244 AERSTIPSRQNSFATSFTDSIYTDSALPMGQKRLDDGIEGSYTHHHSLQHRSVASLQGSE 303

Query: 465 QQPA------PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKW 518
           QQP       P     YSR+PELR+SHK+AERKRR EMK LF+EL   LP     K+SKW
Sbjct: 304 QQPGAAGPYGPSGSGNYSRTPELRVSHKMAERKRRSEMKSLFEELNSILPNSPGSKSSKW 363

Query: 519 EILSKAVEFINTLKHNQDEMAKEVESLRQQLSVLK 553
           EIL+K+++ I  +    D   +E   LR   ++ +
Sbjct: 364 EILTKSIDHIKHINRAYDNSRQENTRLRSDANMCR 398



>gi|425767955|gb|EKV06505.1| hypothetical protein PDIG_77020 [Penicillium digitatum PHI26]
 gi|425783854|gb|EKV21672.1| hypothetical protein PDIP_04140 [Penicillium digitatum Pd1]
          Length = 524

 Score = 87.8 bits (216), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 41/92 (44%), Positives = 62/92 (67%), Gaps = 7/92 (7%)

Query: 465 QQPAPVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKA 524
           ++  P   TPYSR+PELR++HKLAERKRR EMK+ F+ LR  LP  ++ K+SKWE L++A
Sbjct: 369 EEDGPPGSTPYSRTPELRVTHKLAERKRRSEMKDCFEALRLRLPPGQTNKSSKWETLTRA 428

Query: 525 VEFINTL-------KHNQDEMAKEVESLRQQL 549
           +++I  L       + ++  M  E++ +R QL
Sbjct: 429 IDYIGMLEKTVTQSQRDRAVMQSEMDEMRAQL 460



>gi|238495885|ref|XP_002379178.1| HLH transcription factor (Hpa3), putative [Aspergillus flavus
           NRRL3357]
 gi|317147529|ref|XP_001822200.2| HLH transcription factor (Hpa3) [Aspergillus oryzae RIB40]
 gi|220694058|gb|EED50402.1| HLH transcription factor (Hpa3), putative [Aspergillus flavus
           NRRL3357]
 gi|391872925|gb|EIT82000.1| hypothetical protein Ao3042_00680 [Aspergillus oryzae 3.042]
          Length = 508

 Score = 87.8 bits (216), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 58/81 (71%)

Query: 473 TPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINTLK 532
           TPYSR+PELR++HKLAERKRR EMK+ F+ LR  LP  ++ K+SKWE L++A+E+I  L+
Sbjct: 349 TPYSRTPELRVTHKLAERKRRSEMKDCFEALRMRLPQSQNNKSSKWETLTRAIEYIGQLE 408

Query: 533 HNQDEMAKEVESLRQQLSVLK 553
                  +E + LR ++  ++
Sbjct: 409 KMLSNARRENDLLRTEVDDMR 429



>gi|429860568|gb|ELA35298.1| hlh transcription factor [Colletotrichum gloeosporioides Nara gc5]
          Length = 785

 Score = 87.4 bits (215), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/81 (50%), Positives = 58/81 (71%), Gaps = 7/81 (8%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAV-------E 526
           PYSR+PELR SHKLAERKRR EMKELFD+LRD +P ++  K SKWEIL+KA+       +
Sbjct: 318 PYSRTPELRKSHKLAERKRRTEMKELFDQLRDLMPQERGSKASKWEILTKAISEHQRMAD 377

Query: 527 FINTLKHNQDEMAKEVESLRQ 547
            +  ++   + + +E +++RQ
Sbjct: 378 VVRIVQGQNNTVMQENDAMRQ 398



>gi|255930937|ref|XP_002557025.1| Pc12g01260 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211581644|emb|CAP79753.1| Pc12g01260 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 541

 Score = 86.7 bits (213), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 41/92 (44%), Positives = 62/92 (67%), Gaps = 7/92 (7%)

Query: 465 QQPAPVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKA 524
           ++  P   TPYSR+PELR++HKLAERKRR EMK+ F+ LR  LP  ++ K+SKWE L++A
Sbjct: 350 EEDGPPGSTPYSRTPELRVTHKLAERKRRSEMKDCFEALRLRLPPGQTNKSSKWETLTRA 409

Query: 525 VEFINTL-------KHNQDEMAKEVESLRQQL 549
           +++I  L       + ++  M  E++ +R QL
Sbjct: 410 IDYIAMLEKTVAQSQRDRAVMQSEMDEMRAQL 441



>gi|116192347|ref|XP_001221986.1| hypothetical protein CHGG_05891 [Chaetomium globosum CBS 148.51]
 gi|88181804|gb|EAQ89272.1| hypothetical protein CHGG_05891 [Chaetomium globosum CBS 148.51]
          Length = 413

 Score = 86.3 bits (212), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/51 (74%), Positives = 45/51 (88%)

Query: 474 PYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKA 524
           PYSR+PELR+SHKLAERKRR EMKELFD+LRD +P ++  K SKWEIL+KA
Sbjct: 283 PYSRTPELRVSHKLAERKRRTEMKELFDQLRDLMPQERGSKASKWEILTKA 333



>gi|154318622|ref|XP_001558629.1| hypothetical protein BC1G_02700 [Botryotinia fuckeliana B05.10]
          Length = 482

 Score = 85.9 bits (211), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/90 (51%), Positives = 60/90 (66%), Gaps = 5/90 (5%)

Query: 468 APVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEF 527
           +P    PYSR+PELR+SHKLAERKRR EMKELF+ LRD +P ++  K SKWEIL+K  E 
Sbjct: 325 SPNNGQPYSRTPELRVSHKLAERKRRTEMKELFETLRDLMPQERGNKASKWEILTKENE- 383

Query: 528 INTLKHNQDEMAKEVESLRQQLSVLKGCSN 557
             +L+   + +  E   LR +  V +G SN
Sbjct: 384 --SLRRENNVIRLENSQLRSE--VNQGGSN 409



>gi|330928490|ref|XP_003302286.1| hypothetical protein PTT_14037 [Pyrenophora teres f. teres 0-1]
 gi|311322446|gb|EFQ89605.1| hypothetical protein PTT_14037 [Pyrenophora teres f. teres 0-1]
          Length = 470

 Score = 85.9 bits (211), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 50/114 (43%), Positives = 63/114 (55%), Gaps = 23/114 (20%)

Query: 467 PAPVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVE 526
           P P     YSR+PELR+SHK+AERKRR EMK LFD+L   LP     K+SKWE+L+K++E
Sbjct: 273 PLPPGTGSYSRTPELRVSHKMAERKRRSEMKNLFDDLNAILPNSPGNKSSKWEVLTKSIE 332

Query: 527 ---FINTLKHN-------------------QDEMA-KEVESLRQQLSVLKGCSN 557
               INT  HN                   Q + A  E ESLRQ+++ L    N
Sbjct: 333 HIKMINTSNHNLRKDLNRLQLEADAARRMPQGQQAHHETESLRQEVTALWTALN 386



>gi|189203825|ref|XP_001938248.1| conserved hypothetical protein [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187985347|gb|EDU50835.1| conserved hypothetical protein [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 448

 Score = 85.9 bits (211), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 50/114 (43%), Positives = 63/114 (55%), Gaps = 23/114 (20%)

Query: 467 PAPVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVE 526
           P P     YSR+PELR+SHK+AERKRR EMK LFD+L   LP     K+SKWE+L+K++E
Sbjct: 253 PLPPGTGSYSRTPELRVSHKMAERKRRSEMKNLFDDLNAILPNSPGNKSSKWEVLTKSIE 312

Query: 527 ---FINTLKHN-------------------QDEMA-KEVESLRQQLSVLKGCSN 557
               INT  HN                   Q + A  E ESLRQ+++ L    N
Sbjct: 313 HIKMINTSNHNLRKDLNRLQLEADTARRMPQGQQAHHETESLRQEVTALWTALN 366



>gi|406698084|gb|EKD01330.1| bHLH transcription factor-like protein [Trichosporon asahii var.
           asahii CBS 8904]
          Length = 403

 Score = 85.5 bits (210), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 47/54 (87%)

Query: 469 PVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILS 522
           P KETP+SRSPELRISHKLAERKRRKEM++LFDELRD+LP D+ +K SK  + S
Sbjct: 342 PKKETPFSRSPELRISHKLAERKRRKEMRDLFDELRDALPQDRGMKASKITMRS 395



>gi|406868017|gb|EKD21054.1| hlh transcription factor [Marssonina brunnea f. sp. 'multigermtubi'
           MB_m1]
          Length = 493

 Score = 84.3 bits (207), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 54/82 (65%)

Query: 468 APVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEF 527
           +P    PYSR+PELR+SHKLAERKRR EMK+LFD LR    V++  K SKWEILSKA+  
Sbjct: 312 SPNSSQPYSRTPELRVSHKLAERKRRLEMKDLFDNLRTLQSVERGAKASKWEILSKAITE 371

Query: 528 INTLKHNQDEMAKEVESLRQQL 549
                   D+  K++  + Q+L
Sbjct: 372 HERQTKVIDDQKKQLSRVEQRL 393



>gi|169624013|ref|XP_001805413.1| hypothetical protein SNOG_15257 [Phaeosphaeria nodorum SN15]
 gi|160705092|gb|EAT77482.2| hypothetical protein SNOG_15257 [Phaeosphaeria nodorum SN15]
          Length = 599

 Score = 82.0 bits (201), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 52/73 (71%), Gaps = 1/73 (1%)

Query: 475 YSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSK-AVEFINTLKH 533
           YSR+PELR+SHK+AERKRR EMK LFDEL   LP     K+SKWEIL+K A+E+I +L  
Sbjct: 418 YSRTPELRVSHKMAERKRRSEMKGLFDELNVILPNSPGSKSSKWEILTKSAIEYIKSLSR 477

Query: 534 NQDEMAKEVESLR 546
           + + +  E   LR
Sbjct: 478 SHEAVRVENARLR 490



>gi|325087386|gb|EGC40696.1| HLH transcription factor [Ajellomyces capsulatus H88]
          Length = 562

 Score = 81.3 bits (199), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 42/86 (48%), Positives = 57/86 (66%), Gaps = 7/86 (8%)

Query: 471 KETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEFINT 530
           +  PYSR+PELR+ +K+AERKRR EMK+ F+ LR  LP  +S K+SKWE L++A+E+I  
Sbjct: 378 RRCPYSRTPELRVFYKIAERKRRSEMKDCFELLRSRLPSSQSSKSSKWETLTRAIEYIGQ 437

Query: 531 L-------KHNQDEMAKEVESLRQQL 549
           L       +H    +  EV  LRQQL
Sbjct: 438 LEKTVQQTRHEAVTLKAEVTELRQQL 463



>gi|328854842|gb|EGG03972.1| hypothetical protein MELLADRAFT_89781 [Melampsora larici-populina
           98AG31]
          Length = 405

 Score = 80.5 bits (197), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 57/80 (71%), Gaps = 5/80 (6%)

Query: 477 RSPELRISHKLAERKRRKEMKELFDELR-----DSLPVDKSLKTSKWEILSKAVEFINTL 531
           RS +L++SHKLAERKRRKEMKELFDELR     D L  DK+ K SKWE LS+AV+F+  +
Sbjct: 306 RSSDLKVSHKLAERKRRKEMKELFDELRLAIPSDGLIGDKNPKISKWETLSRAVDFLYQV 365

Query: 532 KHNQDEMAKEVESLRQQLSV 551
           ++    + +E + ++  LS+
Sbjct: 366 QNENKILREENKRMKGMLSI 385



>gi|154270149|ref|XP_001535934.1| hypothetical protein HCAG_09151 [Ajellomyces capsulatus NAm1]
 gi|150411177|gb|EDN06565.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
          Length = 522

 Score = 79.3 bits (194), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 56/82 (68%), Gaps = 1/82 (1%)

Query: 468 APVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEF 527
           +P   TPYSR+PELR++HKLAERKRR EMK+ F+ LR  LP  +S K+SKWE L++  + 
Sbjct: 343 SPNGATPYSRTPELRVTHKLAERKRRSEMKDCFELLRSRLPSSQSSKSSKWETLTRE-KT 401

Query: 528 INTLKHNQDEMAKEVESLRQQL 549
           +   +H    +  EV  LRQQL
Sbjct: 402 VQQTRHEAVTLKAEVTELRQQL 423



>gi|225683215|gb|EEH21499.1| conserved hypothetical protein [Paracoccidioides brasiliensis Pb03]
          Length = 468

 Score = 78.6 bits (192), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 41/82 (50%), Positives = 51/82 (62%), Gaps = 1/82 (1%)

Query: 468 APVKETPYSRSPELRISHKLAERKRRKEMKELFDELRDSLPVDKSLKTSKWEILSKAVEF 527
           +P   TPYSR+PELRI+HKLAERKRR EMK+ F+ LR  LP  +S K S  E + +    
Sbjct: 293 SPNGTTPYSRTPELRITHKLAERKRRSEMKDCFELLRSRLPSSQSSK-STIEYIGQLENT 351

Query: 528 INTLKHNQDEMAKEVESLRQQL 549
           I   +H    +  EV  LRQQL
Sbjct: 352 IQQTRHETGALKAEVNDLRQQL 373