BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp1017_c0_seq1-m.76 complete 65-424(+) 120 (+)
         (119 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|403160934|ref|XP_003321347.2| hypothetical protein PGTG_02389...   163   1e-38   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|299743774|ref|XP_001835971.2| progesterone binding protein [C...   154   8e-36   Coprinopsis cinerea okayama7#130
gi|71017849|ref|XP_759155.1| hypothetical protein UM03008.1 [Ust...   153   2e-35   
gi|328851772|gb|EGG00923.1| hypothetical protein MELLADRAFT_5751...   152   2e-35   Melampsora larici-populina 98AG31
gi|358053900|dbj|GAB00033.1| hypothetical protein E5Q_06735 [Mix...   151   4e-35   Mixia osmundae IAM 14324
gi|472584927|gb|EMS22502.1| cytochrome b5 [Rhodosporidium torulo...   151   5e-35   Rhodotorula toruloides NP11
gi|388581595|gb|EIM21903.1| cytochrome b5 [Wallemia sebi CBS 633...   151   6e-35   Wallemia mellicola CBS 633.66
gi|342320319|gb|EGU12260.1| hypothetical protein RTG_01638 [Rhod...   150   8e-35   Rhodotorula toruloides ATCC 204091
gi|392579277|gb|EIW72404.1| hypothetical protein TREMEDRAFT_2676...   150   1e-34   Tremella mesenterica DSM 1558
gi|501308704|dbj|GAC97598.1| potential sterol binding protein [P...   149   2e-34   Pseudozyma hubeiensis SY62
gi|169868427|ref|XP_001840786.1| hypothetical protein CC1G_10160...   149   2e-34   Coprinopsis cinerea okayama7#130
gi|409045321|gb|EKM54802.1| hypothetical protein PHACADRAFT_2589...   149   2e-34   Phanerochaete carnosa HHB-10118-sp
gi|343429835|emb|CBQ73407.1| conserved hypothetical protein [Spo...   148   6e-34   Sporisorium reilianum SRZ2
gi|392569779|gb|EIW62952.1| progesterone binding protein [Tramet...   147   6e-34   Trametes versicolor FP-101664 SS1
gi|170115979|ref|XP_001889182.1| cytochrome b5 [Laccaria bicolor...   147   8e-34   Laccaria bicolor S238N-H82
gi|242218182|ref|XP_002474884.1| predicted protein [Postia place...   146   1e-33   Postia placenta Mad-698-R
gi|443898655|dbj|GAC75989.1| hypothetical protein PANT_19d00055 ...   145   2e-33   Moesziomyces antarcticus T-34
gi|388853878|emb|CCF52599.1| uncharacterized protein [Ustilago h...   144   6e-33   Ustilago hordei
gi|403417188|emb|CCM03888.1| predicted protein [Fibroporia radic...   144   8e-33   Fibroporia radiculosa
gi|406694732|gb|EKC98054.1| DEAD/DEAH box helicase involved in n...   144   9e-33   Trichosporon asahii var. asahii CBS 8904
gi|401885206|gb|EJT49329.1| DEAD/DEAH box helicase involved in n...   144   9e-33   Trichosporon asahii var. asahii CBS 2479
gi|392593782|gb|EIW83107.1| cytochrome b5 [Coniophora puteana RW...   144   9e-33   Coniophora puteana RWD-64-598 SS2
gi|409075680|gb|EKM76057.1| hypothetical protein AGABI1DRAFT_102...   143   1e-32   Agaricus bisporus var. burnettii JB137-S8
gi|426191817|gb|EKV41757.1| hypothetical protein AGABI2DRAFT_139...   143   2e-32   Agaricus bisporus var. bisporus H97
gi|395332821|gb|EJF65199.1| progesterone binding protein [Dichom...   143   2e-32   Dichomitus squalens LYAD-421 SS1
gi|470318761|gb|EMR10402.1| hypothetical protein PNEG_01117 [Pne...   142   2e-32   Pneumocystis murina B123
gi|345561956|gb|EGX45028.1| hypothetical protein AOL_s00173g129 ...   142   2e-32   Arthrobotrys oligospora ATCC 24927
gi|443925571|gb|ELU44378.1| Cyt-b5 domain-containing protein [Rh...   142   3e-32   Rhizoctonia solani AG-1 IA
gi|505756651|gb|EOR00801.1| Glyoxylate reductase/hydroxypyruvate...   142   4e-32   Wallemia ichthyophaga EXF-994
gi|449542755|gb|EMD33733.1| hypothetical protein CERSUDRAFT_5637...   140   1e-31   Gelatoporia subvermispora B
gi|389739826|gb|EIM81018.1| progesterone binding protein [Stereu...   139   2e-31   Stereum hirsutum FP-91666 SS1
gi|393246774|gb|EJD54282.1| cytochrome b5 [Auricularia delicata ...   139   2e-31   Auricularia subglabra TFB-10046 SS5
gi|336372131|gb|EGO00471.1| hypothetical protein SERLA73DRAFT_52...   138   4e-31   Serpula lacrymans var. lacrymans S7.3
gi|384498820|gb|EIE89311.1| hypothetical protein RO3G_14022 [Rhi...   137   7e-31   Rhizopus delemar RA 99-880
gi|353240286|emb|CCA72162.1| related to cytochrome b5-Laccaria b...   136   2e-30   Serendipita indica DSM 11827
gi|430813674|emb|CCJ28987.1| unnamed protein product [Pneumocyst...   135   3e-30   Pneumocystis jirovecii
gi|511004256|gb|EPB85632.1| hypothetical protein HMPREF1544_0762...   135   4e-30   Mucor circinelloides f. circinelloides 1006PhL
gi|405123577|gb|AFR98341.1| hypothetical protein CNAG_06116 [Cry...   133   1e-29   
gi|390600528|gb|EIN09923.1| cytochrome b5, partial [Punctularia ...   132   3e-29   Punctularia strigosozonata HHB-11173 SS5
gi|393217189|gb|EJD02678.1| progesterone binding protein [Fomiti...   132   3e-29   Fomitiporia mediterranea MF3/22
gi|169858656|ref|XP_001835972.1| progesterone binding protein [C...   131   8e-29   Coprinopsis cinerea okayama7#130
gi|296413072|ref|XP_002836241.1| hypothetical protein [Tuber mel...   129   2e-28   Tuber melanosporum Mel28
gi|212528574|ref|XP_002144444.1| progesterone binding protein, p...   129   4e-28   Talaromyces marneffei ATCC 18224
gi|242766024|ref|XP_002341091.1| progesterone binding protein, p...   128   6e-28   Talaromyces stipitatus ATCC 10500
gi|58261742|ref|XP_568281.1| sterol metabolism-related protein [...   123   2e-26   Cryptococcus neoformans var. neoformans JEC21
gi|115398369|ref|XP_001214776.1| conserved hypothetical protein ...   123   2e-26   Aspergillus terreus NIH2624
gi|119501272|ref|XP_001267393.1| progesterone binding protein, p...   122   3e-26   Aspergillus fischeri NRRL 181
gi|449305097|gb|EMD01104.1| hypothetical protein BAUCODRAFT_6095...   120   9e-26   Baudoinia panamericana UAMH 10762
gi|425781539|gb|EKV19499.1| hypothetical protein PDIG_02960 [Pen...   120   1e-25   Penicillium digitatum PHI26
gi|70994846|ref|XP_752200.1| progesterone binding protein [Asper...   120   1e-25   Aspergillus fumigatus Af293
gi|121706510|ref|XP_001271517.1| progesterone binding protein, p...   120   1e-25   Aspergillus clavatus NRRL 1
gi|321265111|ref|XP_003197272.1| sterol metabolism-related prote...   119   2e-25   Cryptococcus gattii WM276
gi|471901389|emb|CCO29950.1| putative steroid-binding protein 3 ...   119   2e-25   Rhizoctonia solani AG-1 IB
gi|134058323|emb|CAK38512.1| unnamed protein product [Aspergillu...   119   2e-25   Aspergillus niger
gi|443918264|gb|ELU38784.1| Cyt-b5 domain-containing protein [Rh...   119   2e-25   Rhizoctonia solani AG-1 IA
gi|239606560|gb|EEQ83547.1| progesterone binding protein [Ajello...   119   3e-25   Blastomyces dermatitidis ER-3
gi|317037973|ref|XP_001401420.2| progesterone binding protein [A...   118   4e-25   Aspergillus niger CBS 513.88
gi|169773977|ref|XP_001821457.1| progesterone binding protein [A...   117   8e-25   Aspergillus oryzae RIB40
gi|67528246|ref|XP_661933.1| hypothetical protein AN4329.2 [Aspe...   117   9e-25   Aspergillus nidulans FGSC A4
gi|255949668|ref|XP_002565601.1| Pc22g16880 [Penicillium chrysog...   117   1e-24   Penicillium rubens Wisconsin 54-1255
gi|261193244|ref|XP_002623028.1| progesterone binding protein [A...   116   2e-24   Blastomyces gilchristii SLH14081
gi|429855364|gb|ELA30322.1| progesterone binding protein [Collet...   115   3e-24   Colletotrichum gloeosporioides Nara gc5
gi|452987672|gb|EME87427.1| hypothetical protein MYCFIDRAFT_6241...   115   4e-24   Cercospora fijiensis CIRAD86
gi|452003349|gb|EMD95806.1| hypothetical protein COCHEDRAFT_1221...   115   5e-24   Bipolaris maydis C5
gi|396465646|ref|XP_003837431.1| similar to progesterone binding...   114   1e-23   Leptosphaeria maculans JN3
gi|494823759|gb|EON61124.1| hypothetical protein W97_00335 [Coni...   114   1e-23   Coniosporium apollinis CBS 100218
gi|398411694|ref|XP_003857185.1| hypothetical protein MYCGRDRAFT...   114   1e-23   Zymoseptoria tritici IPO323
gi|402222430|gb|EJU02497.1| progesterone binding protein [Dacryo...   113   2e-23   Dacryopinax primogenitus
gi|451856275|gb|EMD69566.1| hypothetical protein COCSADRAFT_1557...   112   3e-23   Bipolaris sorokiniana ND90Pr
gi|330935483|ref|XP_003304990.1| hypothetical protein PTT_17724 ...   112   3e-23   Pyrenophora teres f. teres 0-1
gi|452848057|gb|EME49989.1| hypothetical protein DOTSEDRAFT_1648...   112   3e-23   Dothistroma septosporum NZE10
gi|302657511|ref|XP_003020476.1| hypothetical protein TRV_05443 ...   112   5e-23   Trichophyton verrucosum HKI 0517
gi|171691947|ref|XP_001910898.1| hypothetical protein [Podospora...   111   5e-23   Podospora anserina S mat+
gi|400597209|gb|EJP64944.1| cytochrome b5-like Heme/Steroid bind...   111   6e-23   Beauveria bassiana ARSEF 2860
gi|328770667|gb|EGF80708.1| hypothetical protein BATDEDRAFT_7272...   111   6e-23   Batrachochytrium dendrobatidis JAM81
gi|407923519|gb|EKG16589.1| Cytochrome b5 [Macrophomina phaseoli...   111   6e-23   Macrophomina phaseolina MS6
gi|485922918|gb|EOD48238.1| putative progesterone binding protei...   111   6e-23   Neofusicoccum parvum UCRNP2
gi|310793674|gb|EFQ29135.1| cytochrome b5-like Heme/Steroid bind...   111   8e-23   Colletotrichum graminicola M1.001
gi|336257809|ref|XP_003343726.1| hypothetical protein SMAC_04384...   110   9e-23   Sordaria macrospora k-hell
gi|328351906|emb|CCA38305.1| V-type ATPase assembly factor PKR1 ...   110   1e-22   Komagataella phaffii CBS 7435
gi|225560419|gb|EEH08700.1| conserved hypothetical protein [Ajel...   110   1e-22   Histoplasma capsulatum G186AR
gi|154270521|ref|XP_001536115.1| progesterone binding protein [A...   110   1e-22   Histoplasma capsulatum NAm1
gi|296827792|ref|XP_002851225.1| progesterone binding protein [A...   110   1e-22   Arthroderma otae CBS 113480
gi|85101543|ref|XP_961173.1| hypothetical protein NCU04213 [Neur...   110   1e-22   Neurospora crassa OR74A
gi|302914816|ref|XP_003051219.1| predicted protein [Nectria haem...   110   1e-22   Nectria haematococca mpVI 77-13-4
gi|482810074|gb|EOA86880.1| hypothetical protein SETTUDRAFT_1154...   110   2e-22   Setosphaeria turcica Et28A
gi|477530073|gb|ENH81815.1| progesterone binding protein [Collet...   110   2e-22   Colletotrichum orbiculare MAFF 240422
gi|512198737|gb|EPE27571.1| Cytochrome b5-like heme/steroid bind...   109   2e-22   Glarea lozoyensis ATCC 20868
gi|340923699|gb|EGS18602.1| putative heme binding protein [Chaet...   109   3e-22   Chaetomium thermophilum var. thermophilum DSM 1495
gi|225683699|gb|EEH21983.1| conserved hypothetical protein [Para...   109   3e-22   Paracoccidioides brasiliensis Pb03
gi|295665861|ref|XP_002793481.1| progesterone binding protein [P...   109   3e-22   Paracoccidioides lutzii Pb01
gi|346318737|gb|EGX88339.1| progesterone binding protein, putati...   109   3e-22   Cordyceps militaris CM01
gi|302498316|ref|XP_003011156.1| hypothetical protein ARB_02678 ...   108   4e-22   Arthroderma benhamiae CBS 112371
gi|327301715|ref|XP_003235550.1| progesterone binding protein [T...   108   4e-22   Trichophyton rubrum CBS 118892
gi|453088737|gb|EMF16777.1| cytochrome b5 [Mycosphaerella populo...   108   5e-22   Sphaerulina musiva SO2202
gi|326469987|gb|EGD93996.1| progesterone binding protein [Tricho...   108   5e-22   Trichophyton tonsurans CBS 112818
gi|169610956|ref|XP_001798896.1| hypothetical protein SNOG_08587...   108   6e-22   Parastagonospora nodorum SN15
gi|116780127|gb|ABK21560.1| unknown [Picea sitchensis]                107   8e-22   Picea sitchensis
gi|367023895|ref|XP_003661232.1| hypothetical protein MYCTH_2314...   107   9e-22   Myceliophthora thermophila ATCC 42464
gi|315056869|ref|XP_003177809.1| progesterone binding protein [A...   107   1e-21   Microsporum gypseum CBS 118893
gi|320037952|gb|EFW19888.1| progesterone binding protein [Coccid...   107   1e-21   Coccidioides posadasii str. Silveira
gi|380485331|emb|CCF39431.1| cytochrome b5-like Heme/Steroid bin...   107   2e-21   Colletotrichum higginsianum
gi|116785384|gb|ABK23702.1| unknown [Picea sitchensis] >gi|11678...   106   2e-21   Picea sitchensis
gi|358395749|gb|EHK45136.1| hypothetical protein TRIATDRAFT_2998...   106   2e-21   Trichoderma atroviride IMI 206040
gi|475665657|gb|EMT63449.1| Putative steroid-binding protein 3 [...   105   5e-21   Fusarium oxysporum f. sp. cubense race 4
gi|225430523|ref|XP_002285572.1| PREDICTED: uncharacterized prot...   105   6e-21   
gi|342887537|gb|EGU87019.1| hypothetical protein FOXB_02413 [Fus...   105   6e-21   Fusarium oxysporum Fo5176
gi|46137289|ref|XP_390336.1| hypothetical protein FG10160.1 [Fus...   104   9e-21   
gi|470111483|ref|XP_004291977.1| PREDICTED: probable steroid-bin...   103   1e-20   Fragaria vesca subsp. vesca
gi|399171110|emb|CCE28204.1| uncharacterized protein CPUR_01678 ...   103   2e-20   Claviceps purpurea 20.1
gi|500255984|gb|EON99313.1| putative progesterone binding protei...   102   3e-20   Phaeoacremonium minimum UCRPA7
gi|50553850|ref|XP_504336.1| YALI0E24079p [Yarrowia lipolytica] ...   102   3e-20   Yarrowia lipolytica CLIB122
gi|378729308|gb|EHY55767.1| hypothetical protein HMPREF1120_0389...   102   4e-20   Exophiala dermatitidis NIH/UT8656
gi|440631926|gb|ELR01845.1| hypothetical protein GMDG_05032 [Geo...   102   4e-20   Pseudogymnoascus destructans 20631-21
gi|460398711|ref|XP_004244897.1| PREDICTED: probable steroid-bin...   101   5e-20   Solanum lycopersicum
gi|501755768|emb|CCG81081.1| putative Progesterone binding prote...   101   6e-20   Taphrina deformans PYCC 5710
gi|508782031|gb|EOY29287.1| Membrane-associated progesterone bin...   101   7e-20   Theobroma cacao [chocolate]
gi|472242835|gb|EMR87514.1| putative progesterone binding protei...   101   7e-20   Botrytis cinerea BcDW1
gi|482564008|gb|EOA28198.1| hypothetical protein CARUB_v10024390...   100   1e-19   Capsella rubella
gi|462422949|gb|EMJ27212.1| hypothetical protein PRUPE_ppa013839...   100   1e-19   Prunus persica
gi|471572642|gb|EMR71027.1| putative progesterone binding protei...    99   3e-19   Eutypa lata UCREL1
gi|159162523|pdb|1J03|A Chain A, Solution Structure Of A Putativ...    99   3e-19   Arabidopsis thaliana [mouse-ear cress]
gi|303316408|ref|XP_003068206.1| Cytochrome b5-like Heme/Steroid...    99   3e-19   Coccidioides posadasii C735 delta SOWgp
gi|347828767|emb|CCD44464.1| similar to progesterone binding pro...    99   3e-19   Botrytis cinerea T4
gi|320592074|gb|EFX04513.1| progesterone-binding protein [Grosma...    99   3e-19   Grosmannia clavigera kw1407
gi|15224648|ref|NP_180066.1| membrane-associated progesterone bi...    99   3e-19   Arabidopsis thaliana [mouse-ear cress]
gi|48425750|pdb|1T0G|A Chain A, Hypothetical Protein At2g24940.1...    99   3e-19   Arabidopsis thaliana [mouse-ear cress]
gi|297821855|ref|XP_002878810.1| membrane-associated progesteron...    99   3e-19   Arabidopsis lyrata subsp. lyrata
gi|406867867|gb|EKD20904.1| cytochrome b5-like Heme/Steroid bind...    99   4e-19   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|367036683|ref|XP_003648722.1| hypothetical protein THITE_2106...    99   5e-19   Thielavia terrestris NRRL 8126
gi|189205845|ref|XP_001939257.1| conserved hypothetical protein ...    99   5e-19   Pyrenophora tritici-repentis Pt-1C-BFP
gi|53748439|emb|CAH59414.1| hypothetical protein [Plantago major]      98   6e-19   Plantago major [cart-track plant]
gi|340517441|gb|EGR47685.1| predicted protein [Trichoderma reese...    98   9e-19   Trichoderma reesei QM6a
gi|255548688|ref|XP_002515400.1| steroid binding protein, putati...    97   1e-18   Ricinus communis
gi|389635765|ref|XP_003715535.1| hypothetical protein MGG_12396 ...    97   1e-18   Magnaporthe oryzae 70-15
gi|470443171|ref|XP_004339620.1| cytochrome b-like heme/steroid ...    97   1e-18   Acanthamoeba castellanii str. Neff
gi|302421676|ref|XP_003008668.1| progesterone binding protein [V...    96   3e-18   Verticillium alfalfae VaMs.102
gi|485617628|gb|EOD14803.1| hypothetical protein EMIHUDRAFT_4260...    96   3e-18   Emiliania huxleyi CCMP1516
gi|357465989|ref|XP_003603279.1| hypothetical protein MTR_3g1058...    96   3e-18   Medicago truncatula
gi|4960154|gb|AAD34615.1|AF153283_1 putative progesterone-bindin...    95   6e-18   Arabidopsis thaliana [mouse-ear cress]
gi|346974856|gb|EGY18308.1| progesterone binding protein [Vertic...    95   7e-18   Verticillium dahliae VdLs.17
gi|412988370|emb|CCO17706.1| predicted protein [Bathycoccus pras...    95   8e-18   Bathycoccus prasinos
gi|125543658|gb|EAY89797.1| hypothetical protein OsI_11345 [Oryz...    95   8e-18   Oryza sativa Indica Group [Indian rice]
gi|115452713|ref|NP_001049957.1| Os03g0321000 [Oryza sativa Japo...    95   8e-18   
gi|402081993|gb|EJT77138.1| hypothetical protein GGTG_07050 [Gae...    95   8e-18   Gaeumannomyces graminis var. tritici R3-111a-1
gi|15229044|ref|NP_190458.1| membrane-associated progesterone bi...    95   8e-18   Arabidopsis thaliana [mouse-ear cress]
gi|474201637|gb|EMS58506.1| Membrane steroid-binding protein 2 [...    94   9e-18   Triticum urartu
gi|224143346|ref|XP_002324923.1| predicted protein [Populus tric...    94   1e-17   Populus trichocarpa [western balsam poplar]
gi|297816096|ref|XP_002875931.1| membrane-associated progesteron...    94   1e-17   Arabidopsis lyrata subsp. lyrata
gi|358388693|gb|EHK26286.1| hypothetical protein TRIVIDRAFT_8631...    94   1e-17   Trichoderma virens Gv29-8
gi|303279859|ref|XP_003059222.1| predicted protein [Micromonas p...    94   1e-17   Micromonas pusilla CCMP1545
gi|388491690|gb|AFK33911.1| unknown [Lotus japonicus] >gi|388497...    94   1e-17   Lotus japonicus
gi|326487846|dbj|BAJ89762.1| predicted protein [Hordeum vulgare ...    94   1e-17   Hordeum vulgare subsp. vulgare [barley]
gi|224092625|ref|XP_002309686.1| predicted protein [Populus tric...    94   1e-17   Populus trichocarpa [western balsam poplar]
gi|156056068|ref|XP_001593958.1| conserved hypothetical protein ...    94   1e-17   Sclerotinia sclerotiorum 1980 UF-70
gi|357112465|ref|XP_003558029.1| PREDICTED: membrane steroid-bin...    94   1e-17   Brachypodium distachyon [annual false brome]
gi|353248330|emb|CCA77345.1| hypothetical protein PIIN_11322 [Pi...    94   2e-17   Serendipita indica DSM 11827
gi|356514883|ref|XP_003526131.1| PREDICTED: probable steroid-bin...    93   2e-17   Glycine max [soybeans]
gi|475581984|gb|EMT18994.1| Putative steroid-binding protein 3 [...    93   2e-17   Aegilops tauschii
gi|384252282|gb|EIE25758.1| hypothetical protein COCSUDRAFT_4636...    93   2e-17   Coccomyxa subellipsoidea C-169
gi|195635483|gb|ACG37210.1| membrane steroid-binding protein 1 [...    93   2e-17   Zea mays [maize]
gi|225470692|ref|XP_002262780.1| PREDICTED: membrane steroid-bin...    93   2e-17   Vitis vinifera
gi|326497383|dbj|BAK02276.1| predicted protein [Hordeum vulgare ...    93   3e-17   Hordeum vulgare subsp. vulgare [barley]
gi|357146902|ref|XP_003574152.1| PREDICTED: membrane steroid-bin...    93   3e-17   Brachypodium distachyon [annual false brome]
gi|449441858|ref|XP_004138699.1| PREDICTED: probable steroid-bin...    93   3e-17   Cucumis sativus [cucumbers]
gi|449441856|ref|XP_004138698.1| PREDICTED: probable steroid-bin...    92   3e-17   Cucumis sativus [cucumbers]
gi|357497309|ref|XP_003618943.1| Membrane steroid-binding protei...    92   4e-17   Medicago truncatula
gi|168022605|ref|XP_001763830.1| predicted protein [Physcomitrel...    92   4e-17   Physcomitrella patens
gi|242063358|ref|XP_002452968.1| hypothetical protein SORBIDRAFT...    92   5e-17   Sorghum bicolor [broomcorn]
gi|302835497|ref|XP_002949310.1| hypothetical protein VOLCADRAFT...    92   5e-17   Volvox carteri f. nagariensis
gi|326510959|dbj|BAJ91827.1| predicted protein [Hordeum vulgare ...    92   5e-17   Hordeum vulgare subsp. vulgare [barley]
gi|326494410|dbj|BAJ90474.1| predicted protein [Hordeum vulgare ...    92   5e-17   Hordeum vulgare subsp. vulgare [barley]
gi|242063148|ref|XP_002452863.1| hypothetical protein SORBIDRAFT...    92   6e-17   Sorghum bicolor [broomcorn]
gi|222624834|gb|EEE58966.1| hypothetical protein OsJ_10653 [Oryz...    92   6e-17   Oryza sativa Japonica Group [Japonica rice]
gi|508775908|gb|EOY23164.1| Steroid binding protein, putative [T...    92   6e-17   Theobroma cacao [chocolate]
gi|195627742|gb|ACG35701.1| membrane steroid-binding protein 1 [...    92   7e-17   Zea mays [maize]
gi|460377193|ref|XP_004234379.1| PREDICTED: membrane steroid-bin...    91   7e-17   Solanum lycopersicum
gi|115447533|ref|NP_001047546.1| Os02g0640300 [Oryza sativa Japo...    91   7e-17   
gi|356507182|ref|XP_003522349.1| PREDICTED: probable steroid-bin...    91   7e-17   Glycine max [soybeans]
gi|389747213|gb|EIM88392.1| cytochrome b5 [Stereum hirsutum FP-9...    91   7e-17   Stereum hirsutum FP-91666 SS1
gi|302815305|ref|XP_002989334.1| hypothetical protein SELMODRAFT...    91   8e-17   Selaginella moellendorffii
gi|502132503|ref|XP_004501392.1| PREDICTED: probable steroid-bin...    91   8e-17   Cicer arietinum [garbanzo]
gi|168014364|ref|XP_001759722.1| predicted protein [Physcomitrel...    91   8e-17   Physcomitrella patens
gi|224134737|ref|XP_002321894.1| predicted protein [Populus tric...    91   9e-17   Populus trichocarpa [western balsam poplar]
gi|149245164|ref|XP_001527116.1| conserved hypothetical protein ...    91   1e-16   Lodderomyces elongisporus NRRL YB-4239
gi|482560501|gb|EOA24692.1| hypothetical protein CARUB_v10017968...    91   1e-16   Capsella rubella
gi|255539487|ref|XP_002510808.1| steroid binding protein, putati...    91   1e-16   Ricinus communis
gi|226499414|ref|NP_001146971.1| membrane steroid-binding protei...    91   1e-16   Zea mays [maize]
gi|502091804|ref|XP_004489639.1| PREDICTED: membrane steroid-bin...    91   1e-16   Cicer arietinum [garbanzo]
gi|473818556|gb|EMS46970.1| Membrane steroid-binding protein 1 [...    91   1e-16   Triticum urartu
gi|125540451|gb|EAY86846.1| hypothetical protein OsI_08230 [Oryz...    91   1e-16   Oryza sativa Indica Group [Indian rice]
gi|255078044|ref|XP_002502602.1| predicted protein [Micromonas s...    91   1e-16   Micromonas commoda
gi|388493398|gb|AFK34765.1| unknown [Lotus japonicus]                  90   2e-16   Lotus japonicus
gi|302798334|ref|XP_002980927.1| hypothetical protein SELMODRAFT...    90   2e-16   Selaginella moellendorffii
gi|115449183|ref|NP_001048371.1| Os02g0793700 [Oryza sativa Japo...    90   2e-16   
gi|224122412|ref|XP_002318827.1| predicted protein [Populus tric...    90   2e-16   Populus trichocarpa [western balsam poplar]
gi|449461239|ref|XP_004148349.1| PREDICTED: membrane steroid-bin...    90   2e-16   Cucumis sativus [cucumbers]
gi|255565313|ref|XP_002523648.1| steroid binding protein, putati...    90   2e-16   Ricinus communis
gi|224134426|ref|XP_002321821.1| predicted protein [Populus tric...    90   2e-16   
gi|224047150|ref|XP_002193322.1| PREDICTED: neudesin [Taeniopygi...    89   3e-16   Taeniopygia guttata
gi|115482798|ref|NP_001064992.1| Os10g0502500 [Oryza sativa Japo...    89   3e-16   
gi|357137401|ref|XP_003570289.1| PREDICTED: probable steroid-bin...    89   3e-16   Brachypodium distachyon [annual false brome]
gi|50740326|ref|XP_419430.1| PREDICTED: neudesin isoform X2 [Gal...    89   3e-16   Gallus gallus [bantam]
gi|168007434|ref|XP_001756413.1| predicted protein [Physcomitrel...    89   3e-16   Physcomitrella patens
gi|356559831|ref|XP_003548200.1| PREDICTED: membrane steroid-bin...    89   3e-16   Glycine max [soybeans]
gi|356571342|ref|XP_003553837.1| PREDICTED: membrane steroid-bin...    89   4e-16   Glycine max [soybeans]
gi|508773955|gb|EOY21211.1| Steroid binding protein, putative [T...    89   4e-16   Theobroma cacao [chocolate]
gi|384251213|gb|EIE24691.1| cytochrome b5 [Coccomyxa subellipsoi...    89   4e-16   Coccomyxa subellipsoidea C-169
gi|238882324|gb|EEQ45962.1| conserved hypothetical protein [Cand...    89   4e-16   Candida albicans WO-1
gi|242041099|ref|XP_002467944.1| hypothetical protein SORBIDRAFT...    89   4e-16   Sorghum bicolor [broomcorn]
gi|307108876|gb|EFN57115.1| hypothetical protein CHLNCDRAFT_3493...    89   4e-16   Chlorella variabilis
gi|470144928|ref|XP_004308098.1| PREDICTED: membrane steroid-bin...    89   5e-16   Fragaria vesca subsp. vesca
gi|217074140|gb|ACJ85430.1| unknown [Medicago truncatula] >gi|38...    89   5e-16   Medicago truncatula
gi|388516269|gb|AFK46196.1| unknown [Medicago truncatula]              89   6e-16   Medicago truncatula
gi|482549779|gb|EOA13973.1| hypothetical protein CARUB_v10027102...    88   6e-16   Capsella rubella
gi|149391095|gb|ABR25565.1| membrane steroid-binding protein 1 [...    88   6e-16   Oryza sativa Indica Group [Indian rice]
gi|297792547|ref|XP_002864158.1| hypothetical protein ARALYDRAFT...    88   7e-16   Arabidopsis lyrata subsp. lyrata
gi|255724644|ref|XP_002547251.1| hypothetical protein CTRG_01557...    88   7e-16   Candida tropicalis MYA-3404
gi|462414884|gb|EMJ19621.1| hypothetical protein PRUPE_ppa011573...    88   7e-16   Prunus persica
gi|125575313|gb|EAZ16597.1| hypothetical protein OsJ_32072 [Oryz...    88   7e-16   Oryza sativa Japonica Group [Japonica rice]
gi|242034049|ref|XP_002464419.1| hypothetical protein SORBIDRAFT...    88   9e-16   Sorghum bicolor [broomcorn]
gi|358060653|dbj|GAA93649.1| hypothetical protein E5Q_00294 [Mix...    88   9e-16   Mixia osmundae IAM 14324
gi|462398132|gb|EMJ03800.1| hypothetical protein PRUPE_ppa011700...    87   1e-15   Prunus persica
gi|308804353|ref|XP_003079489.1| COG1587: Uroporphyrinogen-III s...    87   1e-15   Ostreococcus tauri
gi|432941239|ref|XP_004082828.1| PREDICTED: neudesin-like [Oryzi...    87   1e-15   Oryzias latipes [Japanese rice fish]
gi|452824869|gb|EME31869.1| heme binding protein [Galdieria sulp...    87   1e-15   Galdieria sulphuraria
gi|4960156|gb|AAD34616.1|AF153284_1 putative progesterone-bindin...    87   1e-15   Arabidopsis thaliana [mouse-ear cress]
gi|115482800|ref|NP_001064993.1| Os10g0502600 [Oryza sativa Japo...    87   1e-15   
gi|125532551|gb|EAY79116.1| hypothetical protein OsI_34222 [Oryz...    87   1e-15   Oryza sativa Indica Group [Indian rice]
gi|15242943|ref|NP_200037.1| membrane-associated progesterone bi...    87   1e-15   Arabidopsis thaliana [mouse-ear cress]
gi|226499280|ref|NP_001149328.1| membrane steroid-binding protei...    87   1e-15   Zea mays [maize]
gi|356575951|ref|XP_003556099.1| PREDICTED: membrane steroid-bin...    87   1e-15   Glycine max [soybeans]
gi|502175275|ref|XP_004515701.1| PREDICTED: membrane steroid-bin...    87   2e-15   Cicer arietinum [garbanzo]
gi|475612781|gb|EMT28523.1| Membrane steroid-binding protein 2 [...    87   2e-15   Aegilops tauschii
gi|460390223|ref|XP_004240738.1| PREDICTED: membrane steroid-bin...    87   2e-15   Solanum lycopersicum
gi|241951516|ref|XP_002418480.1| damage response protein, putati...    87   2e-15   Candida dubliniensis CD36
gi|334188336|ref|NP_001190521.1| membrane-associated progesteron...    87   2e-15   Arabidopsis thaliana [mouse-ear cress]
gi|168030703|ref|XP_001767862.1| predicted protein [Physcomitrel...    87   2e-15   Physcomitrella patens
gi|224284631|gb|ACN40048.1| unknown [Picea sitchensis] >gi|22428...    87   2e-15   Picea sitchensis
gi|449017889|dbj|BAM81291.1| similar to steroid binding protein ...    87   2e-15   Cyanidioschyzon merolae strain 10D
gi|116784123|gb|ABK23222.1| unknown [Picea sitchensis]                 87   2e-15   Picea sitchensis
gi|356535885|ref|XP_003536473.1| PREDICTED: membrane steroid-bin...    86   2e-15   Glycine max [soybeans]
gi|356530872|ref|XP_003534003.1| PREDICTED: membrane steroid-bin...    86   2e-15   
gi|502119335|ref|XP_004496583.1| PREDICTED: membrane steroid-bin...    86   3e-15   Cicer arietinum [garbanzo]
gi|383851882|ref|XP_003701460.1| PREDICTED: membrane-associated ...    86   3e-15   Megachile rotundata
gi|460383640|ref|XP_004237527.1| PREDICTED: membrane steroid-bin...    86   3e-15   Solanum lycopersicum
gi|213406764|ref|XP_002174153.1| membrane-associated progesteron...    86   3e-15   
gi|474222343|gb|EMS59327.1| Membrane steroid-binding protein 1 [...    86   3e-15   Triticum urartu
gi|470147697|ref|XP_004309417.1| PREDICTED: membrane steroid-bin...    86   4e-15   
gi|194701446|gb|ACF84807.1| unknown [Zea mays]                         86   4e-15   Zea mays [maize]
gi|413937967|gb|AFW72518.1| hypothetical protein ZEAMMB73_436072...    86   4e-15   Zea mays [maize]
gi|226494955|ref|NP_001150181.1| membrane steroid-binding protei...    86   4e-15   Zea mays [maize]
gi|222623828|gb|EEE57960.1| hypothetical protein OsJ_08695 [Oryz...    85   5e-15   Oryza sativa Japonica Group [Japonica rice]
gi|195640730|gb|ACG39833.1| membrane steroid-binding protein 1 [...    85   5e-15   Zea mays [maize]
gi|302783431|ref|XP_002973488.1| hypothetical protein SELMODRAFT...    85   5e-15   Selaginella moellendorffii
gi|281207283|gb|EFA81466.1| hypothetical protein PPL_05454 [Poly...    85   5e-15   Polysphondylium pallidum PN500
gi|255078046|ref|XP_002502603.1| predicted protein [Micromonas s...    85   5e-15   Micromonas commoda
gi|475529271|gb|EMT07748.1| Membrane steroid-binding protein 2 [...    85   6e-15   Aegilops tauschii
gi|470236950|ref|XP_004350428.1| cytochrome b5 domain-containing...    85   6e-15   Dictyostelium fasciculatum
gi|449437656|ref|XP_004136607.1| PREDICTED: membrane steroid-bin...    85   6e-15   Cucumis sativus [cucumbers]
gi|474166585|gb|EMS57439.1| Membrane steroid-binding protein 2 [...    85   7e-15   Triticum urartu
gi|392593139|gb|EIW82465.1| cytochrome b5 [Coniophora puteana RW...    85   7e-15   Coniophora puteana RWD-64-598 SS2
gi|159463878|ref|XP_001690169.1| predicted protein [Chlamydomona...    85   7e-15   Chlamydomonas reinhardtii
gi|164660076|ref|XP_001731161.1| hypothetical protein MGL_1344 [...    85   8e-15   Malassezia globosa CBS 7966
gi|384494621|gb|EIE85112.1| hypothetical protein RO3G_09822 [Rhi...    85   8e-15   Rhizopus delemar RA 99-880
gi|307136132|gb|ADN33977.1| steroid binding protein [Cucumis mel...    85   8e-15   Cucumis melo subsp. melo
gi|302783989|ref|XP_002973767.1| hypothetical protein SELMODRAFT...    85   8e-15   Selaginella moellendorffii
gi|408390095|gb|EKJ69506.1| hypothetical protein FPSE_10331 [Fus...    85   8e-15   Fusarium pseudograminearum CS3096
gi|225681596|gb|EEH19880.1| membrane-associated progesterone rec...    85   8e-15   
gi|474259176|gb|EMS60465.1| Membrane steroid-binding protein 2 [...    84   9e-15   Triticum urartu
gi|146416939|ref|XP_001484439.1| hypothetical protein PGUG_03820...    84   1e-14   Meyerozyma guilliermondii ATCC 6260
gi|326495146|dbj|BAJ85669.1| predicted protein [Hordeum vulgare ...    84   1e-14   Hordeum vulgare subsp. vulgare [barley]
gi|226288738|gb|EEH44250.1| membrane-associated progesterone rec...    84   1e-14   Paracoccidioides brasiliensis Pb18
gi|82780762|gb|ABB90550.1| putative steroid membrane binding pro...    84   1e-14   Triticum aestivum [Canadian hard winter wheat]
gi|46111753|ref|XP_382934.1| hypothetical protein FG02758.1 [Fus...    84   1e-14   
gi|357498319|ref|XP_003619448.1| Membrane steroid-binding protei...    84   1e-14   Medicago truncatula
gi|303317262|ref|XP_003068633.1| Cytochrome b5-like Heme/Steroid...    84   1e-14   Coccidioides posadasii C735 delta SOWgp
gi|126307049|ref|XP_001374471.1| PREDICTED: neudesin-like [Monod...    84   1e-14   Monodelphis domestica
gi|302788091|ref|XP_002975815.1| hypothetical protein SELMODRAFT...    84   1e-14   Selaginella moellendorffii
gi|217072942|gb|ACJ84831.1| unknown [Medicago truncatula]              84   1e-14   
gi|126330600|ref|XP_001365574.1| PREDICTED: membrane-associated ...    84   1e-14   
gi|119187123|ref|XP_001244168.1| hypothetical protein CIMG_03609...    84   2e-14   
gi|326429374|gb|EGD74944.1| SP2 protein [Salpingoeca sp. ATCC 50...    84   2e-14   
gi|149041043|gb|EDL95000.1| neuron derived neurotrophic factor, ...    84   2e-14   
gi|378727089|gb|EHY53548.1| dihydrofolate reductase [Exophiala d...    84   2e-14   
gi|412986128|emb|CCO17328.1| predicted protein [Bathycoccus pras...    83   2e-14   
gi|330914462|ref|XP_003296650.1| hypothetical protein PTT_06796 ...    83   2e-14   
gi|50811823|ref|NP_001002851.1| neudesin precursor [Rattus norve...    83   2e-14   
gi|339240867|ref|XP_003376359.1| cytochrome b5 domain-containing...    83   2e-14   
gi|290992206|ref|XP_002678725.1| predicted protein [Naegleria gr...    83   2e-14   
gi|258563732|ref|XP_002582611.1| damage response protein 1 [Unci...    83   2e-14   
gi|145346717|ref|XP_001417830.1| predicted protein [Ostreococcus...    83   2e-14   
gi|159471179|ref|XP_001693734.1| predicted protein [Chlamydomona...    83   3e-14   
gi|242782518|ref|XP_002480016.1| DNA damage response protein (Da...    83   3e-14   
gi|452989010|gb|EME88765.1| hypothetical protein MYCFIDRAFT_8013...    83   3e-14   
gi|357146905|ref|XP_003574153.1| PREDICTED: membrane steroid-bin...    83   3e-14   
gi|260781189|ref|XP_002585704.1| hypothetical protein BRAFLDRAFT...    83   3e-14   
gi|156053289|ref|XP_001592571.1| hypothetical protein SS1G_06812...    83   3e-14   
gi|116195698|ref|XP_001223661.1| hypothetical protein CHGG_04447...    82   4e-14   
gi|409079889|gb|EKM80250.1| hypothetical protein AGABI1DRAFT_113...    82   4e-14   
gi|85068249|ref|XP_962140.1| hypothetical protein NCU07286 [Neur...    82   4e-14   
gi|149641531|ref|XP_001509736.1| PREDICTED: neudesin-like [Ornit...    82   4e-14   
gi|392568976|gb|EIW62150.1| cytochrome b5 [Trametes versicolor F...    82   4e-14   
gi|498932025|ref|XP_004540076.1| PREDICTED: neudesin-like [Mayla...    82   4e-14   
gi|348510957|ref|XP_003443011.1| PREDICTED: neudesin-like [Oreoc...    82   5e-14   
gi|13384818|ref|NP_079700.1| neudesin precursor [Mus musculus] >...    82   5e-14   
gi|507627313|ref|XP_004626911.1| PREDICTED: neudesin [Octodon de...    82   5e-14   
gi|451996763|gb|EMD89229.1| hypothetical protein COCHEDRAFT_1032...    82   6e-14   
gi|390601420|gb|EIN10814.1| cytochrome b5 [Punctularia strigosoz...    82   6e-14   
gi|471561758|gb|EMR63448.1| putative membrane-associated progest...    82   6e-14   
gi|66812042|ref|XP_640200.1| cytochrome b5 domain-containing pro...    82   6e-14   
gi|477587974|gb|ENI05054.1| hypothetical protein COCC4DRAFT_1690...    82   7e-14   
gi|482805689|gb|EOA82775.1| hypothetical protein SETTUDRAFT_3430...    82   7e-14   
gi|255936869|ref|XP_002559461.1| Pc13g10390 [Penicillium chrysog...    81   7e-14   
gi|255943548|ref|XP_002562542.1| Pc19g00540 [Penicillium chrysog...    81   7e-14   
gi|225556636|gb|EEH04924.1| membrane-associated progesterone rec...    81   8e-14   
gi|189205332|ref|XP_001939001.1| membrane-associated progesteron...    81   8e-14   
gi|443686834|gb|ELT89976.1| hypothetical protein CAPTEDRAFT_2275...    81   8e-14   
gi|406860141|gb|EKD13201.1| membrane-associated progesterone rec...    81   8e-14   
gi|154284566|ref|XP_001543078.1| conserved hypothetical protein ...    81   8e-14   
gi|459373507|gb|EMG50682.1| hypothetical protein G210_1651 [Cand...    81   8e-14   
gi|342874558|gb|EGU76560.1| hypothetical protein FOXB_12934 [Fus...    81   9e-14   
gi|327351323|gb|EGE80180.1| membrane-associated progesterone rec...    81   1e-13   
gi|393246515|gb|EJD54024.1| cytochrome b5 [Auricularia delicata ...    81   1e-13   
gi|261191230|ref|XP_002622023.1| DNA damage response protein [Aj...    81   1e-13   
gi|475673845|gb|EMT70956.1| Damage response protein 1 [Fusarium ...    81   1e-13   
gi|511962527|ref|XP_004799439.1| PREDICTED: neudesin [Mustela pu...    81   1e-13   
gi|322711644|gb|EFZ03217.1| membrane-associated progesterone rec...    80   1e-13   
gi|504132206|ref|XP_004578719.1| PREDICTED: neudesin [Ochotona p...    80   1e-13   
gi|470136270|ref|XP_004303919.1| PREDICTED: neuferricin-like [Fr...    80   1e-13   
gi|460396106|ref|XP_004243620.1| PREDICTED: neuferricin-like [So...    80   1e-13   
gi|389608589|dbj|BAM17904.1| membrane steroid binding protein [P...    80   1e-13   
gi|295670852|ref|XP_002795973.1| membrane-associated progesteron...    80   1e-13   
gi|71896009|ref|NP_001025625.1| neudesin neurotrophic factor pre...    80   1e-13   
gi|156400981|ref|XP_001639070.1| predicted protein [Nematostella...    80   2e-13   
gi|452839216|gb|EME41155.1| hypothetical protein DOTSEDRAFT_5506...    80   2e-13   
gi|302754134|ref|XP_002960491.1| hypothetical protein SELMODRAFT...    80   2e-13   
gi|212527078|ref|XP_002143696.1| DNA damage response protein (Da...    80   2e-13   
gi|367021998|ref|XP_003660284.1| hypothetical protein MYCTH_2314...    80   2e-13   
gi|507575588|ref|XP_004671339.1| PREDICTED: uncharacterized prot...    80   2e-13   
gi|347975979|ref|XP_003437319.1| unnamed protein product [Podosp...    80   2e-13   
gi|156713477|ref|NP_001096144.1| neuferricin precursor [Danio re...    80   2e-13   
gi|223974645|gb|ACN31510.1| unknown [Zea mays]                         80   2e-13   
gi|298711224|emb|CBJ32444.1| conserved unknown protein [Ectocarp...    80   2e-13   
gi|83767620|dbj|BAE57759.1| unnamed protein product [Aspergillus...    80   2e-13   
gi|302844841|ref|XP_002953960.1| hypothetical protein VOLCADRAFT...    80   2e-13   
gi|410930299|ref|XP_003978536.1| PREDICTED: neudesin-like [Takif...    80   2e-13   
gi|388515493|gb|AFK45808.1| unknown [Medicago truncatula]              80   2e-13   
gi|308229597|gb|ADO24216.1| membrane-associated progesterone rec...    80   2e-13   
gi|389611015|dbj|BAM19118.1| membrane steroid binding protein [P...    80   2e-13   
gi|402226423|gb|EJU06483.1| cytochrome b5, partial [Dacryopinax ...    80   2e-13   
gi|169609719|ref|XP_001798278.1| hypothetical protein SNOG_07951...    80   2e-13   
gi|330802491|ref|XP_003289250.1| hypothetical protein DICPUDRAFT...    80   2e-13   
gi|505839133|ref|XP_004613096.1| PREDICTED: neudesin [Sorex aran...    80   2e-13   
gi|494827916|gb|EON64812.1| hypothetical protein W97_04045 [Coni...    80   2e-13   
gi|395330666|gb|EJF63049.1| cytochrome b5 [Dichomitus squalens L...    80   2e-13   
gi|302767626|ref|XP_002967233.1| hypothetical protein SELMODRAFT...    80   2e-13   
gi|119491829|ref|XP_001263409.1| DNA damage response protein (Da...    80   3e-13   
gi|302411932|ref|XP_003003799.1| membrane-associated progesteron...    80   3e-13   
gi|238486988|ref|XP_002374732.1| DNA damage response protein (Da...    79   3e-13   
gi|336270342|ref|XP_003349930.1| hypothetical protein SMAC_00822...    79   3e-13   
gi|451847687|gb|EMD60994.1| hypothetical protein COCSADRAFT_2381...    79   3e-13   
gi|70999706|ref|XP_754570.1| DNA damage response protein (Dap1) ...    79   3e-13   
gi|254568624|ref|XP_002491422.1| hypothetical protein [Komagatae...    79   3e-13   
gi|297662034|ref|XP_002809527.1| PREDICTED: neudesin [Pongo abelii]    79   3e-13   
gi|146413577|ref|XP_001482759.1| hypothetical protein PGUG_04714...    79   3e-13   
gi|145252482|ref|XP_001397754.1| DNA damage response protein (Da...    79   3e-13   
gi|393215800|gb|EJD01291.1| cytochrome b5 [Fomitiporia mediterra...    79   3e-13   
gi|291402425|ref|XP_002717456.1| PREDICTED: neuron derived neuro...    79   3e-13   
gi|396459909|ref|XP_003834567.1| hypothetical protein LEMA_P0623...    79   4e-13   
gi|71666778|ref|XP_820345.1| hypothetical protein [Trypanosoma c...    79   4e-13   
gi|301780238|ref|XP_002925537.1| PREDICTED: hypothetical protein...    79   4e-13   
gi|426345455|ref|XP_004040428.1| PREDICTED: uncharacterized prot...    79   4e-13   
gi|115396240|ref|XP_001213759.1| conserved hypothetical protein ...    79   4e-13   
gi|19115373|ref|NP_594461.1| cytochrome P450 regulator Dap1 [Sch...    79   4e-13   
gi|354543649|emb|CCE40370.1| hypothetical protein CPAR2_104080 [...    79   4e-13   
gi|402912588|ref|XP_003918836.1| PREDICTED: neudesin [Papio anubis]    79   4e-13   
gi|109018359|ref|XP_001108201.1| PREDICTED: neudesin-like [Macac...    79   4e-13   
gi|322698626|gb|EFY90395.1| heme/steroid binding domain protein ...    79   4e-13   
gi|390460458|ref|XP_002745404.2| PREDICTED: membrane-associated ...    79   5e-13   
gi|440474117|gb|ELQ42882.1| membrane-associated progesterone rec...    79   5e-13   
gi|453083450|gb|EMF11496.1| cytochrome b5 [Mycosphaerella populo...    79   5e-13   
gi|350633671|gb|EHA22036.1| hypothetical protein ASPNIDRAFT_2105...    79   5e-13   
gi|346978503|gb|EGY21955.1| membrane-associated progesterone rec...    79   5e-13   
gi|115497398|ref|NP_001069887.1| neudesin precursor [Bos taurus]...    79   5e-13   
gi|323454085|gb|EGB09955.1| hypothetical protein AURANDRAFT_1637...    79   5e-13   
gi|219363527|ref|NP_001136676.1| uncharacterized protein LOC1002...    79   5e-13   
gi|358368407|dbj|GAA85024.1| DNA damage response protein [Asperg...    79   5e-13   
gi|7019545|ref|NP_037481.1| neudesin precursor [Homo sapiens] >g...    79   5e-13   
gi|340522141|gb|EGR52374.1| predicted protein [Trichoderma reese...    79   6e-13   
gi|466035885|ref|XP_004275317.1| PREDICTED: neudesin [Orcinus orca]    79   6e-13   
gi|449296798|gb|EMC92817.1| hypothetical protein BAUCODRAFT_3773...    78   6e-13   
gi|242041835|ref|XP_002468312.1| hypothetical protein SORBIDRAFT...    78   6e-13   
gi|345784192|ref|XP_533292.2| PREDICTED: membrane-associated pro...    78   6e-13   
gi|512188054|gb|EPE03828.1| membrane-associated progesterone rec...    78   6e-13   
gi|389642381|ref|XP_003718823.1| membrane-associated progesteron...    78   7e-13   
gi|426247626|ref|XP_004017580.1| PREDICTED: membrane-associated ...    78   7e-13   
gi|400595053|gb|EJP62878.1| membrane-associated progesterone rec...    78   7e-13   
gi|472390466|ref|XP_004414542.1| PREDICTED: neudesin [Odobenus r...    78   7e-13   
gi|68486608|ref|XP_712798.1| potential sterol binding protein [C...    78   8e-13   
gi|357113519|ref|XP_003558550.1| PREDICTED: neuferricin-like [Br...    78   8e-13   
gi|443691798|gb|ELT93549.1| hypothetical protein CAPTEDRAFT_2238...    78   8e-13   
gi|291621647|ref|NP_006311.2| membrane-associated progesterone r...    78   9e-13   
gi|126342305|ref|XP_001372255.1| PREDICTED: membrane-associated ...    78   9e-13   
gi|254573432|ref|XP_002493825.1| Heme-binding protein involved i...    78   9e-13   
gi|344277236|ref|XP_003410409.1| PREDICTED: hypothetical protein...    78   9e-13   
gi|504151762|ref|XP_004588216.1| PREDICTED: LOW QUALITY PROTEIN:...    78   9e-13   
gi|332231037|ref|XP_003264699.1| PREDICTED: membrane-associated ...    78   9e-13   
gi|149642895|ref|NP_001092530.1| membrane-associated progesteron...    78   9e-13   
gi|109075624|ref|XP_001082791.1| PREDICTED: membrane-associated ...    78   9e-13   
gi|512983238|ref|XP_004853601.1| PREDICTED: neudesin [Heteroceph...    78   9e-13   
gi|6647832|sp|O15173.1|PGRC2_HUMAN RecName: Full=Membrane-associ...    78   9e-13   
gi|512986137|ref|XP_004855017.1| PREDICTED: membrane-associated ...    78   9e-13   
gi|312374612|gb|EFR22129.1| hypothetical protein AND_15733 [Anop...    78   9e-13   
gi|281343484|gb|EFB19068.1| hypothetical protein PANDA_015058 [A...    78   1e-12   
gi|465981957|ref|XP_004265175.1| PREDICTED: membrane-associated ...    78   1e-12   
gi|410956880|ref|XP_003985064.1| PREDICTED: LOW QUALITY PROTEIN:...    78   1e-12   
gi|507659496|ref|XP_004635059.1| PREDICTED: membrane-associated ...    78   1e-12   
gi|472347880|ref|XP_004393656.1| PREDICTED: membrane-associated ...    78   1e-12   
gi|226442772|ref|NP_081834.1| membrane-associated progesterone r...    78   1e-12   
gi|56605824|ref|NP_001008375.1| membrane-associated progesterone...    78   1e-12   
gi|114595991|ref|XP_517434.2| PREDICTED: membrane-associated pro...    78   1e-12   
gi|328767980|gb|EGF78028.1| hypothetical protein BATDEDRAFT_1369...    78   1e-12   
gi|507686358|ref|XP_004711908.1| PREDICTED: membrane-associated ...    77   1e-12   
gi|397505197|ref|XP_003823157.1| PREDICTED: membrane-associated ...    77   1e-12   
gi|163310773|ref|NP_001090990.2| membrane-associated progesteron...    77   1e-12   
gi|126131205|gb|ABN79859.1| progesterone receptor membrane compo...    77   1e-12   
gi|478504525|ref|XP_004426561.1| PREDICTED: membrane-associated ...    77   1e-12   
gi|308229591|gb|ADO24213.1| membrane-associated progesterone rec...    77   1e-12   
gi|297674324|ref|XP_002815179.1| PREDICTED: membrane-associated ...    77   1e-12   
gi|511847187|ref|XP_004747982.1| PREDICTED: membrane-associated ...    77   1e-12   
gi|28386260|gb|AAH44759.1| Pgrmc2 protein, partial [Mus musculus]      77   1e-12   
gi|471415609|ref|XP_004389331.1| PREDICTED: membrane-associated ...    77   1e-12   
gi|67537538|ref|XP_662543.1| hypothetical protein AN4939.2 [Aspe...    77   1e-12   
gi|470634561|ref|XP_004322828.1| PREDICTED: LOW QUALITY PROTEIN:...    77   1e-12   
gi|291401874|ref|XP_002717291.1| PREDICTED: progesterone recepto...    77   1e-12   
gi|507543760|ref|XP_004655864.1| PREDICTED: membrane-associated ...    77   1e-12   
gi|62897831|dbj|BAD96855.1| SCIRP10-related protein variant [Hom...    77   1e-12   
gi|345571449|gb|EGX54263.1| hypothetical protein AOL_s00004g296 ...    77   1e-12   
gi|402870439|ref|XP_003899230.1| PREDICTED: membrane-associated ...    77   1e-12   
gi|308229605|gb|ADO24220.1| membrane-associated progesterone rec...    77   1e-12   
gi|488549679|ref|XP_004466306.1| PREDICTED: membrane-associated ...    77   1e-12   
gi|482551398|gb|EOA15591.1| hypothetical protein CARUB_v10005613...    77   1e-12   
gi|322693815|gb|EFY85663.1| membrane-associated progesterone rec...    77   1e-12   
gi|406605300|emb|CCH43256.1| hypothetical protein BN7_2804 [Wick...    77   1e-12   
gi|367045114|ref|XP_003652937.1| hypothetical protein THITE_2114...    77   1e-12   
gi|403271848|ref|XP_003927815.1| PREDICTED: membrane-associated ...    77   1e-12   
gi|425767282|gb|EKV05856.1| DNA damage response protein (Dap1), ...    77   1e-12   
gi|505842024|ref|XP_004614520.1| PREDICTED: membrane-associated ...    77   1e-12   
gi|156842047|ref|XP_001644393.1| hypothetical protein Kpol_1064p...    77   1e-12   
gi|308487560|ref|XP_003105975.1| CRE-TAG-131 protein [Caenorhabd...    77   1e-12   
gi|257792867|gb|ACV67263.1| progesterone receptor membrane compo...    77   1e-12   
gi|308229599|gb|ADO24217.1| membrane-associated progesterone rec...    77   2e-12   
gi|163916131|gb|AAI57473.1| LOC100137663 protein [Xenopus laevis]      77   2e-12   
gi|470459504|ref|XP_004341363.1| cytochrome b-like heme/steroid ...    77   2e-12   
gi|225704130|gb|ACO07911.1| Neudesin precursor [Oncorhynchus myk...    77   2e-12   
gi|55742288|ref|NP_001006842.1| progesterone receptor membrane c...    77   2e-12   
gi|462412045|gb|EMJ17094.1| hypothetical protein PRUPE_ppa010670...    77   2e-12   
gi|512848206|ref|XP_004886458.1| PREDICTED: membrane-associated ...    77   2e-12   
gi|389623413|ref|XP_003709360.1| hypothetical protein MGG_06654 ...    77   2e-12   
gi|310796146|gb|EFQ31607.1| cytochrome b5-like Heme/Steroid bind...    77   2e-12   
gi|504150602|ref|XP_004587693.1| PREDICTED: membrane-associated ...    77   2e-12   
gi|485918493|gb|EOD45140.1| putative dna damage response protein...    77   2e-12   
gi|407926910|gb|EKG19822.1| Cytochrome b5 [Macrophomina phaseoli...    77   2e-12   
gi|91081249|ref|XP_975650.1| PREDICTED: similar to AGAP000767-PA...    77   2e-12   
gi|154314684|ref|XP_001556666.1| hypothetical protein BC1G_04051...    77   2e-12   
gi|297804770|ref|XP_002870269.1| predicted protein [Arabidopsis ...    77   2e-12   
gi|156394141|ref|XP_001636685.1| predicted protein [Nematostella...    77   2e-12   
gi|344304015|gb|EGW34264.1| hypothetical protein SPAPADRAFT_5968...    77   2e-12   
gi|361129595|gb|EHL01498.1| putative Damage response protein 1 [...    76   2e-12   
gi|470638556|ref|XP_004324444.1| PREDICTED: LOW QUALITY PROTEIN:...    76   2e-12   
gi|388580042|gb|EIM20360.1| cytochrome b5 [Wallemia sebi CBS 633...    76   2e-12   
gi|308044601|ref|NP_001183180.1| uncharacterized protein LOC1005...    76   2e-12   
gi|224139604|ref|XP_002323190.1| predicted protein [Populus tric...    76   2e-12   
gi|448516943|ref|XP_003867674.1| hypothetical protein CORT_0B052...    76   2e-12   
gi|47522662|ref|NP_999076.1| membrane-associated progesterone re...    76   2e-12   
gi|357611202|gb|EHJ67365.1| progesterone receptor membrane compo...    76   3e-12   
gi|513021888|ref|XP_004872210.1| PREDICTED: membrane-associated ...    76   3e-12   
gi|365991451|ref|XP_003672554.1| hypothetical protein NDAI_0K012...    76   3e-12   
gi|512196109|gb|EPE24946.1| Cytochrome b5-like heme/steroid bind...    76   3e-12   
gi|512191841|gb|EPE07601.1| cytochrome b5-like heme steroid bind...    76   3e-12   
gi|500253965|gb|EON97612.1| putative membrane-associated progest...    76   3e-12   
gi|470652573|ref|XP_004329308.1| PREDICTED: membrane-associated ...    76   3e-12   
gi|378731269|gb|EHY57728.1| dihydrofolate reductase [Exophiala d...    76   3e-12   
gi|332247897|ref|XP_003273098.1| PREDICTED: neudesin [Nomascus l...    76   3e-12   
gi|466038618|ref|XP_004275850.1| PREDICTED: membrane-associated ...    76   3e-12   
gi|343428917|emb|CBQ72462.1| conserved hypothetical protein [Spo...    76   3e-12   
gi|321465270|gb|EFX76272.1| hypothetical protein DAPPUDRAFT_2140...    76   3e-12   
gi|157877936|ref|XP_001687260.1| conserved hypothetical protein ...    76   3e-12   
gi|408397622|gb|EKJ76762.1| hypothetical protein FPSE_02948 [Fus...    76   3e-12   
gi|336373213|gb|EGO01551.1| hypothetical protein SERLA73DRAFT_17...    76   3e-12   
gi|385303503|gb|EIF47571.1| dap1p [Dekkera bruxellensis AWRI1499]      76   3e-12   
gi|46123293|ref|XP_386200.1| hypothetical protein FG06024.1 [Fus...    76   3e-12   
gi|390349278|ref|XP_003727182.1| PREDICTED: neudesin-like [Stron...    76   3e-12   
gi|308229595|gb|ADO24215.1| membrane-associated progesterone rec...    76   3e-12   
gi|164657626|ref|XP_001729939.1| hypothetical protein MGL_2925 [...    76   3e-12   
gi|242001068|ref|XP_002435177.1| steroid membrane receptor Hpr6....    76   3e-12   
gi|291407855|ref|XP_002720306.1| PREDICTED: progesterone recepto...    76   3e-12   
gi|294890765|ref|XP_002773303.1| membrane associated progesteron...    76   3e-12   
gi|196006383|ref|XP_002113058.1| hypothetical protein TRIADDRAFT...    76   4e-12   


>gi|403160934|ref|XP_003321347.2| hypothetical protein PGTG_02389 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|375170457|gb|EFP76928.2| hypothetical protein PGTG_02389 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 174

 Score =  163 bits (413), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 76/112 (67%), Positives = 94/112 (83%)

Query: 8   VSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLF 67
           ++P   KLDPPKDT  T +EL+++DGSD + PIY+A+KG VFDVS+KR++YGP GSYH+F
Sbjct: 61  MTPETVKLDPPKDTVFTPQELSQFDGSDPSKPIYVAIKGIVFDVSNKREVYGPGGSYHVF 120

Query: 68  AGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           AGKD SKGLG SSL +EDAIADYS L E++LKVL+DW  FFK RYNI+GKVV
Sbjct: 121 AGKDGSKGLGQSSLKVEDAIADYSSLSEAELKVLDDWVAFFKKRYNILGKVV 172



>gi|299743774|ref|XP_001835971.2| progesterone binding protein [Coprinopsis cinerea okayama7#130]
 gi|298405811|gb|EAU85747.2| progesterone binding protein [Coprinopsis cinerea okayama7#130]
          Length = 118

 Score =  154 bits (389), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 75/112 (66%), Positives = 89/112 (79%)

Query: 8   VSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLF 67
           + PP + L PPKD P T EELA+YDGSDT+ PIY+A+KGTVFDV+ K D+YG   SY++F
Sbjct: 2   MQPPVENLAPPKDDPFTPEELAQYDGSDTSKPIYVAIKGTVFDVTRKADVYGAGKSYNIF 61

Query: 68  AGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           AGKD SKGLGMSSL  E AIADYS L E + KVL+DWY FF+ RYNIVG+VV
Sbjct: 62  AGKDGSKGLGMSSLKPEHAIADYSDLGEKERKVLDDWYSFFEKRYNIVGRVV 113



>gi|71017849|ref|XP_759155.1| hypothetical protein UM03008.1 [Ustilago maydis 521]
 gi|46098673|gb|EAK83906.1| hypothetical protein UM03008.1 [Ustilago maydis 521]
          Length = 118

 Score =  153 bits (386), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 91/119 (76%), Gaps = 3/119 (2%)

Query: 1   MNFNPSSVSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGP 60
           M  + S ++ PN    PPKD PI+ EEL +YDG+D + P+Y+AVKGTVFDVS KR+MY P
Sbjct: 1   MIAHCSDLTSPNS---PPKDDPISVEELKQYDGTDESKPVYVAVKGTVFDVSPKREMYSP 57

Query: 61  SGSYHLFAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
              YH+FAGKD S+GLGMSSL  EDA+ADYS LD+ QLKVLNDW+ ++  RYNIVGKV 
Sbjct: 58  GKGYHIFAGKDGSRGLGMSSLKPEDAVADYSTLDDKQLKVLNDWHSYYTKRYNIVGKVA 116



>gi|328851772|gb|EGG00923.1| hypothetical protein MELLADRAFT_57512 [Melampsora larici-populina
           98AG31]
          Length = 127

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 87/109 (79%)

Query: 11  PNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGK 70
           P   L+PPKD P T +EL++YDG+D + PIY+A+KG VFDVS K +MYGPSGSY +FAGK
Sbjct: 14  PIVSLNPPKDDPFTLQELSQYDGTDPSKPIYVAIKGIVFDVSSKAEMYGPSGSYRIFAGK 73

Query: 71  DASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           D SKGLG+SSL  EDAIADYS L  S++KVL+DW  FFK RYNIVG+V 
Sbjct: 74  DGSKGLGLSSLKAEDAIADYSSLGPSEMKVLDDWVTFFKKRYNIVGRVT 122



>gi|358053900|dbj|GAB00033.1| hypothetical protein E5Q_06735 [Mixia osmundae IAM 14324]
          Length = 203

 Score =  151 bits (382), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 85/109 (77%)

Query: 10  PPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAG 69
           P    LDPPKD PI+ EELAK DGS  + PIY+A+KGTVFDV+ KR+MYGP G YH+FAG
Sbjct: 92  PDGTHLDPPKDDPISLEELAKCDGSTADAPIYVAIKGTVFDVTPKREMYGPGGGYHVFAG 151

Query: 70  KDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           KD SKGLG SSL  EDA++DYS L  S+LKVL++W  +F  RYNIVGKV
Sbjct: 152 KDGSKGLGKSSLKPEDAVSDYSDLPASELKVLDEWVAYFTKRYNIVGKV 200



>gi|472584927|gb|EMS22502.1| cytochrome b5 [Rhodosporidium toruloides NP11]
          Length = 201

 Score =  151 bits (382), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 91/116 (78%), Gaps = 3/116 (2%)

Query: 6   SSVSPP---NKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSG 62
           ++VS P    K+LDPPKDTP ++EELAKYDG D N PIY+A+KG ++DVS KRDMYGP  
Sbjct: 84  ATVSAPAGDQKELDPPKDTPFSTEELAKYDGKDENTPIYVAIKGRIYDVSAKRDMYGPGC 143

Query: 63  SYHLFAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            YH+F GKDAS+ LG SSL  EDA+AD+S L++ + KVL+DW  +F+ RYNIVG+V
Sbjct: 144 GYHVFVGKDASRALGKSSLKPEDAVADWSVLNDDEKKVLDDWEKYFQKRYNIVGRV 199



>gi|388581595|gb|EIM21903.1| cytochrome b5 [Wallemia sebi CBS 633.66]
          Length = 111

 Score =  151 bits (381), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 92/112 (82%), Gaps = 1/112 (0%)

Query: 8   VSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLF 67
           + PP  +L+PPKDTPIT +EL ++DGS+ + PIY+A+KGTVFDV+ K++MYG   SY++F
Sbjct: 1   MQPPANELEPPKDTPITVDELKEHDGSN-DKPIYVAIKGTVFDVTKKKEMYGSGQSYNIF 59

Query: 68  AGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           AGKD S+GLGMSSLN EDA++DYS L E +L VL+DWY FF  RYNIVG+VV
Sbjct: 60  AGKDGSRGLGMSSLNPEDAVSDYSTLSEKELSVLDDWYKFFSKRYNIVGRVV 111



>gi|342320319|gb|EGU12260.1| hypothetical protein RTG_01638 [Rhodotorula glutinis ATCC 204091]
          Length = 302

 Score =  150 bits (380), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 91/116 (78%), Gaps = 3/116 (2%)

Query: 6   SSVSPP---NKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSG 62
           ++VS P    K+LDPPKDTP ++EELAKYDG D + PIY+A+KG ++DVS KRDMYGP  
Sbjct: 185 ATVSAPAGDQKELDPPKDTPFSAEELAKYDGKDESTPIYVAIKGRIYDVSAKRDMYGPGC 244

Query: 63  SYHLFAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            YH+F GKDAS+ LG SSL  EDA+AD+S L++ + KVL+DW  +F+ RYNIVG+V
Sbjct: 245 GYHVFVGKDASRALGKSSLKPEDAVADWSVLNDDEKKVLDDWEKYFQKRYNIVGRV 300



>gi|392579277|gb|EIW72404.1| hypothetical protein TREMEDRAFT_26762 [Tremella mesenterica DSM
           1558]
          Length = 113

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 87/112 (77%)

Query: 8   VSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLF 67
           +S P + L PPKD PI + ELAKY+GSD + PIY+A+KG V+DVS KR+MYGP   Y++F
Sbjct: 1   MSAPAQNLAPPKDDPIPAAELAKYNGSDPSKPIYVAIKGKVYDVSPKREMYGPGAGYNIF 60

Query: 68  AGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           AGKDAS+GLGMSSL  EDAIAD S LDE+Q K L+ W  FF  RYNIVGKVV
Sbjct: 61  AGKDASRGLGMSSLKEEDAIADISGLDEAQHKTLDQWEGFFAQRYNIVGKVV 112



>gi|501308704|dbj|GAC97598.1| potential sterol binding protein [Pseudozyma hubeiensis SY62]
          Length = 115

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 86/111 (77%)

Query: 8   VSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLF 67
           + P  K   PPKD PI+ E+L +YDG+D + P+Y+AVKGTVFDVS KR+MY P   YH+F
Sbjct: 2   MEPTTKPTHPPKDDPISVEDLKQYDGTDESKPVYVAVKGTVFDVSPKREMYAPGKGYHIF 61

Query: 68  AGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           AGKD S+GLGMSSL  EDA+ DYS LD+ QLKVL+DW+ ++  RYNIVGKV
Sbjct: 62  AGKDGSRGLGMSSLKPEDAVPDYSTLDDKQLKVLDDWHSYYTKRYNIVGKV 112



>gi|169868427|ref|XP_001840786.1| hypothetical protein CC1G_10160 [Coprinopsis cinerea okayama7#130]
 gi|116498146|gb|EAU81041.1| hypothetical protein CC1G_10160 [Coprinopsis cinerea okayama7#130]
          Length = 183

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 86/112 (76%), Gaps = 1/112 (0%)

Query: 8   VSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLF 67
           + PP++ L PPKD P T EEL KYDG D   PIY+A+KGT+FDV+ K D+YGP  SY +F
Sbjct: 68  MQPPSENLAPPKDDPYTPEELTKYDGKDGR-PIYVAIKGTIFDVTRKADVYGPGKSYSIF 126

Query: 68  AGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           AGKD SKGLGMSSL  E AIADYS L E++ KVL+DWY FF  RYNI+G+VV
Sbjct: 127 AGKDGSKGLGMSSLKAEHAIADYSDLGETERKVLDDWYAFFSKRYNIIGRVV 178



>gi|409045321|gb|EKM54802.1| hypothetical protein PHACADRAFT_258917 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 171

 Score =  149 bits (376), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 72/112 (64%), Positives = 86/112 (76%)

Query: 8   VSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLF 67
           + PP   L PPKD P T E+L  YDGSD + PIY+A+KGTVFDVS KR+ YG  GSY+LF
Sbjct: 51  MQPPPDDLAPPKDDPFTLEQLKPYDGSDPSKPIYVAIKGTVFDVSRKRETYGKGGSYNLF 110

Query: 68  AGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           AG+DAS+ LGMSSL  +DA  DYS L ES +KVLNDW++FF  RY+IVGKVV
Sbjct: 111 AGRDASRALGMSSLKEQDASPDYSTLSESDMKVLNDWHEFFSKRYSIVGKVV 162



>gi|343429835|emb|CBQ73407.1| conserved hypothetical protein [Sporisorium reilianum SRZ2]
          Length = 115

 Score =  148 bits (373), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 68/112 (60%), Positives = 87/112 (77%)

Query: 8   VSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLF 67
           + P  K   PPKD PI+ ++L ++DGSD + P+Y+AVKG +FDVS KR+MY P   YH+F
Sbjct: 2   MEPTTKPTHPPKDDPISVDDLKQFDGSDESKPVYVAVKGDIFDVSPKREMYAPGKGYHIF 61

Query: 68  AGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           AGKD S+GLGMSSL  EDA++DYS LD+ QLKVLNDW+ ++  RYNIVGKVV
Sbjct: 62  AGKDGSRGLGMSSLKPEDAVSDYSTLDDKQLKVLNDWHAYYTKRYNIVGKVV 113



>gi|392569779|gb|EIW62952.1| progesterone binding protein [Trametes versicolor FP-101664 SS1]
          Length = 123

 Score =  147 bits (372), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 70/112 (62%), Positives = 85/112 (75%)

Query: 8   VSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLF 67
           + P    L PPK+ PIT E+L +YDGSD + PIY+A+KGTVFDV+ K D YG   SY+LF
Sbjct: 1   MQPAQTDLAPPKEDPITVEQLKQYDGSDPSQPIYVAIKGTVFDVTRKADTYGKGKSYNLF 60

Query: 68  AGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           AGKDAS+ LGMSSL  EDA++DYS L  + LK LNDW+DFF  RYN+VGKVV
Sbjct: 61  AGKDASRALGMSSLKEEDAVSDYSTLSAADLKTLNDWFDFFSKRYNVVGKVV 112



>gi|170115979|ref|XP_001889182.1| cytochrome b5 [Laccaria bicolor S238N-H82]
 gi|164635823|gb|EDR00125.1| cytochrome b5 [Laccaria bicolor S238N-H82]
          Length = 177

 Score =  147 bits (371), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 69/114 (60%), Positives = 89/114 (78%)

Query: 6   SSVSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYH 65
           S +  P + L PPKD P T+E L ++DGS+ N PIY+A+KGT+FDV+ K ++YG  GSY+
Sbjct: 45  SIMQAPREDLAPPKDDPFTTEALKQFDGSNPNRPIYVAIKGTIFDVTHKAEVYGRGGSYN 104

Query: 66  LFAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           +FAGKD S+GLG SSL  EDA+ADYS LDE+  KVL+DW+ FF+ RYNIVGKVV
Sbjct: 105 IFAGKDGSRGLGKSSLKPEDAVADYSDLDETDQKVLDDWFSFFQKRYNIVGKVV 158



>gi|242218182|ref|XP_002474884.1| predicted protein [Postia placenta Mad-698-R]
 gi|220725947|gb|EED79913.1| predicted protein [Postia placenta Mad-698-R]
          Length = 103

 Score =  146 bits (369), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 70/102 (68%), Positives = 80/102 (78%)

Query: 17  PPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGL 76
           PP+D PIT EEL +YDGSD + PIY+A+KGTVFDVS KRD YGP  SY+LF GKDAS+ L
Sbjct: 1   PPRDDPITLEELKQYDGSDPSKPIYVAIKGTVFDVSHKRDTYGPGKSYNLFTGKDASRAL 60

Query: 77  GMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           GMSSL  EDAI+DYS L E+  K LNDW+ FF  RYNIVG V
Sbjct: 61  GMSSLKEEDAISDYSTLSEADTKTLNDWHSFFSKRYNIVGNV 102



>gi|443898655|dbj|GAC75989.1| hypothetical protein PANT_19d00055 [Pseudozyma antarctica T-34]
          Length = 114

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 68/112 (60%), Positives = 86/112 (76%)

Query: 8   VSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLF 67
           + P  K   PPKD PI+ E+L +YDG+D + P+Y+AVKGTVFDVS KR+MY P   Y++F
Sbjct: 2   MEPSTKPTHPPKDDPISVEDLKQYDGTDESKPVYVAVKGTVFDVSPKREMYAPGKGYNVF 61

Query: 68  AGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           AGKD S+GLGMSSL  EDA+ DYS LD+ QLKVL+DW+ ++  RYNIVGKV 
Sbjct: 62  AGKDGSRGLGMSSLKPEDAVPDYSTLDDKQLKVLDDWHSYYTKRYNIVGKVA 113



>gi|388853878|emb|CCF52599.1| uncharacterized protein [Ustilago hordei]
          Length = 114

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 67/112 (59%), Positives = 84/112 (75%)

Query: 8   VSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLF 67
           + P  K   PPKD PI  ++L +YDG+D + P+Y+AVKGTVFDVS KR+MY P   YH+F
Sbjct: 2   MEPSTKPTHPPKDDPIPVDDLKQYDGTDESKPVYVAVKGTVFDVSPKREMYAPGKGYHIF 61

Query: 68  AGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           AGKD S+GLGMSSL  EDA+ DYS LD+ Q KVL+DW+ ++  RYNIVGKV 
Sbjct: 62  AGKDGSRGLGMSSLKPEDAVPDYSTLDDKQRKVLDDWHSYYTKRYNIVGKVA 113



>gi|403417188|emb|CCM03888.1| predicted protein [Fibroporia radiculosa]
          Length = 171

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 68/105 (64%), Positives = 83/105 (79%)

Query: 15  LDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASK 74
           L PPK  P T +EL ++DGSD + PIY+A+KGTVFDV+ KRD YG   SY+LFAGKDASK
Sbjct: 53  LAPPKADPFTLDELKQFDGSDDSKPIYVAIKGTVFDVTRKRDTYGTGKSYNLFAGKDASK 112

Query: 75  GLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            LGMSSL  EDAI+DYS+L E  +K LNDW+DFF  RY++VGKV+
Sbjct: 113 ALGMSSLKAEDAISDYSELSEGDMKTLNDWHDFFSKRYDVVGKVI 157



>gi|406694732|gb|EKC98054.1| DEAD/DEAH box helicase involved in nucleotide-excision repair
           [Trichosporon asahii var. asahii CBS 8904]
          Length = 988

 Score =  144 bits (363), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 90/120 (75%), Gaps = 6/120 (5%)

Query: 6   SSVSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYH 65
           S +S P   L PPKD PI+  EL +YDGSD + PIY+A+KG V+DVS+K++MYGP   Y+
Sbjct: 868 SVMSAPAADLAPPKDDPISVAELRQYDGSDPSKPIYVAIKGKVYDVSNKKEMYGPGAGYN 927

Query: 66  LFAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFK------ARYNIVGKVV 119
           +FAGKDASKGLGMSSL+ +DAIADYS L+E+Q+K L+ W  FF        RYNIVGKVV
Sbjct: 928 VFAGKDASKGLGMSSLDPKDAIADYSTLNETQMKTLDQWDSFFAKFQADDQRYNIVGKVV 987



>gi|401885206|gb|EJT49329.1| DEAD/DEAH box helicase involved in nucleotide-excision repair
           [Trichosporon asahii var. asahii CBS 2479]
          Length = 961

 Score =  144 bits (362), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 90/120 (75%), Gaps = 6/120 (5%)

Query: 6   SSVSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYH 65
           S +S P   L PPKD PI+  EL +YDGSD + PIY+A+KG V+DVS+K++MYGP   Y+
Sbjct: 841 SVMSAPAADLAPPKDDPISVAELRQYDGSDPSKPIYVAIKGKVYDVSNKKEMYGPGAGYN 900

Query: 66  LFAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFK------ARYNIVGKVV 119
           +FAGKDASKGLGMSSL+ +DAIADYS L+E+Q+K L+ W  FF        RYNIVGKVV
Sbjct: 901 VFAGKDASKGLGMSSLDPKDAIADYSTLNETQMKTLDQWDSFFAKFQADDQRYNIVGKVV 960



>gi|392593782|gb|EIW83107.1| cytochrome b5 [Coniophora puteana RWD-64-598 SS2]
          Length = 168

 Score =  144 bits (362), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 66/112 (58%), Positives = 87/112 (77%)

Query: 8   VSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLF 67
           + PP   L PPKD P T E+L +YDGSD + PIY+++KG VFDV+ K D+YGP  SY++F
Sbjct: 49  MQPPRDDLQPPKDGPFTLEQLQQYDGSDPSKPIYVSIKGDVFDVTRKADVYGPGKSYNIF 108

Query: 68  AGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           AGKD SKGLGMSSL +EDA+ D+S L +++ KVL+DW+ FF  RYN+VG+VV
Sbjct: 109 AGKDGSKGLGMSSLKVEDAVPDWSGLPDNEKKVLDDWHSFFSKRYNVVGRVV 160



>gi|409075680|gb|EKM76057.1| hypothetical protein AGABI1DRAFT_102532 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 119

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 85/111 (76%)

Query: 8   VSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLF 67
           + PP   L PPKD P T+E+L ++DGSD++ PIY+A+KG +FDVS K D YG   SY++F
Sbjct: 1   MQPPRTDLAPPKDDPFTTEQLKEFDGSDSSKPIYVAIKGDIFDVSHKADSYGKGHSYNIF 60

Query: 68  AGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           AGKD S+GLG SSL  EDAIADYS LD+ + KVL+DW+ FF  RYNIVG+V
Sbjct: 61  AGKDGSRGLGKSSLKSEDAIADYSTLDDKERKVLDDWHSFFSKRYNIVGRV 111



>gi|426191817|gb|EKV41757.1| hypothetical protein AGABI2DRAFT_139898 [Agaricus bisporus var.
           bisporus H97]
          Length = 119

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 85/111 (76%)

Query: 8   VSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLF 67
           + PP   L PPKD P T+E+L ++DGSD++ PIY+A+KG +FDVS K D YG   SY++F
Sbjct: 1   MQPPRTDLAPPKDDPFTTEQLKEFDGSDSSKPIYVAIKGDIFDVSHKADSYGKGHSYNIF 60

Query: 68  AGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           AGKD S+GLG SSL  EDAIADYS LD+ + KVL+DW+ FF  RYNIVG++
Sbjct: 61  AGKDGSRGLGKSSLKSEDAIADYSTLDDKERKVLDDWHSFFSKRYNIVGRI 111



>gi|395332821|gb|EJF65199.1| progesterone binding protein [Dichomitus squalens LYAD-421 SS1]
          Length = 122

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 67/112 (59%), Positives = 84/112 (75%)

Query: 8   VSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLF 67
           + PP   + P K  P T E+L ++DG+D + PIY+A+KGTVFDV+ K D YG   SY+LF
Sbjct: 1   MQPPRTDIAPAKHDPFTVEQLKQFDGTDLSKPIYVAIKGTVFDVTRKADTYGKGKSYNLF 60

Query: 68  AGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           AGKDAS+ LGMSSL  EDA++DYS L E+ LK LNDWYDFF  RY+IVGKV+
Sbjct: 61  AGKDASRALGMSSLKPEDAVSDYSTLSEADLKTLNDWYDFFSKRYDIVGKVI 112



>gi|470318761|gb|EMR10402.1| hypothetical protein PNEG_01117 [Pneumocystis murina B123]
          Length = 118

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 65/102 (63%), Positives = 80/102 (78%)

Query: 17  PPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGL 76
           PPKD PI+   L++ DGS+ N PIY+A+KGTVFDV+  R  YGP G YH+FAGKDAS+GL
Sbjct: 15  PPKDNPISLAYLSQCDGSNENFPIYVAIKGTVFDVTSNRASYGPGGGYHIFAGKDASRGL 74

Query: 77  GMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           G SSL  EDA+ADYS L+ES+L+ L  W+DFF  +YNIVGKV
Sbjct: 75  GKSSLKEEDAVADYSNLNESELETLEKWFDFFSKKYNIVGKV 116



>gi|345561956|gb|EGX45028.1| hypothetical protein AOL_s00173g129 [Arthrobotrys oligospora ATCC
           24927]
          Length = 118

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 66/105 (62%), Positives = 85/105 (80%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +LDPPKD  IT++ L+K DG++   PIY+A+KGTVFDV++K++ YGP GSYH+F GKDAS
Sbjct: 12  QLDPPKDDIITTDYLSKCDGTNEGYPIYVAIKGTVFDVTNKKESYGPGGSYHIFTGKDAS 71

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           +GLG SSL  EDAI DYS L+ES+++ L +WY FF  RYNIVGKV
Sbjct: 72  RGLGKSSLKPEDAIPDYSGLNESEMETLENWYTFFSNRYNIVGKV 116



>gi|443925571|gb|ELU44378.1| Cyt-b5 domain-containing protein [Rhizoctonia solani AG-1 IA]
          Length = 174

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 82/108 (75%)

Query: 11  PNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGK 70
           P+++L PPKD P T  EL+ YDG D N P+Y+ + GT+FDV+ KRD+YGP GSY +FAGK
Sbjct: 48  PDRQLQPPKDDPYTLAELSAYDGHDPNKPVYVQLSGTIFDVTAKRDVYGPGGSYSVFAGK 107

Query: 71  DASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           D SKGLG+SSL  EDA+ D+S L+  +  VLNDW+ FF  RYN+VGKV
Sbjct: 108 DGSKGLGLSSLKAEDAVPDWSTLEGKERGVLNDWHAFFSKRYNVVGKV 155



>gi|505756651|gb|EOR00801.1| Glyoxylate reductase/hydroxypyruvate reductase [Wallemia
           ichthyophaga EXF-994]
          Length = 488

 Score =  142 bits (357), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 86/111 (77%), Gaps = 1/111 (0%)

Query: 4   NPSSVSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGS 63
           N S +  P  +LDPPKDTPI++ EL+ +DGS+ + PIY+A+KGTVFDV+ K DMYG   S
Sbjct: 21  NKSPMQAPAAQLDPPKDTPISAAELSMHDGSN-DKPIYVAIKGTVFDVTKKADMYGSGKS 79

Query: 64  YHLFAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNI 114
           Y++FAGKD S+GLGMSSLN EDA+ADYS L E +  VL+DW+ FF  RYNI
Sbjct: 80  YNIFAGKDGSRGLGMSSLNPEDAVADYSTLTEKESSVLDDWFKFFSKRYNI 130



>gi|449542755|gb|EMD33733.1| hypothetical protein CERSUDRAFT_56375 [Ceriporiopsis subvermispora
           B]
          Length = 122

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 66/112 (58%), Positives = 83/112 (74%)

Query: 8   VSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLF 67
           + P    L+PPKD P T E+L ++DGSD + PIY+++KGT+FDV+ K D YG   +Y+LF
Sbjct: 1   MQPAKTDLEPPKDDPFTLEQLKEFDGSDPSKPIYVSIKGTIFDVTRKVDTYGKGKAYNLF 60

Query: 68  AGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            GKDAS+ LGMSSL  EDA+ DYS L E+ LK LNDW+ FF  RYNIVGKVV
Sbjct: 61  CGKDASRALGMSSLKDEDAVPDYSTLSEADLKTLNDWHSFFSQRYNIVGKVV 112



>gi|389739826|gb|EIM81018.1| progesterone binding protein [Stereum hirsutum FP-91666 SS1]
          Length = 121

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 81/104 (77%)

Query: 15  LDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASK 74
           L PPK+   T EEL +YDG+D   PIY+A+KGT+FDV+ KRD YGP  SY++FAGKD SK
Sbjct: 8   LAPPKEDKYTLEELKQYDGNDPAKPIYVAIKGTIFDVTRKRDTYGPGWSYNIFAGKDGSK 67

Query: 75  GLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           GLG SSL  EDA+ DYS L E++LKVLNDW+ FF  RYNIVGKV
Sbjct: 68  GLGKSSLKEEDAVPDYSDLPENELKVLNDWHGFFSKRYNIVGKV 111



>gi|393246774|gb|EJD54282.1| cytochrome b5 [Auricularia delicata TFB-10046 SS5]
          Length = 181

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 65/107 (60%), Positives = 80/107 (74%)

Query: 13  KKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDA 72
           + L PPKD P T  ELA+YDGSD + PI L++KGTVFDVS KRD YGP G Y +FAGKD 
Sbjct: 66  ESLAPPKDDPYTLRELAQYDGSDPSRPILLSIKGTVFDVSTKRDTYGPGGGYSVFAGKDG 125

Query: 73  SKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           S+GLGMSSL  EDA+ D+S L   + KVL DW+ +FK RYN+VG++ 
Sbjct: 126 SRGLGMSSLKPEDAVPDWSTLPPDERKVLADWHAYFKKRYNVVGRIT 172



>gi|336372131|gb|EGO00471.1| hypothetical protein SERLA73DRAFT_52630 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336384875|gb|EGO26023.1| hypothetical protein SERLADRAFT_388841 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 121

 Score =  138 bits (348), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 65/111 (58%), Positives = 83/111 (74%)

Query: 8   VSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLF 67
           + PP   LDPPK  P T E+L +YDGS  + PIY+++KG +FDV+ K D+YGP  SY+LF
Sbjct: 1   MQPPRTDLDPPKSDPYTLEQLKEYDGSKPDKPIYVSIKGDIFDVTRKADVYGPGKSYNLF 60

Query: 68  AGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           AGKD SKGLGMSSL  EDAI DYS L E+  KVL+DW+ +F  RYN++G+V
Sbjct: 61  AGKDGSKGLGMSSLKPEDAIPDYSTLQENDRKVLDDWHSYFSKRYNVIGRV 111



>gi|384498820|gb|EIE89311.1| hypothetical protein RO3G_14022 [Rhizopus delemar RA 99-880]
          Length = 110

 Score =  137 bits (346), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 77/104 (74%)

Query: 16  DPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKG 75
           +PPK TPIT  EL KYDGSD +LPIY+A+KG VFDVS     YGP   Y++FAGKD+SK 
Sbjct: 4   EPPKTTPITVSELRKYDGSDPSLPIYVAIKGDVFDVSKNTQSYGPGAGYNVFAGKDSSKA 63

Query: 76  LGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           LG SSL  ED IADYS+L E +L+ L  W+ FF  RYNIVGKVV
Sbjct: 64  LGKSSLKPEDCIADYSELTEKELQTLEQWHAFFSKRYNIVGKVV 107



>gi|353240286|emb|CCA72162.1| related to cytochrome b5-Laccaria bicolor [Piriformospora indica
           DSM 11827]
          Length = 179

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 67/116 (57%), Positives = 82/116 (70%)

Query: 3   FNPSSVSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSG 62
           F P S++ P   L  P+    T EEL  YDG+  +  IY+AVKGTVFDVS K DMYGP  
Sbjct: 54  FGPGSLTSPPVHLQAPRMDLFTQEELKAYDGTGPDGKIYVAVKGTVFDVSAKADMYGPGK 113

Query: 63  SYHLFAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           +Y++FAGKDASKGLG+SS+  EDA+ DYS LDE  +  LN WYDFF+ RYNI+G V
Sbjct: 114 AYNVFAGKDASKGLGLSSVKPEDAVPDYSGLDEQGMTTLNGWYDFFQKRYNIMGTV 169



>gi|430813674|emb|CCJ28987.1| unnamed protein product [Pneumocystis jirovecii]
          Length = 119

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 89/119 (74%), Gaps = 3/119 (2%)

Query: 1   MNFNPSSVSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGP 60
           M+ +PS VSP   +   P+D PI+ + L++ DG+D  +PIY+A+KG VFDV+ K  +YGP
Sbjct: 1   MSTHPS-VSP--YRPASPRDDPISLDYLSRCDGTDATMPIYVAIKGIVFDVTRKSALYGP 57

Query: 61  SGSYHLFAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            GSYH+FAGKDASK  G SSL  EDAIADYS L+ES+L++L+DW  FF  +Y+IVGKV 
Sbjct: 58  GGSYHIFAGKDASKAFGKSSLKEEDAIADYSSLNESELRILDDWVTFFSKKYDIVGKVT 116



>gi|511004256|gb|EPB85632.1| hypothetical protein HMPREF1544_07626 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 110

 Score =  135 bits (339), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 64/104 (61%), Positives = 79/104 (75%)

Query: 16  DPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKG 75
           + PK TPIT  ELAK+DGSD +LPIY+A+KG +FDVS     YGP   Y++FAGKD+SK 
Sbjct: 4   EAPKTTPITVSELAKHDGSDPSLPIYVAIKGDIFDVSKNTSSYGPGAGYNVFAGKDSSKA 63

Query: 76  LGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           LG SSL  ED IADYS+L E +L+VL+ W+ FF  RYNI+GKVV
Sbjct: 64  LGKSSLKPEDCIADYSELTEKELEVLDQWHAFFSKRYNIIGKVV 107



>gi|405123577|gb|AFR98341.1| hypothetical protein CNAG_06116 [Cryptococcus neoformans var.
           grubii H99]
          Length = 284

 Score =  133 bits (335), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 79/106 (74%)

Query: 6   SSVSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYH 65
           S +S P   L PPK  PIT  ELAK+DGSD + PIY+A+KG VFDVS + +MY P   Y+
Sbjct: 76  SIMSAPAANLAPPKGDPITPSELAKHDGSDPSKPIYVAIKGRVFDVSARSEMYAPGKGYN 135

Query: 66  LFAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKAR 111
           +FAGKD SKGLGMSSL+ +DA+ADYS L+ESQ++ LN W  FF+ R
Sbjct: 136 VFAGKDGSKGLGMSSLDAKDAVADYSSLNESQMQTLNQWESFFEKR 181



>gi|390600528|gb|EIN09923.1| cytochrome b5, partial [Punctularia strigosozonata HHB-11173 SS5]
          Length = 103

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 64/102 (62%), Positives = 80/102 (78%)

Query: 17  PPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGL 76
           PPKD P T E+L ++DGSD + PIY+A+KG VFDV+ K D+YG   SY++FAGKD SKGL
Sbjct: 1   PPKDDPYTLEQLKEFDGSDPSKPIYVAIKGDVFDVTRKADVYGHGKSYNIFAGKDGSKGL 60

Query: 77  GMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           GMSSL  EDA+ D+S+L  S+ KVLNDW+ FF  RYNIVG+V
Sbjct: 61  GMSSLKEEDAVPDWSELPGSEKKVLNDWHSFFSKRYNIVGRV 102



>gi|393217189|gb|EJD02678.1| progesterone binding protein [Fomitiporia mediterranea MF3/22]
          Length = 136

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 79/108 (73%)

Query: 12  NKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKD 71
           N +L PP D P   EEL  +DG D   PIY+++KGT+FDV+ KR+MYGP  SY++FAGKD
Sbjct: 5   NPELLPPSDKPFRLEELKPFDGKDPEKPIYVSIKGTIFDVTRKREMYGPGKSYNIFAGKD 64

Query: 72  ASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            S+GLGMSSL  EDA+ D+  L  +++KVL+DW+ FF  RYNIVG V 
Sbjct: 65  GSRGLGMSSLKDEDAVPDFHTLPPNEMKVLDDWHAFFSKRYNIVGLVT 112



>gi|169858656|ref|XP_001835972.1| progesterone binding protein [Coprinopsis cinerea okayama7#130]
 gi|116502853|gb|EAU85748.1| progesterone binding protein [Coprinopsis cinerea okayama7#130]
          Length = 118

 Score =  131 bits (329), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 63/113 (55%), Positives = 79/113 (69%)

Query: 7   SVSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHL 66
            + PP   LDPPK  P T +ELA+YDG+D + PIYLA+KGTVFDVS + +MYGP G YH 
Sbjct: 3   EMQPPVDNLDPPKHDPFTVDELAQYDGNDKSKPIYLAIKGTVFDVSRRPEMYGPGGKYHP 62

Query: 67  FAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            AG+DAS+ LG  SL  ED   +   LDE Q + ++ W+DFF+ RYNIVG VV
Sbjct: 63  LAGRDASRALGKGSLEKEDLSDNLEGLDEKQREKVDWWFDFFEKRYNIVGSVV 115



>gi|296413072|ref|XP_002836241.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295630052|emb|CAZ80432.1| unnamed protein product [Tuber melanosporum]
          Length = 125

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 65/118 (55%), Positives = 81/118 (68%), Gaps = 4/118 (3%)

Query: 2   NFNPSSVSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPS 61
           NF P +      +LDPPKD PI+ +EL   DGS    P+Y+A+KGTVFDVS  R  YGP 
Sbjct: 8   NFEPKAPV----QLDPPKDDPISLDELKVADGSYEGRPVYVAIKGTVFDVSSNRSSYGPG 63

Query: 62  GSYHLFAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           GSYH+FAGKDAS+ L  SS+  EDAIA +  L + + +VL DWY +F  RYNIVG+VV
Sbjct: 64  GSYHVFAGKDASRALAKSSVKPEDAIAKWDDLGDKEKEVLGDWYTYFSKRYNIVGRVV 121



>gi|212528574|ref|XP_002144444.1| progesterone binding protein, putative [Talaromyces marneffei ATCC
           18224]
 gi|210073842|gb|EEA27929.1| progesterone binding protein, putative [Talaromyces marneffei ATCC
           18224]
          Length = 123

 Score =  129 bits (323), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 77/106 (72%), Gaps = 1/106 (0%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +LDPPKD PIT EEL+K DG+D + P Y+A+KGTVFDVS K   Y P G YH+FAGKD S
Sbjct: 18  QLDPPKDDPITVEELSKCDGTDPSRPTYVAIKGTVFDVS-KNAAYAPGGQYHVFAGKDPS 76

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           + L  SSL +ED  +D+  LD+    VL++W+ FF  RYNIVGKVV
Sbjct: 77  RALATSSLKVEDCRSDWEDLDDKSKTVLDEWFLFFSKRYNIVGKVV 122



>gi|242766024|ref|XP_002341091.1| progesterone binding protein, putative [Talaromyces stipitatus ATCC
           10500]
 gi|218724287|gb|EED23704.1| progesterone binding protein, putative [Talaromyces stipitatus ATCC
           10500]
          Length = 123

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 60/106 (56%), Positives = 77/106 (72%), Gaps = 1/106 (0%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +LD PKD P T EEL+K+DG+D + P Y+A+KGT+FDVS K+D Y P G YH+FAGKDAS
Sbjct: 18  QLDSPKDDPFTLEELSKHDGTDPSRPTYVAIKGTIFDVS-KKDAYAPGGQYHVFAGKDAS 76

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           + L  SSL  ED   ++  LD+ +  VL +W+ FF  RYNIVGKVV
Sbjct: 77  RALAKSSLKKEDCRPEWEDLDDKEKTVLEEWFTFFSKRYNIVGKVV 122



>gi|58261742|ref|XP_568281.1| sterol metabolism-related protein [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|134118351|ref|XP_772189.1| hypothetical protein CNBM1080 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50254797|gb|EAL17542.1| hypothetical protein CNBM1080 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57230454|gb|AAW46764.1| sterol metabolism-related protein, putative [Cryptococcus
           neoformans var. neoformans JEC21]
          Length = 303

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 59/99 (59%), Positives = 73/99 (73%), Gaps = 1/99 (1%)

Query: 22  PITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSL 81
           PIT  ELAK+DGSD + PIY+A+KG VFDVS + +MYGP   Y++FAGKD SKGLGMSSL
Sbjct: 68  PITPSELAKHDGSDPSKPIYVAIKGKVFDVSPRSEMYGPGKGYNVFAGKDGSKGLGMSSL 127

Query: 82  NLEDAIADYSKLDESQLKVLNDWYDFF-KARYNIVGKVV 119
           +  DA+ADYS L+ESQ+  LN W  FF K +    G+ V
Sbjct: 128 DPTDAVADYSSLNESQMNTLNQWEAFFEKIQRGGAGRAV 166



>gi|115398369|ref|XP_001214776.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gi|114192967|gb|EAU34667.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 121

 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 75/105 (71%), Gaps = 1/105 (0%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +LDPPKD PIT EEL+K DG+D + P  +A+KG VFDVS K   Y PSG YH+FAGKD S
Sbjct: 12  QLDPPKDDPITVEELSKCDGTDPSRPTLVAIKGIVFDVS-KNPAYSPSGQYHVFAGKDPS 70

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           + L  SSL  E+ + D+  LD+ +  VL++W+ FF  RYNIVGKV
Sbjct: 71  RALACSSLKPENCVPDWYDLDDKEKTVLDEWFTFFSKRYNIVGKV 115



>gi|119501272|ref|XP_001267393.1| progesterone binding protein, putative [Neosartorya fischeri NRRL
           181]
 gi|119415558|gb|EAW25496.1| progesterone binding protein, putative [Neosartorya fischeri NRRL
           181]
          Length = 127

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 76/105 (72%), Gaps = 1/105 (0%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +L+PPKD PIT EEL+K DG+D + P  +A+KG VFDVS K   YGP+G YH+FAGKD+S
Sbjct: 18  QLNPPKDDPITVEELSKCDGTDPSRPTLVAIKGIVFDVS-KNPAYGPNGQYHVFAGKDSS 76

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           + L  SSL  ED   D+  LD+ +  VL++W+ FF  RYNIVGKV
Sbjct: 77  RALACSSLKPEDCRPDWYDLDDKEKTVLSEWFTFFSKRYNIVGKV 121



>gi|449305097|gb|EMD01104.1| hypothetical protein BAUCODRAFT_60959 [Baudoinia compniacensis UAMH
           10762]
          Length = 119

 Score =  120 bits (302), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 63/119 (52%), Positives = 77/119 (64%), Gaps = 5/119 (4%)

Query: 1   MNFNPSSVSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGP 60
           M+F P        +LD P+D PIT + LAK DG+  + P Y+A+KGTVFDVS  +  YGP
Sbjct: 1   MSFEPKQ----KVELDAPRDDPITLDYLAKCDGTHADYPTYVAIKGTVFDVSGNK-AYGP 55

Query: 61  SGSYHLFAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            GSY LFAGKDAS+ L  SSL  ED   ++  L +   KVLNDW+ FF  RYNI GKVV
Sbjct: 56  EGSYKLFAGKDASRALAQSSLKEEDCSPEWEDLSDEHKKVLNDWFTFFSKRYNIKGKVV 114



>gi|425781539|gb|EKV19499.1| hypothetical protein PDIG_02960 [Penicillium digitatum PHI26]
 gi|425782770|gb|EKV20660.1| hypothetical protein PDIP_14210 [Penicillium digitatum Pd1]
          Length = 126

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 75/105 (71%), Gaps = 1/105 (0%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +LDPPKD PI++EELAK DG+D + P  +A+KG VFDVS +   YG SGSY +FAGKDAS
Sbjct: 17  ELDPPKDDPISAEELAKCDGTDPSRPTLVAIKGVVFDVS-RNSAYGASGSYRVFAGKDAS 75

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           + L  SSL  ED +  +  L + +  VL++WY FF  RYNIVGKV
Sbjct: 76  RALASSSLKPEDCVPQWYDLPDKEKTVLDEWYTFFSKRYNIVGKV 120



>gi|70994846|ref|XP_752200.1| progesterone binding protein [Aspergillus fumigatus Af293]
 gi|66849834|gb|EAL90162.1| progesterone binding protein, putative [Aspergillus fumigatus
           Af293]
 gi|159124887|gb|EDP50004.1| progesterone binding protein, putative [Aspergillus fumigatus
           A1163]
          Length = 127

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 74/105 (70%), Gaps = 1/105 (0%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +LDPPKD PIT EEL+K DG+D + P  +A+KG VFDVS K   YGP+G Y +FAGKD S
Sbjct: 18  QLDPPKDDPITMEELSKCDGTDPSRPTLVAIKGIVFDVS-KNPAYGPNGQYRVFAGKDPS 76

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           + L  SSL  ED   D+  LD+ +  VL++W+ FF  RYNIVGKV
Sbjct: 77  RALACSSLKPEDCRPDWYDLDDKEKTVLSEWFTFFSKRYNIVGKV 121



>gi|121706510|ref|XP_001271517.1| progesterone binding protein, putative [Aspergillus clavatus NRRL
           1]
 gi|119399665|gb|EAW10091.1| progesterone binding protein, putative [Aspergillus clavatus NRRL
           1]
          Length = 127

 Score =  120 bits (301), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 72/105 (68%), Gaps = 1/105 (0%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +LDPPKD PIT EEL+K DG+D N P  +A+KG VFDVS +   Y   G YH+FAGKD S
Sbjct: 18  QLDPPKDDPITVEELSKCDGTDPNRPTLVAIKGIVFDVS-RNPAYSTKGQYHVFAGKDPS 76

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           + L  SSL  ED   D+  LD+ +  VL++WY FF  RYNIVGKV
Sbjct: 77  RALACSSLKPEDCRPDWYDLDDKEKTVLSEWYTFFSKRYNIVGKV 121



>gi|321265111|ref|XP_003197272.1| sterol metabolism-related protein [Cryptococcus gattii WM276]
 gi|317463751|gb|ADV25485.1| Sterol metabolism-related protein, putative [Cryptococcus gattii
           WM276]
          Length = 255

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 54/92 (58%), Positives = 69/92 (75%)

Query: 20  DTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMS 79
           D PIT  +LAK+DGSD + PIY+A+KG VFDVS + +MYGP   Y++FAGKD S+GLGMS
Sbjct: 69  DDPITPAQLAKHDGSDPSKPIYVAIKGKVFDVSSRGEMYGPGKGYNVFAGKDGSRGLGMS 128

Query: 80  SLNLEDAIADYSKLDESQLKVLNDWYDFFKAR 111
           SL+  DA+ADYS L E ++  LN W  FF+ R
Sbjct: 129 SLDPRDAVADYSALSEGEMNTLNQWEAFFEKR 160



>gi|471901389|emb|CCO29950.1| putative steroid-binding protein 3 Short=AtMP3 [Rhizoctonia solani
           AG-1 IB]
          Length = 1179

 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 57/100 (57%), Positives = 73/100 (73%)

Query: 9   SPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFA 68
           + P + + PPKD P T E+L ++ G D N P+Y+++KGTVFDVS KRD YGP GSY L A
Sbjct: 3   ATPPEPIAPPKDDPYTLEKLKQFSGEDANKPVYVSIKGTVFDVSAKRDTYGPGGSYALLA 62

Query: 69  GKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFF 108
           GKDAS  LG SSL  EDA+ DYS+LDES+ + L+ W+ FF
Sbjct: 63  GKDASVALGKSSLKPEDAVPDYSQLDESERQTLDQWHGFF 102



>gi|134058323|emb|CAK38512.1| unnamed protein product [Aspergillus niger]
          Length = 164

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 73/105 (69%), Gaps = 1/105 (0%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +LDPPK  PIT EEL+K DG+D N P  +A+KG VFDV+ +   Y PSG YH+FAGKD S
Sbjct: 55  QLDPPKYDPITVEELSKCDGTDPNRPTLVAIKGIVFDVT-RNQAYSPSGQYHVFAGKDPS 113

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           + L  SSL  ED   D+  L++ +  VL++W+ FF  RYNIVGKV
Sbjct: 114 RALASSSLKAEDCKPDWYDLEDKEKTVLDEWFTFFSKRYNIVGKV 158



>gi|443918264|gb|ELU38784.1| Cyt-b5 domain-containing protein [Rhizoctonia solani AG-1 IA]
          Length = 126

 Score =  119 bits (299), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 77/105 (73%), Gaps = 4/105 (3%)

Query: 19  KDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKG--- 75
           KD P T E+L ++DG D + P+Y+++KGTVFDVS KRD YGP G Y L +GKDAS G   
Sbjct: 13  KDDPYTLEKLKEFDGQDPSKPVYVSIKGTVFDVSAKRDTYGPGGGYALLSGKDASVGELP 72

Query: 76  -LGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            LG SSL  EDAIADYS+L++S+ + L+ W+ FF  +Y+I GKVV
Sbjct: 73  ALGKSSLKPEDAIADYSQLNQSERQTLDQWHSFFTKKYSIAGKVV 117



>gi|239606560|gb|EEQ83547.1| progesterone binding protein [Ajellomyces dermatitidis ER-3]
          Length = 122

 Score =  119 bits (297), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 58/104 (55%), Positives = 73/104 (70%), Gaps = 1/104 (0%)

Query: 15  LDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASK 74
           LDPPKD PI+ EEL+K DG+D N P  +A+KG VF+VS     YGP G+YH+FAGKDAS+
Sbjct: 14  LDPPKDDPISVEELSKSDGTDPNRPTLVAIKGVVFNVSG-NPAYGPGGNYHVFAGKDASR 72

Query: 75  GLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            L  SSL LED   ++  L + +  VL +W+ FF  RYNIVGKV
Sbjct: 73  ALASSSLKLEDCRPEWHDLPDKEKGVLEEWFTFFSKRYNIVGKV 116



>gi|317037973|ref|XP_001401420.2| progesterone binding protein [Aspergillus niger CBS 513.88]
 gi|350631987|gb|EHA20355.1| hypothetical protein ASPNIDRAFT_213350 [Aspergillus niger ATCC
           1015]
 gi|358365932|dbj|GAA82553.1| progesterone binding protein [Aspergillus kawachii IFO 4308]
          Length = 127

 Score =  118 bits (296), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 73/105 (69%), Gaps = 1/105 (0%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +LDPPK  PIT EEL+K DG+D N P  +A+KG VFDV+ +   Y PSG YH+FAGKD S
Sbjct: 18  QLDPPKYDPITVEELSKCDGTDPNRPTLVAIKGIVFDVT-RNQAYSPSGQYHVFAGKDPS 76

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           + L  SSL  ED   D+  L++ +  VL++W+ FF  RYNIVGKV
Sbjct: 77  RALASSSLKAEDCKPDWYDLEDKEKTVLDEWFTFFSKRYNIVGKV 121



>gi|169773977|ref|XP_001821457.1| progesterone binding protein [Aspergillus oryzae RIB40]
 gi|238492010|ref|XP_002377242.1| progesterone binding protein, putative [Aspergillus flavus
           NRRL3357]
 gi|83769318|dbj|BAE59455.1| unnamed protein product [Aspergillus oryzae RIB40]
 gi|220697655|gb|EED53996.1| progesterone binding protein, putative [Aspergillus flavus
           NRRL3357]
 gi|391869083|gb|EIT78288.1| progesterone binding protein [Aspergillus oryzae 3.042]
          Length = 121

 Score =  117 bits (294), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 75/105 (71%), Gaps = 1/105 (0%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +L+ PKD PIT EEL+K DG+D N P ++A+KG VFDVS K   YGP+GSY +FAGKD+S
Sbjct: 12  QLEDPKDDPITVEELSKCDGTDPNRPTWVAIKGIVFDVS-KNPAYGPNGSYRVFAGKDSS 70

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           + L  SSL  ED    +  L++ +  VL++W+ FF  RYNIVGKV
Sbjct: 71  RALACSSLKPEDCRPKWDDLEDKEKTVLDEWFTFFSKRYNIVGKV 115



>gi|67528246|ref|XP_661933.1| hypothetical protein AN4329.2 [Aspergillus nidulans FGSC A4]
 gi|40741300|gb|EAA60490.1| hypothetical protein AN4329.2 [Aspergillus nidulans FGSC A4]
 gi|259482864|tpe|CBF77749.1| TPA: progesterone binding protein, putative (AFU_orthologue;
           AFUA_4G06240) [Aspergillus nidulans FGSC A4]
          Length = 125

 Score =  117 bits (293), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 72/105 (68%), Gaps = 1/105 (0%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +LDPPKD  IT EELAK DG+D + P Y+A+KG VFDVS +   YGP G Y +FAGKDAS
Sbjct: 16  QLDPPKDDLITPEELAKCDGTDPSRPTYVAIKGIVFDVS-RNSAYGPEGQYKVFAGKDAS 74

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           + L  SSL  ED   ++  L +   KVL +W+ FF  RYNIVGKV
Sbjct: 75  RALACSSLKPEDCKPEWYDLPDKDKKVLEEWFTFFSKRYNIVGKV 119



>gi|255949668|ref|XP_002565601.1| Pc22g16880 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211592618|emb|CAP98976.1| Pc22g16880 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 127

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 74/105 (70%), Gaps = 1/105 (0%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +LDPPKD  I+ EELAK DG+D N P  +A+KG VFDV+ +   YG SGSY +FAGKDAS
Sbjct: 18  QLDPPKDDLISVEELAKCDGTDPNRPTLVAIKGVVFDVT-RNSAYGASGSYRVFAGKDAS 76

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           + L  SSL  ED + ++  L + +  VL++WY FF  RYNIVGKV
Sbjct: 77  RALASSSLKPEDCVPEWYDLPDKEKTVLDEWYTFFSKRYNIVGKV 121



>gi|261193244|ref|XP_002623028.1| progesterone binding protein [Ajellomyces dermatitidis SLH14081]
 gi|239589163|gb|EEQ71806.1| progesterone binding protein [Ajellomyces dermatitidis SLH14081]
 gi|327356850|gb|EGE85707.1| progesterone binding protein [Ajellomyces dermatitidis ATCC 18188]
          Length = 122

 Score =  116 bits (290), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 57/104 (54%), Positives = 72/104 (69%), Gaps = 1/104 (0%)

Query: 15  LDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASK 74
           LDPPKD PI+ EEL+K DG+D N P  +A+KG VF+VS     YGP G+YH+FAGKDAS+
Sbjct: 14  LDPPKDDPISVEELSKSDGTDPNRPTLVAIKGVVFNVSG-NPAYGPGGNYHVFAGKDASR 72

Query: 75  GLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            L  SSL  ED   ++  L + +  VL +W+ FF  RYNIVGKV
Sbjct: 73  ALASSSLKPEDCRPEWHDLPDKEKGVLEEWFTFFSKRYNIVGKV 116



>gi|429855364|gb|ELA30322.1| progesterone binding protein [Colletotrichum gloeosporioides Nara
           gc5]
          Length = 122

 Score =  115 bits (288), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 58/106 (54%), Positives = 73/106 (68%), Gaps = 1/106 (0%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +L PPKD PIT EELAK DGSD N   Y+A+KG V+DV+  +  Y   GSY++FAGKDAS
Sbjct: 12  ELAPPKDDPITLEELAKADGSDPNGKTYVAIKGVVYDVTGNK-AYQAGGSYNVFAGKDAS 70

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           + LG +S   ED  AD+S L + +  VLNDW  FF  RYN+VG+V 
Sbjct: 71  RALGKTSTKAEDVSADWSDLSDKEKGVLNDWITFFSKRYNVVGRVA 116



>gi|452987672|gb|EME87427.1| hypothetical protein MYCFIDRAFT_62413 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 124

 Score =  115 bits (288), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 58/104 (55%), Positives = 71/104 (68%), Gaps = 1/104 (0%)

Query: 15  LDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASK 74
           LDPPKD  I+ + L+K DG+    P Y+A+KGTVFDV+  +  YGP GSY +FAGKDAS+
Sbjct: 12  LDPPKDDIISLDHLSKCDGTHEGYPTYVAIKGTVFDVTGNK-AYGPEGSYKVFAGKDASR 70

Query: 75  GLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            L  SSL  E+A  D+  L +   KVLNDWY FF  RYNI GKV
Sbjct: 71  ALAQSSLKAEEARPDWYDLSDEHKKVLNDWYTFFSKRYNIKGKV 114



>gi|452003349|gb|EMD95806.1| hypothetical protein COCHEDRAFT_1221515 [Bipolaris maydis C5]
 gi|477593598|gb|ENI10667.1| hypothetical protein COCC4DRAFT_55328 [Bipolaris maydis ATCC 48331]
          Length = 129

 Score =  115 bits (287), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 56/104 (53%), Positives = 73/104 (70%), Gaps = 1/104 (0%)

Query: 15  LDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASK 74
           L+PPKD  I  + LAK DG++   P  +A+KG VFDVS K + Y P   YH+FAGK+ ++
Sbjct: 20  LNPPKDDIIERDYLAKCDGTNEGYPTLVAIKGDVFDVSGK-ETYAPGKGYHVFAGKEPNR 78

Query: 75  GLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            LG+SSL  ED I+DYS L E +L VLNDW+ FF  RYNIVG++
Sbjct: 79  ALGLSSLKPEDCISDYSGLSEKELGVLNDWHTFFSKRYNIVGRL 122



>gi|396465646|ref|XP_003837431.1| similar to progesterone binding protein [Leptosphaeria maculans
           JN3]
 gi|312213989|emb|CBX93991.1| similar to progesterone binding protein [Leptosphaeria maculans
           JN3]
          Length = 130

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 55/104 (52%), Positives = 72/104 (69%), Gaps = 1/104 (0%)

Query: 15  LDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASK 74
           L+PPKD  I  E LAK DG+    P  +A+KG VFDVS K + Y P   YH+FAGK+ ++
Sbjct: 20  LNPPKDDIIDREYLAKCDGTREGFPTLVAIKGDVFDVSGK-ETYAPGKGYHVFAGKEPNR 78

Query: 75  GLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            LG+SSL  ED I+DYS L + + +VLNDW+ FF  RYNIVG++
Sbjct: 79  ALGLSSLKPEDCISDYSALSDKEKQVLNDWHTFFSKRYNIVGRL 122



>gi|494823759|gb|EON61124.1| hypothetical protein W97_00335 [Coniosporium apollinis CBS 100218]
          Length = 128

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 74/105 (70%), Gaps = 1/105 (0%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +LDPPK+ PI+ E L+K DG++ + P Y+A+KGT+FDVS  +  Y P   YH+FAGKDAS
Sbjct: 19  QLDPPKNDPISPEYLSKCDGTNVDYPTYVAMKGTIFDVSGNK-AYTPGAGYHVFAGKDAS 77

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           + L  SSL  ED   ++  L +S+ KVL+DW+ FF  RYNIVG V
Sbjct: 78  RALAKSSLKPEDCRPEWEDLPDSEKKVLDDWFTFFSKRYNIVGVV 122



>gi|398411694|ref|XP_003857185.1| hypothetical protein MYCGRDRAFT_98659 [Zymoseptoria tritici IPO323]
 gi|339477070|gb|EGP92161.1| hypothetical protein MYCGRDRAFT_98659 [Zymoseptoria tritici IPO323]
          Length = 122

 Score =  114 bits (284), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/104 (54%), Positives = 71/104 (68%), Gaps = 1/104 (0%)

Query: 15  LDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASK 74
           LDPPKD  I+ E L+K DG   + P Y+A+KGTVFDV+  +  YGP GSY +FAG+DAS+
Sbjct: 12  LDPPKDDIISLEYLSKCDGKHEDYPTYVAIKGTVFDVTGNK-AYGPEGSYKVFAGRDASR 70

Query: 75  GLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            L  SSL  E+   D+  L + Q KVLNDW+ FF  RYNI GKV
Sbjct: 71  ALAQSSLKEEECRPDWYDLTDEQKKVLNDWFTFFSKRYNIKGKV 114



>gi|402222430|gb|EJU02497.1| progesterone binding protein [Dacryopinax sp. DJM-731 SS1]
          Length = 128

 Score =  113 bits (282), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 52/93 (55%), Positives = 70/93 (75%)

Query: 27  ELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLNLEDA 86
           +L  +DG+    PIY+++KGTVFDV+ + + YGP+G+YH+FAGKDASKGLG SSL  EDA
Sbjct: 28  DLKSFDGTQPGKPIYVSIKGTVFDVTSRAESYGPAGAYHIFAGKDASKGLGSSSLKPEDA 87

Query: 87  IADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           + D+S L++   KVL DW+ FF+ RY IVG V 
Sbjct: 88  VYDWSGLNDKDKKVLGDWFSFFQKRYPIVGYVA 120



>gi|451856275|gb|EMD69566.1| hypothetical protein COCSADRAFT_155737 [Bipolaris sorokiniana
           ND90Pr]
          Length = 129

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 54/104 (51%), Positives = 72/104 (69%), Gaps = 1/104 (0%)

Query: 15  LDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASK 74
           L+PPKD  I  + LAK DG++   P  +A+KG VFDVS K + Y P   YH+FAGK+ ++
Sbjct: 20  LNPPKDDIIERDYLAKCDGTNEGYPTLVAIKGDVFDVSGK-ETYAPGKGYHVFAGKEPNR 78

Query: 75  GLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            LG+SSL  ED ++DYS L E +  VLNDW+ FF  RYNIVG++
Sbjct: 79  ALGLSSLKPEDCVSDYSGLSEKEQGVLNDWHTFFSKRYNIVGRL 122



>gi|330935483|ref|XP_003304990.1| hypothetical protein PTT_17724 [Pyrenophora teres f. teres 0-1]
 gi|311318180|gb|EFQ86927.1| hypothetical protein PTT_17724 [Pyrenophora teres f. teres 0-1]
          Length = 130

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 54/104 (51%), Positives = 74/104 (71%), Gaps = 1/104 (0%)

Query: 15  LDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASK 74
           L+PPKD  I    LAK DG++   P  +A+KG VFDVS K + Y P   YH+FAGK+ ++
Sbjct: 21  LNPPKDDVIDRAYLAKCDGTNDGYPTLVAIKGDVFDVSGK-ETYAPGKGYHVFAGKEPNR 79

Query: 75  GLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            LG+SSL  ED I+DYS+L++ + +VLNDW+ FF  RYNIVG++
Sbjct: 80  ALGLSSLKPEDCISDYSELNDKEKQVLNDWHTFFSKRYNIVGRL 123



>gi|452848057|gb|EME49989.1| hypothetical protein DOTSEDRAFT_164873 [Dothistroma septosporum
           NZE10]
          Length = 137

 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 55/104 (52%), Positives = 69/104 (66%), Gaps = 1/104 (0%)

Query: 15  LDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASK 74
           LDPPKD  I+ + L+K DG     P Y+A+KGT+FDV+  +  YGP GSY +FAG+DAS+
Sbjct: 18  LDPPKDDIISLDHLSKCDGKHEGFPTYVAIKGTIFDVTGNK-AYGPEGSYKVFAGRDASR 76

Query: 75  GLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            L  SSL  E+  +D+  L     KVLNDWY FF  RYNI GKV
Sbjct: 77  ALAQSSLKDEECRSDWYDLSPEHKKVLNDWYTFFSKRYNIKGKV 120



>gi|302657511|ref|XP_003020476.1| hypothetical protein TRV_05443 [Trichophyton verrucosum HKI 0517]
 gi|291184313|gb|EFE39858.1| hypothetical protein TRV_05443 [Trichophyton verrucosum HKI 0517]
          Length = 123

 Score =  112 bits (279), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 58/114 (50%), Positives = 76/114 (66%), Gaps = 1/114 (0%)

Query: 6   SSVSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYH 65
           S +SP    L+PPKD PI+  +LAK DGSD + PI++A+KG VFDVS     Y   G+Y+
Sbjct: 6   SIMSPVATNLNPPKDDPISLADLAKSDGSDPSRPIFVAIKGDVFDVSG-NSAYAKGGNYN 64

Query: 66  LFAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           +FAGKD+S+ L  SSL  ED +  +S L + +  VL DW+ FF  RYNIVGKV 
Sbjct: 65  VFAGKDSSRALAKSSLKPEDCVPQWSDLGDKEKGVLEDWHKFFSKRYNIVGKVA 118



>gi|171691947|ref|XP_001910898.1| hypothetical protein [Podospora anserina S mat+]
 gi|170945922|emb|CAP72723.1| unnamed protein product [Podospora anserina S mat+]
          Length = 122

 Score =  111 bits (278), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 72/105 (68%), Gaps = 1/105 (0%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +L+PPKD PI+  ELAK +G   +   Y+A+KG V+DV+  +  Y P G+YH+FAGKDAS
Sbjct: 12  QLNPPKDDPISLSELAKANGEQADGKCYVAIKGLVYDVTGNK-AYLPGGAYHVFAGKDAS 70

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           K LG +S  +ED  AD+S L E +   LNDW  FF  RYN+VG+V
Sbjct: 71  KALGKTSTKVEDVDADWSGLTEKEKGTLNDWVTFFSKRYNVVGRV 115



>gi|400597209|gb|EJP64944.1| cytochrome b5-like Heme/Steroid binding domain-containing protein
           [Beauveria bassiana ARSEF 2860]
          Length = 121

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 74/105 (70%), Gaps = 2/105 (1%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +L+PPKD PIT EELAK +G D++  IY+A+KG V+DV+     Y P  +YH+F GKDAS
Sbjct: 12  QLNPPKDDPITLEELAKCNGVDSD-KIYVAIKGKVYDVTGNSS-YLPGKAYHVFTGKDAS 69

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           + LGM+S   ED +AD+S L E +  VL+DW  FF  RYNIVG V
Sbjct: 70  RALGMTSTKPEDVVADWSTLSEKEKGVLDDWITFFSKRYNIVGVV 114



>gi|328770667|gb|EGF80708.1| hypothetical protein BATDEDRAFT_7272 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 90

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 50/90 (55%), Positives = 66/90 (73%)

Query: 27  ELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLNLEDA 86
           ELAK+DGSD   P+Y+A+KGTVFDV+  R MY P   Y +FAGKDAS+ LGMS L LE  
Sbjct: 1   ELAKFDGSDEAQPVYVAIKGTVFDVTSNRKMYAPGQGYAVFAGKDASRALGMSKLQLEYC 60

Query: 87  IADYSKLDESQLKVLNDWYDFFKARYNIVG 116
           ++DYS L   +LKVL++W+ F+  +Y +VG
Sbjct: 61  VSDYSTLTAEELKVLDNWHVFYTKKYPVVG 90



>gi|407923519|gb|EKG16589.1| Cytochrome b5 [Macrophomina phaseolina MS6]
          Length = 136

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 72/105 (68%), Gaps = 1/105 (0%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +LD PKD PIT + LAK DG++   P  +A+KGTVFDVS K D YGP+G Y +FAGK+ +
Sbjct: 23  QLDTPKDDPITLDYLAKCDGTNEGYPTLVAIKGTVFDVS-KNDAYGPTGQYKVFAGKEPN 81

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           + L  SSL  ED   ++  L + +  VL++WY FF  RYNIVGKV
Sbjct: 82  RALAQSSLKPEDCRPEWEDLADKEKTVLDEWYTFFSKRYNIVGKV 126



>gi|485922918|gb|EOD48238.1| putative progesterone binding protein [Neofusicoccum parvum UCRNP2]
          Length = 136

 Score =  111 bits (278), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 71/105 (67%), Gaps = 1/105 (0%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +LDPPKD PIT + LAK DG     P  +A+KGTVFDVS K + YGP+G Y +FAGK+ +
Sbjct: 23  QLDPPKDDPITLDYLAKCDGKTEGYPTLVAIKGTVFDVS-KNEAYGPNGQYKVFAGKEPN 81

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           + L  SSL  ED   ++  L + +  VL++WY FF  RYNIVGKV
Sbjct: 82  RALAQSSLKPEDCRPEWEDLPDKEKTVLDEWYTFFSKRYNIVGKV 126



>gi|310793674|gb|EFQ29135.1| cytochrome b5-like Heme/Steroid binding domain-containing protein
           [Glomerella graminicola M1.001]
          Length = 122

 Score =  111 bits (277), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 56/106 (52%), Positives = 72/106 (67%), Gaps = 1/106 (0%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +L PPKD PIT EELAK DGSD N   Y+A+KG V+DV+  +  Y   GSY++FAGKDAS
Sbjct: 12  ELAPPKDDPITLEELAKADGSDPNGKTYVAIKGIVYDVTGNK-AYQLGGSYNVFAGKDAS 70

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           + LGM+S   ED   ++  L + +  VLNDW  FF  RYN+VG+V 
Sbjct: 71  RALGMTSTKAEDVSPEWQDLPDKEKGVLNDWITFFSKRYNVVGRVA 116



>gi|336257809|ref|XP_003343726.1| hypothetical protein SMAC_04384 [Sordaria macrospora k-hell]
 gi|380091647|emb|CCC10779.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 121

 Score =  110 bits (276), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 72/105 (68%), Gaps = 2/105 (1%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +L+PPKD PI+ EELAK +G+D     Y+A+KG V+DV+  +  Y P GSYH+FAGKDAS
Sbjct: 12  QLNPPKDDPISVEELAKANGADGE-KCYVAIKGIVYDVTGNK-AYQPGGSYHVFAGKDAS 69

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           + LG +S   ED   D+  LD+ +   LNDW  FF  RYN+VG+V
Sbjct: 70  RALGKTSTKAEDVRPDWQDLDDKEKSTLNDWITFFSKRYNVVGRV 114



>gi|328351906|emb|CCA38305.1| V-type ATPase assembly factor PKR1 [Komagataella pastoris CBS 7435]
          Length = 242

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 58/110 (52%), Positives = 69/110 (62%), Gaps = 5/110 (4%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +L PP D PIT EEL + DG  +   IY+A+KGTVFDV+     YG    YH   G+DAS
Sbjct: 129 QLQPPSDQPITLEELYQCDGVKSPY-IYVAIKGTVFDVTHNSKAYGVGQGYHALVGRDAS 187

Query: 74  KGLGMSSLNLED----AIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           K LG SSL  ED       DYS L+E QL+ L +W+ FF  RYNIVGKVV
Sbjct: 188 KALGKSSLKPEDLNPAECWDYSDLNEKQLQTLENWFTFFSKRYNIVGKVV 237



>gi|225560419|gb|EEH08700.1| conserved hypothetical protein [Ajellomyces capsulatus G186AR]
          Length = 122

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/104 (52%), Positives = 70/104 (67%), Gaps = 1/104 (0%)

Query: 15  LDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASK 74
           LDPPK  PI+ EEL+K DG+D N    +A+KG VF+VS     YGP G+YH+FAGKDAS+
Sbjct: 14  LDPPKYDPISVEELSKSDGTDPNRATLVAIKGVVFNVSG-NPAYGPGGNYHVFAGKDASR 72

Query: 75  GLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            L  SSL  ED   ++  L + +  VL +W+ FF  RYNIVGKV
Sbjct: 73  ALASSSLKPEDCRPEWEDLPDKEKAVLEEWFTFFSKRYNIVGKV 116



>gi|154270521|ref|XP_001536115.1| progesterone binding protein [Ajellomyces capsulatus NAm1]
 gi|150409919|gb|EDN05307.1| progesterone binding protein [Ajellomyces capsulatus NAm1]
 gi|240279974|gb|EER43478.1| progesterone binding protein [Ajellomyces capsulatus H143]
 gi|325088691|gb|EGC42001.1| progesterone binding protein [Ajellomyces capsulatus H88]
          Length = 122

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/104 (52%), Positives = 70/104 (67%), Gaps = 1/104 (0%)

Query: 15  LDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASK 74
           LDPPK  PI+ EEL+K DG+D N    +A+KG VF+VS     YGP G+YH+FAGKDAS+
Sbjct: 14  LDPPKYDPISVEELSKSDGTDPNRATLVAIKGVVFNVSG-NPAYGPGGNYHVFAGKDASR 72

Query: 75  GLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            L  SSL  ED   ++  L + +  VL +W+ FF  RYNIVGKV
Sbjct: 73  ALASSSLKPEDCRPEWEDLPDKEKAVLEEWFTFFSKRYNIVGKV 116



>gi|296827792|ref|XP_002851225.1| progesterone binding protein [Arthroderma otae CBS 113480]
 gi|238838779|gb|EEQ28441.1| progesterone binding protein [Arthroderma otae CBS 113480]
          Length = 123

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 75/114 (65%), Gaps = 1/114 (0%)

Query: 6   SSVSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYH 65
           S ++P    L+PPKD PI+  +LAK DGSD + P  +A+KGTVFDVS     Y   G+Y+
Sbjct: 6   SIMTPVATNLNPPKDDPISVADLAKSDGSDPSRPTLVAIKGTVFDVSG-NPAYAKGGNYN 64

Query: 66  LFAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           +FAGKD+S+ L  SSL  ED +  +S L + +  VL DW+ FF  RYNIVGKV 
Sbjct: 65  VFAGKDSSRALAKSSLKPEDCVPQWSDLGDKEKGVLEDWFKFFSKRYNIVGKVA 118



>gi|85101543|ref|XP_961173.1| hypothetical protein NCU04213 [Neurospora crassa OR74A]
 gi|21622359|emb|CAD36990.1| conserved hypothetical protein [Neurospora crassa]
 gi|28922713|gb|EAA31937.1| predicted protein [Neurospora crassa OR74A]
 gi|336472178|gb|EGO60338.1| hypothetical protein NEUTE1DRAFT_119539 [Neurospora tetrasperma
           FGSC 2508]
 gi|350294602|gb|EGZ75687.1| cytochrome b5 [Neurospora tetrasperma FGSC 2509]
          Length = 121

 Score =  110 bits (275), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 71/105 (67%), Gaps = 2/105 (1%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +L+PPKD PI+ EELAK +G+D     Y+A+KG V+DV+  +  Y P GSYH+FAGKDAS
Sbjct: 12  QLNPPKDDPISVEELAKANGADGG-KCYVAIKGIVYDVTGNK-AYQPGGSYHVFAGKDAS 69

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           + LG +S   ED   D+  LD+     LNDW  FF  RYN+VGKV
Sbjct: 70  RALGKTSTKAEDVRPDWQDLDDKDKSTLNDWITFFSKRYNVVGKV 114



>gi|302914816|ref|XP_003051219.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256732157|gb|EEU45506.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 121

 Score =  110 bits (274), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 57/104 (54%), Positives = 71/104 (68%), Gaps = 2/104 (1%)

Query: 15  LDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASK 74
           LDPPKD PI+ EELA  DG D     Y+A+KG V+DV+  +  Y P GSY++FAGKDAS+
Sbjct: 13  LDPPKDDPISPEELAAADGRDGG-KCYVAIKGKVYDVTGNK-AYQPGGSYNVFAGKDASR 70

Query: 75  GLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            LG +S   EDA AD+  LD+ +  VLNDW  FF  RYN+VG V
Sbjct: 71  ALGKTSTKPEDARADWQDLDDKEKGVLNDWVTFFSKRYNVVGVV 114



>gi|482810074|gb|EOA86880.1| hypothetical protein SETTUDRAFT_115439 [Setosphaeria turcica Et28A]
          Length = 129

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 53/104 (50%), Positives = 73/104 (70%), Gaps = 1/104 (0%)

Query: 15  LDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASK 74
           L+PPKD  I  + LAK DG++   P  +A+KG VFDVS K + Y P   YH+FAGK+ ++
Sbjct: 20  LNPPKDDIIERDYLAKCDGTNEGYPTLVAIKGDVFDVSGK-ETYAPGKGYHVFAGKEPNR 78

Query: 75  GLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            LG+SSL  ED I+DYS L + + +VL+DW+ FF  RYNIVG++
Sbjct: 79  ALGLSSLKPEDCISDYSGLSDKEKQVLHDWHTFFSKRYNIVGRL 122



>gi|477530073|gb|ENH81815.1| progesterone binding protein [Colletotrichum orbiculare MAFF
           240422]
          Length = 122

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 70/105 (66%), Gaps = 1/105 (0%)

Query: 15  LDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASK 74
           LDPPKD PI+ EELAK DGSD N   Y+A+KG V+DV+  +  Y   GSY++FAGKDAS+
Sbjct: 13  LDPPKDDPISVEELAKADGSDPNGKTYVAIKGIVYDVTGNK-AYQEGGSYNVFAGKDASR 71

Query: 75  GLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            LG +S   ED   ++  L E +   LNDW  FF  RYN+VG+V 
Sbjct: 72  ALGKTSTKPEDVSPEWQDLPEKEKGTLNDWITFFSKRYNVVGRVA 116



>gi|512198737|gb|EPE27571.1| Cytochrome b5-like heme/steroid binding protein [Glarea lozoyensis
           ATCC 20868]
          Length = 129

 Score =  109 bits (273), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 72/112 (64%), Gaps = 9/112 (8%)

Query: 15  LDPPKDTPITSEELAKYDGSDTNLP--------IYLAVKGTVFDVSDKRDMYGPSGSYHL 66
           L PPKD PI++E L+K +G    +P         Y+A+KG VFDVS +  MY P GSYH+
Sbjct: 13  LAPPKDDPISTEFLSKCNGKPPLVPRDENSGGLCYVAIKGRVFDVS-RNKMYAPGGSYHV 71

Query: 67  FAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           FAG DAS+ LGM+S   ED + D+S L + +  VL DW+ FF  RYNIVG V
Sbjct: 72  FAGHDASRALGMTSTKAEDVVPDWSPLTDKEKSVLEDWFMFFSKRYNIVGMV 123



>gi|340923699|gb|EGS18602.1| putative heme binding protein [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 124

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 56/106 (52%), Positives = 71/106 (66%), Gaps = 2/106 (1%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           KLDPPKD PIT EELAK +G +     Y+A+KG V+DV+  +  Y P G YH+FAGKDAS
Sbjct: 12  KLDPPKDDPITPEELAKANGENGGK-CYVAIKGLVYDVTGNK-AYQPGGPYHVFAGKDAS 69

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           + LG +S   ED   ++  L + +  VLNDW  FF  RYN+VGKVV
Sbjct: 70  RALGKTSTKPEDVRPEWHDLSDKEKGVLNDWITFFSKRYNVVGKVV 115



>gi|225683699|gb|EEH21983.1| conserved hypothetical protein [Paracoccidioides brasiliensis Pb03]
 gi|226293060|gb|EEH48480.1| progesterone binding protein [Paracoccidioides brasiliensis Pb18]
          Length = 122

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 56/104 (53%), Positives = 70/104 (67%), Gaps = 1/104 (0%)

Query: 15  LDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASK 74
           LDPPKD  I+ EELAK DG+D N P  +A+KG VF+VS     YGP  +YH+FAGKDAS+
Sbjct: 14  LDPPKDDLISLEELAKSDGTDPNRPTLVAIKGVVFNVSGN-PAYGPGRNYHVFAGKDASR 72

Query: 75  GLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            L  SSL  ED   D+  L + +  VL +W+ FF  RYNIVG+V
Sbjct: 73  ALASSSLKPEDCRPDWYDLPDKEKGVLEEWFAFFSKRYNIVGRV 116



>gi|295665861|ref|XP_002793481.1| progesterone binding protein [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226277775|gb|EEH33341.1| progesterone binding protein [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 122

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 56/104 (53%), Positives = 70/104 (67%), Gaps = 1/104 (0%)

Query: 15  LDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASK 74
           LDPPKD  I+ EELAK DG+D N P  +A+KG VF+VS     YGP  +YH+FAGKDAS+
Sbjct: 14  LDPPKDDLISLEELAKSDGTDPNRPTLVAIKGVVFNVSGN-PAYGPGRNYHVFAGKDASR 72

Query: 75  GLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            L  SSL  ED   D+  L + +  VL +W+ FF  RYNIVG+V
Sbjct: 73  ALASSSLKPEDCRPDWYDLPDKEKGVLEEWFAFFSKRYNIVGRV 116



>gi|346318737|gb|EGX88339.1| progesterone binding protein, putative [Cordyceps militaris CM01]
          Length = 236

 Score =  109 bits (272), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 56/106 (52%), Positives = 73/106 (68%), Gaps = 2/106 (1%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +L+PPKD PIT EEL+K +G D++  IY+A+KG V+DV+     Y P  +YH+F GKDAS
Sbjct: 12  QLNPPKDDPITLEELSKCNGVDSD-KIYVAIKGKVYDVTGNPS-YLPGKAYHVFTGKDAS 69

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           + LGM+S   ED +AD+S L E +  VL DW  FF  RYNIVG V 
Sbjct: 70  RALGMTSTKPEDVVADWSTLSEKEKGVLQDWITFFSKRYNIVGVVA 115



>gi|302498316|ref|XP_003011156.1| hypothetical protein ARB_02678 [Arthroderma benhamiae CBS 112371]
 gi|291174704|gb|EFE30516.1| hypothetical protein ARB_02678 [Arthroderma benhamiae CBS 112371]
          Length = 192

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 74/114 (64%), Gaps = 1/114 (0%)

Query: 6   SSVSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYH 65
           S +SP    L+PPK  PI+  +LAK DGSD + PI +A+KG VFDVS     Y   G+Y+
Sbjct: 75  SIMSPVATNLNPPKSDPISLADLAKSDGSDPSRPILVAIKGDVFDVSG-NSAYAKGGNYN 133

Query: 66  LFAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           +FAGKD+S+ L  SSL  ED +  +S L + +  VL DW+ FF  RYNIVGKV 
Sbjct: 134 VFAGKDSSRALAKSSLKPEDCVPQWSDLGDKEKGVLEDWHKFFSKRYNIVGKVA 187



>gi|327301715|ref|XP_003235550.1| progesterone binding protein [Trichophyton rubrum CBS 118892]
 gi|326462902|gb|EGD88355.1| progesterone binding protein [Trichophyton rubrum CBS 118892]
          Length = 123

 Score =  108 bits (271), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 75/114 (65%), Gaps = 1/114 (0%)

Query: 6   SSVSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYH 65
           S +SP    L+PPK+ PI+  +LAK DGSD + PI +A+KG VFDVS     Y   G+Y+
Sbjct: 6   SIMSPVATNLNPPKNDPISLADLAKSDGSDPSRPILVAIKGDVFDVSG-NSAYAKGGNYN 64

Query: 66  LFAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           +FAGKD+S+ L  SSL  ED +  +S L + +  VL DW+ FF  RYNIVGKV 
Sbjct: 65  VFAGKDSSRALAKSSLKPEDCVPQWSDLGDKEKGVLEDWHKFFSKRYNIVGKVA 118



>gi|453088737|gb|EMF16777.1| cytochrome b5 [Mycosphaerella populorum SO2202]
          Length = 121

 Score =  108 bits (270), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 72/118 (61%), Gaps = 5/118 (4%)

Query: 1   MNFNPSSVSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGP 60
           M+F P         LDPPKD  IT E L+K DG     P Y+A+KGTVFDV+  +  YGP
Sbjct: 1   MSFEPKQ----KVDLDPPKDDIITLEYLSKCDGKHEGYPTYVAIKGTVFDVTGNK-AYGP 55

Query: 61  SGSYHLFAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            GSY +FAG+DAS+ L  SSL  +    D+  L + Q KVL+DW  FF  RYNI GKV
Sbjct: 56  DGSYKVFAGRDASRALAQSSLKEDQCRPDWYDLTDDQKKVLSDWCTFFSKRYNIKGKV 113



>gi|326469987|gb|EGD93996.1| progesterone binding protein [Trichophyton tonsurans CBS 112818]
          Length = 123

 Score =  108 bits (269), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 74/114 (64%), Gaps = 1/114 (0%)

Query: 6   SSVSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYH 65
           S +SP    L+PPK  PI+  +LAK DGSD + PI +A+KG VFDVS     Y   G+Y+
Sbjct: 6   SIMSPVATNLNPPKSDPISLADLAKSDGSDPSRPILVAIKGDVFDVSG-NSAYAKGGNYN 64

Query: 66  LFAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           +FAGKD+S+ L  SSL  ED +  +S L + +  VL DW+ FF  RYNIVGKV 
Sbjct: 65  VFAGKDSSRALAKSSLKPEDCVPQWSDLGDKEKGVLEDWHKFFSKRYNIVGKVA 118



>gi|169610956|ref|XP_001798896.1| hypothetical protein SNOG_08587 [Phaeosphaeria nodorum SN15]
 gi|160702188|gb|EAT83755.2| hypothetical protein SNOG_08587 [Phaeosphaeria nodorum SN15]
          Length = 164

 Score =  108 bits (269), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 70/104 (67%), Gaps = 1/104 (0%)

Query: 15  LDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASK 74
           L PPKD  I  + LAK DG++   P  +A+K  VFDVS K + Y P   YH+FAGK+ +K
Sbjct: 54  LQPPKDDIIDRDHLAKCDGTNEGYPTLVAIKADVFDVSGK-ETYAPGKGYHVFAGKEPNK 112

Query: 75  GLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            LG+SSL  ED I+D+S L + + + L+DW+ FF  RYNIVG++
Sbjct: 113 ALGLSSLKPEDCISDFSTLSDKEKQTLHDWHTFFSKRYNIVGRL 156



>gi|116780127|gb|ABK21560.1| unknown [Picea sitchensis]
          Length = 101

 Score =  107 bits (268), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 52/97 (53%), Positives = 68/97 (70%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
            T EEL KY+GSD++ PIY+A+KG VFDVS  ++ YGP GSY +FAGKDAS+ L   S N
Sbjct: 5   FTEEELLKYNGSDSSKPIYVAIKGRVFDVSSGKNFYGPGGSYAVFAGKDASRALAKMSKN 64

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            ED  A    L E ++ VL DW   F+A+Y++VG+VV
Sbjct: 65  EEDVSASLDGLTEKEIGVLEDWEKKFEAKYSVVGRVV 101



>gi|367023895|ref|XP_003661232.1| hypothetical protein MYCTH_2314458 [Myceliophthora thermophila ATCC
           42464]
 gi|347008500|gb|AEO55987.1| hypothetical protein MYCTH_2314458 [Myceliophthora thermophila ATCC
           42464]
          Length = 121

 Score =  107 bits (267), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 70/105 (66%), Gaps = 2/105 (1%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +LDPPKD PI+ EELAK +G +     Y+A+KG V+DV+  +  Y P G+YH+FAGKDAS
Sbjct: 12  QLDPPKDDPISPEELAKANGENGGK-CYVAIKGIVYDVTGNK-AYQPGGAYHVFAGKDAS 69

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           + LG +S   ED   ++  L E +   LNDW  FF  RYN+VGKV
Sbjct: 70  RALGKTSTKPEDVSPEWRDLPEKEQSTLNDWITFFSKRYNVVGKV 114



>gi|315056869|ref|XP_003177809.1| progesterone binding protein [Arthroderma gypseum CBS 118893]
 gi|311339655|gb|EFQ98857.1| progesterone binding protein [Arthroderma gypseum CBS 118893]
          Length = 123

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 74/114 (64%), Gaps = 1/114 (0%)

Query: 6   SSVSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYH 65
           S +SP    L+PPK  PI+  +LAK DGSD + P  +A+KG VFDVS     Y   G+Y+
Sbjct: 6   SIMSPVATNLNPPKSDPISLADLAKSDGSDPSRPTLVAIKGDVFDVSGNA-AYAKGGNYN 64

Query: 66  LFAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           +FAGKD+S+ L  SSL  ED + ++S L + +  VL DW+ FF  RYNIVGKV 
Sbjct: 65  VFAGKDSSRALAKSSLKPEDCVPEWSDLGDKEKGVLEDWHKFFSKRYNIVGKVA 118



>gi|320037952|gb|EFW19888.1| progesterone binding protein [Coccidioides posadasii str. Silveira]
 gi|392871471|gb|EAS33388.2| progesterone binding protein [Coccidioides immitis RS]
          Length = 123

 Score =  107 bits (266), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 54/111 (48%), Positives = 74/111 (66%), Gaps = 1/111 (0%)

Query: 8   VSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLF 67
           +SP  K L+PPK  PI+ +EL++ DG D + P  +A+KG VFDVS     Y P G+Y++F
Sbjct: 8   MSPEVKNLNPPKYDPISLDELSRSDGKDPSRPTLVAIKGIVFDVSGN-PAYKPGGNYNVF 66

Query: 68  AGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           AGKDAS+ L  SSL  ED   ++  L++ +  VL +W+ FF  RYNIVGKV
Sbjct: 67  AGKDASRALARSSLKPEDCRPEWQDLEDKEKGVLEEWFSFFSKRYNIVGKV 117



>gi|380485331|emb|CCF39431.1| cytochrome b5-like Heme/Steroid binding domain-containing protein
           [Colletotrichum higginsianum]
          Length = 122

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 70/105 (66%), Gaps = 1/105 (0%)

Query: 15  LDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASK 74
           L PPKD PIT +ELAK DGSD N   Y+A+KG V+DV+  +  Y P GSY++FAGKDAS+
Sbjct: 13  LAPPKDDPITLDELAKADGSDPNGKTYVAIKGIVYDVTGNK-AYQPGGSYNVFAGKDASR 71

Query: 75  GLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            LG +S   ED   ++  L + +   L+DW  FF  RYN+VG+V 
Sbjct: 72  ALGKTSTKAEDVSPEWQDLPDKEKGTLSDWVTFFSKRYNVVGRVA 116



>gi|116785384|gb|ABK23702.1| unknown [Picea sitchensis]
 gi|116785715|gb|ABK23832.1| unknown [Picea sitchensis]
 gi|148910049|gb|ABR18108.1| unknown [Picea sitchensis]
          Length = 101

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 51/99 (51%), Positives = 67/99 (67%)

Query: 21  TPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSS 80
           T  T EEL KY+GSD++ PIY+A+KG VFDVS  ++ YGP  SY +FAG+DAS+ L   S
Sbjct: 3   TEFTEEELVKYNGSDSSKPIYVAIKGRVFDVSSGKNFYGPGESYAMFAGRDASRALAKMS 62

Query: 81  LNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            N ED  A    L E ++ VL DW   F+A+Y +VG+VV
Sbjct: 63  KNEEDICASLDGLTEKEIGVLEDWEKKFEAKYPVVGRVV 101



>gi|358395749|gb|EHK45136.1| hypothetical protein TRIATDRAFT_299847 [Trichoderma atroviride IMI
           206040]
          Length = 120

 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 72/105 (68%), Gaps = 2/105 (1%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +LDPPKD PI+  +LAK DG++     Y+A+KG V+DVS  + MY P GSYH+FAGKDAS
Sbjct: 12  QLDPPKDDPISLGDLAKADGTNGEKS-YVAIKGKVYDVSGNK-MYQPGGSYHVFAGKDAS 69

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           + LGM+S+  ED   D+  L + +  VL DW  FF  RYN+VG V
Sbjct: 70  RALGMTSVKPEDVRPDWHDLPDKEKGVLEDWITFFSKRYNVVGVV 114



>gi|475665657|gb|EMT63449.1| Putative steroid-binding protein 3 [Fusarium oxysporum f. sp.
           cubense race 4]
          Length = 121

 Score =  105 bits (261), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 55/104 (52%), Positives = 71/104 (68%), Gaps = 2/104 (1%)

Query: 15  LDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASK 74
           LDPPKD  I+ EELAK +G+D N   Y+A+KG V+DV+  +  Y P  SY++FAGKDAS+
Sbjct: 13  LDPPKDDIISREELAKANGADGN-KCYVAIKGKVYDVTGNK-AYLPGASYNVFAGKDASR 70

Query: 75  GLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            LG +S   EDA  ++  LDE +  VLNDW  FF  RYN+VG V
Sbjct: 71  ALGKTSTKPEDARPEWQDLDEKEKGVLNDWVTFFSKRYNVVGVV 114



>gi|225430523|ref|XP_002285572.1| PREDICTED: uncharacterized protein LOC100252604 [Vitis vinifera]
 gi|147864286|emb|CAN83013.1| hypothetical protein VITISV_010105 [Vitis vinifera]
 gi|296082154|emb|CBI21159.3| unnamed protein product [Vitis vinifera]
          Length = 99

 Score =  105 bits (261), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 68/97 (70%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           +T+E+L ++DGSD + PIY+AVKG +FDV+  +  YGP GSY +FAGKDAS+ L   S N
Sbjct: 3   VTAEQLKQFDGSDPSKPIYVAVKGRIFDVTTGKSFYGPGGSYCMFAGKDASRALAKMSKN 62

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            ED       L E ++ VLNDW + F+A+Y +VG+V+
Sbjct: 63  EEDVSPSLDGLSEKEMGVLNDWENKFQAKYPVVGRVI 99



>gi|342887537|gb|EGU87019.1| hypothetical protein FOXB_02413 [Fusarium oxysporum Fo5176]
 gi|477509158|gb|ENH62450.1| Putative steroid-binding protein 3 [Fusarium oxysporum f. sp.
           cubense race 1]
          Length = 121

 Score =  105 bits (261), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 55/104 (52%), Positives = 71/104 (68%), Gaps = 2/104 (1%)

Query: 15  LDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASK 74
           LDPPKD  I+ EELAK +G+D N   Y+A+KG V+DV+  +  Y P  SY++FAGKDAS+
Sbjct: 13  LDPPKDDIISREELAKANGADGN-KCYVAIKGKVYDVTGNK-AYLPGASYNVFAGKDASR 70

Query: 75  GLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            LG +S   EDA  ++  LDE +  VLNDW  FF  RYN+VG V
Sbjct: 71  ALGKTSTKPEDARPEWQDLDEKEKGVLNDWITFFSKRYNVVGVV 114



>gi|46137289|ref|XP_390336.1| hypothetical protein FG10160.1 [Fusarium graminearum PH-1]
 gi|408398069|gb|EKJ77205.1| hypothetical protein FPSE_02655 [Fusarium pseudograminearum CS3096]
          Length = 122

 Score =  104 bits (259), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 53/104 (50%), Positives = 69/104 (66%), Gaps = 1/104 (0%)

Query: 15  LDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASK 74
           LDPPKD  I+ EELAK +G+      Y+A+KG V+DV+  +  Y P  SY++FAGKDAS+
Sbjct: 13  LDPPKDDIISKEELAKANGATEGGKCYVAIKGKVYDVTGNK-AYLPGASYNVFAGKDASR 71

Query: 75  GLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            L  SS   EDA+ ++  LD+ +  VLNDW  FF  RYNIVG V
Sbjct: 72  ALAKSSTKQEDALPEWQDLDDKEKGVLNDWITFFSKRYNIVGVV 115



>gi|470111483|ref|XP_004291977.1| PREDICTED: probable steroid-binding protein 3-like [Fragaria vesca
           subsp. vesca]
          Length = 100

 Score =  103 bits (258), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 49/97 (50%), Positives = 68/97 (70%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           +T+EEL +Y+G+D + PIY+AVKG VFDVS+ +  YGP G Y +FAGKDAS+ L   + N
Sbjct: 3   LTAEELIQYNGTDPSKPIYVAVKGRVFDVSNGKSFYGPGGPYAMFAGKDASRALAKMTKN 62

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            ED  AD   L + ++ VL DW + F A+Y +VG+VV
Sbjct: 63  EEDITADLQGLSDKEIGVLTDWENKFVAKYPVVGRVV 99



>gi|399171110|emb|CCE28204.1| uncharacterized protein CPUR_01678 [Claviceps purpurea 20.1]
          Length = 121

 Score =  103 bits (256), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 52/105 (49%), Positives = 71/105 (67%), Gaps = 2/105 (1%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +L+PPKD PI+ +ELAK +G++     Y+A+KG V+DV+     Y P GSY++FAGKDAS
Sbjct: 12  QLNPPKDDPISKDELAKANGTEGGT-CYVAIKGKVYDVTG-NSAYQPGGSYNVFAGKDAS 69

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           + LGM+S   ED   ++  L E + + LNDW  FF  RYNIVG V
Sbjct: 70  RALGMTSTKPEDIRPEWHDLSEKEKETLNDWNTFFSKRYNIVGVV 114



>gi|500255984|gb|EON99313.1| putative progesterone binding protein [Togninia minima UCRPA7]
          Length = 121

 Score =  102 bits (255), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 69/105 (65%), Gaps = 2/105 (1%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +LDPPKD PI+ EELAK DG       Y+A+KG V+DV+  +  Y P GSY++FAGKDAS
Sbjct: 12  QLDPPKDDPISLEELAKADGK-AGGKCYVAIKGKVYDVTGNK-AYQPGGSYNVFAGKDAS 69

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           + LG +S   ED  +D+  L + +   LNDW  FF  RYN+VG V
Sbjct: 70  RALGKTSTKPEDVRSDWKDLGDKEKSTLNDWVTFFSKRYNVVGVV 114



>gi|50553850|ref|XP_504336.1| YALI0E24079p [Yarrowia lipolytica]
 gi|49650205|emb|CAG79935.1| YALI0E24079p [Yarrowia lipolytica CLIB122]
          Length = 126

 Score =  102 bits (255), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 70/114 (61%), Gaps = 10/114 (8%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +LDPPKDTPIT  EL+  DG  +   +++ +KG VFDV+     YGP  +YH+F GKDAS
Sbjct: 10  QLDPPKDTPITLAELSLKDGVKSE-QLWVGIKGDVFDVTRNSKAYGPGTNYHVFCGKDAS 68

Query: 74  KGLGMSSLNLED-----AIADYSK----LDESQLKVLNDWYDFFKARYNIVGKV 118
           K LG SSL  ED      I  + +    L E  LK L +WY +F  RYNIVGK+
Sbjct: 69  KALGKSSLEEEDFAPAGEIISWQELTADLSEKDLKTLEEWYSYFSQRYNIVGKI 122



>gi|378729308|gb|EHY55767.1| hypothetical protein HMPREF1120_03891 [Exophiala dermatitidis
           NIH/UT8656]
          Length = 130

 Score =  102 bits (253), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 64/94 (68%), Gaps = 1/94 (1%)

Query: 26  EELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLNLED 85
           EELA+ DG++ + P  +A+KGTVFDVS K   Y   G YH+FAGKD S+ L +SSL  ED
Sbjct: 30  EELAQCDGTNPDKPTLVAIKGTVFDVS-KNPAYSEKGQYHVFAGKDPSRALALSSLKPED 88

Query: 86  AIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            + D+  LD+    VL++WY FF  RYNIVGKV 
Sbjct: 89  CVPDWDDLDDKYKTVLDEWYTFFSKRYNIVGKVA 122



>gi|440631926|gb|ELR01845.1| hypothetical protein GMDG_05032 [Geomyces destructans 20631-21]
          Length = 124

 Score =  102 bits (253), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 69/105 (65%), Gaps = 2/105 (1%)

Query: 15  LDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASK 74
           L+PPKD PIT E L+K +G+D   P Y+A+K  VFDV+ K + Y P GSY +F+G DAS+
Sbjct: 13  LNPPKDDPITVEHLSKCNGTD-GYPCYVAIKSVVFDVNGK-EPYLPGGSYSVFSGHDASR 70

Query: 75  GLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            L  +S    D   ++  LD+ +  VLNDWY FF  RYNIVGKV 
Sbjct: 71  ALAKTSTKASDVSPEWFDLDDKEKGVLNDWYTFFSKRYNIVGKVA 115



>gi|460398711|ref|XP_004244897.1| PREDICTED: probable steroid-binding protein 3-like [Solanum
           lycopersicum]
          Length = 112

 Score =  101 bits (252), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 49/97 (50%), Positives = 64/97 (65%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           +T++EL  YDGSD + PIY+A+KG +FDVS     YGP G Y +FAGKDAS+ L   S N
Sbjct: 15  LTADELKAYDGSDPSKPIYVAIKGRIFDVSAGNSFYGPGGPYCMFAGKDASRALAKMSKN 74

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            ED       L E ++ VLNDW   F+A+Y+IVG V+
Sbjct: 75  EEDVSPSLDGLSEKEMAVLNDWETKFEAKYSIVGNVI 111



>gi|501755768|emb|CCG81081.1| putative Progesterone binding protein [Taphrina deformans PYCC
           5710]
          Length = 144

 Score =  101 bits (252), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 47/105 (44%), Positives = 72/105 (68%), Gaps = 1/105 (0%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +LDPP+   +++  L+K  G D + P  +A+KG +FDVS K ++Y P   Y++F G+DAS
Sbjct: 33  QLDPPRTDAVSTTYLSKCTGKDGDYPTLVAIKGHIFDVS-KNEVYAPGKGYNVFTGRDAS 91

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
             LGM+SL+  D   D S L E++++ L+DW+ FF+ RYNIVG+V
Sbjct: 92  CALGMTSLDEGDCHDDISGLSEAEVQTLDDWFTFFQYRYNIVGRV 136



>gi|508782031|gb|EOY29287.1| Membrane-associated progesterone binding protein 2 [Theobroma
           cacao]
          Length = 101

 Score =  101 bits (251), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 69/97 (71%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           +T ++L++++G+D + PIYLAVKG ++DV+  +  YGP G+Y LFAGKDAS+ LG  S N
Sbjct: 3   LTPQQLSQFNGTDPSKPIYLAVKGVIYDVTAGKSFYGPGGAYALFAGKDASRALGKMSKN 62

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            ED   +   L + ++ VLNDW   F+A+Y +VG+VV
Sbjct: 63  EEDVCPNIDGLSDKEIDVLNDWVKKFEAKYPVVGRVV 99



>gi|472242835|gb|EMR87514.1| putative progesterone binding protein [Botryotinia fuckeliana
           BcDW1]
          Length = 131

 Score =  101 bits (251), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 71/104 (68%), Gaps = 2/104 (1%)

Query: 15  LDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASK 74
           L+PPK  PI+ EELAK +GSD++   Y+A+KG V+DV+  +  Y P G+YH+FAG DAS+
Sbjct: 13  LNPPKYDPISLEELAKCNGSDSD-KCYVAIKGKVYDVTGNK-AYLPDGAYHVFAGHDASR 70

Query: 75  GLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            L  +S   ED  +++  LDE +  VLNDW  FF  RYN+VG V
Sbjct: 71  ALAKTSTKAEDVSSEWFDLDEKEKGVLNDWNTFFSKRYNVVGLV 114



>gi|482564008|gb|EOA28198.1| hypothetical protein CARUB_v10024390mg [Capsella rubella]
          Length = 100

 Score =  100 bits (249), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 65/97 (67%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
            T+E+L++Y+G+D + PIY+A+KG VFDV+  +  YGP G Y +FAGKDAS+ LG  S N
Sbjct: 3   FTAEQLSQYNGTDGSKPIYVAIKGRVFDVTTGKSFYGPEGDYSMFAGKDASRALGKMSKN 62

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            ED       L E ++  LNDW   F A+Y +VG+VV
Sbjct: 63  EEDISPSLEGLTEKEMNTLNDWETKFVAKYPVVGRVV 99



>gi|462422949|gb|EMJ27212.1| hypothetical protein PRUPE_ppa013839mg [Prunus persica]
          Length = 100

 Score =  100 bits (249), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 67/97 (69%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           +T+++L +Y+G+D + PIY+A+KG VFDV+D +  YGP G Y +FAGKDAS+ L   + N
Sbjct: 3   LTAQQLIQYNGTDPSKPIYVALKGRVFDVTDGKSFYGPGGPYAMFAGKDASRALAKMTKN 62

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            ED  A    L E ++ VL DW   F+A+Y +VG+VV
Sbjct: 63  EEDITASLDGLSEKEIGVLTDWEKKFEAKYPVVGRVV 99



>gi|471572642|gb|EMR71027.1| putative progesterone binding protein [Eutypa lata UCREL1]
          Length = 121

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 68/104 (65%), Gaps = 2/104 (1%)

Query: 15  LDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASK 74
           LDPPKD PI+ ++LAK +G +     Y+A+KG V+DV+  +  Y   GSYH+FAGKDAS+
Sbjct: 13  LDPPKDDPISLDDLAKANGKEGQ-KAYVAIKGKVYDVTGNK-AYQAGGSYHVFAGKDASR 70

Query: 75  GLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            L  +S N +D   ++  LD+ Q   LNDW  FF  RYNIVG V
Sbjct: 71  ALAKTSTNADDVKPEWQDLDDKQKSTLNDWVTFFSNRYNIVGVV 114



>gi|159162523|pdb|1J03|A Chain A, Solution Structure Of A Putative Steroid-Binding Protein
           From Arabidopsis
          Length = 102

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 65/97 (67%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
            T+E+L++Y+G+D + PIY+A+KG VFDV+  +  YG  G Y +FAGKDAS+ LG  S N
Sbjct: 5   FTAEQLSQYNGTDESKPIYVAIKGRVFDVTTGKSFYGSGGDYSMFAGKDASRALGKMSKN 64

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            ED       L E ++  LNDW   F+A+Y +VG+VV
Sbjct: 65  EEDVSPSLEGLTEKEINTLNDWETKFEAKYPVVGRVV 101



>gi|303316408|ref|XP_003068206.1| Cytochrome b5-like Heme/Steroid binding domain containing protein
           [Coccidioides posadasii C735 delta SOWgp]
 gi|240107887|gb|EER26061.1| Cytochrome b5-like Heme/Steroid binding domain containing protein
           [Coccidioides posadasii C735 delta SOWgp]
          Length = 114

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 53/111 (47%), Positives = 73/111 (65%), Gaps = 3/111 (2%)

Query: 8   VSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLF 67
           +SP  K L+PPK  PI+ +EL++ D  D + P  +A+KG VFDVS     Y P G+Y++F
Sbjct: 1   MSPEVKNLNPPKYDPISLDELSRSD--DPSRPTLVAIKGIVFDVSGN-PAYKPGGNYNVF 57

Query: 68  AGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           AGKDAS+ L  SSL  ED   ++  L++ +  VL +W+ FF  RYNIVGKV
Sbjct: 58  AGKDASRALARSSLKPEDCRPEWQDLEDKEKGVLEEWFSFFSKRYNIVGKV 108



>gi|347828767|emb|CCD44464.1| similar to progesterone binding protein [Botryotinia fuckeliana T4]
          Length = 131

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 71/104 (68%), Gaps = 2/104 (1%)

Query: 15  LDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASK 74
           L+PPK  PI+ EELAK +GSD++   Y+A+KG V+DV+  +  Y P G+YH+FAG DAS+
Sbjct: 13  LNPPKYDPISLEELAKCNGSDSD-KCYVAIKGKVYDVTGNK-AYLPDGAYHVFAGHDASR 70

Query: 75  GLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            L  +S   ED  +++  LD+ +  VLNDW  FF  RYN+VG V
Sbjct: 71  ALAKTSTKAEDVSSEWFDLDDKEKGVLNDWNTFFSKRYNVVGLV 114



>gi|320592074|gb|EFX04513.1| progesterone-binding protein [Grosmannia clavigera kw1407]
          Length = 120

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 68/106 (64%), Gaps = 2/106 (1%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +L+PP+D PIT EEL++  G D     Y+A+KG V+DV+  +  Y P GSYH+FAG DAS
Sbjct: 12  QLNPPQDDPITLEELSQATGVDGG-KCYVAIKGKVYDVTGNKS-YQPGGSYHVFAGNDAS 69

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           + L  SS N  D   ++  LD  +  VL+DW  FF  RYN++G VV
Sbjct: 70  RALAKSSTNPADVKPEWKDLDSKEQGVLDDWITFFSKRYNVIGTVV 115



>gi|15224648|ref|NP_180066.1| membrane-associated progesterone binding protein 2 [Arabidopsis
           thaliana]
 gi|62903498|sp|Q9SK39.1|SBP3_ARATH RecName: Full=Probable steroid-binding protein 3; Short=AtMP3
 gi|4559358|gb|AAD23019.1| putative steroid binding protein [Arabidopsis thaliana]
 gi|21536553|gb|AAM60885.1| putative steroid binding protein [Arabidopsis thaliana]
 gi|27311681|gb|AAO00806.1| putative steroid binding protein [Arabidopsis thaliana]
 gi|30725550|gb|AAP37797.1| At2g24940 [Arabidopsis thaliana]
 gi|330252546|gb|AEC07640.1| putative steroid-binding protein 3 [Arabidopsis thaliana]
          Length = 100

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 65/97 (67%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
            T+E+L++Y+G+D + PIY+A+KG VFDV+  +  YG  G Y +FAGKDAS+ LG  S N
Sbjct: 3   FTAEQLSQYNGTDESKPIYVAIKGRVFDVTTGKSFYGSGGDYSMFAGKDASRALGKMSKN 62

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            ED       L E ++  LNDW   F+A+Y +VG+VV
Sbjct: 63  EEDVSPSLEGLTEKEINTLNDWETKFEAKYPVVGRVV 99



>gi|48425750|pdb|1T0G|A Chain A, Hypothetical Protein At2g24940.1 From Arabidopsis Thaliana
           Has A Cytochrome B5 Like Fold
          Length = 109

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 65/97 (67%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
            T+E+L++Y+G+D + PIY+A+KG VFDV+  +  YG  G Y +FAGKDAS+ LG  S N
Sbjct: 12  FTAEQLSQYNGTDESKPIYVAIKGRVFDVTTGKSFYGSGGDYSMFAGKDASRALGKMSKN 71

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            ED       L E ++  LNDW   F+A+Y +VG+VV
Sbjct: 72  EEDVSPSLEGLTEKEINTLNDWETKFEAKYPVVGRVV 108



>gi|297821855|ref|XP_002878810.1| membrane-associated progesterone binding protein 2 [Arabidopsis
           lyrata subsp. lyrata]
 gi|297324649|gb|EFH55069.1| membrane-associated progesterone binding protein 2 [Arabidopsis
           lyrata subsp. lyrata]
          Length = 100

 Score = 99.4 bits (246), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 65/97 (67%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
            T+E+L++Y+G+D + PIY+A+KG VFDV+  +  YG  G Y +FAGKDAS+ LG  S N
Sbjct: 3   FTAEQLSQYNGTDESKPIYVAIKGRVFDVTTGKSFYGSGGDYAMFAGKDASRALGKMSKN 62

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            ED       L E ++  LNDW   F+A+Y +VG+VV
Sbjct: 63  EEDVSPSLEGLTEKEINTLNDWETKFEAKYPVVGRVV 99



>gi|406867867|gb|EKD20904.1| cytochrome b5-like Heme/Steroid binding domain-containing protein
           [Marssonina brunnea f. sp. 'multigermtubi' MB_m1]
          Length = 122

 Score = 99.0 bits (245), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 54/106 (50%), Positives = 68/106 (64%), Gaps = 4/106 (3%)

Query: 15  LDPPKDTPITSEELAKYDGSDT--NLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDA 72
           L PPK  PI+ E LAK +G+    NL  Y+A+KG VFDV+  +  Y P GSYH+FAG DA
Sbjct: 13  LAPPKSDPISPEFLAKCNGTQAPDNL-CYVAIKGKVFDVTGNKS-YVPGGSYHVFAGHDA 70

Query: 73  SKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           S+ LGM+S   ED   D++ L + +  VL DW  FF  RYNIVG V
Sbjct: 71  SRALGMTSTKPEDVRPDWADLPDKEKGVLEDWLTFFSKRYNIVGVV 116



>gi|367036683|ref|XP_003648722.1| hypothetical protein THITE_2106495 [Thielavia terrestris NRRL 8126]
 gi|346995983|gb|AEO62386.1| hypothetical protein THITE_2106495 [Thielavia terrestris NRRL 8126]
          Length = 121

 Score = 98.6 bits (244), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 50/105 (47%), Positives = 68/105 (64%), Gaps = 2/105 (1%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +L PPKD PI+ EELAK +G +     Y+A+KG V+DV+  +  Y P G+Y++FAGKDAS
Sbjct: 12  QLAPPKDDPISVEELAKANGENGGK-CYVAIKGIVYDVTGNK-AYQPGGAYNVFAGKDAS 69

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           + L  +S   ED   D+  L + +   LNDW  FF  RYN+VGKV
Sbjct: 70  RALAKTSTKPEDVRPDWQDLPDKEKSTLNDWVTFFSKRYNVVGKV 114



>gi|189205845|ref|XP_001939257.1| conserved hypothetical protein [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187975350|gb|EDU41976.1| conserved hypothetical protein [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 154

 Score = 98.6 bits (244), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 53/127 (41%), Positives = 73/127 (57%), Gaps = 24/127 (18%)

Query: 15  LDPPKDTPITSEELAKYDG-----------------------SDTNLPIYLAVKGTVFDV 51
           L+PPKD  I    LAK DG                       ++   P  +A+KG VFDV
Sbjct: 21  LNPPKDDVIDRAYLAKCDGALPKTTHFYMHYLGHRPLILQAGTNEGYPTLVAIKGDVFDV 80

Query: 52  SDKRDMYGPSGSYHLFAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKAR 111
           S K + Y P   YH+FAGK+ ++ LG+SSL  ED I+DYS+L + + +VLNDW+ FF  R
Sbjct: 81  SGK-ETYAPGKGYHVFAGKEPNRALGLSSLKPEDCISDYSELTDKEKQVLNDWHTFFSKR 139

Query: 112 YNIVGKV 118
           YN+VG++
Sbjct: 140 YNVVGRL 146



>gi|53748439|emb|CAH59414.1| hypothetical protein [Plantago major]
          Length = 101

 Score = 98.2 bits (243), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 68/97 (70%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           +T+E+L +YDGSD + PIY+A++G ++DV+  +  YGP G+Y LF+GKDAS+ L   S N
Sbjct: 3   LTTEQLKQYDGSDPSKPIYVAIRGKIYDVTTGKSFYGPGGTYCLFSGKDASRALAKMSKN 62

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            ED ++    L + ++ VL+DW   F+A+Y +VG V+
Sbjct: 63  EEDVVSSLHGLSDKEIGVLDDWEKKFQAKYPLVGTVI 99



>gi|340517441|gb|EGR47685.1| predicted protein [Trichoderma reesei QM6a]
          Length = 120

 Score = 97.8 bits (242), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 51/105 (48%), Positives = 66/105 (62%), Gaps = 2/105 (1%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +LDPPK  PI+ E LA  +G D     Y+A+KG V+DV+  +  Y P GSYH+FAGKDAS
Sbjct: 12  QLDPPKSDPISLETLAAANGVD-GAKTYVAIKGKVYDVTGNK-AYQPGGSYHVFAGKDAS 69

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           + LG +S   ED   D+S L + +   L DW  FF  RYN+VG V
Sbjct: 70  RALGKTSTKPEDVSPDWSDLTDKEKDTLEDWVTFFSKRYNVVGVV 114



>gi|255548688|ref|XP_002515400.1| steroid binding protein, putative [Ricinus communis]
 gi|223545344|gb|EEF46849.1| steroid binding protein, putative [Ricinus communis]
          Length = 101

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 65/97 (67%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
            T+E+L +++G+D + PIYLA+KG VFDV+  +  YGP GSY +F+GKDAS+ L   S N
Sbjct: 3   FTAEQLIQFNGTDPSKPIYLAIKGRVFDVTAGKSFYGPGGSYAMFSGKDASRALAKMSKN 62

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            ED       L E ++ VLNDW   F+ +Y IVG+VV
Sbjct: 63  DEDISPSLDGLTEKEMGVLNDWEKKFEVKYPIVGRVV 99



>gi|389635765|ref|XP_003715535.1| hypothetical protein MGG_12396 [Magnaporthe oryzae 70-15]
 gi|351647868|gb|EHA55728.1| hypothetical protein MGG_12396 [Magnaporthe oryzae 70-15]
 gi|440465037|gb|ELQ34380.1| hypothetical protein OOU_Y34scaffold00768g24 [Magnaporthe oryzae
           Y34]
 gi|440482025|gb|ELQ62552.1| hypothetical protein OOW_P131scaffold01066g11 [Magnaporthe oryzae
           P131]
          Length = 122

 Score = 97.4 bits (241), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 51/103 (49%), Positives = 64/103 (62%), Gaps = 3/103 (2%)

Query: 15  LDPPK-DTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           LDPPK D  I  EEL K  G +     Y+A+KG V+DV+  +  Y P GSYH+FAG DAS
Sbjct: 13  LDPPKLDVKIAREELEKATGENGG-KCYVAIKGLVYDVTGNK-AYQPGGSYHVFAGHDAS 70

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVG 116
           + LG +S   E+   D+  LDE +  VLNDW  FF  RYN+VG
Sbjct: 71  RALGKTSTKAENVSPDWKTLDEKEQGVLNDWITFFSKRYNVVG 113



>gi|470443171|ref|XP_004339620.1| cytochrome b-like heme/steroid binding domain containing protein
           [Acanthamoeba castellanii str. Neff]
 gi|440796498|gb|ELR17607.1| cytochrome b-like heme/steroid binding domain containing protein
           [Acanthamoeba castellanii str. Neff]
          Length = 152

 Score = 97.1 bits (240), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 77/125 (61%), Gaps = 9/125 (7%)

Query: 3   FNPSSVSPPNKKLDPPKDTPI-----TSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDM 57
           F  +   PP   +   K TP+     + +EL K +G++ N P+Y+AV G V+DVS +   
Sbjct: 17  FPGAVAQPPVASIASRKRTPVEPRDFSPDELRKMNGTNGN-PVYVAVLGVVYDVSSRASF 75

Query: 58  YGPSGSYHLFAGKDASKGLGMSSLNLEDAIADYSKLDE---SQLKVLNDWYDFFKARYNI 114
           YGP G YH+FAG+DA++ L + SL  +D  A Y KLD+   S+ + LNDW   ++A+Y +
Sbjct: 76  YGPGGPYHIFAGRDAARALALGSLEEKDVEAPYPKLDDLQPSEREALNDWIGSYQAKYEV 135

Query: 115 VGKVV 119
           VG+++
Sbjct: 136 VGRII 140



>gi|302421676|ref|XP_003008668.1| progesterone binding protein [Verticillium albo-atrum VaMs.102]
 gi|261351814|gb|EEY14242.1| progesterone binding protein [Verticillium albo-atrum VaMs.102]
          Length = 121

 Score = 96.3 bits (238), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 50/105 (47%), Positives = 68/105 (64%), Gaps = 2/105 (1%)

Query: 15  LDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASK 74
           L PPKD PIT EELA  +G D     Y+A+KG V+DV+  +  Y   GSY++FAGKDAS+
Sbjct: 13  LAPPKDDPITLEELAAANGVDGG-KCYVAIKGKVYDVTGNK-AYQQGGSYNVFAGKDASR 70

Query: 75  GLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            LG +S  +ED   ++  LD+ +   L+DW  +F  RYN+VG VV
Sbjct: 71  ALGKTSTKIEDVRPEWHDLDDKEKSTLDDWNTYFSKRYNVVGYVV 115



>gi|485617628|gb|EOD14803.1| hypothetical protein EMIHUDRAFT_426038 [Emiliania huxleyi CCMP1516]
          Length = 157

 Score = 95.9 bits (237), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 60/97 (61%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
            T +EL  Y+G D   P+ LA+KG V DVS   D YGP G Y +FAGKDASKG  M SL 
Sbjct: 61  FTKDELLAYNGMDRRKPLLLALKGRVIDVSAGADFYGPGGPYGIFAGKDASKGFAMMSLK 120

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            EDA +D + +D+  LK+L+DWY     +Y  VG V 
Sbjct: 121 EEDAHSDLTGVDDDHLKILDDWYSKLTGKYPTVGHVA 157



>gi|357465989|ref|XP_003603279.1| hypothetical protein MTR_3g105860 [Medicago truncatula]
 gi|355492327|gb|AES73530.1| hypothetical protein MTR_3g105860 [Medicago truncatula]
 gi|388512437|gb|AFK44280.1| unknown [Medicago truncatula]
 gi|388521009|gb|AFK48566.1| unknown [Medicago truncatula]
          Length = 100

 Score = 95.9 bits (237), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 66/97 (68%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           +T+++L++Y+G+D + PIY+AVKG V+DV+  +  YGP G+Y +FAGKDAS+ L   S N
Sbjct: 3   MTAQQLSEYNGTDPSKPIYVAVKGRVYDVTTGKSFYGPGGAYAMFAGKDASRALAKMSKN 62

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            ED  +    L E ++ VLNDW   F A+Y +V  +V
Sbjct: 63  EEDITSSLDGLTEKEIGVLNDWETKFVAKYPVVATIV 99



>gi|4960154|gb|AAD34615.1|AF153283_1 putative progesterone-binding protein homolog [Arabidopsis
           thaliana]
          Length = 253

 Score = 94.7 bits (234), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 65/112 (58%), Gaps = 1/112 (0%)

Query: 8   VSPPNKKLDPPKDT-PITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHL 66
           V P ++ L PP     IT EEL  YDGSD+  P+ +A+KG ++DVS  R  YGP G Y L
Sbjct: 55  VQPQSEPLPPPVQLGEITEEELKLYDGSDSKKPLLMAIKGQIYDVSQSRMFYGPGGPYAL 114

Query: 67  FAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           FAGKDAS+ L   S   +D   D S L   +L+ L DW   F ++Y  VG +
Sbjct: 115 FAGKDASRALAKMSFEDQDLTGDISGLGAFELEALQDWEYKFMSKYVKVGTI 166



>gi|346974856|gb|EGY18308.1| progesterone binding protein [Verticillium dahliae VdLs.17]
          Length = 121

 Score = 94.7 bits (234), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 50/105 (47%), Positives = 67/105 (63%), Gaps = 2/105 (1%)

Query: 15  LDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASK 74
           L PPKD PIT EELA  +G D     Y+A+KG V+DV+  +  Y   GSY++FAGKDAS+
Sbjct: 13  LAPPKDDPITLEELAAANGVDGG-KCYVAIKGKVYDVTGNK-AYQQGGSYNVFAGKDASR 70

Query: 75  GLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            LG +S   ED   ++  LD+ +   L+DW  +F  RYN+VG VV
Sbjct: 71  ALGKTSTKAEDVRPEWHDLDDKEKSTLDDWNTYFSKRYNVVGYVV 115



>gi|412988370|emb|CCO17706.1| predicted protein [Bathycoccus prasinos]
          Length = 149

 Score = 94.7 bits (234), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 50/103 (48%), Positives = 63/103 (61%), Gaps = 5/103 (4%)

Query: 20  DTPITSEELAKYDGSDTNLP----IYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKG 75
           D  +T EEL +Y G  TN      IYL  K  V+DV+  +D YGP G Y  FAG+DAS+ 
Sbjct: 44  DVIVTREELMRYTGGGTNHSQEKRIYLCCKDIVYDVTAAKDFYGPEGPYANFAGRDASRA 103

Query: 76  LGMSSLNLEDAI-ADYSKLDESQLKVLNDWYDFFKARYNIVGK 117
           L + SL +ED    D S LD+ QL VLNDW   FK++Y IVG+
Sbjct: 104 LALMSLKIEDVENTDLSDLDDEQLSVLNDWERKFKSKYKIVGR 146



>gi|125543658|gb|EAY89797.1| hypothetical protein OsI_11345 [Oryza sativa Indica Group]
          Length = 190

 Score = 94.7 bits (234), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 47/103 (45%), Positives = 62/103 (60%)

Query: 16  DPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKG 75
           DP +   IT E+LA YDG D   PI +A++G V+DV+  R  YGP G Y LFAG+DA++ 
Sbjct: 74  DPVQVGEITLEQLAAYDGKDPAKPILIAIRGQVYDVTRGRLFYGPQGPYSLFAGRDATRA 133

Query: 76  LGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           L + S +  D   D   L   +L+VL DW D FK RY  VG +
Sbjct: 134 LALMSFDPIDLTGDLDGLGPDELEVLQDWEDKFKERYPTVGHL 176



>gi|115452713|ref|NP_001049957.1| Os03g0321000 [Oryza sativa Japonica Group]
 gi|108707869|gb|ABF95664.1| Membrane steroid binding protein 1, putative, expressed [Oryza
           sativa Japonica Group]
 gi|113548428|dbj|BAF11871.1| Os03g0321000 [Oryza sativa Japonica Group]
 gi|215737260|dbj|BAG96189.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 191

 Score = 94.7 bits (234), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 47/103 (45%), Positives = 62/103 (60%)

Query: 16  DPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKG 75
           DP +   IT E+LA YDG D   PI +A++G V+DV+  R  YGP G Y LFAG+DA++ 
Sbjct: 75  DPVQVGEITLEQLAAYDGKDPAKPILIAIRGQVYDVTRGRLFYGPQGPYSLFAGRDATRA 134

Query: 76  LGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           L + S +  D   D   L   +L+VL DW D FK RY  VG +
Sbjct: 135 LALMSFDPIDLTGDLDGLGPDELEVLQDWEDKFKERYPTVGHL 177



>gi|402081993|gb|EJT77138.1| hypothetical protein GGTG_07050 [Gaeumannomyces graminis var.
           tritici R3-111a-1]
          Length = 130

 Score = 94.7 bits (234), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 67/106 (63%), Gaps = 3/106 (2%)

Query: 14  KLDPPK-DTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDA 72
           +LDPPK D  I+ ++LAK  G +     Y+ +KG V+DV+  R  Y P G+YH+FAGKDA
Sbjct: 13  ELDPPKLDVKISKDDLAKAIGLEDGT-CYVGIKGLVYDVTGNR-AYQPGGAYHVFAGKDA 70

Query: 73  SKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           S+ L  SS   ED   ++  LDE +  VLNDW  FF  RYN+VG +
Sbjct: 71  SRALAKSSTQAEDVSPEWKDLDEKEQGVLNDWITFFSKRYNVVGVI 116



>gi|15229044|ref|NP_190458.1| membrane-associated progesterone binding protein 3 [Arabidopsis
           thaliana]
 gi|59800223|sp|Q9M2Z4.1|MSBP2_ARATH RecName: Full=Membrane steroid-binding protein 2; Short=AtMP2
 gi|16930427|gb|AAL31899.1|AF419567_1 AT3g48890/T21J18_160 [Arabidopsis thaliana]
 gi|7576227|emb|CAB87917.1| putative progesterone-binding protein homolog Atmp2 [Arabidopsis
           thaliana]
 gi|19310509|gb|AAL84988.1| AT3g48890/T21J18_160 [Arabidopsis thaliana]
 gi|332644949|gb|AEE78470.1| membrane steroid-binding protein 2 [Arabidopsis thaliana]
          Length = 233

 Score = 94.7 bits (234), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 65/112 (58%), Gaps = 1/112 (0%)

Query: 8   VSPPNKKLDPPKDT-PITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHL 66
           V P ++ L PP     IT EEL  YDGSD+  P+ +A+KG ++DVS  R  YGP G Y L
Sbjct: 55  VQPQSEPLPPPVQLGEITEEELKLYDGSDSKKPLLMAIKGQIYDVSQSRMFYGPGGPYAL 114

Query: 67  FAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           FAGKDAS+ L   S   +D   D S L   +L+ L DW   F ++Y  VG +
Sbjct: 115 FAGKDASRALAKMSFEDQDLTGDISGLGAFELEALQDWEYKFMSKYVKVGTI 166



>gi|474201637|gb|EMS58506.1| Membrane steroid-binding protein 2 [Triticum urartu]
          Length = 140

 Score = 94.4 bits (233), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 60/96 (62%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           IT E+L  YDG D    I +A++G V+DVS  R  YGP G Y LFAG+DAS+ L + S +
Sbjct: 27  ITLEQLRAYDGKDPAKSILIAIRGQVYDVSRGRLFYGPQGPYSLFAGRDASRALALMSFD 86

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           L D   D   L   +L+VL DW + FK RY +VG++
Sbjct: 87  LNDLTGDLEGLSPDELEVLQDWEEKFKERYPVVGRL 122



>gi|224143346|ref|XP_002324923.1| predicted protein [Populus trichocarpa]
 gi|118484415|gb|ABK94084.1| unknown [Populus trichocarpa]
 gi|222866357|gb|EEF03488.1| predicted protein [Populus trichocarpa]
          Length = 100

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 67/97 (69%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
            T+++L +Y+G++ + PIY+A+KG VFDV+  +  YGP GSY +FAGKDAS+ L   S N
Sbjct: 3   FTADQLLQYNGTNPSNPIYVALKGRVFDVTTGKSFYGPGGSYAMFAGKDASRALAKMSKN 62

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            ED  +    L E ++ VL+DW   F+A+Y +VG+VV
Sbjct: 63  DEDISSSLHGLTEKEIGVLDDWEKKFEAKYPVVGRVV 99



>gi|297816096|ref|XP_002875931.1| membrane-associated progesterone binding protein 3 [Arabidopsis
           lyrata subsp. lyrata]
 gi|297321769|gb|EFH52190.1| membrane-associated progesterone binding protein 3 [Arabidopsis
           lyrata subsp. lyrata]
          Length = 232

 Score = 94.0 bits (232), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 50/112 (44%), Positives = 65/112 (58%), Gaps = 1/112 (0%)

Query: 8   VSPPNKKLDPPKDT-PITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHL 66
           V P ++ L PP     IT EEL  YDGSD+  P+ +A+KG ++DVS  R  YGP G Y L
Sbjct: 55  VQPQSEPLPPPVQLGEITEEELKLYDGSDSKKPLLMAIKGQIYDVSQSRMFYGPGGPYAL 114

Query: 67  FAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           FAGKDAS+ L   S   +D   D S L   +L+ L DW   F ++Y  VG +
Sbjct: 115 FAGKDASRALAKMSFEDQDLTGDISGLGAFELEALQDWEYKFMSKYVKVGTI 166



>gi|358388693|gb|EHK26286.1| hypothetical protein TRIVIDRAFT_86314 [Trichoderma virens Gv29-8]
          Length = 120

 Score = 94.0 bits (232), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/105 (46%), Positives = 64/105 (60%), Gaps = 2/105 (1%)

Query: 14  KLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           +LDPP+  PI+ E LA  +G D     Y+A+KG V+DV+  +  Y P GSYH FAGKDAS
Sbjct: 12  QLDPPRSDPISLEALAAANGVD-GAKTYVAIKGKVYDVTGNK-AYQPGGSYHAFAGKDAS 69

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           + LG +S   ED  A +  L + +   L DW  FF  RYN+VG V
Sbjct: 70  RALGKTSTKPEDVQAVWQDLSDKEKGTLEDWVTFFSKRYNVVGVV 114



>gi|303279859|ref|XP_003059222.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226459058|gb|EEH56354.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 110

 Score = 94.0 bits (232), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/103 (47%), Positives = 66/103 (64%), Gaps = 2/103 (1%)

Query: 17  PPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGL 76
           PP D  +T+EEL +YDGS+  LPI LA KG +FD++  RD YG  G Y+ FAG D S+ L
Sbjct: 2   PPGD--LTNEELRRYDGSNPALPILLAAKGRIFDMTRGRDFYGKGGPYNCFAGIDCSRAL 59

Query: 77  GMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
              SL  +D  A+ + L  S+  VLNDW   F+A+Y +VG V+
Sbjct: 60  AKVSLEKKDLNANCADLFASERDVLNDWVAKFEAKYPVVGNVL 102



>gi|388491690|gb|AFK33911.1| unknown [Lotus japonicus]
 gi|388497796|gb|AFK36964.1| unknown [Lotus japonicus]
          Length = 100

 Score = 94.0 bits (232), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 68/97 (70%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           +T+++L++Y+G+D + PIY++VKG VFDV+  +  YGP G+Y +FAG+DAS+ L   S N
Sbjct: 3   MTAQQLSQYNGTDPSKPIYVSVKGRVFDVTTGKSFYGPGGAYAMFAGRDASRALAKMSKN 62

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            ED   +   L + ++ VLNDW + F A+Y +V ++V
Sbjct: 63  EEDISPNLDGLSDKEIGVLNDWENKFVAKYPVVARLV 99



>gi|326487846|dbj|BAJ89762.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326487866|dbj|BAJ89772.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326509613|dbj|BAJ87022.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 198

 Score = 94.0 bits (232), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 59/96 (61%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           IT E+L  YDG D    I +A++G V+DVS  R  YGP G Y LFAG+DAS+ L + S +
Sbjct: 85  ITLEQLGAYDGKDPAKSILIAIRGQVYDVSRGRLFYGPQGPYSLFAGRDASRALALMSFD 144

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           L D   D   L   +L+VL DW + FK RY +VG +
Sbjct: 145 LNDLTGDLEGLSPDELEVLQDWEEKFKERYPVVGHL 180



>gi|224092625|ref|XP_002309686.1| predicted protein [Populus trichocarpa]
 gi|222855662|gb|EEE93209.1| predicted protein [Populus trichocarpa]
          Length = 100

 Score = 94.0 bits (232), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 66/96 (68%)

Query: 24  TSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLNL 83
           T+++L +Y+G+D + PIY+A+KG VFDV   +  YGP GSY +FAGKDAS+ L   S N 
Sbjct: 4   TTDQLLQYNGTDPSKPIYVAIKGRVFDVMTGKSFYGPGGSYVIFAGKDASRALAKMSKND 63

Query: 84  EDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           ED  +    L E ++ VL+DW   F+A+Y +VG+VV
Sbjct: 64  EDISSSLYGLIEKEIGVLDDWEKKFEAKYPVVGRVV 99



>gi|156056068|ref|XP_001593958.1| conserved hypothetical protein [Sclerotinia sclerotiorum 1980]
 gi|154703170|gb|EDO02909.1| conserved hypothetical protein [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 131

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 49/104 (47%), Positives = 70/104 (67%), Gaps = 2/104 (1%)

Query: 15  LDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASK 74
           L+PPK  PI+ EELAK +G+D+    Y+A+KG V+DV+  +  Y P G+Y++FAG DAS+
Sbjct: 13  LNPPKYDPISVEELAKCNGADSE-KCYVAIKGKVYDVTGNK-AYLPGGAYNVFAGHDASR 70

Query: 75  GLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            L  +S + +D   ++  LD+ +  VLNDW  FF  RYNIVG V
Sbjct: 71  ALAKTSTSADDVSPNWFDLDDKEKGVLNDWNTFFSKRYNIVGLV 114



>gi|357112465|ref|XP_003558029.1| PREDICTED: membrane steroid-binding protein 2-like [Brachypodium
           distachyon]
          Length = 205

 Score = 93.6 bits (231), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 59/96 (61%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           IT E+L  YDG D    I +A++G V+DVS  R  YGP G Y LFAG+DAS+ L + S +
Sbjct: 86  ITLEQLRAYDGKDAAKSILIAIRGQVYDVSRGRLFYGPQGPYSLFAGRDASRALALMSFD 145

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
             D   D   L   +++VL DW D FK RY +VG++
Sbjct: 146 PNDLTGDLEGLSPDEMEVLQDWEDKFKERYPVVGRL 181



>gi|353248330|emb|CCA77345.1| hypothetical protein PIIN_11322 [Piriformospora indica DSM 11827]
          Length = 233

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 60/99 (60%), Gaps = 3/99 (3%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
            T E LAKYDGS+ NLPIYLA+ G V+DVS  R  YGP GSYHL AG DA++  G     
Sbjct: 102 FTEEMLAKYDGSNPNLPIYLAIDGDVYDVSANRHTYGPGGSYHLMAGIDAARSFGTGCFK 161

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKA--RYNIVGKVV 119
            +    D   LDE ++K +  W  FFK   +Y  VGKV+
Sbjct: 162 -DHRTHDLRGLDEGEMKGVEHWKAFFKRSDKYPFVGKVI 199



>gi|356514883|ref|XP_003526131.1| PREDICTED: probable steroid-binding protein 3-like [Glycine max]
          Length = 111

 Score = 93.2 bits (230), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 67/97 (69%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           +T+++L++Y+G+D + PIY+AVKG V+DV+  +  YGP G Y +FAGKDAS+ L   S N
Sbjct: 14  LTAQQLSQYNGTDPSKPIYVAVKGRVYDVTSGKSFYGPGGPYAMFAGKDASRALAKMSKN 73

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            ED       L + ++ VLNDW + F+A+Y +V +++
Sbjct: 74  DEDISPSLDGLSDKEIGVLNDWENKFQAKYPVVARLL 110



>gi|475581984|gb|EMT18994.1| Putative steroid-binding protein 3 [Aegilops tauschii]
          Length = 102

 Score = 93.2 bits (230), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 63/99 (63%)

Query: 21  TPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSS 80
           T +T+ +L  YDG+D + PIY+A++G VFDVS  R  YGP G Y LFAG++A++ L   S
Sbjct: 3   TELTAAQLRAYDGTDASKPIYVAIRGKVFDVSAGRGFYGPGGDYALFAGREAARALAKMS 62

Query: 81  LNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            +  D   D S L + +L VL DW   F+A+Y +V ++ 
Sbjct: 63  KDAADVSGDLSGLSDKELGVLADWESKFQAKYPVVARLA 101



>gi|384252282|gb|EIE25758.1| hypothetical protein COCSUDRAFT_46368 [Coccomyxa subellipsoidea
           C-169]
          Length = 1434

 Score = 93.2 bits (230), Expect = 2e-17,   Method: Composition-based stats.
 Identities = 45/97 (46%), Positives = 60/97 (61%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           +   ELAKYDG D    I L+++GT+ DVS  ++MYGP GSY  FAGK+ ++ LG  S++
Sbjct: 60  VIPSELAKYDGQDPYRAILLSLRGTILDVSAGKEMYGPGGSYAHFAGKEVARALGKMSMD 119

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            +D       L   QLK L DW    KA+Y +VGKVV
Sbjct: 120 SKDCTDKVDDLTPEQLKTLEDWEAKLKAKYPVVGKVV 156



 Score = 72.4 bits (176), Expect = 4e-11,   Method: Composition-based stats.
 Identities = 41/110 (37%), Positives = 59/110 (53%), Gaps = 3/110 (2%)

Query: 10  PPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAG 69
           P   K+ PPK   +T ++L  Y G D + PI LA++G +FDVS   + YGP G Y  FAG
Sbjct: 150 PVVGKVVPPKR--LTLQQLRTYGGEDKSKPILLAIRGVIFDVSRGAEFYGPDGMYP-FAG 206

Query: 70  KDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            + ++   M S ++ D   +   L   +L  L DW   F  +Y IVG +V
Sbjct: 207 HECARAFAMISTDVADCNDNLEGLGAMELDNLRDWEAKFNFKYPIVGSLV 256



>gi|195635483|gb|ACG37210.1| membrane steroid-binding protein 1 [Zea mays]
 gi|414870847|tpg|DAA49404.1| TPA: membrane steroid-binding protein 1 [Zea mays]
          Length = 261

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 58/96 (60%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           IT EEL +YDGSD   P+ +A+KG ++DVS+ R  YGP  +Y LFAGKDAS+ L   S  
Sbjct: 122 ITEEELRQYDGSDPEKPLLMAIKGQIYDVSESRMFYGPGAAYALFAGKDASRALAKMSFE 181

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            +D   D S L   +L  LNDW   F  +Y  VG +
Sbjct: 182 SQDLNGDISGLTPMELGALNDWEYKFATKYAKVGTI 217



>gi|225470692|ref|XP_002262780.1| PREDICTED: membrane steroid-binding protein 2 [Vitis vinifera]
 gi|147841765|emb|CAN62209.1| hypothetical protein VITISV_008090 [Vitis vinifera]
          Length = 215

 Score = 92.8 bits (229), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 58/96 (60%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           IT EEL  YDGSD+  P+ +A+KG ++DVS  R  YGP G Y LFAGKDAS+ L   S  
Sbjct: 70  ITEEELKTYDGSDSKKPLLMAIKGQIYDVSQGRIFYGPGGPYALFAGKDASRALAKMSFE 129

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            +D   D S L   +L+ L DW   F ++Y  VG +
Sbjct: 130 EQDLTGDLSDLGPFELEALQDWEYKFMSKYTKVGTI 165



>gi|326497383|dbj|BAK02276.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326505378|dbj|BAJ95360.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 244

 Score = 92.8 bits (229), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 64/109 (58%), Gaps = 2/109 (1%)

Query: 10  PPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAG 69
           PP   L+P +   IT++EL +YDGSD   P+ +A+KG ++DVS  R  YGP G Y LFAG
Sbjct: 106 PP--ALEPVQVGEITADELRQYDGSDPEKPLLMAIKGQIYDVSQSRLFYGPGGPYALFAG 163

Query: 70  KDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           KDAS+ L   S   +D   D S L   +L  L DW   F ++Y  VG +
Sbjct: 164 KDASRALAKMSFEPQDLTGDVSGLGSFELSALQDWEYKFTSKYVKVGSI 212



>gi|357146902|ref|XP_003574152.1| PREDICTED: membrane steroid-binding protein 1-like [Brachypodium
           distachyon]
          Length = 250

 Score = 92.8 bits (229), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 63/111 (56%), Gaps = 5/111 (4%)

Query: 13  KKLDPPKDTP-----ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLF 67
           ++  PP   P     IT++EL +YDGSD   P+ +A+KG ++DVS  R  YGP G Y LF
Sbjct: 106 EEAQPPAPEPVEVGEITADELQQYDGSDPEKPLLMAIKGQIYDVSQSRMFYGPGGPYALF 165

Query: 68  AGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           AGKDAS+ L   S   +D   D S L   +L  L DW   F ++Y  VG +
Sbjct: 166 AGKDASRALAKMSFEPQDLTGDISGLGSFELSALQDWEYKFASKYAKVGSI 216



>gi|449441858|ref|XP_004138699.1| PREDICTED: probable steroid-binding protein 3-like [Cucumis
           sativus]
 gi|449493315|ref|XP_004159253.1| PREDICTED: probable steroid-binding protein 3-like [Cucumis
           sativus]
          Length = 101

 Score = 92.8 bits (229), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 67/100 (67%)

Query: 20  DTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMS 79
           +  +T ++L  Y+GSD + P+Y+A+KG ++DV+    +YG  GSY++FAGKDAS+ L   
Sbjct: 2   ELKLTPQQLLVYNGSDRSKPLYVALKGCIYDVTKSVLLYGLGGSYNMFAGKDASRALAKM 61

Query: 80  SLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           S N+ D  +    L + ++ VLNDW   F+A+Y IVG+VV
Sbjct: 62  SKNVSDITSSLVGLSKKEISVLNDWEKKFQAKYPIVGRVV 101



>gi|449441856|ref|XP_004138698.1| PREDICTED: probable steroid-binding protein 3-like [Cucumis
           sativus]
 gi|449493313|ref|XP_004159252.1| PREDICTED: probable steroid-binding protein 3-like [Cucumis
           sativus]
          Length = 100

 Score = 92.4 bits (228), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 64/97 (65%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           +T  +L+ Y+G+D   PIY+A+KG +++V+  R  YG  G Y +FAGKDAS+ L   + N
Sbjct: 3   LTPLQLSVYNGTDPTKPIYVALKGQIYNVTSGRSFYGSGGPYAMFAGKDASRALAKMTKN 62

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            ED  +    L E ++ VLNDW + F+A+Y IVG+VV
Sbjct: 63  EEDITSSLEGLSEKEIGVLNDWENKFQAKYPIVGRVV 99



>gi|357497309|ref|XP_003618943.1| Membrane steroid-binding protein [Medicago truncatula]
 gi|355493958|gb|AES75161.1| Membrane steroid-binding protein [Medicago truncatula]
          Length = 195

 Score = 92.0 bits (227), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 48/112 (42%), Positives = 70/112 (62%), Gaps = 2/112 (1%)

Query: 8   VSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLF 67
           V+ P KK  P +   I+ +EL  Y+GSD N PI ++VKG ++DVS  ++ YGP GSY +F
Sbjct: 65  VTEPPKK--PVQVGEISEKELRLYNGSDENKPILISVKGNIYDVSQGKNFYGPGGSYAMF 122

Query: 68  AGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           AGK+ S+ L + S   +D   +   LDES+L +L DW   F  +Y  VG++V
Sbjct: 123 AGKECSRALALLSFKPQDINGNLEGLDESELAILEDWEYKFIDKYPKVGQLV 174



>gi|168022605|ref|XP_001763830.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162685074|gb|EDQ71472.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 105

 Score = 92.0 bits (227), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 40/96 (41%), Positives = 66/96 (68%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           I++ +L++Y+G++  LPI +A++G ++DV+  +  YGP GSY +F+GKDAS+ L   S  
Sbjct: 7   ISAAQLSRYNGTNDALPILVAIRGKIYDVTSGKSFYGPGGSYAMFSGKDASRALAKMSTK 66

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            ED +AD   L + ++ VL+DW   F A+Y +VG+V
Sbjct: 67  QEDVVADLDGLTDKEIGVLDDWDRKFAAKYPVVGRV 102



>gi|242063358|ref|XP_002452968.1| hypothetical protein SORBIDRAFT_04g035710 [Sorghum bicolor]
 gi|241932799|gb|EES05944.1| hypothetical protein SORBIDRAFT_04g035710 [Sorghum bicolor]
          Length = 103

 Score = 92.0 bits (227), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 65/99 (65%)

Query: 21  TPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSS 80
           T +T+ +L  YDG+D + PIY++++G V+DV+  R  YGP GSY +FAG++AS+ LG  S
Sbjct: 3   TELTAAQLRAYDGTDPSKPIYVSIRGKVYDVTSGRGFYGPGGSYAVFAGREASRALGKMS 62

Query: 81  LNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            +  D   D S L + +L VL DW   F+A+Y +V ++ 
Sbjct: 63  KDEADVSGDLSGLTDKELGVLADWETKFQAKYPVVARLA 101



>gi|302835497|ref|XP_002949310.1| hypothetical protein VOLCADRAFT_59178 [Volvox carteri f.
           nagariensis]
 gi|300265612|gb|EFJ49803.1| hypothetical protein VOLCADRAFT_59178 [Volvox carteri f.
           nagariensis]
          Length = 102

 Score = 92.0 bits (227), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 60/96 (62%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
            T+ EL  +DG+D   P+Y+AVKGTV+DVS  R+ YG  G Y  FAG++ ++ L +  ++
Sbjct: 5   FTASELLSFDGTDAAKPVYIAVKGTVYDVSASREFYGKGGPYEAFAGRECARALAIMKVD 64

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           L +   + +   E QLK L DW   F A+Y +VGKV
Sbjct: 65  LAECNDNLADCTEKQLKTLEDWIAKFNAKYAVVGKV 100



>gi|326510959|dbj|BAJ91827.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 244

 Score = 91.7 bits (226), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 64/109 (58%), Gaps = 2/109 (1%)

Query: 10  PPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAG 69
           PP   L+P +   IT++EL +YDGSD   P+ +A+KG ++DVS  R  YGP G Y LFAG
Sbjct: 106 PP--ALEPVQVGEITADELRQYDGSDPEKPLLMAIKGQIYDVSQSRLFYGPGGPYALFAG 163

Query: 70  KDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           KDAS+ L   S   +D   D S L   +L  L DW   F ++Y  VG +
Sbjct: 164 KDASRALAKMSFVPQDLTGDVSGLGSFELSALQDWEYKFTSKYVKVGSI 212



>gi|326494410|dbj|BAJ90474.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 244

 Score = 91.7 bits (226), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 63/109 (57%), Gaps = 2/109 (1%)

Query: 10  PPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAG 69
           PP   L P +   IT++EL +YDGSD   P+ +A+KG ++DVS  R  YGP G Y LFAG
Sbjct: 106 PP--ALGPVQVGEITADELRQYDGSDPEKPLLMAIKGQIYDVSQSRLFYGPGGPYALFAG 163

Query: 70  KDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           KDAS+ L   S   +D   D S L   +L  L DW   F ++Y  VG +
Sbjct: 164 KDASRALAKMSFEPQDLTGDVSGLGSFELSALQDWEYKFTSKYVKVGSI 212



>gi|242063148|ref|XP_002452863.1| hypothetical protein SORBIDRAFT_04g033800 [Sorghum bicolor]
 gi|241932694|gb|EES05839.1| hypothetical protein SORBIDRAFT_04g033800 [Sorghum bicolor]
          Length = 361

 Score = 91.7 bits (226), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 42/94 (44%), Positives = 57/94 (60%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           +T EEL  YDGSD N P+ +A+KG ++DV+  R  YGP G Y LFAG+DAS+ L   S  
Sbjct: 79  VTEEELRAYDGSDPNKPLLMAIKGQIYDVTQSRIFYGPGGPYALFAGRDASRALAKMSFE 138

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVG 116
             D   D S L   +++ L +W   FK++Y  VG
Sbjct: 139 ASDLTGDISGLGPFEVEALQEWEHKFKSKYVTVG 172



>gi|222624834|gb|EEE58966.1| hypothetical protein OsJ_10653 [Oryza sativa Japonica Group]
          Length = 152

 Score = 91.7 bits (226), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 59/96 (61%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           IT E+LA YDG D   PI +A++G V+DV+  R  YGP G Y LFAG+DA++ L + S +
Sbjct: 43  ITLEQLAAYDGKDPAKPILIAIRGQVYDVTRGRLFYGPQGPYSLFAGRDATRALALMSFD 102

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
             D   D   L   +L+VL DW D FK RY  VG +
Sbjct: 103 PIDLTGDLDGLGPDELEVLQDWEDKFKERYPTVGHL 138



>gi|508775908|gb|EOY23164.1| Steroid binding protein, putative [Theobroma cacao]
          Length = 216

 Score = 91.7 bits (226), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 59/96 (61%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           IT EEL +YDGSD+  P+ +A+KG ++DVS  R  YGP G Y LFAGKDAS+ L   S  
Sbjct: 71  ITEEELKQYDGSDSKKPLLMAIKGQIYDVSQSRMFYGPGGPYALFAGKDASRALAKMSFE 130

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            +D   D S L   +L+ L DW   F ++Y  VG +
Sbjct: 131 EKDLTGDISGLGPFELEALQDWEYKFMSKYVKVGTI 166



>gi|195627742|gb|ACG35701.1| membrane steroid-binding protein 1 [Zea mays]
          Length = 104

 Score = 91.7 bits (226), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 65/99 (65%)

Query: 21  TPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSS 80
           T +T+ +L  YDG+D + PIY++V+G V+DV+  R  YGP G+Y +FAG++AS+ LG  S
Sbjct: 3   TELTAAQLRAYDGTDPSKPIYVSVRGKVYDVTSGRGFYGPGGAYAVFAGREASRALGKMS 62

Query: 81  LNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            +  D   D S L + +L VL DW   F+A+Y +V ++ 
Sbjct: 63  KDEADVSGDLSGLTDKELGVLADWETKFQAKYPVVARLA 101



>gi|460377193|ref|XP_004234379.1| PREDICTED: membrane steroid-binding protein 2-like [Solanum
           lycopersicum]
          Length = 227

 Score = 91.3 bits (225), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 63/108 (58%), Gaps = 1/108 (0%)

Query: 12  NKKLDPPKDT-PITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGK 70
            K L PP     I+ EEL +YDGSD+  P+ +A+KG ++DVS  R  YGP G Y LFAGK
Sbjct: 59  QKPLPPPVQLGEISGEELKQYDGSDSKKPLLMAIKGQIYDVSQSRMFYGPGGPYALFAGK 118

Query: 71  DASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           DAS+ L   S   +D   D S L   +L+ L DW   F ++Y  VG V
Sbjct: 119 DASRALAKMSFEEKDLTGDISGLGPFELEALQDWEYKFMSKYVKVGTV 166



>gi|115447533|ref|NP_001047546.1| Os02g0640300 [Oryza sativa Japonica Group]
 gi|49388239|dbj|BAD25359.1| steroid membrane binding protein-like [Oryza sativa Japonica Group]
 gi|113537077|dbj|BAF09460.1| Os02g0640300 [Oryza sativa Japonica Group]
 gi|222623325|gb|EEE57457.1| hypothetical protein OsJ_07680 [Oryza sativa Japonica Group]
          Length = 333

 Score = 91.3 bits (225), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 60/96 (62%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           +T EEL  YDGSD N P+ +A+KG ++DV+  R  YGP G Y LFAG+DAS+ L   S  
Sbjct: 70  VTEEELRVYDGSDPNKPLLMAIKGQIYDVTQSRMFYGPGGPYALFAGRDASRALAKMSFE 129

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           L+D   D S L   +L+ L++W   F ++Y  VG +
Sbjct: 130 LDDLTGDVSGLGPIELEALHEWEGKFMSKYVKVGTI 165



>gi|356507182|ref|XP_003522349.1| PREDICTED: probable steroid-binding protein 3-like [Glycine max]
          Length = 100

 Score = 91.3 bits (225), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 66/97 (68%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           +T ++L++Y+G+D + PIY+AVKG V+DV+  +  YGP G Y +FAGKDAS+ L   S N
Sbjct: 3   LTPQQLSQYNGTDPSKPIYVAVKGRVYDVTTGKSFYGPGGPYAMFAGKDASRALAKMSKN 62

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            +D       L + ++ VLNDW + F+A+Y +V +V+
Sbjct: 63  DDDISPSLDGLSDKEIGVLNDWENKFQAKYPVVARVL 99



>gi|389747213|gb|EIM88392.1| cytochrome b5 [Stereum hirsutum FP-91666 SS1]
          Length = 301

 Score = 91.3 bits (225), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 61/104 (58%), Gaps = 3/104 (2%)

Query: 17  PPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGL 76
           P  +   +   LA++DGSD   P+YLA+ G VFDVSD R +YGP GSYH+ AGKDA++  
Sbjct: 131 PSNERLFSERTLAQFDGSDPEKPLYLAIDGDVFDVSDNRRVYGPGGSYHIMAGKDAARAF 190

Query: 77  GMSSLNLEDAIADYSKLDESQLKVLNDWYDFFK--ARYNIVGKV 118
           G           D   L ES+L+ +N W  FFK    Y+ +G+V
Sbjct: 191 GTGCFQTHQT-HDLRGLTESELRGVNHWKSFFKDHKSYHKIGRV 233



>gi|302815305|ref|XP_002989334.1| hypothetical protein SELMODRAFT_19415 [Selaginella moellendorffii]
 gi|300142912|gb|EFJ09608.1| hypothetical protein SELMODRAFT_19415 [Selaginella moellendorffii]
          Length = 97

 Score = 91.3 bits (225), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 60/96 (62%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           +T  ELA YDG D++ P+ +A+KGT+++VS  RD YGP G Y +FAG+DAS+ L   S +
Sbjct: 2   VTLLELAAYDGKDSSKPLLMAIKGTIYNVSSARDFYGPGGPYAVFAGRDASRALAKMSFD 61

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
             D   D   L   QL+VL DW   F ++Y  VG V
Sbjct: 62  EGDLCGDLDGLSSQQLEVLKDWESKFASKYPRVGAV 97



>gi|502132503|ref|XP_004501392.1| PREDICTED: probable steroid-binding protein 3-like [Cicer
           arietinum]
          Length = 100

 Score = 91.3 bits (225), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 65/97 (67%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           +T+++L++Y+G+D + PIY++VKG VFDV+  +  YGP G Y +FAGKDAS+ L   S +
Sbjct: 3   MTAQQLSQYNGTDPSKPIYVSVKGRVFDVTTGKSFYGPGGPYAMFAGKDASRALAKMSKS 62

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            ED  +    L E ++ VLNDW   F A+Y +V  ++
Sbjct: 63  EEDITSSLDGLTEKEIGVLNDWETKFIAKYPVVATLL 99



>gi|168014364|ref|XP_001759722.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162689261|gb|EDQ75634.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 156

 Score = 91.3 bits (225), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 62/109 (56%), Gaps = 1/109 (0%)

Query: 11  PNKKLDPPKDT-PITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAG 69
           P + L PP+    IT+EEL  YDG+D N P+ +A+K  ++DVS  R  YGP G Y LFAG
Sbjct: 46  PMEPLPPPQQLGEITAEELRAYDGTDPNKPLLMAIKAQIYDVSRSRAFYGPGGPYALFAG 105

Query: 70  KDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           KDAS+ L   S   +D   D   L   + + L DW   F ++Y  VG V
Sbjct: 106 KDASRALAKMSFEEKDLTGDIEGLSPYEAEALTDWEYKFMSKYQKVGTV 154



>gi|224134737|ref|XP_002321894.1| predicted protein [Populus trichocarpa]
 gi|118482553|gb|ABK93197.1| unknown [Populus trichocarpa]
 gi|222868890|gb|EEF06021.1| predicted protein [Populus trichocarpa]
          Length = 215

 Score = 91.3 bits (225), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 59/96 (61%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           +T EEL +YDG+D+  P+ +A+KG ++DVS  R  YGP G Y LFAGKDAS+ L   S  
Sbjct: 71  VTEEELKQYDGTDSTKPLLMAIKGQIYDVSQSRMFYGPGGPYALFAGKDASRALAKMSFE 130

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            +D   D S L   +L+ L DW   F ++Y  VG +
Sbjct: 131 DKDLTGDVSGLGPFELEALQDWEYKFMSKYEKVGTI 166



>gi|149245164|ref|XP_001527116.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146449510|gb|EDK43766.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 130

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 73/120 (60%), Gaps = 7/120 (5%)

Query: 5   PSSVSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSY 64
           P+ +   N+++D  K    T  +L  Y+G+ T   +Y+A++G +FDV++    YGP  +Y
Sbjct: 9   PTEIYLQNERIDRDKLPKFTRAQLLSYNGT-TKKELYVAIRGNIFDVTENTKSYGPGKAY 67

Query: 65  HLFAGKDASKGLGMSSLNLEDAIA------DYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           +   GKD+S+ LG++ L L+D         D S LDE QLK+++DW +FFK RY IVG V
Sbjct: 68  NKLVGKDSSRLLGLNKLQLKDTDGNPENSWDISGLDEKQLKIVDDWIEFFKMRYPIVGIV 127



>gi|482560501|gb|EOA24692.1| hypothetical protein CARUB_v10017968mg [Capsella rubella]
          Length = 231

 Score = 90.9 bits (224), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/112 (41%), Positives = 65/112 (58%), Gaps = 1/112 (0%)

Query: 8   VSPPNKKLDPPKDT-PITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHL 66
           V P ++ L PP     IT E+L  YDG+D+  P+ +A+KG ++DV+  R  YGP G Y L
Sbjct: 55  VQPESEPLPPPVQLGEITEEDLKLYDGADSTKPLLMAIKGQIYDVTQSRMFYGPGGPYAL 114

Query: 67  FAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           FAGKDAS+ L   S   +D   D S L   +L+ L DW   F ++Y  VG +
Sbjct: 115 FAGKDASRALAKMSFEDQDLTGDISGLGAFELEALQDWEYKFMSKYVKVGTI 166



>gi|255539487|ref|XP_002510808.1| steroid binding protein, putative [Ricinus communis]
 gi|223549923|gb|EEF51410.1| steroid binding protein, putative [Ricinus communis]
          Length = 242

 Score = 90.5 bits (223), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 64/116 (55%), Gaps = 1/116 (0%)

Query: 4   NPSSVSPPNKKLDPPKDT-PITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSG 62
            P S     + L PP     +T EEL +YDGSD   P+ +A+KG ++DVS  R  YGP G
Sbjct: 53  RPRSFEEQMQPLPPPVQLGEVTEEELKQYDGSDPKKPLLMAIKGQIYDVSQSRMFYGPGG 112

Query: 63  SYHLFAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            Y LFAGKDAS+ L   S   +D   D S L   +L+ L DW   F ++Y  VG +
Sbjct: 113 PYALFAGKDASRALAKMSFEDKDLTGDISGLGPFELEALQDWEYKFMSKYVKVGTI 168



>gi|226499414|ref|NP_001146971.1| membrane steroid-binding protein 1 [Zea mays]
 gi|194699780|gb|ACF83974.1| unknown [Zea mays]
 gi|195605752|gb|ACG24706.1| membrane steroid-binding protein 1 [Zea mays]
 gi|195605994|gb|ACG24827.1| membrane steroid-binding protein 1 [Zea mays]
 gi|195606076|gb|ACG24868.1| membrane steroid-binding protein 1 [Zea mays]
 gi|413939292|gb|AFW73843.1| membrane steroid-binding protein 1 [Zea mays]
          Length = 104

 Score = 90.5 bits (223), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 65/99 (65%)

Query: 21  TPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSS 80
           T +T+ +L  YDG+D + PIY++V+G V+DV+  R  YGP G+Y +FAG++AS+ LG  S
Sbjct: 3   TELTAAQLRAYDGTDPSKPIYVSVRGKVYDVTSGRGFYGPGGAYAVFAGREASRALGKMS 62

Query: 81  LNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            +  D   D S L + +L VL DW   F+A+Y +V ++ 
Sbjct: 63  KDEADVSGDLSGLTDKELGVLADWEIKFQAKYPVVARLA 101



>gi|502091804|ref|XP_004489639.1| PREDICTED: membrane steroid-binding protein 2-like [Cicer
           arietinum]
          Length = 194

 Score = 90.5 bits (223), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 65/104 (62%)

Query: 16  DPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKG 75
           +P +   IT  EL  Y+GSD + P+ L+VKG ++DVS  R+ YGP GSY +FAGK+ S+ 
Sbjct: 68  EPVQVGEITEPELRLYNGSDPSKPLLLSVKGQIYDVSSARNFYGPGGSYAMFAGKECSRA 127

Query: 76  LGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           L + S   +D   +   LDES+L +L DW   F  +Y  VG++V
Sbjct: 128 LALLSFKPDDFNGNLEGLDESELAILEDWEYKFIEKYPKVGQLV 171



>gi|473818556|gb|EMS46970.1| Membrane steroid-binding protein 1 [Triticum urartu]
          Length = 133

 Score = 90.5 bits (223), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 60/96 (62%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           ++ EEL +YDGSD   P+ +A+KG ++D++  R  YGP G Y +FAGKDAS+ L   S  
Sbjct: 7   LSEEELRQYDGSDRTKPLLMAIKGQIYDITRSRTYYGPGGPYAIFAGKDASRALAKMSFE 66

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            +D  +D S L   +L  L DW   F +RYN+VG V
Sbjct: 67  PQDLTSDVSGLGPFELDALIDWEYKFVSRYNMVGTV 102



>gi|125540451|gb|EAY86846.1| hypothetical protein OsI_08230 [Oryza sativa Indica Group]
          Length = 496

 Score = 90.5 bits (223), Expect = 1e-16,   Method: Composition-based stats.
 Identities = 46/108 (42%), Positives = 65/108 (60%), Gaps = 1/108 (0%)

Query: 12  NKKLDPPKDT-PITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGK 70
           ++ L PP     +T EEL  YDGSD N P+ +A+KG ++DV+  R  YGP G Y LFAG+
Sbjct: 209 SQPLPPPVQLGEVTEEELRVYDGSDPNKPLLMAIKGQIYDVTQSRMFYGPGGPYALFAGR 268

Query: 71  DASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           DAS+ L   S  L+D   D S L   +L+ L++W   F ++Y  VG +
Sbjct: 269 DASRALAKMSFELDDLTGDVSGLGPIELEALHEWEGKFMSKYVKVGTI 316



>gi|255078044|ref|XP_002502602.1| predicted protein [Micromonas sp. RCC299]
 gi|226517867|gb|ACO63860.1| predicted protein [Micromonas sp. RCC299]
          Length = 200

 Score = 90.5 bits (223), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/103 (42%), Positives = 63/103 (61%)

Query: 17  PPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGL 76
           P +   +T  +L ++DGSD  +PI LA KG V+DV+  RD YGP G+Y  FAG D S+ L
Sbjct: 90  PMRKGDMTVAQLKRHDGSDLGIPILLAAKGRVYDVTRGRDFYGPGGAYANFAGIDCSRAL 149

Query: 77  GMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
              SL  +D   D S   E+ L VL+DW   F+ +Y +VG+++
Sbjct: 150 AKMSLRRDDLSGDVSDATEADLTVLDDWVRKFEDKYPLVGRLI 192



>gi|388493398|gb|AFK34765.1| unknown [Lotus japonicus]
          Length = 228

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 48/110 (43%), Positives = 61/110 (55%), Gaps = 1/110 (0%)

Query: 10  PPNKKLDPPKDT-PITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFA 68
           P  + L PP     +T EEL  YDGSD   P+ +A+KG ++DVS  R  YGP G Y LFA
Sbjct: 59  PQMEPLRPPVQIGEVTEEELKSYDGSDPEKPLLMAIKGQIYDVSQSRMFYGPGGPYALFA 118

Query: 69  GKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           GKDAS+ L   S   +D   D S L   +L  L DW   F ++Y  VG +
Sbjct: 119 GKDASRALAKMSFEEKDLTGDISGLGSFELDALQDWEYKFMSKYVKVGTI 168



>gi|302798334|ref|XP_002980927.1| hypothetical protein SELMODRAFT_58069 [Selaginella moellendorffii]
 gi|300151466|gb|EFJ18112.1| hypothetical protein SELMODRAFT_58069 [Selaginella moellendorffii]
          Length = 169

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/108 (42%), Positives = 63/108 (58%), Gaps = 4/108 (3%)

Query: 15  LDPPKDT----PITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGK 70
           +DPP        +T  ELA YDG D++ P+ +A+KG +++VS  RD YGP G Y +FAG+
Sbjct: 59  VDPPSIVELGDQVTLLELAAYDGKDSSKPLLMAIKGRIYNVSSARDFYGPGGPYAVFAGR 118

Query: 71  DASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           DAS+ L   S +  D   D   L   QL+VL DW   F ++Y  VG V
Sbjct: 119 DASRALAKMSFDEGDLCGDLDGLSSQQLEVLKDWESKFASKYPRVGAV 166



>gi|115449183|ref|NP_001048371.1| Os02g0793700 [Oryza sativa Japonica Group]
 gi|47497145|dbj|BAD19194.1| cytochrome b5 domain-containing protein-like [Oryza sativa Japonica
           Group]
 gi|47497592|dbj|BAD19662.1| cytochrome b5 domain-containing protein-like [Oryza sativa Japonica
           Group]
 gi|113537902|dbj|BAF10285.1| Os02g0793700 [Oryza sativa Japonica Group]
 gi|125541442|gb|EAY87837.1| hypothetical protein OsI_09258 [Oryza sativa Indica Group]
 gi|215692943|dbj|BAG88363.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 102

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 64/97 (65%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           +T+ +L  YDGSD + PIY++V+G V+DV+  R  YGP G+Y +FAG++AS+ LG  S +
Sbjct: 5   LTAAQLRAYDGSDPSKPIYVSVRGKVYDVTSGRGFYGPGGAYAVFAGREASRALGKMSKD 64

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
             D   D S L + +L VL DW   F+A+Y +V ++ 
Sbjct: 65  DADVSGDLSGLSDKELGVLADWETKFQAKYPVVARLT 101



>gi|224122412|ref|XP_002318827.1| predicted protein [Populus trichocarpa]
 gi|222859500|gb|EEE97047.1| predicted protein [Populus trichocarpa]
          Length = 215

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 59/96 (61%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           IT EEL +YDG+D+  P+ +A+KG ++DVS  R  YGP G Y LFAGKDAS+ L   S  
Sbjct: 71  ITEEELKQYDGTDSKNPLLMAIKGQIYDVSQSRMFYGPGGPYALFAGKDASRALAKMSFE 130

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            +D   D S L   +L+ L DW   F ++Y  VG +
Sbjct: 131 DKDLTGDVSGLGPFELEALQDWEYKFMSKYIKVGTI 166



>gi|449461239|ref|XP_004148349.1| PREDICTED: membrane steroid-binding protein 2-like [Cucumis
           sativus]
 gi|449517455|ref|XP_004165761.1| PREDICTED: membrane steroid-binding protein 2-like [Cucumis
           sativus]
          Length = 212

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 61/96 (63%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           I+ ++L +YDGSD+  P+ +A+KG ++DVS  R  YGP G Y LFAGKDAS+ L   S  
Sbjct: 69  ISEDDLKQYDGSDSQKPLLMAIKGQIYDVSQSRMFYGPGGPYALFAGKDASRALAKMSFE 128

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            +D   D S L  S+L++L DW   F ++Y  VG V
Sbjct: 129 EKDLTGDISGLGPSELEMLQDWEYKFMSKYVKVGTV 164



>gi|255565313|ref|XP_002523648.1| steroid binding protein, putative [Ricinus communis]
 gi|223537100|gb|EEF38734.1| steroid binding protein, putative [Ricinus communis]
          Length = 197

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 62/97 (63%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           +T +EL  YDGSD + P+ +A+KG ++DVS  R  YGP G Y  FAG+DAS+ L + S +
Sbjct: 74  VTEQELRAYDGSDPSKPLLMAIKGQIYDVSSSRMFYGPGGPYAKFAGRDASRALALLSFD 133

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            +D   +   L ES+L+VL DW   F  +Y  VG++V
Sbjct: 134 PKDLTGNLEGLSESELEVLQDWEYKFMEKYVKVGQLV 170



>gi|224134426|ref|XP_002321821.1| predicted protein [Populus trichocarpa]
 gi|222868817|gb|EEF05948.1| predicted protein [Populus trichocarpa]
          Length = 179

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 63/104 (60%)

Query: 16  DPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKG 75
           +P +   +T EEL  YDGSD N P+ +A+KG ++DVS  R  YGP G Y  FAG++AS+ 
Sbjct: 58  EPVQLGDVTEEELRAYDGSDPNKPLLMAIKGKIYDVSRSRMFYGPGGPYAFFAGREASRA 117

Query: 76  LGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           L + S +  D   +   L E +L+VL DW   F  +Y  VG++V
Sbjct: 118 LALMSFDPRDLNGNLEGLSEPELEVLQDWEYKFMEKYVKVGQLV 161



>gi|224047150|ref|XP_002193322.1| PREDICTED: neudesin [Taeniopygia guttata]
          Length = 177

 Score = 89.4 bits (220), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 69/115 (60%), Gaps = 4/115 (3%)

Query: 6   SSVSPPNKKLDPPKDTPI---TSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSG 62
           ++ + P  +  PP + P+   T  ELA+YDG     PIYLAVKG VFDV+  ++ YG   
Sbjct: 32  AASTQPELRFRPPAEAPVRLFTEPELARYDGQQEGQPIYLAVKGVVFDVTSGKEFYGKGA 91

Query: 63  SYHLFAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWY-DFFKARYNIVG 116
            Y+   GKD+++G+   SL+  D   D + L E +LK L+D + + +KA+Y IVG
Sbjct: 92  PYNALVGKDSTRGVAKMSLDPADLTHDTTGLTEEELKSLDDIFNNVYKAKYPIVG 146



>gi|115482798|ref|NP_001064992.1| Os10g0502500 [Oryza sativa Japonica Group]
 gi|10140793|gb|AAG13623.1|AC078840_14 putative steroid membrane binding protein [Oryza sativa Japonica
           Group]
 gi|31432910|gb|AAP54486.1| Cytochrome b5-like Heme/Steroid binding domain containing protein,
           expressed [Oryza sativa Japonica Group]
 gi|113639601|dbj|BAF26906.1| Os10g0502500 [Oryza sativa Japonica Group]
 gi|215692711|dbj|BAG88131.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|215704356|dbj|BAG93790.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|215765662|dbj|BAG87359.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|222613095|gb|EEE51227.1| hypothetical protein OsJ_32070 [Oryza sativa Japonica Group]
          Length = 265

 Score = 89.4 bits (220), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 45/96 (46%), Positives = 58/96 (60%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           IT+EEL +YDGSD   P+ +A+KG ++DVS  R  YGP G Y LFAGKDAS+ L   S  
Sbjct: 121 ITAEELLQYDGSDPEKPLLMAIKGQIYDVSQSRLFYGPGGPYALFAGKDASRALAKMSFE 180

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            +D   D S L   +L  L DW   F ++Y  VG +
Sbjct: 181 PQDLTDDISGLSLLELSALQDWEYKFSSKYVKVGTI 216



>gi|357137401|ref|XP_003570289.1| PREDICTED: probable steroid-binding protein 3-like [Brachypodium
           distachyon]
          Length = 101

 Score = 89.4 bits (220), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 61/95 (64%)

Query: 21  TPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSS 80
           T +T+ +L  YDGSD + PIY++++G V+DV+  R  YGP G Y LFAG++AS+ L   S
Sbjct: 3   TELTAAQLRAYDGSDASKPIYVSIRGKVYDVTTGRGFYGPGGDYALFAGREASRALAKMS 62

Query: 81  LNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIV 115
            +  D   D S L + +L VL DW   F+A+Y +V
Sbjct: 63  KDSADVSGDLSGLSDKELGVLADWETKFQAKYPVV 97



>gi|50740326|ref|XP_419430.1| PREDICTED: neudesin isoform X2 [Gallus gallus]
          Length = 164

 Score = 89.4 bits (220), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 47/107 (43%), Positives = 66/107 (61%), Gaps = 4/107 (3%)

Query: 14  KLDPPKDTPI---TSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGK 70
           K  PP +TP+   T  ELA+YDG     PIYLAVKG VFDV+  ++ YG    Y+   GK
Sbjct: 27  KAPPPAETPVRLFTEPELARYDGQQEGQPIYLAVKGVVFDVTSGKEFYGKGAPYNALVGK 86

Query: 71  DASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWY-DFFKARYNIVG 116
           D+++G+   SL+  D   D + L E +LK L+D + + +KA+Y IVG
Sbjct: 87  DSTRGVAKMSLDPADLTHDITGLTEEELKSLDDIFNNVYKAKYPIVG 133



>gi|168007434|ref|XP_001756413.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162692452|gb|EDQ78809.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 171

 Score = 89.4 bits (220), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 49/118 (41%), Positives = 67/118 (56%), Gaps = 2/118 (1%)

Query: 3   FNPSSVS-PPNKKLDPPKD-TPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGP 60
           F P+  +  P K L PP+    IT+E+L  YDG+D + P+ +A+KG ++DVS  R  YGP
Sbjct: 44  FAPAPATYAPLKPLPPPRQFGEITAEDLRAYDGTDPDKPLLMAIKGQIYDVSRSRAFYGP 103

Query: 61  SGSYHLFAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            G Y LFAGKDAS+ L   S   +D   D   L   + + L DW   F ++Y  VG V
Sbjct: 104 GGPYALFAGKDASRALAKMSFEEKDLTGDTEGLSAYEAEALTDWEYKFMSKYVRVGTV 161



>gi|356559831|ref|XP_003548200.1| PREDICTED: membrane steroid-binding protein 2-like [Glycine max]
          Length = 222

 Score = 89.4 bits (220), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 48/110 (43%), Positives = 61/110 (55%), Gaps = 1/110 (0%)

Query: 10  PPNKKLDPPKDT-PITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFA 68
           P  + L PP     +T EEL  YDGSD   P+ +A+KG ++DVS  R  YGP G Y LFA
Sbjct: 59  PQMEPLRPPVQIGEVTEEELKAYDGSDPEKPLLMAIKGQIYDVSQSRMFYGPGGPYALFA 118

Query: 69  GKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           GKDAS+ L   S   +D   D S L   +++ L DW   F  +Y  VG V
Sbjct: 119 GKDASRALAKMSFEEKDLTGDISGLGPFEVEALQDWEYKFMGKYVKVGTV 168



>gi|356571342|ref|XP_003553837.1| PREDICTED: membrane steroid-binding protein 2-like [Glycine max]
          Length = 200

 Score = 89.0 bits (219), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 68/115 (59%), Gaps = 7/115 (6%)

Query: 12  NKKLD---PPKDT----PITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSY 64
           N +LD   PP++      IT  EL  YDGSD + P+ +A+KG ++DVS+ R+ YGP G Y
Sbjct: 57  NSRLDESEPPREPVQLGEITDRELRAYDGSDPSKPLLMAIKGQIYDVSNGRNFYGPGGPY 116

Query: 65  HLFAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            +FAGK+ S+ L + S   +D   +   L E +L +L DW   F  +Y  VG+++
Sbjct: 117 AMFAGKECSRALALLSFKPDDINGNLEGLGEEELTILEDWEFKFIEKYPKVGQLI 171



>gi|508773955|gb|EOY21211.1| Steroid binding protein, putative [Theobroma cacao]
          Length = 185

 Score = 89.0 bits (219), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 46/107 (42%), Positives = 61/107 (57%), Gaps = 4/107 (3%)

Query: 17  PPKDTP----ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDA 72
           PPK+      +T EEL  YDGSD   P+ +A+KG ++DVS  +  YG  G Y +F G+DA
Sbjct: 50  PPKEPVQLGDVTEEELRAYDGSDPRKPLLIAIKGQIYDVSSSKMFYGRGGPYSMFTGRDA 109

Query: 73  SKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           S+ L M S   ED   +   L   +L VL DW   F  +Y IVG+VV
Sbjct: 110 SRALAMLSFKPEDLTGNIEGLSAEELAVLEDWEYKFMDKYPIVGRVV 156



>gi|384251213|gb|EIE24691.1| cytochrome b5 [Coccomyxa subellipsoidea C-169]
          Length = 100

 Score = 89.0 bits (219), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 62/95 (65%), Gaps = 1/95 (1%)

Query: 24  TSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLNL 83
           ++EEL++YDG      IY++V+G ++D++  +D YGP   YH+FAGK+ S+ L   SL+ 
Sbjct: 6   SAEELSEYDGIKRQ-EIYVSVRGKIYDMTPGKDFYGPGAGYHIFAGKECSRALAKMSLSA 64

Query: 84  EDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           +D   +   LDE QLKVL+DW   F  +Y  VG++
Sbjct: 65  DDCTGELGDLDEKQLKVLDDWQKKFDEKYTFVGRL 99



>gi|238882324|gb|EEQ45962.1| conserved hypothetical protein [Candida albicans WO-1]
          Length = 129

 Score = 89.0 bits (219), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 74/120 (61%), Gaps = 7/120 (5%)

Query: 5   PSSVSPPNKKLDPPKDTPI-TSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGS 63
           P+ +   N+KL   KD PI T  +LA+Y+G+D    +Y+ ++G ++DV+   + YGP  +
Sbjct: 9   PTEIFKNNEKL-SIKDLPIFTRSQLAQYNGTDKP-ELYVGIRGYIYDVTSNSNSYGPGKA 66

Query: 64  YHLFAGKDASKGLGMSSLNLEDAIADYS----KLDESQLKVLNDWYDFFKARYNIVGKVV 119
           YH   GKD S+ LG++ L L +   +Y+     LDE Q  +++DW  FFK RYNIVG +V
Sbjct: 67  YHKLVGKDVSRLLGLNKLKLSEDSDEYTWYTDDLDEKQQGIIDDWVKFFKMRYNIVGVIV 126



>gi|242041099|ref|XP_002467944.1| hypothetical protein SORBIDRAFT_01g036910 [Sorghum bicolor]
 gi|241921798|gb|EER94942.1| hypothetical protein SORBIDRAFT_01g036910 [Sorghum bicolor]
          Length = 205

 Score = 89.0 bits (219), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 44/103 (42%), Positives = 61/103 (59%)

Query: 16  DPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKG 75
           DP +   +T E+L+ YDG D    I +A++G V+DVS  R  YGP G Y LFAG+DA++ 
Sbjct: 81  DPVEVGEVTLEQLSAYDGKDPAKQILIAIRGQVYDVSRGRLFYGPQGPYSLFAGRDATRA 140

Query: 76  LGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           L + S +  D   D   L   +L+VL DW + FK RY  VG +
Sbjct: 141 LALMSFDPNDLTGDLDGLSPDELEVLQDWEEKFKERYPRVGHL 183



>gi|307108876|gb|EFN57115.1| hypothetical protein CHLNCDRAFT_34937 [Chlorella variabilis]
          Length = 207

 Score = 88.6 bits (218), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 61/96 (63%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           +T  EL+KY+G D   P+ LAV+G VFDV+  R  YGP   YHLFAG++ ++ L   ++ 
Sbjct: 43  LTLLELSKYNGRDPMRPLLLAVRGRVFDVTTGRAFYGPGAGYHLFAGREVARALAKVAVE 102

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            E+   +   L +++L+ L DW   F+++Y +VG+V
Sbjct: 103 EEECTDNLEGLSKAELESLADWERTFESKYEVVGRV 138



>gi|470144928|ref|XP_004308098.1| PREDICTED: membrane steroid-binding protein 2-like [Fragaria vesca
           subsp. vesca]
          Length = 207

 Score = 88.6 bits (218), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 65/117 (55%)

Query: 2   NFNPSSVSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPS 61
           +  P ++      L P +   +T EEL +YDG+D   P+ +A+KG ++DVS  R  YGP 
Sbjct: 48  HHQPRNLEEMQPLLPPVQVGEVTEEELKQYDGTDPKKPLLMAIKGQIYDVSQSRMFYGPG 107

Query: 62  GSYHLFAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           G Y LFAGKDAS+ L   S   +D   D + L   +L+ L DW   F ++Y  VG +
Sbjct: 108 GPYALFAGKDASRALAKMSFEDKDLTGDTTGLGPFELEALQDWEYKFMSKYVKVGTI 164



>gi|217074140|gb|ACJ85430.1| unknown [Medicago truncatula]
 gi|388519781|gb|AFK47952.1| unknown [Medicago truncatula]
          Length = 220

 Score = 88.6 bits (218), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 64/118 (54%), Gaps = 5/118 (4%)

Query: 2   NFNPSSVSPPNKKLDPPKDT-PITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGP 60
           NF    + P    L PP     IT EEL  YDG+D + P+ +A+KG ++DVS  R  YGP
Sbjct: 56  NFQEEELPP----LRPPVQLGEITEEELKAYDGNDHDKPLLMAIKGQIYDVSQSRMFYGP 111

Query: 61  SGSYHLFAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            G Y LFAGKDAS+ L   S + +D   D S L   +L  L DW   F  +Y  VG +
Sbjct: 112 GGPYALFAGKDASRALAKMSFDEKDLTGDISGLGPFELDALQDWEYKFMEKYVKVGTI 169



>gi|388516269|gb|AFK46196.1| unknown [Medicago truncatula]
          Length = 220

 Score = 88.6 bits (218), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 64/118 (54%), Gaps = 5/118 (4%)

Query: 2   NFNPSSVSPPNKKLDPPKDT-PITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGP 60
           NF    + P    L PP     IT EEL  YDG+D + P+ +A+KG ++DVS  R  YGP
Sbjct: 56  NFQEEELPP----LRPPVQLGEITEEELKAYDGNDHDKPLLMAIKGQIYDVSQSRMFYGP 111

Query: 61  SGSYHLFAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            G Y LFAGKDAS+ L   S + +D   D S L   +L  L DW   F  +Y  VG +
Sbjct: 112 GGPYALFAGKDASRALAKMSFDEKDLTGDISGLGPFELDALQDWEYKFMEKYVKVGTI 169



>gi|482549779|gb|EOA13973.1| hypothetical protein CARUB_v10027102mg [Capsella rubella]
          Length = 219

 Score = 88.2 bits (217), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 61/108 (56%), Gaps = 5/108 (4%)

Query: 16  DPPKDTP-----ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGK 70
           +PP   P     IT EEL +YDGSD   P+ +A+K  ++DV+  R  YGP G Y LFAGK
Sbjct: 63  EPPIPQPVQVGEITEEELKQYDGSDPQKPLLMAIKHQIYDVTQSRMFYGPGGPYALFAGK 122

Query: 71  DASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           DAS+ L   S   +D   D S L   +L+ L DW   F ++Y  VG V
Sbjct: 123 DASRALAKMSFEEKDLTWDISGLGPFELEALQDWEYKFMSKYAKVGTV 170



>gi|149391095|gb|ABR25565.1| membrane steroid-binding protein 1 [Oryza sativa Indica Group]
          Length = 173

 Score = 88.2 bits (217), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 56/96 (58%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           ++ EEL +YDGSD   P+ +A+KG ++DV+  R  YGP G Y LFAGKDAS+ L   S  
Sbjct: 15  VSEEELRQYDGSDPKKPLLMAIKGQIYDVTQSRMFYGPGGPYALFAGKDASRALAKMSFE 74

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            +D   D S L   +L  L DW   F  +Y  VG V
Sbjct: 75  PQDLTGDISGLGPFELDALQDWEYKFMGKYVKVGTV 110



>gi|297792547|ref|XP_002864158.1| hypothetical protein ARALYDRAFT_495293 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297309993|gb|EFH40417.1| hypothetical protein ARALYDRAFT_495293 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 218

 Score = 88.2 bits (217), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 61/108 (56%), Gaps = 5/108 (4%)

Query: 16  DPPKDTP-----ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGK 70
           +PP   P     IT EEL +YDGSD   P+ +A+K  ++DV+  R  YGP G Y LFAGK
Sbjct: 63  EPPIPQPVQVGEITEEELKQYDGSDPQKPLLMAIKHQIYDVTQSRMFYGPGGPYALFAGK 122

Query: 71  DASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           DAS+ L   S   +D   D S L   +L+ L DW   F ++Y  VG V
Sbjct: 123 DASRALAKMSFEEKDLTWDISGLGPFELEALQDWEYKFMSKYAKVGTV 170



>gi|255724644|ref|XP_002547251.1| hypothetical protein CTRG_01557 [Candida tropicalis MYA-3404]
 gi|240135142|gb|EER34696.1| hypothetical protein CTRG_01557 [Candida tropicalis MYA-3404]
          Length = 128

 Score = 88.2 bits (217), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 50/118 (42%), Positives = 73/118 (61%), Gaps = 5/118 (4%)

Query: 5   PSSVSPPNKKLDPPKDTPITSE-ELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGS 63
           P+ +   N+KL    D PI S  +L++Y+G+D    IY+A++G ++DV+     YGP   
Sbjct: 10  PTEIFLKNEKL-SIHDLPIFSRNKLSQYNGTDKP-QIYVAIRGYIYDVTANSKSYGPGKG 67

Query: 64  YHLFAGKDASKGLGMSSLNLEDAIADY--SKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           YH F GKDAS+ LG++ L L +    +    LD+ Q K+++DW  FFK RYNIVG VV
Sbjct: 68  YHAFVGKDASRMLGLNKLKLPEGEESWYTDDLDDKQQKIIDDWTVFFKRRYNIVGLVV 125



>gi|462414884|gb|EMJ19621.1| hypothetical protein PRUPE_ppa011573mg [Prunus persica]
          Length = 205

 Score = 88.2 bits (217), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 46/105 (43%), Positives = 61/105 (58%), Gaps = 1/105 (0%)

Query: 15  LDPPKDT-PITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           L PP     IT +EL +YDG+D+  P+ +A+KG ++DVS  R  YGP G Y LFAGKDAS
Sbjct: 60  LAPPVQLGEITEDELKQYDGTDSKKPLLMAIKGQIYDVSQSRMFYGPGGPYALFAGKDAS 119

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           + L   S   +D   D S L   +L  L DW   F ++Y  VG +
Sbjct: 120 RALAKMSFEDKDLTGDISGLGPFELDALQDWEYKFMSKYVTVGTI 164



>gi|125575313|gb|EAZ16597.1| hypothetical protein OsJ_32072 [Oryza sativa Japonica Group]
          Length = 232

 Score = 88.2 bits (217), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 56/96 (58%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           ++ EEL +YDGSD   P+ +A+KG ++DV+  R  YGP G Y LFAGKDAS+ L   S  
Sbjct: 74  VSEEELRQYDGSDPKKPLLMAIKGQIYDVTQSRMFYGPGGPYALFAGKDASRALAKMSFE 133

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            +D   D S L   +L  L DW   F  +Y  VG V
Sbjct: 134 PQDLTGDISGLGPFELDALQDWEYKFMGKYVKVGTV 169



>gi|242034049|ref|XP_002464419.1| hypothetical protein SORBIDRAFT_01g017840 [Sorghum bicolor]
 gi|241918273|gb|EER91417.1| hypothetical protein SORBIDRAFT_01g017840 [Sorghum bicolor]
          Length = 223

 Score = 87.8 bits (216), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 57/96 (59%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           ++ EEL +YDGSDT  P+ +A+ G ++DV+  R  YGP G Y LFAGKDAS+ L   S  
Sbjct: 71  VSEEELRQYDGSDTKKPLLMAIMGQIYDVTQSRMFYGPGGPYALFAGKDASRALAKMSFE 130

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            +D   D S L   +L  L DW   F ++Y  VG V
Sbjct: 131 PQDLTGDISGLGPFELDALQDWEYKFMSKYVKVGTV 166



>gi|358060653|dbj|GAA93649.1| hypothetical protein E5Q_00294 [Mixia osmundae IAM 14324]
          Length = 213

 Score = 87.8 bits (216), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 62/109 (56%), Gaps = 4/109 (3%)

Query: 13  KKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDA 72
           +K   P+ T  T  +L ++DG+D + PIYLAV   VFDVS  R MYGP GSYH FAG+D 
Sbjct: 87  RKWTTPQQT-FTEAQLRQFDGTDPSKPIYLAVMSDVFDVSAGRRMYGPGGSYHHFAGRDG 145

Query: 73  SKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKA--RYNIVGKVV 119
           S+          D   D   L E +L+ +  W+ FF+   +Y  VGKV+
Sbjct: 146 SRAFTTGCFET-DLTHDTRGLSEKELRTIQGWHSFFERSKKYWKVGKVL 193



>gi|462398132|gb|EMJ03800.1| hypothetical protein PRUPE_ppa011700mg [Prunus persica]
 gi|462398133|gb|EMJ03801.1| hypothetical protein PRUPE_ppa011700mg [Prunus persica]
          Length = 200

 Score = 87.4 bits (215), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 61/97 (62%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           +T ++L  +DGSD N P+ +A++  ++DVS  R+ YGP G Y +FAG+DAS+ L + S  
Sbjct: 84  MTEQQLRGFDGSDPNKPLLMAIRAQIYDVSSSRNFYGPGGPYAMFAGRDASRALALLSFK 143

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            +D   +   L   +L++L DW D F  +Y  VGK+V
Sbjct: 144 PQDINGNIEGLGPDELEILQDWEDKFIEKYPNVGKLV 180



>gi|308804353|ref|XP_003079489.1| COG1587: Uroporphyrinogen-III synthase (ISS) [Ostreococcus tauri]
 gi|116057944|emb|CAL54147.1| COG1587: Uroporphyrinogen-III synthase (ISS) [Ostreococcus tauri]
          Length = 901

 Score = 87.4 bits (215), Expect = 1e-15,   Method: Composition-based stats.
 Identities = 46/106 (43%), Positives = 60/106 (56%), Gaps = 3/106 (2%)

Query: 16  DPPKDTP---ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDA 72
           D P   P   +T  ELA +DG D   PI LA KG ++DV+  RD YG   SY+ FAGKD 
Sbjct: 507 DFPAPQPAGDLTKRELATFDGKDPTKPILLAAKGVIYDVTRGRDFYGAGASYNAFAGKDC 566

Query: 73  SKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           S+ LG  SL+ E+  A+      S+   LN W   F+ +Y +VGKV
Sbjct: 567 SRALGKVSLDAENLSANVRDFAASERDTLNGWVAKFQDKYPVVGKV 612



>gi|432941239|ref|XP_004082828.1| PREDICTED: neudesin-like [Oryzias latipes]
          Length = 159

 Score = 87.4 bits (215), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 63/95 (66%), Gaps = 1/95 (1%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
            T EEL +YDGS+ + PIY+AVKG VFDV+  ++ YG +  Y+   GKD+++ +   SLN
Sbjct: 34  FTEEELRQYDGSEEHHPIYMAVKGVVFDVTKGKEFYGKNAPYNALTGKDSTRAVAKMSLN 93

Query: 83  LEDAIADYSKLDESQLKVLNDWYD-FFKARYNIVG 116
            ED  +D + L E QL+ L + ++  +KA+Y IVG
Sbjct: 94  PEDLTSDITGLTEEQLQSLQNIFEGTYKAKYPIVG 128



>gi|452824869|gb|EME31869.1| heme binding protein [Galdieria sulphuraria]
          Length = 180

 Score = 87.4 bits (215), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 67/117 (57%), Gaps = 11/117 (9%)

Query: 10  PP--NKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKG------TVFDVSDKRDMYGPS 61
           PP  NK   PPK    T EEL  YDG +   PIY+AV+G      TVFDVS  RD YGP 
Sbjct: 55  PPVSNKIRKPPKL--FTLEELRAYDGENGK-PIYIAVQGPFDQTPTVFDVSRGRDFYGPG 111

Query: 62  GSYHLFAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           G YH+FAGK+AS+GL  +S + +D       L ESQ   L+ WY  F  +Y  +G +
Sbjct: 112 GPYHVFAGKNASRGLAKTSTDPDDVEGPLDDLSESQKDSLSQWYLRFMEKYENIGHL 168



>gi|4960156|gb|AAD34616.1|AF153284_1 putative progesterone-binding protein homolog [Arabidopsis
           thaliana]
 gi|21555444|gb|AAM63860.1| progesterone-binding protein-like [Arabidopsis thaliana]
          Length = 220

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 60/108 (55%), Gaps = 5/108 (4%)

Query: 16  DPPKDTP-----ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGK 70
           +PP   P     IT EEL +YDGSD   P+ +A+K  ++DV+  R  YGP G Y LFAGK
Sbjct: 63  EPPIPQPVQVGEITEEELKQYDGSDPQKPLLMAIKHQIYDVTQSRMFYGPGGPYALFAGK 122

Query: 71  DASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           DAS+ L   S   +D   D S L   +L  L DW   F ++Y  VG V
Sbjct: 123 DASRALAKMSFEEKDLTWDISGLGPFELDALQDWEYKFMSKYAKVGTV 170



>gi|115482800|ref|NP_001064993.1| Os10g0502600 [Oryza sativa Japonica Group]
 gi|10140799|gb|AAG13629.1|AC078840_20 putative steroid membrane binding protein [Oryza sativa Japonica
           Group]
 gi|110289351|gb|ABB47845.2| Membrane steroid binding protein 1, putative, expressed [Oryza
           sativa Japonica Group]
 gi|113639602|dbj|BAF26907.1| Os10g0502600 [Oryza sativa Japonica Group]
 gi|215697473|dbj|BAG91467.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|215740702|dbj|BAG97358.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 232

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 56/96 (58%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           ++ EEL +YDGSD   P+ +A+KG ++DV+  R  YGP G Y LFAGKDAS+ L   S  
Sbjct: 74  VSEEELRQYDGSDPKKPLLMAIKGQIYDVTQSRMFYGPGGPYALFAGKDASRALAKMSFE 133

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            +D   D S L   +L  L DW   F  +Y  VG V
Sbjct: 134 PQDLTGDISGLGPFELDALQDWEYKFMGKYVKVGTV 169



>gi|125532551|gb|EAY79116.1| hypothetical protein OsI_34222 [Oryza sativa Indica Group]
          Length = 231

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 56/96 (58%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           ++ EEL +YDGSD   P+ +A+KG ++DV+  R  YGP G Y LFAGKDAS+ L   S  
Sbjct: 73  VSEEELRQYDGSDPKKPLLMAIKGQIYDVTQSRMFYGPGGPYALFAGKDASRALAKMSFE 132

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            +D   D S L   +L  L DW   F  +Y  VG V
Sbjct: 133 PQDLTGDISGLGPFELDALQDWEYKFMGKYVKVGTV 168



>gi|15242943|ref|NP_200037.1| membrane-associated progesterone binding protein 5 [Arabidopsis
           thaliana]
 gi|83288340|sp|Q9XFM6.2|MSBP1_ARATH RecName: Full=Membrane steroid-binding protein 1; Short=AtMP1
 gi|8885537|dbj|BAA97467.1| progesterone-binding protein-like [Arabidopsis thaliana]
 gi|24030304|gb|AAN41322.1| putative progesterone-binding protein [Arabidopsis thaliana]
 gi|332008807|gb|AED96190.1| membrane steroid-binding protein 1 [Arabidopsis thaliana]
          Length = 220

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 60/108 (55%), Gaps = 5/108 (4%)

Query: 16  DPPKDTP-----ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGK 70
           +PP   P     IT EEL +YDGSD   P+ +A+K  ++DV+  R  YGP G Y LFAGK
Sbjct: 63  EPPIPQPVQVGEITEEELKQYDGSDPQKPLLMAIKHQIYDVTQSRMFYGPGGPYALFAGK 122

Query: 71  DASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           DAS+ L   S   +D   D S L   +L  L DW   F ++Y  VG V
Sbjct: 123 DASRALAKMSFEEKDLTWDVSGLGPFELDALQDWEYKFMSKYAKVGTV 170



>gi|226499280|ref|NP_001149328.1| membrane steroid-binding protein 1 [Zea mays]
 gi|195626430|gb|ACG35045.1| membrane steroid-binding protein 1 [Zea mays]
 gi|413933906|gb|AFW68457.1| membrane steroid-binding protein 1 [Zea mays]
          Length = 232

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 58/97 (59%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           ++ EEL++YDGSD   P+ +A+KG ++DV+  R  YGP G Y LFAGKDAS+ L   S  
Sbjct: 71  VSEEELSQYDGSDPKKPLLMAIKGQIYDVTQSRMFYGPGGPYALFAGKDASRALAKMSFE 130

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            +D   D + L   +L  L DW   F ++Y  VG V 
Sbjct: 131 PQDLTGDITGLGPFELDALQDWEYKFMSKYVKVGTVT 167



>gi|356575951|ref|XP_003556099.1| PREDICTED: membrane steroid-binding protein 1-like [Glycine max]
          Length = 225

 Score = 87.0 bits (214), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 56/96 (58%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           IT+EEL  YDG+D   P+ +A+K  ++DVS  R  YGP G Y LFAGKDAS+ L   S  
Sbjct: 73  ITAEELKAYDGTDPEKPLLMAIKAQIYDVSQSRMFYGPGGPYALFAGKDASRALAKMSFE 132

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            +D   D S L   +L  L DW   F ++Y  VG V
Sbjct: 133 EKDLTGDISGLGPFELDALQDWEYKFMSKYVKVGTV 168



>gi|502175275|ref|XP_004515701.1| PREDICTED: membrane steroid-binding protein 2-like [Cicer
           arietinum]
          Length = 235

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/105 (42%), Positives = 60/105 (57%), Gaps = 1/105 (0%)

Query: 15  LDPPKDT-PITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           L PP     +T EEL +YDG++   P+ +A+KG ++DVS  R  YGP G Y LFAGKDAS
Sbjct: 64  LKPPVQIGEVTEEELKEYDGNNPEKPLLMAIKGQIYDVSQSRMFYGPGGPYALFAGKDAS 123

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           + L   S   +D   D S L   +L+ L DW   F  +Y  VG +
Sbjct: 124 RALAKMSFEEKDLTGDISGLGPFELEALQDWEYKFMGKYVKVGTI 168



>gi|475612781|gb|EMT28523.1| Membrane steroid-binding protein 2 [Aegilops tauschii]
          Length = 287

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/128 (35%), Positives = 66/128 (51%), Gaps = 11/128 (8%)

Query: 2   NFNPSSVSPPNKK-----------LDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFD 50
           +F   + SPP +K           L P +   +T +EL  YDGSD   P+ +A+KG ++D
Sbjct: 45  SFARPAPSPPRRKGAEDERTLERLLPPVQLGEVTEKELGLYDGSDPKKPLLIAIKGQIYD 104

Query: 51  VSDKRDMYGPSGSYHLFAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKA 110
           V+  R  YGP G Y LFAG+DAS+ L   S  L     D S L   +++ L +W   F  
Sbjct: 105 VTQSRMFYGPGGPYALFAGRDASRALAKMSFELSGLTCDVSGLGPLEVEALQEWEQKFMG 164

Query: 111 RYNIVGKV 118
           +Y  VG +
Sbjct: 165 KYVKVGTI 172



>gi|460390223|ref|XP_004240738.1| PREDICTED: membrane steroid-binding protein 2-like [Solanum
           lycopersicum]
          Length = 240

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 60/104 (57%)

Query: 15  LDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASK 74
           L P +   +T +EL +YDGSD   P+ +A+KG ++DVS  R  YGP G Y LFAGKDAS+
Sbjct: 63  LPPVQLGEVTEDELKEYDGSDPKKPLLMAIKGQIYDVSQSRMFYGPGGPYALFAGKDASR 122

Query: 75  GLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            L   S   +D   D S L   +L  L DW   F ++Y  VG V
Sbjct: 123 ALAKLSFEEKDLTGDISGLGAFELDALQDWEYKFMSKYVKVGTV 166



>gi|241951516|ref|XP_002418480.1| damage response protein, putative; sterol binding protein, putative
           [Candida dubliniensis CD36]
 gi|223641819|emb|CAX43781.1| damage response protein, putative [Candida dubliniensis CD36]
          Length = 190

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 50/120 (41%), Positives = 76/120 (63%), Gaps = 7/120 (5%)

Query: 5   PSSVSPPNKKLDPPKDTPI-TSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGS 63
           P+ +   N+KL   +D PI T  +LA+Y+G+D    +Y+ ++G ++DV+   + YGP  +
Sbjct: 70  PTEIFKNNEKL-SIQDLPIFTRSQLAQYNGTDKP-ELYVGIRGYIYDVTPNSNSYGPGKA 127

Query: 64  YHLFAGKDASKGLGMSSLNL-EDAIAD--YS-KLDESQLKVLNDWYDFFKARYNIVGKVV 119
           YH   GKD S+ LG++ L L ED+  D  Y+  LDE Q  +++DW  FFK RYNIVG +V
Sbjct: 128 YHKLVGKDVSRLLGLNKLKLSEDSNEDTWYTDDLDEKQQGIIDDWVKFFKMRYNIVGVIV 187



>gi|334188336|ref|NP_001190521.1| membrane-associated progesterone binding protein 5 [Arabidopsis
           thaliana]
 gi|332008808|gb|AED96191.1| membrane steroid-binding protein 1 [Arabidopsis thaliana]
          Length = 175

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 60/108 (55%), Gaps = 5/108 (4%)

Query: 16  DPPKDTP-----ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGK 70
           +PP   P     IT EEL +YDGSD   P+ +A+K  ++DV+  R  YGP G Y LFAGK
Sbjct: 63  EPPIPQPVQVGEITEEELKQYDGSDPQKPLLMAIKHQIYDVTQSRMFYGPGGPYALFAGK 122

Query: 71  DASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           DAS+ L   S   +D   D S L   +L  L DW   F ++Y  VG V
Sbjct: 123 DASRALAKMSFEEKDLTWDVSGLGPFELDALQDWEYKFMSKYAKVGTV 170



>gi|168030703|ref|XP_001767862.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162680944|gb|EDQ67376.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 188

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 45/105 (42%), Positives = 62/105 (59%), Gaps = 1/105 (0%)

Query: 15  LDPPKDT-PITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDAS 73
           L PP     +T++ELA YDG+D + P+ +A+KG ++DVS  R  YG  G Y LFAGKDAS
Sbjct: 54  LPPPAQVGELTAKELAAYDGTDPSKPLLMAIKGQIYDVSQSRAFYGTGGPYALFAGKDAS 113

Query: 74  KGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           + L   S   +D   D   L   +++ LNDW   F ++Y  VG V
Sbjct: 114 RALAKMSFEEKDLTGDTEGLSSYEVEALNDWEYKFISKYVKVGTV 158



>gi|224284631|gb|ACN40048.1| unknown [Picea sitchensis]
 gi|224284943|gb|ACN40201.1| unknown [Picea sitchensis]
 gi|224285699|gb|ACN40565.1| unknown [Picea sitchensis]
          Length = 262

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 55/96 (57%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           +T EEL  YDGSD   P+ +A+KG ++DV+  R  YGP G Y LFAGKDAS+ L   S  
Sbjct: 66  VTEEELKAYDGSDPKKPLLMAIKGQIYDVTQSRMFYGPGGPYALFAGKDASRALAKMSFE 125

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            +D   D   L   +L  L DW   F  +Y  VG++
Sbjct: 126 EKDLTGDIEGLGPFELDALQDWEYKFMGKYVKVGQI 161



>gi|449017889|dbj|BAM81291.1| similar to steroid binding protein [Cyanidioschyzon merolae strain
           10D]
          Length = 162

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/121 (38%), Positives = 66/121 (54%), Gaps = 8/121 (6%)

Query: 4   NPSSVSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAV------KGTVFDVSDKRDM 57
           NP+ V PP +  + P     T EELA+Y+G+    PIY+AV      +  VFDVSD R  
Sbjct: 29  NPA-VQPPPRHHERPAPRAFTGEELAQYNGTKGQ-PIYVAVQPRPGARAEVFDVSDARSF 86

Query: 58  YGPSGSYHLFAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGK 117
           YGP G Y +FAGK+AS+GL   S    +       L E + + L  W++ F  +Y +VG 
Sbjct: 87  YGPGGPYFVFAGKNASRGLAKMSTEPGEVCGAIDDLTEHEKETLYQWFEKFLQKYEVVGH 146

Query: 118 V 118
           +
Sbjct: 147 L 147



>gi|116784123|gb|ABK23222.1| unknown [Picea sitchensis]
          Length = 262

 Score = 86.7 bits (213), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 55/96 (57%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           +T EEL  YDGSD   P+ +A+KG ++DV+  R  YGP G Y LFAGKDAS+ L   S  
Sbjct: 66  VTEEELKAYDGSDPKKPLLMAIKGQIYDVTQSRMFYGPGGPYALFAGKDASRALAKMSFE 125

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            +D   D   L   +L  L DW   F  +Y  VG++
Sbjct: 126 EKDLTGDIEGLGPFELDALQDWEYKFMGKYVKVGQI 161



>gi|356535885|ref|XP_003536473.1| PREDICTED: membrane steroid-binding protein 1-like [Glycine max]
          Length = 235

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/96 (44%), Positives = 56/96 (58%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           IT+EEL  YDG+D   P+ +A+K  ++DVS  R  YGP G Y LFAGKDAS+ L   S  
Sbjct: 72  ITAEELKAYDGTDPEKPLLMAIKAQIYDVSQSRMFYGPGGPYALFAGKDASRALAKMSFE 131

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            +D   D S L   ++  L DW   F ++Y  VG V
Sbjct: 132 EKDLTGDISGLGPFEIDALQDWEYKFMSKYVKVGTV 167



>gi|356530872|ref|XP_003534003.1| PREDICTED: membrane steroid-binding protein 2-like [Glycine max]
          Length = 220

 Score = 86.3 bits (212), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/113 (40%), Positives = 62/113 (54%), Gaps = 1/113 (0%)

Query: 8   VSPPNKKLDPPKDT-PITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHL 66
           + P  + L PP     +T ++L  YDG+D   P+ +A+KG ++DVS  R  YGP G Y L
Sbjct: 56  LEPQMEPLRPPVQIGEVTEDDLKAYDGTDPEKPLLMAIKGQIYDVSQSRMFYGPGGPYAL 115

Query: 67  FAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           FAGKDAS+ L   S   +D   D S L   +L+ L DW   F  +Y  VG V 
Sbjct: 116 FAGKDASRALAKMSFEEKDLTGDISGLGPFELEALQDWEYKFMGKYVKVGTVT 168



>gi|502119335|ref|XP_004496583.1| PREDICTED: membrane steroid-binding protein 1-like [Cicer
           arietinum]
          Length = 220

 Score = 86.3 bits (212), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 55/96 (57%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           IT EEL  YDGSD + P+ +A+K  ++DVS  R  YGP G Y LFAGKDAS+ L   S  
Sbjct: 71  ITEEELKAYDGSDHDKPLLMAIKAQIYDVSQSRMFYGPGGPYALFAGKDASRALAKMSFE 130

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            +D   D S L   +L  L DW   F  +Y  VG +
Sbjct: 131 EKDLTGDISGLGPFELDALQDWEYKFMEKYVKVGTI 166



>gi|383851882|ref|XP_003701460.1| PREDICTED: membrane-associated progesterone receptor component
           2-like [Megachile rotundata]
          Length = 215

 Score = 86.3 bits (212), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 41/96 (42%), Positives = 61/96 (63%)

Query: 24  TSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLNL 83
           T EEL KYDG+  +  I +AV G+V+D +    MYGP G+Y +F+G+DAS+GL    L  
Sbjct: 75  TVEELKKYDGTGPDGRILIAVNGSVYDCTRGTRMYGPGGAYSVFSGRDASRGLATFMLET 134

Query: 84  EDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           +D   D S LD  Q+  + +W + FK +Y+ VGK++
Sbjct: 135 KDEYDDLSDLDTDQMNSVKEWEEQFKEKYDYVGKLL 170



>gi|460383640|ref|XP_004237527.1| PREDICTED: membrane steroid-binding protein 2-like [Solanum
           lycopersicum]
          Length = 162

 Score = 85.9 bits (211), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 63/97 (64%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           +T EEL  Y+GSD+  P+ +A++G ++DVS  +  YGP  SY +FAG+DAS+ L + S  
Sbjct: 60  MTEEELRAYNGSDSEKPLLMAIRGQIYDVSTSKMFYGPGSSYAMFAGRDASRALALLSFK 119

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            ED   +   L +++L++L DW   F  +Y+ VG++V
Sbjct: 120 PEDINGNLEGLGDAELQILLDWECKFMEKYDRVGQLV 156



>gi|213406764|ref|XP_002174153.1| membrane-associated progesterone receptor component 2
           [Schizosaccharomyces japonicus yFS275]
 gi|212002200|gb|EEB07860.1| membrane-associated progesterone receptor component 2
           [Schizosaccharomyces japonicus yFS275]
          Length = 158

 Score = 85.9 bits (211), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 69/114 (60%), Gaps = 6/114 (5%)

Query: 11  PNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGK 70
           P  +L+ PK +  T+ EL +++G  +   I+LA+KG V++V++    YGP G Y+ FAG 
Sbjct: 8   PAPELEQPKWSLYTASELKRFNGKSSPF-IFLAIKGDVYNVTEGGKFYGPGGPYYTFAGH 66

Query: 71  DASKGLGMSSLNLE-----DAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
           DAS+GL  SS   +     D + D S L+E +   LNDW  FF  +Y +VG++V
Sbjct: 67  DASRGLAKSSFEEDVVPEGDEMDDLSDLNEEEKSTLNDWKTFFDQKYPVVGRLV 120



>gi|474222343|gb|EMS59327.1| Membrane steroid-binding protein 1 [Triticum urartu]
          Length = 204

 Score = 85.9 bits (211), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 61/109 (55%), Gaps = 7/109 (6%)

Query: 17  PPKDTP-----ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRD--MYGPSGSYHLFAG 69
           PP   P     IT++EL +YDGSD   P+ +A+KG ++DVS  R    YGP G Y LFAG
Sbjct: 64  PPAPEPVQVGEITADELRQYDGSDPEKPLLMAIKGQIYDVSQSRVRMFYGPGGPYALFAG 123

Query: 70  KDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
           KDAS+ L   S   +D   D S L   +L  L DW   F ++Y  VG +
Sbjct: 124 KDASRALAKMSFEPQDLTGDVSGLGPFELSALQDWEYKFTSKYVKVGSI 172



>gi|470147697|ref|XP_004309417.1| PREDICTED: membrane steroid-binding protein 2-like, partial
           [Fragaria vesca subsp. vesca]
          Length = 177

 Score = 85.5 bits (210), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 68/117 (58%), Gaps = 4/117 (3%)

Query: 3   FNPSSVSPPNKKLDPPKDTPITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSG 62
           FNP++ +  + ++       +T +EL  Y+GSD N P+ +A+K  ++DVS  R+ YGP G
Sbjct: 61  FNPTTTTQSSVQVV----GDMTEQELRAYNGSDPNKPLLMAIKAQIYDVSSSRNFYGPGG 116

Query: 63  SYHLFAGKDASKGLGMSSLNLEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKVV 119
            Y +FAG+DAS+ L + S    D   +   L   +L++L DW D F  +Y  VG ++
Sbjct: 117 PYAMFAGRDASRALALLSFKPHDINGNLEGLGPDELQILQDWEDKFVEKYVKVGHLL 173



>gi|194701446|gb|ACF84807.1| unknown [Zea mays]
          Length = 145

 Score = 85.5 bits (210), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 42/96 (43%), Positives = 57/96 (59%)

Query: 23  ITSEELAKYDGSDTNLPIYLAVKGTVFDVSDKRDMYGPSGSYHLFAGKDASKGLGMSSLN 82
           ++ E+L +YDGSD   P+ +A+KG ++DV+  R  YGP G Y LFAGKDAS+ L   S  
Sbjct: 4   VSEEDLRQYDGSDPKKPLLMAIKGQIYDVTQSRMFYGPGGPYALFAGKDASRALAKMSFE 63

Query: 83  LEDAIADYSKLDESQLKVLNDWYDFFKARYNIVGKV 118
            +D   D S L   +L  L DW   F ++Y  VG V
Sbjct: 64  PQDLTGDISGLGPFELDALQDWEYKFMSKYVKVGTV 99