BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10185_c0_seq1-m.77 complete 217-1401(+) 395 (+)
         (394 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|511003916|gb|EPB85300.1| phosphatidate cytidylyltransferase [...   527   e-147   Mucor circinelloides f. circinelloides 1006PhL
gi|511010006|gb|EPB91237.1| phosphatidate cytidylyltransferase [...   512   e-143   Mucor circinelloides f. circinelloides 1006PhL
gi|296419360|ref|XP_002839280.1| hypothetical protein [Tuber mel...   501   e-139   Tuber melanosporum Mel28
gi|238489965|ref|XP_002376220.1| phosphatidate cytidylyltransfer...   489   e-136   Aspergillus flavus NRRL3357
gi|83770920|dbj|BAE61053.1| unnamed protein product [Aspergillus...   488   e-135   Aspergillus oryzae RIB40
gi|317137682|ref|XP_001727892.2| phosphatidate cytidylyltransfer...   488   e-135   Aspergillus oryzae RIB40
gi|378734307|gb|EHY60766.1| phosphatidate cytidylyltransferase [...   488   e-135   Exophiala dermatitidis NIH/UT8656
gi|115388615|ref|XP_001211813.1| phosphatidate cytidylyltransfer...   486   e-135   Aspergillus terreus NIH2624
gi|242807602|ref|XP_002484990.1| phosphatidate cytidylyltransfer...   484   e-134   Talaromyces stipitatus ATCC 10500
gi|384483864|gb|EIE76044.1| phosphatidate cytidylyltransferase [...   483   e-134   Rhizopus delemar RA 99-880
gi|358368935|dbj|GAA85551.1| phosphatidate cytidylyltransferase ...   481   e-133   Aspergillus kawachii IFO 4308
gi|70991200|ref|XP_750449.1| phosphatidate cytidylyltransferase ...   481   e-133   Aspergillus fumigatus Af293
gi|121702389|ref|XP_001269459.1| phosphatidate cytidylyltransfer...   481   e-133   Aspergillus clavatus NRRL 1
gi|145238768|ref|XP_001392031.1| phosphatidate cytidylyltransfer...   480   e-133   Aspergillus niger CBS 513.88
gi|350635960|gb|EHA24321.1| hypothetical protein ASPNIDRAFT_1812...   479   e-133   Aspergillus niger ATCC 1015
gi|327295715|ref|XP_003232552.1| phosphatidate cytidylyltransfer...   479   e-133   Trichophyton rubrum CBS 118892
gi|449300349|gb|EMC96361.1| hypothetical protein BAUCODRAFT_3369...   479   e-133   Baudoinia panamericana UAMH 10762
gi|315044991|ref|XP_003171871.1| phosphatidate cytidylyltransfer...   479   e-133   Microsporum gypseum CBS 118893
gi|212538095|ref|XP_002149203.1| phosphatidate cytidylyltransfer...   479   e-133   Talaromyces marneffei ATCC 18224
gi|452987195|gb|EME86951.1| hypothetical protein MYCFIDRAFT_1869...   479   e-133   Cercospora fijiensis CIRAD86
gi|302510699|ref|XP_003017301.1| hypothetical protein ARB_04181 ...   479   e-133   Arthroderma benhamiae CBS 112371
gi|296810308|ref|XP_002845492.1| phosphatidate cytidylyltransfer...   478   e-132   Arthroderma otae CBS 113480
gi|327352578|gb|EGE81435.1| phosphatidate cytidylyltransferase [...   478   e-132   Blastomyces dermatitidis ATCC 18188
gi|326472298|gb|EGD96307.1| phosphatidate cytidylyltransferase [...   478   e-132   Trichophyton tonsurans CBS 112818
gi|328766814|gb|EGF76866.1| hypothetical protein BATDEDRAFT_3082...   478   e-132   Batrachochytrium dendrobatidis JAM81
gi|302656340|ref|XP_003019924.1| hypothetical protein TRV_06025 ...   478   e-132   Trichophyton verrucosum HKI 0517
gi|259484620|tpe|CBF81000.1| TPA: phosphatidate cytidylyltransfe...   477   e-132   Aspergillus nidulans FGSC A4
gi|119496383|ref|XP_001264965.1| phosphatidate cytidylyltransfer...   477   e-132   Aspergillus fischeri NRRL 181
gi|452845168|gb|EME47101.1| hypothetical protein DOTSEDRAFT_6916...   477   e-132   Dothistroma septosporum NZE10
gi|261193084|ref|XP_002622948.1| phosphatidate cytidylyltransfer...   477   e-132   Blastomyces gilchristii SLH14081
gi|67537992|ref|XP_662770.1| hypothetical protein AN5166.2 [Aspe...   477   e-132   Aspergillus nidulans FGSC A4
gi|347837436|emb|CCD52008.1| similar to phosphatidate cytidylylt...   477   e-132   Botrytis cinerea T4
gi|225555463|gb|EEH03755.1| phosphatidate cytidylyltransferase [...   476   e-132   Histoplasma capsulatum G186AR
gi|258569877|ref|XP_002543742.1| phosphatidate cytidylyltransfer...   476   e-132   Uncinocarpus reesii 1704
gi|119196153|ref|XP_001248680.1| phosphatidate cytidylyltransfer...   476   e-132   Coccidioides immitis RS
gi|303321926|ref|XP_003070957.1| phosphatidate cytidylyltransfer...   476   e-132   Coccidioides posadasii C735 delta SOWgp
gi|453087610|gb|EMF15651.1| phosphatidate cytidylyltransferase [...   475   e-132   Sphaerulina musiva SO2202
gi|406865235|gb|EKD18277.1| phosphatidate cytidylyltransferase [...   475   e-131   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|440637077|gb|ELR06996.1| hypothetical protein GMDG_02318 [Geo...   475   e-131   Pseudogymnoascus destructans 20631-21
gi|225682984|gb|EEH21268.1| phosphatidate cytidylyltransferase [...   475   e-131   
gi|226290434|gb|EEH45918.1| phosphatidate cytidylyltransferase [...   474   e-131   
gi|295658605|ref|XP_002789863.1| phosphatidate cytidylyltransfer...   474   e-131   
gi|322710013|gb|EFZ01588.1| phosphatidate cytidylyltransferase [...   473   e-131   Metarhizium robertsii ARSEF 23
gi|322697874|gb|EFY89649.1| phosphatidate cytidylyltransferase [...   473   e-131   Metarhizium acridum CQMa 102
gi|470317112|gb|EMR08832.1| phosphatidate cytidylyltransferase [...   472   e-131   Pneumocystis murina B123
gi|398391416|ref|XP_003849168.1| hypothetical protein MYCGRDRAFT...   472   e-131   Zymoseptoria tritici IPO323
gi|512188139|gb|EPE03913.1| phosphatidate cytidylyltransferase [...   471   e-130   Ophiostoma piceae UAMH 11346
gi|358389400|gb|EHK26992.1| hypothetical protein TRIVIDRAFT_3369...   469   e-130   Trichoderma virens Gv29-8
gi|500256970|gb|EOO00174.1| putative phosphatidate cytidylyltran...   469   e-130   Phaeoacremonium minimum UCRPA7
gi|425774697|gb|EKV12998.1| Phosphatidate cytidylyltransferase [...   469   e-130   Penicillium digitatum PHI26
gi|255948692|ref|XP_002565113.1| Pc22g11670 [Penicillium chrysog...   469   e-130   Penicillium rubens Wisconsin 54-1255
gi|475668276|gb|EMT66064.1| Putative phosphatidate cytidylyltran...   468   e-129   Fusarium oxysporum f. sp. cubense race 4
gi|407920900|gb|EKG14079.1| Phosphatidate cytidylyltransferase [...   468   e-129   Macrophomina phaseolina MS6
gi|345560878|gb|EGX43995.1| hypothetical protein AOL_s00210g156 ...   466   e-129   Arthrobotrys oligospora ATCC 24927
gi|512199638|gb|EPE28471.1| Acid protease [Glarea lozoyensis ATC...   466   e-129   Glarea lozoyensis ATCC 20868
gi|358395474|gb|EHK44861.1| hypothetical protein TRIATDRAFT_3936...   465   e-128   Trichoderma atroviride IMI 206040
gi|485925205|gb|EOD49839.1| putative phosphatidate cytidylyltran...   464   e-128   Neofusicoccum parvum UCRNP2
gi|340515109|gb|EGR45366.1| predicted protein [Trichoderma reese...   461   e-127   Trichoderma reesei QM6a
gi|321257269|ref|XP_003193529.1| phosphatidate cytidylyltransfer...   461   e-127   Cryptococcus gattii WM276
gi|302892333|ref|XP_003045048.1| predicted protein [Nectria haem...   460   e-127   Nectria haematococca mpVI 77-13-4
gi|405120406|gb|AFR95177.1| phosphatidate cytidylyltransferase [...   459   e-127   Cryptococcus neoformans var. grubii H99
gi|392572322|gb|EIW65473.1| hypothetical protein TREMEDRAFT_4615...   458   e-126   Tremella mesenterica DSM 1558
gi|430813202|emb|CCJ29427.1| unnamed protein product [Pneumocyst...   458   e-126   Pneumocystis jirovecii
gi|402083446|gb|EJT78464.1| phosphatidate cytidylyltransferase [...   457   e-126   Gaeumannomyces graminis var. tritici R3-111a-1
gi|58266536|ref|XP_570424.1| phosphatidate cytidylyltransferase ...   457   e-126   Cryptococcus neoformans var. neoformans JEC21
gi|494826584|gb|EON63640.1| phosphatidate cytidylyltransferase [...   456   e-126   Coniosporium apollinis CBS 100218
gi|403411988|emb|CCL98688.1| predicted protein [Fibroporia radic...   453   e-125   Fibroporia radiculosa
gi|320589638|gb|EFX02094.1| phosphatidate cytidylyltransferase [...   453   e-125   Grosmannia clavigera kw1407
gi|400598312|gb|EJP66029.1| cytidylyltransferase-like protein [B...   453   e-125   Beauveria bassiana ARSEF 2860
gi|346327603|gb|EGX97199.1| phosphatidate cytidylyltransferase [...   452   e-125   Cordyceps militaris CM01
gi|169620329|ref|XP_001803576.1| hypothetical protein SNOG_13366...   451   e-124   Parastagonospora nodorum SN15
gi|477524488|gb|ENH76429.1| phosphatidate cytidylyltransferase [...   451   e-124   Colletotrichum orbiculare MAFF 240422
gi|46116790|ref|XP_384413.1| hypothetical protein FG04237.1 [Fus...   451   e-124   
gi|310798829|gb|EFQ33722.1| cytidylyltransferase [Glomerella gra...   451   e-124   Colletotrichum graminicola M1.001
gi|169847770|ref|XP_001830594.1| phosphatidate cytidylyltransfer...   451   e-124   Coprinopsis cinerea okayama7#130
gi|393245288|gb|EJD52799.1| hypothetical protein AURDEDRAFT_1113...   451   e-124   Auricularia subglabra TFB-10046 SS5
gi|471571357|gb|EMR70179.1| putative phosphatidate cytidylyltran...   450   e-124   Eutypa lata UCREL1
gi|408391718|gb|EKJ71087.1| hypothetical protein FPSE_08751 [Fus...   449   e-124   Fusarium pseudograminearum CS3096
gi|399170156|emb|CCE28929.1| probable CDS1-CDP-diacylglycerol sy...   448   e-123   Claviceps purpurea 20.1
gi|384494136|gb|EIE84627.1| hypothetical protein RO3G_09337 [Rhi...   448   e-123   Rhizopus delemar RA 99-880
gi|19113208|ref|NP_596416.1| phosphatidate cytidylyltransferase ...   447   e-123   Schizosaccharomyces pombe 972h-
gi|392569487|gb|EIW62660.1| phosphatidate cytidylyltransferase, ...   447   e-123   Trametes versicolor FP-101664 SS1
gi|330922448|ref|XP_003299842.1| hypothetical protein PTT_10924 ...   446   e-123   Pyrenophora teres f. teres 0-1
gi|213401867|ref|XP_002171706.1| phosphatidate cytidylyltransfer...   446   e-123   
gi|395325236|gb|EJF57662.1| phosphatidate cytidylyltransferase, ...   445   e-122   Dichomitus squalens LYAD-421 SS1
gi|189197983|ref|XP_001935329.1| phosphatidate cytidylyltransfer...   445   e-122   Pyrenophora tritici-repentis Pt-1C-BFP
gi|346973626|gb|EGY17078.1| phosphatidate cytidylyltransferase [...   444   e-122   Verticillium dahliae VdLs.17
gi|452001384|gb|EMD93844.1| hypothetical protein COCHEDRAFT_1172...   444   e-122   Bipolaris maydis C5
gi|451849161|gb|EMD62465.1| hypothetical protein COCSADRAFT_3427...   444   e-122   Bipolaris sorokiniana ND90Pr
gi|501754677|emb|CCG81950.1| Phosphatidate cytidylyltransferase ...   444   e-122   Taphrina deformans PYCC 5710
gi|336371392|gb|EGN99731.1| hypothetical protein SERLA73DRAFT_17...   443   e-122   Serpula lacrymans var. lacrymans S7.3
gi|367046684|ref|XP_003653722.1| hypothetical protein THITE_2116...   442   e-122   Thielavia terrestris NRRL 8126
gi|367028714|ref|XP_003663641.1| hypothetical protein MYCTH_2134...   441   e-121   Myceliophthora thermophila ATCC 42464
gi|482810990|gb|EOA87770.1| hypothetical protein SETTUDRAFT_1689...   441   e-121   Setosphaeria turcica Et28A
gi|116197300|ref|XP_001224462.1| hypothetical protein CHGG_05248...   437   e-120   Chaetomium globosum CBS 148.51
gi|389740121|gb|EIM81313.1| hypothetical protein STEHIDRAFT_1722...   437   e-120   Stereum hirsutum FP-91666 SS1
gi|343427468|emb|CBQ70995.1| related to CDS1-CDP-diacylglycerol ...   436   e-120   Sporisorium reilianum SRZ2
gi|389645224|ref|XP_003720244.1| phosphatidate cytidylyltransfer...   436   e-120   Magnaporthe oryzae 70-15
gi|409045207|gb|EKM54688.1| hypothetical protein PHACADRAFT_2586...   436   e-120   Phanerochaete carnosa HHB-10118-sp
gi|392594022|gb|EIW83347.1| phosphatidate cytidylyltransferase [...   434   e-119   Coniophora puteana RWD-64-598 SS2
gi|388582772|gb|EIM23076.1| phosphatidate cytidylyltransferase [...   434   e-119   Wallemia mellicola CBS 633.66
gi|429853027|gb|ELA28128.1| phosphatidate cytidylyltransferase [...   434   e-119   Colletotrichum gloeosporioides Nara gc5
gi|449546688|gb|EMD37657.1| hypothetical protein CERSUDRAFT_1143...   432   e-118   Gelatoporia subvermispora B
gi|426197546|gb|EKV47473.1| hypothetical protein AGABI2DRAFT_702...   431   e-118   Agaricus bisporus var. bisporus H97
gi|443895040|dbj|GAC72386.1| CDP-diacylglycerol synthase [Pseudo...   431   e-118   Moesziomyces antarcticus T-34
gi|505760636|gb|EOR04701.1| Putative phosphatidate cytidylyltran...   431   e-118   Wallemia ichthyophaga EXF-994
gi|409080632|gb|EKM80992.1| hypothetical protein AGABI1DRAFT_380...   429   e-118   Agaricus bisporus var. burnettii JB137-S8
gi|85091044|ref|XP_958709.1| phosphatidate cytidylyltransferase ...   426   e-117   Neurospora crassa OR74A
gi|393217832|gb|EJD03321.1| phosphatidate cytidylyltransferase [...   426   e-117   Fomitiporia mediterranea MF3/22
gi|302679378|ref|XP_003029371.1| hypothetical protein SCHCODRAFT...   426   e-117   Schizophyllum commune H4-8
gi|388854569|emb|CCF51726.1| related to CDS1-CDP-diacylglycerol ...   424   e-116   Ustilago hordei
gi|336266243|ref|XP_003347890.1| hypothetical protein SMAC_07265...   423   e-116   Sordaria macrospora k-hell
gi|71010773|ref|XP_758413.1| hypothetical protein UM02266.1 [Ust...   419   e-114   
gi|501309999|dbj|GAC98802.1| hypothetical protein PHSY_006397 [P...   418   e-114   Pseudozyma hubeiensis SY62
gi|171676714|ref|XP_001903309.1| hypothetical protein [Podospora...   417   e-114   Podospora anserina S mat+
gi|50553064|ref|XP_503942.1| YALI0E14443p [Yarrowia lipolytica] ...   416   e-114   Yarrowia lipolytica CLIB122
gi|406603559|emb|CCH44925.1| Phosphatidate cytidylyltransferase ...   412   e-112   Wickerhamomyces ciferrii
gi|358060181|dbj|GAA94240.1| hypothetical protein E5Q_00889 [Mix...   411   e-112   Mixia osmundae IAM 14324
gi|465797112|emb|CCU97871.1| unnamed protein product [Malassezia...   409   e-112   Malassezia sympodialis ATCC 42132
gi|402224320|gb|EJU04383.1| phosphatidate cytidylyltransferase [...   409   e-112   Dacryopinax primogenitus
gi|390602531|gb|EIN11924.1| phosphatidate cytidylyltransferase [...   408   e-111   Punctularia strigosozonata HHB-11173 SS5
gi|353236314|emb|CCA68311.1| related to CDS1-CDP-diacylglycerol ...   407   e-111   Serendipita indica DSM 11827
gi|154317539|ref|XP_001558089.1| hypothetical protein BC1G_03121...   405   e-111   Botrytis cinerea B05.10
gi|170093043|ref|XP_001877743.1| predicted protein [Laccaria bic...   405   e-110   Laccaria bicolor S238N-H82
gi|156049449|ref|XP_001590691.1| hypothetical protein SS1G_08431...   404   e-110   Sclerotinia sclerotiorum 1980 UF-70
gi|396468085|ref|XP_003838087.1| similar to phosphatidate cytidy...   402   e-110   Leptosphaeria maculans JN3
gi|354547258|emb|CCE43992.1| hypothetical protein CPAR2_502170 [...   401   e-109   Candida parapsilosis
gi|340904790|gb|EGS17158.1| hypothetical protein CTHT_0064720 [C...   400   e-109   Chaetomium thermophilum var. thermophilum DSM 1495
gi|448515671|ref|XP_003867388.1| Cds1 protein [Candida orthopsil...   398   e-108   Candida orthopsilosis Co 90-125
gi|164662633|ref|XP_001732438.1| hypothetical protein MGL_0213 [...   394   e-107   Malassezia globosa CBS 7966
gi|241955909|ref|XP_002420675.1| CDP-diacylglycerol synthase, pu...   391   e-106   Candida dubliniensis CD36
gi|260945753|ref|XP_002617174.1| hypothetical protein CLUG_02618...   390   e-106   Clavispora lusitaniae ATCC 42720
gi|254570120|ref|XP_002492170.1| Phosphatidate cytidylyltransfer...   390   e-106   Komagataella phaffii GS115
gi|238882791|gb|EEQ46429.1| phosphatidate cytidylyltransferase [...   389   e-106   Candida albicans WO-1
gi|68491050|ref|XP_710660.1| hypothetical protein CaO19.1279 [Ca...   389   e-106   Candida albicans SC5314
gi|149238013|ref|XP_001524883.1| phosphatidate cytidylyltransfer...   388   e-105   Lodderomyces elongisporus NRRL YB-4239
gi|459367384|gb|EMG46422.1| Phosphatidate cytidylyltransferase [...   386   e-105   Candida maltosa Xu316
gi|472584042|gb|EMS21658.1| phosphatidate cytidylyltransferase [...   385   e-104   Rhodotorula toruloides NP11
gi|363751244|ref|XP_003645839.1| hypothetical protein Ecym_3548 ...   383   e-104   Eremothecium cymbalariae DBVPG#7215
gi|344301871|gb|EGW32176.1| hypothetical protein SPAPADRAFT_6126...   383   e-104   Spathaspora passalidarum NRRL Y-27907
gi|50312289|ref|XP_456177.1| hypothetical protein [Kluyveromyces...   383   e-104   Kluyveromyces lactis NRRL Y-1140
gi|255712657|ref|XP_002552611.1| KLTH0C08910p [Lachancea thermot...   382   e-103   Lachancea thermotolerans CBS 6340
gi|366988405|ref|XP_003673969.1| hypothetical protein NCAS_0A103...   382   e-103   Naumovozyma castellii CBS 4309
gi|126137253|ref|XP_001385150.1| hypothetical protein PICST_7825...   381   e-103   Scheffersomyces stipitis CBS 6054
gi|294657967|ref|XP_460277.2| DEHA2E22462p [Debaryomyces hanseni...   380   e-103   Debaryomyces hansenii CBS767
gi|443701157|gb|ELT99753.1| hypothetical protein CAPTEDRAFT_1618...   380   e-103   Capitella teleta
gi|410079627|ref|XP_003957394.1| hypothetical protein KAFR_0E010...   379   e-103   Kazachstania africana CBS 2517
gi|448080479|ref|XP_004194646.1| Piso0_005153 [Millerozyma farin...   378   e-102   Millerozyma farinosa CBS 7064
gi|392594027|gb|EIW83352.1| phosphatidate cytidylyltransferase [...   377   e-102   Coniophora puteana RWD-64-598 SS2
gi|365982563|ref|XP_003668115.1| hypothetical protein NDAI_0A071...   377   e-102   Naumovozyma dairenensis CBS 421
gi|448084987|ref|XP_004195742.1| Piso0_005153 [Millerozyma farin...   376   e-102   Millerozyma farinosa CBS 7064
gi|321472774|gb|EFX83743.1| hypothetical protein DAPPUDRAFT_3156...   375   e-101   Daphnia pulex
gi|156844503|ref|XP_001645314.1| hypothetical protein Kpol_1037p...   375   e-101   Vanderwaltozyma polyspora DSM 70294
gi|401626675|gb|EJS44601.1| cds1p [Saccharomyces arboricola H-6]      374   e-101   Saccharomyces arboricola H-6
gi|190408803|gb|EDV12068.1| phosphatidate cytidylyltransferase [...   374   e-101   Saccharomyces cerevisiae RM11-1a
gi|189519187|ref|XP_001341899.2| PREDICTED: phosphatidate cytidy...   374   e-101   Danio rerio [leopard danio]
gi|6319503|ref|NP_009585.1| phosphatidate cytidylyltransferase [...   374   e-101   Saccharomyces cerevisiae S288c
gi|365767087|gb|EHN08575.1| Cds1p [Saccharomyces cerevisiae x Sa...   374   e-101   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gi|290878046|emb|CAY77812.2| Cds1p [Saccharomyces cerevisiae EC1...   374   e-101   Saccharomyces cerevisiae EC1118
gi|323310202|gb|EGA63394.1| Cds1p [Saccharomyces cerevisiae Fost...   374   e-101   Saccharomyces cerevisiae FostersO
gi|323306081|gb|EGA59815.1| Cds1p [Saccharomyces cerevisiae Fost...   373   e-101   Saccharomyces cerevisiae FostersB
gi|426232274|ref|XP_004010158.1| PREDICTED: phosphatidate cytidy...   372   e-100   
gi|367013378|ref|XP_003681189.1| hypothetical protein TDEL_0D039...   371   e-100   Torulaspora delbrueckii
gi|505841857|ref|XP_004614439.1| PREDICTED: phosphatidate cytidy...   371   e-100   
gi|478513422|ref|XP_004430966.1| PREDICTED: phosphatidate cytidy...   371   e-100   Ceratotherium simum simum [southern square-lipped rhinoceros]
gi|301755614|ref|XP_002913656.1| PREDICTED: phosphatidate cytidy...   370   e-100   
gi|281344298|gb|EFB19882.1| hypothetical protein PANDA_001470 [A...   370   e-100   Ailuropoda melanoleuca
gi|74002166|ref|XP_544962.2| PREDICTED: phosphatidate cytidylylt...   370   e-100   Canis lupus familiaris [dogs]
gi|466085181|ref|XP_004285477.1| PREDICTED: phosphatidate cytidy...   370   e-100   Orcinus orca [Orca]
gi|511920394|ref|XP_004779418.1| PREDICTED: phosphatidate cytidy...   370   e-100   
gi|511920396|ref|XP_004779419.1| PREDICTED: phosphatidate cytidy...   370   e-100   Mustela putorius furo [black ferret]
gi|410957297|ref|XP_003985266.1| PREDICTED: phosphatidate cytidy...   369   e-100   Felis catus [cat]
gi|354496776|ref|XP_003510501.1| PREDICTED: hypothetical protein...   369   e-100   
gi|359066583|ref|XP_003586270.1| PREDICTED: phosphatidate cytidy...   369   e-100   
gi|323356300|gb|EGA88104.1| Cds1p [Saccharomyces cerevisiae VL3]      369   e-100   Saccharomyces cerevisiae VL3
gi|440908509|gb|ELR58517.1| Phosphatidate cytidylyltransferase 1...   369   e-100   Bos mutus
gi|194209004|ref|XP_001915418.1| PREDICTED: phosphatidate cytidy...   369   e-100   
gi|366998377|ref|XP_003683925.1| hypothetical protein TPHA_0A041...   368   1e-99   Tetrapisispora phaffii CBS 4417
gi|301616982|ref|XP_002937924.1| PREDICTED: phosphatidate cytidy...   368   2e-99   Xenopus tropicalis [western clawed frog]
gi|395834323|ref|XP_003790156.1| PREDICTED: phosphatidate cytidy...   368   2e-99   
gi|472343711|ref|XP_004391612.1| PREDICTED: phosphatidate cytidy...   367   3e-99   Odobenus rosmarus divergens
gi|254577105|ref|XP_002494539.1| ZYRO0A03872p [Zygosaccharomyces...   367   4e-99   Zygosaccharomyces rouxii CBS 732
gi|291401482|ref|XP_002717093.1| PREDICTED: CDP-diacylglycerol s...   367   4e-99   
gi|197099885|ref|NP_001125832.1| phosphatidate cytidylyltransfer...   366   5e-99   Pongo abelii [Orang-utan]
gi|507942614|ref|XP_004681206.1| PREDICTED: phosphatidate cytidy...   366   6e-99   Condylura cristata
gi|3219176|dbj|BAA28787.1| CDP-diacylglycerol synthase [Rattus n...   366   6e-99   Rattus norvegicus [brown rat]
gi|471416482|ref|XP_004389764.1| PREDICTED: phosphatidate cytidy...   366   8e-99   Trichechus manatus latirostris
gi|380023843|ref|XP_003695720.1| PREDICTED: phosphatidate cytidy...   365   1e-98   Apis florea [dwarf honeybee]
gi|114593861|ref|XP_517179.2| PREDICTED: phosphatidate cytidylyl...   365   1e-98   Pan troglodytes
gi|307179096|gb|EFN67568.1| Phosphatidate cytidylyltransferase, ...   365   1e-98   Camponotus floridanus
gi|148747375|ref|NP_112521.2| phosphatidate cytidylyltransferase...   365   1e-98   Rattus norvegicus [brown rat]
gi|470325812|ref|XP_004364563.1| CDP-diacylglycerol synthase [Ca...   365   1e-98   
gi|402869335|ref|XP_003898718.1| PREDICTED: phosphatidate cytidy...   365   1e-98   
gi|33186923|ref|NP_775546.2| phosphatidate cytidylyltransferase ...   365   2e-98   Mus musculus [mouse]
gi|426344852|ref|XP_004038967.1| PREDICTED: phosphatidate cytidy...   365   2e-98   Gorilla gorilla gorilla [lowland gorilla]
gi|22035624|ref|NP_001254.2| phosphatidate cytidylyltransferase ...   365   2e-98   Homo sapiens [man]
gi|488566161|ref|XP_004472748.1| PREDICTED: phosphatidate cytidy...   364   2e-98   Dasypus novemcinctus
gi|255732475|ref|XP_002551161.1| phosphatidate cytidylyltransfer...   364   2e-98   Candida tropicalis MYA-3404
gi|344284801|ref|XP_003414153.1| PREDICTED: phosphatidate cytidy...   364   3e-98   Loxodonta africana [African bush elephant]
gi|432876101|ref|XP_004072977.1| PREDICTED: phosphatidate cytidy...   363   3e-98   Oryzias latipes [Japanese rice fish]
gi|355749268|gb|EHH53667.1| Phosphatidate cytidylyltransferase 1...   363   5e-98   Macaca fascicularis [crab eating macaque]
gi|401840154|gb|EJT43061.1| CDS1-like protein [Saccharomyces kud...   363   5e-98   Saccharomyces kudriavzevii IFO 1802
gi|332016494|gb|EGI57387.1| Phosphatidate cytidylyltransferase, ...   363   5e-98   Acromyrmex echinatior
gi|94468722|gb|ABF18210.1| phosphatidate cytidylyltransferase [A...   363   5e-98   Aedes aegypti
gi|355687278|gb|EHH25862.1| Phosphatidate cytidylyltransferase 1...   363   5e-98   Macaca mulatta [rhesus macaque]
gi|507555647|ref|XP_004661593.1| PREDICTED: phosphatidate cytidy...   363   6e-98   
gi|507637090|ref|XP_004629325.1| PREDICTED: phosphatidate cytidy...   363   7e-98   Octodon degus
gi|327273030|ref|XP_003221286.1| PREDICTED: phosphatidate cytidy...   362   8e-98   Anolis carolinensis [Carolina anole]
gi|357624919|gb|EHJ75514.1| phosphatidate cytidylyltransferase [...   362   8e-98   Danaus plexippus [American monarch]
gi|334331033|ref|XP_001364720.2| PREDICTED: phosphatidate cytidy...   362   8e-98   Monodelphis domestica
gi|291230676|ref|XP_002735291.1| PREDICTED: phosphatidate cytidy...   362   9e-98   
gi|157125436|ref|XP_001654340.1| phosphatidate cytidylyltransfer...   362   9e-98   Aedes aegypti
gi|383848195|ref|XP_003699737.1| PREDICTED: phosphatidate cytidy...   362   9e-98   Megachile rotundata
gi|340720098|ref|XP_003398480.1| PREDICTED: phosphatidate cytidy...   362   1e-97   
gi|513022291|ref|XP_004872397.1| PREDICTED: phosphatidate cytidy...   362   1e-97   Heterocephalus glaber [naked mole rat]
gi|350408246|ref|XP_003488349.1| PREDICTED: phosphatidate cytidy...   362   1e-97   Bombus impatiens
gi|507648191|ref|XP_004703300.1| PREDICTED: phosphatidate cytidy...   362   1e-97   Echinops telfairi [lesser hedgehog tenrec]
gi|512823574|ref|XP_004880163.1| PREDICTED: phosphatidate cytidy...   361   2e-97   
gi|156379863|ref|XP_001631675.1| predicted protein [Nematostella...   361   2e-97   Nematostella vectensis
gi|512823578|ref|XP_004880164.1| PREDICTED: phosphatidate cytidy...   361   2e-97   
gi|395542210|ref|XP_003773027.1| PREDICTED: phosphatidate cytidy...   361   2e-97   
gi|50290049|ref|XP_447456.1| hypothetical protein [Candida glabr...   361   2e-97   Candida glabrata CBS 138
gi|403217066|emb|CCK71561.1| hypothetical protein KNAG_0H01470 [...   360   4e-97   Kazachstania naganishii CBS 8797
gi|113205588|ref|NP_001037999.1| phosphatidate cytidylyltransfer...   360   4e-97   Sus scrofa [pigs]
gi|187607503|ref|NP_001119975.1| CDP-diacylglycerol synthase (ph...   360   5e-97   Xenopus tropicalis [western clawed frog]
gi|390460673|ref|XP_003732522.1| PREDICTED: LOW QUALITY PROTEIN:...   359   6e-97   
gi|482552507|gb|EOA16700.1| hypothetical protein CARUB_v10004892...   359   6e-97   Capsella rubella
gi|374107996|gb|AEY96903.1| FAEL084Wp [Ashbya gossypii FDAG1]         359   6e-97   Eremothecium gossypii FDAG1
gi|403263807|ref|XP_003924202.1| PREDICTED: phosphatidate cytidy...   359   7e-97   
gi|297837175|ref|XP_002886469.1| CDP-diacylglycerol synthase 1 [...   359   7e-97   Arabidopsis lyrata subsp. lyrata
gi|328856067|gb|EGG05190.1| hypothetical protein MELLADRAFT_4398...   359   8e-97   Melampsora larici-populina 98AG31
gi|45190523|ref|NP_984777.1| AEL084Wp [Ashbya gossypii ATCC 1089...   359   9e-97   Eremothecium gossypii ATCC 10895
gi|344279397|ref|XP_003411474.1| PREDICTED: phosphatidate cytidy...   358   1e-96   
gi|281351254|gb|EFB26838.1| hypothetical protein PANDA_014276 [A...   358   1e-96   Ailuropoda melanoleuca
gi|73991700|ref|XP_542903.2| PREDICTED: phosphatidate cytidylylt...   358   1e-96   
gi|15235611|ref|NP_193965.1| cytidinediphosphate diacylglycerol ...   358   2e-96   Arabidopsis thaliana [mouse-ear cress]
gi|472357270|ref|XP_004398264.1| PREDICTED: phosphatidate cytidy...   358   2e-96   Odobenus rosmarus divergens
gi|79325225|ref|NP_001031697.1| cytidinediphosphate diacylglycer...   358   2e-96   Arabidopsis thaliana [mouse-ear cress]
gi|301778911|ref|XP_002924874.1| PREDICTED: phosphatidate cytidy...   358   2e-96   
gi|410922279|ref|XP_003974610.1| PREDICTED: phosphatidate cytidy...   358   2e-96   Takifugu rubripes [tiger puffer]
gi|498955367|ref|XP_004523818.1| PREDICTED: phosphatidate cytidy...   358   2e-96   Ceratitis capitata
gi|410954322|ref|XP_003983814.1| PREDICTED: phosphatidate cytidy...   357   2e-96   
gi|511855754|ref|XP_004751577.1| PREDICTED: phosphatidate cytidy...   357   3e-96   Mustela putorius furo [black ferret]
gi|348567310|ref|XP_003469443.1| PREDICTED: phosphatidate cytidy...   357   3e-96   
gi|158286129|ref|XP_308594.4| AGAP007175-PA [Anopheles gambiae s...   357   3e-96   Anopheles gambiae str. PEST
gi|410923487|ref|XP_003975213.1| PREDICTED: phosphatidate cytidy...   357   4e-96   Takifugu rubripes [tiger puffer]
gi|449274401|gb|EMC83594.1| Phosphatidate cytidylyltransferase 1...   357   4e-96   Columba livia [carrier pigeon]
gi|511947739|ref|XP_004792353.1| PREDICTED: phosphatidate cytidy...   357   4e-96   
gi|449499796|ref|XP_002189814.2| PREDICTED: phosphatidate cytidy...   357   5e-96   Taeniopygia guttata
gi|513032283|gb|AGO12275.1| AaceriAEL084Wp [Saccharomycetaceae s...   356   5e-96   Saccharomycetaceae sp. 'Ashbya aceri'
gi|297799782|ref|XP_002867775.1| hypothetical protein ARALYDRAFT...   356   6e-96   Arabidopsis lyrata subsp. lyrata
gi|30696710|ref|NP_176433.2| phosphatidate cytidylyltransferase ...   356   6e-96   Arabidopsis thaliana [mouse-ear cress]
gi|218189085|gb|EEC71512.1| hypothetical protein OsI_03804 [Oryz...   356   6e-96   Oryza sativa Indica Group [Indian rice]
gi|260787682|ref|XP_002588881.1| hypothetical protein BRAFLDRAFT...   356   7e-96   Branchiostoma floridae
gi|41055397|ref|NP_957480.1| phosphatidate cytidylyltransferase ...   355   1e-95   Danio rerio [leopard danio]
gi|320581137|gb|EFW95359.1| Phosphatidate cytidylyltransferase (...   355   1e-95   
gi|115440045|ref|NP_001044302.1| Os01g0758400 [Oryza sativa Japo...   355   1e-95   
gi|242024808|ref|XP_002432818.1| Phosphatidate cytidylyltransfer...   355   1e-95   Pediculus humanus corporis [human body lice]
gi|357125270|ref|XP_003564318.1| PREDICTED: phosphatidate cytidy...   355   1e-95   Brachypodium distachyon [annual false brome]
gi|344234387|gb|EGV66257.1| phosphatidate cytidylyltransferase [...   355   2e-95   Candida tenuis ATCC 10573
gi|390334609|ref|XP_794770.3| PREDICTED: phosphatidate cytidylyl...   355   2e-95   
gi|47217520|emb|CAG02447.1| unnamed protein product [Tetraodon n...   355   2e-95   Tetraodon nigroviridis
gi|478519224|ref|XP_004433834.1| PREDICTED: phosphatidate cytidy...   354   2e-95   Ceratotherium simum simum [southern square-lipped rhinoceros]
gi|512900016|ref|XP_004924789.1| PREDICTED: phosphatidate cytidy...   354   3e-95   Bombyx mori [silk moth]
gi|55778022|gb|AAH48045.2| CDP-diacylglycerol synthase (phosphat...   353   3e-95   Danio rerio [leopard danio]
gi|432111158|gb|ELK34544.1| Phosphatidate cytidylyltransferase 2...   353   4e-95   Myotis davidii
gi|402883144|ref|XP_003905089.1| PREDICTED: phosphatidate cytidy...   353   4e-95   Papio anubis [Doguera baboon]
gi|348514119|ref|XP_003444588.1| PREDICTED: phosphatidate cytidy...   353   4e-95   Oreochromis niloticus
gi|397501443|ref|XP_003821394.1| PREDICTED: phosphatidate cytidy...   353   4e-95   Pan paniscus [bonobo]
gi|91083997|ref|XP_975257.1| PREDICTED: similar to AGAP007175-PA...   353   4e-95   Tribolium castaneum [rust-red flour beetle]
gi|20143480|ref|NP_003809.1| phosphatidate cytidylyltransferase ...   353   4e-95   Homo sapiens [man]
gi|426390881|ref|XP_004061822.1| PREDICTED: phosphatidate cytidy...   353   4e-95   Gorilla gorilla gorilla [lowland gorilla]
gi|1620512|gb|AAC50735.1| CDP-diacylglycerol synthase [Homo sapi...   353   4e-95   Homo sapiens [man]
gi|355784676|gb|EHH65527.1| Phosphatidate cytidylyltransferase 2...   353   5e-95   Macaca fascicularis [crab eating macaque]
gi|343962129|dbj|BAK62652.1| phosphatidate cytidylyltransferase ...   353   5e-95   Pan troglodytes
gi|499004436|ref|XP_004555727.1| PREDICTED: phosphatidate cytidy...   353   5e-95   
gi|193785541|dbj|BAG50907.1| unnamed protein product [Homo sapiens]   353   6e-95   Homo sapiens [man]
gi|193786582|dbj|BAG51366.1| unnamed protein product [Homo sapiens]   353   6e-95   Homo sapiens [man]
gi|432875358|ref|XP_004072802.1| PREDICTED: phosphatidate cytidy...   353   6e-95   Oryzias latipes [Japanese rice fish]
gi|3892191|gb|AAC78305.1| CDP-diacylglycerol synthase 2 [Homo sa...   353   7e-95   
gi|262272069|ref|NP_001160145.1| phosphatidate cytidylyltransfer...   353   7e-95   
gi|126304021|ref|XP_001381706.1| PREDICTED: phosphatidate cytidy...   353   7e-95   
gi|403283758|ref|XP_003933272.1| PREDICTED: phosphatidate cytidy...   353   7e-95   
gi|475559477|gb|EMT13347.1| Phosphatidate cytidylyltransferase [...   352   8e-95   
gi|449279710|gb|EMC87218.1| Phosphatidate cytidylyltransferase 2...   352   8e-95   
gi|2361033|dbj|BAA22085.1| CDP-diacylglycerol synthase [Rattus sp.]   352   8e-95   
gi|504167464|ref|XP_004593399.1| PREDICTED: phosphatidate cytidy...   352   8e-95   
gi|482571017|gb|EOA35205.1| hypothetical protein CARUB_v10020355...   352   9e-95   
gi|440896627|gb|ELR48509.1| Phosphatidate cytidylyltransferase 2...   352   9e-95   
gi|348522306|ref|XP_003448666.1| PREDICTED: phosphatidate cytidy...   352   1e-94   
gi|395507362|ref|XP_003757994.1| PREDICTED: phosphatidate cytidy...   352   1e-94   
gi|348581374|ref|XP_003476452.1| PREDICTED: phosphatidate cytidy...   352   1e-94   
gi|291388903|ref|XP_002710938.1| PREDICTED: phosphatidate cytidy...   352   1e-94   
gi|512849660|ref|XP_004886850.1| PREDICTED: phosphatidate cytidy...   352   1e-94   
gi|118151180|ref|NP_001071514.1| phosphatidate cytidylyltransfer...   352   1e-94   
gi|170047934|ref|XP_001851458.1| conserved hypothetical protein ...   352   1e-94   
gi|507657318|ref|XP_004634336.1| PREDICTED: phosphatidate cytidy...   352   1e-94   
gi|507555564|ref|XP_004661552.1| PREDICTED: phosphatidate cytidy...   352   1e-94   
gi|426241020|ref|XP_004014390.1| PREDICTED: phosphatidate cytidy...   351   2e-94   
gi|149023367|gb|EDL80261.1| CDP-diacylglycerol synthase (phospha...   351   2e-94   
gi|195376275|ref|XP_002046922.1| GJ13151 [Drosophila virilis] >g...   351   2e-94   
gi|444522719|gb|ELV13422.1| Phosphatidate cytidylyltransferase 2...   351   2e-94   
gi|326488785|dbj|BAJ98004.1| predicted protein [Hordeum vulgare ...   351   2e-94   
gi|470657402|ref|XP_004330832.1| PREDICTED: phosphatidate cytidy...   351   2e-94   
gi|471400558|ref|XP_004383102.1| PREDICTED: phosphatidate cytidy...   351   2e-94   
gi|483520869|gb|EOB06140.1| Phosphatidate cytidylyltransferase 2...   351   2e-94   
gi|20149726|ref|NP_619592.1| phosphatidate cytidylyltransferase ...   351   2e-94   
gi|354473670|ref|XP_003499056.1| PREDICTED: phosphatidate cytidy...   351   2e-94   
gi|50759504|ref|XP_417669.1| PREDICTED: phosphatidate cytidylylt...   351   2e-94   
gi|47125068|gb|AAH69879.1| Cds2 protein [Mus musculus]                351   3e-94   
gi|466041822|ref|XP_004276493.1| PREDICTED: phosphatidate cytidy...   350   3e-94   
gi|513220418|ref|XP_004947611.1| PREDICTED: phosphatidate cytidy...   350   3e-94   
gi|513220415|ref|XP_004947610.1| PREDICTED: phosphatidate cytidy...   350   3e-94   
gi|513220410|ref|XP_004947609.1| PREDICTED: phosphatidate cytidy...   350   4e-94   
gi|513220407|ref|XP_004947608.1| PREDICTED: phosphatidate cytidy...   350   4e-94   
gi|499033299|ref|XP_004567342.1| PREDICTED: phosphatidate cytidy...   350   4e-94   
gi|326491635|dbj|BAJ94295.1| predicted protein [Hordeum vulgare ...   350   5e-94   
gi|326932670|ref|XP_003212437.1| PREDICTED: phosphatidate cytidy...   349   9e-94   
gi|332233553|ref|XP_003265967.1| PREDICTED: phosphatidate cytidy...   349   9e-94   
gi|149733442|ref|XP_001496284.1| PREDICTED: phosphatidate cytidy...   349   1e-93   
gi|326918730|ref|XP_003205641.1| PREDICTED: phosphatidate cytidy...   349   1e-93   
gi|224118188|ref|XP_002331579.1| predicted protein [Populus tric...   349   1e-93   
gi|513183097|ref|XP_420571.4| PREDICTED: phosphatidate cytidylyl...   348   1e-93   
gi|212720954|ref|NP_001132909.1| phosphatidate cytidylyltransfer...   348   1e-93   
gi|449434016|ref|XP_004134792.1| PREDICTED: phosphatidate cytidy...   348   1e-93   
gi|507961212|ref|XP_004687246.1| PREDICTED: phosphatidate cytidy...   348   1e-93   
gi|508781611|gb|EOY28867.1| Cytidinediphosphate diacylglycerol s...   348   1e-93   
gi|505831516|ref|XP_004611041.1| PREDICTED: phosphatidate cytidy...   348   1e-93   
gi|255554719|ref|XP_002518397.1| phosphatidate cytidylyltransfer...   348   2e-93   
gi|326529431|dbj|BAK04662.1| predicted protein [Hordeum vulgare ...   348   2e-93   
gi|42572989|ref|NP_974591.1| cytidinediphosphate diacylglycerol ...   348   2e-93   
gi|512849664|ref|XP_004886851.1| PREDICTED: phosphatidate cytidy...   348   2e-93   
gi|242058753|ref|XP_002458522.1| hypothetical protein SORBIDRAFT...   347   3e-93   
gi|226509604|ref|NP_001150805.1| LOC100284438 [Zea mays] >gi|195...   347   4e-93   
gi|16758454|ref|NP_446095.1| phosphatidate cytidylyltransferase ...   346   6e-93   
gi|470114295|ref|XP_004293351.1| PREDICTED: phosphatidate cytidy...   346   6e-93   
gi|483517460|gb|EOB03968.1| Phosphatidate cytidylyltransferase 1...   346   7e-93   
gi|391334418|ref|XP_003741601.1| PREDICTED: phosphatidate cytidy...   346   8e-93   
gi|353232842|emb|CCD80198.1| phosphatidate cytidylyltransferase ...   345   9e-93   
gi|391334416|ref|XP_003741600.1| PREDICTED: phosphatidate cytidy...   345   1e-92   
gi|390462417|ref|XP_002747467.2| PREDICTED: phosphatidate cytidy...   345   1e-92   
gi|356576511|ref|XP_003556374.1| PREDICTED: phosphatidate cytidy...   345   1e-92   
gi|449488125|ref|XP_004176555.1| PREDICTED: LOW QUALITY PROTEIN:...   345   1e-92   
gi|125980482|ref|XP_001354265.1| GA20725 [Drosophila pseudoobscu...   344   3e-92   
gi|357136520|ref|XP_003569852.1| PREDICTED: phosphatidate cytidy...   344   3e-92   
gi|195435516|ref|XP_002065726.1| GK20000 [Drosophila willistoni]...   343   4e-92   
gi|17864222|ref|NP_524661.1| CDP diglyceride synthetase [Drosoph...   343   6e-92   
gi|194750319|ref|XP_001957575.1| GF23961 [Drosophila ananassae] ...   343   6e-92   
gi|195127337|ref|XP_002008125.1| GI13325 [Drosophila mojavensis]...   343   7e-92   
gi|90083230|dbj|BAE90697.1| unnamed protein product [Macaca fasc...   342   8e-92   
gi|195492749|ref|XP_002094124.1| GE21660 [Drosophila yakuba] >gi...   342   8e-92   
gi|195325895|ref|XP_002029666.1| GM25022 [Drosophila sechellia] ...   342   8e-92   
gi|1085168|pir||S52437 CDP-diacylglycerol synthase - fruit fly (...   342   8e-92
gi|383505582|gb|AFH36370.1| FI18858p1 [Drosophila melanogaster]       342   9e-92   
gi|225719464|gb|ACO15578.1| Phosphatidate cytidylyltransferase, ...   342   1e-91   
gi|332000069|gb|AED98583.1| RH66092p [Drosophila melanogaster]        342   1e-91   
gi|444322179|ref|XP_004181745.1| hypothetical protein TBLA_0G028...   342   1e-91   
gi|241747707|ref|XP_002414352.1| CDP-diacylglycerol synthase, pu...   342   1e-91   
gi|194865313|ref|XP_001971367.1| GG14472 [Drosophila erecta] >gi...   342   1e-91   
gi|211938669|gb|ACJ13231.1| GH23282p [Drosophila melanogaster]        342   1e-91   
gi|470247378|ref|XP_004357400.1| CDP-diacylglycerol synthase [Di...   342   2e-91   
gi|302796868|ref|XP_002980195.1| hypothetical protein SELMODRAFT...   341   2e-91   
gi|195014028|ref|XP_001983945.1| GH16172 [Drosophila grimshawi] ...   341   2e-91   
gi|268552715|ref|XP_002634340.1| Hypothetical protein CBG17684 [...   340   4e-91   
gi|312071527|ref|XP_003138649.1| phosphatidate cytidylyltransfer...   340   4e-91   
gi|74054299|gb|AAZ95511.1| CDP-diacylglycerol synthase 2 [Sus sc...   340   6e-91   
gi|17539014|ref|NP_501297.1| Protein C33H5.18, isoform a [Caenor...   340   6e-91   
gi|17539016|ref|NP_501298.1| Protein C33H5.18, isoform b [Caenor...   339   8e-91   
gi|297292575|ref|XP_001104375.2| PREDICTED: phosphatidate cytidy...   339   8e-91   
gi|357447853|ref|XP_003594202.1| Phosphatidate cytidylyltransfer...   339   8e-91   
gi|308454127|ref|XP_003089720.1| hypothetical protein CRE_17731 ...   339   8e-91   
gi|339239209|ref|XP_003381159.1| phosphatidate cytidylyltransfer...   338   2e-90   
gi|196010834|ref|XP_002115281.1| hypothetical protein TRIADDRAFT...   338   2e-90   
gi|460404347|ref|XP_004247644.1| PREDICTED: phosphatidate cytidy...   337   3e-90   
gi|356535384|ref|XP_003536226.1| PREDICTED: phosphatidate cytidy...   337   3e-90   
gi|488547587|ref|XP_004465300.1| PREDICTED: phosphatidate cytidy...   337   4e-90   
gi|345492846|ref|XP_001600537.2| PREDICTED: phosphatidate cytidy...   337   4e-90   
gi|3121837|sp|O04940.1|CDS1_SOLTU RecName: Full=Phosphatidate cy...   335   1e-89   
gi|341887000|gb|EGT42935.1| hypothetical protein CAEBREN_24525 [...   335   1e-89   
gi|449678341|ref|XP_002156973.2| PREDICTED: uncharacterized prot...   335   1e-89   
gi|328699564|ref|XP_003240973.1| PREDICTED: phosphatidate cytidy...   335   2e-89   
gi|193668032|ref|XP_001951819.1| PREDICTED: phosphatidate cytidy...   335   2e-89   
gi|226510355|ref|NP_001151263.1| phosphatidate cytidylyltransfer...   334   3e-89   
gi|502079285|ref|XP_004486212.1| PREDICTED: phosphatidate cytidy...   333   5e-89   
gi|242044328|ref|XP_002460035.1| hypothetical protein SORBIDRAFT...   333   6e-89   
gi|26339952|dbj|BAC33639.1| unnamed protein product [Mus musculus]    333   8e-89   
gi|460376490|ref|XP_004234031.1| PREDICTED: phosphatidate cytidy...   332   8e-89   
gi|115481524|ref|NP_001064355.1| Os10g0327300 [Oryza sativa Japo...   331   3e-88   
gi|478254568|gb|ENN74811.1| hypothetical protein YQE_08584, part...   330   5e-88   
gi|168032592|ref|XP_001768802.1| predicted protein [Physcomitrel...   327   3e-87   
gi|67971726|dbj|BAE02205.1| unnamed protein product [Macaca fasc...   327   3e-87   
gi|356499413|ref|XP_003518535.1| PREDICTED: phosphatidate cytidy...   327   3e-87   
gi|504158541|ref|XP_004590696.1| PREDICTED: phosphatidate cytidy...   326   9e-87   
gi|359494156|ref|XP_002277501.2| PREDICTED: phosphatidate cytidy...   326   9e-87   
gi|507626055|ref|XP_004697905.1| PREDICTED: phosphatidate cytidy...   325   2e-86   
gi|356553541|ref|XP_003545113.1| PREDICTED: phosphatidate cytidy...   325   2e-86   
gi|508720329|gb|EOY12226.1| Phosphatidate cytidylyltransferase [...   323   4e-86   
gi|326429484|gb|EGD75054.1| phosphatidate cytidylyltransferase [...   323   5e-86   
gi|116831395|gb|ABK28650.1| unknown [Arabidopsis thaliana]            322   1e-85   
gi|240256083|ref|NP_194407.5| phosphatidate cytidylyltransferase...   322   1e-85   
gi|413952385|gb|AFW85034.1| phosphatidate cytidylyltransferase [...   322   2e-85   
gi|482554505|gb|EOA18698.1| hypothetical protein CARUB_v10007275...   321   2e-85   
gi|194695350|gb|ACF81759.1| unknown [Zea mays]                        321   2e-85   
gi|297803416|ref|XP_002869592.1| phosphatidate cytidylyltransfer...   321   3e-85   
gi|281209072|gb|EFA83247.1| CDP-diacylglycerol synthase [Polysph...   321   3e-85   
gi|471235779|ref|XP_004039764.1| phosphatidate cytidylyltransfer...   320   5e-85   
gi|4455200|emb|CAB36523.1| putative CDP-diacylglycerol synthetas...   320   6e-85   
gi|66825773|ref|XP_646241.1| CDP-diacylglycerol synthase [Dictyo...   320   6e-85   
gi|332257925|ref|XP_003278055.1| PREDICTED: LOW QUALITY PROTEIN:...   319   9e-85   
gi|313227833|emb|CBY22982.1| unnamed protein product [Oikopleura...   319   1e-84   
gi|357136522|ref|XP_003569853.1| PREDICTED: phosphatidate cytidy...   318   1e-84   
gi|159467319|ref|XP_001691839.1| phosphatidate cytidylyltransfer...   317   3e-84   
gi|452823002|gb|EME30016.1| phosphatidate cytidylyltransferase [...   317   4e-84   
gi|357494707|ref|XP_003617642.1| Phosphatidate cytidylyltransfer...   317   4e-84   
gi|170587887|ref|XP_001898705.1| Putative phosphatidate cytidyly...   315   1e-83   
gi|449017911|dbj|BAM81313.1| phosphatidate cytidylyltransferase ...   315   1e-83   
gi|255075041|ref|XP_002501195.1| predicted protein [Micromonas s...   315   2e-83   
gi|359495577|ref|XP_003635028.1| PREDICTED: phosphatidate cytidy...   313   4e-83   
gi|145546113|ref|XP_001458740.1| hypothetical protein [Parameciu...   313   5e-83   
gi|465964924|gb|EMP30533.1| Phosphatidate cytidylyltransferase 2...   312   1e-82   
gi|358341060|dbj|GAA48830.1| phosphatidate cytidylyltransferase ...   311   2e-82   
gi|502099246|ref|XP_004491429.1| PREDICTED: phosphatidate cytidy...   311   2e-82   
gi|384250259|gb|EIE23739.1| phosphatidate cytidylyltransferase [...   311   3e-82   
gi|145551765|ref|XP_001461559.1| hypothetical protein [Parameciu...   310   5e-82   
gi|302830372|ref|XP_002946752.1| hypothetical protein VOLCADRAFT...   309   1e-81   
gi|159467317|ref|XP_001691838.1| CDP-DAG synthetase [Chlamydomon...   306   5e-81   
gi|428177348|gb|EKX46228.1| hypothetical protein GUITHDRAFT_7060...   305   1e-80   
gi|410054823|ref|XP_001165937.3| PREDICTED: phosphatidate cytidy...   304   3e-80   
gi|194388268|dbj|BAG65518.1| unnamed protein product [Homo sapiens]   304   3e-80   
gi|348681871|gb|EGZ21687.1| hypothetical protein PHYSODRAFT_5576...   303   4e-80   
gi|330790000|ref|XP_003283086.1| hypothetical protein DICPUDRAFT...   302   9e-80   
gi|297706559|ref|XP_002830107.1| PREDICTED: phosphatidate cytidy...   301   3e-79   
gi|449521677|ref|XP_004167856.1| PREDICTED: LOW QUALITY PROTEIN:...   301   3e-79   
gi|513022297|ref|XP_004872400.1| PREDICTED: phosphatidate cytidy...   297   4e-78   
gi|294877856|ref|XP_002768161.1| Phosphatidate cytidylyltransfer...   295   2e-77   
gi|301106959|ref|XP_002902562.1| phosphatidate cytidylyltransfer...   295   2e-77   
gi|302407383|ref|XP_003001527.1| phosphatidate cytidylyltransfer...   292   9e-77   
gi|325179493|emb|CCA13890.1| phosphatidate cytidylyltransferase ...   292   1e-76   
gi|167538010|ref|XP_001750671.1| hypothetical protein [Monosiga ...   290   5e-76   
gi|465964553|gb|EMP30391.1| Phosphatidate cytidylyltransferase 1...   290   7e-76   
gi|209881261|ref|XP_002142069.1| phosphatidate cytidylyltransfer...   287   4e-75   
gi|307213311|gb|EFN88763.1| Phosphatidate cytidylyltransferase, ...   285   2e-74   
gi|270007494|gb|EFA03942.1| hypothetical protein TcasGA2_TC01408...   284   4e-74   
gi|224458356|ref|NP_001138948.1| gustatory receptor Gr83 [Tribol...   284   4e-74   
gi|342874284|gb|EGU76319.1| hypothetical protein FOXB_13169 [Fus...   283   5e-74   
gi|340370254|ref|XP_003383661.1| PREDICTED: phosphatidate cytidy...   282   1e-73   
gi|66362538|ref|XP_628235.1| cytidine diphosphate-diacylglycerol...   279   1e-72   
gi|146161650|ref|XP_001007653.2| phosphatidate cytidylyltransfer...   278   2e-72   
gi|154287046|ref|XP_001544318.1| predicted protein [Ajellomyces ...   277   3e-72   
gi|474167021|gb|EMS57464.1| Phosphatidate cytidylyltransferase [...   275   1e-71   
gi|47226636|emb|CAG07795.1| unnamed protein product [Tetraodon n...   275   2e-71   
gi|238587911|ref|XP_002391574.1| hypothetical protein MPER_08974...   272   1e-70   
gi|307108697|gb|EFN56936.1| hypothetical protein CHLNCDRAFT_1434...   270   5e-70   
gi|443923377|gb|ELU42629.1| phosphatidate cytidylyltransferase [...   267   5e-69   
gi|308805751|ref|XP_003080187.1| putative CDP-diacylglycerol syn...   265   2e-68   
gi|145348827|ref|XP_001418845.1| predicted protein [Ostreococcus...   261   3e-67   
gi|255580758|ref|XP_002531200.1| phosphatidate cytidylyltransfer...   261   3e-67   
gi|312379412|gb|EFR25691.1| hypothetical protein AND_08743 [Anop...   260   6e-67   
gi|124808255|ref|XP_001348270.1| cytidine diphosphate-diacylglyc...   258   2e-66   
gi|6934280|gb|AAF31696.1|AF212137_1 CDP-diacylglycerol synthase ...   258   2e-66   
gi|412986832|emb|CCO15258.1| phosphatidate cytidylyltransferase ...   258   2e-66   
gi|507114312|emb|CDF37872.1| Phosphatidate cytidylyltransferase ...   258   2e-66   
gi|303285967|ref|XP_003062273.1| predicted protein [Micromonas p...   255   1e-65   
gi|294936211|ref|XP_002781659.1| phosphatidate cytidylyltransfer...   255   2e-65   
gi|68076377|ref|XP_680108.1| cytidine diphosphate-diacylglycerol...   255   2e-65   
gi|297260251|ref|XP_002798244.1| PREDICTED: phosphatidate cytidy...   252   1e-64   
gi|71416492|ref|XP_810276.1| CDP-diacylglycerol synthetase [Tryp...   252   2e-64   
gi|298710107|emb|CBJ31820.1| phosphatidate cytidylyltransferase ...   251   2e-64   
gi|83273950|ref|XP_729622.1| phosphatidate cytidylyltransferase ...   251   2e-64   
gi|407842619|gb|EKG01134.1| CDP-diacylglycerol synthetase, putat...   249   1e-63   
gi|359497117|ref|XP_002265868.2| PREDICTED: phosphatidate cytidy...   248   2e-63   
gi|401884120|gb|EJT48293.1| phosphatidate cytidylyltransferase [...   247   3e-63   
gi|402468664|gb|EJW03784.1| hypothetical protein EDEG_01913 [Edh...   246   7e-63   
gi|457876124|ref|XP_004224541.1| cytidine diphosphate-diacylglyc...   246   1e-62   
gi|157871233|ref|XP_001684166.1| cdp-diacylglycerol synthetase-l...   246   1e-62   
gi|407408502|gb|EKF31919.1| CDP-diacylglycerol synthetase, putat...   244   2e-62   
gi|414589325|tpg|DAA39896.1| TPA: hypothetical protein ZEAMMB73_...   243   6e-62   
gi|146089905|ref|XP_001470506.1| cdp-diacylglycerol synthetase-l...   242   1e-61   
gi|398017117|ref|XP_003861746.1| cdp-diacylglycerol synthetase-l...   242   1e-61   
gi|340054367|emb|CCC48662.1| putative CDP-diacylglycerol synthet...   242   2e-61   
gi|402586269|gb|EJW80207.1| phosphatidate cytidylyltransferase 1...   241   3e-61   
gi|323453396|gb|EGB09268.1| hypothetical protein AURANDRAFT_3513...   241   4e-61   
gi|344246368|gb|EGW02472.1| Phosphatidate cytidylyltransferase 1...   240   6e-61   
gi|401423954|ref|XP_003876463.1| cdp-diacylglycerol synthetase-l...   239   1e-60   
gi|261329051|emb|CBH12030.1| phosphatidate cytidylyltransferase ...   239   1e-60   
gi|72390704|ref|XP_845646.1| CDP-diacylglycerol synthetase [Tryp...   239   1e-60   
gi|221060508|ref|XP_002260899.1| cytidine diphosphate-diacylglyc...   238   2e-60   
gi|154339407|ref|XP_001562395.1| cdp-diacylglycerol synthetase-l...   238   2e-60   
gi|219114335|ref|XP_002176338.1| predicted protein [Phaeodactylu...   236   1e-59   
gi|395829906|ref|XP_003788078.1| PREDICTED: phosphatidate cytidy...   234   2e-59   
gi|156102322|ref|XP_001616854.1| cytidine diphosphate-diacylglyc...   234   3e-59   
gi|397593876|gb|EJK56087.1| hypothetical protein THAOC_24092 [Th...   233   6e-59   
gi|224012218|ref|XP_002294762.1| phosphatidate cytidylytransfera...   233   1e-58   
gi|119630830|gb|EAX10425.1| CDP-diacylglycerol synthase (phospha...   231   3e-58   
gi|474344102|gb|EMS62796.1| Phosphatidate cytidylyltransferase [...   229   9e-58   
gi|149941218|emb|CAO02541.1| putative phosphatidate cytidylyltra...   229   1e-57   
gi|390462419|ref|XP_003732854.1| PREDICTED: phosphatidate cytidy...   229   1e-57   
gi|1093381|prf||2103317A CDP-diacylglycerol synthase                  229   2e-57
gi|198413750|ref|XP_002122942.1| PREDICTED: phosphatidate cytidy...   228   2e-57   
gi|297736733|emb|CBI25879.3| unnamed protein product [Vitis vini...   227   5e-57   


>gi|511003916|gb|EPB85300.1| phosphatidate cytidylyltransferase [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 444

 Score =  527 bits (1358), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 253/387 (65%), Positives = 305/387 (78%), Gaps = 2/387 (0%)

Query: 3   QKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKLP 62
           +KW+N  VRTI TF+MI  FFLIL  GHIWVI +V+ I T+VY EV+ IA  P+K+    
Sbjct: 30  KKWRNWWVRTITTFMMIGTFFLILASGHIWVIMMVIAISTVVYNEVLQIAQAPAKDSNFR 89

Query: 63  WFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFVA 122
           WFKT++WYFL++T YFLYGESIIYYF+ I++VD  LLPFATHHRFISFVLY IGFVFFVA
Sbjct: 90  WFKTMSWYFLVTTTYFLYGESIIYYFQQIILVDRVLLPFATHHRFISFVLYMIGFVFFVA 149

Query: 123 NLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYICG 182
           NLKK  YK QF QF W HM LL+VV QSHFI+NNI EGLIWF +P SLVICNDIFAYICG
Sbjct: 150 NLKKGQYKQQFRQFGWMHMALLLVVFQSHFIVNNILEGLIWFFIPTSLVICNDIFAYICG 209

Query: 183 FFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGRL 242
           FFWGRTPLI +SPKKT EGFVG  ICT+IFG  WS+LL R+DYMICP +DL+ +A + ++
Sbjct: 210 FFWGRTPLITVSPKKTVEGFVGGWICTMIFGMLWSTLLMRFDYMICPVKDLSMSA-WSQI 268

Query: 243 TCEP-NPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
            C P NPVF    + L    T++ + L  K++  VWIAP+Q H LVMACFASLIAPFGGF
Sbjct: 269 DCSPVNPVFTAVPWALPTMWTTVIKTLIHKEVTKVWIAPVQLHSLVMACFASLIAPFGGF 328

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASGVKRAFN+KDFG SIPGHGG+TDR DCQFLMG FS +YYQSFIK  +L +G +L ++
Sbjct: 329 FASGVKRAFNVKDFGQSIPGHGGLTDRFDCQFLMGVFSSIYYQSFIKTYNLNIGTILASV 388

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLE 388
           +N+L   DQ+EL  R+  Y ++QG+L+
Sbjct: 389 INNLSLPDQLELLERILTYFVNQGILD 415



>gi|511010006|gb|EPB91237.1| phosphatidate cytidylyltransferase [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 426

 Score =  512 bits (1318), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 245/390 (62%), Positives = 306/390 (78%), Gaps = 3/390 (0%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
           S+KW+N  +RTI T +MI  FF++L  G+IW I +V++I  LVY+EVI+IA+  S +  L
Sbjct: 23  SKKWQNWWIRTITTLIMIGAFFIVLASGYIWSIVMVMIITVLVYREVISIAY-HSAKGNL 81

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            WFKT++WY+LI+T YFLYGESIIYYFK IVMVDAFLLPFATHHRFISFVLY IGFVFFV
Sbjct: 82  RWFKTMSWYYLITTEYFLYGESIIYYFKEIVMVDAFLLPFATHHRFISFVLYVIGFVFFV 141

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            NLKK  Y+ Q +QF WTHM + ++V Q+HFI++NI EGLIWFVLP +LV+CNDIFAYIC
Sbjct: 142 MNLKKGQYRSQMSQFGWTHMAIFLIVFQAHFIVDNILEGLIWFVLPAALVVCNDIFAYIC 201

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           GFFWG+TPLI+LSPKKT EGFVG +  T+IFGF  ++LL R+DYM CP QDL  +A +  
Sbjct: 202 GFFWGKTPLIQLSPKKTVEGFVGGMFFTLIFGFLATTLLMRFDYMTCPVQDLGASA-WSN 260

Query: 242 LTCEP-NPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
           ++CEP NPVF    ++L      L +  T  D+  VWIAP+Q H +VMACFASLIAPFGG
Sbjct: 261 VSCEPKNPVFTAAPWELPSLFRYLIKYTTTMDVTEVWIAPVQLHAIVMACFASLIAPFGG 320

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFAS VKRAF IKDFGHSIPGHGG+TDR DCQFLMG F++MYYQSFIKM +++VG +L  
Sbjct: 321 FFASAVKRAFKIKDFGHSIPGHGGLTDRCDCQFLMGLFAYMYYQSFIKMYNVSVGTILAL 380

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           ++N+L  ++Q+EL  RL+ YL +Q  L  +
Sbjct: 381 VINNLSSKEQVELLERLQTYLANQDHLASQ 410



>gi|296419360|ref|XP_002839280.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295635400|emb|CAZ83471.1| unnamed protein product [Tuber melanosporum]
          Length = 462

 Score =  501 bits (1289), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 243/390 (62%), Positives = 303/390 (77%), Gaps = 9/390 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWT +MI  FF  +  GHI+++ LV  +Q + +KEVIAIA+VPS+EKKL
Sbjct: 69  EKKKQTFITRTIWTLLMIALFFAAMAAGHIYLVILVTAVQVITFKEVIAIANVPSREKKL 128

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWYFL +T YFLYGES+IYYFK IV+VDAFLLPFATHHRFISFVLY IGFVFFV
Sbjct: 129 QFTKSLNWYFLAATMYFLYGESVIYYFKHIVVVDAFLLPFATHHRFISFVLYIIGFVFFV 188

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A+LKK HYKFQFTQFAWTHM L +VV Q+HFI+NNIFEG+IWF LPVSLVI NDIFAYIC
Sbjct: 189 ASLKKGHYKFQFTQFAWTHMALYLVVVQAHFIMNNIFEGMIWFFLPVSLVITNDIFAYIC 248

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIK+SPKKT EGFVGA +CTI FG   +++L R+ Y ICP +DL + AF G 
Sbjct: 249 GITFGRTQLIKISPKKTVEGFVGAWVCTIFFGLAMTNILMRYKYFICPVKDLGSNAFTG- 307

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C+PNPVF+   Y L  +L  +          +V + P+Q+H+LVMA FASLIAPFGGF
Sbjct: 308 LECDPNPVFLKHEYQLPFFLQPILG-------TAVKVQPMQFHILVMATFASLIAPFGGF 360

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMS-SLTVGAVLQT 360
           FASG+KR F IKDFG  +PGHGGITDRMDCQF+MG FS+MYYQSFI ++   +VG +L+T
Sbjct: 361 FASGLKRTFKIKDFGDLVPGHGGITDRMDCQFIMGFFSYMYYQSFIAVNHRASVGGILET 420

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLEER 390
            + SL P++Q+E+  RL +YL+ QG++ ++
Sbjct: 421 AITSLSPEEQLEVVERLGRYLVGQGIVGDK 450



>gi|238489965|ref|XP_002376220.1| phosphatidate cytidylyltransferase [Aspergillus flavus NRRL3357]
 gi|220698608|gb|EED54948.1| phosphatidate cytidylyltransferase [Aspergillus flavus NRRL3357]
          Length = 468

 Score =  489 bits (1259), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 234/388 (60%), Positives = 295/388 (76%), Gaps = 10/388 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMIFGFF+ +  GHI++I LV  IQ + +KEVIAIA+VPSKEK L
Sbjct: 69  EKKKQTFITRTIWTFVMIFGFFIAMFSGHIYIIGLVTAIQIISFKEVIAIANVPSKEKNL 128

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWYFL +T YFLYGES+IYYFK +++VD  LLP ATHHRFISF LY +GFVFFV
Sbjct: 129 RFTKSLNWYFLATTMYFLYGESVIYYFKHVLLVDKVLLPLATHHRFISFTLYVMGFVFFV 188

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A+L+K HY+FQFTQFAWTHM L ++V Q+HF++NNI EG+IWF LP SLVI NDIFAY+C
Sbjct: 189 ASLQKGHYRFQFTQFAWTHMALYLIVVQAHFVMNNILEGMIWFFLPASLVITNDIFAYVC 248

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LI+LSPKKT EGF+GA ICTIIFG+F +++L R+ Y ICP  DL +    G 
Sbjct: 249 GITFGRTQLIQLSPKKTVEGFLGAWICTIIFGYFMTNVLMRYKYFICPVNDLGSNVLTG- 307

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNP F+PQ Y +  W        T  D ++ ++ P+Q+H+L+ A FASLIAPFGGF
Sbjct: 308 LECTPNPAFMPQPYQVPEW--------TGVD-KTFYVEPIQFHILIFATFASLIAPFGGF 358

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGGITDRMDCQF+MG F++MYY SFI +   TVG V++T 
Sbjct: 359 FASGLKRTFKIKDFGESIPGHGGITDRMDCQFIMGFFAYMYYHSFIAVYKATVGDVIETA 418

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           +N L  ++Q+E+   L +YL +QG + E
Sbjct: 419 INGLTVEEQLEVVRGLGKYLYNQGTVSE 446



>gi|83770920|dbj|BAE61053.1| unnamed protein product [Aspergillus oryzae RIB40]
          Length = 447

 Score =  488 bits (1257), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 234/388 (60%), Positives = 295/388 (76%), Gaps = 10/388 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMIFGFF+ +  GHI++I LV  IQ + +KEVIAIA+VPSKEK L
Sbjct: 57  EKKKQTFITRTIWTFVMIFGFFIAMFSGHIYIIGLVTAIQIISFKEVIAIANVPSKEKNL 116

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWYFL +T YFLYGES+IYYFK +++VD  LLP ATHHRFISF LY +GFVFFV
Sbjct: 117 RFTKSLNWYFLATTMYFLYGESVIYYFKHVLLVDKVLLPLATHHRFISFTLYVMGFVFFV 176

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A+L+K HY+FQFTQFAWTHM L ++V Q+HF++NNI EG+IWF LP SLVI NDIFAY+C
Sbjct: 177 ASLQKGHYRFQFTQFAWTHMALYLIVVQAHFVMNNILEGMIWFFLPASLVITNDIFAYVC 236

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LI+LSPKKT EGF+GA ICTIIFG+F +++L R+ Y ICP  DL +    G 
Sbjct: 237 GITFGRTQLIQLSPKKTVEGFLGAWICTIIFGYFMTNVLMRYKYFICPVNDLGSNVLTG- 295

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNP F+PQ Y +  W        T  D ++ ++ P+Q+H+L+ A FASLIAPFGGF
Sbjct: 296 LECTPNPAFMPQPYQVPEW--------TGVD-KTFYVEPIQFHILIFATFASLIAPFGGF 346

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGGITDRMDCQF+MG F++MYY SFI +   TVG V++T 
Sbjct: 347 FASGLKRTFKIKDFGESIPGHGGITDRMDCQFIMGFFAYMYYHSFIAVYKATVGDVIETA 406

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           +N L  ++Q+E+   L +YL +QG + E
Sbjct: 407 INGLTVEEQLEVVRGLGKYLYNQGTVSE 434



>gi|317137682|ref|XP_001727892.2| phosphatidate cytidylyltransferase [Aspergillus oryzae RIB40]
 gi|391871130|gb|EIT80295.1| CDP-diacylglycerol synthase [Aspergillus oryzae 3.042]
          Length = 451

 Score =  488 bits (1257), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 234/388 (60%), Positives = 295/388 (76%), Gaps = 10/388 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMIFGFF+ +  GHI++I LV  IQ + +KEVIAIA+VPSKEK L
Sbjct: 61  EKKKQTFITRTIWTFVMIFGFFIAMFSGHIYIIGLVTAIQIISFKEVIAIANVPSKEKNL 120

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWYFL +T YFLYGES+IYYFK +++VD  LLP ATHHRFISF LY +GFVFFV
Sbjct: 121 RFTKSLNWYFLATTMYFLYGESVIYYFKHVLLVDKVLLPLATHHRFISFTLYVMGFVFFV 180

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A+L+K HY+FQFTQFAWTHM L ++V Q+HF++NNI EG+IWF LP SLVI NDIFAY+C
Sbjct: 181 ASLQKGHYRFQFTQFAWTHMALYLIVVQAHFVMNNILEGMIWFFLPASLVITNDIFAYVC 240

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LI+LSPKKT EGF+GA ICTIIFG+F +++L R+ Y ICP  DL +    G 
Sbjct: 241 GITFGRTQLIQLSPKKTVEGFLGAWICTIIFGYFMTNVLMRYKYFICPVNDLGSNVLTG- 299

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNP F+PQ Y +  W        T  D ++ ++ P+Q+H+L+ A FASLIAPFGGF
Sbjct: 300 LECTPNPAFMPQPYQVPEW--------TGVD-KTFYVEPIQFHILIFATFASLIAPFGGF 350

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGGITDRMDCQF+MG F++MYY SFI +   TVG V++T 
Sbjct: 351 FASGLKRTFKIKDFGESIPGHGGITDRMDCQFIMGFFAYMYYHSFIAVYKATVGDVIETA 410

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           +N L  ++Q+E+   L +YL +QG + E
Sbjct: 411 INGLTVEEQLEVVRGLGKYLYNQGTVSE 438



>gi|378734307|gb|EHY60766.1| phosphatidate cytidylyltransferase [Exophiala dermatitidis
           NIH/UT8656]
          Length = 455

 Score =  488 bits (1256), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 233/389 (59%), Positives = 294/389 (75%), Gaps = 10/389 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K      RTIWT VMI GFF  +  GH++V+ ++  +Q + +KEVIAIA VP+K+K L
Sbjct: 65  EKKKATFITRTIWTIVMISGFFGAMFAGHVYVLMIITAVQIISFKEVIAIAQVPTKQKNL 124

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           P  ++LNWYFL  T YFLYGES+IYYFK +++VD  LLPFATHHRFISF++Y  GFVFFV
Sbjct: 125 PLTRSLNWYFLAITMYFLYGESVIYYFKHVLLVDRVLLPFATHHRFISFMMYIFGFVFFV 184

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A+LKK HYKFQFTQFAWTHM L ++V Q+HF++NN+FEG+IWF LPVSLVI NDIFAYIC
Sbjct: 185 ASLKKGHYKFQFTQFAWTHMALYLIVVQAHFMMNNVFEGMIWFFLPVSLVITNDIFAYIC 244

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIK+SPKKT EGFVGA ICT+IFGF  ++LL R+ Y ICP  DL    F G 
Sbjct: 245 GITFGRTQLIKISPKKTVEGFVGAWICTLIFGFALTNLLMRYKYFICPVNDLGANFFTG- 303

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNPVF+ Q Y L  W    +         ++WI P+Q+H+L+ A FASLIAPFGGF
Sbjct: 304 LECTPNPVFVAQPYHLPEWTGLDY---------TLWIEPMQFHILIFATFASLIAPFGGF 354

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGG+TDRMDCQF+MG FS+MYYQSFI +   +VGAV++T 
Sbjct: 355 FASGLKRTFKIKDFGDSIPGHGGMTDRMDCQFIMGLFSYMYYQSFIAVYRTSVGAVIETA 414

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           +  L P++Q+E+   L +YL +QG++ ++
Sbjct: 415 IVGLTPEEQVEVVKGLGKYLYNQGIVSDK 443



>gi|115388615|ref|XP_001211813.1| phosphatidate cytidylyltransferase [Aspergillus terreus NIH2624]
 gi|114195897|gb|EAU37597.1| phosphatidate cytidylyltransferase [Aspergillus terreus NIH2624]
          Length = 454

 Score =  486 bits (1252), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 232/388 (59%), Positives = 295/388 (76%), Gaps = 10/388 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMI GFF+ +  GHI++I ++  +Q + +KEVIAIA+VPSKEK L
Sbjct: 64  EKKRQTFITRTIWTFVMIAGFFIAMFSGHIYIIGIISAVQIVSFKEVIAIANVPSKEKNL 123

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWYFL +T YFLYGES+IYYFK I++VD  LLP ATHHRFISF LY +GFVFFV
Sbjct: 124 RFTKSLNWYFLATTMYFLYGESVIYYFKHILLVDKVLLPLATHHRFISFTLYVMGFVFFV 183

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A+L+K HY+FQFTQFAWTHM L ++V Q+HF++NN+ EG+IWF LP SLVI NDIFAY+C
Sbjct: 184 ASLQKGHYRFQFTQFAWTHMALYLIVVQAHFVMNNVLEGMIWFFLPASLVITNDIFAYVC 243

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LI+LSPKKT EGF+GA ICTIIFG+F +++L R+ Y ICP  DL +    G 
Sbjct: 244 GITFGRTQLIQLSPKKTVEGFLGAWICTIIFGYFMTNILMRYKYFICPVNDLGSNVLTG- 302

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNPVF+P  Y L  W T L         ++ +I P+Q+H+LV A FASLIAPFGGF
Sbjct: 303 LECNPNPVFVPHAYSLPEW-TGL--------NKTFYIEPMQFHILVFATFASLIAPFGGF 353

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGGITDRMDCQF+MG F++MYY SFI + ++TVG +++T 
Sbjct: 354 FASGLKRTFKIKDFGESIPGHGGITDRMDCQFIMGFFAYMYYHSFIAVYNVTVGDIIETA 413

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           +N L  + Q+E+   L +YL +QG + E
Sbjct: 414 INGLTVEQQLEVVRGLGKYLYNQGTVSE 441



>gi|242807602|ref|XP_002484990.1| phosphatidate cytidylyltransferase [Talaromyces stipitatus ATCC
           10500]
 gi|218715615|gb|EED15037.1| phosphatidate cytidylyltransferase [Talaromyces stipitatus ATCC
           10500]
          Length = 441

 Score =  484 bits (1245), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 233/388 (60%), Positives = 295/388 (76%), Gaps = 10/388 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMI GFF  +  GHI+++ +V  +Q + +KEVIAIA+VPSK++ L
Sbjct: 51  EKKKQTFITRTIWTFVMIAGFFSAMFSGHIYLVAIVTAVQIISFKEVIAIANVPSKDRNL 110

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWYFL +T YFLYGES+IYYFK I++VD  LLPFATHHRF+SF+LY  GFVFFV
Sbjct: 111 RFTKSLNWYFLATTMYFLYGESVIYYFKHILLVDRILLPFATHHRFLSFMLYVFGFVFFV 170

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A L+K HY+FQFTQFAWTHM L ++V Q+HFI+NNIFEG+IWF LP SLVI NDIFAY+C
Sbjct: 171 ATLQKGHYRFQFTQFAWTHMALYLIVVQAHFIMNNIFEGMIWFFLPASLVITNDIFAYVC 230

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGF+GA ICTIIFG+F +++L ++ Y ICP  DL +    G 
Sbjct: 231 GITFGRTQLIKLSPKKTVEGFIGAWICTIIFGYFMTNILMQYKYFICPVTDLGSNVVSG- 289

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNPVFIP  Y L  W         F   +++ +AP+Q+H+LV A FASLIAPFGGF
Sbjct: 290 LECTPNPVFIPNTYTLPDW--------PFLP-KTITVAPMQFHILVFATFASLIAPFGGF 340

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGGITDRMDCQF+MG F++MYY SFI +   +VG V++T 
Sbjct: 341 FASGLKRTFKIKDFGESIPGHGGITDRMDCQFIMGFFAYMYYHSFIALHKASVGDVIETA 400

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           +N L  ++Q+E+   L +YL +QG++ E
Sbjct: 401 INGLTVEEQLEVVRGLGKYLYNQGVVTE 428



>gi|384483864|gb|EIE76044.1| phosphatidate cytidylyltransferase [Rhizopus delemar RA 99-880]
          Length = 380

 Score =  483 bits (1244), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 232/370 (62%), Positives = 288/370 (77%), Gaps = 5/370 (1%)

Query: 22  FFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKLPWFKTLNWYFLISTYYFLYG 81
           FF+IL  G+IW I +V++I  LVY+EVI IA   S +  L W+KT++WY+LI T YFLYG
Sbjct: 2   FFVILASGYIWSIIMVMIITVLVYREVIDIA---SAKGDLRWYKTMSWYYLIVTEYFLYG 58

Query: 82  ESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFVANLKKHHYKFQFTQFAWTHM 141
           ESIIYYFK IVMVDAFLLPF THHRFISF LY IGFVFFV NLKK  Y+ Q +QF WTHM
Sbjct: 59  ESIIYYFKEIVMVDAFLLPFTTHHRFISFTLYVIGFVFFVMNLKKGQYRQQMSQFGWTHM 118

Query: 142 TLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYICGFFWGRTPLIKLSPKKTWEG 201
            + ++V Q+HFI++NI EGLIWFV+P +LV+CNDIFAYICGFFWG+TPLI+LSPKKT EG
Sbjct: 119 AIFLIVFQAHFIVDNILEGLIWFVMPAALVVCNDIFAYICGFFWGKTPLIQLSPKKTVEG 178

Query: 202 FVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGRLTCEP-NPVFIPQRYDLNPW 260
           FVG LI T+IFGF  ++ L R+DY++CP QDL  +A +  ++CEP NPVF    + L   
Sbjct: 179 FVGGLIFTLIFGFLITTALMRFDYIVCPVQDLGASA-WSDISCEPKNPVFTAAAWRLPSL 237

Query: 261 LTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGFFASGVKRAFNIKDFGHSIP 320
           +  + + L   DI  V+IAP+Q H +VMACFASLIAPFGGFFAS VKRAF IKDFGHSIP
Sbjct: 238 IRYVIKYLFLSDISEVYIAPIQLHTIVMACFASLIAPFGGFFASAVKRAFKIKDFGHSIP 297

Query: 321 GHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTIVNSLKPQDQIELFNRLKQY 380
           GHGG+TDRMDCQFLMG F+ MYY SFIKM +++VG +L  I+N+L  ++Q+EL  RL+ Y
Sbjct: 298 GHGGLTDRMDCQFLMGLFAFMYYHSFIKMYNVSVGTILALIINNLSSKEQLELLERLQTY 357

Query: 381 LLSQGLLEER 390
           L++Q  L  +
Sbjct: 358 LINQDHLASQ 367



>gi|358368935|dbj|GAA85551.1| phosphatidate cytidylyltransferase [Aspergillus kawachii IFO 4308]
          Length = 453

 Score =  481 bits (1239), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 232/388 (59%), Positives = 293/388 (75%), Gaps = 10/388 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMIFGFF+ +  GHI++I +V  +Q + +KEVIAIA+VPSKEK L
Sbjct: 64  EKKKQTFITRTIWTFVMIFGFFVAMFSGHIYIIGIVTAVQIISFKEVIAIANVPSKEKNL 123

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWYFL +T YFLYGES+IYYFK +++VD  LLP ATHHRFISF LY +GFVFFV
Sbjct: 124 RFTKSLNWYFLATTMYFLYGESVIYYFKHVLLVDRVLLPLATHHRFISFTLYVMGFVFFV 183

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A+L+K  Y+FQFTQFAWTHM L ++V Q+HF++NNI EG+IWF LP SLVI NDIFAY+C
Sbjct: 184 ASLQKGQYRFQFTQFAWTHMALYLIVVQAHFVMNNILEGMIWFFLPASLVITNDIFAYVC 243

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LI+LSPKKT EGF+GA ICTIIFG+F +++L R+ Y ICP  DL      G 
Sbjct: 244 GITFGRTQLIQLSPKKTVEGFLGAWICTIIFGYFMTNILMRYKYFICPVNDLGANVLTG- 302

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNP F+PQ Y +  W T + +  TF+      I P+Q+H+L+ A FASLIAPFGGF
Sbjct: 303 LQCSPNPAFVPQPYHVPEW-TGMHK--TFQ------IEPIQFHILIFATFASLIAPFGGF 353

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGGITDRMDCQF+MG FS+MYY SFI +   +VG V++  
Sbjct: 354 FASGLKRTFKIKDFGESIPGHGGITDRMDCQFIMGFFSYMYYHSFIAVFKASVGDVIEAA 413

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           +N L  ++Q+E+   L +YL +QG + E
Sbjct: 414 INGLTVEEQLEVVRGLSKYLYNQGTVSE 441



>gi|70991200|ref|XP_750449.1| phosphatidate cytidylyltransferase [Aspergillus fumigatus Af293]
 gi|66848081|gb|EAL88411.1| phosphatidate cytidylyltransferase [Aspergillus fumigatus Af293]
 gi|159130923|gb|EDP56036.1| phosphatidate cytidylyltransferase [Aspergillus fumigatus A1163]
          Length = 432

 Score =  481 bits (1239), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 230/388 (59%), Positives = 294/388 (75%), Gaps = 10/388 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMIF FF+ +  GHI++I +V  +Q + +KEVIAIA+VPS+EK +
Sbjct: 42  EKKKQTFITRTIWTFVMIFLFFIAMFSGHIYIIGIVTAVQIISFKEVIAIANVPSREKNI 101

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWYFL +T YFLYGES+IYYFK I++V+  LLP ATHHRFISF LY +GFVFFV
Sbjct: 102 RFTKSLNWYFLATTMYFLYGESVIYYFKHILLVEKGLLPLATHHRFISFTLYVMGFVFFV 161

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A+L+K HY+FQFTQFAWTHM L ++V Q+HF++NN+FEG+IWF LP SLVI NDIFAY+C
Sbjct: 162 ASLQKGHYRFQFTQFAWTHMALYLIVVQAHFVMNNVFEGMIWFFLPASLVITNDIFAYVC 221

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LI+LSPKKT EGF+GA ICTIIFG+F +++L R+ Y ICP  DL +    G 
Sbjct: 222 GITFGRTQLIQLSPKKTVEGFLGAWICTIIFGYFMTNILMRYKYFICPVNDLGSNVLTG- 280

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNPVF+PQ Y L  W T L         ++ ++ P+Q+H+LV A FASLIAPFGGF
Sbjct: 281 LQCNPNPVFVPQPYSLPEW-TGL--------SKTFYVEPMQFHILVFATFASLIAPFGGF 331

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGGITDRMDCQF+MG FS+MYY SFI +   +VG +++  
Sbjct: 332 FASGLKRTFKIKDFGESIPGHGGITDRMDCQFIMGFFSYMYYHSFIAVYKASVGDIIEAA 391

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           +N L  ++Q E+   L +YL +QG + E
Sbjct: 392 INGLTVEEQFEVVRGLGKYLYNQGTVSE 419



>gi|121702389|ref|XP_001269459.1| phosphatidate cytidylyltransferase [Aspergillus clavatus NRRL 1]
 gi|119397602|gb|EAW08033.1| phosphatidate cytidylyltransferase [Aspergillus clavatus NRRL 1]
          Length = 454

 Score =  481 bits (1237), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 230/388 (59%), Positives = 291/388 (75%), Gaps = 10/388 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMI  FF+ +  GHI++I +V  +Q + +KEVIAIA+VPS+EK L
Sbjct: 64  EKKKQTFITRTIWTFVMILFFFIAMFSGHIYIIGIVTAVQIVSFKEVIAIANVPSREKNL 123

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWYFL +T YFLYGES+IYYFK I++VD  LLP ATHHRFISF LY +GFVFFV
Sbjct: 124 RFTKSLNWYFLATTMYFLYGESVIYYFKHILLVDKVLLPLATHHRFISFTLYVMGFVFFV 183

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A+L+K HY+FQFTQFAWTHM L ++V Q+HF++NN+FEG+IWF LP SLVI NDIFAY+C
Sbjct: 184 ASLQKGHYRFQFTQFAWTHMALYLIVVQAHFVMNNVFEGMIWFFLPASLVITNDIFAYVC 243

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LI+LSPKKT EGF+GA ICTIIFG+F +++L R+ Y ICP  DL      G 
Sbjct: 244 GITFGRTQLIQLSPKKTVEGFLGAWICTIIFGYFMTNILMRYKYFICPVNDLGANVLTG- 302

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNPVF+PQ Y L  W T L         ++ ++ P+Q+H+LV A FASLIAPFGGF
Sbjct: 303 LQCTPNPVFVPQPYSLPEW-TGL--------AKTFYVEPMQFHILVFATFASLIAPFGGF 353

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGGITDRMDCQF+MG FS+MYY SFI +   +VG +++  
Sbjct: 354 FASGLKRTFKIKDFGESIPGHGGITDRMDCQFIMGFFSYMYYHSFIAVYKASVGDIIEAA 413

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           +N L    Q+E+   L +YL +QG + +
Sbjct: 414 INGLTVDQQLEVVRGLGKYLYNQGTISD 441



>gi|145238768|ref|XP_001392031.1| phosphatidate cytidylyltransferase [Aspergillus niger CBS 513.88]
 gi|134076527|emb|CAK39722.1| unnamed protein product [Aspergillus niger]
          Length = 453

 Score =  480 bits (1235), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 232/388 (59%), Positives = 292/388 (75%), Gaps = 10/388 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMIFGFF+ +  GHI++I +V  +Q + +KEVIAIA+VPSKEK L
Sbjct: 64  EKKKQTFITRTIWTFVMIFGFFVAMFSGHIYIIGIVTAVQIISFKEVIAIANVPSKEKNL 123

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWYFL +T YFLYGES+IYYFK +++VD  LLP ATHHRFISF LY +GFVFFV
Sbjct: 124 RFTKSLNWYFLATTMYFLYGESVIYYFKHVLLVDRVLLPLATHHRFISFTLYVMGFVFFV 183

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A+L+K  Y+FQFTQFAWTHM L ++V Q+HF++NNI EG+IWF LP SLVI NDIFAY+C
Sbjct: 184 ASLQKGQYRFQFTQFAWTHMALYLIVVQAHFVMNNILEGMIWFFLPASLVITNDIFAYVC 243

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LI+LSPKKT EGF+GA ICTIIFG+F +++L R+ Y ICP  DL      G 
Sbjct: 244 GITFGRTQLIQLSPKKTVEGFLGAWICTIIFGYFMTNILMRYKYFICPVNDLGANVLTG- 302

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNP F+PQ Y +  W T + +  TF       I P+Q+H+L+ A FASLIAPFGGF
Sbjct: 303 LQCSPNPAFVPQPYHVPEW-TGMHK--TFH------IEPIQFHILIFATFASLIAPFGGF 353

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGGITDRMDCQF+MG FS+MYY SFI +   +VG V++  
Sbjct: 354 FASGLKRTFKIKDFGESIPGHGGITDRMDCQFIMGFFSYMYYHSFIAVFKASVGDVIEIA 413

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           +N L  ++Q+E+   L +YL +QG + E
Sbjct: 414 INGLSVEEQLEVVRGLSKYLYNQGTVSE 441



>gi|350635960|gb|EHA24321.1| hypothetical protein ASPNIDRAFT_181254 [Aspergillus niger ATCC
           1015]
          Length = 440

 Score =  479 bits (1234), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 232/388 (59%), Positives = 292/388 (75%), Gaps = 10/388 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMIFGFF+ +  GHI++I +V  +Q + +KEVIAIA+VPSKEK L
Sbjct: 51  EKKKQTFITRTIWTFVMIFGFFVAMFSGHIYIIGIVTAVQIISFKEVIAIANVPSKEKNL 110

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWYFL +T YFLYGES+IYYFK +++VD  LLP ATHHRFISF LY +GFVFFV
Sbjct: 111 RFTKSLNWYFLATTMYFLYGESVIYYFKHVLLVDRVLLPLATHHRFISFTLYVMGFVFFV 170

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A+L+K  Y+FQFTQFAWTHM L ++V Q+HF++NNI EG+IWF LP SLVI NDIFAY+C
Sbjct: 171 ASLQKGQYRFQFTQFAWTHMALYLIVVQAHFVMNNILEGMIWFFLPASLVITNDIFAYVC 230

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LI+LSPKKT EGF+GA ICTIIFG+F +++L R+ Y ICP  DL      G 
Sbjct: 231 GITFGRTQLIQLSPKKTVEGFLGAWICTIIFGYFMTNILMRYKYFICPVNDLGANVLTG- 289

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNP F+PQ Y +  W T + +  TF       I P+Q+H+L+ A FASLIAPFGGF
Sbjct: 290 LQCSPNPAFVPQPYHVPEW-TGMHK--TFH------IEPIQFHILIFATFASLIAPFGGF 340

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGGITDRMDCQF+MG FS+MYY SFI +   +VG V++  
Sbjct: 341 FASGLKRTFKIKDFGESIPGHGGITDRMDCQFIMGFFSYMYYHSFIAVFKASVGDVIEIA 400

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           +N L  ++Q+E+   L +YL +QG + E
Sbjct: 401 INGLSVEEQLEVVRGLSKYLYNQGTVSE 428



>gi|327295715|ref|XP_003232552.1| phosphatidate cytidylyltransferase [Trichophyton rubrum CBS 118892]
 gi|326464863|gb|EGD90316.1| phosphatidate cytidylyltransferase [Trichophyton rubrum CBS 118892]
          Length = 463

 Score =  479 bits (1234), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 232/388 (59%), Positives = 290/388 (74%), Gaps = 10/388 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMI GFF+I+  GH+++I +V  IQ + +KEVIAIA+VPSK + L
Sbjct: 71  EKKRQTFITRTIWTFVMIAGFFVIIFAGHLYLIIVVTAIQIVSFKEVIAIANVPSKARNL 130

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWYFL++T YFLYGES++YYFK I++VD  LLPFATHHRFISF+LY IGFVFFV
Sbjct: 131 KFTKSLNWYFLVTTMYFLYGESVLYYFKHILLVDRILLPFATHHRFISFMLYLIGFVFFV 190

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A L+K HYKFQFTQFAWTHM L ++V Q+HF++NNIFEGLIWF +PVSLVI NDIFAYIC
Sbjct: 191 ATLQKGHYKFQFTQFAWTHMALYLIVVQAHFVLNNIFEGLIWFCIPVSLVITNDIFAYIC 250

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA +CT+IFG+  + LL+++ Y  CP  DL +    G 
Sbjct: 251 GITFGRTQLIKLSPKKTVEGFVGAWVCTVIFGYGATILLKQYKYFTCPVNDLGSNLLTG- 309

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNP F  Q Y +  W             ++  IAP+Q+HV V++ FASLIAPFGGF
Sbjct: 310 LECTPNPCFKAQPYTMPEWT---------HINKTFHIAPVQFHVFVLSTFASLIAPFGGF 360

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGGITDRMDCQF+MG F++MYY SFI +   +VG V++  
Sbjct: 361 FASGLKRTFKIKDFGESIPGHGGITDRMDCQFIMGLFAYMYYHSFIAVHKASVGGVIENA 420

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           +  L   +QIEL   L +YL +QG++ E
Sbjct: 421 ITGLTVDEQIELIKGLSKYLYNQGVVSE 448



>gi|449300349|gb|EMC96361.1| hypothetical protein BAUCODRAFT_33690 [Baudoinia compniacensis UAMH
           10762]
          Length = 486

 Score =  479 bits (1233), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 233/380 (61%), Positives = 296/380 (77%), Gaps = 6/380 (1%)

Query: 6   KNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKLPWFK 65
           +N   R +WTF+MI  FF  +  GHI++I +V  +Q + +KEVIAI++VPS+ + L + K
Sbjct: 92  QNFWTRALWTFIMIGIFFGAMFAGHIYIIIIVTAVQIISFKEVIAISNVPSRARSLRFTK 151

Query: 66  TLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFVANLK 125
           TLNWYFL +T YFLYGES+IYYFK IV++D  LLPFATHHRFISF+LY +GFVFFVA+L+
Sbjct: 152 TLNWYFLGTTMYFLYGESVIYYFKHIVLIDRVLLPFATHHRFISFMLYVMGFVFFVASLQ 211

Query: 126 KHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYICGFFW 185
           K HYKFQFTQFAWTHM L ++V Q+HFI+NNIFEG+IWF LPVSLVI NDIFAY+CG  +
Sbjct: 212 KGHYKFQFTQFAWTHMALYLIVVQAHFIMNNIFEGMIWFFLPVSLVITNDIFAYVCGITF 271

Query: 186 GRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGRLTCE 245
           GRT LIKLSPKKT EGFVGA ICTII GF  ++LL ++ Y ICP  DL    F G L CE
Sbjct: 272 GRTQLIKLSPKKTVEGFVGAWICTIILGFALTNLLMKYKYFICPVNDLGANIFTG-LECE 330

Query: 246 PNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGFFASG 305
           PNPVFIP+ Y L P++   +  L  K    V ++P+Q+H+++M+ FASLIAPFGGFFASG
Sbjct: 331 PNPVFIPRTYQL-PFVPHNWTFLPTK----VTVSPMQFHIMIMSTFASLIAPFGGFFASG 385

Query: 306 VKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTIVNSL 365
           +KR FNIKDFG SIPGHGG+TDRMDCQF+MG F+ MYYQSFI +   +VG+V++T +  L
Sbjct: 386 LKRTFNIKDFGDSIPGHGGMTDRMDCQFIMGFFAFMYYQSFIAVYKASVGSVIETAITGL 445

Query: 366 KPQDQIELFNRLKQYLLSQG 385
            P++Q+E+   L ++L +QG
Sbjct: 446 TPEEQMEVVKGLAKHLYNQG 465



>gi|315044991|ref|XP_003171871.1| phosphatidate cytidylyltransferase [Arthroderma gypseum CBS 118893]
 gi|311344214|gb|EFR03417.1| phosphatidate cytidylyltransferase [Arthroderma gypseum CBS 118893]
          Length = 463

 Score =  479 bits (1233), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 231/388 (59%), Positives = 290/388 (74%), Gaps = 10/388 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMI GFF+I+  GH+++I +V  +Q + +KEVIAIA+VPSK + L
Sbjct: 71  EKKRQTFITRTIWTFVMIAGFFVIIFAGHLYLIIVVTAVQIVSFKEVIAIANVPSKARNL 130

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWYFL++T YFLYGES++YYFK I++VD  LLPFATHHRFISF+LY IGFVFFV
Sbjct: 131 KFTKSLNWYFLVTTMYFLYGESVLYYFKHILLVDRILLPFATHHRFISFMLYLIGFVFFV 190

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A L+K HYKFQFTQFAWTHM L ++V Q+HF++NNIFEGLIWF +PVSLVI NDIFAYIC
Sbjct: 191 ATLQKGHYKFQFTQFAWTHMALYLIVVQAHFVLNNIFEGLIWFCIPVSLVITNDIFAYIC 250

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA +CT+IFG+  + +L+++ Y  CP  DL +    G 
Sbjct: 251 GITFGRTQLIKLSPKKTVEGFVGAWVCTVIFGYGATIVLKQYKYFTCPVNDLGSNLLTG- 309

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNP F  Q Y +  W             R+  IAP+Q+HV V++ FASLIAPFGGF
Sbjct: 310 LECTPNPCFKSQPYTMPEWT---------HINRTFHIAPVQFHVFVLSTFASLIAPFGGF 360

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGGITDRMDCQF+MG F++MYY SFI +   +VG V++  
Sbjct: 361 FASGLKRTFKIKDFGESIPGHGGITDRMDCQFIMGLFAYMYYHSFIAVHKASVGGVIENA 420

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           +  L   +QIEL   L +YL +QG++ E
Sbjct: 421 ITGLTVDEQIELIKGLSKYLYNQGVVSE 448



>gi|212538095|ref|XP_002149203.1| phosphatidate cytidylyltransferase [Talaromyces marneffei ATCC
           18224]
 gi|210068945|gb|EEA23036.1| phosphatidate cytidylyltransferase [Talaromyces marneffei ATCC
           18224]
          Length = 442

 Score =  479 bits (1233), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 236/388 (60%), Positives = 292/388 (75%), Gaps = 10/388 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMI GFF  +  GHI++I +V  +Q + +KEVIAIA+VPSK + L
Sbjct: 52  EKKKQTFITRTIWTFVMIAGFFSAMFSGHIYLIAIVTAVQIISFKEVIAIANVPSKGRNL 111

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWYFL +T YFLYGES+IYYFK I++VD  LLPFATHHRF+SF+LY  GFVFFV
Sbjct: 112 RFTKSLNWYFLATTMYFLYGESVIYYFKHILLVDRILLPFATHHRFLSFMLYVFGFVFFV 171

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A L+K HY+FQFTQFAWTHM L ++V Q+HFI+NNIFEG+IWF LP SLVI NDIFAY+C
Sbjct: 172 ATLQKGHYRFQFTQFAWTHMALYLIVVQAHFIMNNIFEGMIWFFLPASLVITNDIFAYVC 231

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGF+GA ICTIIFG+F +++L ++ Y ICP  DL +    G 
Sbjct: 232 GITFGRTQLIKLSPKKTVEGFIGAWICTIIFGYFMTNILMQYKYFICPVTDLGSNVVTG- 290

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C  NPVFIP  Y L  W       L    IR   +AP+Q+H+LV A FASLIAPFGGF
Sbjct: 291 LECTVNPVFIPTTYHLPDW------PLLPTTIR---VAPMQFHILVFATFASLIAPFGGF 341

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGGITDRMDCQF+MG F+ MYYQSFI +   +VG V++T 
Sbjct: 342 FASGLKRTFKIKDFGESIPGHGGITDRMDCQFIMGFFAFMYYQSFIALHKASVGDVIETA 401

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           +N L  ++Q+E+   L +YL +QG++ E
Sbjct: 402 INGLTVEEQLEVVRGLGKYLYNQGVVTE 429



>gi|452987195|gb|EME86951.1| hypothetical protein MYCFIDRAFT_186963 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 468

 Score =  479 bits (1233), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 236/389 (60%), Positives = 294/389 (75%), Gaps = 6/389 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    R IWT VMI  FF  +  GHI+VI +V  +Q L +KEVIAI++VPS+ + L
Sbjct: 70  EKKKQTFITRGIWTIVMIAIFFGCMFAGHIYVIIVVTAVQILSFKEVIAISNVPSRARAL 129

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWYFL +T YFLYGES+IYYFK IV++D  LLPFATHHRFISF+LY +GFVFFV
Sbjct: 130 QFSKSLNWYFLGTTMYFLYGESVIYYFKHIVLIDKVLLPFATHHRFISFMLYVMGFVFFV 189

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K HYKFQFTQFAWTHM L ++V Q+HFI+NNIFEG+IWF LPVSLVI NDIFAYIC
Sbjct: 190 GSLQKGHYKFQFTQFAWTHMALYLIVVQAHFIMNNIFEGMIWFFLPVSLVIINDIFAYIC 249

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA ICTI+ GF +++LL R  Y ICP  DL    F G 
Sbjct: 250 GITFGRTQLIKLSPKKTVEGFVGAWICTILMGFGFTNLLMRSKYFICPVNDLGANIFTG- 308

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L CE NPVFIP  Y L P++   +  L     +++ ++P+Q+H+LVMA FASLIAPFGGF
Sbjct: 309 LECEANPVFIPHNYTL-PFIPHTWDFLP----QTLTVSPMQFHILVMASFASLIAPFGGF 363

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR FNIKDFG SIPGHGG+TDRMDCQF+MG FS+MYYQSFI     T+G V++T 
Sbjct: 364 FASGLKRTFNIKDFGDSIPGHGGMTDRMDCQFIMGFFSYMYYQSFIATHKATIGGVIETA 423

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           +  L P++Q+ +   L Q+L +QG +  +
Sbjct: 424 ITGLTPEEQMAVVKGLAQHLYNQGTISHK 452



>gi|302510699|ref|XP_003017301.1| hypothetical protein ARB_04181 [Arthroderma benhamiae CBS 112371]
 gi|291180872|gb|EFE36656.1| hypothetical protein ARB_04181 [Arthroderma benhamiae CBS 112371]
          Length = 463

 Score =  479 bits (1232), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 231/388 (59%), Positives = 290/388 (74%), Gaps = 10/388 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMI GFF+I+  GH+++I +V  IQ + +KEVIAIA+VPSK + L
Sbjct: 72  EKKRQTFITRTIWTFVMIAGFFVIIFAGHLYLIIVVTAIQIVSFKEVIAIANVPSKARNL 131

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWYFL++T YFLYGES++YYFK I++VD  LLPFATHHRFISF+LY IGFVFFV
Sbjct: 132 KFTKSLNWYFLVTTMYFLYGESVLYYFKHILLVDRILLPFATHHRFISFMLYLIGFVFFV 191

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A L+K HYKFQFTQFAWTHM L ++V Q+HF++NNIFEGLIWF +PVSLVI NDIFAYIC
Sbjct: 192 ATLQKGHYKFQFTQFAWTHMALYLIVVQAHFVLNNIFEGLIWFCIPVSLVITNDIFAYIC 251

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA +CT+IFG+  + LL+++ Y  CP  DL +    G 
Sbjct: 252 GITFGRTQLIKLSPKKTVEGFVGAWVCTVIFGYGATILLKQYKYFTCPVNDLGSNLLTG- 310

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNP F  Q Y +  W             ++  IAP+Q+HV V++ FASLIAPFGGF
Sbjct: 311 LECTPNPCFKAQPYTMPEWT---------HINKTFHIAPVQFHVFVLSTFASLIAPFGGF 361

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGGITDRMDCQF+MG F++MYY SFI +   +VG V++  
Sbjct: 362 FASGLKRTFKIKDFGESIPGHGGITDRMDCQFIMGLFAYMYYHSFIAVHKASVGGVIENA 421

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           +  L   +Q+EL   L +YL +QG++ E
Sbjct: 422 ITGLTVDEQLELIKGLSKYLYNQGVVSE 449



>gi|296810308|ref|XP_002845492.1| phosphatidate cytidylyltransferase [Arthroderma otae CBS 113480]
 gi|238842880|gb|EEQ32542.1| phosphatidate cytidylyltransferase [Arthroderma otae CBS 113480]
          Length = 453

 Score =  478 bits (1231), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 231/388 (59%), Positives = 289/388 (74%), Gaps = 10/388 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMI GFF+I+  GH+++I +V  +Q + +KEVIAIA VPSK + L
Sbjct: 68  EKKRQTFITRTIWTFVMIAGFFVIIFAGHLYLIIVVTAVQIVSFKEVIAIADVPSKARNL 127

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWYFL++T YFLYGES++YYFK I++VD  LLPFATHHRFISF+LY IGFVFFV
Sbjct: 128 KFTKSLNWYFLVTTMYFLYGESVLYYFKHILLVDRILLPFATHHRFISFMLYLIGFVFFV 187

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A L+K HYKFQFTQFAWTHM L ++V Q+HF++NNIFEGLIWF +PVSLVI NDIFAYIC
Sbjct: 188 ATLQKGHYKFQFTQFAWTHMALYLIVVQAHFVLNNIFEGLIWFCIPVSLVITNDIFAYIC 247

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA ICT+IFG+  + +L+++ Y  CP  DL +    G 
Sbjct: 248 GITFGRTQLIKLSPKKTVEGFVGAWICTVIFGYGATIVLKQYKYFTCPVNDLGSNLLTG- 306

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNP F  Q Y +  W             ++  IAP+Q+HV V++ FASLIAPFGGF
Sbjct: 307 LECTPNPCFRAQPYTMPEWT---------HINKTFHIAPVQFHVFVLSTFASLIAPFGGF 357

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGGITDRMDCQF+MG F++MYY SFI +   +VG V++  
Sbjct: 358 FASGLKRTFKIKDFGESIPGHGGITDRMDCQFIMGLFAYMYYHSFIAVHKASVGGVIENA 417

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           +  L   +QIEL   L +YL +QG++ E
Sbjct: 418 ITGLTVDEQIELIKGLSKYLYNQGVVSE 445



>gi|327352578|gb|EGE81435.1| phosphatidate cytidylyltransferase [Ajellomyces dermatitidis ATCC
           18188]
          Length = 456

 Score =  478 bits (1231), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 232/389 (59%), Positives = 289/389 (74%), Gaps = 6/389 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMI GFF+ +  GHI++I ++ V+Q + +KEVIAIA+VPSK K L
Sbjct: 61  EKKKQTFITRTIWTFVMIAGFFIAMFSGHIYLIAIITVVQIISFKEVIAIANVPSKAKNL 120

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K LNWYFL +T YFLYGES+IYYFK I++VD  LLP ATHHRF+SF+LY +GFVFFV
Sbjct: 121 KFTKALNWYFLATTMYFLYGESVIYYFKHILLVDKVLLPLATHHRFLSFMLYVMGFVFFV 180

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K HY+FQFTQFAWTHM L ++V Q+HFI+NNIFEG+IWF LPVSLVI NDIFAY+C
Sbjct: 181 GSLQKGHYRFQFTQFAWTHMALYLIVVQAHFIMNNIFEGMIWFFLPVSLVITNDIFAYVC 240

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA ICTI+FG+  +++L +  Y ICP  DL + A  G 
Sbjct: 241 GITFGRTQLIKLSPKKTVEGFVGAWICTILFGYGMTNVLMKHKYFICPVNDLGSNALTG- 299

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNPVF PQ Y L  W        T    ++V+ AP+Q H+ V A FASLIAPFGGF
Sbjct: 300 LECTPNPVFTPQPYQLPTWTP-----WTHSPPKTVYFAPMQIHIFVFATFASLIAPFGGF 354

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F +KDFG SIPGHGGITDRMDCQF+MG F++MYY SFI +   +VG V++  
Sbjct: 355 FASGLKRTFKVKDFGESIPGHGGITDRMDCQFIMGFFAYMYYHSFIAVYKASVGNVIEAS 414

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           +N L    Q+E+   L +YL +QG + E 
Sbjct: 415 INGLTVDQQLEVIRGLSKYLYNQGEVSEN 443



>gi|326472298|gb|EGD96307.1| phosphatidate cytidylyltransferase [Trichophyton tonsurans CBS
           112818]
 gi|326480511|gb|EGE04521.1| phosphatidate cytidylyltransferase [Trichophyton equinum CBS
           127.97]
          Length = 464

 Score =  478 bits (1230), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 231/388 (59%), Positives = 290/388 (74%), Gaps = 10/388 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMI GFF+I+  GH+++I +V  +Q + +KEVIAIA+VPSK + L
Sbjct: 72  EKKRQTFITRTIWTFVMIAGFFVIIFAGHLYLIIVVTAVQIVSFKEVIAIANVPSKARNL 131

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWYFL++T YFLYGES++YYFK I++VD  LLPFATHHRFISF+LY IGFVFFV
Sbjct: 132 KFTKSLNWYFLVTTMYFLYGESVLYYFKHILLVDRILLPFATHHRFISFMLYLIGFVFFV 191

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A L+K HYKFQFTQFAWTHM L ++V Q+HF++NNIFEGLIWF +PVSLVI NDIFAYIC
Sbjct: 192 ATLQKGHYKFQFTQFAWTHMALYLIVVQAHFVLNNIFEGLIWFCIPVSLVITNDIFAYIC 251

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA +CT+IFG+  + LL+++ Y  CP  DL +    G 
Sbjct: 252 GITFGRTQLIKLSPKKTVEGFVGAWVCTVIFGYGATILLKQYKYFTCPVNDLGSNLLTG- 310

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNP F  Q Y +  W             ++  IAP+Q+HV V++ FASLIAPFGGF
Sbjct: 311 LECTPNPCFKAQPYTMPEWT---------HINKTFHIAPVQFHVFVLSTFASLIAPFGGF 361

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGGITDRMDCQF+MG F++MYY SFI +   +VG V++  
Sbjct: 362 FASGLKRTFKIKDFGESIPGHGGITDRMDCQFIMGLFAYMYYHSFIAVHKASVGGVIENA 421

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           +  L   +QIEL   L +YL +QG++ E
Sbjct: 422 ITGLTVDEQIELIKGLSKYLYNQGVVSE 449



>gi|328766814|gb|EGF76866.1| hypothetical protein BATDEDRAFT_30828 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 414

 Score =  478 bits (1229), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 253/398 (63%), Positives = 296/398 (74%), Gaps = 14/398 (3%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
           + KWKN  VRT WT +MI GF  IL  GH WVI LV VIQT+VY+EVI+I   PSKE+ L
Sbjct: 16  TAKWKNWWVRTFWTVIMISGFISILMAGHAWVIALVTVIQTIVYREVISIGVQPSKERHL 75

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           PWF++L+WYFL ST YFLYGES+I+YFK +V VDAFL+P A HHRFISF+LYC+G V FV
Sbjct: 76  PWFRSLHWYFLGSTNYFLYGESLIHYFKPVVFVDAFLMPLANHHRFISFLLYCLGLVNFV 135

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            NLKK +YKFQF+ F WTHM LL+V  QSHFI+NNIFEGLIWFVLPVSLVICNDI AYIC
Sbjct: 136 LNLKKGNYKFQFSHFCWTHMALLLVAVQSHFIVNNIFEGLIWFVLPVSLVICNDIMAYIC 195

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           GFFWGRTPLI+LSPKKTWEGF+G  I T IF FF S++L    YM CP ++  T    G 
Sbjct: 196 GFFWGRTPLIRLSPKKTWEGFIGGFIITFIFAFFISAVLASGSYMTCPMKNFQTNMNSGH 255

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFK-------------DIRSVWIAPLQWHVLVM 288
            TC  NPVF+ +   + P +T L R L+                IRS  I PLQ+H L++
Sbjct: 256 -TCPVNPVFVSRDMYIFPAVTGLIRWLSMPITILLPSIMPAPLVIRSFSIMPLQFHALLL 314

Query: 289 ACFASLIAPFGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIK 348
           ACFASLIAPFGGFFASGVKRAF IKDFG SIPGHGG+TDRMDCQF+MG FS +Y+QSFI 
Sbjct: 315 ACFASLIAPFGGFFASGVKRAFKIKDFGDSIPGHGGLTDRMDCQFIMGVFSFIYFQSFIG 374

Query: 349 MSSLTVGAVLQTIVNSLKPQDQIELFNRLKQYLLSQGL 386
            + +TVG VLQ+ V+ L   DQ+EL  RL QYL  QG+
Sbjct: 375 TTGVTVGTVLQSAVSYLSIADQVELHRRLTQYLAGQGV 412



>gi|302656340|ref|XP_003019924.1| hypothetical protein TRV_06025 [Trichophyton verrucosum HKI 0517]
 gi|291183700|gb|EFE39300.1| hypothetical protein TRV_06025 [Trichophyton verrucosum HKI 0517]
          Length = 571

 Score =  478 bits (1229), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 231/388 (59%), Positives = 290/388 (74%), Gaps = 10/388 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMI GFF+I+  GH+++I +V  IQ + +KEVIAIA+VPSK + L
Sbjct: 72  EKKRQTFITRTIWTFVMIAGFFVIIFAGHLYLIIVVTAIQIVSFKEVIAIANVPSKARNL 131

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWYFL++T YFLYGES++YYFK I++VD  LLPFATHHRFISF+LY IGFVFFV
Sbjct: 132 KFTKSLNWYFLVTTMYFLYGESVLYYFKHILLVDRILLPFATHHRFISFMLYLIGFVFFV 191

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A L+K HYKFQFTQFAWTHM L ++V Q+HF++NNIFEGLIWF +PVSLVI NDIFAYIC
Sbjct: 192 ATLQKGHYKFQFTQFAWTHMALYLIVVQAHFVLNNIFEGLIWFSIPVSLVITNDIFAYIC 251

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA +CT+IFG+  + LL+++ Y  CP  DL +    G 
Sbjct: 252 GITFGRTQLIKLSPKKTVEGFVGAWVCTVIFGYGATILLKQYKYFTCPVNDLGSNLLTG- 310

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNP F  Q Y +  W             ++  IAP+Q+HV V++ FASLIAPFGGF
Sbjct: 311 LECTPNPCFKAQPYTMPEWT---------HINKTFHIAPVQFHVFVLSTFASLIAPFGGF 361

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGGITDRMDCQF+MG F++MYY SFI +   +VG V++  
Sbjct: 362 FASGLKRTFKIKDFGESIPGHGGITDRMDCQFIMGLFAYMYYHSFIAVHKASVGGVIENA 421

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           +  L   +Q+EL   L +YL +QG++ E
Sbjct: 422 ITGLTVDEQLELIKGLSKYLYNQGVVSE 449



>gi|259484620|tpe|CBF81000.1| TPA: phosphatidate cytidylyltransferase (AFU_orthologue;
           AFUA_1G07010) [Aspergillus nidulans FGSC A4]
          Length = 450

 Score =  477 bits (1228), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 225/387 (58%), Positives = 296/387 (76%), Gaps = 10/387 (2%)

Query: 3   QKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKLP 62
           +K +    RTIWTFVMI GFF+ +  GHI++I LV  +Q + +KEVIAIA+VPSKEK + 
Sbjct: 61  KKKQTFITRTIWTFVMIAGFFIAMFSGHIYIIGLVTAVQIISFKEVIAIANVPSKEKNIR 120

Query: 63  WFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFVA 122
           + K+LNWYFL ++ YFLYGES+IYYFK I++VD  LLP A+HHRFISFVL+ +GFVFFVA
Sbjct: 121 FTKSLNWYFLGTSMYFLYGESVIYYFKHILLVDRVLLPLASHHRFISFVLWIMGFVFFVA 180

Query: 123 NLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYICG 182
           +L+K HY+FQFTQFAWTHM L ++V Q+HF++NNI EG+IWF LP SLVI NDIFAY+CG
Sbjct: 181 SLQKGHYRFQFTQFAWTHMALYLIVVQAHFVMNNILEGMIWFFLPASLVITNDIFAYVCG 240

Query: 183 FFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGRL 242
             +GRT LI+LSPKKT EGF+GA +CTIIFG+F +++L R+ Y ICP  DL +    G L
Sbjct: 241 ITFGRTQLIQLSPKKTVEGFLGAWVCTIIFGYFMTNILMRYKYFICPVYDLGSNVLTG-L 299

Query: 243 TCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGFF 302
            C+PNPVF+PQ +++  W             R+ ++AP+Q+H+L+ A FASL+APFGGFF
Sbjct: 300 ECDPNPVFVPQAFEIPEWTGFG---------RTFYVAPMQFHILLFATFASLVAPFGGFF 350

Query: 303 ASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTIV 362
           ASG+KR+F IKDFG SIPGHGGITDRMDCQF+MG F++MYY SFI +   +VG +++  +
Sbjct: 351 ASGLKRSFKIKDFGESIPGHGGITDRMDCQFIMGFFAYMYYHSFIAVFKASVGDIIEAAI 410

Query: 363 NSLKPQDQIELFNRLKQYLLSQGLLEE 389
           N L   +Q+E+   L +YL +QG + E
Sbjct: 411 NGLTVDEQLEVLRGLSKYLYNQGAVPE 437



>gi|119496383|ref|XP_001264965.1| phosphatidate cytidylyltransferase [Neosartorya fischeri NRRL 181]
 gi|119413127|gb|EAW23068.1| phosphatidate cytidylyltransferase [Neosartorya fischeri NRRL 181]
          Length = 454

 Score =  477 bits (1228), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 228/388 (58%), Positives = 292/388 (75%), Gaps = 10/388 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMI  FF+ +  GHI++I +V  +Q + +KEVIAIA+VPS+EK +
Sbjct: 64  EKKKQTFITRTIWTFVMISLFFIAMFSGHIYIIGIVTAVQIISFKEVIAIANVPSREKNI 123

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWYFL +T YFLYGES+IYYFK I++V+  LLP ATHHRFISF LY +GFVFFV
Sbjct: 124 RFTKSLNWYFLATTMYFLYGESVIYYFKHILLVEKGLLPLATHHRFISFTLYVMGFVFFV 183

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A+L+K HY+FQFTQFAWTHM L ++V Q+HF++NN+FEG+IWF LP SLVI NDIFAY+C
Sbjct: 184 ASLQKGHYRFQFTQFAWTHMALYLIVVQAHFVMNNVFEGMIWFFLPASLVITNDIFAYVC 243

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LI+LSPKKT EGF+GA ICTIIFG+F +++L R+ Y ICP  DL      G 
Sbjct: 244 GITFGRTQLIQLSPKKTVEGFLGAWICTIIFGYFMTNILIRYKYFICPVNDLGANVLTG- 302

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNPVF+PQ Y L  W T L         ++ ++ P+Q+H+LV A FASLIAPFGGF
Sbjct: 303 LQCNPNPVFVPQPYSLPEW-TGL--------AKTFYVEPMQFHILVFATFASLIAPFGGF 353

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGGITDRMDCQF+MG F++MYY SFI +   +VG +++  
Sbjct: 354 FASGLKRTFKIKDFGESIPGHGGITDRMDCQFIMGFFAYMYYHSFIAVYKASVGDIIEAA 413

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           +N L  ++Q E+   L +YL +QG + E
Sbjct: 414 INGLTVEEQFEVVRGLGKYLYNQGTVSE 441



>gi|452845168|gb|EME47101.1| hypothetical protein DOTSEDRAFT_69164 [Dothistroma septosporum
           NZE10]
          Length = 487

 Score =  477 bits (1228), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 231/388 (59%), Positives = 296/388 (76%), Gaps = 6/388 (1%)

Query: 3   QKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKLP 62
           +K++    R+IWTFVMI  FF  +  GHI++I L   +Q + +KEVI+I +VPS+ + L 
Sbjct: 91  KKFQTFVTRSIWTFVMIGVFFASMFAGHIYIIILATAVQIISFKEVISIQNVPSRARSLR 150

Query: 63  WFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFVA 122
           + KTLNWYFL +T YFLYGES+IYYFK IV++D  LLPFATHHRFISF+LY IGFVFFV 
Sbjct: 151 FTKTLNWYFLGTTMYFLYGESVIYYFKHIVLIDKVLLPFATHHRFISFMLYIIGFVFFVG 210

Query: 123 NLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYICG 182
           +L+K HYKFQFTQFAWTHM L ++V Q+HFI+NNIFEG+IWF LP+SLVI NDIFAYICG
Sbjct: 211 SLQKGHYKFQFTQFAWTHMALYLIVVQAHFIMNNIFEGMIWFFLPISLVIINDIFAYICG 270

Query: 183 FFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGRL 242
             +GRT LIK+SPKKT EGFVGA ICTII GFF+++LL R  Y ICP  DL    F G L
Sbjct: 271 ITFGRTQLIKISPKKTVEGFVGAWICTIILGFFFANLLMRSKYFICPVNDLGANIFTG-L 329

Query: 243 TCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGFF 302
            C+ NPVFI + Y++ P++   +  L      ++ +AP+Q+H++  A FASLIAPFGGFF
Sbjct: 330 ECDVNPVFIAKTYNI-PFIPHTWDFLP----TTITVAPMQFHIMAFATFASLIAPFGGFF 384

Query: 303 ASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTIV 362
           ASG+KR FNIKDFG SIPGHGG+TDRMDCQF+MG F++MYYQSFI +   +VG+V++T +
Sbjct: 385 ASGLKRTFNIKDFGDSIPGHGGMTDRMDCQFVMGFFAYMYYQSFIALHKASVGSVIETAI 444

Query: 363 NSLKPQDQIELFNRLKQYLLSQGLLEER 390
             L P++QI +   L Q+L +QG +  +
Sbjct: 445 TGLSPEEQIAVVKGLAQHLYNQGAVSHK 472



>gi|261193084|ref|XP_002622948.1| phosphatidate cytidylyltransferase [Ajellomyces dermatitidis
           SLH14081]
 gi|239589083|gb|EEQ71726.1| phosphatidate cytidylyltransferase [Ajellomyces dermatitidis
           SLH14081]
 gi|239613664|gb|EEQ90651.1| phosphatidate cytidylyltransferase [Ajellomyces dermatitidis ER-3]
          Length = 432

 Score =  477 bits (1228), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 232/389 (59%), Positives = 289/389 (74%), Gaps = 6/389 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMI GFF+ +  GHI++I ++ V+Q + +KEVIAIA+VPSK K L
Sbjct: 37  EKKKQTFITRTIWTFVMIAGFFIAMFSGHIYLIAIITVVQIISFKEVIAIANVPSKAKNL 96

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K LNWYFL +T YFLYGES+IYYFK I++VD  LLP ATHHRF+SF+LY +GFVFFV
Sbjct: 97  KFTKALNWYFLATTMYFLYGESVIYYFKHILLVDKVLLPLATHHRFLSFMLYVMGFVFFV 156

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K HY+FQFTQFAWTHM L ++V Q+HFI+NNIFEG+IWF LPVSLVI NDIFAY+C
Sbjct: 157 GSLQKGHYRFQFTQFAWTHMALYLIVVQAHFIMNNIFEGMIWFFLPVSLVITNDIFAYVC 216

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA ICTI+FG+  +++L +  Y ICP  DL + A  G 
Sbjct: 217 GITFGRTQLIKLSPKKTVEGFVGAWICTILFGYGMTNVLMKHKYFICPVNDLGSNALTG- 275

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNPVF PQ Y L  W        T    ++V+ AP+Q H+ V A FASLIAPFGGF
Sbjct: 276 LECTPNPVFTPQPYQLPTWTP-----WTHSPPKTVYFAPMQIHIFVFATFASLIAPFGGF 330

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F +KDFG SIPGHGGITDRMDCQF+MG F++MYY SFI +   +VG V++  
Sbjct: 331 FASGLKRTFKVKDFGESIPGHGGITDRMDCQFIMGFFAYMYYHSFIAVYKASVGNVIEAS 390

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           +N L    Q+E+   L +YL +QG + E 
Sbjct: 391 INGLTVDQQLEVIRGLSKYLYNQGEVSEN 419



>gi|67537992|ref|XP_662770.1| hypothetical protein AN5166.2 [Aspergillus nidulans FGSC A4]
 gi|40743157|gb|EAA62347.1| hypothetical protein AN5166.2 [Aspergillus nidulans FGSC A4]
          Length = 446

 Score =  477 bits (1227), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 225/387 (58%), Positives = 296/387 (76%), Gaps = 10/387 (2%)

Query: 3   QKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKLP 62
           +K +    RTIWTFVMI GFF+ +  GHI++I LV  +Q + +KEVIAIA+VPSKEK + 
Sbjct: 61  KKKQTFITRTIWTFVMIAGFFIAMFSGHIYIIGLVTAVQIISFKEVIAIANVPSKEKNIR 120

Query: 63  WFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFVA 122
           + K+LNWYFL ++ YFLYGES+IYYFK I++VD  LLP A+HHRFISFVL+ +GFVFFVA
Sbjct: 121 FTKSLNWYFLGTSMYFLYGESVIYYFKHILLVDRVLLPLASHHRFISFVLWIMGFVFFVA 180

Query: 123 NLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYICG 182
           +L+K HY+FQFTQFAWTHM L ++V Q+HF++NNI EG+IWF LP SLVI NDIFAY+CG
Sbjct: 181 SLQKGHYRFQFTQFAWTHMALYLIVVQAHFVMNNILEGMIWFFLPASLVITNDIFAYVCG 240

Query: 183 FFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGRL 242
             +GRT LI+LSPKKT EGF+GA +CTIIFG+F +++L R+ Y ICP  DL +    G L
Sbjct: 241 ITFGRTQLIQLSPKKTVEGFLGAWVCTIIFGYFMTNILMRYKYFICPVYDLGSNVLTG-L 299

Query: 243 TCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGFF 302
            C+PNPVF+PQ +++  W             R+ ++AP+Q+H+L+ A FASL+APFGGFF
Sbjct: 300 ECDPNPVFVPQAFEIPEWTGFG---------RTFYVAPMQFHILLFATFASLVAPFGGFF 350

Query: 303 ASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTIV 362
           ASG+KR+F IKDFG SIPGHGGITDRMDCQF+MG F++MYY SFI +   +VG +++  +
Sbjct: 351 ASGLKRSFKIKDFGESIPGHGGITDRMDCQFIMGFFAYMYYHSFIAVFKASVGDIIEAAI 410

Query: 363 NSLKPQDQIELFNRLKQYLLSQGLLEE 389
           N L   +Q+E+   L +YL +QG + E
Sbjct: 411 NGLTVDEQLEVLRGLSKYLYNQGAVPE 437



>gi|347837436|emb|CCD52008.1| similar to phosphatidate cytidylyltransferase [Botryotinia
           fuckeliana T4]
 gi|472242547|gb|EMR87236.1| putative phosphatidate cytidylyltransferase protein [Botryotinia
           fuckeliana BcDW1]
          Length = 453

 Score =  477 bits (1227), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 231/388 (59%), Positives = 295/388 (76%), Gaps = 10/388 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    R+IWTFVMI GFF  + +GHI++I +V  +Q + +KEVIAIA+VPS+ ++L
Sbjct: 63  EKKKQTFITRSIWTFVMIGGFFASMFMGHIYIIAIVTAVQIISFKEVIAIANVPSRARRL 122

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K LNWY+L +T YFLYGES+IYYFK IV+VD  LLPFATHHRFISF+LY IGFVFFV
Sbjct: 123 RFTKALNWYWLATTMYFLYGESVIYYFKHIVLVDKVLLPFATHHRFISFMLYTIGFVFFV 182

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A+L+  HYKFQFTQFAWTHM L ++V Q+HFI+NN+FEG+IWF LPVSLVICNDIFAYIC
Sbjct: 183 ASLQAGHYKFQFTQFAWTHMALYLIVVQAHFIMNNVFEGMIWFFLPVSLVICNDIFAYIC 242

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA I T+IFG   +++L R+ Y ICP  DL    + G 
Sbjct: 243 GITFGRTQLIKLSPKKTVEGFVGAWILTVIFGVGMTNVLMRYKYFICPVNDLGANLWTG- 301

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNPVF+P  Y L  W         F   +S  +AP+Q H+LV   FASLIAPFGGF
Sbjct: 302 LECTPNPVFLPHTYQLPIW---------FPVWKSFSMAPMQGHILVFGTFASLIAPFGGF 352

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGGITDRMDCQF+MG F+++Y+ SFI +  +++G V++T+
Sbjct: 353 FASGLKRTFKIKDFGDSIPGHGGITDRMDCQFIMGFFAYVYFHSFIAIYKVSLGGVIETV 412

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           +N L P++Q+EL   + ++L +QG++ E
Sbjct: 413 INGLTPEEQMELVKGISKHLYNQGVIAE 440



>gi|225555463|gb|EEH03755.1| phosphatidate cytidylyltransferase [Ajellomyces capsulatus G186AR]
 gi|325094775|gb|EGC48085.1| phosphatidate cytidylyltransferase [Ajellomyces capsulatus H88]
          Length = 455

 Score =  476 bits (1226), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 233/392 (59%), Positives = 292/392 (74%), Gaps = 12/392 (3%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMI GFF+ +  GHI++I ++ V+Q + +KEVIAIA+VPSK K L
Sbjct: 60  EKKKQTFITRTIWTFVMIAGFFIAMFSGHIYLIAIITVVQIISFKEVIAIANVPSKAKNL 119

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWYFL +T YFLYGES+IYYFK I++VD  LLP ATHHRF+SF+LY +GFVFFV
Sbjct: 120 KFTKSLNWYFLATTMYFLYGESVIYYFKHILLVDKVLLPLATHHRFLSFMLYVMGFVFFV 179

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K HY+FQFTQFAWTHM L ++V Q+HFI+NNIFEG+IWF LPVSLVI NDIFAYIC
Sbjct: 180 GSLQKGHYRFQFTQFAWTHMALYLIVVQAHFIMNNIFEGMIWFFLPVSLVITNDIFAYIC 239

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA ICTI+FG+  +++L ++ Y ICP  DL + A  G 
Sbjct: 240 GITFGRTQLIKLSPKKTVEGFVGAWICTILFGYGMTNVLMKYKYFICPVNDLGSNALTG- 298

Query: 242 LTCEPNPVFIPQRYDL---NPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPF 298
           L C PNPVF P+ Y L    PW  S          ++V +AP+Q H+ V A FASLIAPF
Sbjct: 299 LECIPNPVFTPRPYHLPSWTPWTDS--------PPKTVHLAPMQIHIFVFATFASLIAPF 350

Query: 299 GGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVL 358
           GGFFASG+KR F +KDFG SIPGHGGITDRMDCQF+MG F++MYY SFI +   +VG V+
Sbjct: 351 GGFFASGLKRTFKVKDFGESIPGHGGITDRMDCQFIMGFFAYMYYHSFIAVYKASVGNVI 410

Query: 359 QTIVNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           +  +N L    Q+E+   L +YL +QG + E 
Sbjct: 411 EMAINGLTVDQQLEVIRGLSKYLYNQGEVSEN 442



>gi|258569877|ref|XP_002543742.1| phosphatidate cytidylyltransferase [Uncinocarpus reesii 1704]
 gi|237904012|gb|EEP78413.1| phosphatidate cytidylyltransferase [Uncinocarpus reesii 1704]
          Length = 451

 Score =  476 bits (1225), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 234/389 (60%), Positives = 288/389 (74%), Gaps = 10/389 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMIFGFF+ +  GHI+VI +V  IQ + +KEVIAIA+VPS+ K L
Sbjct: 60  EKKKQTFITRTIWTFVMIFGFFVSMFSGHIYVIAIVTAIQIISFKEVIAIANVPSRAKNL 119

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K LNWYFL +T YFLYGES+IYYFK I++VD  LLP ATHHRF+SF+LY IGFVFFV
Sbjct: 120 RFTKALNWYFLATTMYFLYGESVIYYFKHILLVDRVLLPLATHHRFLSFMLYLIGFVFFV 179

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K HYKFQFTQFAWTHM L ++V Q+HFI+NNIFEG+IWF LPVSLVI NDIFAY+C
Sbjct: 180 GSLQKGHYKFQFTQFAWTHMALFLIVVQAHFIMNNIFEGMIWFFLPVSLVITNDIFAYVC 239

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIK+SPKKT EGFVGA ICTIIFGF  +++L ++ Y  CP  DL +    G 
Sbjct: 240 GITFGRTQLIKISPKKTVEGFVGAWICTIIFGFVMTNILLKYKYFTCPVNDLGSNVLTG- 298

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C  NPVF  Q Y L  W             R+ +IAP+Q+H+L+ A FASLIAPFGGF
Sbjct: 299 LECNLNPVFQAQPYRLPHWTHVN---------RTFYIAPMQFHILMFATFASLIAPFGGF 349

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGGITDRMDCQF+MG FS+MYY SFI +   +VG V++  
Sbjct: 350 FASGLKRTFKIKDFGESIPGHGGITDRMDCQFIMGFFSYMYYHSFIAVHKASVGGVIEAA 409

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           +  L   +QI++   L +YL +QG + E+
Sbjct: 410 ITGLTVDEQIDVIKGLTKYLYNQGAVSEK 438



>gi|119196153|ref|XP_001248680.1| phosphatidate cytidylyltransferase [Coccidioides immitis RS]
 gi|392862105|gb|EAS37286.2| phosphatidate cytidylyltransferase [Coccidioides immitis RS]
          Length = 453

 Score =  476 bits (1224), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 233/388 (60%), Positives = 287/388 (73%), Gaps = 10/388 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMI GFF+ +  GHI+VI +V  IQ + +KEVIAIA+VPSK K L
Sbjct: 62  EKKKQTFITRTIWTFVMIAGFFIAMFSGHIYVIAIVTAIQIVSFKEVIAIANVPSKAKNL 121

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K LNWYFL +T YFLYGES+IYYFK I++VD  LLP ATHHRF+SF+LY +GFVFFV
Sbjct: 122 RFTKALNWYFLATTMYFLYGESVIYYFKHILLVDRVLLPLATHHRFLSFMLYLMGFVFFV 181

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K HY+FQFTQFAWTHM L ++V Q+HFI+NNIFEG+IWF LPVSLVI NDIFAY+C
Sbjct: 182 GSLQKGHYRFQFTQFAWTHMALFLIVVQAHFIMNNIFEGMIWFFLPVSLVITNDIFAYVC 241

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA ICTIIFG+  +++L ++ Y  CP  DL +    G 
Sbjct: 242 GITFGRTQLIKLSPKKTVEGFVGAWICTIIFGYAMTNILMKYKYFTCPVNDLGSNVLTG- 300

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C  NPVF PQ Y L  W             R+ +IAP+Q+H+L+ A FASLIAPFGGF
Sbjct: 301 LECNLNPVFKPQPYQLPGWSHVG---------RTFYIAPMQFHILMFATFASLIAPFGGF 351

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGGITDRMDCQF+MG FS+MYY SFI +   +VG V++  
Sbjct: 352 FASGLKRTFKIKDFGESIPGHGGITDRMDCQFIMGFFSYMYYHSFIAVHKASVGGVIEAA 411

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           +  L   +QI++   L +YL +QG + E
Sbjct: 412 ITGLTVDEQIDVMKGLAKYLYNQGAVSE 439



>gi|303321926|ref|XP_003070957.1| phosphatidate cytidylyltransferase, putative [Coccidioides
           posadasii C735 delta SOWgp]
 gi|240110654|gb|EER28812.1| phosphatidate cytidylyltransferase, putative [Coccidioides
           posadasii C735 delta SOWgp]
 gi|320040479|gb|EFW22412.1| phosphatidate cytidylyltransferase [Coccidioides posadasii str.
           Silveira]
          Length = 453

 Score =  476 bits (1224), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 233/388 (60%), Positives = 287/388 (73%), Gaps = 10/388 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMI GFF+ +  GHI+VI +V  IQ + +KEVIAIA+VPSK K L
Sbjct: 62  EKKKQTFITRTIWTFVMIAGFFIAMFSGHIYVIAIVTAIQIVSFKEVIAIANVPSKAKNL 121

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K LNWYFL +T YFLYGES+IYYFK I++VD  LLP ATHHRF+SF+LY +GFVFFV
Sbjct: 122 RFTKALNWYFLATTMYFLYGESVIYYFKHILLVDRVLLPLATHHRFLSFMLYLMGFVFFV 181

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K HY+FQFTQFAWTHM L ++V Q+HFI+NNIFEG+IWF LPVSLVI NDIFAY+C
Sbjct: 182 GSLQKGHYRFQFTQFAWTHMALFLIVVQAHFIMNNIFEGMIWFFLPVSLVITNDIFAYVC 241

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA ICTIIFG+  +++L ++ Y  CP  DL +    G 
Sbjct: 242 GITFGRTQLIKLSPKKTVEGFVGAWICTIIFGYAMTNILMKYKYFTCPVNDLGSNVLTG- 300

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C  NPVF PQ Y L  W             R+ +IAP+Q+H+L+ A FASLIAPFGGF
Sbjct: 301 LECNINPVFKPQPYQLPGWSHVG---------RTFYIAPMQFHILMFATFASLIAPFGGF 351

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGGITDRMDCQF+MG FS+MYY SFI +   +VG V++  
Sbjct: 352 FASGLKRTFKIKDFGESIPGHGGITDRMDCQFIMGFFSYMYYHSFIAVHKASVGGVIEAA 411

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           +  L   +QI++   L +YL +QG + E
Sbjct: 412 ITGLTVDEQIDVMKGLAKYLYNQGAVSE 439



>gi|453087610|gb|EMF15651.1| phosphatidate cytidylyltransferase [Mycosphaerella populorum
           SO2202]
          Length = 489

 Score =  475 bits (1223), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 235/384 (61%), Positives = 292/384 (76%), Gaps = 6/384 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    R IWTFVMI  FF  +  GHI++I +V   Q + +KEVI IA+VPS+ + L
Sbjct: 91  EKKKQTFITRAIWTFVMIAIFFGGMFAGHIYMIIIVTACQIISFKEVINIANVPSRARSL 150

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + KTLNWYFL +T YFLYGES+IYYFK IV++D  LLPFATHHRFISF+LY +GFVFFV
Sbjct: 151 RFTKTLNWYFLGTTMYFLYGESVIYYFKHIVLIDRVLLPFATHHRFISFMLYILGFVFFV 210

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K HYKFQFTQ+AWTHM L ++V Q+HFI+NNIFEG+IWF LPVSLVI NDIFAYIC
Sbjct: 211 GSLQKGHYKFQFTQYAWTHMALYLIVVQAHFIMNNIFEGMIWFFLPVSLVIINDIFAYIC 270

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +G+T LIKLSPKKT EGFVGA ICTI+ GFF++++L R  Y ICP  DL    F G 
Sbjct: 271 GITFGKTQLIKLSPKKTVEGFVGAWICTILLGFFFTNILMRSKYFICPVNDLGANIFTG- 329

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L CEPNPVFIP  Y L P++   +  L     R++ ++P+Q+H++++A FASLIAPFGGF
Sbjct: 330 LQCEPNPVFIPHTYTL-PFIPHSWDFLP----RTLTVSPMQFHIVILASFASLIAPFGGF 384

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR FNIKDFG SIPGHGG+TDRMDCQF+MG FS MYYQSFI     +VG VL+T 
Sbjct: 385 FASGLKRTFNIKDFGDSIPGHGGMTDRMDCQFIMGFFSFMYYQSFIAQYKASVGGVLETA 444

Query: 362 VNSLKPQDQIELFNRLKQYLLSQG 385
           +  L P++Q+ L   L Q+L +QG
Sbjct: 445 ITGLSPEEQMVLVKGLTQHLYNQG 468



>gi|406865235|gb|EKD18277.1| phosphatidate cytidylyltransferase [Marssonina brunnea f. sp.
           'multigermtubi' MB_m1]
          Length = 452

 Score =  475 bits (1222), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 232/388 (59%), Positives = 292/388 (75%), Gaps = 10/388 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K      R+IWTFVMI  FF  + +GHI++I +V  +Q + +KEVIAIA+VPS+ ++L
Sbjct: 62  EKKKATFITRSIWTFVMIGAFFGAMFMGHIYIIAIVTAVQIVSFKEVIAIANVPSRARRL 121

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K LNWY+L +T YFLYGES+IYYFK IV+VD  LLPFATHHRFISF+LY IGFVFFV
Sbjct: 122 KFTKALNWYWLATTMYFLYGESVIYYFKHIVLVDKVLLPFATHHRFISFMLYVIGFVFFV 181

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A+L+  HY+FQFTQFAWTHM L ++V Q+HFI+NN+FEG+IWF LPVSLVICNDIFAYIC
Sbjct: 182 ASLQAGHYRFQFTQFAWTHMALYLIVVQAHFIMNNVFEGMIWFFLPVSLVICNDIFAYIC 241

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA I TIIFG   +++L R+ Y ICP  DL    + G 
Sbjct: 242 GITFGRTQLIKLSPKKTVEGFVGAWILTIIFGVGMTNVLMRYKYFICPVNDLGANIWTG- 300

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNPVF+P  Y L  W         F   +S  +AP+Q H+LV   FASLIAPFGGF
Sbjct: 301 LQCTPNPVFLPSLYHLPIW---------FPFFKSFSMAPMQVHILVFGTFASLIAPFGGF 351

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGGITDRMDCQF+MG F++MYY SFI +  +++G V+++ 
Sbjct: 352 FASGLKRTFKIKDFGDSIPGHGGITDRMDCQFIMGFFAYMYYHSFIAVYKVSLGGVIESA 411

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           +N L PQ+Q+EL   + ++L +QG++ E
Sbjct: 412 INGLTPQEQMELVKGISKHLYNQGIIPE 439



>gi|440637077|gb|ELR06996.1| hypothetical protein GMDG_02318 [Geomyces destructans 20631-21]
          Length = 451

 Score =  475 bits (1222), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 231/388 (59%), Positives = 297/388 (76%), Gaps = 11/388 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWT VM+  FF+ LG+GH+++I +V  IQ + +KEVIAIA+VPS+ ++L
Sbjct: 63  EKKKQTFITRTIWTLVMVAFFFIALGMGHLYIIAIVTAIQIISFKEVIAIANVPSRARRL 122

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWY+L +T YFLYGES+IYYFK IV+VD  L PFATHHRFISF LY IGFVFFV
Sbjct: 123 RFTKSLNWYWLATTMYFLYGESVIYYFKHIVLVDKVLQPFATHHRFISFTLYVIGFVFFV 182

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A+L+  HY+FQFTQFAWTHM L ++V Q+HFI+NNIFEG++WF LPVSLVICNDIFAY+C
Sbjct: 183 ASLQAGHYRFQFTQFAWTHMALYLIVVQTHFIMNNIFEGMVWFFLPVSLVICNDIFAYLC 242

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA + T+IFG F +++L R+DY ICP  DL    + G 
Sbjct: 243 GITFGRTQLIKLSPKKTVEGFVGAWVLTVIFGVFLTNVLMRYDYFICPVNDLGANIWTG- 301

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C+ NPVF+ Q Y L  W         F    SV IAP+Q+H+LV A FASLIAPFGGF
Sbjct: 302 LHCKVNPVFLTQEYPLPIW---------FPFASSVRIAPMQFHILVFATFASLIAPFGGF 352

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGGITDRMDCQF+MG F++MYY SFI ++++T+G V++T 
Sbjct: 353 FASGLKRTFKIKDFGDSIPGHGGITDRMDCQFIMGFFAYMYYHSFIALNNVTLGDVIETA 412

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           +  L  ++Q+EL   + ++L +QG++ +
Sbjct: 413 IQ-LAAEEQMELVKGISKHLYNQGVISD 439



>gi|225682984|gb|EEH21268.1| phosphatidate cytidylyltransferase [Paracoccidioides brasiliensis
           Pb03]
          Length = 450

 Score =  475 bits (1222), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 231/388 (59%), Positives = 287/388 (73%), Gaps = 6/388 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMI GFF+ +  GHI++I ++ V+Q + +KEVIAIA+VPSK K L
Sbjct: 62  ERKKQTFITRTIWTFVMIAGFFIAIFSGHIYIIAIITVVQIISFKEVIAIANVPSKAKNL 121

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K LNWYFL +T YFLYGES+IYYFK I++VD  LLP ATHHRFISF+LY +GFVFFV
Sbjct: 122 KFTKALNWYFLATTMYFLYGESVIYYFKHILLVDRVLLPLATHHRFISFMLYVMGFVFFV 181

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K HY+FQFTQFAWTHM L ++V Q+HFI+NNIFEG+IWF LPVSLVI NDIFAYIC
Sbjct: 182 GSLQKGHYRFQFTQFAWTHMALYLIVVQAHFIMNNIFEGMIWFFLPVSLVITNDIFAYIC 241

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA ICTI+FG+  +++L ++ Y ICP  DL +    G 
Sbjct: 242 GITFGRTQLIKLSPKKTVEGFVGAWICTILFGYGMTNILMKYKYFICPVNDLGSNVLTG- 300

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNPVF P  Y +  W        T    R+V+ AP+Q H+ V A FASLIAPFGGF
Sbjct: 301 LECTPNPVFTPHPYQIPSWAP-----WTHAPPRTVYFAPMQIHIFVFATFASLIAPFGGF 355

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F +KDFG SIPGHGGITDRMDCQF+MG F++MYY SFI +   +VG V++  
Sbjct: 356 FASGLKRTFKVKDFGESIPGHGGITDRMDCQFIMGFFAYMYYHSFIAVYKASVGNVIEAA 415

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           +  L    Q+E+   L +YL +QG + E
Sbjct: 416 ITGLTVDQQLEVIRGLTKYLYNQGEVSE 443



>gi|226290434|gb|EEH45918.1| phosphatidate cytidylyltransferase [Paracoccidioides brasiliensis
           Pb18]
          Length = 450

 Score =  474 bits (1221), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 231/388 (59%), Positives = 287/388 (73%), Gaps = 6/388 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMI GFF+ +  GHI++I ++ V+Q + +KEVIAIA+VPSK K L
Sbjct: 62  EKKKQTFITRTIWTFVMIAGFFIAIFSGHIYIIAIITVVQIISFKEVIAIANVPSKAKNL 121

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K LNWYFL +T YFLYGES+IYYFK I++VD  LLP ATHHRFISF+LY +GFVFFV
Sbjct: 122 KFTKALNWYFLATTMYFLYGESVIYYFKHILLVDRVLLPLATHHRFISFMLYVMGFVFFV 181

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K HY+FQFTQFAWTHM L ++V Q+HFI+NNIFEG+IWF LPVSLVI NDIFAYIC
Sbjct: 182 GSLQKGHYRFQFTQFAWTHMALYLIVVQAHFIMNNIFEGMIWFFLPVSLVITNDIFAYIC 241

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA ICTI+FG+  +++L ++ Y ICP  DL +    G 
Sbjct: 242 GITFGRTQLIKLSPKKTVEGFVGAWICTILFGYGMTNILMKYKYFICPVNDLGSNVLTG- 300

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNPVF P  Y +  W        T    R+V+ AP+Q H+ V A FASLIAPFGGF
Sbjct: 301 LECTPNPVFTPHPYQIPSWAP-----WTHAPPRTVYFAPMQIHIFVFATFASLIAPFGGF 355

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F +KDFG SIPGHGGITDRMDCQF+MG F++MYY SFI +   +VG V++  
Sbjct: 356 FASGLKRTFKVKDFGESIPGHGGITDRMDCQFIMGFFAYMYYHSFIAVYKASVGNVIEAA 415

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           +  L    Q+E+   L +YL +QG + E
Sbjct: 416 ITGLTVDQQLEVIRGLTKYLYNQGEVSE 443



>gi|295658605|ref|XP_002789863.1| phosphatidate cytidylyltransferase [Paracoccidioides sp. 'lutzii'
           Pb01]
 gi|226283007|gb|EEH38573.1| phosphatidate cytidylyltransferase [Paracoccidioides sp. 'lutzii'
           Pb01]
          Length = 450

 Score =  474 bits (1220), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 231/388 (59%), Positives = 287/388 (73%), Gaps = 6/388 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMI GFF+ +  GHI++I ++ V+Q + +KEVIAIA+VPSK K L
Sbjct: 62  EKKKQTFITRTIWTFVMIAGFFIAIFSGHIYIIAIITVVQIISFKEVIAIANVPSKAKNL 121

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K LNWYFL +T YFLYGES+IYYFK I++VD  LLP ATHHRFISF+LY +GFVFFV
Sbjct: 122 KFTKALNWYFLATTMYFLYGESVIYYFKHILLVDRVLLPLATHHRFISFMLYVMGFVFFV 181

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K HY+FQFTQFAWTHM L ++V Q+HFI+NNIFEG+IWF LPVSLVI NDIFAYIC
Sbjct: 182 GSLQKGHYRFQFTQFAWTHMALYLIVVQAHFIMNNIFEGMIWFFLPVSLVITNDIFAYIC 241

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA ICTI+FG+  +++L ++ Y ICP  DL +    G 
Sbjct: 242 GITFGRTQLIKLSPKKTVEGFVGAWICTILFGYGMTNILMKYKYFICPVNDLGSNVLTG- 300

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNPVF P  Y +  W        T    R+V+ AP+Q H+ V A FASLIAPFGGF
Sbjct: 301 LECTPNPVFTPHPYQILSWAP-----WTHAPPRTVYFAPMQIHIFVFATFASLIAPFGGF 355

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F +KDFG SIPGHGGITDRMDCQF+MG F++MYY SFI +   +VG V++  
Sbjct: 356 FASGLKRTFKVKDFGESIPGHGGITDRMDCQFIMGFFAYMYYHSFIAVYKASVGNVIEAA 415

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           +  L    Q+E+   L +YL +QG + E
Sbjct: 416 ITGLTVDQQLEVIRGLTKYLYNQGEVSE 443



>gi|322710013|gb|EFZ01588.1| phosphatidate cytidylyltransferase [Metarhizium anisopliae ARSEF
           23]
          Length = 458

 Score =  473 bits (1217), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 231/388 (59%), Positives = 291/388 (75%), Gaps = 5/388 (1%)

Query: 3   QKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKLP 62
           +K  N   RT WT  M+  FF  L +GHI++I +V ++Q + +KEVIAIA+VPS+ + L 
Sbjct: 65  KKKANFITRTFWTLCMLGAFFTALFMGHIYIIIIVTMVQIVSFKEVIAIANVPSRARSLR 124

Query: 63  WFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFVA 122
             K+LNWY+L +T YFLYGES+IYYFK IV+VD  LLP ATHHRFISF+LY  GFVFFVA
Sbjct: 125 STKSLNWYWLATTMYFLYGESVIYYFKHIVLVDKVLLPLATHHRFISFILYVFGFVFFVA 184

Query: 123 NLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYICG 182
           +L+  HYKFQFT FAWTHM L ++V Q+HF++NN+FEG+IWF LP +LVI NDIFAYICG
Sbjct: 185 SLQAGHYKFQFTNFAWTHMALYLIVVQAHFVMNNVFEGMIWFFLPAALVITNDIFAYICG 244

Query: 183 FFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGRL 242
             +GRT LIKLSPKKT EGFVGA I T++FG    +L+ R  Y ICP  DL  T F G L
Sbjct: 245 IAFGRTQLIKLSPKKTVEGFVGAWIATVLFGMVLVNLMVRSKYFICPVNDLGATIFTG-L 303

Query: 243 TCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGFF 302
            C+PNPVFIP+ Y + P L   F   +F +I S   AP+Q H LV+A FASLIAPFGGFF
Sbjct: 304 QCDPNPVFIPRTYHM-PQL--FFLPPSFTNI-SFTFAPMQLHALVLASFASLIAPFGGFF 359

Query: 303 ASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTIV 362
           ASG+KR+F IKDFG SIPGHGG+TDRMDCQF+MG F++MYY +FI +  + VG VL+T +
Sbjct: 360 ASGLKRSFKIKDFGDSIPGHGGMTDRMDCQFIMGFFAYMYYHTFISLHKVNVGTVLETAI 419

Query: 363 NSLKPQDQIELFNRLKQYLLSQGLLEER 390
            SL P++QIEL   + +YL +QG++ E+
Sbjct: 420 TSLSPEEQIELVKSMSRYLGNQGVVSEK 447



>gi|322697874|gb|EFY89649.1| phosphatidate cytidylyltransferase [Metarhizium acridum CQMa 102]
          Length = 458

 Score =  473 bits (1216), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 230/388 (59%), Positives = 291/388 (75%), Gaps = 5/388 (1%)

Query: 3   QKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKLP 62
           +K  N   RT WT  M+  FF  L +GHI++I +V ++Q + +KEVIAIA+VPS+ + L 
Sbjct: 65  KKKANFITRTFWTLCMLGAFFTALFMGHIYIIIIVTMVQIVSFKEVIAIANVPSRARSLR 124

Query: 63  WFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFVA 122
             K+LNWY+L +T YFLYGES+IYYFK IV+VD  LLP ATHHRFISF+LY  GFVFFVA
Sbjct: 125 STKSLNWYWLATTMYFLYGESVIYYFKHIVLVDKVLLPLATHHRFISFILYVFGFVFFVA 184

Query: 123 NLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYICG 182
           +L+  HYKFQFT FAWTHM L ++V Q+HF++NN+FEG+IWF LP +LVI NDIFAYICG
Sbjct: 185 SLQAGHYKFQFTNFAWTHMALYLIVVQAHFVMNNVFEGMIWFFLPAALVITNDIFAYICG 244

Query: 183 FFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGRL 242
             +GRT LIKLSPKKT EGFVGA I T++FG    +L+ R  Y ICP  DL  T F G L
Sbjct: 245 IAFGRTQLIKLSPKKTVEGFVGAWIATVLFGMILVNLMIRSKYFICPVNDLGATIFTG-L 303

Query: 243 TCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGFF 302
            C+PNPVFIP+ Y + P L   F   +F +I S   AP+Q H L++A FASLIAPFGGFF
Sbjct: 304 QCDPNPVFIPRTYHM-PHL--FFLPPSFTNI-SFTFAPMQLHALILASFASLIAPFGGFF 359

Query: 303 ASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTIV 362
           ASG+KR+F IKDFG SIPGHGG+TDRMDCQF+MG F++MYY +FI +  + VG VL+T +
Sbjct: 360 ASGLKRSFKIKDFGDSIPGHGGMTDRMDCQFIMGFFAYMYYHTFISLHKVNVGTVLETAI 419

Query: 363 NSLKPQDQIELFNRLKQYLLSQGLLEER 390
            SL P++QIEL   + +YL +QG++ E+
Sbjct: 420 TSLSPEEQIELVKSMSRYLGNQGVVSEK 447



>gi|470317112|gb|EMR08832.1| phosphatidate cytidylyltransferase [Pneumocystis murina B123]
          Length = 395

 Score =  472 bits (1215), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 228/387 (58%), Positives = 294/387 (75%), Gaps = 5/387 (1%)

Query: 3   QKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKLP 62
           +   N  +RT+WTF MIFGF +I+  GHIW+I L+  IQ +V+KE+IAI ++  KEKKLP
Sbjct: 2   KNRSNFFLRTVWTFAMIFGFLVIIAAGHIWIIVLLTFIQVIVFKELIAIVNISDKEKKLP 61

Query: 63  WFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFVA 122
           WF+TLNWYFL +T YF YGES+IYYFK IV+VDAFL    THHRFISF+LY  GF+FFV 
Sbjct: 62  WFRTLNWYFLCTTLYFAYGESLIYYFKHIVIVDAFLFSITTHHRFISFILYIGGFIFFVM 121

Query: 123 NLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYICG 182
           NLKK HYK+QFTQ+ WTHM LL++V QSHFIINNIFEG+ WF+LP SLVICNDIF+Y+CG
Sbjct: 122 NLKKGHYKYQFTQYCWTHMILLLIVGQSHFIINNIFEGIFWFLLPASLVICNDIFSYLCG 181

Query: 183 FFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGRL 242
             +GRT LIKLSPKKT EGF+G  +CT++ G    +++  W+YMICP +DL  TA  G L
Sbjct: 182 KLFGRTQLIKLSPKKTVEGFIGGWVCTVVLGLTMGNIILHWNYMICPLRDLGATALIG-L 240

Query: 243 TCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGFF 302
            C PNP F  Q++ L  ++ S +  L +  I    I P+++H++V + FASLIAPFGGFF
Sbjct: 241 ECIPNPTFTLQQFPLPEFIIS-YLALPYHTIT---IRPVEFHLMVFSTFASLIAPFGGFF 296

Query: 303 ASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTIV 362
           ASG+KRAF IKDFG SIPGHGG+TDR DCQF+ G F ++YY SFI ++ ++VG+VLQT +
Sbjct: 297 ASGLKRAFKIKDFGDSIPGHGGLTDRFDCQFINGFFVYLYYHSFIAVTHVSVGSVLQTAI 356

Query: 363 NSLKPQDQIELFNRLKQYLLSQGLLEE 389
            SL   +QI+L N + +YL+S+G+L  
Sbjct: 357 TSLTYDEQIKLSNSIYKYLVSKGVLSN 383



>gi|398391416|ref|XP_003849168.1| hypothetical protein MYCGRDRAFT_110994 [Zymoseptoria tritici
           IPO323]
 gi|339469044|gb|EGP84144.1| hypothetical protein MYCGRDRAFT_110994 [Zymoseptoria tritici
           IPO323]
          Length = 473

 Score =  472 bits (1214), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 231/389 (59%), Positives = 293/389 (75%), Gaps = 6/389 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
           ++  K+   R IWTF MI  FF  +  GHI+VI +V  +Q + +KEVIAI++VPS+ + L
Sbjct: 75  NEDEKSFITRAIWTFAMIGIFFGSMFAGHIYVIIIVTAVQIISFKEVIAISNVPSRARSL 134

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + KTLNWYFL +T YFLYGES+IYYFK IV++D  LLPFATHHRFISF+LY +GFVFFV
Sbjct: 135 RFTKTLNWYFLGTTMYFLYGESVIYYFKHIVLIDRVLLPFATHHRFISFMLYVMGFVFFV 194

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K HYKFQFTQFAWTHM L ++V Q+HFI+NNIFEG+IWF LPVSLVI NDIFAYIC
Sbjct: 195 GSLQKGHYKFQFTQFAWTHMALYLIVVQAHFIMNNIFEGMIWFFLPVSLVIINDIFAYIC 254

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +G+T LIKLSPKKT EGFVGA ICTI+ GF ++++L R  Y ICP  DL    F G 
Sbjct: 255 GITFGKTQLIKLSPKKTVEGFVGAWICTILMGFLFTNMLMRSKYFICPVNDLGANIFTG- 313

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNPVF+ Q Y + P++   +  L      +V I+P+Q+H+L MA FASLIAPFGGF
Sbjct: 314 LQCTPNPVFVAQSYHI-PFIPHAWTFLP----TTVRISPMQFHILAMASFASLIAPFGGF 368

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR FNIKDFG SIPGHGG+TDRMDCQF+MG F+ MYYQSFI ++  +VG+V++  
Sbjct: 369 FASGLKRTFNIKDFGDSIPGHGGMTDRMDCQFIMGFFAFMYYQSFIAVNHASVGSVIEAA 428

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           +  L  +DQ+ +   L Q+L +QG +  +
Sbjct: 429 ITGLSAEDQMAVVKGLAQHLYNQGQVNHK 457



>gi|512188139|gb|EPE03913.1| phosphatidate cytidylyltransferase [Ophiostoma piceae UAMH 11346]
          Length = 459

 Score =  471 bits (1211), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 228/389 (58%), Positives = 288/389 (74%), Gaps = 5/389 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +N   RT WTFVMI GFF  L +GHI++I +V  +Q + + EVIAIA VPS+E++L
Sbjct: 63  EKKKQNFITRTFWTFVMIGGFFAALFMGHIYMIIIVTAVQIVSFSEVIAIASVPSRERQL 122

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWY+L ST YFLYGES+IYYFK IV+VD  LLP ATHHRFISF+LY  GFVFFV
Sbjct: 123 SFTKSLNWYWLASTMYFLYGESVIYYFKHIVLVDKVLLPLATHHRFISFILYVFGFVFFV 182

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A+L+  HYKFQFTQFAWTHM L ++V Q+HF++NNIFEGLIWF LP +LVI NDIFAYIC
Sbjct: 183 ASLQAGHYKFQFTQFAWTHMALYLIVVQAHFVMNNIFEGLIWFFLPAALVITNDIFAYIC 242

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA + T++FGF  S +L +  Y  CP  DL    F G 
Sbjct: 243 GITFGRTQLIKLSPKKTVEGFVGAWVMTVLFGFVLSDILMKSKYFTCPVNDLGANIFTG- 301

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L+CE NPVF+P+ Y   P L   F   +  + R + +APLQ H ++ + FASLIAPFGGF
Sbjct: 302 LSCELNPVFLPRTYT-TPNL--FFLPASLSNFR-ITMAPLQIHTVIFSTFASLIAPFGGF 357

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFGHSIPGHGGITDRMDCQF+MG F+++YY +FI      +G+V++  
Sbjct: 358 FASGLKRTFKIKDFGHSIPGHGGITDRMDCQFIMGFFAYIYYHTFIATHKANIGSVMELA 417

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           +  L P+DQ+EL   + +YL +Q ++ E 
Sbjct: 418 ITGLSPEDQVELVRGISRYLRNQAIIGEE 446



>gi|358389400|gb|EHK26992.1| hypothetical protein TRIVIDRAFT_33697 [Trichoderma virens Gv29-8]
          Length = 453

 Score =  469 bits (1208), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 232/389 (59%), Positives = 287/389 (73%), Gaps = 6/389 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K  N   RT WT VMI GFF  L +GHI++I +V  +Q + +KEVIAIA+VPS+ + L
Sbjct: 67  EKKKANFWTRTFWTLVMISGFFGALFMGHIYMIAIVTAVQIISFKEVIAIANVPSRARSL 126

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
              K+LNWYFL ST YFLYGES+IYYFK IV+VD  LLP ATHHRFISFVLY  GFV+FV
Sbjct: 127 RSTKSLNWYFLASTMYFLYGESVIYYFKHIVLVDKVLLPLATHHRFISFVLYVFGFVYFV 186

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A+L+  HYKFQFT FAWTHM L ++V Q+HF++NNIFEG+IWF LP +LVI NDIFAYIC
Sbjct: 187 ASLQAGHYKFQFTNFAWTHMALYLIVVQAHFVMNNIFEGMIWFFLPAALVITNDIFAYIC 246

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA I TIIF F   ++L R  Y ICP  DL    F G 
Sbjct: 247 GIAFGRTQLIKLSPKKTVEGFVGAWIMTIIFSFLLVNILMRSKYFICPVNDLGANVFSG- 305

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C+ NPVF+P+ Y L P    L     F    S+  AP+Q H L +A FASLIAPFGGF
Sbjct: 306 LKCDVNPVFLPRTYKL-PEFFFLPPNTNF----SLTFAPMQLHALALATFASLIAPFGGF 360

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGG+TDRMDCQF+MG F++MY+ +FI++  +T+G+VL+T 
Sbjct: 361 FASGLKRTFKIKDFGDSIPGHGGMTDRMDCQFIMGFFAYMYFHTFIEVHKVTLGSVLETA 420

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           + SL P++Q+EL   + +YL +QG++ E 
Sbjct: 421 ITSLNPEEQVELVKSMCRYLSNQGIMPEE 449



>gi|500256970|gb|EOO00174.1| putative phosphatidate cytidylyltransferase protein [Togninia
           minima UCRPA7]
          Length = 451

 Score =  469 bits (1208), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 230/389 (59%), Positives = 289/389 (74%), Gaps = 6/389 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +N   R+IWTF+MI GFF  L +GH++++ ++ +IQ + +KEVIAIA+VPS+ ++L
Sbjct: 65  EKKKQNFITRSIWTFIMIGGFFAALFMGHLYILAVITIIQIISFKEVIAIANVPSRARQL 124

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
              K+LNWY+L ST YFLYGES+IYYFK IV+VD  LLP ATHHRFISF+LY IGFVFFV
Sbjct: 125 RSTKSLNWYWLASTMYFLYGESVIYYFKHIVLVDKVLLPLATHHRFISFILYIIGFVFFV 184

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A+L+  HYKFQFTQFAWTHM L ++V Q+HFI+NN+FEG+IWF LP +LVI ND+FAYI 
Sbjct: 185 ASLQAGHYKFQFTQFAWTHMALYLIVVQAHFIMNNVFEGMIWFFLPAALVITNDVFAYIV 244

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA + T+IFGF  ++LL R  Y ICP  DL    F G 
Sbjct: 245 GITFGRTQLIKLSPKKTVEGFVGAWVMTVIFGFGLTNLLMRSGYFICPVTDLGANIFTG- 303

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C+PNPVF+P  Y L P L  L    T     S+ I P+Q H  + A FASLIAPFGGF
Sbjct: 304 LACDPNPVFLPHTYTL-PDLFFLPPNTT----PSLTIEPMQLHTFIFATFASLIAPFGGF 358

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFGHSIPGHGG+TDRMDCQF+MG F++MYY SFI +  L +G V++  
Sbjct: 359 FASGLKRTFKIKDFGHSIPGHGGMTDRMDCQFIMGFFTYMYYHSFIAVHKLNLGGVMEMA 418

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           +  L   +Q+EL   + +YL +QGL+ E 
Sbjct: 419 ITGLTVDEQVELIRGMSRYLGNQGLVGEE 447



>gi|425774697|gb|EKV12998.1| Phosphatidate cytidylyltransferase [Penicillium digitatum PHI26]
 gi|425780794|gb|EKV18792.1| Phosphatidate cytidylyltransferase [Penicillium digitatum Pd1]
          Length = 447

 Score =  469 bits (1207), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 225/388 (57%), Positives = 284/388 (73%), Gaps = 11/388 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMI GFF+ L  GHI++I L+  IQ + +KEVIAIA +P+KEK L
Sbjct: 59  EKKKQTFITRTIWTFVMIAGFFIALFSGHIYIIALITGIQIISFKEVIAIASIPNKEKNL 118

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWYFL +T YFLYGES+IYYFK I++VD  LLP A HHRF+SF LY +GFVFFV
Sbjct: 119 RFTKSLNWYFLATTMYFLYGESVIYYFKHILLVDKVLLPLANHHRFLSFTLYVMGFVFFV 178

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K HY+FQFTQFAWTHM L ++V Q+HF++NNIFEG+IWF LP +LVI NDIFAY+C
Sbjct: 179 GSLQKGHYRFQFTQFAWTHMALYLIVVQAHFVMNNIFEGMIWFFLPAALVITNDIFAYVC 238

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +G+T LI+LSPKKT EGF+GA  CT+ FG+F ++LL R  Y ICP  DL + A  G 
Sbjct: 239 GISFGKTQLIQLSPKKTVEGFLGAWACTVAFGYFMTNLLIRSKYFICPVTDLGSNALTG- 297

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNPVF  Q Y L            F   ++ W+ P+Q+H+L  A FASLIAPFGGF
Sbjct: 298 LECVPNPVFTSQPYSLE----------VFGLDKTFWVEPIQFHILAFATFASLIAPFGGF 347

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGGITDRMDCQF+MG FS+MYY SFI +   +VG +++  
Sbjct: 348 FASGLKRTFKIKDFGESIPGHGGITDRMDCQFIMGFFSYMYYHSFIAVYKASVGDIIEAA 407

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           +N L   +Q+E+   L +YL +QG + E
Sbjct: 408 INGLTVDEQLEVVRGLGKYLYNQGAVSE 435



>gi|255948692|ref|XP_002565113.1| Pc22g11670 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211592130|emb|CAP98455.1| Pc22g11670 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 448

 Score =  469 bits (1206), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 226/388 (58%), Positives = 284/388 (73%), Gaps = 11/388 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMI GFF+ L  GHI++I L+  IQ + +KEVIAIA +P+KEK L
Sbjct: 59  EKKKQTFITRTIWTFVMIAGFFVALFSGHIYIIALITGIQIISFKEVIAIASIPNKEKNL 118

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWYFL +T YFLYGES+IYYFK I++VD  LLP A HHRFISF LY +GFVFFV
Sbjct: 119 RFTKSLNWYFLATTMYFLYGESVIYYFKHILLVDKVLLPLANHHRFISFTLYVMGFVFFV 178

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K HY+FQFTQFAWTHM L ++V Q+HF++NNIFEG+IWF LP +LVI NDIFAY+C
Sbjct: 179 GSLQKGHYRFQFTQFAWTHMALYLIVVQAHFVMNNIFEGMIWFFLPAALVITNDIFAYVC 238

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +G+T LI+LSPKKT EGF+GA  CT+ FG+F ++LL R+ Y ICP  DL +    G 
Sbjct: 239 GISFGKTQLIQLSPKKTVEGFLGAWACTVAFGYFMTNLLIRYKYFICPVNDLGSNVLTG- 297

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNPVF  Q Y L            F   ++ W+ P+Q+H+L  A FASLIAPFGGF
Sbjct: 298 LECVPNPVFTLQPYSLE----------VFGLDKTFWVEPIQFHILAFATFASLIAPFGGF 347

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGGITDRMDCQF+MG FS MYY SFI +   +VG +++T 
Sbjct: 348 FASGLKRTFKIKDFGESIPGHGGITDRMDCQFIMGFFSFMYYHSFIAVYKASVGDIIETA 407

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           +N L   +Q+E+   L +YL +QG + E
Sbjct: 408 INGLTVDEQLEVVRGLGKYLYNQGAVSE 435



>gi|475668276|gb|EMT66064.1| Putative phosphatidate cytidylyltransferase [Fusarium oxysporum f.
           sp. cubense race 4]
 gi|477523193|gb|ENH75226.1| Putative phosphatidate cytidylyltransferase [Fusarium oxysporum f.
           sp. cubense race 1]
          Length = 455

 Score =  468 bits (1205), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 230/388 (59%), Positives = 286/388 (73%), Gaps = 6/388 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K  N   RT WTFVM   FF  L +GHI++I ++  +Q + +KEVIAIA+VPS+ + L
Sbjct: 60  EKKKANFITRTFWTFVMFALFFAALFMGHIYIICIITAVQIVSFKEVIAIANVPSRARSL 119

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
              K+LNWY+L +T YFLYGE++IYYFK I++VD  LLP ATHHRFISF+LY  GFVFFV
Sbjct: 120 RSTKSLNWYWLATTMYFLYGETVIYYFKHIILVDKVLLPLATHHRFISFILYVFGFVFFV 179

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+  HYKFQFT FAWTHM L ++V Q+HFI+NN+FEG+IWF LP +LVI NDIFAYIC
Sbjct: 180 TSLQAGHYKFQFTNFAWTHMALYLIVVQAHFIMNNVFEGMIWFFLPAALVITNDIFAYIC 239

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA I TIIF    SS++ R  Y ICP  DL    F G 
Sbjct: 240 GILFGRTQLIKLSPKKTVEGFVGAWIMTIIFAMLLSSIMMRSKYFICPVNDLGANIFTG- 298

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C+PNPVF+P+ Y+L P L  L     F    SV IAP+Q H L +A FASLIAPFGGF
Sbjct: 299 LKCDPNPVFLPKTYEL-PELFFLPDTANF----SVTIAPMQIHALNLATFASLIAPFGGF 353

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGGITDRMDCQF+MG F++MY+ +FI +  +++G+VL+T 
Sbjct: 354 FASGLKRTFKIKDFGDSIPGHGGITDRMDCQFIMGFFAYMYFHTFIAIHKVSLGSVLETA 413

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           + SL P +Q+EL   +  YL +QG+L E
Sbjct: 414 ITSLNPDEQLELVKGMGHYLRNQGILAE 441



>gi|407920900|gb|EKG14079.1| Phosphatidate cytidylyltransferase [Macrophomina phaseolina MS6]
          Length = 451

 Score =  468 bits (1204), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 230/389 (59%), Positives = 291/389 (74%), Gaps = 6/389 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWT VMI GFF  +  GHI++I +V  +Q + +KEVIAI++VPS+ + L
Sbjct: 57  EKKKETFITRTIWTLVMIAGFFWAMFAGHIYIIIIVTAVQIISFKEVIAISNVPSRARSL 116

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWYFL +T YFLYGES+IYYFK I++VD  LLPFATHHRFISF+LY  GFVFFV
Sbjct: 117 RFTKSLNWYFLGTTMYFLYGESVIYYFKHIILVDKILLPFATHHRFISFMLYVTGFVFFV 176

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A+L+K HYKFQFTQFAWTHM L ++V Q+HFI+NNIFEG+IWF LPVSLV+ NDIFAYIC
Sbjct: 177 ASLQKGHYKFQFTQFAWTHMALYLIVVQAHFIMNNIFEGMIWFFLPVSLVVTNDIFAYIC 236

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIK+SPKKT EGF+GA I TIIFG   +++L R+ Y ICP  DL    F G 
Sbjct: 237 GITFGRTQLIKISPKKTVEGFLGAWIFTIIFGVILTNILMRYKYFICPVNDLGANFFTG- 295

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C+ NPVFIP +Y L P++   +  L      +V IAP+Q+H+L+ A FASLIAPFGGF
Sbjct: 296 LECDVNPVFIPHKYRL-PFIPPNWTHLP----STVTIAPMQFHILIFATFASLIAPFGGF 350

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGG+TDRMDCQF+MG F+ MYY SFI +   +VG V++  
Sbjct: 351 FASGLKRTFKIKDFGDSIPGHGGMTDRMDCQFIMGFFAFMYYSSFIAVYKASVGGVIEQA 410

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           +  L P  QIE+   L ++L++QG++   
Sbjct: 411 ITGLTPDQQIEVVKGLSKHLVNQGVIPSN 439



>gi|345560878|gb|EGX43995.1| hypothetical protein AOL_s00210g156 [Arthrobotrys oligospora ATCC
           24927]
          Length = 470

 Score =  466 bits (1199), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 231/394 (58%), Positives = 295/394 (74%), Gaps = 17/394 (4%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +N  VRTIWT VMI  FF++L  GH++++ +V  +Q + +KEVIAI+ VP+KEK +
Sbjct: 77  EKKKQNFVVRTIWTLVMIAFFFILLFSGHLYLVAVVTAVQIITFKEVIAISSVPAKEKNM 136

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K LNWYFL++T Y+LYGES+IYYFK IV+VDAFLLP A+HHRFISF+LY +GFVFFV
Sbjct: 137 HFTKALNWYFLVTTIYYLYGESVIYYFKHIVLVDAFLLPMASHHRFISFMLYMLGFVFFV 196

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L++ HY+FQFTQFAWTHM L +VV Q+HF INNIFEGLIWF LP S++I NDI+AYIC
Sbjct: 197 GSLRRGHYRFQFTQFAWTHMALYLVVVQAHFTINNIFEGLIWFFLPTSMIITNDIWAYIC 256

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA ICT+I+G   + +L  + Y ICP ++L    + G 
Sbjct: 257 GISFGRTQLIKLSPKKTVEGFVGAWICTMIYGLAVARILVPYKYFICPVRNLGANIWTG- 315

Query: 242 LTCEPNPVFIPQRY----DLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAP 297
           L C PNPVF P  Y     L P L   F             AP+ +HVL+MA FASLIAP
Sbjct: 316 LECTPNPVFSPHTYTLPLPLQPILGDTFTS-----------APIYFHVLLMATFASLIAP 364

Query: 298 FGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMS-SLTVGA 356
           FGGFFASG+KR F IKDFG +IPGHGGITDRMDCQF+MG FS++YYQSFI  + ++TVG 
Sbjct: 365 FGGFFASGLKRTFKIKDFGDTIPGHGGITDRMDCQFIMGFFSNLYYQSFIAANKAVTVGG 424

Query: 357 VLQTIVNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           VLQ+++ +L PQ+Q+E+   L++YL  QGL+ + 
Sbjct: 425 VLQSVIGNLSPQEQVEVVLGLQKYLAGQGLVGQE 458



>gi|512199638|gb|EPE28471.1| Acid protease [Glarea lozoyensis ATCC 20868]
          Length = 857

 Score =  466 bits (1198), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 226/388 (58%), Positives = 292/388 (75%), Gaps = 10/388 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    R+IWTFVMI  FF  + +GHI++I +V  +Q + +KEVIAIA+VPS+ ++L
Sbjct: 61  EKKKQTFITRSIWTFVMIGAFFGSMFMGHIYIIIIVTAVQIVSFKEVIAIANVPSRARRL 120

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K LNWY+L +T YFLYGES+IYYFK IV+VD  LLPFATHHRFISF+LY IGFVFFV
Sbjct: 121 RFTKALNWYWLATTMYFLYGESVIYYFKHIVLVDKVLLPFATHHRFISFMLYVIGFVFFV 180

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+  HY+FQFTQFAWTHM L ++V Q+HFI+NN+FEG+IWF LPVSLVICNDIFAY+ 
Sbjct: 181 TSLQAGHYRFQFTQFAWTHMALYLIVVQAHFIMNNVFEGMIWFFLPVSLVICNDIFAYLV 240

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G   GRT LIKLSPKKT EGF+GA I T+IFG   +++L R+ Y ICP  DL    + G 
Sbjct: 241 GITVGRTQLIKLSPKKTVEGFLGAWIFTVIFGCAMANVLMRYKYFICPVNDLGANIWTG- 299

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNPVF+P  Y L  W         F  I+S  +AP+Q H+L+ A FASLIAPFGGF
Sbjct: 300 LECVPNPVFLPHTYHLPIW---------FPYIKSFVMAPMQIHILLFATFASLIAPFGGF 350

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGGITDRMDCQF+MG F++MYY SFI  + +++G V++ +
Sbjct: 351 FASGLKRTFKIKDFGDSIPGHGGITDRMDCQFIMGFFAYMYYHSFIAQNKVSLGGVIEQV 410

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           +  L P++Q+EL   + ++L++QG++ E
Sbjct: 411 ITGLTPEEQMELVKGISKHLVNQGVITE 438



>gi|358395474|gb|EHK44861.1| hypothetical protein TRIATDRAFT_39363 [Trichoderma atroviride IMI
           206040]
          Length = 460

 Score =  465 bits (1196), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 226/389 (58%), Positives = 288/389 (74%), Gaps = 6/389 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K  N   RT+WT VMI GFF  L +GHI++I +V  +Q + +KEVIAIA+VPS+ + L
Sbjct: 67  EKKKANFWTRTLWTLVMISGFFGALFMGHIYMIAIVTAVQIISFKEVIAIANVPSRARSL 126

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
              K+LNWYFL +T YFLYGES+IYYFK IV+VD  LLP ATHHRFISF+LY  GFVFFV
Sbjct: 127 RSTKSLNWYFLATTMYFLYGESVIYYFKHIVLVDKVLLPLATHHRFISFMLYVFGFVFFV 186

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A+L+  +YKFQFT FAWTHM L ++V Q+HF++NNIFEG+IWF LP +LVI NDIFAYIC
Sbjct: 187 ASLQAGNYKFQFTNFAWTHMALYLIVVQAHFVMNNIFEGMIWFFLPAALVITNDIFAYIC 246

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA I T++F F   ++L R  Y ICP  DL    F G 
Sbjct: 247 GIMFGRTQLIKLSPKKTVEGFVGAWIMTVLFSFLLVNILMRSKYFICPVNDLGANVFTG- 305

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C+ NP F+P  Y+L P    L    +F    S+  AP+Q H L +A FASLIAPFGGF
Sbjct: 306 LKCDVNPAFVPHTYEL-PQFFFLPPNTSF----SLTFAPMQLHALALATFASLIAPFGGF 360

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGG+TDRMDCQF+MG F++MY+ +FI++  +++G+VL+T 
Sbjct: 361 FASGLKRTFKIKDFGDSIPGHGGMTDRMDCQFIMGFFAYMYFHTFIEVHKVSLGSVLETA 420

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           + SL P++Q+EL   + +YL +QGL+ + 
Sbjct: 421 ITSLAPEEQVELVKSMCRYLSNQGLMPQE 449



>gi|485925205|gb|EOD49839.1| putative phosphatidate cytidylyltransferase protein [Neofusicoccum
           parvum UCRNP2]
          Length = 456

 Score =  464 bits (1194), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 229/389 (58%), Positives = 292/389 (75%), Gaps = 7/389 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWT VMI  FF  +  GHI++I +V  +Q + +KEVIAI++VPS+ + L
Sbjct: 61  EKKKETFITRTIWTLVMIATFFWAMFAGHIYIIIIVTAVQIISFKEVIAISNVPSRARSL 120

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWYFL +T YFLYGES+IYYFK I++VD  LLPFATHHRFISF+LY  GFVFFV
Sbjct: 121 RFTKSLNWYFLGTTMYFLYGESVIYYFKHIILVDKILLPFATHHRFISFMLYVTGFVFFV 180

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A+L+K HYKFQFTQFAWTHM L ++V Q+HFI+NNIFEG+IWF LPVSLVI NDIFAYIC
Sbjct: 181 ASLQKGHYKFQFTQFAWTHMALYLIVVQAHFIMNNIFEGMIWFFLPVSLVITNDIFAYIC 240

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPA-QDLTTTAFYG 240
           G  +GRT LIK+SPKKT EGF+GA + TI+FG   +++L R+ Y ICP  QDL    F G
Sbjct: 241 GITFGRTQLIKISPKKTVEGFLGAWVFTILFGMLLTNILMRYKYFICPVNQDLGANVFTG 300

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
            L C+ NPVFIP  Y L P++   +  L      ++ IAP+Q+H+LV A FASLIAPFGG
Sbjct: 301 -LECDVNPVFIPHLYRL-PFIPPNWTHLP----TTITIAPMQFHILVFATFASLIAPFGG 354

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG+KR F IKDFG SIPGHGG+TDRMDCQF+MG F+ MYY SFI +   TVG +++ 
Sbjct: 355 FFASGLKRTFKIKDFGDSIPGHGGMTDRMDCQFIMGFFAFMYYSSFIAVYKTTVGGLIEQ 414

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLEE 389
            +  L P+ Q+EL   L ++L++QG+++ 
Sbjct: 415 AITGLTPEQQMELVKGLSKHLVNQGVIQS 443



>gi|340515109|gb|EGR45366.1| predicted protein [Trichoderma reesei QM6a]
          Length = 459

 Score =  461 bits (1186), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 222/389 (57%), Positives = 284/389 (73%), Gaps = 6/389 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K  N   RT WT VMI GFF  L +GHI++I +V  +Q + +KEVIAIA+VPS+ + L
Sbjct: 67  EKKKANFWTRTFWTLVMISGFFGALFMGHIYIIAIVTAVQIISFKEVIAIANVPSRARSL 126

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
              K+LNWYFL +T YFLYGES+IYYFK IV+VD  LLP ATHHRFISF+LY  GFV+FV
Sbjct: 127 RSTKSLNWYFLATTMYFLYGESVIYYFKHIVLVDKVLLPLATHHRFISFILYVFGFVYFV 186

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A+L+  HYKFQFT FAWTHM L ++V Q+HF++NNIFEG+IWF LP +LVI NDIFAYIC
Sbjct: 187 ASLQAGHYKFQFTNFAWTHMALYLIVVQAHFVMNNIFEGMIWFFLPAALVITNDIFAYIC 246

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA + T++F     +++ R  Y ICP  DL    F G 
Sbjct: 247 GIAFGRTQLIKLSPKKTVEGFVGAWVMTVLFSILLVNIMTRSKYFICPVNDLGANIFTG- 305

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C+ NPVF+P  Y +  +              S+  AP+Q H LV+A FASLIAPFGGF
Sbjct: 306 LKCDVNPVFLPHTYRIPQFFFLPPNFNF-----SLTFAPMQLHALVLATFASLIAPFGGF 360

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGG+TDRMDCQF+MG F++MY+ +FI++  +T+G+VL+T 
Sbjct: 361 FASGLKRTFKIKDFGDSIPGHGGMTDRMDCQFIMGFFAYMYFHTFIEVHKVTLGSVLETA 420

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           + SL P++Q+EL   + +YL +QG++ E 
Sbjct: 421 ITSLDPEEQVELVKSMCRYLSNQGIMPEE 449



>gi|321257269|ref|XP_003193529.1| phosphatidate cytidylyltransferase [Cryptococcus gattii WM276]
 gi|317459999|gb|ADV21742.1| phosphatidate cytidylyltransferase, putative [Cryptococcus gattii
           WM276]
          Length = 645

 Score =  461 bits (1186), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 222/393 (56%), Positives = 289/393 (73%), Gaps = 10/393 (2%)

Query: 3   QKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAI----AHVPSK- 57
           +K +NM  RTIWTF+MI GF  +L +GH ++I LV++ QTLVYKEV A+     H  SK 
Sbjct: 252 KKNRNMIERTIWTFIMIGGFITLLCMGHPYMILLVMLCQTLVYKEVTALFDLRDHGGSKA 311

Query: 58  ----EKKLPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLY 113
               E+   W KT+NWYF +   YFLYGESIIYYFK IV VDA+ +PFA +HRFISF+LY
Sbjct: 312 ATPGEQGDSWNKTINWYFFVVANYFLYGESIIYYFKHIVFVDAYFIPFARNHRFISFMLY 371

Query: 114 CIGFVFFVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVIC 173
            +GFV FVANL++ + + QF  F W H++LL++V  SHFI+NNI EGL+WF +P SLVIC
Sbjct: 372 VVGFVGFVANLQRQYLRQQFALFCWVHISLLLIVVSSHFIVNNILEGLVWFFIPASLVIC 431

Query: 174 NDIFAYICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDL 233
           ND+ AY+CG  +G+TPLIKLSPKKT EGFVGA ICTI+FG  W +   R+ YMICPA+DL
Sbjct: 432 NDVMAYVCGKLFGKTPLIKLSPKKTVEGFVGAFICTILFGIAWGTFWMRYPYMICPARDL 491

Query: 234 TTTAFYGRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFAS 293
            T  F  ++TC PNPVF+ + ++       + + +      S+  AP Q H LVMA FAS
Sbjct: 492 GTNVF-SQVTCRPNPVFVWRDFEFTGVAKHVLQTILGHPPPSIPYAPFQIHCLVMATFAS 550

Query: 294 LIAPFGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLT 353
           L+APFGGFFASG KRAFNIKDFGHSIPGHGG+TDRMDCQF+MG FS++YY S I++ ++T
Sbjct: 551 LVAPFGGFFASGFKRAFNIKDFGHSIPGHGGMTDRMDCQFMMGLFSYVYYSSLIRIQNVT 610

Query: 354 VGAVLQTIVNSLKPQDQIELFNRLKQYLLSQGL 386
           VG ++Q +V SL   +Q+EL + L+++L+ QG+
Sbjct: 611 VGGIMQAVVTSLTQAEQLELLHDLRRFLIGQGV 643



>gi|302892333|ref|XP_003045048.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256725973|gb|EEU39335.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 455

 Score =  460 bits (1183), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 229/386 (59%), Positives = 282/386 (73%), Gaps = 6/386 (1%)

Query: 7   NMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKLPWFKT 66
           N   RT WTFVM   FF  L +GHI++I ++  +Q + +KEVIAIA+VPS+ + L   K+
Sbjct: 65  NFMTRTFWTFVMFAMFFTALFMGHIYIICIITAVQIISFKEVIAIANVPSRARSLRSTKS 124

Query: 67  LNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFVANLKK 126
           LNWY+L +T YFLYGE++IYYFK IV+VD  LLP ATHHRFISF+LY  GFVFFVA+L+ 
Sbjct: 125 LNWYWLATTMYFLYGETVIYYFKHIVLVDKVLLPLATHHRFISFILYVFGFVFFVASLQA 184

Query: 127 HHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYICGFFWG 186
            HYKFQFT FAWTHM L ++V Q+HFI+NN+FEG+IWF LP +LVI NDIFAYICG  +G
Sbjct: 185 GHYKFQFTNFAWTHMALYLIVVQAHFIMNNVFEGMIWFFLPAALVITNDIFAYICGIMFG 244

Query: 187 RTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGRLTCEP 246
           RT LIKLSPKKT EGFVGA I TI+FG    +++ R  Y ICP  DL    F G L C+P
Sbjct: 245 RTQLIKLSPKKTVEGFVGAWIMTILFGMILVNIMMRSKYFICPVNDLGANIFTG-LQCDP 303

Query: 247 NPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGFFASGV 306
           NPVF+ + Y+L P L  L     F    SV  AP+Q H L +A FASLIAPFGGFFASG+
Sbjct: 304 NPVFLLKTYEL-PELFFLPENTHF----SVTFAPMQLHALNLATFASLIAPFGGFFASGL 358

Query: 307 KRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTIVNSLK 366
           KR F IKDFG SIPGHGGITDRMDCQF+MG F++MYY SFI +  + +G VL+T + SL 
Sbjct: 359 KRTFKIKDFGDSIPGHGGITDRMDCQFIMGFFAYMYYHSFIAIHKVNLGTVLETAITSLS 418

Query: 367 PQDQIELFNRLKQYLLSQGLLEERGA 392
           P +Q+EL   +  YL +QG+L +  A
Sbjct: 419 PDEQVELVKSMGHYLRNQGVLLDEVA 444



>gi|405120406|gb|AFR95177.1| phosphatidate cytidylyltransferase [Cryptococcus neoformans var.
           grubii H99]
          Length = 645

 Score =  459 bits (1180), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 224/393 (56%), Positives = 284/393 (72%), Gaps = 10/393 (2%)

Query: 3   QKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAI----AHVPSK- 57
           +K +NM  RTIWTF+MI GF  +L +GH ++I LV++ QTLVYKEV A+     H  SK 
Sbjct: 252 KKNRNMIERTIWTFIMIGGFITLLCMGHPYMILLVMLCQTLVYKEVTALFDLRDHGGSKA 311

Query: 58  ----EKKLPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLY 113
               E+   W KT+NWYF +   YFLYGESIIYYFK IV VDA+ +PFA +HRFISF+LY
Sbjct: 312 ATPGEQGDSWNKTINWYFFVVANYFLYGESIIYYFKHIVFVDAYFIPFARNHRFISFMLY 371

Query: 114 CIGFVFFVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVIC 173
            +GFV FVANL++ + + QF  F W H++LL+VV  SHFI+NNI EGL+WF +P SLVIC
Sbjct: 372 VVGFVGFVANLQRQYLRQQFALFCWVHISLLLVVVSSHFIVNNILEGLVWFFVPASLVIC 431

Query: 174 NDIFAYICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDL 233
           ND+ AY+CG  +G+TPLIKLSPKKT EGFVGA ICT++FG  W +   R+ YMICPA+DL
Sbjct: 432 NDVMAYVCGKLFGKTPLIKLSPKKTVEGFVGAFICTLLFGIAWGTFWMRYPYMICPARDL 491

Query: 234 TTTAFYGRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFAS 293
            T  F   + C PNPVF+   ++       L + +      S+  AP Q H LVMA FAS
Sbjct: 492 GTNVF-SEVACRPNPVFMWHSFEFTGVARQLLQTILGHPPPSIPYAPFQIHCLVMATFAS 550

Query: 294 LIAPFGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLT 353
           L+APFGGFFASG KRAFNIKDFGHSIPGHGG+TDRMDCQF+MG FS++YY S I++ ++T
Sbjct: 551 LVAPFGGFFASGFKRAFNIKDFGHSIPGHGGMTDRMDCQFMMGLFSYVYYSSLIRIQNVT 610

Query: 354 VGAVLQTIVNSLKPQDQIELFNRLKQYLLSQGL 386
           VG ++Q +V SL   +QIEL   LK++L  QG+
Sbjct: 611 VGGIMQAVVTSLTQPEQIELLYDLKRFLAGQGV 643



>gi|392572322|gb|EIW65473.1| hypothetical protein TREMEDRAFT_46158 [Tremella mesenterica DSM
           1558]
          Length = 648

 Score =  458 bits (1178), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 220/392 (56%), Positives = 287/392 (73%), Gaps = 10/392 (2%)

Query: 4   KWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSK------ 57
           K +N   RTIWTF+MI GF  +L LGH ++I L++V QTLVYKEV A+  +  +      
Sbjct: 255 KDRNAIERTIWTFIMIGGFITLLCLGHPYMILLIMVCQTLVYKEVTALFELRDQGSPKAE 314

Query: 58  ---EKKLPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYC 114
              E +  W KTLNWYF + T YFLYGESIIYYFK IV VD   +PFA +HRFISF+LY 
Sbjct: 315 THPEDRDKWSKTLNWYFFVVTNYFLYGESIIYYFKHIVFVDRHFIPFARNHRFISFMLYM 374

Query: 115 IGFVFFVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICN 174
           +GF+ FV NL++ + + QF  F W H+TLL++V  SHFI+NNI EG +WF +P SLVICN
Sbjct: 375 VGFMGFVGNLQRQYLRQQFGLFCWVHITLLLIVVSSHFIVNNILEGHVWFFIPASLVICN 434

Query: 175 DIFAYICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLT 234
           D+ AY+CG  +GRTPLIKLSPKKT EGFVGA ICT++FG  W +   R+ YMICPA DL 
Sbjct: 435 DVMAYVCGKLFGRTPLIKLSPKKTVEGFVGAFICTLMFGLAWGTYFMRFPYMICPATDLG 494

Query: 235 TTAFYGRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASL 294
           T  F  +++C+PNPVF+ + ++L      + + +  +   ++  AP Q HVLVMA FASL
Sbjct: 495 TNVF-SQVSCKPNPVFLWREFELTGVAQQILQTVLGRPPPAIPYAPFQIHVLVMATFASL 553

Query: 295 IAPFGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTV 354
           +APFGGFFASG KRAFNIKDFGHSIPGHGG+TDRMDCQFLMG FS++YY S I++ ++TV
Sbjct: 554 VAPFGGFFASGFKRAFNIKDFGHSIPGHGGMTDRMDCQFLMGLFSYVYYSSLIRIQNVTV 613

Query: 355 GAVLQTIVNSLKPQDQIELFNRLKQYLLSQGL 386
           G+++Q++V SL   +Q++LF  LK++L  QG+
Sbjct: 614 GSIMQSVVTSLTAAEQVDLFFDLKRFLEGQGI 645



>gi|430813202|emb|CCJ29427.1| unnamed protein product [Pneumocystis jirovecii]
          Length = 467

 Score =  458 bits (1178), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 229/385 (59%), Positives = 294/385 (76%), Gaps = 5/385 (1%)

Query: 3   QKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKLP 62
           +   N  +RTIWTF MIFGF +I+  GHIW+I L+ +IQ +V+KE++AI ++  KEKK+P
Sbjct: 75  ENRSNFYLRTIWTFAMIFGFLVIVAAGHIWIIILLTIIQVIVFKELMAIVNISDKEKKIP 134

Query: 63  WFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFVA 122
           WF+TLNWYFL +T YF YGES+IYYFK I++V+AFL    THHRFISF+LY  GF+FFV 
Sbjct: 135 WFQTLNWYFLSTTLYFAYGESLIYYFKHIIIVNAFLFSIVTHHRFISFILYVGGFIFFVM 194

Query: 123 NLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYICG 182
           NLKK HYK+QFTQF WTHM LL++V QSHFIINNIFEG+ WF+LP SLVICNDIF+Y+CG
Sbjct: 195 NLKKGHYKYQFTQFCWTHMILLLIVGQSHFIINNIFEGIFWFLLPASLVICNDIFSYLCG 254

Query: 183 FFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGRL 242
             +GRT LIKLSPKKT EGF+G  ICT+I G    +++  W+YMICP +DL  TA  G L
Sbjct: 255 KLFGRTQLIKLSPKKTVEGFIGGWICTVILGLTMGNIILHWNYMICPLRDLGATALIG-L 313

Query: 243 TCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGFF 302
            C PNP FI Q++ +  ++ S    L F    ++ I P+++H++V + FASLIAPFGGFF
Sbjct: 314 ECVPNPTFILQQFSVPEFIISY---LGFP-YHTITIRPVEFHLMVFSTFASLIAPFGGFF 369

Query: 303 ASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTIV 362
           ASG+KRAF IKDFG SIPGHGG+TDR DCQF+ G F ++YY SFI ++ ++VG+VLQT +
Sbjct: 370 ASGLKRAFKIKDFGDSIPGHGGLTDRFDCQFINGFFVYLYYHSFIAVTHVSVGSVLQTAI 429

Query: 363 NSLKPQDQIELFNRLKQYLLSQGLL 387
            SL    Q+ L N L +YL+SQG+L
Sbjct: 430 TSLTYDQQMRLSNSLYKYLVSQGVL 454



>gi|402083446|gb|EJT78464.1| phosphatidate cytidylyltransferase [Gaeumannomyces graminis var.
           tritici R3-111a-1]
          Length = 460

 Score =  457 bits (1177), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 228/386 (59%), Positives = 282/386 (73%), Gaps = 4/386 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K  N   RT+WTFVMI  FF  L +GHI++I ++  IQ + +KEVIAIA+VPS+ ++L
Sbjct: 63  EKKKANFFTRTLWTFVMIGVFFGALFMGHIYMILVITTIQIISFKEVIAIANVPSRARQL 122

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
              K+LNWY+L S  YFLYGES+IYYFK IV+VD  LLP ATHHRFISF+LY IGFVFFV
Sbjct: 123 RSTKSLNWYWLASAMYFLYGESVIYYFKHIVLVDKVLLPLATHHRFISFILYVIGFVFFV 182

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A+LK  HYKFQFT FAWTHM L ++V Q+HF++NNIFEG+ WF +P +LVI NDIFAYIC
Sbjct: 183 ASLKAGHYKFQFTNFAWTHMALYLIVVQAHFVMNNIFEGMFWFFMPAALVITNDIFAYIC 242

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA + T++FG   + LL R  Y ICP  DL    F G 
Sbjct: 243 GITFGRTQLIKLSPKKTVEGFVGAWVMTVLFGILLTHLLSRSKYFICPVTDLGANIFTG- 301

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C+PNPVF+P+ Y L P    L R    K   S+ ++ +Q H LV+A FASLIAPFGGF
Sbjct: 302 LACDPNPVFVPKTYTL-PDFVFLPRDWAHK--LSITMSTMQLHSLVIASFASLIAPFGGF 358

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGG+TDRMDCQF MG FS++YY +FI    L +G VL+  
Sbjct: 359 FASGLKRTFKIKDFGDSIPGHGGMTDRMDCQFTMGFFSYIYYHTFIATHHLGLGGVLEDA 418

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLL 387
           +  L P +QIEL   + +YL +QG++
Sbjct: 419 ITGLTPDEQIELIKGVGRYLANQGIV 444



>gi|58266536|ref|XP_570424.1| phosphatidate cytidylyltransferase [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|134111320|ref|XP_775802.1| hypothetical protein CNBD5310 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50258466|gb|EAL21155.1| hypothetical protein CNBD5310 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57226657|gb|AAW43117.1| phosphatidate cytidylyltransferase, putative [Cryptococcus
           neoformans var. neoformans JEC21]
          Length = 646

 Score =  457 bits (1175), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 222/393 (56%), Positives = 285/393 (72%), Gaps = 10/393 (2%)

Query: 3   QKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAI----AHVPSK- 57
           +K +NM  RTIWTF+MI GF ++L +GH ++I LV++ QTLVY EV A+     H  SK 
Sbjct: 253 KKNRNMIERTIWTFIMIGGFIVLLCMGHPYMILLVMLCQTLVYNEVTALFDLRDHGGSKA 312

Query: 58  ----EKKLPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLY 113
               E+   W KT+NWYF +   YFLYGESIIYYFK IV VDA+ +PFA +HRFISF+LY
Sbjct: 313 ATPGEQGDSWNKTINWYFFVVANYFLYGESIIYYFKHIVFVDAYFIPFARNHRFISFMLY 372

Query: 114 CIGFVFFVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVIC 173
            +GFV FVANL++ + + QF  F W H++LL++V  SHFI+NNI EGL+WF +P SLVIC
Sbjct: 373 VVGFVGFVANLQRQYLRQQFALFCWVHISLLLIVVSSHFIVNNILEGLVWFFVPASLVIC 432

Query: 174 NDIFAYICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDL 233
           ND+ AY+CG  +G+TPLIKLSPKKT EGFVGA ICT++FG  W +   R+ YMICPA+DL
Sbjct: 433 NDVMAYVCGKLFGKTPLIKLSPKKTVEGFVGAFICTLLFGIAWGTFWMRYPYMICPARDL 492

Query: 234 TTTAFYGRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFAS 293
            T  F  ++TC PNPVF+   ++         + +      S+  AP Q H LVMA FAS
Sbjct: 493 GTNVF-SQVTCRPNPVFMWHSFEFTGVARQALQTILGHPPPSIPYAPFQIHCLVMATFAS 551

Query: 294 LIAPFGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLT 353
           L+APFGGFFASG KRAFNIKDFGHSIPGHGG+TDRMDCQF+MG FS++YY S I++ ++T
Sbjct: 552 LVAPFGGFFASGFKRAFNIKDFGHSIPGHGGMTDRMDCQFMMGLFSYVYYSSLIRIQNVT 611

Query: 354 VGAVLQTIVNSLKPQDQIELFNRLKQYLLSQGL 386
           VG ++Q +V SL   +QIEL   LK++L  QG+
Sbjct: 612 VGGIMQAVVTSLTQPEQIELLYDLKRFLAGQGV 644



>gi|494826584|gb|EON63640.1| phosphatidate cytidylyltransferase [Coniosporium apollinis CBS
           100218]
          Length = 459

 Score =  456 bits (1173), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 227/389 (58%), Positives = 291/389 (74%), Gaps = 6/389 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWT +MI  FF  +  GHI++I +V  IQ + +KEVIAI++VPS+ + L
Sbjct: 62  EKKKETFITRTIWTLIMIGIFFGGMFAGHIYMIMIVTAIQIISFKEVIAISNVPSRARSL 121

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + KTLNWYFL +T YF YGES+IYYFK I+++D  LLPFATHHRFISF+LY IGFVFFV
Sbjct: 122 RFTKTLNWYFLGTTMYFFYGESVIYYFKHIILIDRVLLPFATHHRFISFMLYVIGFVFFV 181

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L++ H+KFQF+QFAWTHM LLI+V Q+HFI+NN+FEG+IWF LPVSLVI NDI+AYIC
Sbjct: 182 GSLQQGHFKFQFSQFAWTHMALLIIVFQAHFIMNNLFEGMIWFFLPVSLVITNDIWAYIC 241

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA I T+ FG   +++L R+ Y ICP  DL    + G 
Sbjct: 242 GITFGRTQLIKLSPKKTVEGFVGAWIFTMFFGVILTNILMRYKYFICPVNDLGANLWTG- 300

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNPVFIP  Y L P++   +  L     +++ +AP+Q+H+LV A FASLIAPFGGF
Sbjct: 301 LECTPNPVFIPHTYRL-PFIPPTWTHLP----QTLTVAPMQFHILVFATFASLIAPFGGF 355

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGG+TDRMDCQF+MG FS +YYQSFI ++  +VG VL+  
Sbjct: 356 FASGLKRTFKIKDFGDSIPGHGGMTDRMDCQFIMGFFSFVYYQSFIAVNKASVGGVLEMA 415

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           V  L  ++ +E+   L +YL+ QG L+ +
Sbjct: 416 VQGLNNEEVVEVVRGLVKYLVGQGRLDPK 444



>gi|403411988|emb|CCL98688.1| predicted protein [Fibroporia radiculosa]
          Length = 620

 Score =  453 bits (1166), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 217/392 (55%), Positives = 286/392 (72%), Gaps = 7/392 (1%)

Query: 3   QKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEK--- 59
           +K +N+  RT+WTF+MI GF ++L +GH ++I LV++ QTLVY+EV ++  +  K+    
Sbjct: 226 KKRRNILTRTLWTFIMIGGFLMLLLMGHAYMIMLVLLCQTLVYREVTSLFSLKRKDSGET 285

Query: 60  ----KLPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCI 115
               + PW KTLNWYF + T YFLYGESIIYYFK +V  DA L  FAT+HR +SF LY I
Sbjct: 286 RSRGRDPWSKTLNWYFFVVTNYFLYGESIIYYFKHVVFADAQLTLFATNHRMVSFTLYTI 345

Query: 116 GFVFFVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICND 175
           GF+ FV +L++ + K QF  F W HMTLL+VV  SHFI+NNI EG+IWF +P SLVICND
Sbjct: 346 GFMGFVMSLQRGYLKQQFGLFCWVHMTLLLVVVSSHFIMNNILEGMIWFWVPASLVICND 405

Query: 176 IFAYICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTT 235
           +FAYI G   GRTPLIKLSPKKT EGFVGA   T++FG  W +   R+DYMICP  DL  
Sbjct: 406 VFAYIWGMSVGRTPLIKLSPKKTVEGFVGAFFSTVVFGVLWGTYFMRFDYMICPVHDLGV 465

Query: 236 TAFYGRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLI 295
           +A+     C+PNPVF+ + + +   + +    L  ++I ++  AP Q+H+L M+CFASL+
Sbjct: 466 SAWSETARCDPNPVFVWRDWAIPAPMGAFLTTLLGREITTISYAPYQYHLLFMSCFASLV 525

Query: 296 APFGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVG 355
           APFGGFFASG KRAFNIKDFGHSIPGHGG+TDRMDCQFLMG F+++YY S I+ ++++VG
Sbjct: 526 APFGGFFASGFKRAFNIKDFGHSIPGHGGMTDRMDCQFLMGVFTYVYYSSLIRQNNVSVG 585

Query: 356 AVLQTIVNSLKPQDQIELFNRLKQYLLSQGLL 387
           ++LQ IV+ L P  Q+EL   LK+YL  QG++
Sbjct: 586 SLLQMIVSGLTPGQQLELMGDLKRYLEGQGIV 617



>gi|320589638|gb|EFX02094.1| phosphatidate cytidylyltransferase [Grosmannia clavigera kw1407]
          Length = 457

 Score =  453 bits (1165), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 222/389 (57%), Positives = 281/389 (72%), Gaps = 5/389 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +N   RT WTFVMI GFF  L +GHI+++ +V  +Q + + EVIAIA+VPS+ ++L
Sbjct: 61  EKKKQNFITRTFWTFVMIGGFFAALFMGHIYMVIIVTGVQVVSFSEVIAIANVPSRARQL 120

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
              K+LNWY+L +T YFLYGES+IYYFK IV+VD  LLP ATHHRFISFVLY IGFVFFV
Sbjct: 121 HSTKSLNWYWLATTMYFLYGESVIYYFKHIVLVDKVLLPLATHHRFISFVLYVIGFVFFV 180

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+  HYKFQFT FAWTHM L ++V Q+HF++NNIFEG+IWF LP SLVI NDIFAY+C
Sbjct: 181 MSLQAGHYKFQFTNFAWTHMALYLIVVQAHFVMNNIFEGMIWFFLPASLVITNDIFAYVC 240

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGF+GA I T+   F  +++L +  Y ICP  DL  + F G 
Sbjct: 241 GITFGRTQLIKLSPKKTVEGFLGAWIMTVFSSFILTTILTKSKYFICPVNDLGASFFTG- 299

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C+ NPVF+P  Y     L   F       + SV  AP+ +H  ++A FASLIAPFGGF
Sbjct: 300 LECDINPVFLPHTYT----LPHFFFLPDSYYLASVTFAPIHFHSAILATFASLIAPFGGF 355

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFGHSIPGHGG+TDRMDCQF+MG F+++YY SFI     +VG VL+  
Sbjct: 356 FASGLKRTFKIKDFGHSIPGHGGMTDRMDCQFIMGFFAYLYYHSFIATHKASVGRVLELA 415

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           +  L P++Q+EL   +  YL +QG++ E 
Sbjct: 416 ITGLTPKEQVELLRGVGHYLRNQGIIGEE 444



>gi|400598312|gb|EJP66029.1| cytidylyltransferase-like protein [Beauveria bassiana ARSEF 2860]
          Length = 458

 Score =  453 bits (1165), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 226/388 (58%), Positives = 282/388 (72%), Gaps = 6/388 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K  N   RT+WTFVMI  FF  L +GHI++I +V  +Q + +KEVIAIA+VPS+ + L
Sbjct: 63  EKKKANFWTRTLWTFVMIGVFFGALFMGHIYMIAIVTAVQIISFKEVIAIANVPSRARSL 122

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
              K+LNWY+L +T YFLYGES+IYYFK IV+VD  LLP ATHHRFISF+LY  GFVFFV
Sbjct: 123 RSTKSLNWYWLATTMYFLYGESVIYYFKHIVLVDKVLLPLATHHRFISFILYVFGFVFFV 182

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A+LK  HYKFQFT FAWTHM L ++V Q+HF++NNI EG+IWF LP SLVI NDIFAYIC
Sbjct: 183 ASLKAGHYKFQFTNFAWTHMALYLIVVQAHFVMNNILEGMIWFFLPASLVITNDIFAYIC 242

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA I T+IFG F ++L+ +  + ICP  DL    F G 
Sbjct: 243 GIAFGRTQLIKLSPKKTVEGFVGAWIMTVIFGIFLTNLMMKSKFFICPVNDLGANIFTG- 301

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNPVF+P  Y++ P    L +  T     ++  AP+Q H  V+A FASLIAPFGGF
Sbjct: 302 LQCNPNPVFLPATYEV-PQFFFLPQHRTI----TLTFAPIQLHTFVLASFASLIAPFGGF 356

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGG+TDRMDCQF+MG F++MY  +FI +  + +G VL+  
Sbjct: 357 FASGLKRTFKIKDFGDSIPGHGGMTDRMDCQFIMGFFAYMYLHTFIAVYKVDLGTVLEAA 416

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           +  L P DQ+EL   + +YL +QG+  E
Sbjct: 417 ITRLGPDDQVELVRSMCRYLGNQGIYPE 444



>gi|346327603|gb|EGX97199.1| phosphatidate cytidylyltransferase [Cordyceps militaris CM01]
          Length = 458

 Score =  452 bits (1163), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 223/388 (57%), Positives = 285/388 (73%), Gaps = 6/388 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K  N   RT+WTFVM+  FF  L +GHI++I ++  +Q + +KEVIAIA+VPS+ + L
Sbjct: 63  EKKKANFWTRTLWTFVMMGIFFGALFMGHIYIITIITAVQIISFKEVIAIANVPSRARSL 122

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
              K+LNWY+L +T YFLYGES+IYYFK IV+VD  LLP ATHHRFISF+LY  GFV FV
Sbjct: 123 RSTKSLNWYWLATTMYFLYGESVIYYFKHIVLVDKVLLPLATHHRFISFILYVFGFVCFV 182

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A+LK  HYKFQFT FAWTHM L ++V Q+HF++NNI EG+IWF LP +LVI NDIFAYIC
Sbjct: 183 ASLKAGHYKFQFTNFAWTHMALYLIVVQAHFVMNNILEGMIWFFLPAALVITNDIFAYIC 242

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA I T++FG F S+L+ +  + ICP  DL    F G 
Sbjct: 243 GIAFGRTQLIKLSPKKTVEGFVGAWIMTVLFGIFLSNLMMKSKFFICPVNDLGANIFTG- 301

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNPVF+P  Y++ P    L +  T     ++  AP+Q H  ++A FASLIAPFGGF
Sbjct: 302 LECNPNPVFLPATYEI-PQFFFLPQHRTI----TLTFAPIQLHTFILASFASLIAPFGGF 356

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR+F IKDFG SIPGHGG+TDRMDCQF+MG F++MYY +FI +  + +G VL+T 
Sbjct: 357 FASGLKRSFKIKDFGDSIPGHGGMTDRMDCQFIMGFFAYMYYHTFIAVYKVDLGIVLETA 416

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           +  L P DQ+EL   + +YL +QG++ E
Sbjct: 417 ITRLGPDDQVELVKSMCRYLGNQGIVPE 444



>gi|169620329|ref|XP_001803576.1| hypothetical protein SNOG_13366 [Phaeosphaeria nodorum SN15]
 gi|111058130|gb|EAT79250.1| hypothetical protein SNOG_13366 [Phaeosphaeria nodorum SN15]
          Length = 463

 Score =  451 bits (1161), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 223/389 (57%), Positives = 283/389 (72%), Gaps = 7/389 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K  N   RTIWT VMI GFF ILG GHI++I +V  +Q + +KEVIAIA+VPSK + L
Sbjct: 63  EKKKANFITRTIWTVVMIMGFFWILGAGHIYLIIIVTAVQVISFKEVIAIANVPSKARSL 122

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWYFL +  YFLYGESIIYYFK I++VD  LLP ATHHRFISF+LY IGFVFFV
Sbjct: 123 RFTKSLNWYFLGTAMYFLYGESIIYYFKHILLVDRILLPLATHHRFISFMLYIIGFVFFV 182

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K HYKFQFTQFAWTHM L ++V Q+HF+INNIFEGLIW +LPVS+VI NDI+AY+C
Sbjct: 183 FSLQKGHYKFQFTQFAWTHMALFLIVGQAHFVINNIFEGLIWLILPVSMVITNDIWAYLC 242

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRTPLI++SPKKTWEGF+GA   TII+G   +  L ++ Y ICP  DL    + G 
Sbjct: 243 GITFGRTPLIQISPKKTWEGFLGAWFFTIIWGIGLTHFLAQYKYFICPVNDLGANIWTG- 301

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C+PNPVFI + Y L       F        R+  I P+Q+H+ ++A FASL+APFGGF
Sbjct: 302 LECKPNPVFIARNYALP------FVPAGLPIPRTFNIMPVQFHIFILATFASLVAPFGGF 355

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGG+TDRMDCQF+MG  +  YY SFI +   TVG V++  
Sbjct: 356 FASGLKRTFKIKDFGDSIPGHGGMTDRMDCQFIMGSIAFFYYSSFIAVYHTTVGGVIEAA 415

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           V  L  ++Q+E+   L + L++Q ++  +
Sbjct: 416 VTGLSAEEQMEVVKILAKNLVNQDIISPK 444



>gi|477524488|gb|ENH76429.1| phosphatidate cytidylyltransferase [Colletotrichum orbiculare MAFF
           240422]
          Length = 461

 Score =  451 bits (1161), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 225/385 (58%), Positives = 285/385 (74%), Gaps = 4/385 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K  N   RT WT VM  GFF  L +GHI++I ++  IQ + +KEVIAIA+VPS+ ++L
Sbjct: 64  EKKKANFLTRTFWTLVMFAGFFTALFMGHIYIICIMTAIQIISFKEVIAIANVPSRARQL 123

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
              K+LNWY+L +T YFLYGES+IYYFK IV+VD  LLP ATHHRFISF+LY  GFVFFV
Sbjct: 124 RSAKSLNWYWLATTMYFLYGESVIYYFKHIVLVDKVLLPLATHHRFISFILYIFGFVFFV 183

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A+L+  HYKFQFTQFAWTHM L ++V Q+HFI+NN+FEG+IWF LP ++VI NDI+AYI 
Sbjct: 184 ASLQAGHYKFQFTQFAWTHMALYLIVVQAHFIMNNVFEGMIWFFLPAAMVITNDIWAYIV 243

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G   GRT LIK+SPKKT EGFVGA + TIIFG F +SLL R D+ +CP  DL    F G 
Sbjct: 244 GITIGRTQLIKISPKKTVEGFVGAWVMTIIFGMFLTSLLMRSDFFLCPVNDLGANIFTG- 302

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C  NPVF P+ Y L P L   F      +  S+ +AP+Q+H LV+A FASLIAPFGGF
Sbjct: 303 LECVRNPVFEPRTYRL-PHL--FFLPPDVNESISLTVAPVQFHTLVLATFASLIAPFGGF 359

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGG+TDRMDCQF+MG F++MYY SFI ++ +++G V++  
Sbjct: 360 FASGLKRTFKIKDFGDSIPGHGGMTDRMDCQFIMGFFTYMYYHSFIAVNKVSLGNVMEMA 419

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGL 386
           V  L  ++Q+EL   + +YL +QG+
Sbjct: 420 VTGLTVEEQLELVRGMGRYLSNQGV 444



>gi|46116790|ref|XP_384413.1| hypothetical protein FG04237.1 [Fusarium graminearum PH-1]
          Length = 455

 Score =  451 bits (1160), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 225/388 (57%), Positives = 286/388 (73%), Gaps = 6/388 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K  N   RT WTFVM   FF  L +GHI++I ++  IQ + +KEVIAIA+VPS+ + L
Sbjct: 59  EKKKANFITRTFWTFVMFALFFTALFMGHIYIITIITAIQIVSFKEVIAIANVPSRARSL 118

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
              K+LNWY+L +T YFLYGE++IYYFK I++VD  LLP ATHHRFISF+LY  GFVFFV
Sbjct: 119 RSTKSLNWYWLATTMYFLYGETVIYYFKHIILVDKVLLPLATHHRFISFILYVFGFVFFV 178

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+  HYKFQFT FAWTHM L ++V Q+HFI+NN+FEG+IWF LP +LVI NDIFAYIC
Sbjct: 179 TSLQAGHYKFQFTNFAWTHMALYLIVVQAHFIMNNVFEGMIWFFLPAALVITNDIFAYIC 238

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA I TIIF    S+++ R  + ICP  DL    F G 
Sbjct: 239 GIMFGRTQLIKLSPKKTVEGFVGAWIMTIIFAMILSNIMMRSKFFICPVNDLGANIFTG- 297

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C+PNPVF+P+ Y++ P L  L     F    S  IAP+Q H L +A FASLIAPFGGF
Sbjct: 298 LKCDPNPVFLPKTYEM-PELFFLPDTANF----SFTIAPMQIHALNLATFASLIAPFGGF 352

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGGITDRMDCQF+MG F++MY+ +F+ +  +++G+VL+T 
Sbjct: 353 FASGLKRTFKIKDFGDSIPGHGGITDRMDCQFIMGFFAYMYFHTFVAIHKVSLGSVLETA 412

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           + SL P++Q+EL   +  YL +QG++ E
Sbjct: 413 ITSLNPEEQVELVKSMGHYLRNQGIVTE 440



>gi|310798829|gb|EFQ33722.1| cytidylyltransferase [Glomerella graminicola M1.001]
          Length = 460

 Score =  451 bits (1159), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 221/385 (57%), Positives = 279/385 (72%), Gaps = 4/385 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K  N   RT WTFVM  GFF  L +GHI++I ++  IQ + +KEVIAIA VPS+ ++L
Sbjct: 63  EKKKANFMTRTFWTFVMFAGFFAALVMGHIYIICIMTAIQIISFKEVIAIASVPSRARQL 122

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
              K+LNWY+L +T YFLYGES+IYYFK IV+VD  LLP ATHHRFISF+LY  GFVFFV
Sbjct: 123 RSAKSLNWYWLATTMYFLYGESVIYYFKHIVLVDKVLLPLATHHRFISFILYIFGFVFFV 182

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+  HYKFQFTQFAWTHM L ++V Q+HFI+NN+FEG+IWF LP ++VI NDI+AY+C
Sbjct: 183 TSLQAGHYKFQFTQFAWTHMALYLIVVQAHFIMNNVFEGMIWFFLPAAMVITNDIWAYLC 242

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LI LSPKKT EGFVGA + TIIFG   +++L R D+ +CP  DL    F G 
Sbjct: 243 GITFGRTQLIALSPKKTVEGFVGAWVFTIIFGMLLTNVLMRSDFFLCPVNDLGANIFTG- 301

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C  NPVF P+ Y L P     F         S  +AP+Q H LV+A FASLIAPFGGF
Sbjct: 302 LDCTRNPVFEPKTYSLPPL---FFLPPNMHKTFSFTVAPMQLHTLVLATFASLIAPFGGF 358

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGG+TDRMDCQF+MG F++MYY SFI + ++ +G V++  
Sbjct: 359 FASGLKRTFKIKDFGDSIPGHGGMTDRMDCQFIMGFFTYMYYHSFIALHTVNLGDVMEMA 418

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGL 386
           V  L  ++Q+EL   + +YL +QG+
Sbjct: 419 VTGLTVEEQLELVRGMGRYLSNQGV 443



>gi|169847770|ref|XP_001830594.1| phosphatidate cytidylyltransferase [Coprinopsis cinerea
           okayama7#130]
 gi|116508330|gb|EAU91225.1| phosphatidate cytidylyltransferase [Coprinopsis cinerea
           okayama7#130]
          Length = 618

 Score =  451 bits (1159), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 230/397 (57%), Positives = 283/397 (71%), Gaps = 10/397 (2%)

Query: 3   QKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAI---------AH 53
           +K +N+  R IWTFVMIFGF  +L +GH ++I LV++  TLVY+EV A+          +
Sbjct: 223 KKRQNVVERVIWTFVMIFGFIGLLLMGHAYMIVLVMLCSTLVYREVTALFSLKSADQKEN 282

Query: 54  VPSKEKKLPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLY 113
            P  + K PW KTLNWYF   T YFLYGESIIYYFK +V  DA LLPFAT+HR ISF LY
Sbjct: 283 KPELKGKDPWSKTLNWYFFAVTNYFLYGESIIYYFKHVVFADAQLLPFATNHRMISFTLY 342

Query: 114 CIGFVFFVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVIC 173
            IGF+ FV +LKK + K QF  F W HM+LLI+V  SHFIINNI EGLIWF +P SLV+C
Sbjct: 343 IIGFMGFVMSLKKGYLKQQFGLFCWVHMSLLIIVFSSHFIINNILEGLIWFWVPASLVVC 402

Query: 174 NDIFAYICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDL 233
           ND FAYI G   GRTPLIKLSPKKT EGFVGA   TIIF   W +   R++YMICP  DL
Sbjct: 403 NDCFAYIWGKTMGRTPLIKLSPKKTVEGFVGAFFSTIIFAVLWGTYFMRFNYMICPVHDL 462

Query: 234 TTTAFYGRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFAS 293
            T AF   ++C PNPVFI +  +L   L+     ++ + I S+  AP Q H+LV+ACFAS
Sbjct: 463 GTNAFTA-MSCNPNPVFIWRSLELWKPLSVALGTISGQSITSISYAPYQLHLLVLACFAS 521

Query: 294 LIAPFGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLT 353
           L+APFGGFFASG KRAF+IKDFG SIPGHGG+TDRMDCQFLMG F+++YY S I+ +++T
Sbjct: 522 LVAPFGGFFASGFKRAFDIKDFGQSIPGHGGMTDRMDCQFLMGVFTYVYYSSLIRQNNVT 581

Query: 354 VGAVLQTIVNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           VG +LQTIV++L   +Q+EL   L +YL  QG+   R
Sbjct: 582 VGGILQTIVSNLTVDEQLELIGDLVRYLEKQGIAVPR 618



>gi|393245288|gb|EJD52799.1| hypothetical protein AURDEDRAFT_111348 [Auricularia delicata
           TFB-10046 SS5]
          Length = 603

 Score =  451 bits (1159), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 222/395 (56%), Positives = 285/395 (72%), Gaps = 12/395 (3%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAI---------- 51
           ++K +N  +RT+WTF+MI GF L+L +GH+++I LV+V Q+LVY+EV A+          
Sbjct: 205 AKKMRNAGIRTLWTFIMIGGFILLLLMGHVYMILLVMVCQSLVYREVTALFTLGAKDKVS 264

Query: 52  -AHVPSKEKKLPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISF 110
              V S  ++  W KT NWYF   T YFLYGE+IIYYFK +V  DA  LPFA +HR +SF
Sbjct: 265 DPEVASDPRETAWSKTFNWYFFAVTNYFLYGETIIYYFKHVVFSDANFLPFALNHRLVSF 324

Query: 111 VLYCIGFVFFVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSL 170
           +L+ +GFV FVA+LKK + K QF  F W HMTLL+VV  SHFI+NNI EG+IWF +P S 
Sbjct: 325 MLWTMGFVGFVASLKKQYLKQQFGLFCWVHMTLLVVVVSSHFIVNNILEGMIWFWVPASF 384

Query: 171 VICNDIFAYICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPA 230
           VICNDIFAY+ G   GRTPL KLSPKKT EGFVGAL  TII G  + +   R+DYMICPA
Sbjct: 385 VICNDIFAYVWGVTLGRTPLFKLSPKKTVEGFVGALFSTIILGVIYGTFFMRFDYMICPA 444

Query: 231 QDLTTTAFYGRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMAC 290
            DL  +A +    C+PNPVF+ + + + P L  L   L  + + ++  AP Q+H L +AC
Sbjct: 445 HDLGVSA-WSSFKCDPNPVFVWREWSMWPPLRILASSLLGRPVSTIPYAPYQFHCLALAC 503

Query: 291 FASLIAPFGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMS 350
           FASL+APFGGFFASG KRAF+IKDFGHSIPGHGG+TDRMDCQFLMG FS+++Y S ++  
Sbjct: 504 FASLVAPFGGFFASGFKRAFDIKDFGHSIPGHGGMTDRMDCQFLMGMFSYVWYSSLVRQM 563

Query: 351 SLTVGAVLQTIVNSLKPQDQIELFNRLKQYLLSQG 385
           ++TVG+VLQ IV+ L PQ+Q+ELF  LK+YL + G
Sbjct: 564 NVTVGSVLQMIVSGLSPQEQVELFYDLKRYLETSG 598



>gi|471571357|gb|EMR70179.1| putative phosphatidate cytidylyltransferase protein [Eutypa lata
           UCREL1]
          Length = 459

 Score =  450 bits (1158), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 224/384 (58%), Positives = 273/384 (71%), Gaps = 5/384 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K  N  VRT WTFVMI GFF  L  GHI++I  +  +Q + +KEVIAIA VPSK + L
Sbjct: 64  EKKKANFMVRTFWTFVMIGGFFGALFSGHIYIIACITAVQVVCFKEVIAIASVPSKARDL 123

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
              K+LNWY+L++T YFLYGES+IYYFK IV+VD  L P ATHHRFISF LY IGFVFFV
Sbjct: 124 KAIKSLNWYWLVTTMYFLYGESVIYYFKHIVLVDRVLSPLATHHRFISFSLYVIGFVFFV 183

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           ANL+  H KFQFT FAWTHM L ++V Q+HF +NN+FEG+IWF LP SLVI NDIFAYIC
Sbjct: 184 ANLRAGHLKFQFTNFAWTHMALYLIVVQAHFTMNNVFEGMIWFFLPASLVITNDIFAYIC 243

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGF GA +CT+++ F  + +L ++ Y ICP  DL    F G 
Sbjct: 244 GITFGRTQLIKLSPKKTVEGFAGAWLCTLVWAFLLTRVLMQYKYFICPVNDLGANVFTG- 302

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C+PNPVF P  Y L P     F  L  +D  S    P+Q+H + +A FASLIAPFGGF
Sbjct: 303 LECDPNPVFKPHTYTL-PLSGGGF--LPLRDF-SFTTEPMQFHAMALATFASLIAPFGGF 358

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGG+TDRMDCQF+MGCF+ MYY +FI      +G VL   
Sbjct: 359 FASGLKRTFKIKDFGDSIPGHGGMTDRMDCQFIMGCFAFMYYHNFIASHKAGLGDVLSLA 418

Query: 362 VNSLKPQDQIELFNRLKQYLLSQG 385
           +  L P++Q+EL   + + L +QG
Sbjct: 419 IRGLTPEEQVELVRGMVRVLENQG 442



>gi|408391718|gb|EKJ71087.1| hypothetical protein FPSE_08751 [Fusarium pseudograminearum CS3096]
          Length = 454

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 225/388 (57%), Positives = 286/388 (73%), Gaps = 6/388 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K  N   RT WTFVM   FF  L +GHI++I ++  IQ + +KEVIAIA+VPS+ + L
Sbjct: 59  EKKKANFITRTFWTFVMFALFFTALFMGHIYIITIITAIQIVSFKEVIAIANVPSRARSL 118

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
              K+LNWY+L +T YFLYGE++IYYFK I++VD  LLP ATHHRFISF+LY  GFVFFV
Sbjct: 119 RSTKSLNWYWLATTMYFLYGETVIYYFKHIILVDKVLLPLATHHRFISFILYVFGFVFFV 178

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+  HYKFQFT FAWTHM L ++V Q+HFI+NN+FEG+IWF LP +LVI NDIFAYIC
Sbjct: 179 TSLQAGHYKFQFTNFAWTHMALYLIVVQAHFIMNNVFEGMIWFFLPAALVITNDIFAYIC 238

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA I TIIF    S+++ R  + ICP  DL    F G 
Sbjct: 239 GIMFGRTQLIKLSPKKTVEGFVGAWIMTIIFAMILSNIMMRSKFFICPVNDLGANIFTG- 297

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C+PNPVF+P+ Y++ P L  L     F    S  IAP+Q H L +A FASLIAPFGGF
Sbjct: 298 LKCDPNPVFLPKTYEM-PELFFLPDTANF----SFTIAPMQIHALNLATFASLIAPFGGF 352

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGGITDRMDCQF+MG F++MY+ +F+ +  +++G+VL+T 
Sbjct: 353 FASGLKRTFKIKDFGDSIPGHGGITDRMDCQFIMGFFAYMYFHTFVAIHKVSLGSVLETA 412

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           + SL P++Q+EL   +  YL +QG++ E
Sbjct: 413 ITSLNPEEQVELVKSMGHYLRNQGIVTE 440



>gi|399170156|emb|CCE28929.1| probable CDS1-CDP-diacylglycerol synthase [Claviceps purpurea 20.1]
          Length = 441

 Score =  448 bits (1153), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 225/394 (57%), Positives = 286/394 (72%), Gaps = 17/394 (4%)

Query: 3   QKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKLP 62
           +K  N   R  WT  M+  FF  L +GHI+VI +V  IQ + +KEVIAIA+VPS+ + L 
Sbjct: 48  KKKANFMTRAFWTMCMLALFFSALFIGHIYVIIIVTAIQIISFKEVIAIANVPSRARSLR 107

Query: 63  WFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFVA 122
             K+LNWY+L +T YFLYGES+IYYFK IV+VD  LLP ATHHRFISF+LY  GFVFFVA
Sbjct: 108 STKSLNWYWLATTMYFLYGESVIYYFKHIVLVDKVLLPLATHHRFISFILYVFGFVFFVA 167

Query: 123 NLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYICG 182
           +L+  HYKFQFT FAWTHM L ++V Q+HF++NN+FEG+IWF LP +LVI NDIFAYICG
Sbjct: 168 SLQAGHYKFQFTNFAWTHMALYLIVVQAHFVMNNVFEGMIWFFLPAALVITNDIFAYICG 227

Query: 183 FFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGRL 242
             +GRT LIKLSPKKT EGFVGA I T++FG    +L+ R  Y ICP  DL  T F G L
Sbjct: 228 IAFGRTQLIKLSPKKTVEGFVGAWITTVLFGTILVNLMSRSKYFICPVNDLGATVFTG-L 286

Query: 243 TCEPNPVFI------PQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIA 296
            C+PNPVFI      P+ + L P L +L          S   AP+Q H  V+A FASLIA
Sbjct: 287 ECDPNPVFIARTYHMPELFFLPPKLANL----------SFTFAPIQIHTFVLASFASLIA 336

Query: 297 PFGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGA 356
           PFGGFFASG+KR+F +KDFG SIPGHGG+TDRMDCQF+MG F++MYY +FI +  +T+G+
Sbjct: 337 PFGGFFASGLKRSFKLKDFGDSIPGHGGMTDRMDCQFIMGFFAYMYYHTFISLHKVTMGS 396

Query: 357 VLQTIVNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           +L+T + SL P++Q+EL   + +YL +QG++ + 
Sbjct: 397 ILETAITSLSPEEQVELVKSMARYLGNQGVVSQN 430



>gi|384494136|gb|EIE84627.1| hypothetical protein RO3G_09337 [Rhizopus delemar RA 99-880]
          Length = 393

 Score =  448 bits (1153), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 220/387 (56%), Positives = 278/387 (71%), Gaps = 40/387 (10%)

Query: 3   QKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKLP 62
           +KWKN  VRT+ T +MI  FF+IL  GHIWVI +V+ I T+VY EV+ IA  P+K+    
Sbjct: 23  KKWKNWWVRTVTTLMMIGTFFMILASGHIWVILMVIAISTIVYNEVLQIAQGPAKDSSFK 82

Query: 63  WFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFVA 122
           WFKT++WYFL++T Y+LYGESIIYYF++IV+VDA LLPFATHHRFISF+LY I       
Sbjct: 83  WFKTMSWYFLVTTTYYLYGESIIYYFQSIVLVDAVLLPFATHHRFISFILYVI------- 135

Query: 123 NLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYICG 182
                                          +NNI EGLIWF +P SLVI NDIFAYICG
Sbjct: 136 -------------------------------VNNILEGLIWFFIPTSLVITNDIFAYICG 164

Query: 183 FFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGRL 242
           FFWGR  LI+LSPKKT EGFVGA ICT+IFGF  SSLL R++YMICP +DL+ +A +  +
Sbjct: 165 FFWGRHQLIQLSPKKTVEGFVGAWICTLIFGFLASSLLMRFNYMICPVKDLSMSA-WSDI 223

Query: 243 TCEP-NPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
            C+P NPVF    ++L   + S+ + L  K + ++WIAP+Q H LVMACFASLIAPFGGF
Sbjct: 224 NCDPVNPVFTAVPWNLPETVISIIKTLFHKQVTTIWIAPVQIHALVMACFASLIAPFGGF 283

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASGVKRAFN+KDFG SIPGHGG+TDRMDCQFLMG F+H+YYQSFIK + L VG +L ++
Sbjct: 284 FASGVKRAFNVKDFGQSIPGHGGMTDRMDCQFLMGFFAHIYYQSFIKTNHLNVGTILASV 343

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLE 388
           +N+L   +Q+EL  R+  Y ++QG+++
Sbjct: 344 INNLTLHEQLELLERILTYFINQGIMD 370



>gi|19113208|ref|NP_596416.1| phosphatidate cytidylyltransferase (predicted) [Schizosaccharomyces
           pombe 972h-]
 gi|74665248|sp|Q9P381.1|CDSH_SCHPO RecName: Full=Putative phosphatidate cytidylyltransferase; AltName:
           Full=CDP-DAG synthase; AltName: Full=CDP-DG synthase;
           AltName: Full=CDP-diacylglycerol synthase; Short=CDS;
           AltName: Full=CDP-diglyceride pyrophosphorylase;
           AltName: Full=CDP-diglyceride synthase; AltName:
           Full=CTP:phosphatidate cytidylyltransferase
 gi|9453829|emb|CAB99396.1| phosphatidate cytidylyltransferase (predicted) [Schizosaccharomyces
           pombe]
          Length = 439

 Score =  447 bits (1150), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 215/380 (56%), Positives = 278/380 (73%), Gaps = 6/380 (1%)

Query: 6   KNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKLPWFK 65
           +N   RTIWTF+++  FF  L +GH WV+ LV ++Q  VYKEVIAIA VPS+EK LPW +
Sbjct: 50  QNFITRTIWTFLLLGIFFTALAMGHFWVVLLVTIVQIGVYKEVIAIASVPSREKDLPWTR 109

Query: 66  TLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFVANLK 125
            +NWYFL++T Y+ YGESI  YF  + ++D+F+LP   HHRFISF+LY IGFV FVA+LK
Sbjct: 110 FINWYFLMTTLYYAYGESIYAYFHHLFIMDSFMLPLVLHHRFISFMLYIIGFVLFVASLK 169

Query: 126 KHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYICGFFW 185
           K +YKFQF+QF WTHMTLL+VV QSHF+INN+FEGL WF +PV  V+CND+FAY+CG  +
Sbjct: 170 KGNYKFQFSQFCWTHMTLLLVVGQSHFMINNLFEGLFWFFVPVCYVVCNDVFAYLCGKMF 229

Query: 186 GRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGRLTCE 245
           G+ PLI++SPKKT EGF+G  ICT++ G   S +L  + Y ICP +DL+T+AF G L C 
Sbjct: 230 GKHPLIQVSPKKTVEGFLGGWICTVVIGSLISYVLMHFKYFICPTRDLSTSAFSG-LNCT 288

Query: 246 PNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGFFASG 305
           PN VF+P  Y +           TF+   ++ +AP+ +H+ + A F+SLIAPFGGFFASG
Sbjct: 289 PNSVFLPHTYTIPAVFVD-----TFRLPETITLAPIYFHLAIFATFSSLIAPFGGFFASG 343

Query: 306 VKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTIVNSL 365
           +KRAF IKDFG SIPGHGG+TDRMDCQFL G F +MY+QSFI   S +V  +L T V SL
Sbjct: 344 LKRAFKIKDFGASIPGHGGLTDRMDCQFLNGVFVYMYFQSFIAEKSTSVADLLDTAVYSL 403

Query: 366 KPQDQIELFNRLKQYLLSQG 385
               Q++L   L+ YL+S G
Sbjct: 404 TTTQQVQLVEDLQNYLISHG 423



>gi|392569487|gb|EIW62660.1| phosphatidate cytidylyltransferase, partial [Trametes versicolor
           FP-101664 SS1]
          Length = 397

 Score =  447 bits (1149), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 223/393 (56%), Positives = 288/393 (73%), Gaps = 8/393 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKE--- 58
           ++K  +   RT+WTF+MI GF  +L +GH ++I LV++ QTLVY+EV A+  +  K+   
Sbjct: 3   AKKKASFVTRTLWTFIMIGGFITLLLMGHAYMIILVMLCQTLVYREVTALFSLRRKDVGD 62

Query: 59  ----KKLPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYC 114
                + PW KTLNWYF   T YFLYGESIIYYFK +V  +A L PFAT+HRF+SF LY 
Sbjct: 63  GNARGRDPWSKTLNWYFFAVTNYFLYGESIIYYFKHVVFSNAQLTPFATNHRFVSFTLYL 122

Query: 115 IGFVFFVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICN 174
           IGFV FV +LK+ + K QF  F W HM+LL++V  SHFI+NNI EGLIWF +P SLVICN
Sbjct: 123 IGFVGFVLSLKRGYLKQQFGLFCWVHMSLLLIVVSSHFIVNNILEGLIWFWVPASLVICN 182

Query: 175 DIFAYICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLT 234
           D+FAYI G   GRTPLIKLSPKKT EGFVGA   TIIFG  W S   R+DYMICP +DL 
Sbjct: 183 DVFAYIWGITVGRTPLIKLSPKKTVEGFVGAFFSTIIFGLLWGSYFSRFDYMICPMRDLG 242

Query: 235 TTAFYGRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASL 294
            TA+ G+ +CEPNPVF+ + + +   L++    L    + ++  AP   H+LV++CFASL
Sbjct: 243 VTAWSGQ-SCEPNPVFVWRDWQMPAPLSAPLSTLMGHQVTAIPYAPYHLHLLVLSCFASL 301

Query: 295 IAPFGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTV 354
           +APFGGFFASG KRAF+IKDFGHSIPGHGG+TDRMDCQFLMG F+++YY S I+ + +TV
Sbjct: 302 VAPFGGFFASGFKRAFDIKDFGHSIPGHGGMTDRMDCQFLMGVFTYVYYSSLIRDNHVTV 361

Query: 355 GAVLQTIVNSLKPQDQIELFNRLKQYLLSQGLL 387
           G++LQTIV+ L   +Q++L   LK+Y+ SQG++
Sbjct: 362 GSILQTIVSGLTVTEQLQLLADLKRYIESQGIV 394



>gi|330922448|ref|XP_003299842.1| hypothetical protein PTT_10924 [Pyrenophora teres f. teres 0-1]
 gi|311326308|gb|EFQ92051.1| hypothetical protein PTT_10924 [Pyrenophora teres f. teres 0-1]
          Length = 451

 Score =  446 bits (1148), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 217/389 (55%), Positives = 281/389 (72%), Gaps = 7/389 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K  N   RTIWT VMI GFF  LG GH++++  V  +Q + +KEVIAIA+VPSK + L
Sbjct: 58  EKKKANFITRTIWTLVMIGGFFWALGAGHVFIMIAVTAVQVISFKEVIAIANVPSKARSL 117

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWYFL    YFLYGES+IYYFK I+MVD  LLP ATHHRFISF+LY IGFVFFV
Sbjct: 118 RFTKSLNWYFLGIAMYFLYGESVIYYFKHILMVDRLLLPLATHHRFISFMLYIIGFVFFV 177

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K HYKFQFTQFAWTHM L ++V Q+HF+INNIFEG IWF+LPVS+V+ NDIFAY+C
Sbjct: 178 FSLQKGHYKFQFTQFAWTHMALFLIVGQAHFVINNIFEGFIWFILPVSMVVTNDIFAYLC 237

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRTPLI++SPKKTWEGF+GA   T+++G   +  L ++ Y ICP  DL    + G 
Sbjct: 238 GITFGRTPLIQISPKKTWEGFLGAWFFTVLWGIAVTHFLAQYKYFICPVNDLGANIWSG- 296

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNPVF+ + Y +  +   L    TF       I P+Q+HV+V+  FASLIAPFGGF
Sbjct: 297 LECRPNPVFVARNYSIPFFPEGLPIPSTFN------IMPVQFHVIVLGTFASLIAPFGGF 350

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGG+TDRMDCQF+MG  +  YY SFI +   TVG V++  
Sbjct: 351 FASGLKRTFKIKDFGDSIPGHGGMTDRMDCQFIMGSIAFFYYSSFIAVHHTTVGGVIEAA 410

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           +  L  ++Q+E+   + ++L++Q ++  +
Sbjct: 411 ITGLTYEEQMEVVKIMSKHLVNQDIISPK 439



>gi|213401867|ref|XP_002171706.1| phosphatidate cytidylyltransferase [Schizosaccharomyces japonicus
           yFS275]
 gi|211999753|gb|EEB05413.1| phosphatidate cytidylyltransferase [Schizosaccharomyces japonicus
           yFS275]
          Length = 442

 Score =  446 bits (1147), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 218/384 (56%), Positives = 284/384 (73%), Gaps = 8/384 (2%)

Query: 6   KNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKLPWFK 65
           +N   RT+WT +M+  FF+IL +G  W++ LV V+Q  VYKEVIAIA VPS+EK LP  K
Sbjct: 55  QNFIQRTVWTVIMLVFFFIILAMGPFWILVLVTVLQIGVYKEVIAIASVPSREKDLPLTK 114

Query: 66  TLNWY--FLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFVAN 123
            +NWY  FLI+T Y+ YGESI+ YF  +++VD++L+P ATHHRFISF+LY I FV FVA+
Sbjct: 115 VVNWYACFLITTLYYAYGESILRYFHHLLIVDSYLMPLATHHRFISFMLYTISFVLFVAS 174

Query: 124 LKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYICGF 183
           LKK +YKFQF+QF WTHMTLL+VV Q+HF+INNIFEGL WF +PV  V+CND+FAY+CG 
Sbjct: 175 LKKGNYKFQFSQFCWTHMTLLLVVGQAHFMINNIFEGLFWFFVPVCYVVCNDVFAYLCGK 234

Query: 184 FWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGRLT 243
            +G+ PLI+LSPKKT EGFVG  +CT++ G   S +L R +Y ICP +DL+ T F   + 
Sbjct: 235 VFGKHPLIQLSPKKTVEGFVGGWVCTVVVGSLLSFMLMRSNYFICPTRDLSATIF-SNIE 293

Query: 244 CEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGFFA 303
           C PN VF+P+ Y++   ++ LFR       R++ +AP+ +H+ V A FASL+APFGGFFA
Sbjct: 294 CVPNSVFLPKTYNVPLIMSRLFRF-----PRTLTLAPIYFHLAVFATFASLVAPFGGFFA 348

Query: 304 SGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTIVN 363
           SG+KRAF +KDFG SIPGHGG+TDR+DCQ L G F +MY QSFI      V  +L+  V 
Sbjct: 349 SGLKRAFKLKDFGDSIPGHGGLTDRVDCQLLNGAFVYMYVQSFISEKRGNVTELLEIAVT 408

Query: 364 SLKPQDQIELFNRLKQYLLSQGLL 387
           SL   +Q+ELF  LK+YL+SQG L
Sbjct: 409 SLTSAEQLELFEDLKEYLISQGKL 432



>gi|395325236|gb|EJF57662.1| phosphatidate cytidylyltransferase, partial [Dichomitus squalens
           LYAD-421 SS1]
          Length = 396

 Score =  445 bits (1144), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 221/390 (56%), Positives = 286/390 (73%), Gaps = 7/390 (1%)

Query: 3   QKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEK--- 59
           +K ++   RT+WTF+MI GF  +L +GH +++ LV++ QTLVY+EV A+  +  K+    
Sbjct: 4   KKRRSFLTRTLWTFIMIGGFITLLLMGHGYMVLLVMLCQTLVYREVTALFSLKRKDGQSN 63

Query: 60  ---KLPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIG 116
              + PW KTLNWYF   T YFLYGESIIYYFK +V  +A L PFAT+HRF+SF LY IG
Sbjct: 64  ISGRDPWSKTLNWYFFAVTNYFLYGESIIYYFKHVVFSNAQLTPFATNHRFVSFTLYLIG 123

Query: 117 FVFFVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDI 176
           FV FV +LK+ + K QF  F W HMTLL++V  SHFI+NNI EGLIWF +P SLVICND+
Sbjct: 124 FVGFVMSLKRGYLKQQFGMFCWVHMTLLLIVVSSHFIVNNILEGLIWFWVPASLVICNDV 183

Query: 177 FAYICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTT 236
           FAY+ G   GRTPLIKLSPKKT EGF+GA   T++FG  W +   R+ YMICP +DL  +
Sbjct: 184 FAYVWGITVGRTPLIKLSPKKTVEGFIGAFFSTLVFGLLWGTYFMRFYYMICPVEDLGVS 243

Query: 237 AFYGRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIA 296
           A+ G L C PNPVF+ + +++ P    +F      +  ++  AP Q+H+LV+ACFASL+A
Sbjct: 244 AWSGELHCTPNPVFVWRDWEM-PLPLRVFLAPVLGNRTTIPYAPYQFHLLVLACFASLVA 302

Query: 297 PFGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGA 356
           PFGGFFASG KRAF+IKDFGHSIPGHGG+TDRMDCQFLMG F+++YY S I+ + +TVG+
Sbjct: 303 PFGGFFASGFKRAFDIKDFGHSIPGHGGMTDRMDCQFLMGVFTYVYYSSLIRENHVTVGS 362

Query: 357 VLQTIVNSLKPQDQIELFNRLKQYLLSQGL 386
           VLQTIV+SL   +Q+EL   LK+YL  QG+
Sbjct: 363 VLQTIVSSLTVTEQLELMADLKRYLEGQGV 392



>gi|189197983|ref|XP_001935329.1| phosphatidate cytidylyltransferase 1 [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187981277|gb|EDU47903.1| phosphatidate cytidylyltransferase 1 [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 451

 Score =  445 bits (1144), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 216/389 (55%), Positives = 282/389 (72%), Gaps = 7/389 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K  N   RTIWT VMI GFF  LG GH++++  V  +Q + +KEVIAIA+VPSK + L
Sbjct: 58  EKKKANFITRTIWTLVMIGGFFWALGAGHVFIMIAVTAVQVISFKEVIAIANVPSKARSL 117

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWYFL    YFLYGES+IYYFK I+MVD  LLP ATHHRFISF+LY IGFVFFV
Sbjct: 118 RFTKSLNWYFLGIAMYFLYGESVIYYFKHILMVDRLLLPLATHHRFISFMLYIIGFVFFV 177

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K HYKFQFTQFAWTHM L ++V Q+HF+INNIFEG IWF+LPVS+V+ NDIFAY+C
Sbjct: 178 FSLQKGHYKFQFTQFAWTHMALFLIVGQAHFVINNIFEGFIWFILPVSMVVTNDIFAYLC 237

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRTPLI++SPKKTWEGF+GA   T+++G   +  L ++ Y ICP  DL    + G 
Sbjct: 238 GITFGRTPLIQISPKKTWEGFLGAWFFTVLWGIAITHFLAQYKYFICPVNDLGANIWSG- 296

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNPVF+ + Y + P+L            R+  I P+Q+HV+++  FASLIAPFGGF
Sbjct: 297 LECRPNPVFVARDYSI-PFLPE-----GLPIPRTFNIMPVQFHVIMLGTFASLIAPFGGF 350

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGG+TDRMDCQF+MG  +  YY SFI +   TVG V++  
Sbjct: 351 FASGLKRTFKIKDFGDSIPGHGGMTDRMDCQFIMGSIAFFYYSSFIAVHHTTVGGVIEAA 410

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           +  L  ++Q+E+   + ++L++Q ++  +
Sbjct: 411 ITGLTYEEQMEVVKIMSKHLVNQDIISPK 439



>gi|346973626|gb|EGY17078.1| phosphatidate cytidylyltransferase [Verticillium dahliae VdLs.17]
          Length = 468

 Score =  444 bits (1143), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 225/388 (57%), Positives = 284/388 (73%), Gaps = 7/388 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            ++  +  VRT WTFVM  GFF  L  GH+++I ++ VIQ + +KEVIAIA VPS+ ++L
Sbjct: 72  EKRKTDFKVRTFWTFVMFAGFFAALFSGHMYIICVMTVIQVVCFKEVIAIASVPSRARQL 131

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
              K+LNWY+L +T YFLYGES+IYYFK IV+VD  LLP ATHHRFISF LY  GFVFFV
Sbjct: 132 RPSKSLNWYWLATTMYFLYGESVIYYFKHIVLVDKVLLPLATHHRFISFFLYIFGFVFFV 191

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
             L   H+KFQFTQFAWTHM L ++V Q+HF++NN+FEGLIWF LP +LVI NDIFAYI 
Sbjct: 192 TTLHAGHFKFQFTQFAWTHMALYLIVVQAHFVMNNVFEGLIWFFLPAALVITNDIFAYIV 251

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA + TI+FG   +++L R+ Y ICPA DL +  F G 
Sbjct: 252 GMTFGRTQLIKLSPKKTVEGFVGAWVFTIVFGIILANILTRFSYFICPAHDLASNIFTG- 310

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNP F+P+ Y L P L  L       DI S  IAP+Q+H LV+  FASLIAPFGGF
Sbjct: 311 LECTPNPAFLPKTYKL-PDLVFLPPN---TDI-SFTIAPIQFHTLVLGTFASLIAPFGGF 365

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMS-SLTVGAVLQT 360
           FASG+KR F IKDFG SIPGHGG+TDRMDCQF+MG F+++Y+ +F+ ++   ++GAVL+ 
Sbjct: 366 FASGLKRTFKIKDFGDSIPGHGGMTDRMDCQFIMGFFTYIYFHTFVSLNKEASLGAVLEL 425

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
            +  L  ++Q EL   L +YL +QGL+ 
Sbjct: 426 AITGLTHEEQKELITGLGRYLSNQGLVN 453



>gi|452001384|gb|EMD93844.1| hypothetical protein COCHEDRAFT_1172061 [Bipolaris maydis C5]
 gi|477581599|gb|ENH98726.1| hypothetical protein COCC4DRAFT_155076 [Bipolaris maydis ATCC
           48331]
          Length = 456

 Score =  444 bits (1142), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 217/389 (55%), Positives = 286/389 (73%), Gaps = 7/389 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K  N   RTIWT VMI  FF  LG GH+++I +V  +Q + +KEVIAIA+VPSK + L
Sbjct: 63  EKKKANFITRTIWTLVMIAAFFWALGAGHLFIIIMVTAVQCISFKEVIAIANVPSKARSL 122

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWYFL +  YFLYGES+IYYFK I+MVD  LLP ATHHRFISF+LY IGF+FFV
Sbjct: 123 RFTKSLNWYFLGTAMYFLYGESVIYYFKHILMVDRLLLPLATHHRFISFMLYIIGFIFFV 182

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K HYKFQFTQFAW+HM L ++V Q+HF+INNIFEG IWF+LPVS+VI NDIFAY+C
Sbjct: 183 FSLQKGHYKFQFTQFAWSHMALFLIVGQAHFVINNIFEGFIWFILPVSMVITNDIFAYLC 242

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRTPLI++SPKKTWEGF+GA   T+++G   +  + ++ Y ICP  DL    + G 
Sbjct: 243 GITFGRTPLIQISPKKTWEGFLGAWFFTVLWGVAVTHFVSQYKYFICPVNDLGANIWSG- 301

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNPVF+ + Y + P+L      L F   R+  I P+Q+HV+++  FASLIAPFGGF
Sbjct: 302 LECRPNPVFVARDYTI-PFLP---EGLPFP--RTFNIMPVQFHVIMLGTFASLIAPFGGF 355

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGG+TDRMDCQF+MG  +  YY SFI +   TVG V+++ 
Sbjct: 356 FASGLKRTFKIKDFGDSIPGHGGMTDRMDCQFIMGSIAFFYYSSFIAVHHTTVGGVIESA 415

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           +  L  ++Q+E+   L ++L++Q ++  +
Sbjct: 416 ITGLSYEEQMEVVKILSKHLVNQDIISPK 444



>gi|451849161|gb|EMD62465.1| hypothetical protein COCSADRAFT_342754 [Bipolaris sorokiniana
           ND90Pr]
          Length = 456

 Score =  444 bits (1142), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 217/389 (55%), Positives = 286/389 (73%), Gaps = 7/389 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K  N   RTIWT VMI  FF  LG GH+++I +V  +Q + +KEVIAIA+VPSK + L
Sbjct: 63  EKKKANFITRTIWTLVMIAAFFWALGAGHLFIIIMVTAVQCISFKEVIAIANVPSKARSL 122

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWYFL +  YFLYGES+IYYFK I+MVD  LLP ATHHRFISF+LY IGF+FFV
Sbjct: 123 RFTKSLNWYFLGTAMYFLYGESVIYYFKHILMVDRLLLPLATHHRFISFMLYIIGFIFFV 182

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K HYKFQFTQFAW+HM L ++V Q+HF+INNIFEG IWF+LPVS+VI NDIFAY+C
Sbjct: 183 FSLQKGHYKFQFTQFAWSHMALFLIVGQAHFVINNIFEGFIWFILPVSMVITNDIFAYLC 242

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRTPLI++SPKKTWEGF+GA   T+++G   +  + ++ Y ICP  DL    + G 
Sbjct: 243 GITFGRTPLIQISPKKTWEGFLGAWFFTVLWGIAVTHFVSQYKYFICPVNDLGANIWSG- 301

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNPVF+ + Y + P+L      L F   R+  I P+Q+HV+++  FASLIAPFGGF
Sbjct: 302 LECRPNPVFVARDYTI-PFLP---EGLPFP--RTFNIMPVQFHVIMLGTFASLIAPFGGF 355

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGG+TDRMDCQF+MG  +  YY SFI +   TVG V+++ 
Sbjct: 356 FASGLKRTFKIKDFGDSIPGHGGMTDRMDCQFIMGSIAFFYYSSFIAVHHTTVGGVIESA 415

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           +  L  ++Q+E+   L ++L++Q ++  +
Sbjct: 416 ITGLTYEEQMEVVKILSKHLVNQDIISPK 444



>gi|501754677|emb|CCG81950.1| Phosphatidate cytidylyltransferase [Taphrina deformans PYCC 5710]
          Length = 417

 Score =  444 bits (1142), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 215/380 (56%), Positives = 282/380 (74%), Gaps = 2/380 (0%)

Query: 6   KNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKLPWFK 65
            N  +RT WT +MI G   +L  GH+W+I  + V+Q +++ E++AIA VP+KE ++PWFK
Sbjct: 39  SNAAIRTTWTAIMIGGLLALLAAGHLWIILFLTVVQVMIFNEILAIAAVPAKENQIPWFK 98

Query: 66  TLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFVANLK 125
            +NWYFL +T YF YGE+++YYFK IV+VDA LLPFATHHRFISF+LY IGFV+FV +L+
Sbjct: 99  AINWYFLATTLYFAYGETVVYYFKHIVLVDALLLPFATHHRFISFILYIIGFVWFVGSLQ 158

Query: 126 KHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYICGFFW 185
           K  Y+FQF+QF++THMTL++VV Q+HFIINN+ EG+ WF++P SLVI ND FAY+CG  +
Sbjct: 159 KGQYRFQFSQFSFTHMTLILVVGQAHFIINNLLEGIYWFLIPASLVIANDCFAYVCGKLF 218

Query: 186 GRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGRLTCE 245
           G+  L++LSPKKT EGF+GA +CT + G   S++  R DY ICPA DL    F G L CE
Sbjct: 219 GKHKLLELSPKKTVEGFLGAWVCTGVIGLIVSNVFMRSDYFICPATDLGANFFTG-LQCE 277

Query: 246 PNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGFFASG 305
           PNPVF+ + +DL P   +L   L+F   R + IAP+Q H++V++ FASLIAPFGGFFASG
Sbjct: 278 PNPVFLTRTFDLPPTFLNLHPLLSFLP-RHINIAPIQLHLMVLSTFASLIAPFGGFFASG 336

Query: 306 VKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTIVNSL 365
           +KRAF IKDFG SIPGHGG+TDRMDCQ L G F ++YYQSFI +   +VGA+L   V  L
Sbjct: 337 LKRAFKIKDFGDSIPGHGGMTDRMDCQILNGFFVYLYYQSFIAVKKESVGALLGAAVMGL 396

Query: 366 KPQDQIELFNRLKQYLLSQG 385
              D I L  +L  YL ++G
Sbjct: 397 SDDDIIILIQKLTSYLRNRG 416



>gi|336371392|gb|EGN99731.1| hypothetical protein SERLA73DRAFT_179897 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336384148|gb|EGO25296.1| hypothetical protein SERLADRAFT_465220 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 463

 Score =  443 bits (1140), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 223/396 (56%), Positives = 282/396 (71%), Gaps = 11/396 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAI---------- 51
           ++K +NM  RT+WTF+MI GF  +L +GH+++I LV++ QTLVY+EV A+          
Sbjct: 67  TKKRQNMLTRTLWTFIMIGGFIGLLLMGHVYMIILVMLCQTLVYREVTALFSLRNTAPES 126

Query: 52  AHVPSKEKKLPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFV 111
           + V +K KK PW KTLNWYF   T YFLYGESIIYYFK +V  DA LLPFAT+HR ISF 
Sbjct: 127 SDVETKGKKDPWSKTLNWYFFAVTNYFLYGESIIYYFKHVVFADAQLLPFATNHRIISFT 186

Query: 112 LYCIGFVFFVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLV 171
           LY IGF+ FV +LK+ + K QF  F W HM+LL++V  SHFI+NNI EGLIWF +P SLV
Sbjct: 187 LYTIGFMGFVMSLKRGYLKQQFGLFCWVHMSLLLIVVSSHFIVNNILEGLIWFWVPASLV 246

Query: 172 ICNDIFAYICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQ 231
           ICND+FAYI G   GRTPLIKLSPKKT EGFVGA   T+IFG  W S   R+DYMICP  
Sbjct: 247 ICNDVFAYIWGITLGRTPLIKLSPKKTVEGFVGAFFSTVIFGIIWGSYFMRFDYMICPVH 306

Query: 232 DLTTTAFYGRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACF 291
           DL   A +    C PNP+FI + + +   L      +    + ++   P Q+H+L M+ F
Sbjct: 307 DLGVDA-WSSGHCTPNPIFIWREWQIWAPLRVFISPILGNAVTTIPYVPYQFHLLCMSVF 365

Query: 292 ASLIAPFGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSS 351
           ASL+APFGGFFASG KRAFNIKDFGHSIPGHGG+TDRMDCQFLMG F+++YY S I+   
Sbjct: 366 ASLVAPFGGFFASGFKRAFNIKDFGHSIPGHGGMTDRMDCQFLMGVFTYVYYSSLIREHH 425

Query: 352 LTVGAVLQTIVNSLKPQDQIELFNRLKQYLLSQGLL 387
           +TVG++LQ IV+ L  ++Q+EL   L++YL  QG++
Sbjct: 426 VTVGSILQMIVSGLTMEEQLELMKDLRRYLQGQGIM 461



>gi|367046684|ref|XP_003653722.1| hypothetical protein THITE_2116289 [Thielavia terrestris NRRL 8126]
 gi|347000984|gb|AEO67386.1| hypothetical protein THITE_2116289 [Thielavia terrestris NRRL 8126]
          Length = 464

 Score =  442 bits (1137), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 218/386 (56%), Positives = 274/386 (70%), Gaps = 6/386 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K  N   RT WTFVMI GFF  L +GH++V+ ++  +Q + +KEVIAIA+VPS+ + L
Sbjct: 67  EKKKANFITRTFWTFVMIGGFFAALLMGHVYVLVIITAVQIVSFKEVIAIANVPSRARDL 126

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
              K+LNWY+L +T YFLYGES++YY K IV+VD  LLP ATHHRFISF+LY  GFVFFV
Sbjct: 127 RSTKSLNWYWLATTMYFLYGESVVYYLKHIVLVDKVLLPLATHHRFISFILYVFGFVFFV 186

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +LK  H KFQF+QFAWTHM L ++V Q+HFI+NN+ EGLIWF LP +LVI NDIFAY+C
Sbjct: 187 GSLKAGHLKFQFSQFAWTHMALFLIVVQAHFIMNNVLEGLIWFFLPAALVITNDIFAYVC 246

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA + T++FG   +SLL R  Y ICPA DL    F G 
Sbjct: 247 GITFGRTQLIKLSPKKTVEGFVGAWVMTVLFGVGLTSLLLRSKYFICPATDLGANVFTG- 305

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C+PNPVFIP+ Y   P        L      SV +AP+Q H    A FASLIAPFGGF
Sbjct: 306 LECDPNPVFIPRVYSTPPLFF-----LPAGYSLSVTMAPMQIHTFFWASFASLIAPFGGF 360

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGG+TDRMDCQF+MG F+ +YY +FI     +V  V++  
Sbjct: 361 FASGLKRTFKIKDFGDSIPGHGGMTDRMDCQFIMGLFAFIYYHTFIAFKRSSVSHVMELA 420

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLL 387
           +  L   +Q+E+   + +YL +QG++
Sbjct: 421 IMELTADEQLEVIKGVLKYLTNQGVV 446



>gi|367028714|ref|XP_003663641.1| hypothetical protein MYCTH_2134429 [Myceliophthora thermophila ATCC
           42464]
 gi|347010910|gb|AEO58396.1| hypothetical protein MYCTH_2134429 [Myceliophthora thermophila ATCC
           42464]
          Length = 463

 Score =  441 bits (1135), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 217/389 (55%), Positives = 277/389 (71%), Gaps = 6/389 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K  N   RT WTFVMI GFF  L +GH++V+ ++  +Q + +KEVIAIA+VPS+ + L
Sbjct: 66  EKKKANFITRTFWTFVMIGGFFAALFMGHVYVLVIITAVQIVSFKEVIAIANVPSRARDL 125

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
              K+LNWY+L +T YFLYGES++YY K IV+VD  LLP ATHHRFISF+LY  GFVFFV
Sbjct: 126 QSTKSLNWYWLATTMYFLYGESVVYYLKHIVLVDKVLLPLATHHRFISFILYVFGFVFFV 185

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +LK  H KFQF+QFAWTHM L ++V Q+HFI+NN+ EG+IWF LP +LVI NDIFAYIC
Sbjct: 186 GSLKTGHLKFQFSQFAWTHMALFLIVVQAHFIMNNVLEGMIWFFLPAALVITNDIFAYIC 245

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA I T++FG   ++LL R  Y ICPA +L    F G 
Sbjct: 246 GITFGRTQLIKLSPKKTVEGFVGAWIMTVLFGIILTNLLLRSKYFICPATNLGANIFTG- 304

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C+PNPVF+P+ Y   P L  L    T     S+ ++P+Q H    A FASLIAPFGGF
Sbjct: 305 LNCDPNPVFLPRTYS-TPQLFFLPPNYTI----SITMSPMQIHTFFWASFASLIAPFGGF 359

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGG+TDRMDCQF+MG F+ +YY +FI     +V  VL+  
Sbjct: 360 FASGLKRTFKIKDFGDSIPGHGGMTDRMDCQFIMGLFAFIYYHTFIAFKRSSVTHVLELA 419

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           +  L   +Q+E+   + +YL +QG+++  
Sbjct: 420 IMELSTDEQVEVIKGVLKYLTNQGVVKAE 448



>gi|482810990|gb|EOA87770.1| hypothetical protein SETTUDRAFT_168903 [Setosphaeria turcica Et28A]
          Length = 451

 Score =  441 bits (1134), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 213/389 (54%), Positives = 285/389 (73%), Gaps = 7/389 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K  N   RT WT VMI  FF  LG GH+++I +V  +Q + +KEVIAIA+VPSK + L
Sbjct: 58  EKKKANFITRTTWTLVMIGIFFWALGAGHLFIIIIVTAVQVICFKEVIAIANVPSKARSL 117

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWYFL +T YFLYGES+IYYFK I+MVD  LLP ATHHRFISF+LY IGF+FFV
Sbjct: 118 RFTKSLNWYFLGTTMYFLYGESVIYYFKHILMVDRLLLPLATHHRFISFMLYIIGFIFFV 177

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K HYKFQFTQFAWTHM L ++V Q+HF+INNIFEG IWF+LP S+VI NDIFAY+C
Sbjct: 178 FSLQKGHYKFQFTQFAWTHMALFLIVGQAHFVINNIFEGYIWFILPASMVITNDIFAYLC 237

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRTPLI++SPKKTWEGF+GA   T+++G   + ++ ++ Y ICP  DL    + G 
Sbjct: 238 GITFGRTPLIQISPKKTWEGFLGAWFFTVLWGIGVTHVVAQYKYFICPVNDLGANIWSG- 296

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNPVF+ + Y++ P++            R+  I P+Q+HV+++  FASL+APFGGF
Sbjct: 297 LECRPNPVFVARDYEI-PFIPE-----GLPIPRTFNIMPVQFHVIMLGTFASLVAPFGGF 350

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGG+TDRMDCQF+MG  +  YY SFI +   TVG V+++ 
Sbjct: 351 FASGLKRTFKIKDFGDSIPGHGGMTDRMDCQFIMGSIAFFYYSSFIAVHHTTVGGVIESA 410

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           +  L  ++Q+E+   L ++L++Q ++  +
Sbjct: 411 ITGLTYEEQMEVVKILSKHLVNQEIISPK 439



>gi|116197300|ref|XP_001224462.1| hypothetical protein CHGG_05248 [Chaetomium globosum CBS 148.51]
 gi|88181161|gb|EAQ88629.1| hypothetical protein CHGG_05248 [Chaetomium globosum CBS 148.51]
          Length = 462

 Score =  437 bits (1125), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 215/389 (55%), Positives = 276/389 (70%), Gaps = 6/389 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K  N   RT WTFVMI GFF  L +GH++++ ++  IQ + +KEVIAIA+VPS+ + L
Sbjct: 65  EKKKANFITRTFWTFVMIGGFFAALFMGHVYILVIITAIQIVSFKEVIAIANVPSRARDL 124

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
              K+LNWY+L +T YFLYGES++YY K IV+VD  LLP ATHHRFISF+LY  GFVFFV
Sbjct: 125 QSTKSLNWYWLATTMYFLYGESVVYYLKHIVLVDKVLLPLATHHRFISFILYVFGFVFFV 184

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +LK  H KFQF+QFAWTHM L ++V Q+HF++NN+ EG+IWF LP +LVI NDIFAYIC
Sbjct: 185 GSLKTGHLKFQFSQFAWTHMALFLIVVQAHFVMNNVLEGMIWFFLPAALVITNDIFAYIC 244

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA I T++FG   +++L R  Y ICPA +L    F G 
Sbjct: 245 GITFGRTQLIKLSPKKTVEGFVGAWIMTVLFGIVLTNILLRSQYFICPATNLGANIFSG- 303

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C+PNPVFIP+ Y   P L  L    T     SV  +P+Q H    A FASLIAPFGGF
Sbjct: 304 LDCDPNPVFIPRTYS-TPQLFFLPPNYTL----SVTTSPMQIHTFFWASFASLIAPFGGF 358

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGG+TDRMDCQF+MG F+ +YY +FI     +V  V++  
Sbjct: 359 FASGLKRTFKIKDFGDSIPGHGGMTDRMDCQFIMGLFAFIYYHTFIAFKRSSVTHVMELA 418

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           +  L   +Q+++   + +YL +QG+++  
Sbjct: 419 IMELTADEQLDVIKGVLKYLTNQGVVKPE 447



>gi|389740121|gb|EIM81313.1| hypothetical protein STEHIDRAFT_172281 [Stereum hirsutum FP-91666
           SS1]
          Length = 633

 Score =  437 bits (1123), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 219/392 (55%), Positives = 274/392 (69%), Gaps = 9/392 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAI------AHVP 55
            +K +N   RT+WT +MI GF  IL +GH +++ LV++ QTLVY+EV  +          
Sbjct: 240 EKKRQNALTRTVWTLIMIGGFLTILAMGHGYMVILVMLCQTLVYREVTRLFTLTGSKADA 299

Query: 56  SKEKKLPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCI 115
            K  K PW +TLNWYF + T YFLYGESIIYYFK +V  D+ LLPFAT+HR ISF LY I
Sbjct: 300 DKAGKDPWSQTLNWYFFVVTNYFLYGESIIYYFKHVVFADSNLLPFATNHRIISFTLYTI 359

Query: 116 GFVFFVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICND 175
           GF+ FV +LKK + K QF  F W HM+LL++V  SHFI+NNI EGLIW  +P SLVICND
Sbjct: 360 GFMGFVMSLKKGYLKQQFGLFCWVHMSLLLIVVSSHFIVNNILEGLIWLWVPASLVICND 419

Query: 176 IFAYICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTT 235
           IFAYI G   GRTPLIKLSPKKT EGFVGA + TI+F   W +   R++YMICP  DL  
Sbjct: 420 IFAYIWGITLGRTPLIKLSPKKTVEGFVGAFLSTIVFAILWGTYFARFNYMICPVHDLGV 479

Query: 236 TAFYGRLTCEPNPVFIPQRYDL-NPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASL 294
              +  + C PNPVF+ + + +  P   SL   L  + I ++   P Q H+  MACFASL
Sbjct: 480 N-IWSDMQCTPNPVFVWRDWQIWKPVAASLSTFLR-RQITTIPYTPYQIHLFFMACFASL 537

Query: 295 IAPFGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTV 354
           +APFGGFFASG KRAFNIKDFGHSIPGHGG+TDRMDCQFLMG F ++Y+ S I+   +TV
Sbjct: 538 VAPFGGFFASGFKRAFNIKDFGHSIPGHGGMTDRMDCQFLMGVFVYVYHSSLIREHHVTV 597

Query: 355 GAVLQTIVNSLKPQDQIELFNRLKQYLLSQGL 386
           G+VLQTIV+ L  ++Q+EL   +K+YL  QG+
Sbjct: 598 GSVLQTIVSGLSTEEQLELLRDMKRYLEGQGI 629



>gi|343427468|emb|CBQ70995.1| related to CDS1-CDP-diacylglycerol synthase [Sporisorium reilianum
           SRZ2]
          Length = 640

 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 220/427 (51%), Positives = 285/427 (66%), Gaps = 46/427 (10%)

Query: 5   WKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSK------- 57
           WK +  RT++T +MI GF  +L LGH ++I LV++ QTLVY+EV+A+ ++P +       
Sbjct: 213 WKKIYERTLYTLIMIAGFIGLLLLGHPYMILLVMISQTLVYREVVALFNIPGRPSVTGGG 272

Query: 58  --------------------------------EKKLP------WFKTLNWYFLISTYYFL 79
                                           +K+L       W KTL+WYF + T YFL
Sbjct: 273 GGGGGGRSSRMSSAPTSAAISEVEDDDEEERIQKRLEGRRDQLWSKTLSWYFFVVTNYFL 332

Query: 80  YGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFVANLKKHHYKFQFTQFAWT 139
           YGESIIYYFK IV VDA+ +PFA HHRF+SF+LY  GF+ FV+NLK+ + K QF  F W 
Sbjct: 333 YGESIIYYFKHIVFVDAYFIPFARHHRFLSFMLYVFGFMAFVSNLKRRNLKHQFGLFCWV 392

Query: 140 HMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYICGFFWGRTPLIKLSPKKTW 199
           HM+LL++V  SHFI+NNI EGLIW  +P SLV+CND+FAYICG  +G+TPLI LSPKKT 
Sbjct: 393 HMSLLLIVFSSHFIVNNILEGLIWLWVPASLVVCNDVFAYICGMTFGKTPLIDLSPKKTV 452

Query: 200 EGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGRLTCEPNPVFIPQRYDLNP 259
           EGFVGAL+ T IF + W++  +R++YMICPA  L   AF   ++CE NPVF      L P
Sbjct: 453 EGFVGALVITEIFAYGWATFFQRFNYMICPAVSLGMNAF-KEVSCEVNPVFHWHYLSLPP 511

Query: 260 WLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGFFASGVKRAFNIKDFGHSI 319
            + SL   +    + ++   P Q H LVMA FASL+APFGGFFASG KRAFNIKDFG SI
Sbjct: 512 AIASLASSVVGHRVSALPWTPFQLHALVMASFASLVAPFGGFFASGFKRAFNIKDFGDSI 571

Query: 320 PGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTIVNSLKPQDQIELFNRLKQ 379
           PGHGG+TDR DCQFLMG FS++YY S I+   +TVG+VLQT+V  L  +DQ+EL+N + +
Sbjct: 572 PGHGGLTDRFDCQFLMGLFSYVYYSSLIREHHVTVGSVLQTVVTQLTLEDQLELYNEISR 631

Query: 380 YLLSQGL 386
           YL+ QG+
Sbjct: 632 YLVGQGI 638



>gi|389645224|ref|XP_003720244.1| phosphatidate cytidylyltransferase [Magnaporthe oryzae 70-15]
 gi|351640013|gb|EHA47877.1| phosphatidate cytidylyltransferase [Magnaporthe oryzae 70-15]
 gi|440470720|gb|ELQ39780.1| phosphatidate cytidylyltransferase [Magnaporthe oryzae Y34]
 gi|440478958|gb|ELQ59755.1| phosphatidate cytidylyltransferase [Magnaporthe oryzae P131]
          Length = 458

 Score =  436 bits (1121), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 219/388 (56%), Positives = 281/388 (72%), Gaps = 9/388 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K  N   RT+WTFVMI  FF  L +GHI++I ++  IQ + +KEVIAIA+VPSK + L
Sbjct: 62  EKKKANFITRTLWTFVMIAIFFGALFMGHIYIILIITAIQIISFKEVIAIANVPSKARSL 121

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
              K+LNWY+L ST YFLYGES+IYYFK IV+VD  LLP ATHHRFISF+LY  GFVFFV
Sbjct: 122 SSAKSLNWYWLASTMYFLYGESVIYYFKHIVLVDKVLLPLATHHRFISFILYVFGFVFFV 181

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+  HYKFQFT FAWTHM L ++V Q+HF++NNIFEG+IWF LP +LVI NDI+AYIC
Sbjct: 182 MSLQAGHYKFQFTNFAWTHMALYLIVVQAHFVMNNIFEGMIWFFLPAALVITNDIWAYIC 241

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA + T++FG   +  L R  Y ICP  DL    F G 
Sbjct: 242 GITFGRTQLIKLSPKKTVEGFVGAWVMTVLFGILLTHFLTRSKYFICPVNDLGANVFTG- 300

Query: 242 LTCEPNPVFIPQRYDLNP--WLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFG 299
           L+C+PNP F+P  + +    +L   F +L      S+ +AP+Q H L+++ FASLIAPFG
Sbjct: 301 LSCDPNPAFLPTTWTMPDFVFLPRDFGKL------SITMAPVQLHTLILSTFASLIAPFG 354

Query: 300 GFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQ 359
           GFFASG+KR F IKDFG SIPGHGG+TDRMDCQF MG F+++YY +FI    + +G +++
Sbjct: 355 GFFASGLKRTFKIKDFGDSIPGHGGMTDRMDCQFTMGFFTYVYYHTFIATHKMGLGGIME 414

Query: 360 TIVNSLKPQDQIELFNRLKQYLLSQGLL 387
             +  L P +QIEL   + +YL +QG++
Sbjct: 415 DAITGLTPDEQIELIRGMGRYLANQGIV 442



>gi|409045207|gb|EKM54688.1| hypothetical protein PHACADRAFT_258698 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 625

 Score =  436 bits (1120), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 211/391 (53%), Positives = 279/391 (71%), Gaps = 7/391 (1%)

Query: 3   QKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAI---AHVPSKEK 59
           +K ++   RT+WTF+MI GF  +L +GH+++I LV + Q LVY+EV A+      P  E+
Sbjct: 231 KKRQSFLTRTLWTFIMIGGFIALLLMGHVYMIVLVFMCQMLVYREVTALFSLKRKPQDEE 290

Query: 60  KL----PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCI 115
           +     PW KTLNWYF     Y+LYGE+IIYYFK +V  DA L+ FAT+HRF SF LY +
Sbjct: 291 EANGRDPWSKTLNWYFFAVVNYYLYGETIIYYFKHVVFSDAQLIGFATNHRFTSFSLYTL 350

Query: 116 GFVFFVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICND 175
           GFV FV +LK+ + K QF  F W HMTL+++V  SHFI+NNI EG+IWF +P SLVICND
Sbjct: 351 GFVGFVLSLKRGYLKQQFGLFCWVHMTLMLIVVSSHFIVNNILEGMIWFFVPASLVICND 410

Query: 176 IFAYICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTT 235
           +FAY+ G   GRTPLIKLSPKKT EGFVGA   T+IFG  W +   +++YM CP +DL  
Sbjct: 411 VFAYVWGITVGRTPLIKLSPKKTVEGFVGAFFSTVIFGIAWGTYFAQFEYMTCPVRDLGA 470

Query: 236 TAFYGRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLI 295
           +AF   + C PNPVF+ + + +   L++    +  + + SV   P Q+HVL +A FASL+
Sbjct: 471 SAFDSVVACTPNPVFVWREWVIPGPLSAFLSTVLGRSVSSVPYTPYQYHVLFLATFASLV 530

Query: 296 APFGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVG 355
           APFGGFFASG KRAF+IKDFGHSIPGHGG+TDRMDCQFLMG F+++YY S I+   +TVG
Sbjct: 531 APFGGFFASGFKRAFDIKDFGHSIPGHGGMTDRMDCQFLMGVFTYVYYSSLIRQHHVTVG 590

Query: 356 AVLQTIVNSLKPQDQIELFNRLKQYLLSQGL 386
           ++LQ IV+ L  ++Q+EL + LK+YL  QG+
Sbjct: 591 SILQMIVSGLTIEEQLELMSDLKRYLEGQGV 621



>gi|392594022|gb|EIW83347.1| phosphatidate cytidylyltransferase [Coniophora puteana RWD-64-598
           SS2]
          Length = 419

 Score =  434 bits (1116), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 217/396 (54%), Positives = 280/396 (70%), Gaps = 12/396 (3%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAI---------- 51
           ++K +N+  RT+WTF+MI GF  ++ +GH+++I LV++ QTLVY+EV A+          
Sbjct: 23  TKKRQNILTRTLWTFIMIGGFITLMLMGHVYMIILVMLCQTLVYREVTALFSLKRVAPDS 82

Query: 52  -AHVPSKEKKLPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISF 110
              V +K K+ PW KTLNWYF     YFLYGESIIYYFK +V VD  LLPFA +HR ISF
Sbjct: 83  TEIVETKAKRDPWSKTLNWYFWAVANYFLYGESIIYYFKHVVFVDGQLLPFAMNHRIISF 142

Query: 111 VLYCIGFVFFVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSL 170
            LY IGF+ FV +LK+ + K QF  F W HM+LL++V  SHFI+NNI EGLIWF +P SL
Sbjct: 143 TLYTIGFMGFVMSLKRGYLKQQFGLFCWVHMSLLLIVVSSHFIVNNILEGLIWFFVPASL 202

Query: 171 VICNDIFAYICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPA 230
           VICND+FAY+ G   GRTPLIKLSPKKT EGFVGA   T++F   W +   R+DYMICP 
Sbjct: 203 VICNDVFAYVWGMTIGRTPLIKLSPKKTVEGFVGAFWSTLLFSLAWGTYFMRFDYMICPV 262

Query: 231 QDLTTTAFYGRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMAC 290
            DL  +A +  + C PNPVF+ Q +++   L     ++  + I  +   P Q H++V A 
Sbjct: 263 HDLGVSA-WSAVKCVPNPVFVWQEWEIWAPLRVFLSQVLGRSITHIPYVPYQLHLIVFAI 321

Query: 291 FASLIAPFGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMS 350
           FASL+APFGGFFASG KRAFNIKDFGHSIPGHGG+TDRMDCQFLMG F+++YY S I+  
Sbjct: 322 FASLVAPFGGFFASGFKRAFNIKDFGHSIPGHGGMTDRMDCQFLMGVFTYVYYSSLIREH 381

Query: 351 SLTVGAVLQTIVNSLKPQDQIELFNRLKQYLLSQGL 386
            +TVG+VLQ +V+ L   +Q+ELFN L +YL  +G+
Sbjct: 382 HITVGSVLQQVVSGLTLNEQVELFNDLARYLQGRGI 417



>gi|388582772|gb|EIM23076.1| phosphatidate cytidylyltransferase [Wallemia sebi CBS 633.66]
          Length = 486

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 215/392 (54%), Positives = 273/392 (69%), Gaps = 8/392 (2%)

Query: 4   KWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAI-------AHVPS 56
           K + +  RTIWTF+M+FGFF  L  GH W+I LV++ Q+L Y+EV A+            
Sbjct: 96  KKQAIVTRTIWTFIMVFGFFGCLMAGHAWLIMLVMLCQSLSYREVTALFGFKTEYGLKAE 155

Query: 57  KEKKLPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIG 116
             ++  W   LNWYF I T YFLYGESIIYY K I+  D + +  A HHRFISF+LY IG
Sbjct: 156 NSERDRWSTILNWYFFIVTNYFLYGESIIYYLKHIIFADVYFIQLAKHHRFISFMLYVIG 215

Query: 117 FVFFVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDI 176
           F+ FVANLK+   K QF  F W HM+LL++V  SHFI+NNI EG+IWF +P SLVICNDI
Sbjct: 216 FMGFVANLKRTFLKRQFVLFCWVHMSLLLIVLSSHFIVNNILEGIIWFWVPASLVICNDI 275

Query: 177 FAYICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTT 236
           FAY+ G  +GRTPLI LSPKKT EGFVG  I T++F + W +L ++W YMICP  DL T+
Sbjct: 276 FAYVFGMAFGRTPLIALSPKKTVEGFVGGGIATVLFAWGWGTLFQQWKYMICPVHDLGTS 335

Query: 237 AFYGRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIA 296
            F   + C PNPVFI + +++   ++ L   L  ++I  +   P Q H L MA FAS++A
Sbjct: 336 IF-SNVDCVPNPVFIWRDFEIPSVISGLLSSLAQQEITKIPYTPFQIHCLFMATFASVVA 394

Query: 297 PFGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGA 356
           PFGGFFASG KRAF+IKDFG SIPGHGG+TDRMDCQFLMG F+++YY S I+ + ++ G 
Sbjct: 395 PFGGFFASGFKRAFDIKDFGDSIPGHGGLTDRMDCQFLMGLFAYVYYSSLIREAHVSSGQ 454

Query: 357 VLQTIVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           VLQTIV+SL+P +QIELF   K+YL SQ  L 
Sbjct: 455 VLQTIVSSLRPDEQIELFRDFKKYLESQNYLS 486



>gi|429853027|gb|ELA28128.1| phosphatidate cytidylyltransferase [Colletotrichum gloeosporioides
           Nara gc5]
          Length = 744

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 218/385 (56%), Positives = 280/385 (72%), Gaps = 4/385 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K  N   RT WT VM  GFF  L +GH+++I ++  IQ + +KEVIAIA VPS+ ++L
Sbjct: 19  EKKKANFLTRTFWTLVMFVGFFAALVMGHLYIICIITAIQIISFKEVIAIASVPSRARQL 78

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
              K+LNWY+L +T YFLYGE++IYYFK IV+VD  LLP ATHHRFISF+LY  GFVFFV
Sbjct: 79  RSSKSLNWYWLATTMYFLYGETVIYYFKHIVLVDKVLLPLATHHRFISFILYIFGFVFFV 138

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+  HYKFQFTQFAWTHM L ++V Q+HFI+NN+FEG+IWF LP ++VI NDI+AY+ 
Sbjct: 139 TSLQAGHYKFQFTQFAWTHMALYLIVVQAHFIMNNVFEGMIWFFLPAAMVITNDIWAYLV 198

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA I TI+FG   ++LL R  + ICP  DL    F G 
Sbjct: 199 GITFGRTQLIKLSPKKTVEGFVGAWIMTIVFGMLLTNLLMRSSFFICPVTDLAANIFTG- 257

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C  NPVF  + Y L P     F      +  S+ +AP+Q+H LV+A FASLIAPFGGF
Sbjct: 258 LECTRNPVFNLKTYRLPPL---FFLPPNMNESLSLTMAPVQFHTLVLATFASLIAPFGGF 314

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGG+TDRMDCQF+MG F++MYY SFI ++  ++G+V++  
Sbjct: 315 FASGLKRTFKIKDFGDSIPGHGGMTDRMDCQFIMGFFTYMYYHSFIAINKASLGSVMEMA 374

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGL 386
           V  L  ++Q+EL   + +YL +QG+
Sbjct: 375 VTGLTVEEQLELVRGMGRYLSNQGV 399



>gi|449546688|gb|EMD37657.1| hypothetical protein CERSUDRAFT_114302, partial [Ceriporiopsis
           subvermispora B]
          Length = 623

 Score =  432 bits (1110), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 212/392 (54%), Positives = 277/392 (70%), Gaps = 6/392 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEK-- 59
            +K +N+  RT+WTF+MI  F L+L +GH+++I LV++ QT+VY+EV ++  +  +    
Sbjct: 229 EKKRQNILTRTLWTFIMIGVFILLLLMGHVYMIALVMLCQTMVYREVTSLFSLKKRGSGE 288

Query: 60  ----KLPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCI 115
               + PW KTLNWYF   T YFLYGESIIYYFK +V  D     FA +HR ISF LY I
Sbjct: 289 EVAGRDPWSKTLNWYFFAVTNYFLYGESIIYYFKHVVFSDPQRTLFAMNHRIISFTLYTI 348

Query: 116 GFVFFVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICND 175
           GF+ FV +LK+ + K QF  F W HMTLL++V  SHFI+NNI EGLIWF +P SLVICND
Sbjct: 349 GFMGFVMSLKRGYLKQQFGLFCWVHMTLLMIVVSSHFIVNNILEGLIWFWVPASLVICND 408

Query: 176 IFAYICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTT 235
           +FAYI G   GRTPLI LSPKKT EGFVGA   T++FG  W +   R+ YMICP QDL  
Sbjct: 409 VFAYIWGITIGRTPLIALSPKKTVEGFVGAFFSTLVFGVLWGTWFMRYQYMICPVQDLGV 468

Query: 236 TAFYGRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLI 295
           +A+ G + CEPNP F+ +  ++ P +++    L  + + ++  AP   H+L M+CFASL+
Sbjct: 469 SAWSGLVKCEPNPAFVWREANIWPPVSTALSTLLGRTVTTIPYAPFHLHLLFMSCFASLV 528

Query: 296 APFGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVG 355
           APFGGFFASG KRAF IKDFGHSIPGHGG+TDRMDCQFLMG F+++YY S I+ + ++VG
Sbjct: 529 APFGGFFASGFKRAFGIKDFGHSIPGHGGMTDRMDCQFLMGVFTYVYYSSLIRQNHVSVG 588

Query: 356 AVLQTIVNSLKPQDQIELFNRLKQYLLSQGLL 387
            +LQ IV+ L  Q Q+EL   LK+YL  QG++
Sbjct: 589 ELLQQIVSGLTVQQQLELVADLKRYLEGQGIV 620



>gi|426197546|gb|EKV47473.1| hypothetical protein AGABI2DRAFT_70290 [Agaricus bisporus var.
           bisporus H97]
          Length = 470

 Score =  431 bits (1109), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 219/395 (55%), Positives = 276/395 (69%), Gaps = 11/395 (2%)

Query: 3   QKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKE---- 58
           +K +N   RTIWT +MI GF  +L +GH++++ LV+V QT+ Y+EV A+  + + E    
Sbjct: 75  KKRQNALTRTIWTLIMIGGFIGLLLMGHVYMMILVMVCQTVAYREVTALFGLATTELSTQ 134

Query: 59  ------KKLPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVL 112
                  K PW KTLNWYF   T YFLYGESIIYYFK +V  D  L+PF T+HR ISF L
Sbjct: 135 DKQSLKDKDPWSKTLNWYFFAVTNYFLYGESIIYYFKHVVFADPQLVPFITNHRMISFTL 194

Query: 113 YCIGFVFFVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVI 172
           Y IGF+ FV +LKK   K QF  F W HMTLL++V  SHF++NNI EGLIWF +P SLVI
Sbjct: 195 YVIGFMGFVMSLKKGFLKQQFGLFCWVHMTLLMIVVSSHFVVNNILEGLIWFWVPASLVI 254

Query: 173 CNDIFAYICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQD 232
           CND+FAYI G   GRTPLI+LSPKKT EGFVGA   T+IF  FW +L  R++YMICP  D
Sbjct: 255 CNDVFAYIWGITIGRTPLIQLSPKKTVEGFVGAFFSTLIFALFWGTLFMRFNYMICPVHD 314

Query: 233 LTTTAFYGRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFA 292
           L  +A +  + C+PNPVF+ +   L    +     L  + I ++  AP   H+L+MACFA
Sbjct: 315 LGISA-WNSIQCKPNPVFVWRELPLWHPFSIFVSTLLGRTITAIPYAPYHLHLLLMACFA 373

Query: 293 SLIAPFGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSL 352
           SL+APFGGFFASG KRAF IKDFGHSIPGHGG+TDRMDCQFLMG F+++YY S I+   +
Sbjct: 374 SLVAPFGGFFASGFKRAFKIKDFGHSIPGHGGMTDRMDCQFLMGVFTYVYYSSLIREHHV 433

Query: 353 TVGAVLQTIVNSLKPQDQIELFNRLKQYLLSQGLL 387
           TVG +LQTIV+ L   +QIEL   L +YL +QG++
Sbjct: 434 TVGTILQTIVSGLTVDEQIELVADLHRYLETQGIV 468



>gi|443895040|dbj|GAC72386.1| CDP-diacylglycerol synthase [Pseudozyma antarctica T-34]
          Length = 654

 Score =  431 bits (1108), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 219/418 (52%), Positives = 281/418 (67%), Gaps = 40/418 (9%)

Query: 11  RTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVP-----------SKEK 59
           RT++TF+MI  F  +L LGH ++I LV+V QTL+Y+E++A+ ++P           S+  
Sbjct: 236 RTLFTFIMIGAFIALLLLGHPYMILLVMVSQTLMYREIVALFNIPGRPSVTGGGRSSRMS 295

Query: 60  KLP----------------------------WFKTLNWYFLISTYYFLYGESIIYYFKAI 91
             P                            W K+L+WYF     YFLYGESIIYYFK I
Sbjct: 296 SAPTSAATSEVDDDEEDERIRRRLEGRREELWSKSLSWYFFAVANYFLYGESIIYYFKHI 355

Query: 92  VMVDAFLLPFATHHRFISFVLYCIGFVFFVANLKKHHYKFQFTQFAWTHMTLLIVVCQSH 151
           V VDA+ +PFA HHRF+SF+LY  GF+ FV+NLK+ + K QF  F W HM+LL++V  SH
Sbjct: 356 VFVDAYFIPFARHHRFLSFMLYVFGFMAFVSNLKRRNLKHQFGLFCWVHMSLLLIVFSSH 415

Query: 152 FIINNIFEGLIWFVLPVSLVICNDIFAYICGFFWGRTPLIKLSPKKTWEGFVGALICTII 211
           FI+NNI EGLIWF +P SLVICND+FAYICG   GRTPLI LSPKKT EGFVGAL+ T +
Sbjct: 416 FIVNNILEGLIWFWVPASLVICNDVFAYICGMTLGRTPLIDLSPKKTVEGFVGALVVTEV 475

Query: 212 FGFFWSSLLRRWDYMICPAQDLTTTAFYGRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFK 271
           F + W++L +R++YMICPA  L   AF   +TCEPNPVF      L P ++SL   +  +
Sbjct: 476 FAYGWATLFQRFNYMICPAVSLGMNAF-KEITCEPNPVFHWHYLSLPPAVSSLASSVVGQ 534

Query: 272 DIRSVWIAPLQWHVLVMACFASLIAPFGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDC 331
            + ++     Q H LVMA FASL+APFGGFFASG KRAFNIKDFG SIPGHGG+TDR DC
Sbjct: 535 RVSALPWTYFQLHALVMAAFASLVAPFGGFFASGFKRAFNIKDFGDSIPGHGGLTDRFDC 594

Query: 332 QFLMGCFSHMYYQSFIKMSSLTVGAVLQTIVNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           QFLMG FS++YY S I+   +TVG+VLQT+V  L   DQ+EL++ + +YL+ QG L +
Sbjct: 595 QFLMGLFSYVYYSSLIREHHVTVGSVLQTVVTQLTLDDQLELYSEISRYLVGQGKLPK 652



>gi|505760636|gb|EOR04701.1| Putative phosphatidate cytidylyltransferase [Wallemia ichthyophaga
           EXF-994]
          Length = 524

 Score =  431 bits (1108), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 212/393 (53%), Positives = 277/393 (70%), Gaps = 10/393 (2%)

Query: 4   KWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAI--------AHVP 55
           K + +  RTIWTF+M+FGFF  L  GH W+I LV++ Q+L Y+EV A+            
Sbjct: 134 KKQAIVTRTIWTFIMVFGFFGCLMAGHAWLIMLVMLCQSLSYREVTALFGFKTEYGVRAK 193

Query: 56  SKEKKLPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCI 115
           + EK   W   LNWYF + T YFLYGESIIYY K I+  D + +  A HHRFISF+LY I
Sbjct: 194 NSEKDR-WSTILNWYFFVVTNYFLYGESIIYYLKHIIFADVYFIQLAKHHRFISFMLYII 252

Query: 116 GFVFFVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICND 175
           GF+ FVANLK+   K QF  F W HM+LL++V  SHFI+NNI EG+IWF +P SLVICND
Sbjct: 253 GFMGFVANLKRSFLKRQFVLFCWVHMSLLLIVLSSHFIVNNILEGIIWFWVPASLVICND 312

Query: 176 IFAYICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTT 235
           IFAY+ G  +G+TPLI LSPKKT EGF+G  I T++F + W ++ ++W YMICP  DL T
Sbjct: 313 IFAYVFGMLFGKTPLIALSPKKTVEGFIGGGIATVLFAWGWGTIFQQWKYMICPVHDLGT 372

Query: 236 TAFYGRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLI 295
           + F  ++ C PNPVFI + +++   +++L   +T +DI  +   P Q H L MA FAS++
Sbjct: 373 SIF-SQVECVPNPVFIWREFEIPSMISALLSTMTQRDITIIPYTPFQIHCLFMATFASVV 431

Query: 296 APFGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVG 355
           APFGGFFASG KRAF+IKDFG SIPGHGG+TDRMDCQFLMG F+++YY S I+ + ++ G
Sbjct: 432 APFGGFFASGFKRAFDIKDFGDSIPGHGGLTDRMDCQFLMGLFAYVYYSSLIREAHVSAG 491

Query: 356 AVLQTIVNSLKPQDQIELFNRLKQYLLSQGLLE 388
            VLQTIV+SL+  +Q+ELF+  K+YL SQ  L 
Sbjct: 492 QVLQTIVSSLRADEQLELFSDFKKYLESQNYLS 524



>gi|409080632|gb|EKM80992.1| hypothetical protein AGABI1DRAFT_38024 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 422

 Score =  429 bits (1102), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 218/395 (55%), Positives = 274/395 (69%), Gaps = 11/395 (2%)

Query: 3   QKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKE---- 58
           +K +N   RTIWT +MI GF  +L +GH++++ LV+V QT+ Y+EV A+  + + E    
Sbjct: 27  KKRQNALTRTIWTLIMIGGFIGLLLMGHVYMMILVMVCQTVAYREVTALFGLATTELSTQ 86

Query: 59  ------KKLPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVL 112
                  K PW KTLNWYF   T YFLYGESIIYYFK +V  D  L+PF T+HR ISF L
Sbjct: 87  DKQSLKDKDPWSKTLNWYFFAVTNYFLYGESIIYYFKHVVFADPQLVPFITNHRMISFTL 146

Query: 113 YCIGFVFFVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVI 172
           Y IGF+ FV +LKK   K QF  F W HMTLL++V  SHF++NNI EGLIWF +P SLVI
Sbjct: 147 YVIGFMGFVMSLKKGFLKQQFGLFCWVHMTLLMIVVSSHFVVNNILEGLIWFWVPASLVI 206

Query: 173 CNDIFAYICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQD 232
           CND+FAYI G   GRTPLI+LSPKKT EGFVGA   T++F  FW +L  R++YMICP  D
Sbjct: 207 CNDVFAYIWGITIGRTPLIQLSPKKTVEGFVGAFFSTLVFALFWGTLFMRFNYMICPVHD 266

Query: 233 LTTTAFYGRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFA 292
           L  +A +    C+PNPVF+ +   L          L  + I ++  AP   H+L+MACFA
Sbjct: 267 LGISA-WNSTQCKPNPVFVWRELPLWHPFAIFMSTLLGRTITAIPYAPYHLHLLLMACFA 325

Query: 293 SLIAPFGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSL 352
           SL+APFGGFFASG KRAF IKDFGHSIPGHGG+TDRMDCQFLMG F+++YY S I+   +
Sbjct: 326 SLVAPFGGFFASGFKRAFKIKDFGHSIPGHGGMTDRMDCQFLMGVFTYVYYSSLIREHHV 385

Query: 353 TVGAVLQTIVNSLKPQDQIELFNRLKQYLLSQGLL 387
           TVG +LQTIV+ L   +QIEL   L +YL +QG++
Sbjct: 386 TVGTILQTIVSGLTVDEQIELVADLHRYLETQGIV 420



>gi|85091044|ref|XP_958709.1| phosphatidate cytidylyltransferase [Neurospora crassa OR74A]
 gi|28920091|gb|EAA29473.1| phosphatidate cytidylyltransferase [Neurospora crassa OR74A]
 gi|336470367|gb|EGO58528.1| phosphatidate cytidylyltransferase [Neurospora tetrasperma FGSC
           2508]
 gi|350291398|gb|EGZ72593.1| phosphatidate cytidylyltransferase [Neurospora tetrasperma FGSC
           2509]
          Length = 449

 Score =  426 bits (1096), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 211/388 (54%), Positives = 270/388 (69%), Gaps = 6/388 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K  N   RT+WTFVMI GFF  L +GHI+++ ++  +Q + +KEVIAI+   S+ + +
Sbjct: 55  EKKKANFIERTLWTFVMIAGFFAALFMGHIYIVVIITAVQIISFKEVIAISSGASRARDI 114

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
              K+LNWY+L    YFL+GE++IYYFK IVMVD  LLP ATHHRFI F LY +GFVFFV
Sbjct: 115 QSTKSLNWYWLAVAMYFLHGETVIYYFKHIVMVDRVLLPLATHHRFICFTLYVVGFVFFV 174

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           + LK  H KFQFTQF W HM L ++V QSHFI+NN+F+GLIWF LP +LVI NDIFAY+C
Sbjct: 175 STLKGGHLKFQFTQFVWAHMALFLIVGQSHFIMNNVFDGLIWFFLPAALVITNDIFAYVC 234

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGF+GA + T++FG   + +L R  + ICPA DL    F G 
Sbjct: 235 GITFGRTQLIKLSPKKTVEGFLGAWVMTVLFGILLTHILMRSRFFICPANDLGANIFTG- 293

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L CEPNPVFIPQ + + P L     +  F    S+ +AP+Q H    A FASLIAPFGGF
Sbjct: 294 LDCEPNPVFIPQTWTM-PELLFFPTKTRF----SITMAPMQIHTFFWATFASLIAPFGGF 348

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFGHSIPGHGGITDRMDCQF+MG F+++YY +FI  S +    VL+ +
Sbjct: 349 FASGLKRTFKIKDFGHSIPGHGGITDRMDCQFIMGFFAYIYYHTFIAQSKVDFDEVLEIV 408

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
              L   D  +L   + +YL++   ++ 
Sbjct: 409 ATRLTIDDHKKLLLFIAKYLVNHNAIDS 436



>gi|393217832|gb|EJD03321.1| phosphatidate cytidylyltransferase [Fomitiporia mediterranea
           MF3/22]
          Length = 435

 Score =  426 bits (1094), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 218/393 (55%), Positives = 275/393 (69%), Gaps = 9/393 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAI-------AHV 54
           ++K ++  VRT WTF+MI GF L L  GH ++I LV++ QTLVY+EV A+       +  
Sbjct: 42  TKKRQSFIVRTRWTFIMIGGFLLCLLAGHAYMIMLVMLCQTLVYREVTALFTSVTTKSGS 101

Query: 55  PSKEKKLPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYC 114
              + K PW KTLNWYF + T +FLYGESIIYYFK +V  D     FA +HRF SF+LY 
Sbjct: 102 DRSKGKDPWSKTLNWYFFVVTNFFLYGESIIYYFKHVVFADWHFSLFAANHRFTSFILYM 161

Query: 115 IGFVFFVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICN 174
           IGFV FVA+L++ H K QF  F W HM+LL++V  SHFI+NNI EGLIWF +P SLVICN
Sbjct: 162 IGFVGFVASLQRGHLKSQFGLFCWVHMSLLVIVVSSHFIMNNILEGLIWFWVPASLVICN 221

Query: 175 DIFAYICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLT 234
           DIFAYI G   GRTPLI+LSPKKT EGFVGA   TI+FG  W     R++YM CPAQ+L 
Sbjct: 222 DIFAYIWGITMGRTPLIQLSPKKTVEGFVGAFFSTIVFGHLWGVFFMRFNYMTCPAQNLG 281

Query: 235 TTAFYGRLTCEPNPVFIPQRYDLNPWLTSLFRRLT-FKDIRSVWIAPLQWHVLVMACFAS 293
             AF   ++C PNPVF+   + +   L  +   L     + ++   P Q+H+L+M+CFAS
Sbjct: 282 VNAF-SDISCTPNPVFLWHSWVIPAPLRVVLSALPGLGGVETIPYTPYQFHLLIMSCFAS 340

Query: 294 LIAPFGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLT 353
           L+APFGGFFASG KRAFNIKDFGHSIPGHGG+TDRMDCQFLMG F+++YY S +K+  +T
Sbjct: 341 LVAPFGGFFASGFKRAFNIKDFGHSIPGHGGMTDRMDCQFLMGIFTYVYYSSVVKVHHVT 400

Query: 354 VGAVLQTIVNSLKPQDQIELFNRLKQYLLSQGL 386
           VG VLQ IV+ L   +QIEL    K+YL  +G+
Sbjct: 401 VGHVLQLIVSGLTLDEQIELMGDFKRYLEGRGI 433



>gi|302679378|ref|XP_003029371.1| hypothetical protein SCHCODRAFT_69598 [Schizophyllum commune H4-8]
 gi|300103061|gb|EFI94468.1| hypothetical protein SCHCODRAFT_69598 [Schizophyllum commune H4-8]
          Length = 376

 Score =  426 bits (1094), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 216/374 (57%), Positives = 268/374 (71%), Gaps = 6/374 (1%)

Query: 18  MIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKE-----KKLPWFKTLNWYFL 72
           MI  F   L  GH +++ LV + QTLVY+EV  +  + SK      KK PW  TLNWYF 
Sbjct: 1   MIAAFIGFLTFGHGYMVLLVHICQTLVYREVTNLFALSSKNAKIEAKKDPWSVTLNWYFF 60

Query: 73  ISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFVANLKKHHYKFQ 132
             T YFLYGESIIYYFK +V  DA LLPFAT+HR +SF+LY +GFV FV +L+K   K Q
Sbjct: 61  AVTNYFLYGESIIYYFKHVVFADANLLPFATNHRMLSFMLYTLGFVGFVMSLQKGQLKQQ 120

Query: 133 FTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYICGFFWGRTPLIK 192
           F  F W HM+LL+VV  SHFI+NNI EG+IWF +P SLVICND+FAYICG  +G+TPLI+
Sbjct: 121 FGLFCWVHMSLLLVVVSSHFIVNNILEGVIWFWVPASLVICNDVFAYICGITFGKTPLIQ 180

Query: 193 LSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGRLTCEPNPVFIP 252
           LSPKKT EGFVGA  CT+ FG  W +   R++YMICP +DL   A +    C+PNPVF+ 
Sbjct: 181 LSPKKTVEGFVGAFFCTMAFGVAWGTFFMRFNYMICPVRDLGKHA-WEEFMCKPNPVFMW 239

Query: 253 QRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGFFASGVKRAFNI 312
           + + +   + S    L   +I+++  AP Q HVLVMA FASL+APFGGFFASG KRAFNI
Sbjct: 240 REWQIWGPVASFLSNLLGHEIKTIPYAPFQGHVLVMAIFASLVAPFGGFFASGFKRAFNI 299

Query: 313 KDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTIVNSLKPQDQIE 372
           KDFGHSIPGHGG+TDRMDCQFLMG F+++YY S I+   +TVG+VLQTIV+ L  ++Q+E
Sbjct: 300 KDFGHSIPGHGGMTDRMDCQFLMGVFTYVYYSSLIREHHVTVGSVLQTIVSGLTTEEQLE 359

Query: 373 LFNRLKQYLLSQGL 386
           L   LK YL  QG+
Sbjct: 360 LIKDLKGYLQGQGI 373



>gi|388854569|emb|CCF51726.1| related to CDS1-CDP-diacylglycerol synthase [Ustilago hordei]
          Length = 635

 Score =  424 bits (1091), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 216/416 (51%), Positives = 278/416 (66%), Gaps = 40/416 (9%)

Query: 11  RTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSK------------- 57
           RT++T +MI GF  ++ LGH ++I LV+V QTLVY+E++A+ ++P +             
Sbjct: 219 RTLFTLIMIAGFVALVLLGHPYMILLVMVSQTLVYREIVALFNIPGRPSVTGGGGTGRSS 278

Query: 58  ----------------EKKLP----------WFKTLNWYFLISTYYFLYGESIIYYFKAI 91
                           E+++           W K L+WYF     YFLYGESIIYYFK I
Sbjct: 279 RVSSAPTSAATSEDEEEERIQSRLEGRREELWSKALSWYFFAVANYFLYGESIIYYFKHI 338

Query: 92  VMVDAFLLPFATHHRFISFVLYCIGFVFFVANLKKHHYKFQFTQFAWTHMTLLIVVCQSH 151
           V VDA+ +PFA HHRF+SF+LY  GF+ FV+NLK+ + K QF  F W HM+LL++V  SH
Sbjct: 339 VFVDAYFIPFARHHRFLSFMLYVFGFMAFVSNLKRRNLKHQFGLFCWVHMSLLLIVFSSH 398

Query: 152 FIINNIFEGLIWFVLPVSLVICNDIFAYICGFFWGRTPLIKLSPKKTWEGFVGALICTII 211
           FI+NNI EGLIW  +P SLVICND+FAYICG  +G+TPLI LSPKKT EGFVGA I T I
Sbjct: 399 FIVNNILEGLIWIWVPASLVICNDVFAYICGMSFGKTPLIDLSPKKTVEGFVGAFIVTEI 458

Query: 212 FGFFWSSLLRRWDYMICPAQDLTTTAFYGRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFK 271
           F + W++  +R++YMICPA  L   AF   +TC+ NPVF      L P + SL   L   
Sbjct: 459 FAYGWATFFQRYNYMICPAVSLGMNAF-KEITCDVNPVFHWHYLPLPPAIASLASSLLRH 517

Query: 272 DIRSVWIAPLQWHVLVMACFASLIAPFGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDC 331
            + ++  +  Q H LVMA FASL+APFGGFFASG KRAFNIKDFG SIPGHGG+TDR DC
Sbjct: 518 RVAALPWSYFQLHALVMAAFASLVAPFGGFFASGFKRAFNIKDFGDSIPGHGGLTDRFDC 577

Query: 332 QFLMGCFSHMYYQSFIKMSSLTVGAVLQTIVNSLKPQDQIELFNRLKQYLLSQGLL 387
           QFLMG FS++YY S I+   +TVG+VLQT+V  L  +DQ+EL+N + +YL+ QG L
Sbjct: 578 QFLMGLFSYVYYSSLIREHHVTVGSVLQTVVTQLTLEDQMELYNEISRYLVGQGKL 633



>gi|336266243|ref|XP_003347890.1| hypothetical protein SMAC_07265 [Sordaria macrospora k-hell]
 gi|380088261|emb|CCC13756.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 460

 Score =  423 bits (1087), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 210/387 (54%), Positives = 266/387 (68%), Gaps = 6/387 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K  N   RT+WT +MI GFF  L +GHI+++ ++  +Q + +KEVIAI+   S+ + +
Sbjct: 65  EKKKANFIERTLWTLIMIGGFFAALFMGHIYIVVIITAVQIISFKEVIAISSGASRARDI 124

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
              K+LNWY+L    YFL+GES+IYYFK IVMVD  LLP ATHHRFI F LY +GFVFFV
Sbjct: 125 QSTKSLNWYWLAIAMYFLHGESVIYYFKHIVMVDRVLLPLATHHRFICFTLYVVGFVFFV 184

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           + LK  H KFQFTQF W HM L ++V QSHFI+NN+F+GLIWF LP +LVI NDIFAYIC
Sbjct: 185 STLKGGHLKFQFTQFVWAHMALFLIVGQSHFIMNNVFDGLIWFFLPAALVITNDIFAYIC 244

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGF+GA + T++FG F + +L R  + ICPA DL    F G 
Sbjct: 245 GITFGRTQLIKLSPKKTVEGFLGAWVMTVLFGIFLTHILMRSRFFICPANDLGANIFTG- 303

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L CEPNPVFIP+      W T            S+ +AP+Q H    A FASLIAPFGGF
Sbjct: 304 LDCEPNPVFIPKT-----WTTPELLFFPPNTHFSITMAPMQIHTFFWATFASLIAPFGGF 358

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFGHSIPGHGGITDRMDCQF+MG F+++YY +FI  S +    VL+ +
Sbjct: 359 FASGLKRTFKIKDFGHSIPGHGGITDRMDCQFIMGFFAYIYYHTFIAQSKVDFDEVLEIV 418

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLE 388
              L   D  +L   + +YL++   ++
Sbjct: 419 ATRLTIDDHKKLLLFIAKYLVNHNAID 445



>gi|71010773|ref|XP_758413.1| hypothetical protein UM02266.1 [Ustilago maydis 521]
 gi|46097968|gb|EAK83201.1| hypothetical protein UM02266.1 [Ustilago maydis 521]
          Length = 639

 Score =  419 bits (1076), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 220/425 (51%), Positives = 282/425 (66%), Gaps = 41/425 (9%)

Query: 5   WKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSK------- 57
           W+ +  RT++T +MI GF  +L LGH ++I LV++ QTLVY+E++A+ ++P +       
Sbjct: 215 WQKIYERTLYTLIMIGGFIGLLLLGHPYMILLVMICQTLVYREIVALFNIPGRPSVTGGG 274

Query: 58  ---------------------------EKKLP------WFKTLNWYFLISTYYFLYGESI 84
                                      +K++       W KTL+WYF     YFLYGESI
Sbjct: 275 GRSSRMSSAPTSAATSEVDDDDDDERIQKRIQGRRDQLWSKTLSWYFFAVANYFLYGESI 334

Query: 85  IYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFVANLKKHHYKFQFTQFAWTHMTLL 144
           IYYFK IV VDA+ +PFA HHRF+SF+LY  GF+ FV+NLK+ + K QF  F W HM+LL
Sbjct: 335 IYYFKHIVFVDAWFIPFARHHRFLSFMLYVFGFMAFVSNLKRRNLKHQFGLFCWVHMSLL 394

Query: 145 IVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYICGFFWGRTPLIKLSPKKTWEGFVG 204
           ++V  SHFI+NNI EGLIW  +P SLV+CND+FAYICG  +GRTPLI LSPKKT EGFVG
Sbjct: 395 LIVFSSHFIVNNILEGLIWLWVPASLVVCNDVFAYICGMTFGRTPLIDLSPKKTVEGFVG 454

Query: 205 ALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGRLTCEPNPVFIPQRYDLNPWLTSL 264
           A I T IF + W++  +R++YMICPA  L   AF   +TC+ NPVF      L P + SL
Sbjct: 455 AFIVTEIFAYGWATFFQRYNYMICPAVSLGMNAF-KEVTCDVNPVFHWHYLSLPPAMASL 513

Query: 265 FRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGFFASGVKRAFNIKDFGHSIPGHGG 324
              +    I +   +P Q H LVMA FASL+APFGGFFASG KRAFNIKDFG SIPGHGG
Sbjct: 514 ASSIAGHRISAFPWSPFQLHALVMAAFASLVAPFGGFFASGFKRAFNIKDFGDSIPGHGG 573

Query: 325 ITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTIVNSLKPQDQIELFNRLKQYLLSQ 384
           +TDR DCQFLMG FS++YY S I+   +TVG+VLQT+V  L   DQIEL+N + +YL+ Q
Sbjct: 574 LTDRFDCQFLMGLFSYVYYSSLIREHHVTVGSVLQTVVTQLTLDDQIELYNEISRYLVGQ 633

Query: 385 GLLEE 389
           G L +
Sbjct: 634 GKLTK 638



>gi|501309999|dbj|GAC98802.1| hypothetical protein PHSY_006397 [Pseudozyma hubeiensis SY62]
          Length = 710

 Score =  418 bits (1074), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 217/427 (50%), Positives = 285/427 (66%), Gaps = 43/427 (10%)

Query: 5   WKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSK------- 57
           W+ +  RT++T +MI GF  +L LGH ++I LV+V QTLVY+EV+A+ ++P++       
Sbjct: 284 WQKIWERTLYTLIMIGGFLGLLLLGHPYMILLVMVCQTLVYREVVALFNIPNRPSVTGSG 343

Query: 58  -----------------------------EKKLP------WFKTLNWYFLISTYYFLYGE 82
                                        +++L       W KTL+WYF  +  YFLYGE
Sbjct: 344 GGGRSSRMSSAPTSAATSEVDDDEEEERVQRRLEGRRDQLWSKTLSWYFFATANYFLYGE 403

Query: 83  SIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFVANLKKHHYKFQFTQFAWTHMT 142
           SIIYYFK IV VDA+ +PFA HHRF+SF+LY  GF+ FV+NLK+ + K QF  F W HM+
Sbjct: 404 SIIYYFKHIVFVDAWFIPFARHHRFLSFMLYVFGFMAFVSNLKRRNLKHQFGLFCWVHMS 463

Query: 143 LLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYICGFFWGRTPLIKLSPKKTWEGF 202
           LL++V  SHFI+NNI EGLIW ++P SLV+CND+FAYICG  +GRTPLI LSPKKT EGF
Sbjct: 464 LLLIVFSSHFIVNNILEGLIWLLVPASLVVCNDVFAYICGMTFGRTPLIDLSPKKTVEGF 523

Query: 203 VGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGRLTCEPNPVFIPQRYDLNPWLT 262
           VGA+I T +F + W++  +R++YMICPA  L   AF   ++CE NPVF      L P + 
Sbjct: 524 VGAIIVTEVFAYGWATFFQRYNYMICPAVSLGMNAFKD-VSCEVNPVFHWHYLSLPPAIA 582

Query: 263 SLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGFFASGVKRAFNIKDFGHSIPGH 322
           SL   +    + ++     Q H LV+A FASL+APFGGFFASG KRAFNIKDFG SIPGH
Sbjct: 583 SLASSIAGHRVSALPWTAFQLHSLVLASFASLVAPFGGFFASGFKRAFNIKDFGDSIPGH 642

Query: 323 GGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTIVNSLKPQDQIELFNRLKQYLL 382
           GG+TDR DCQFLMG F+++YY S I+   +TVG VLQT+V  L  +DQ+EL+N L +YL+
Sbjct: 643 GGLTDRFDCQFLMGMFTYVYYSSLIREHHVTVGTVLQTVVTQLTLEDQMELYNELSRYLV 702

Query: 383 SQGLLEE 389
            QG L +
Sbjct: 703 GQGKLAK 709



>gi|171676714|ref|XP_001903309.1| hypothetical protein [Podospora anserina S mat+]
 gi|170936424|emb|CAP61081.1| unnamed protein product [Podospora anserina S mat+]
          Length = 455

 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 209/391 (53%), Positives = 269/391 (68%), Gaps = 6/391 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K  N  VRT WT VMI GFF  L  GHI+V+ ++  IQ + +KEVIAIA++ S+ + L
Sbjct: 51  EKKKANFMVRTFWTLVMIAGFFAALLAGHIYVVLIITTIQIISFKEVIAIANIGSRARDL 110

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWY+L +T YFLYGES++YYF+ I++VD  L P +THHRFISF +Y  GFV FV
Sbjct: 111 RFTKSLNWYWLATTMYFLYGESVVYYFRHIILVDKVLQPLSTHHRFISFCIYIFGFVIFV 170

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +LK  + +FQF+QFAWTHM L ++  Q+HFI+NNIFEGLIWF LP +LVI NDIFAYIC
Sbjct: 171 TSLKPGNLRFQFSQFAWTHMALFLINIQAHFILNNIFEGLIWFFLPAALVITNDIFAYIC 230

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGF+GA   T++ G   +  L R +Y ICPA +L T+     
Sbjct: 231 GITFGRTQLIKLSPKKTVEGFIGAWFSTMVVGLGLTWCLLRSNYFICPATNLATSILQ-D 289

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           + C+PNPVFIP+ Y      T  F  L      S+ +AP+ +H LV A FASLIAPFGGF
Sbjct: 290 IHCDPNPVFIPRTYT-----TPEFFFLPPGHTVSITVAPMYFHTLVWATFASLIAPFGGF 344

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F +KDFG SIPGHGG+TDRMDCQF+MG F+ +YYQ+FI +     GAVL  +
Sbjct: 345 FASGLKRTFKLKDFGDSIPGHGGMTDRMDCQFIMGMFAFLYYQTFIAVRDYNPGAVLDML 404

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEERGA 392
           V  L  +DQ  +   + Q     G++    A
Sbjct: 405 VTGLGVEDQAHVVKGMLQIWARDGVISPTAA 435



>gi|50553064|ref|XP_503942.1| YALI0E14443p [Yarrowia lipolytica]
 gi|49649811|emb|CAG79535.1| YALI0E14443p [Yarrowia lipolytica CLIB122]
          Length = 442

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 211/387 (54%), Positives = 272/387 (70%), Gaps = 7/387 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
             K +   VRTIW+ VMI  FF +L  GHIWVI LV ++Q L +KEVI +A  P+ EKKL
Sbjct: 54  ESKKQAFIVRTIWSLVMIVFFFAVLAAGHIWVIALVGLVQILTFKEVINLASEPASEKKL 113

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVM-VDAFLLPFATHHRFISFVLYCIGFVFF 120
           PW ++LNWYFL +T YFL GE+II + K     ++  L     HHRF+S+ LY +GFVFF
Sbjct: 114 PWVRSLNWYFLATTIYFLEGENIIRFIKQNNSDLENTLNTLFLHHRFLSYCLYILGFVFF 173

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           VA+L+K+HY+FQFTQF  THMTLL  V Q+HFI+NNIF+GL WF +P  LVI NDIFAY+
Sbjct: 174 VASLEKNHYRFQFTQFCLTHMTLLFGVVQAHFIVNNIFQGLFWFFVPAGLVISNDIFAYL 233

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
           CG  +G+  LI +SPKKT EGF+GA ICTII+G  +S  L R+DY ICP +D+ T  F  
Sbjct: 234 CGITFGKHQLIAISPKKTVEGFLGAWICTIIWGVIFSVFLYRFDYFICPVEDMGTNLF-S 292

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
            LTC PNPVF+P+ Y   P  T   R+LT K   S   AP+ +HV ++A FASL+APFGG
Sbjct: 293 NLTCVPNPVFMPKEY---PIPTEFLRQLTHKTTFSA--APIHFHVGILASFASLVAPFGG 347

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG+KRAF +KDFG +IPGHGGITDRMDCQFLMG FS++YY++F+      V  +L T
Sbjct: 348 FFASGLKRAFQVKDFGDTIPGHGGITDRMDCQFLMGFFSYLYYETFVSNHVSKVETLLNT 407

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLL 387
           ++ +   Q Q E   +  ++  ++GLL
Sbjct: 408 LMFTFTRQQQEEFVRQFFEWAKNEGLL 434



>gi|406603559|emb|CCH44925.1| Phosphatidate cytidylyltransferase [Wickerhamomyces ciferrii]
          Length = 428

 Score =  412 bits (1058), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 205/388 (52%), Positives = 276/388 (71%), Gaps = 7/388 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +N  VR IWT VM  GF  +L LGH+W++ L+ V Q LV+KE IA+A   S+EK L
Sbjct: 38  EKKKQNFIVRAIWTIVMFLGFITVLSLGHLWMVLLIFVFQILVFKECIAVASKSSQEKNL 97

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           P  K+LNWYFL +T Y+L GES I+ F  ++  +  L P ATHH+F+S+  Y  GFVFFV
Sbjct: 98  PLTKSLNWYFLFTTIYYLDGESFIHSFNHLIFTNKILTPLATHHKFLSYFFYIFGFVFFV 157

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
             L+K HYKFQF+Q   THM LL+VV Q+H IINNIF G+IWF+LPV LVI NDIFAY+C
Sbjct: 158 ITLQKGHYKFQFSQLCITHMVLLLVVFQAHLIINNIFNGMIWFLLPVLLVITNDIFAYLC 217

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +G+T LI +SPKKT EGFVGA I T I G   + LL  +DY+ICP  DL    F   
Sbjct: 218 GITFGKTQLIAISPKKTVEGFVGAWIFTSIVGILLAKLLTNYDYLICPVTDLRENIF-SH 276

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           ++CE NP+F+ Q + + P ++     + F    ++ I P+ +H L +A FASLIAPFGGF
Sbjct: 277 VSCERNPIFVAQDFRIPPIIS---ENIGF---TTLTIRPIYFHSLNLASFASLIAPFGGF 330

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR FN KDFGH+IPGHGGITDR+DCQFLMG F+++YY++F+  + + VG++LQ I
Sbjct: 331 FASGLKRTFNAKDFGHTIPGHGGITDRIDCQFLMGSFAYLYYETFLSTNRINVGSILQMI 390

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           V +++P+D I+L ++L  YL + G+++E
Sbjct: 391 VTNMEPKDIIQLIDKLHLYLFNTGIIDE 418



>gi|358060181|dbj|GAA94240.1| hypothetical protein E5Q_00889 [Mixia osmundae IAM 14324]
          Length = 687

 Score =  411 bits (1057), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 209/408 (51%), Positives = 269/408 (65%), Gaps = 28/408 (6%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVI------------ 49
           ++KW+++  R +W+ +M+  F  IL LGH++VI L  V   LV++E+             
Sbjct: 281 AKKWQSVMTRIVWSLIMVTIFITILLLGHVYVILLTFVSSALVFRELTDLFDGASSSHHH 340

Query: 50  -------AIAHVPSKEKKLPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFA 102
                  + AH   K ++  W +   WYF IST YFLYGE+IIYYFK IV++D + +PFA
Sbjct: 341 EGEGRERSAAHQRRKAERERWSRITAWYFFISTNYFLYGETIIYYFKHIVLIDTYFIPFA 400

Query: 103 THHRFISFVLYCIGFVFFVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLI 162
            HHRFISF+LY IGFV FV  LK++  + QF  F W HM+LL+VV  SHFI+NNI EGLI
Sbjct: 401 RHHRFISFMLYVIGFVGFVGALKRNQLRRQFGLFCWIHMSLLVVVVSSHFIVNNILEGLI 460

Query: 163 WFVLPVSLVICNDIFAYICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRR 222
           WF +P SLVI ND+ AY  G   GRT LIKLSPKKT EGFVGA   T++F +FW +L  R
Sbjct: 461 WFWIPASLVIMNDVAAYFFGMTMGRTQLIKLSPKKTVEGFVGAFFATVVFSYFWGTLFMR 520

Query: 223 WDYMICPAQDLTTTAFYGRLTCEPNPVFI----PQRYDLNPWLTSLFRRLTFKDIRSVWI 278
           + Y+ CPA DL T+AF   +TC  NPVF     P    +   L++LFRR     I  +  
Sbjct: 521 FTYLTCPATDLGTSAF-STITCSTNPVFTWREWPLPQGVAAGLSTLFRR----SITVLPW 575

Query: 279 APLQWHVLVMACFASLIAPFGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCF 338
           +P Q H LVMA FASL+APFGGFFASG KRAFNIKDFG SIPGHGGITDRMDCQFLMG F
Sbjct: 576 SPFQLHCLVMAVFASLVAPFGGFFASGFKRAFNIKDFGDSIPGHGGITDRMDCQFLMGLF 635

Query: 339 SHMYYQSFIKMSSLTVGAVLQTIVNSLKPQDQIELFNRLKQYLLSQGL 386
           S++YY S I+   +  G +LQ+ + +L  ++Q+EL   L  YL ++G+
Sbjct: 636 SYVYYSSLIREHHINAGTLLQSALTALTTEEQVELLRGLHSYLSAKGV 683



>gi|465797112|emb|CCU97871.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 571

 Score =  409 bits (1052), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 201/402 (50%), Positives = 268/402 (66%), Gaps = 20/402 (4%)

Query: 5   WKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVP--------- 55
           WK +  RT+++ +MI GF  IL +G  ++I LV++++TLVY+E+ A+ ++P         
Sbjct: 171 WKKIKERTVFSLLMIGGFLFILAMGPSYLILLVLILETLVYREITALFNIPGLPHSQSDG 230

Query: 56  ----------SKEKKLPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHH 105
                       +++  W KTL+WYF     +FLYGES+ YYFK IV+ D+F + FA HH
Sbjct: 231 DEEDNTLSQREADREELWSKTLSWYFFAVCNFFLYGESLTYYFKHIVLTDSFFVQFARHH 290

Query: 106 RFISFVLYCIGFVFFVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFV 165
           RFISF+LY  GF+ FV+NLK+ + K QF  F W HM+L+++V  SHFI++NI EG++WF 
Sbjct: 291 RFISFMLYIFGFMAFVSNLKRRNLKHQFALFCWVHMSLMLIVMSSHFIVDNILEGIVWFW 350

Query: 166 LPVSLVICNDIFAYICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDY 225
           +P SLVICNDIFAY+CG  WGRTPLI LSPKKT EGFVGAL+ T++F +FW+   +++ Y
Sbjct: 351 VPSSLVICNDIFAYVCGMLWGRTPLISLSPKKTVEGFVGALVITMVFSWFWAGFFQQFKY 410

Query: 226 MICPAQDLTTTAFYGRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHV 285
           MICPA  L    F  R  CE NPVF+     L   L+ L   +  + I      P Q H 
Sbjct: 411 MICPAVSLGMNVFQ-RPNCEVNPVFMVHHTALPAQLSELLSSVFHRSITHFSWTPFQCHA 469

Query: 286 LVMACFASLIAPFGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQS 345
           LVMA FASL+APFGGFFASG KRAF IKDFG SIPGHGG+TDR DCQFLMG FS++Y+ S
Sbjct: 470 LVMAAFASLVAPFGGFFASGFKRAFRIKDFGDSIPGHGGLTDRFDCQFLMGLFSYVYFSS 529

Query: 346 FIKMSSLTVGAVLQTIVNSLKPQDQIELFNRLKQYLLSQGLL 387
            I+ S ++V  ++Q I+  L   DQ  + + L  YLL +G L
Sbjct: 530 LIRDSRVSVHMIMQMIITHLPLDDQKRVLHELTSYLLKEGQL 571



>gi|402224320|gb|EJU04383.1| phosphatidate cytidylyltransferase [Dacryopinax sp. DJM-731 SS1]
          Length = 383

 Score =  409 bits (1050), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 205/378 (54%), Positives = 271/378 (71%), Gaps = 13/378 (3%)

Query: 22  FFLILGLGHIWVIFLVVVIQTLVYKEVIAI----AHVPSK--------EKKLPWFKTLNW 69
           FFLI+  G  +V+ LV+V Q LVY+EV A+    AH  S+        + +  W KTLNW
Sbjct: 5   FFLIMAGGTPFVVMLVLVCQALVYREVTALFEFTAHAGSRPIEGKGAEKSEDRWSKTLNW 64

Query: 70  YFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFVANLKKHHY 129
           YF   T YFLYGES+I+YFK +V  DA+L PFAT+HRFISF+LY IGF+ FV+NLK+ + 
Sbjct: 65  YFFAVTNYFLYGESLIHYFKHVVFADAWLTPFATNHRFISFMLYMIGFIGFVSNLKRQYL 124

Query: 130 KFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYICGFFWGRTP 189
           + QF  F W HMTL ++V  SHFI+NNI EGLIWF +P  LVICNDIFAY+ G  +GRTP
Sbjct: 125 RQQFGLFCWVHMTLFLIVVSSHFIVNNILEGLIWFWVPACLVICNDIFAYVWGMSFGRTP 184

Query: 190 LIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGRLTCEPNPV 249
           LI+LSPKKT EGFVGA   T++F +   +   ++DYMICP  DL  TA +  + C+ N V
Sbjct: 185 LIQLSPKKTVEGFVGAFFTTLVFAYILGTFSMQFDYMICPGHDLGVTA-WDNVVCDKNKV 243

Query: 250 FIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGFFASGVKRA 309
           FI +   +   L ++      + + S+ +AP Q+H +V+ACFASL+APFGGFFASG KRA
Sbjct: 244 FIWRDLPIGEPLVTILSTWARRPVTSIPVAPFQFHSVVLACFASLVAPFGGFFASGFKRA 303

Query: 310 FNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTIVNSLKPQD 369
           F+IKDFG SIPGHGG+TDRMDCQFLMG F+++YY + I+++ +T G++LQ IV+SL PQ+
Sbjct: 304 FDIKDFGDSIPGHGGMTDRMDCQFLMGMFTYVYYSTLIRVNHVTPGSILQAIVSSLGPQE 363

Query: 370 QIELFNRLKQYLLSQGLL 387
           Q+EL+  L  YL ++GLL
Sbjct: 364 QLELYRELTSYLHTKGLL 381



>gi|390602531|gb|EIN11924.1| phosphatidate cytidylyltransferase [Punctularia strigosozonata
           HHB-11173 SS5]
          Length = 389

 Score =  408 bits (1048), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 206/364 (56%), Positives = 256/364 (70%), Gaps = 8/364 (2%)

Query: 30  HIWVIFLVVVIQTLVYKEVIA---IAHVPSKEK----KLPWFKTLNWYFLISTYYFLYGE 82
           H ++I LV   Q LVY+EV A   I    S E+    K PW KTLNWYF     YFLYGE
Sbjct: 13  HSYMIMLVFFCQMLVYREVTALFAIRKTDSAEEQGKGKDPWSKTLNWYFFAVANYFLYGE 72

Query: 83  SIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFVANLKKHHYKFQFTQFAWTHMT 142
           SIIYYFK IV VDA L   AT HR ISF LY +GFV FVA+LK+ + + QF  F W HM+
Sbjct: 73  SIIYYFKHIVFVDAHLTTIATKHRIISFSLYIMGFVGFVASLKRGYLRKQFGLFCWVHMS 132

Query: 143 LLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYICGFFWGRTPLIKLSPKKTWEGF 202
           LL++V  SHFI+NNI EGLIWF +P SLVICNDIFAY+CG  +GRT LI LSPKKT EGF
Sbjct: 133 LLLIVVSSHFIVNNILEGLIWFWVPASLVICNDIFAYVCGMTFGRTQLIALSPKKTVEGF 192

Query: 203 VGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGRLTCEPNPVFIPQRYDLNPWLT 262
           VGA  CT+ FG  W S   R+DYMICP  DL  +A +  + C+PN VF+ +   ++P L+
Sbjct: 193 VGAFFCTVAFGLLWGSYFMRFDYMICPVHDLGVSA-WNSVECKPNSVFVWREAQISPPLS 251

Query: 263 SLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGFFASGVKRAFNIKDFGHSIPGH 322
           +         + +V   P  +H+L ++CFASL+APFGGFFASG KRAFNIKDFGHSIPGH
Sbjct: 252 TWLSTAVGHPVTAVPWTPYHFHLLFLSCFASLVAPFGGFFASGFKRAFNIKDFGHSIPGH 311

Query: 323 GGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTIVNSLKPQDQIELFNRLKQYLL 382
           GG+TDRMDCQFLMG F+++YY S I+ S ++VG++LQ IV+ L  ++Q+EL   LK+YL 
Sbjct: 312 GGMTDRMDCQFLMGVFTYVYYSSLIRESGVSVGSLLQMIVSGLTVEEQLELMGDLKRYLE 371

Query: 383 SQGL 386
            QG+
Sbjct: 372 GQGI 375



>gi|353236314|emb|CCA68311.1| related to CDS1-CDP-diacylglycerol synthase [Piriformospora indica
           DSM 11827]
          Length = 585

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 199/356 (55%), Positives = 259/356 (72%), Gaps = 5/356 (1%)

Query: 30  HIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKLPWFKTLNWYFLISTYYFLYGESIIYYFK 89
           HI++I LVVVIQ+LV++E+  +     +  + PW KTLNWYF     Y+ YGE+IIYY K
Sbjct: 232 HIYMIMLVVVIQSLVFREITQLF----QGIRDPWSKTLNWYFFAIANYYFYGETIIYYLK 287

Query: 90  AIVMVDAFLLPFATHHRFISFVLYCIGFVFFVANLKKHHYKFQFTQFAWTHMTLLIVVCQ 149
            ++  +A   PFA +HRFISF+LY  GF+ FVA+LKK++ + QF+ F W HMTLL+VV  
Sbjct: 288 HVLFSEAVFHPFAANHRFISFMLYVFGFMGFVASLKKNYLQRQFSLFGWVHMTLLVVVVS 347

Query: 150 SHFIINNIFEGLIWFVLPVSLVICNDIFAYICGFFWGRTPLIKLSPKKTWEGFVGALICT 209
           SHFI++NI EG+IWF LP SLVICNDIFA+  G   GRT L  LSPKKT EGFVGA   T
Sbjct: 348 SHFIVDNILEGMIWFWLPASLVICNDIFAWFWGVTLGRTQLFALSPKKTVEGFVGAFFST 407

Query: 210 IIFGFFWSSLLRRWDYMICPAQDLTTTAFYGRLTCEPNPVFIPQRYDLNPWLTSLFRRLT 269
           +IFGFFW+S   R+DYMICP +DL  +AF G LTC+PNPVF+ + + L     ++   L 
Sbjct: 408 LIFGFFWASFFMRYDYMICPVKDLGASAFSG-LTCKPNPVFVWRDFKLTQPAVAIASFLA 466

Query: 270 FKDIRSVWIAPLQWHVLVMACFASLIAPFGGFFASGVKRAFNIKDFGHSIPGHGGITDRM 329
            + + ++  AP Q+H L+MA FASL+APFGGFFASG KRAFNIKDFGHSIPGHGG+TDRM
Sbjct: 467 GRTVTTIPWAPFQFHALMMATFASLVAPFGGFFASGFKRAFNIKDFGHSIPGHGGMTDRM 526

Query: 330 DCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTIVNSLKPQDQIELFNRLKQYLLSQG 385
           DCQFLMG FS++YY + I+++ +TV +V+Q IVN L   +Q++L   LK+ + S  
Sbjct: 527 DCQFLMGMFSYVYYSNLIRVNEITVASVMQAIVNGLSRDEQMQLLGELKRLIGSSA 582



>gi|154317539|ref|XP_001558089.1| hypothetical protein BC1G_03121 [Botryotinia fuckeliana B05.10]
          Length = 420

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 204/388 (52%), Positives = 265/388 (68%), Gaps = 43/388 (11%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    R+IWTFVMI GFF  + +GHI++I +V  +Q + +KEVIAIA+VPS+ ++L
Sbjct: 63  EKKKQTFITRSIWTFVMIGGFFASMFMGHIYIIAIVTAVQIISFKEVIAIANVPSRARRL 122

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K LNWY+L +T YFLYGE                                  FVFFV
Sbjct: 123 RFTKALNWYWLATTMYFLYGER---------------------------------FVFFV 149

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A+L+  HYKFQFTQFAWTHM L ++V Q+HFI+NN+FEG+IWF LPVSLVICNDIFAYIC
Sbjct: 150 ASLQAGHYKFQFTQFAWTHMALYLIVVQAHFIMNNVFEGMIWFFLPVSLVICNDIFAYIC 209

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA I T+IFG   +++L R+ Y ICP  DL    + G 
Sbjct: 210 GITFGRTQLIKLSPKKTVEGFVGAWILTVIFGVGMTNVLMRYKYFICPVNDLGANLWTG- 268

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNPVF+P  Y L  W         F   +S  +AP+Q H+LV   FASLIAPFGGF
Sbjct: 269 LECTPNPVFLPHTYQLPIW---------FPVWKSFSMAPMQGHILVFGTFASLIAPFGGF 319

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGGITDRMDCQF+MG F+++Y+ SFI +  +++G V++T+
Sbjct: 320 FASGLKRTFKIKDFGDSIPGHGGITDRMDCQFIMGFFAYVYFHSFIAIYKVSLGGVIETV 379

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           +N L P++Q+EL   + ++L +QG++ E
Sbjct: 380 INGLTPEEQMELVKGISKHLYNQGVIAE 407



>gi|170093043|ref|XP_001877743.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164647602|gb|EDR11846.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 455

 Score =  405 bits (1041), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 225/391 (57%), Positives = 281/391 (71%), Gaps = 12/391 (3%)

Query: 6   KNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAI-----AHVPSKEK- 59
           +N+  RT+WTF+MI GF  +L LGH +++ LV++ QTLVY+EV A+     A   S++K 
Sbjct: 63  QNLLTRTLWTFIMIGGFVGLLLLGHAYMVLLVMLCQTLVYREVTALFSLKSATPESRDKE 122

Query: 60  ----KLPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCI 115
               K PW KTLNWYF   T YFLYGESIIYYFK +V  DA LLPFAT+HR ISF LY I
Sbjct: 123 DLKGKDPWSKTLNWYFFAVTNYFLYGESIIYYFKHVVFADAQLLPFATNHRMISFTLYTI 182

Query: 116 GFVFFVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICND 175
           GF+ FV +LKK + K QF  F W HM+LL++V  SHFI+NNI EGLIWF +P SLVICND
Sbjct: 183 GFMGFVMSLKKGYLKQQFGLFCWVHMSLLLIVMSSHFIVNNILEGLIWFWVPASLVICND 242

Query: 176 IFAYICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTT 235
            FAYI G   GRTPLIKLSPKKT EGFVGA   T+IF   W +   R++YMICP  DL  
Sbjct: 243 CFAYIWGKTLGRTPLIKLSPKKTVEGFVGAFWSTVIFAVIWGTYFMRFNYMICPVHDLGV 302

Query: 236 TAFYGRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLI 295
           +A +  + C PNPVF+ +  +L   L +L    T   + ++  AP Q H+L++A FASL+
Sbjct: 303 SA-WSSMQCVPNPVFVWKTLELWRPLATLL-TWTGHAVSTISYAPYQLHLLLLAFFASLV 360

Query: 296 APFGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVG 355
           APFGGFFASG KRAFNIKDFGHSIPGHGG+TDRMDCQFLMG F+++YY S I+ +++TVG
Sbjct: 361 APFGGFFASGFKRAFNIKDFGHSIPGHGGMTDRMDCQFLMGVFTYVYYSSLIRQNNVTVG 420

Query: 356 AVLQTIVNSLKPQDQIELFNRLKQYLLSQGL 386
            +LQTIV+ L  + Q+EL   L +YL SQG+
Sbjct: 421 GILQTIVSGLTAEQQLELIADLTRYLGSQGI 451



>gi|156049449|ref|XP_001590691.1| hypothetical protein SS1G_08431 [Sclerotinia sclerotiorum 1980]
 gi|154692830|gb|EDN92568.1| hypothetical protein SS1G_08431 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 419

 Score =  404 bits (1039), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 203/389 (52%), Positives = 266/389 (68%), Gaps = 43/389 (11%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    R+IWTFVMI GFF  + +GHI++I +V  +Q + +KEVIAIA+VPS+ ++L
Sbjct: 62  EKKKQTFITRSIWTFVMIGGFFASMFMGHIYIIGIVTAVQIISFKEVIAIANVPSRARRL 121

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K LNWY+L +T YFLYGE                                  FVFFV
Sbjct: 122 RFTKALNWYWLATTMYFLYGER---------------------------------FVFFV 148

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A+L+  HYKFQFTQFAWTHM L ++V Q+HFI+NN+FEG+IWF LPVSLVICNDIFAYIC
Sbjct: 149 ASLQAGHYKFQFTQFAWTHMALYLIVVQAHFIMNNVFEGMIWFFLPVSLVICNDIFAYIC 208

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA + TIIFG   +++L R+ Y ICP  DL    + G 
Sbjct: 209 GITFGRTQLIKLSPKKTVEGFVGAWVLTIIFGVGMTNVLMRYKYFICPVNDLGANLWTG- 267

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C PNPVF+P  Y L  W         F   +S  +AP+Q H+LV   FASLIAPFGGF
Sbjct: 268 LECTPNPVFLPHTYQLPIW---------FPVWKSFSMAPMQGHILVFGTFASLIAPFGGF 318

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGGITDRMDCQF+MG F+++Y+ SFI +  +++G V++T+
Sbjct: 319 FASGLKRTFKIKDFGDSIPGHGGITDRMDCQFIMGFFAYVYFHSFIAIYKVSLGGVIETV 378

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           +N L P++Q+EL   + ++L +QG++ ++
Sbjct: 379 INGLTPEEQMELVKGISKHLYNQGVIGDK 407



>gi|396468085|ref|XP_003838087.1| similar to phosphatidate cytidylyltransferase [Leptosphaeria
           maculans JN3]
 gi|312214654|emb|CBX94608.1| similar to phosphatidate cytidylyltransferase [Leptosphaeria
           maculans JN3]
          Length = 443

 Score =  402 bits (1034), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 205/389 (52%), Positives = 269/389 (69%), Gaps = 15/389 (3%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K  N   RTIWT VMI GFF  LG GH+++I ++  +Q + +KEVIAIA+VPSK + L
Sbjct: 58  EKKKANFITRTIWTLVMIAGFFWALGAGHLFIIIIITAVQIISFKEVIAIANVPSKARSL 117

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
            + K+LNWYFL +  YFLYGES+IYYFK I+MV         H       L  +GFVFFV
Sbjct: 118 RFTKSLNWYFLGTAMYFLYGESVIYYFKHILMVP--------HKNANRVGLISLGFVFFV 169

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
             L+K HYKFQFTQFAWTHM L ++V Q+HF+INNIFEG IWF+LP S+VI NDIFAY+C
Sbjct: 170 TTLQKGHYKFQFTQFAWTHMALFLIVGQAHFVINNIFEGFIWFILPASMVITNDIFAYLC 229

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRTPLI++SPKKTWEGF+GA   TI++G   +  L ++ Y ICP  DL    + G 
Sbjct: 230 GITFGRTPLIQISPKKTWEGFLGAWFFTILWGLGLTHFLAKYKYFICPVNDLGANIYSG- 288

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C+PNPVFI + Y +  +   L    TF       I P+Q+HVL++A FASL+APFGGF
Sbjct: 289 LECKPNPVFIERNYSIPFFPEGLPLPRTFD------IMPVQFHVLILATFASLVAPFGGF 342

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGG+TDR DCQF+MG  +  YY SFI ++  TVG +++  
Sbjct: 343 FASGLKRTFKIKDFGDSIPGHGGMTDRFDCQFIMGSIAFFYYSSFIAVNHTTVGGLIEAA 402

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           V  L  ++Q+E+   L ++L++Q ++  +
Sbjct: 403 VTGLTYEEQMEVVRILSKHLVNQEVISPK 431



>gi|354547258|emb|CCE43992.1| hypothetical protein CPAR2_502170 [Candida parapsilosis]
          Length = 454

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 197/388 (50%), Positives = 269/388 (69%), Gaps = 5/388 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMI GFF++L  GH+ +I +V++ Q L +KE+IA+   P+++KK+
Sbjct: 60  EKKKQAFVTRTIWTFVMIAGFFVVLASGHLPIIIMVLIFQLLTFKEIIALTSEPARDKKI 119

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           P+ ++LNWYFLI+T+Y+L   S + +F+  +  + FL     +H+ +S+ LY  GF+FFV
Sbjct: 120 PYNRSLNWYFLIATWYYLDFPSFVDFFQEEIFSNKFLTLLVLNHKIVSYSLYMAGFIFFV 179

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
             LKK +YKFQF Q   THMTLL+VV Q+H II NI  G+ WF LP +LVI NDIFAYIC
Sbjct: 180 WTLKKGYYKFQFAQLCVTHMTLLLVVFQAHLIIGNILNGIFWFFLPSALVIVNDIFAYIC 239

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LI++SPKKT EGFVGA ICT +     S +L + DY+ICPAQ+L +T  Y  
Sbjct: 240 GITFGRTQLIEISPKKTVEGFVGAWICTGVAAVIGSLILSKSDYLICPAQNL-STHLYNY 298

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
            +CEPNPVFIPQ Y L   +  LF      +I  +   P+ +H  ++A FASLIAPFGGF
Sbjct: 299 PSCEPNPVFIPQVYQLPQNIIDLFG----GNIELITFKPVYFHAAILATFASLIAPFGGF 354

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KRAF IKDFG +IPGHGGITDR DCQFLMG F+++YYQ+FI   ++ +G VLQ  
Sbjct: 355 FASGLKRAFGIKDFGDTIPGHGGITDRFDCQFLMGSFTYLYYQTFISNHNMNLGKVLQMA 414

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           + +L     I+L   + +YL  +G+++ 
Sbjct: 415 IINLSAPQLIQLIKSILRYLNREGVVDN 442



>gi|340904790|gb|EGS17158.1| hypothetical protein CTHT_0064720 [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 442

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 206/388 (53%), Positives = 265/388 (68%), Gaps = 21/388 (5%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K  N   RT WTF+MI GFF  L +GH++V+ ++  +Q + +KEVI+I+++ SK + L
Sbjct: 60  EKKKANFITRTFWTFIMIGGFFAALFMGHVYVLAIITAVQIVSFKEVISISNLSSKARDL 119

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
              K+LNWY+L +T YFLYGES+IYY K IV      LP++T            GFVFFV
Sbjct: 120 RSTKSLNWYWLATTMYFLYGESVIYYLKHIV------LPYSTD---------SPGFVFFV 164

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +LK  H KFQF+QFAWTHM L ++V Q+HFI+NN+ EGLIWF LP +LVI NDIFAYIC
Sbjct: 165 GSLKAGHLKFQFSQFAWTHMALFLIVVQAHFIMNNVLEGLIWFFLPAALVITNDIFAYIC 224

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LIKLSPKKT EGFVGA I TI+FG   ++LL R  Y ICPA +L    F G 
Sbjct: 225 GITFGRTQLIKLSPKKTVEGFVGAWIMTILFGIVLTNLLLRSKYFICPATNLGANIFTG- 283

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L CEPNPVFIP+ Y   P L  L    +     SV IAP+Q+H    A FASLIAPFGGF
Sbjct: 284 LECEPNPVFIPRTYT-TPELFFLPPNYSI----SVTIAPMQFHAFFWASFASLIAPFGGF 338

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F IKDFG SIPGHGG+TDRMDCQF+MG F+++YY +FI     +V  V++  
Sbjct: 339 FASGLKRTFKIKDFGDSIPGHGGMTDRMDCQFIMGLFAYIYYHTFIAFKRSSVSHVMELA 398

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           +  L   +Q+E+   + +YL +QG+++ 
Sbjct: 399 IMELTADEQMEVIKGVLKYLSNQGIVKS 426



>gi|448515671|ref|XP_003867388.1| Cds1 protein [Candida orthopsilosis Co 90-125]
 gi|380351727|emb|CCG21950.1| Cds1 protein [Candida orthopsilosis]
          Length = 447

 Score =  398 bits (1022), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 198/388 (51%), Positives = 269/388 (69%), Gaps = 5/388 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMI  FF+IL  GH+ +I +V++ Q L +KE+IA+   P+++KK+
Sbjct: 53  EKKKQAFITRTIWTFVMIGAFFVILASGHLPIIVMVLLFQFLTFKEIIALTSEPARDKKI 112

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           P+ ++LNWYFLI+T+Y+L   S + +F+  +  + FL     +H+ IS+ LY  GF+FFV
Sbjct: 113 PYNRSLNWYFLIATWYYLDFPSFVDFFQEEIFSNKFLTLLILNHKIISYSLYIAGFIFFV 172

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
             LKK +YKFQF Q   THMTLL+VV Q+H II NI  G+ WF LP +LVI NDIFAY+C
Sbjct: 173 WTLKKGYYKFQFAQLCVTHMTLLLVVFQAHLIIGNILNGIFWFFLPSALVIVNDIFAYVC 232

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LI++SPKKT EGFVGA ICT I     S +L + DY+ICPAQ+L +T  Y  
Sbjct: 233 GITFGRTQLIEISPKKTVEGFVGAWICTGIAAVIGSLILSKSDYLICPAQNL-STHLYNY 291

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
            +CEPNPVFIPQ Y L   +  LF      +I  +   P+ +H  ++A FASLIAPFGGF
Sbjct: 292 PSCEPNPVFIPQVYQLPQNIIDLFG----GNIELITFKPVYFHAAILATFASLIAPFGGF 347

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KRAF IKDFG +IPGHGGITDR DCQFLMG F+++YYQ+FI   ++ +G VLQ  
Sbjct: 348 FASGLKRAFGIKDFGDTIPGHGGITDRFDCQFLMGSFTYLYYQTFISNHNMNLGKVLQMA 407

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           + +L     I+L   + +YL  +G++++
Sbjct: 408 IINLSAPQLIQLIKSILRYLNREGVIDD 435



>gi|164662633|ref|XP_001732438.1| hypothetical protein MGL_0213 [Malassezia globosa CBS 7966]
 gi|159106341|gb|EDP45224.1| hypothetical protein MGL_0213 [Malassezia globosa CBS 7966]
          Length = 536

 Score =  394 bits (1011), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 200/406 (49%), Positives = 268/406 (66%), Gaps = 24/406 (5%)

Query: 5   WKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVP--------- 55
           WK +  R +++ +MI GF  IL +G  ++I LV+V++TLVY+EV A+ +VP         
Sbjct: 132 WKKIQERVVFSLLMIAGFMFILVMGPSYMILLVLVLETLVYREVTALFNVPGHTILSQQV 191

Query: 56  --------------SKEKKLPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPF 101
                          ++ +  W K+L+WYF     +FLYGE+++YYFK +VM D+  L F
Sbjct: 192 QNEVEDDDEGESQRERQAEELWSKSLSWYFFAVCNFFLYGETLVYYFKHVVMTDSLFLHF 251

Query: 102 ATHHRFISFVLYCIGFVFFVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGL 161
           A HHRFISF+LY  GF+ FV+NLK+ + K QF  F W HM+L+++V  SHF+++NI EG+
Sbjct: 252 ARHHRFISFMLYMFGFMAFVSNLKRRNLKHQFALFCWVHMSLMLIVLSSHFLVDNILEGI 311

Query: 162 IWFVLPVSLVICNDIFAYICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLR 221
           IWF +P SLVICND+FAY+CG  +GRTPLI LSPKKT EGF+GAL+ T+ F +FW+   +
Sbjct: 312 IWFWVPSSLVICNDVFAYVCGMMFGRTPLISLSPKKTVEGFIGALLITLAFSWFWAGFFQ 371

Query: 222 RWDYMICPAQDLTTTAFYGRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPL 281
           ++DYM+CPA  L  + F     CE N VF+ +   L  W+  +   L  + I +    P 
Sbjct: 372 QFDYMVCPAMSLGMSMF-NPPDCEVNSVFLVRTTALPSWIADILSHLVGRSITTFSWTPF 430

Query: 282 QWHVLVMACFASLIAPFGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHM 341
           Q H LVMA FASL+APFGGFFASG KRAF IKDFGHSIPGHGG+TDR DCQFLMG FS++
Sbjct: 431 QCHALVMAAFASLVAPFGGFFASGFKRAFKIKDFGHSIPGHGGLTDRFDCQFLMGLFSYV 490

Query: 342 YYQSFIKMSSLTVGAVLQTIVNSLKPQDQIELFNRLKQYLLSQGLL 387
           YY S I+ S ++V  V+Q I   L   DQ +L   L  YL+ QG L
Sbjct: 491 YYSSLIRDSRMSVQLVMQIITTQLPIADQKQLLQHLSSYLVDQGQL 536



>gi|241955909|ref|XP_002420675.1| CDP-diacylglycerol synthase, putative; CTP:phosphatidate
           cytidylyltransferase, putative; phosphatidate
           cytidylyltransferase, putative [Candida dubliniensis
           CD36]
 gi|223644017|emb|CAX41758.1| CDP-diacylglycerol synthase, putative [Candida dubliniensis CD36]
          Length = 452

 Score =  391 bits (1005), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 200/389 (51%), Positives = 265/389 (68%), Gaps = 11/389 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMI GFF IL  GH+ +I +V V Q L +KEVIA+   P+++KK+
Sbjct: 60  EKKKQAFVTRTIWTFVMIGGFFAILASGHLALIIMVSVFQMLTFKEVIALTSEPARDKKI 119

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           PW ++LNWYFL +T+Y+L   ++  +F+  V    FL     +H+FIS+ LY  GFVFFV
Sbjct: 120 PWNRSLNWYFLGTTWYYLDFPALFDFFQESVYSSKFLTLLVKNHKFISYSLYIAGFVFFV 179

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
             LKK +Y+FQF Q   THMTLL+VV Q+H II+NI +G+IWF LP +LVI NDIFAY+C
Sbjct: 180 WTLKKGYYRFQFAQLCVTHMTLLLVVFQAHLIIDNILQGIIWFFLPATLVIVNDIFAYLC 239

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LI++SPKKT EGFVGA ICT I G   S +L + DYMICPA++L +T  Y  
Sbjct: 240 GITFGRTQLIEISPKKTVEGFVGAWICTGIAGVIASHILSKSDYMICPAENL-STHLYNF 298

Query: 242 LTCEPNPVFIPQRYDLNPWLTSL--FRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFG 299
             C+ NP++IPQ Y L   +  +  +  +TFK        P  +H  V+A FASLIAPFG
Sbjct: 299 PHCDLNPIYIPQVYQLPAKIVEITGYELITFK--------PFYFHAAVLATFASLIAPFG 350

Query: 300 GFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQ 359
           GFFASG+KRAF IKDFG +IPGHGGITDR DCQFLMG F+++YY +F+   ++ +G VLQ
Sbjct: 351 GFFASGLKRAFGIKDFGDTIPGHGGITDRFDCQFLMGSFTYLYYHTFVSNQNVNLGHVLQ 410

Query: 360 TIVNSLKPQDQIELFNRLKQYLLSQGLLE 388
             + +L     I+L   L +YL  + +L 
Sbjct: 411 LAIMNLSVPQLIQLVKSLLKYLNREEVLS 439



>gi|260945753|ref|XP_002617174.1| hypothetical protein CLUG_02618 [Clavispora lusitaniae ATCC 42720]
 gi|238849028|gb|EEQ38492.1| hypothetical protein CLUG_02618 [Clavispora lusitaniae ATCC 42720]
          Length = 422

 Score =  390 bits (1002), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 199/388 (51%), Positives = 264/388 (68%), Gaps = 7/388 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIW+ VMIFGF +I+  GH+ +I LV++ Q L +KE+IA+   P+++K +
Sbjct: 31  EKKKQAFITRTIWSLVMIFGFIVIVLSGHLPLICLVILFQILTFKEIIALTAEPARDKNI 90

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           P+ K+LNWYFL+ST Y+L GES+  + + +V     +     +H+FIS+ LY  GFVFFV
Sbjct: 91  PYNKSLNWYFLLSTLYYLDGESLFEFLQEVVFNFKAMTFLYKNHKFISYSLYITGFVFFV 150

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
             LKK  Y+FQF Q   THMTLL+VV QSH II NIF G+ W +LP +LVI NDIFAY+C
Sbjct: 151 WTLKKGFYRFQFAQLCATHMTLLLVVFQSHLIIENIFNGIFWLLLPAALVIVNDIFAYLC 210

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LI++SPKKT EGFVGA ICT      +S +L R DY+ICP Q+  TTA    
Sbjct: 211 GITFGRTQLIEISPKKTVEGFVGAWICTGFAAVVFSYILSRSDYLICPVQNFYTTAL-NY 269

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
             C+PNPVFIPQ Y +   +  L        I  +   P+ +H  V+A FASLIAPFGGF
Sbjct: 270 PHCDPNPVFIPQLYPVPSNIAEL------TGISVIVFKPIYFHSAVLATFASLIAPFGGF 323

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KRAF IKDFG +IPGHGGITDR DCQFLMG FS++YYQ+FI  ++++V  +LQ  
Sbjct: 324 FASGLKRAFGIKDFGDTIPGHGGITDRFDCQFLMGSFSYLYYQTFIAFNNVSVAKLLQMA 383

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           V  L  +  ++L   L +YL + G+LE+
Sbjct: 384 VFHLSAEQILQLIKSLLRYLHTSGVLEQ 411



>gi|254570120|ref|XP_002492170.1| Phosphatidate cytidylyltransferase (CDP-diglyceride synthetase)
           [Komagataella pastoris GS115]
 gi|238031967|emb|CAY69890.1| Phosphatidate cytidylyltransferase (CDP-diglyceride synthetase)
           [Komagataella pastoris GS115]
 gi|328351343|emb|CCA37742.1| phosphatidate cytidylyltransferase [Komagataella pastoris CBS 7435]
          Length = 428

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 203/394 (51%), Positives = 270/394 (68%), Gaps = 7/394 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +   VR  WT VMI G F I+G GHIW I LVV++Q LV+KE I I    ++ + L
Sbjct: 26  EKKKQAFLVRAFWTLVMIAGMFFIIGAGHIWTILLVVLLQILVFKECITITTEKARIENL 85

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVD------AFLLPFATHHRFISFVLYCI 115
           P+  +LNWYFLI++ YFL GES+IY+    +  +       F   F  +HRFIS+ LY +
Sbjct: 86  PFTASLNWYFLITSIYFLDGESLIYHSINKLQTEDYERVFEFFKFFIVNHRFISYCLYVL 145

Query: 116 GFVFFVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICND 175
           GFVFFVA+L K +YKFQF Q   T MTLL+VV Q+H I+NNI  GLIWF+LPV LVI ND
Sbjct: 146 GFVFFVASLTKGYYKFQFAQLCITTMTLLLVVVQAHCIVNNILNGLIWFLLPVGLVIVND 205

Query: 176 IFAYICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTT 235
           IFAY+CG  +GRT LI++SPKKT EGFVGA ICT  F    S +  ++ Y+ICP +D  +
Sbjct: 206 IFAYLCGITFGRTQLIEISPKKTVEGFVGAWICTGAFSMILSYVFSKYTYLICPVEDNLS 265

Query: 236 TAFYGRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLI 295
             ++  +TC+PNP+FIPQ + L   L  L  R+ ++ +  V   P+ +H +V+A FASLI
Sbjct: 266 ANWFTGMTCDPNPIFIPQIFKLPEVLVDLAARVDYQ-VDFVSFKPIYFHSMVLATFASLI 324

Query: 296 APFGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVG 355
           APFGGFFASG+KRAF +KDFG +IPGHGGITDRMDCQFLMG FS++YY++FI  + + +G
Sbjct: 325 APFGGFFASGLKRAFKVKDFGDTIPGHGGITDRMDCQFLMGSFSYLYYETFISNNKVNIG 384

Query: 356 AVLQTIVNSLKPQDQIELFNRLKQYLLSQGLLEE 389
            +LQ+IV +L     + L   L +YL   G++ E
Sbjct: 385 TILQSIVINLSEDQIVILVQSLHKYLYKIGVINE 418



>gi|238882791|gb|EEQ46429.1| phosphatidate cytidylyltransferase [Candida albicans WO-1]
          Length = 451

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 199/391 (50%), Positives = 264/391 (67%), Gaps = 11/391 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMI GFF IL  GH+ +I +V V Q L +KEVIA+   P+++KK+
Sbjct: 59  EKKKQAFVTRTIWTFVMIGGFFAILASGHLALIIMVSVFQMLTFKEVIALTSEPARDKKI 118

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           PW ++LNWYFL +T+Y+L   ++  +F+  V    FL     +H+FIS+ LY  GFVFFV
Sbjct: 119 PWNRSLNWYFLGTTWYYLDFPALFDFFQESVYSSKFLTLLVKNHKFISYSLYIAGFVFFV 178

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
             LKK +Y+FQF Q   THMTLL+VV Q+H II+NI +G+IWF LP +LVI NDIFAY+C
Sbjct: 179 WTLKKGYYRFQFAQLCVTHMTLLLVVFQAHLIIDNILQGIIWFFLPATLVIVNDIFAYLC 238

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LI++SPKKT EGFVGA ICT I G   S +L + DYMICPA++L +T  Y  
Sbjct: 239 GITFGRTQLIEISPKKTVEGFVGAWICTGIAGVIASHILSKSDYMICPAENL-STHLYNF 297

Query: 242 LTCEPNPVFIPQRYDLNPWLTSL--FRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFG 299
             C+ NP++IPQ Y L   +  L     +TFK        P  +H  ++A FASLIAPFG
Sbjct: 298 PHCDLNPIYIPQVYQLPANIVELTGHELITFK--------PFYFHAAILATFASLIAPFG 349

Query: 300 GFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQ 359
           GFFASG+KRAF IKDFG +IPGHGGITDR DCQFLMG F+++YY +F+   ++ +G VLQ
Sbjct: 350 GFFASGLKRAFGIKDFGDTIPGHGGITDRFDCQFLMGSFTYLYYHTFVSNQNVNLGHVLQ 409

Query: 360 TIVNSLKPQDQIELFNRLKQYLLSQGLLEER 390
             + +L     ++L   L +YL  + +L   
Sbjct: 410 LAIMNLSVPQLLQLIKSLLKYLNREEVLTSE 440



>gi|68491050|ref|XP_710660.1| hypothetical protein CaO19.1279 [Candida albicans SC5314]
 gi|68491069|ref|XP_710651.1| hypothetical protein CaO19.8866 [Candida albicans SC5314]
 gi|46431882|gb|EAK91403.1| hypothetical protein CaO19.8866 [Candida albicans SC5314]
 gi|46431892|gb|EAK91412.1| hypothetical protein CaO19.1279 [Candida albicans SC5314]
          Length = 451

 Score =  389 bits (999), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 199/391 (50%), Positives = 264/391 (67%), Gaps = 11/391 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMI GFF IL  GH+ +I +V V Q L +KEVIA+   P+++KK+
Sbjct: 59  EKKKQAFVTRTIWTFVMIGGFFAILASGHLALIIMVSVFQMLTFKEVIALTSEPARDKKI 118

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           PW ++LNWYFL +T+Y+L   ++  +F+  V    FL     +H+FIS+ LY  GFVFFV
Sbjct: 119 PWNRSLNWYFLGTTWYYLDFPALFDFFQESVYSSKFLTLLVKNHKFISYSLYIAGFVFFV 178

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
             LKK +Y+FQF Q   THMTLL+VV Q+H II+NI +G+IWF LP +LVI NDIFAY+C
Sbjct: 179 WTLKKGYYRFQFAQLCVTHMTLLLVVFQAHLIIDNILQGIIWFFLPATLVIVNDIFAYLC 238

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LI++SPKKT EGFVGA ICT I G   S +L + DYMICPA++L +T  Y  
Sbjct: 239 GITFGRTQLIEISPKKTVEGFVGAWICTGIAGVIASHILSKSDYMICPAENL-STHLYNF 297

Query: 242 LTCEPNPVFIPQRYDLNPWLTSL--FRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFG 299
             C+ NP++IPQ Y L   +  L     +TFK        P  +H  ++A FASLIAPFG
Sbjct: 298 PHCDLNPIYIPQVYQLPANIVELTGHELITFK--------PFYFHAAILATFASLIAPFG 349

Query: 300 GFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQ 359
           GFFASG+KRAF IKDFG +IPGHGGITDR DCQFLMG F+++YY +F+   ++ +G VLQ
Sbjct: 350 GFFASGLKRAFGIKDFGDTIPGHGGITDRFDCQFLMGSFTYLYYHTFVSNQNVNLGHVLQ 409

Query: 360 TIVNSLKPQDQIELFNRLKQYLLSQGLLEER 390
             + +L     ++L   L +YL  + +L   
Sbjct: 410 LAIMNLSVPQLLQLIKSLLKYLNREEVLTSE 440



>gi|149238013|ref|XP_001524883.1| phosphatidate cytidylyltransferase [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146451480|gb|EDK45736.1| phosphatidate cytidylyltransferase [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 457

 Score =  388 bits (997), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 191/389 (49%), Positives = 262/389 (67%), Gaps = 5/389 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMI GFF+IL  GH+ +I +++V Q L +KE+IA+   P+++KK+
Sbjct: 60  EKKKEAFITRTIWTFVMIGGFFIILASGHLPIILMILVFQLLTFKEIIALTSEPARDKKI 119

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           P+ ++LNWYFL++T+Y+L       +F+  V  D  L      H+ +S+ LY  GF+FFV
Sbjct: 120 PYNRSLNWYFLVATWYYLDFPKFADFFQEKVFSDKLLTVLVKSHKLVSYSLYMAGFIFFV 179

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
             LKK +YKFQF Q   THMTLL+VV Q+H II+NI  G+ WF LP +LVI NDIFAYIC
Sbjct: 180 WTLKKGYYKFQFAQLCITHMTLLLVVFQAHLIIDNILNGIFWFFLPSALVIVNDIFAYIC 239

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +G+T LI++SPKKT EGF+GA ICT I     +SL  + DY+ICPAQ+L +T  Y  
Sbjct: 240 GITFGKTQLIEISPKKTVEGFLGAWICTGIAAVIGASLFSKSDYLICPAQNL-STHLYNF 298

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
             C+PNPVFIPQ Y L   +  L        I  +   P+ +H  ++A FASLIAPFGGF
Sbjct: 299 PQCDPNPVFIPQIYQLPANIIELLG----GKIEMITFKPIYFHAAILATFASLIAPFGGF 354

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KRAF IKDFG +IPGHGGITDR DCQFLMG F+++YYQ+FI   ++ +G +LQ  
Sbjct: 355 FASGLKRAFGIKDFGDTIPGHGGITDRFDCQFLMGSFTYLYYQTFISNHNMNLGKILQMA 414

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           + +L     ++L   + +YL  + ++ + 
Sbjct: 415 IINLSVPQLLQLVKSILRYLNREQVVSDE 443



>gi|459367384|gb|EMG46422.1| Phosphatidate cytidylyltransferase [Candida maltosa Xu316]
          Length = 431

 Score =  386 bits (992), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 195/382 (51%), Positives = 264/382 (69%), Gaps = 11/382 (2%)

Query: 10  VRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKLPWFKTLNW 69
            RTIWTFVMI GFF  L  GH+ +I +V++ + L +KEVIA+   P+++KK+PW ++LNW
Sbjct: 47  TRTIWTFVMIGGFFFTLASGHVPLIVMVLLFEMLTFKEVIALTSEPARDKKIPWNRSLNW 106

Query: 70  YFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFVANLKKHHY 129
           YFL +T+Y+L   S+  +F+  V  + FL     +H+FIS+ LY  GFVFFV  LKK +Y
Sbjct: 107 YFLGTTWYYLDFPSLFAFFQDSVYSNKFLTLLVLNHKFISYSLYIAGFVFFVWTLKKGYY 166

Query: 130 KFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYICGFFWGRTP 189
           KFQF Q   THM LL+VV Q+H II+NI  G++WF LP +LVI NDIFAY+CG  +GRT 
Sbjct: 167 KFQFAQLCVTHMALLLVVFQAHLIISNILNGIVWFFLPATLVIVNDIFAYLCGITFGRTQ 226

Query: 190 LIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGRLTCEPNPV 249
           LI++SPKKT EGF GA ICT I G   S +L + DY+ICPA++L +T  Y    CEPNP+
Sbjct: 227 LIEISPKKTVEGFAGAWICTGIAGIIASYILSKSDYLICPAENL-STHLYNFPHCEPNPI 285

Query: 250 FIPQRYDLNPWLTSL--FRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGFFASGVK 307
           FIPQ Y L   +  L  +  +TFK        P  +H  ++A FASLIAPFGGFFASG+K
Sbjct: 286 FIPQVYQLPANIIELTGWEIITFK--------PFYFHSAILATFASLIAPFGGFFASGLK 337

Query: 308 RAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTIVNSLKP 367
           RAF IKDFG +IPGHGGITDR DCQFLMG F+++YYQ+F+   ++ +G++LQ  + +L  
Sbjct: 338 RAFGIKDFGDTIPGHGGITDRFDCQFLMGSFTYLYYQTFVSNQNINLGSILQLAIINLSV 397

Query: 368 QDQIELFNRLKQYLLSQGLLEE 389
              ++L   L +YL  + ++ +
Sbjct: 398 PQLLQLVKSLLKYLNREDVVND 419



>gi|472584042|gb|EMS21658.1| phosphatidate cytidylyltransferase [Rhodosporidium toruloides NP11]
          Length = 646

 Score =  385 bits (988), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 196/412 (47%), Positives = 266/412 (64%), Gaps = 29/412 (7%)

Query: 3   QKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAI-------AHVP 55
           +K + +  RT+W FV+  G   ++ +GH++VI L+ VIQ +V+KE+  +       AHV 
Sbjct: 230 KKIQAIITRTVWGFVLAGGAIGLVLMGHVYVIALIFVIQAMVFKELTNLFDVGYSGAHVT 289

Query: 56  S-----------------KEKKLPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFL 98
                             KE++  W + + WYF   T Y+LYGES+IYYFK ++ + A  
Sbjct: 290 EEGKMTRTPEKEAKRRGRKEQRERWSRQMAWYFFAVTNYYLYGESLIYYFKHVLTLQASF 349

Query: 99  LP----FATHHRFISFVLYCIGFVFFVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFII 154
           LP    F+ HHR ISF LY IGFV FVA L +   + QF  F W HM+LL++V  SHFI+
Sbjct: 350 LPTAYSFSQHHRLISFGLYTIGFVSFVATLNRSSLRRQFGLFGWIHMSLLLIVVSSHFIV 409

Query: 155 NNIFEGLIWFVLPVSLVICNDIFAYICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGF 214
           NNI EG+IWF +PV+LVI NDI AY+ G  +GR  LIKLSPKKT EGFVGA   T++F +
Sbjct: 410 NNILEGMIWFWVPVALVIINDIAAYVFGMAFGRHQLIKLSPKKTVEGFVGAFFFTMLFAY 469

Query: 215 FWSSLLRRWDYMICPAQDLTTTAFYGRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIR 274
            W+++  R++YMICPAQDL+T  F  R+ C+PNP F      L   LT L   +T   I 
Sbjct: 470 VWATIFMRYNYMICPAQDLSTNVF-SRVQCKPNPCFEWHELPLPSALTDLLAPITRHHIT 528

Query: 275 SVWIAPLQWHVLVMACFASLIAPFGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFL 334
           S+  AP Q H +V+A FASL+APFGGFFASG KRAF IKDFG +IPGHGG+TDRMDCQF+
Sbjct: 529 SIPWAPFQLHSVVLAAFASLVAPFGGFFASGFKRAFGIKDFGDTIPGHGGLTDRMDCQFI 588

Query: 335 MGCFSHMYYQSFIKMSSLTVGAVLQTIVNSLKPQDQIELFNRLKQYLLSQGL 386
            G F+ +YY +F++ S +T  +V+ TI   L  + Q+EL   L ++L+ +G+
Sbjct: 589 NGIFTFVYYSAFVRESYITPTSVMATIATHLTTEQQVELLGELSRFLMQKGV 640



>gi|363751244|ref|XP_003645839.1| hypothetical protein Ecym_3548 [Eremothecium cymbalariae
           DBVPG#7215]
 gi|356889473|gb|AET39022.1| Hypothetical protein Ecym_3548 [Eremothecium cymbalariae
           DBVPG#7215]
          Length = 435

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 194/388 (50%), Positives = 251/388 (64%), Gaps = 7/388 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
             K  N  VRTIWT +MI GFF+ L LGH W + L++  Q   +KE IA+     +EK L
Sbjct: 43  ESKTYNFVVRTIWTMIMISGFFVTLALGHFWCVMLILGCQIATFKECIAVTGQSGREKNL 102

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           P  +TLNWYFL +T Y+L G S++ +FK   M        A++H+FIS+ LY +GF+ FV
Sbjct: 103 PLTRTLNWYFLFTTIYYLDGRSLLKFFKDNSMNYGLFSFVASNHKFISYCLYVLGFIVFV 162

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K   KFQF     THM LL+VV Q+H IINN+  GLIWF+LP  LVI NDIFAY+C
Sbjct: 163 CSLRKGFLKFQFATLCITHMVLLLVVFQAHLIINNVLNGLIWFLLPCGLVIVNDIFAYLC 222

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LI +SPKKT EGF+GA   T +     + LL  + YM CP +D+ T  F+  
Sbjct: 223 GITFGRTKLIAISPKKTLEGFIGAWFFTALASIVLTRLLTPYSYMTCPVRDIHTN-FFTP 281

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L C+ NPVFIPQ Y L P    LF R    DI S+ I P+  H L +A FASL APFGGF
Sbjct: 282 LNCDINPVFIPQEYRLPPI---LFERF---DILSITIKPIYLHALNLATFASLFAPFGGF 335

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F +KDFGHSIPGHGGITDR+DCQF+MG F ++Y+++FI    +TV  VL TI
Sbjct: 336 FASGLKRTFKVKDFGHSIPGHGGITDRVDCQFMMGSFMNLYFETFINEKRITVETVLSTI 395

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           + +   +  I+L + L   L + G + E
Sbjct: 396 IMNFDERQIIQLIDSLNHILFNNGSISE 423



>gi|344301871|gb|EGW32176.1| hypothetical protein SPAPADRAFT_61264 [Spathaspora passalidarum
           NRRL Y-27907]
          Length = 438

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 197/397 (49%), Positives = 263/397 (66%), Gaps = 21/397 (5%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMI  FFL+L  GH  +I +V++ Q L +KE+I +   P+++KK+
Sbjct: 46  EKKKQAFITRTIWTFVMIGLFFLLLSSGHFALILMVLLFQILTFKEIIGLVSEPARDKKI 105

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           P+ ++LNWYF+ +T+Y+L   S + +F+  +  + +L     +H+FI + LY  GFVFFV
Sbjct: 106 PYNRSLNWYFVAATWYYLDFPSFVDFFQDSIYSNKYLTLLVLNHKFICYSLYIAGFVFFV 165

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
             LKK +YKFQF Q   THM LL++V Q+H II+NI  G+IWF LP +LVI ND+FAYIC
Sbjct: 166 WTLKKGYYKFQFAQLCVTHMALLLIVFQAHLIISNILRGIIWFFLPAALVIVNDVFAYIC 225

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LI++SPKKT EGFVGA ICT I    +S +L R DYMICPAQ+L +T  Y  
Sbjct: 226 GITFGRTQLIEISPKKTVEGFVGAWICTGIATIIFSYILSRSDYMICPAQNL-STHLYNY 284

Query: 242 LTCEPNPVFIPQRY-------DLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASL 294
             CEPNPVFIP  Y       DL  W    FR             PL +H  ++A FASL
Sbjct: 285 PHCEPNPVFIPHIYQLPQNIIDLTGWEIISFR-------------PLYFHTAILATFASL 331

Query: 295 IAPFGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTV 354
           IAPFGGFFASG+KRAF IKDFG +IPGHGGITDR DCQF+MG F+++YYQ+FI  S+L +
Sbjct: 332 IAPFGGFFASGLKRAFGIKDFGDTIPGHGGITDRFDCQFIMGSFTYLYYQTFISNSNLNL 391

Query: 355 GAVLQTIVNSLKPQDQIELFNRLKQYLLSQGLLEERG 391
           G +LQ  + +L     I+L   L +YL  + ++ +  
Sbjct: 392 GKILQLAIINLSTPQLIQLVKSLMRYLNREHVIPDDN 428



>gi|50312289|ref|XP_456177.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49645313|emb|CAG98885.1| KLLA0F24640p [Kluyveromyces lactis]
          Length = 440

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 196/388 (50%), Positives = 255/388 (65%), Gaps = 7/388 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
             K  N  VRTIWTFVMI GFF+IL  GH W + L++  Q   +KE IA+     +EK L
Sbjct: 48  DSKLYNFAVRTIWTFVMIAGFFIILASGHFWCVVLILGCQIATFKECIAVTGQSGREKNL 107

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           P  KTLNWYFL +T Y+L G+S+  +F    +    L   A++H+FIS+ LY +GFV FV
Sbjct: 108 PLTKTLNWYFLFTTIYYLDGKSLFKFFNDTFVKYTVLNFVASNHKFISYCLYVLGFVIFV 167

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K + KFQF     THM LL+VV Q+H IINN+  GLIWF+LP  LVI NDIFAY+C
Sbjct: 168 CSLRKGYLKFQFASLCVTHMVLLLVVFQAHLIINNVLNGLIWFLLPCGLVIVNDIFAYLC 227

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LI++SPKKT EGF+GA   T I     + LL  + YM CP  DL T  F+  
Sbjct: 228 GITFGRTKLIEISPKKTLEGFLGAWFFTAIASVLLTRLLAPYYYMTCPVTDLKTN-FFTA 286

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L+CE NPVF+PQ Y L P    +F ++    +  + I P+  H L +A FASL APFGGF
Sbjct: 287 LSCELNPVFVPQDYRLPPI---IFEKI---GVDVITIKPVYLHALNLATFASLFAPFGGF 340

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F +KDFG SIPGHGGITDR+DCQFLMG F ++YY++FI  + +TVG V+ TI
Sbjct: 341 FASGLKRTFQVKDFGDSIPGHGGITDRVDCQFLMGSFMNLYYETFISENRITVGTVVSTI 400

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           + +L     IEL + L + L   G++ +
Sbjct: 401 LMNLDTNQIIELIHTLNKALYDNGVMNK 428



>gi|255712657|ref|XP_002552611.1| KLTH0C08910p [Lachancea thermotolerans]
 gi|238933990|emb|CAR22173.1| KLTH0C08910p [Lachancea thermotolerans CBS 6340]
          Length = 439

 Score =  382 bits (981), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 191/385 (49%), Positives = 253/385 (65%), Gaps = 7/385 (1%)

Query: 7   NMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKLPWFKT 66
           N  VRT+WTF+MI GFF+ L  GH W + L++  Q   +KE I +  +  ++K LP  KT
Sbjct: 52  NFFVRTVWTFIMISGFFITLASGHFWCVMLILACQIAAFKECIRVTAMSGRQKNLPLSKT 111

Query: 67  LNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFVANLKK 126
           LNWYFL +T Y+L G+S+  +F+  V+   FL   A++H FI + LY +GFV FV +L+K
Sbjct: 112 LNWYFLFTTIYYLDGKSLFQFFQYYVVNYRFLSMIASNHFFICYCLYVLGFVIFVCSLRK 171

Query: 127 HHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYICGFFWG 186
            + KFQF     THM LL+VV Q+H +INN+  GLIWF+LP  LVI NDIFAY+CG  +G
Sbjct: 172 GYLKFQFASLCVTHMVLLLVVFQAHLVINNVLNGLIWFLLPCGLVIVNDIFAYLCGITFG 231

Query: 187 RTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGRLTCEP 246
           RT LI++SPKKT EGF+GA   T I     + LL  + YM CP  D+ T  F   L C+P
Sbjct: 232 RTKLIEISPKKTLEGFLGAWFFTAIASIILTRLLTPFSYMTCPVNDIQTNLF-TSLQCDP 290

Query: 247 NPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGFFASGV 306
           NPVF+PQ Y L P    +F +L   +I S+ I P+  H L +A FASL APFGGFFASG+
Sbjct: 291 NPVFVPQEYRLPPI---IFEKL---NISSITIKPIYLHALNLATFASLFAPFGGFFASGL 344

Query: 307 KRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTIVNSLK 366
           KR F +KDFG SIPGHGGITDR+DCQFLMG F ++YY++FI    +TV  V+ TI+ +  
Sbjct: 345 KRTFQVKDFGQSIPGHGGITDRIDCQFLMGSFMNLYYETFISEKRVTVETVISTILMNFN 404

Query: 367 PQDQIELFNRLKQYLLSQGLLEERG 391
            +  +EL   L + L S G L ++ 
Sbjct: 405 EKQMVELIKILNEVLYSNGYLSDKA 429



>gi|366988405|ref|XP_003673969.1| hypothetical protein NCAS_0A10300 [Naumovozyma castellii CBS 4309]
 gi|342299832|emb|CCC67588.1| hypothetical protein NCAS_0A10300 [Naumovozyma castellii CBS 4309]
          Length = 442

 Score =  382 bits (981), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 195/390 (50%), Positives = 252/390 (64%), Gaps = 7/390 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
             K  N  +RTIWTFVMI GFF  L  GHIW + L+V  Q   +KE IA+     +EK L
Sbjct: 47  ENKKSNFIIRTIWTFVMIGGFFATLASGHIWCVLLIVWCQIATFKECIAVTSASGREKNL 106

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           P  +TLNWYFL +T Y+L G S+  +F +      FL   A +H+FI + LY +GFV FV
Sbjct: 107 PLTRTLNWYFLFTTIYYLDGTSLFNFFNSSFYEYRFLSIIAANHKFICYCLYVMGFVLFV 166

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K   KFQF     THM LL+VV Q+H IINN+  GL WF+LP  LVI NDIFAY+C
Sbjct: 167 CSLRKGFLKFQFASLCITHMVLLLVVFQAHLIINNVLSGLFWFLLPCGLVIVNDIFAYLC 226

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LI++SPKKT EGF+GA   T +     + LL  + Y+ CP QD+ T  F+  
Sbjct: 227 GITFGRTKLIEISPKKTLEGFLGAWFFTALASIILTRLLAPFLYLTCPVQDIHTN-FFTP 285

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           +TCE NPVFIPQ Y L P +   F       I S+ I P+ +H L +A FASL APFGGF
Sbjct: 286 ITCELNPVFIPQEYRLPPIVFEKF------GISSITIKPIYFHALNLATFASLFAPFGGF 339

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F +KDFGHSIPGHGGITDR+DCQFLMG F+++YY++FI    +TV  VL TI
Sbjct: 340 FASGLKRTFKVKDFGHSIPGHGGITDRIDCQFLMGSFANLYYETFISEHRITVETVLSTI 399

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEERG 391
           + +L  ++ ++L   L   L  + ++EE  
Sbjct: 400 LMNLNEKEILQLVETLTTILFKKEVIEESS 429



>gi|126137253|ref|XP_001385150.1| hypothetical protein PICST_78259 [Scheffersomyces stipitis CBS
           6054]
 gi|126092372|gb|ABN67121.1| CDP-diacylglycerol synthase [Scheffersomyces stipitis CBS 6054]
          Length = 437

 Score =  381 bits (978), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 191/388 (49%), Positives = 261/388 (67%), Gaps = 5/388 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWT +MI  FF +L  GH+ +I LV++ Q L +KE+IA+   P+++KK+
Sbjct: 44  EKKKQAFVTRTIWTLIMIVFFFFVLASGHLALIALVLLFQILTFKEIIALTSEPARDKKI 103

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           P+ K+LNWYFL+ T Y+L  +S   +F+  V  + +L     +HRFIS+ L+  GF+FFV
Sbjct: 104 PYNKSLNWYFLLCTVYYLDSQSFFNFFQDSVYSNKYLTVLVLNHRFISYSLFIAGFIFFV 163

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
             LKK +YKFQF Q   THMTL++VV QSH II+NI  G+ WF LP  +VI NDIFAY+C
Sbjct: 164 WTLKKGYYKFQFAQLCITHMTLVLVVFQSHLIIDNILNGIFWFFLPCGVVIVNDIFAYLC 223

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +G+T LI++SPKKT EGFVGA +CT I    +S +L + DY++CPA +L +T  Y  
Sbjct: 224 GITFGKTQLIEISPKKTVEGFVGAWVCTTIAAVIFSYILTQSDYLVCPAVNL-STHLYNF 282

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
             CEPNPVFIPQ Y +   +  L           + I P+ +H  V+A FASLIAPFGGF
Sbjct: 283 PHCEPNPVFIPQIYQIPQNIIDLIG----GRYEILSIKPMYFHACVLATFASLIAPFGGF 338

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KRAF IKDFG +IPGHGG+TDRMDCQFLMG FS++YYQ+FI   ++ +G +LQ  
Sbjct: 339 FASGLKRAFGIKDFGDTIPGHGGVTDRMDCQFLMGSFSYLYYQTFISPHNVNIGKILQLA 398

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEE 389
           + +L      +L   L +YL S   +++
Sbjct: 399 IINLSTPQLFQLVKSLLKYLNSLNAVDD 426



>gi|294657967|ref|XP_460277.2| DEHA2E22462p [Debaryomyces hansenii CBS767]
 gi|199433088|emb|CAG88558.2| DEHA2E22462p [Debaryomyces hansenii CBS767]
          Length = 440

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 196/393 (49%), Positives = 263/393 (66%), Gaps = 9/393 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWT VMI  FF  L  GH+ +I +V ++QTL +KE+I++   P+++KKL
Sbjct: 43  EKKKQAFVTRTIWTIVMIAFFFTCLLSGHLALISVVFLLQTLTFKEIISLTAEPARDKKL 102

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           P+ K LNWYFL +T Y+L  ES   +F+  +  +  L   A HH+ IS+  Y  GF+FFV
Sbjct: 103 PFNKLLNWYFLFATIYYLDSESFFNFFQESIYDNKILSLLAIHHKIISYTSYIAGFIFFV 162

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A L+K +YKFQF Q   TH TL++VV QSH II+NI  GLIWF LPV LVI NDIFAY+C
Sbjct: 163 ATLQKGYYKFQFAQLCMTHTTLILVVFQSHLIIDNILNGLIWFFLPVGLVIVNDIFAYLC 222

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAF-YG 240
           G  +GRT LI +SPKKT EGFVGA +CT +F   ++  L +  Y+ICPA +LTT  F Y 
Sbjct: 223 GITFGRTQLIAISPKKTVEGFVGAWVCTGLFALLFAFFLSKSSYLICPATNLTTNIFNYP 282

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
           R  C+PNPVFI Q Y L   L  +F       + ++ + P+  H L  A FASLIAPFGG
Sbjct: 283 R--CDPNPVFISQIYQLPANLVEIFH------LETISLKPIYIHALNFATFASLIAPFGG 334

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG+KRAF IKDFG +IPGHGGITDR+DCQF MG FS++Y Q+F+ +S + +G +LQ 
Sbjct: 335 FFASGLKRAFGIKDFGDTIPGHGGITDRLDCQFFMGSFSYLYIQTFVSISHVNIGNLLQL 394

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLEERGAT 393
            + +L     ++L   L +YL + G++++   T
Sbjct: 395 AIMNLSIPQVVQLVKSLLKYLNNSGVVDDNKLT 427



>gi|443701157|gb|ELT99753.1| hypothetical protein CAPTEDRAFT_161806 [Capitella teleta]
          Length = 445

 Score =  380 bits (975), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 194/388 (50%), Positives = 266/388 (68%), Gaps = 7/388 (1%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           ++ +W+N  +R I++ +MIF F  ++ LG + V+ LV+VIQ   + E+I I +V  K  +
Sbjct: 59  LTPRWRNWIIRGIFSLIMIFSFGGVIWLGPLAVVLLVMVIQIKCFHEIITIGYVVYKSHE 118

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFLI + YF YGES+I YF  ++    F+ PF T+HRF SF LY  G V F
Sbjct: 119 LPWFRTLSWYFLICSNYFFYGESMIQYFGVLLSRTEFMTPFVTYHRFFSFSLYISGIVAF 178

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY  QFT F WTH+TL+I+V QSH II NIFEGLIWF++PVS++ICNDI AYI
Sbjct: 179 VLSLVKKHYLKQFTLFGWTHVTLVILVTQSHLIIQNIFEGLIWFLVPVSMIICNDIMAYI 238

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQ-DLTTTAFY 239
            GFF+GRTPLIKLSPKKTWEGF+G    T+++G   S +L ++D+ +CP + D+   +  
Sbjct: 239 FGFFFGRTPLIKLSPKKTWEGFIGGAFSTVVWGLMISYILVQFDFFVCPIEYDMAAESL- 297

Query: 240 GRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFG 299
             L+CE  PVF    Y L  ++ +L R +      +    P+  H + M+ FAS+I PFG
Sbjct: 298 -SLSCERAPVFKLAEYTLPQFVQNLCRTVGIH-CNTFTTYPMMLHSIYMSLFASIIGPFG 355

Query: 300 GFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQ 359
           GFFASG KRAF IKDFG +IPGHGG  DR DCQ LM  F H+Y+ SFIK  +++   ++Q
Sbjct: 356 GFFASGFKRAFKIKDFGDTIPGHGGFMDRFDCQLLMATFVHVYHSSFIK--AVSPQKLVQ 413

Query: 360 TIVNSLKPQDQIELFNRLKQYLLSQGLL 387
            I+ SLKP++Q+++FN L+  L  +GLL
Sbjct: 414 QIL-SLKPEEQLQVFNMLRDGLTQRGLL 440



>gi|410079627|ref|XP_003957394.1| hypothetical protein KAFR_0E01050 [Kazachstania africana CBS 2517]
 gi|372463980|emb|CCF58259.1| hypothetical protein KAFR_0E01050 [Kazachstania africana CBS 2517]
          Length = 428

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 190/393 (48%), Positives = 258/393 (65%), Gaps = 7/393 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
           S+K+ N  +RT+WTFVMI GFFL L  GH+W + L++  Q   + E+I +    S+EKKL
Sbjct: 33  SKKY-NFIIRTVWTFVMIAGFFLTLAAGHLWCVVLILGCQVATFSEIIDVTLQSSREKKL 91

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           P  +TLNWYFL +T YFL GE++   F+        L   A++H+FI + LY +GFV FV
Sbjct: 92  PLTRTLNWYFLFTTIYFLDGEALYKLFQTTFFKYRALAFIASNHKFICYCLYLLGFVIFV 151

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           A+L+K H KFQF     THM L+ VV Q+H IINN+  G+ WF+LP  LVI NDIFAY+C
Sbjct: 152 ASLRKGHLKFQFGSLCATHMVLVFVVTQAHLIINNVLNGIFWFLLPCGLVIVNDIFAYLC 211

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LI++SPKKT EGF+GA   T +     + +L  + Y+ CP  DL T  F G 
Sbjct: 212 GITFGRTKLIEISPKKTLEGFIGAWFFTALASIILTRILSPYSYLTCPVNDLQTNFFTG- 270

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           LTC+ NP+F+ Q Y L P      +  T   + +V + P+ +H L +A FASL APFGGF
Sbjct: 271 LTCDLNPIFLSQTYKLPP-----LKIFTQFSLHTVVLKPVYFHALNLATFASLFAPFGGF 325

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F +KDFGHSIPGHGGITDR+DCQFLMG F+++YY++FI    +TV  VL TI
Sbjct: 326 FASGLKRTFKVKDFGHSIPGHGGITDRVDCQFLMGSFANLYYETFISEHRITVETVLSTI 385

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEERGATN 394
           + +L  ++ I+L   L + L ++G ++     N
Sbjct: 386 LMNLNEREIIQLIETLLEALHTRGFIDNEKTYN 418



>gi|448080479|ref|XP_004194646.1| Piso0_005153 [Millerozyma farinosa CBS 7064]
 gi|359376068|emb|CCE86650.1| Piso0_005153 [Millerozyma farinosa CBS 7064]
          Length = 434

 Score =  378 bits (971), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 196/390 (50%), Positives = 255/390 (65%), Gaps = 11/390 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    R+IW  VMI  F +++  GH+ +I  V   Q L +KE+I +   P+++K L
Sbjct: 40  EKKKQAFITRSIWGLVMIALFLVLVSSGHLSLILAVFTFQYLTFKEIIKLTSEPARDKNL 99

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           P+ K LNWYFL +T Y+L  ES+  +F+  +  +  L   A HH+FIS+ LY  GFVFFV
Sbjct: 100 PFNKLLNWYFLFATIYYLDSESVFNFFQEKIYSNKILSMLAIHHKFISYSLYIAGFVFFV 159

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
             LKK +YKFQF Q   THMTLL+VV QSH II+NI  G+IWFVLP SLVI NDIFAYIC
Sbjct: 160 TTLKKGYYKFQFAQLCATHMTLLLVVFQSHLIIDNILNGIIWFVLPCSLVIVNDIFAYIC 219

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LI +SPKKT EGF+GA +CT      +S +L  + Y+ICPA++LTT      
Sbjct: 220 GITFGRTQLIAISPKKTVEGFIGAWVCTGAASLLFSFILSNFSYLICPAENLTTY-IGNH 278

Query: 242 LTCEPNPVFIPQRYDLNPWLTSL--FRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFG 299
             CEPNPVF PQ + L   L     F  +TFK        P+  H L +A FASLIAPFG
Sbjct: 279 PQCEPNPVFSPQIFQLPSNLAEFFGFSIITFK--------PIYIHSLNLATFASLIAPFG 330

Query: 300 GFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQ 359
           GFFASG+KRAF IKDFG +IPGHGGITDR+DCQFLMG FS++Y+Q+FI  + +++G VLQ
Sbjct: 331 GFFASGLKRAFGIKDFGDTIPGHGGITDRLDCQFLMGSFSYLYFQTFISNNRVSIGNVLQ 390

Query: 360 TIVNSLKPQDQIELFNRLKQYLLSQGLLEE 389
             + +L       L   + +YL + G L +
Sbjct: 391 MAIINLSVPQLFHLVQAILRYLNNSGFLND 420



>gi|392594027|gb|EIW83352.1| phosphatidate cytidylyltransferase [Coniophora puteana RWD-64-598
           SS2]
          Length = 345

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 193/346 (55%), Positives = 243/346 (70%), Gaps = 6/346 (1%)

Query: 41  QTLVYKEVIAIAHVPSKEKKLPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLP 100
           QTLVY+EV A+    S ++  P   +   YF     YFLYGESIIYYFK +V VD  LLP
Sbjct: 4   QTLVYREVTALF---SLKRVAP--DSTEIYFWAVANYFLYGESIIYYFKHVVFVDGQLLP 58

Query: 101 FATHHRFISFVLYCIGFVFFVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEG 160
           FA +HR ISF LY IGF+ FV +LK+ + K QF  F W HM+LL++V  SHFI+NNI EG
Sbjct: 59  FAMNHRIISFTLYTIGFMGFVMSLKRGYLKQQFGLFCWVHMSLLLIVVSSHFIVNNILEG 118

Query: 161 LIWFVLPVSLVICNDIFAYICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLL 220
           LIWF +P SLVICND+FAY+ G   GRTPLIKLSPKKT EGFVGA   T++F   W +  
Sbjct: 119 LIWFFVPASLVICNDVFAYVWGMTIGRTPLIKLSPKKTVEGFVGAFWSTLLFSLAWGTYF 178

Query: 221 RRWDYMICPAQDLTTTAFYGRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAP 280
            R+DYMICP  DL  +A +  + C PNPVF+ Q +++   L     ++  + I  +   P
Sbjct: 179 MRFDYMICPVHDLGVSA-WSAVKCVPNPVFVWQEWEIWAPLRVFLSQVLGRSITHIPYVP 237

Query: 281 LQWHVLVMACFASLIAPFGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSH 340
            Q H++V A FASL+APFGGFFASG KRAFNIKDFGHSIPGHGG+TDRMDCQFLMG F++
Sbjct: 238 YQLHLIVFAIFASLVAPFGGFFASGFKRAFNIKDFGHSIPGHGGMTDRMDCQFLMGVFTY 297

Query: 341 MYYQSFIKMSSLTVGAVLQTIVNSLKPQDQIELFNRLKQYLLSQGL 386
           +YY S I+   +TVG+VLQ +V+ L   +Q+ELFN L +YL  +G+
Sbjct: 298 VYYSSLIREHHITVGSVLQQVVSGLTLNEQVELFNDLARYLQGRGI 343



>gi|365982563|ref|XP_003668115.1| hypothetical protein NDAI_0A07180 [Naumovozyma dairenensis CBS 421]
 gi|343766881|emb|CCD22872.1| hypothetical protein NDAI_0A07180 [Naumovozyma dairenensis CBS 421]
          Length = 437

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 189/391 (48%), Positives = 256/391 (65%), Gaps = 8/391 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
             K  N  VRT WT +MI GFF+I+G GHIW + L++  Q  V+ E IA+     +EK L
Sbjct: 39  ESKKSNFLVRTFWTLIMIAGFFIIIGSGHIWCVILILGCQIAVFSECIAVTSASGREKNL 98

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAF--LLPFATHHRFISFVLYCIGFVF 119
           P  KTLNWYFL +T Y+L G S + +F+  +    +  +   AT+H+FI +  Y IGFV 
Sbjct: 99  PLTKTLNWYFLFTTIYYLNGLSFLSFFQRRLSFFEYKIIAIIATNHKFICYCFYVIGFVL 158

Query: 120 FVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAY 179
           FV +L+K   KFQF     THM LL+VV Q H I+NN+  G+IWF+LP  LVI NDIFAY
Sbjct: 159 FVCSLRKGFLKFQFASLCVTHMALLLVVFQGHLIMNNLLNGIIWFLLPCGLVIVNDIFAY 218

Query: 180 ICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFY 239
           +CG  +GRT LI++SPKKT EGF+GA   T +     + LL  +DY+ CPA +   + F+
Sbjct: 219 LCGITFGRTKLIEISPKKTLEGFLGAWFFTALASIILTRLLTPYDYLTCPAANEINSNFF 278

Query: 240 GRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFG 299
             +TC+ NPVFIPQ Y L+P    +F ++    I S+ + P+ +H L +A FASL APFG
Sbjct: 279 TFVTCDLNPVFIPQEYRLSPM---VFDKI---GISSITMKPIYFHALNLATFASLFAPFG 332

Query: 300 GFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQ 359
           GFFASG+KR F +KDFGHSIPGHGGITDR+DCQF+MG F+++YY++FI    +TV  VL 
Sbjct: 333 GFFASGLKRTFKVKDFGHSIPGHGGITDRIDCQFIMGSFANLYYETFISEHRITVDTVLS 392

Query: 360 TIVNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           TI+ +L  +  IEL + L   L  + ++ E 
Sbjct: 393 TILMNLNDKQIIELISVLNSVLFKKEVVGEE 423



>gi|448084987|ref|XP_004195742.1| Piso0_005153 [Millerozyma farinosa CBS 7064]
 gi|359377164|emb|CCE85547.1| Piso0_005153 [Millerozyma farinosa CBS 7064]
          Length = 434

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 193/390 (49%), Positives = 255/390 (65%), Gaps = 11/390 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    R+IW  VMI  F +++  GH+ +I  V   Q L +KE+I +   P+++K L
Sbjct: 40  EKKKQAFITRSIWGLVMIALFLVLVSSGHLSLILAVFTFQYLTFKEIIKLTSEPARDKNL 99

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           P+ K LNWYFL +T Y+L  ES+  +F+  +  +  L   A HH+FIS+ LY  GFVFFV
Sbjct: 100 PFNKLLNWYFLFATIYYLDSESVFNFFQEKIYSNKILSMLAIHHKFISYSLYIAGFVFFV 159

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
             LK  +YKFQF Q   THMTLL+VV QSH II+NI  G+IWFVLP SLVI NDIFAY+C
Sbjct: 160 TTLKTGYYKFQFAQLCATHMTLLLVVFQSHLIIDNILNGIIWFVLPCSLVIVNDIFAYLC 219

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LI +SPKKT EGF+GA +CT +     S +L  + Y+ICPA++LTT      
Sbjct: 220 GITFGRTQLIAISPKKTVEGFIGAWVCTGVASLLLSFILSNFSYLICPAENLTTY-IGNH 278

Query: 242 LTCEPNPVFIPQRYDLNPWLTSL--FRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFG 299
             CEPNPVF+PQ + L   L     F  +TFK        P+  H L +A FASLIAPFG
Sbjct: 279 PQCEPNPVFLPQIFQLPSNLAEFFGFSIITFK--------PIYIHSLNLATFASLIAPFG 330

Query: 300 GFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQ 359
           GFFASG+KRAF IKDFG +IPGHGGITDR+DCQFLMG FS++Y+Q+FI  + +++G VLQ
Sbjct: 331 GFFASGLKRAFGIKDFGDTIPGHGGITDRLDCQFLMGSFSYLYFQTFISNNRMSIGNVLQ 390

Query: 360 TIVNSLKPQDQIELFNRLKQYLLSQGLLEE 389
             + +L       L   + +YL + G + +
Sbjct: 391 MAIINLSVPQLFHLVQAILRYLNNSGFISD 420



>gi|321472774|gb|EFX83743.1| hypothetical protein DAPPUDRAFT_315618 [Daphnia pulex]
          Length = 455

 Score =  375 bits (964), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 192/390 (49%), Positives = 267/390 (68%), Gaps = 10/390 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +  +W+N  +R I+T+VMIFGF L++  G + ++ +V+ +Q   + E+I I +   K   
Sbjct: 70  LPPRWRNWVIRGIFTWVMIFGFALMIYAGPLALMLVVLAVQVKCFAEIINIGYAVYKIHG 129

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF++L+WYFLI++ YF YGES++ YF  +     FL     +HRFISF LY  GFV+F
Sbjct: 130 LPWFRSLSWYFLITSNYFFYGESLVDYFGVVDNRTEFLRALVKYHRFISFSLYIGGFVWF 189

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K +Y  QF+ FAWTH+ LLIVV QS+ II NIF+GLIWF++PVS+++CND+ AY+
Sbjct: 190 VLSLVKRYYMKQFSLFAWTHVALLIVVTQSYLIIRNIFQGLIWFIVPVSMIVCNDVMAYM 249

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FG   S +L ++ + +CP +        G
Sbjct: 250 FGFFFGRTPLIKLSPKKTWEGFIGGGFATVLFGLMISYVLCQYPFFVCPIE---FNEEIG 306

Query: 241 RLT--CEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPF 298
           R+T  CEP+P++ PQ Y +   L  + R +T K+  +V I P  +H L M+ F+S+I PF
Sbjct: 307 RMTLDCEPSPLYRPQEYSVPASLAPVVRMITGKN--TVMIIPFLFHSLSMSVFSSVIGPF 364

Query: 299 GGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVL 358
           GGFFASG KRAF IKDFG  IPGHGGI DR DCQ+LM  F ++Y  SFI+M S     +L
Sbjct: 365 GGFFASGFKRAFKIKDFGDIIPGHGGIMDRFDCQYLMATFVNVYISSFIRMDSPQ--KLL 422

Query: 359 QTIVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           Q I  SLKP+ Q+ELF  L+  L ++G+L+
Sbjct: 423 QQIY-SLKPELQLELFTALRDSLTARGILQ 451



>gi|156844503|ref|XP_001645314.1| hypothetical protein Kpol_1037p53 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156115974|gb|EDO17456.1| hypothetical protein Kpol_1037p53 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 461

 Score =  375 bits (962), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 188/390 (48%), Positives = 248/390 (63%), Gaps = 7/390 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
           + K  N  +RT WTFVM+ GFF IL  GH + + L++  Q   +KE IA+       K L
Sbjct: 62  ANKRYNFIIRTSWTFVMLAGFFAILASGHFYCVLLIIACQVATFKECIAVTGASGSAKNL 121

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           P  KTLNWY L +T Y+L G++   +F+  +    FL    +HH+F+ + LY  GF+FFV
Sbjct: 122 PLTKTLNWYLLFTTIYYLDGKTFFRFFQNFLFEHPFLTLIVSHHKFVCYFLYLFGFIFFV 181

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
             L+K   KFQF     THM L +VV Q+H II N+  GL WF++P  LVI NDIFAY+C
Sbjct: 182 CTLRKGFLKFQFASLCITHMALALVVFQAHLIIKNVINGLFWFLVPCGLVIVNDIFAYLC 241

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LI++SPKKT EGF+GA   T +     + +   + YM CP +D+ T  F+  
Sbjct: 242 GITFGRTKLIEISPKKTLEGFIGAWFFTALASVILTRIFEPFSYMTCPVKDINTN-FFSS 300

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           LTCE NPVFIPQRY L P +   F       I SV I P+ +H L +A FASL APFGGF
Sbjct: 301 LTCELNPVFIPQRYPLPPMVFEKF------GISSVTIKPIYFHALNLATFASLFAPFGGF 354

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F +KDFG SIPGHGGITDR+DCQFLMG F+++YY++FI  + LTV AVL +I
Sbjct: 355 FASGLKRTFKVKDFGDSIPGHGGITDRIDCQFLMGSFTNLYYETFISENRLTVEAVLSSI 414

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEERG 391
           + S   Q  +E+   L   L  +G+ +E+G
Sbjct: 415 LLSFNDQQILEVLTSLTTILTKKGIFKEKG 444



>gi|401626675|gb|EJS44601.1| cds1p [Saccharomyces arboricola H-6]
          Length = 457

 Score =  374 bits (961), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 190/390 (48%), Positives = 255/390 (65%), Gaps = 8/390 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
           S+K+ N  +RT+WTFVMI GFF+ L  GH W I L++  Q   +KE IA+     +EK L
Sbjct: 57  SRKY-NFFIRTVWTFVMICGFFITLASGHAWCILLILGCQIATFKECIAVTSASGREKNL 115

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           P  KTLNWY L +T Y+L G+S+  +F+        L    T+H+FI + LY +GFV FV
Sbjct: 116 PLTKTLNWYLLFTTIYYLDGKSLFKFFQTTFYEYPVLNFIVTNHKFICYCLYLLGFVLFV 175

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K   KFQF     THM LL+VV Q+H II N+  GL WF+LP  LVI NDIFAY+C
Sbjct: 176 CSLRKGFLKFQFGSLCATHMVLLLVVFQAHLIIKNVLNGLFWFLLPCGLVIVNDIFAYLC 235

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +G+T LI++SPKKT EGF+GA   T +     + LL  + Y+ CP +DL T  F+  
Sbjct: 236 GITFGKTKLIEISPKKTLEGFLGAWFFTALASIILTRLLSPYTYLTCPVEDLHTN-FFSN 294

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           LTCE NPVF+PQ Y L P        L   +I S+ + P+ +H L +A FASL APFGGF
Sbjct: 295 LTCELNPVFLPQVYRLPPVF------LDKVEISSITVKPIYFHALNLATFASLFAPFGGF 348

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F +KDFGHSIPGHGGITDR+DCQF+MG F+++YY++FI    +TV  VL TI
Sbjct: 349 FASGLKRTFKVKDFGHSIPGHGGITDRVDCQFIMGSFANLYYETFISEHRITVDTVLSTI 408

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEERG 391
           + +L  +  IEL + L ++L  +G++  + 
Sbjct: 409 LMNLNDKQIIELIDILIRFLSKKGIISPKN 438



>gi|190408803|gb|EDV12068.1| phosphatidate cytidylyltransferase [Saccharomyces cerevisiae
           RM11-1a]
          Length = 457

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 190/390 (48%), Positives = 257/390 (65%), Gaps = 8/390 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
           S+K+ N  +RT+WTFVMI GFF+ L  GH W I L++  Q   +KE IA+     +EK L
Sbjct: 57  SRKY-NFFIRTVWTFVMISGFFITLASGHAWCIVLILGCQIATFKECIAVTSASGREKNL 115

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           P  KTLNWY L +T Y+L G+S+  +F+A       L    T+H+FI + LY +GFV FV
Sbjct: 116 PLTKTLNWYLLFTTIYYLDGKSLFKFFQATFYEYPVLNFIVTNHKFICYCLYLMGFVLFV 175

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K   KFQF     THM LL+VV Q+H II N+  GL WF+LP  LVI NDIFAY+C
Sbjct: 176 CSLRKGFLKFQFGSLCVTHMVLLLVVFQAHLIIKNVLNGLFWFLLPCGLVIVNDIFAYLC 235

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +G+T LI++SPKKT EGF+GA   T +     + +L  + Y+ CP +DL T  F+  
Sbjct: 236 GITFGKTKLIEISPKKTLEGFLGAWFFTALASIILTRILSPYTYLTCPVEDLHTN-FFSN 294

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           LTCE NPVF+PQ Y L P     F ++    I S+ + P+ +H L +A FASL APFGGF
Sbjct: 295 LTCELNPVFLPQVYRLPPI---FFDKV---QINSITVKPIYFHALNLATFASLFAPFGGF 348

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F +KDFGHSIPGHGGITDR+DCQF+MG F+++YY++FI    +TV  VL TI
Sbjct: 349 FASGLKRTFKVKDFGHSIPGHGGITDRVDCQFIMGSFANLYYETFISEHRITVDTVLSTI 408

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEERG 391
           + +L  +  IEL + L ++L  +G++  + 
Sbjct: 409 LMNLNDKQIIELIDILIRFLSKKGIISAKN 438



>gi|189519187|ref|XP_001341899.2| PREDICTED: phosphatidate cytidylyltransferase 1 [Danio rerio]
          Length = 452

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 192/388 (49%), Positives = 259/388 (66%), Gaps = 12/388 (3%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I +  MI GFFLI+ LG I +I +V+ +Q   + E+I I +      +
Sbjct: 68  LSSRWKNWWIRGILSLTMIIGFFLIIYLGPIMLIIVVMGVQIKCFHEIITIGYRVYHSYE 127

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFLI   YF YGE++  YF A+V  +  L     +HRFISF LY  GF  F
Sbjct: 128 LPWFRTLSWYFLICVNYFFYGETVADYFGALVQREEPLQFLVRYHRFISFALYLAGFCMF 187

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLIVV QSH +I N+FEG+IWF++P+S+VICNDI AY+
Sbjct: 188 VLSLVKKHYRLQFYMFAWTHVTLLIVVTQSHLVIQNLFEGMIWFIVPISIVICNDIMAYL 247

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQ-DLTTTAFY 239
            GFF+GRTPLIKLSPKKTWEGF+G    T++  FF++ LL ++ Y +CP + D  T  F 
Sbjct: 248 FGFFFGRTPLIKLSPKKTWEGFIGGFFATVVLSFFFAYLLSQYQYFVCPVEYDSETNRF- 306

Query: 240 GRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFG 299
             + CEP+ +F+ Q Y L   + +  R       ++V + P Q H + ++ FASLI PFG
Sbjct: 307 -AVECEPSNLFMIQEYTLPAVVQNALR------WKTVNLYPFQIHSIALSSFASLIGPFG 359

Query: 300 GFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQ 359
           GFFASG KRAF IKDF  +IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ
Sbjct: 360 GFFASGFKRAFKIKDFADTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQ 417

Query: 360 TIVNSLKPQDQIELFNRLKQYLLSQGLL 387
            ++  L+P+ Q+ +FN L+  L  +GLL
Sbjct: 418 QLL-VLQPEQQLGIFNTLRNQLREKGLL 444



>gi|6319503|ref|NP_009585.1| phosphatidate cytidylyltransferase [Saccharomyces cerevisiae S288c]
 gi|586479|sp|P38221.1|CDS1_YEAST RecName: Full=Phosphatidate cytidylyltransferase; AltName:
           Full=CDP-DAG synthase; AltName: Full=CDP-DG synthase;
           AltName: Full=CDP-diacylglycerol synthase; Short=CDS;
           AltName: Full=CDP-diglyceride pyrophosphorylase;
           AltName: Full=CDP-diglyceride synthase; AltName:
           Full=CTP:phosphatidate cytidylyltransferase
 gi|498757|emb|CAA53685.1| YBR0313 [Saccharomyces cerevisiae]
 gi|536240|emb|CAA84971.1| CDS1 [Saccharomyces cerevisiae]
 gi|51013599|gb|AAT93093.1| YBR029C [Saccharomyces cerevisiae]
 gi|151946421|gb|EDN64643.1| phosphatidate cytidylyltransferase [Saccharomyces cerevisiae
           YJM789]
 gi|207347777|gb|EDZ73848.1| YBR029Cp-like protein [Saccharomyces cerevisiae AWRI1631]
 gi|256273184|gb|EEU08133.1| Cds1p [Saccharomyces cerevisiae JAY291]
 gi|285810365|tpg|DAA07150.1| TPA: phosphatidate cytidylyltransferase [Saccharomyces cerevisiae
           S288c]
 gi|323334522|gb|EGA75896.1| Cds1p [Saccharomyces cerevisiae AWRI796]
 gi|349576407|dbj|GAA21578.1| K7_Cds1p [Saccharomyces cerevisiae Kyokai no. 7]
 gi|392300867|gb|EIW11956.1| Cds1p [Saccharomyces cerevisiae CEN.PK113-7D]
 gi|1587586|prf||2206497J ORF YBR0313
          Length = 457

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 190/390 (48%), Positives = 257/390 (65%), Gaps = 8/390 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
           S+K+ N  +RT+WTFVMI GFF+ L  GH W I L++  Q   +KE IA+     +EK L
Sbjct: 57  SRKY-NFFIRTVWTFVMISGFFITLASGHAWCIVLILGCQIATFKECIAVTSASGREKNL 115

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           P  KTLNWY L +T Y+L G+S+  +F+A       L    T+H+FI + LY +GFV FV
Sbjct: 116 PLTKTLNWYLLFTTIYYLDGKSLFKFFQATFYEYPVLNFIVTNHKFICYCLYLMGFVLFV 175

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K   KFQF     THM LL+VV Q+H II N+  GL WF+LP  LVI NDIFAY+C
Sbjct: 176 CSLRKGFLKFQFGSLCVTHMVLLLVVFQAHLIIKNVLNGLFWFLLPCGLVIVNDIFAYLC 235

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +G+T LI++SPKKT EGF+GA   T +     + +L  + Y+ CP +DL T  F+  
Sbjct: 236 GITFGKTKLIEISPKKTLEGFLGAWFFTALASIILTRILSPYTYLTCPVEDLHTN-FFSN 294

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           LTCE NPVF+PQ Y L P     F ++    I S+ + P+ +H L +A FASL APFGGF
Sbjct: 295 LTCELNPVFLPQVYRLPPI---FFDKV---QINSITVKPIYFHALNLATFASLFAPFGGF 348

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F +KDFGHSIPGHGGITDR+DCQF+MG F+++YY++FI    +TV  VL TI
Sbjct: 349 FASGLKRTFKVKDFGHSIPGHGGITDRVDCQFIMGSFANLYYETFISEHRITVDTVLSTI 408

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEERG 391
           + +L  +  IEL + L ++L  +G++  + 
Sbjct: 409 LMNLNDKQIIELIDILIRFLSKKGIISAKN 438



>gi|365767087|gb|EHN08575.1| Cds1p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 457

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 190/390 (48%), Positives = 257/390 (65%), Gaps = 8/390 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
           S+K+ N  +RT+WTFVMI GFF+ L  GH W I L++  Q   +KE IA+     +EK L
Sbjct: 57  SRKY-NFFIRTVWTFVMISGFFITLASGHAWCIVLILGCQIATFKECIAVTSASGREKNL 115

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           P  KTLNWY L +T Y+L G+S+  +F+A       L    T+H+FI + LY +GFV FV
Sbjct: 116 PLTKTLNWYLLFTTIYYLDGKSLFKFFQATFYEYPVLNFIVTNHKFICYCLYLMGFVLFV 175

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K   KFQF     THM LL+VV Q+H II N+  GL WF+LP  LVI NDIFAY+C
Sbjct: 176 CSLRKGFLKFQFGSLCVTHMVLLLVVFQAHLIIKNVLNGLFWFLLPCGLVIVNDIFAYLC 235

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +G+T LI++SPKKT EGF+GA   T +     + +L  + Y+ CP +DL T  F+  
Sbjct: 236 GITFGKTKLIEISPKKTLEGFLGAWFFTALASIILTRILSPYTYLTCPVEDLHTN-FFSN 294

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           LTCE NPVF+PQ Y L P     F ++    I S+ + P+ +H L +A FASL APFGGF
Sbjct: 295 LTCELNPVFLPQVYRLPPI---FFDKV---QINSITVKPIYFHALNLATFASLFAPFGGF 348

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F +KDFGHSIPGHGGITDR+DCQF+MG F+++YY++FI    +TV  VL TI
Sbjct: 349 FASGLKRTFKVKDFGHSIPGHGGITDRVDCQFIMGSFANLYYETFISEHRITVDTVLSTI 408

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEERG 391
           + +L  +  IEL + L ++L  +G++  + 
Sbjct: 409 LMNLNDKQIIELIDILIRFLSKKGIISAKB 438



>gi|290878046|emb|CAY77812.2| Cds1p [Saccharomyces cerevisiae EC1118]
          Length = 457

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 190/389 (48%), Positives = 257/389 (66%), Gaps = 8/389 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
           S+K+ N  +RT+WTFVMI GFF+ L  GH W I L++  Q   +KE IA+     +EK L
Sbjct: 57  SRKY-NFFIRTVWTFVMISGFFITLASGHAWCIVLILGCQIATFKECIAVTSASGREKNL 115

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           P  KTLNWY L +T Y+L G+S+  +F+A       L    T+H+FI + LY +GFV FV
Sbjct: 116 PLTKTLNWYLLFTTIYYLDGKSLFKFFQATFYEYPVLNFIVTNHKFICYCLYLMGFVLFV 175

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K   KFQF     THM LL+VV Q+H II N+  GL WF+LP  LVI NDIFAY+C
Sbjct: 176 CSLRKGFLKFQFGSLCVTHMVLLLVVFQAHLIIKNVLNGLFWFLLPCGLVIVNDIFAYLC 235

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +G+T LI++SPKKT EGF+GA   T +     + +L  + Y+ CP +DL T  F+  
Sbjct: 236 GITFGKTKLIEISPKKTLEGFLGAWFFTALASIILTRILSPYTYLTCPVEDLHTN-FFSN 294

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           LTCE NPVF+PQ Y L P     F ++    I S+ + P+ +H L +A FASL APFGGF
Sbjct: 295 LTCELNPVFLPQVYRLPPI---FFDKV---QINSITVKPIYFHALNLATFASLFAPFGGF 348

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F +KDFGHSIPGHGGITDR+DCQF+MG F+++YY++FI    +TV  VL TI
Sbjct: 349 FASGLKRTFKVKDFGHSIPGHGGITDRVDCQFIMGSFANLYYETFISEHRITVDTVLSTI 408

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           + +L  +  IEL + L ++L  +G++  +
Sbjct: 409 LMNLNDKQIIELIDILIRFLSKKGIISAK 437



>gi|323310202|gb|EGA63394.1| Cds1p [Saccharomyces cerevisiae FostersO]
          Length = 451

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 190/390 (48%), Positives = 257/390 (65%), Gaps = 8/390 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
           S+K+ N  +RT+WTFVMI GFF+ L  GH W I L++  Q   +KE IA+     +EK L
Sbjct: 51  SRKY-NFFIRTVWTFVMISGFFITLASGHAWCIVLILGCQIATFKECIAVTSASGREKNL 109

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           P  KTLNWY L +T Y+L G+S+  +F+A       L    T+H+FI + LY +GFV FV
Sbjct: 110 PLTKTLNWYLLFTTIYYLDGKSLFKFFQATFYEYPVLNFIVTNHKFICYCLYLMGFVLFV 169

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K   KFQF     THM LL+VV Q+H II N+  GL WF+LP  LVI NDIFAY+C
Sbjct: 170 CSLRKGFLKFQFGSLCVTHMVLLLVVFQAHLIIKNVLNGLFWFLLPCGLVIVNDIFAYLC 229

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +G+T LI++SPKKT EGF+GA   T +     + +L  + Y+ CP +DL T  F+  
Sbjct: 230 GITFGKTKLIEISPKKTLEGFLGAWFFTALASIILTRILSPYTYLTCPVEDLHTN-FFSX 288

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           LTCE NPVF+PQ Y L P     F ++    I S+ + P+ +H L +A FASL APFGGF
Sbjct: 289 LTCELNPVFLPQVYRLPPI---FFDKV---QINSITVKPIYFHALNLATFASLFAPFGGF 342

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F +KDFGHSIPGHGGITDR+DCQF+MG F+++YY++FI    +TV  VL TI
Sbjct: 343 FASGLKRTFKVKDFGHSIPGHGGITDRVDCQFIMGSFANLYYETFISEHRITVDTVLSTI 402

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEERG 391
           + +L  +  IEL + L ++L  +G++  + 
Sbjct: 403 LMNLNDKQIIELIDILIRFLSKKGIISAKN 432



>gi|323306081|gb|EGA59815.1| Cds1p [Saccharomyces cerevisiae FostersB]
          Length = 457

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 190/390 (48%), Positives = 257/390 (65%), Gaps = 8/390 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
           S+K+ N  +RT+WTFVMI GFF+ L  GH W I L++  Q   +KE IA+     +EK L
Sbjct: 57  SRKY-NFFIRTVWTFVMISGFFITLASGHAWCIVLILGCQIATFKECIAVTSASGREKNL 115

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           P  KTLNWY L +T Y+L G+S+  +F+A       L    T+H+FI + LY +GFV FV
Sbjct: 116 PLTKTLNWYLLFTTIYYLDGKSLFKFFQATFYEYPVLNFIVTNHKFICYCLYLMGFVLFV 175

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K   KFQF     THM LL+VV Q+H II N+  GL WF+LP  LVI NDIFAY+C
Sbjct: 176 CSLRKGFLKFQFGSLCVTHMVLLLVVFQAHLIIKNVLNGLFWFLLPCGLVIVNDIFAYLC 235

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +G+T LI++SPKKT EGF+GA   T +     + +L  + Y+ CP +DL T  F+  
Sbjct: 236 GITFGKTKLIEISPKKTLEGFLGAWFFTALASIILTRILSPYTYLTCPVEDLHTN-FFSX 294

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           LTCE NPVF+PQ Y L P     F ++    I S+ + P+ +H L +A FASL APFGGF
Sbjct: 295 LTCELNPVFLPQVYRLPPI---FFDKV---QINSITVKPIYFHALNLATFASLFAPFGGF 348

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F +KDFGHSIPGHGGITDR+DCQF+MG F+++YY++FI    +TV  VL TI
Sbjct: 349 FASGLKRTFKVKDFGHSIPGHGGITDRVDCQFIMGSFANLYYETFISEHRITVDTVLSTI 408

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEERG 391
           + +L  +  IEL + L ++L  +G++  + 
Sbjct: 409 LMNLNDKQIIELIDILIRFLSKKGIISAKN 438



>gi|426232274|ref|XP_004010158.1| PREDICTED: phosphatidate cytidylyltransferase 1, partial [Ovis
           aries]
          Length = 433

 Score =  372 bits (954), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 190/388 (48%), Positives = 255/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +       
Sbjct: 51  LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLSIQVKCFHEIITIGYRVYHSYD 110

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 111 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 170

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AYI
Sbjct: 171 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDIAAYI 230

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T+IFGF  + LL ++ Y +CP +  +    + 
Sbjct: 231 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVIFGFIAAYLLSKYQYFVCPVEYRSDVNSF- 289

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y L P+L ++ RR       SV + P Q H + ++ FASLI PFGG
Sbjct: 290 VTECEPSELFQLQSYSLPPFLKAVLRR------ESVSMYPFQIHSIALSTFASLIGPFGG 343

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 344 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 401

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L+ +G+L+
Sbjct: 402 LL-VLQPEQQLNIYKTLKTHLIEKGILQ 428



>gi|367013378|ref|XP_003681189.1| hypothetical protein TDEL_0D03940 [Torulaspora delbrueckii]
 gi|359748849|emb|CCE91978.1| hypothetical protein TDEL_0D03940 [Torulaspora delbrueckii]
          Length = 424

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 186/389 (47%), Positives = 251/389 (64%), Gaps = 7/389 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
             K  N  VRTIWT++MI GFF+ L  GH W I L++  Q   +KE I +     + K L
Sbjct: 26  ESKKSNFLVRTIWTWIMIAGFFITLASGHFWCIMLILACQIATFKECIGVTSESGRAKNL 85

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           P  KTLNWYFL +T Y+L G+S+  +F+   +    L   A +HRFI + LY +GFV FV
Sbjct: 86  PLTKTLNWYFLFTTIYYLDGKSLFQFFQDYFIEYKGLTLLAANHRFICYCLYLLGFVLFV 145

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K   KFQF     THM L++VV Q+H II N+  GLIWF+LP  LVI NDIFAY+C
Sbjct: 146 CSLRKGFLKFQFASLCATHMVLMLVVGQAHLIIKNVINGLIWFLLPCGLVIVNDIFAYLC 205

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LI++SPKKT EGF+GA   T +     + +   + YM CP +D+ T  F+  
Sbjct: 206 GITFGRTKLIEISPKKTLEGFLGAWFFTALASIILTKIFSSFMYMTCPVKDIHTN-FFSN 264

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           LTCE NPVF+PQ Y L P    +F +L    +  + + P+ +H L +A FASL APFGGF
Sbjct: 265 LTCELNPVFVPQDYRLPPI---IFDKL---GVSVLTVKPIYFHALNLATFASLFAPFGGF 318

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F +KDFGHSIPGHGGITDR+DCQF+MG F+++YY++FI  + +TV  VL TI
Sbjct: 319 FASGLKRTFQVKDFGHSIPGHGGITDRVDCQFIMGSFANLYYETFISENRITVETVLSTI 378

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           + +L  +  + L + L   L  +G+  E+
Sbjct: 379 LMNLDEKQIVRLISTLNAILFKKGIFTEQ 407



>gi|505841857|ref|XP_004614439.1| PREDICTED: phosphatidate cytidylyltransferase 1 [Sorex araneus]
          Length = 614

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 188/388 (48%), Positives = 256/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +   +   
Sbjct: 232 LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYRSYD 291

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 292 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 351

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 352 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 411

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T+IFGF  + +L ++ Y +CP +  +    + 
Sbjct: 412 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVIFGFIAAHVLSKYQYFVCPVEYRSDVNSF- 470

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y L P+L ++ RR       SV + P Q H + ++ FASLI PFGG
Sbjct: 471 VTECEPSELFQLQDYSLPPFLRAVLRR------DSVSLCPFQIHSIALSTFASLIGPFGG 524

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 525 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 582

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L+ +G+L+
Sbjct: 583 LL-VLQPEQQLNIYKTLKTHLIEKGILQ 609



>gi|478513422|ref|XP_004430966.1| PREDICTED: phosphatidate cytidylyltransferase 1 [Ceratotherium
           simum simum]
          Length = 461

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 187/388 (48%), Positives = 256/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +   +   
Sbjct: 79  LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYRSYD 138

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 139 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQSLIRYHRFISFALYLAGFCMF 198

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 199 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 258

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FGF  + +L ++ Y +CP +  +    + 
Sbjct: 259 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFIAAYVLSKYQYFVCPVEYRSDVNSF- 317

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y L P+L ++ RR T      V + P Q H + ++ FASLI PFGG
Sbjct: 318 VTECEPSEIFQLQSYSLPPFLKAVLRRET------VSLYPFQIHSIALSTFASLIGPFGG 371

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 372 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 429

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L+ +G+L+
Sbjct: 430 LL-VLQPEQQLNIYKTLKTHLIEKGILQ 456



>gi|301755614|ref|XP_002913656.1| PREDICTED: phosphatidate cytidylyltransferase 1-like [Ailuropoda
           melanoleuca]
          Length = 435

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 187/388 (48%), Positives = 256/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +   +   
Sbjct: 53  LSSRWKNWWIRGILTLTMISVFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYRSYD 112

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 113 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 172

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 173 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 232

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FGF  + +L ++ Y +CP +  +    + 
Sbjct: 233 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFIAAYMLSKYQYFVCPVEYRSDVNSF- 291

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y L P+L ++ RR T      V + P Q H + ++ FASLI PFGG
Sbjct: 292 VTECEPSELFKLQSYSLPPFLKTVLRRET------VSLYPFQIHSIALSTFASLIGPFGG 345

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 346 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 403

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L+ +G+L+
Sbjct: 404 LL-VLQPEQQLNIYKTLKTHLIEKGILQ 430



>gi|281344298|gb|EFB19882.1| hypothetical protein PANDA_001470 [Ailuropoda melanoleuca]
          Length = 422

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 187/388 (48%), Positives = 256/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +   +   
Sbjct: 40  LSSRWKNWWIRGILTLTMISVFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYRSYD 99

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 100 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 159

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 160 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 219

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FGF  + +L ++ Y +CP +  +    + 
Sbjct: 220 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFIAAYMLSKYQYFVCPVEYRSDVNSF- 278

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y L P+L ++ RR T      V + P Q H + ++ FASLI PFGG
Sbjct: 279 VTECEPSELFKLQSYSLPPFLKTVLRRET------VSLYPFQIHSIALSTFASLIGPFGG 332

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 333 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 390

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L+ +G+L+
Sbjct: 391 LL-VLQPEQQLNIYKTLKTHLIEKGILQ 417



>gi|74002166|ref|XP_544962.2| PREDICTED: phosphatidate cytidylyltransferase 1 [Canis lupus
           familiaris]
          Length = 461

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 187/388 (48%), Positives = 256/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +   +   
Sbjct: 79  LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYRSYD 138

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 139 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 198

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 199 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 258

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FGF  + +L ++ Y +CP +  +    + 
Sbjct: 259 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFVAAYMLSKYQYFVCPVEYRSDVNSF- 317

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y L P+L ++ RR T      V + P Q H + ++ FASLI PFGG
Sbjct: 318 VTECEPSELFQLQSYSLPPFLKAVLRRET------VSLYPFQIHSIALSTFASLIGPFGG 371

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 372 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 429

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L+ +G+L+
Sbjct: 430 LL-VLQPEQQLNIYKTLKTHLIEKGILQ 456



>gi|466085181|ref|XP_004285477.1| PREDICTED: phosphatidate cytidylyltransferase 1 [Orcinus orca]
 gi|470599775|ref|XP_004312043.1| PREDICTED: phosphatidate cytidylyltransferase 1 [Tursiops
           truncatus]
          Length = 461

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 188/388 (48%), Positives = 256/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +   +   
Sbjct: 79  LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYRSYD 138

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 139 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 198

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 199 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 258

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T+IFGF  + +L ++ Y +CP +  +    + 
Sbjct: 259 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVIFGFIAAYVLSKYQYFVCPVEYRSDVNSF- 317

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y L P+L +L RR T      + + P Q H + ++ FASLI PFGG
Sbjct: 318 VTECEPSELFQLQSYSLPPFLKALLRRET------ISLYPFQIHSIALSTFASLIGPFGG 371

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 372 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 429

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L+ +G+L+
Sbjct: 430 LL-VLQPEQQLNIYKTLKTHLIEKGILQ 456



>gi|511920394|ref|XP_004779418.1| PREDICTED: phosphatidate cytidylyltransferase 1 isoform X1 [Mustela
           putorius furo]
 gi|511940088|ref|XP_004788860.1| PREDICTED: phosphatidate cytidylyltransferase 1 isoform X1 [Mustela
           putorius furo]
          Length = 500

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 187/388 (48%), Positives = 256/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +   +   
Sbjct: 118 LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYRSYD 177

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 178 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 237

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 238 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 297

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FGF  + +L ++ Y +CP +  +    + 
Sbjct: 298 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFIAAYMLSKYQYFVCPVEYRSDVNSF- 356

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y L P+L ++ RR T      V + P Q H + ++ FASLI PFGG
Sbjct: 357 VTECEPSELFQLQSYSLPPFLKAVLRRET------VSLYPFQIHSIALSTFASLIGPFGG 410

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 411 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 468

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L+ +G+L+
Sbjct: 469 LL-VLQPEQQLNIYKTLKTHLIEKGILQ 495



>gi|511920396|ref|XP_004779419.1| PREDICTED: phosphatidate cytidylyltransferase 1 isoform X2 [Mustela
           putorius furo]
 gi|511940090|ref|XP_004788861.1| PREDICTED: phosphatidate cytidylyltransferase 1 isoform X2 [Mustela
           putorius furo]
          Length = 461

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 187/388 (48%), Positives = 256/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +   +   
Sbjct: 79  LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYRSYD 138

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 139 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 198

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 199 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 258

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FGF  + +L ++ Y +CP +  +    + 
Sbjct: 259 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFIAAYMLSKYQYFVCPVEYRSDVNSF- 317

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y L P+L ++ RR T      V + P Q H + ++ FASLI PFGG
Sbjct: 318 VTECEPSELFQLQSYSLPPFLKAVLRRET------VSLYPFQIHSIALSTFASLIGPFGG 371

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 372 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 429

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L+ +G+L+
Sbjct: 430 LL-VLQPEQQLNIYKTLKTHLIEKGILQ 456



>gi|410957297|ref|XP_003985266.1| PREDICTED: phosphatidate cytidylyltransferase 1 [Felis catus]
          Length = 461

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 187/388 (48%), Positives = 256/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +   +   
Sbjct: 79  LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYRSYD 138

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 139 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 198

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 199 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 258

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FGF  + +L ++ Y +CP +  +    + 
Sbjct: 259 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFIAAYMLSKYQYFVCPVEYRSDVNSF- 317

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y L P+L ++ RR T      V + P Q H + ++ FASLI PFGG
Sbjct: 318 VTECEPSELFQLQSYSLPPFLKAVLRRET------VSLYPFQIHSIALSTFASLIGPFGG 371

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 372 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 429

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L+ +G+L+
Sbjct: 430 LL-VLQPEQQLNIYKTLKTHLIEKGILQ 456



>gi|354496776|ref|XP_003510501.1| PREDICTED: hypothetical protein LOC100761973 [Cricetulus griseus]
          Length = 861

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 188/388 (48%), Positives = 255/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +       
Sbjct: 479 LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYHSYD 538

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 539 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 598

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 599 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 658

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T+IFGF  + +L ++ Y +CP +  +    + 
Sbjct: 659 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVIFGFIAAYVLSKYQYFVCPVEYRSDVNSF- 717

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y L P+L ++ RR T      V + P Q H + ++ FASLI PFGG
Sbjct: 718 VTECEPSELFQLQSYSLPPFLKAVLRRET------VSMYPFQIHSIALSTFASLIGPFGG 771

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 772 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 829

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L+ +G+L+
Sbjct: 830 LL-VLQPEQQLNIYKTLKTHLIEKGILQ 856



>gi|359066583|ref|XP_003586270.1| PREDICTED: phosphatidate cytidylyltransferase 1-like [Bos taurus]
          Length = 461

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 189/388 (48%), Positives = 254/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +       
Sbjct: 79  LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLSIQVKCFHEIITIGYRVYHSYD 138

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 139 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 198

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AYI
Sbjct: 199 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYI 258

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T+IFGF  + +L ++ Y +CP +  +    + 
Sbjct: 259 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVIFGFIAAYVLSKYQYFVCPVEYRSDVNSF- 317

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y L P+L ++ RR T      V + P Q H + ++ FASLI PFGG
Sbjct: 318 VTECEPSELFQLQSYSLPPFLKAVLRRET------VSMYPFQIHSIALSTFASLIGPFGG 371

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 372 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 429

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L  +G+L+
Sbjct: 430 LL-VLQPEQQLNIYKTLKTHLTEKGILQ 456



>gi|323356300|gb|EGA88104.1| Cds1p [Saccharomyces cerevisiae VL3]
          Length = 481

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 189/380 (49%), Positives = 252/380 (66%), Gaps = 8/380 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
           S+K+ N  +RT+WTFVMI GFF+ L  GH W I L++  Q   +KE IA+     +EK L
Sbjct: 99  SRKY-NFFIRTVWTFVMISGFFITLASGHAWCIVLILGCQIATFKECIAVTSASGREKNL 157

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           P  KTLNWY L +T Y+L G+S+  +F+A       L    T+H+FI + LY +GFV FV
Sbjct: 158 PLTKTLNWYLLFTTIYYLDGKSLFKFFQATFYEYPVLNFIVTNHKFICYCLYLMGFVLFV 217

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K   KFQF     THM LL+VV Q+H II N+  GL WF+LP  LVI NDIFAY+C
Sbjct: 218 CSLRKGFLKFQFGSLCVTHMVLLLVVFQAHLIIKNVLNGLFWFLLPCGLVIVNDIFAYLC 277

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +G+T LI++SPKKT EGF+GA   T +     + +L  + Y+ CP +DL T  F+  
Sbjct: 278 GITFGKTKLIEISPKKTLEGFLGAWFFTALASIILTRILSPYTYLTCPVEDLHTN-FFSN 336

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           LTCE NPVF+PQ Y L P     F ++    I S+ + P+ +H L +A FASL APFGGF
Sbjct: 337 LTCELNPVFLPQVYRLPPI---FFDKV---QINSITVKPIYFHALNLATFASLFAPFGGF 390

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F +KDFGHSIPGHGGITDR+DCQF+MG F+++YY++FI    +TV  VL TI
Sbjct: 391 FASGLKRTFKVKDFGHSIPGHGGITDRVDCQFIMGSFANLYYETFISEHRITVDTVLSTI 450

Query: 362 VNSLKPQDQIELFNRLKQYL 381
           + +L  +  IEL + L ++L
Sbjct: 451 LMNLNDKQIIELIDILIRFL 470



>gi|440908509|gb|ELR58517.1| Phosphatidate cytidylyltransferase 1, partial [Bos grunniens mutus]
          Length = 442

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 189/388 (48%), Positives = 254/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +       
Sbjct: 60  LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLSIQVKCFHEIITIGYRVYHSYD 119

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 120 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 179

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AYI
Sbjct: 180 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYI 239

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T+IFGF  + +L ++ Y +CP +  +    + 
Sbjct: 240 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVIFGFIAAYVLSKYQYFVCPVEYRSDVNSF- 298

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y L P+L ++ RR T      V + P Q H + ++ FASLI PFGG
Sbjct: 299 VTECEPSELFQLQSYSLPPFLKAVLRRET------VSMYPFQIHSIALSTFASLIGPFGG 352

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 353 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 410

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L  +G+L+
Sbjct: 411 LL-VLQPEQQLNIYKTLKTHLTEKGILQ 437



>gi|194209004|ref|XP_001915418.1| PREDICTED: phosphatidate cytidylyltransferase 1 [Equus caballus]
          Length = 461

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 187/388 (48%), Positives = 256/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +   +   
Sbjct: 79  LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYRSYD 138

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 139 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 198

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 199 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 258

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FGF  + +L ++ Y +CP +  +    + 
Sbjct: 259 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFIAAYVLSKYQYFVCPVEYRSDVNSF- 317

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y L P+L ++ RR T      V + P Q H + ++ FASLI PFGG
Sbjct: 318 VTECEPSELFRLQSYSLPPFLKAVLRRET------VSLYPFQIHSIALSTFASLIGPFGG 371

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 372 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 429

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L+ +G+L+
Sbjct: 430 LL-VLQPEQQLNIYKTLKSHLIEKGILQ 456



>gi|366998377|ref|XP_003683925.1| hypothetical protein TPHA_0A04160 [Tetrapisispora phaffii CBS 4417]
 gi|357522220|emb|CCE61491.1| hypothetical protein TPHA_0A04160 [Tetrapisispora phaffii CBS 4417]
          Length = 430

 Score =  368 bits (945), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 185/390 (47%), Positives = 252/390 (64%), Gaps = 8/390 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
           S+K+ N  +RTIWTFVMI GFF  L  GHI+ I L+ + Q   +KE+IA+      EK L
Sbjct: 36  SKKY-NFLIRTIWTFVMIAGFFATLASGHIYCILLITLCQVFAFKEIIAVTGASGSEKNL 94

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           P  KTLNWYFL++  Y+L G+++  +F   +     L    +HH+ I + +Y +G VFFV
Sbjct: 95  PLTKTLNWYFLVTILYYLDGKTLFIFFHDFLFDHPLLSSIVSHHKIICYFMYLLGIVFFV 154

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
             L+K   KFQF  F  TH+ LL++V Q+H II N+  GL WF++P  LVI NDIFAY+C
Sbjct: 155 CTLRKGFLKFQFGSFCITHVVLLLIVFQAHLIIKNVISGLFWFLVPCGLVIINDIFAYLC 214

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LI++SPKKT EGFVGA   T I     + LL  +DY+ CP QD+ T  F+  
Sbjct: 215 GITFGRTRLIEISPKKTLEGFVGAWFFTAIGSIILTRLLLPFDYLKCPVQDINTN-FFSN 273

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           LTC+ NPVF+ Q+Y L P +   F       +  V I P+ +HVL +A FASL APFGGF
Sbjct: 274 LTCDLNPVFLAQQYKLPPMVFDAF------GLSIVTIRPIYFHVLNLATFASLFAPFGGF 327

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F +KDFG SIPGHGGITDR+DCQF+MG F+++Y+++FI  + +TV  V+ TI
Sbjct: 328 FASGLKRTFKVKDFGDSIPGHGGITDRIDCQFIMGSFTNLYFETFISENRITVETVISTI 387

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEERG 391
           + +   +  +EL   L   L  +G ++E  
Sbjct: 388 LMNFDDKQILELMTSLATLLFKKGSIKENS 417



>gi|301616982|ref|XP_002937924.1| PREDICTED: phosphatidate cytidylyltransferase 1 [Xenopus (Silurana)
           tropicalis]
          Length = 441

 Score =  368 bits (945), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 183/388 (47%), Positives = 256/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I++  MI  FF ++ +G + +I LV  IQ   ++E+I+I H   +  +
Sbjct: 58  LSSRWKNWWIRGIFSLTMISLFFFLIYMGPVMLILLVSAIQVKCFQEIISIGHRVYRSYE 117

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF  +V  +  L     +HRFISF  Y IGF  F
Sbjct: 118 LPWFRTLSWYFLLCVNYFFYGETLADYFATLVQREEMLQFLIRYHRFISFAFYLIGFCMF 177

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  F WTH+TLLI V QSH +I N+FEG+IWF++P+S+VICNDI AYI
Sbjct: 178 VLSLVKKHYRLQFYMFGWTHVTLLITVTQSHLVIQNLFEGMIWFIVPISIVICNDIMAYI 237

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T+IFGF ++ +L ++ Y +CP +  + T  + 
Sbjct: 238 FGFFFGRTPLIKLSPKKTWEGFIGGFFMTVIFGFLFAYILAQFQYFVCPVEYSSETNSFS 297

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F    Y +  +L  L  R      R+V + P Q H + ++ FASLI PFGG
Sbjct: 298 T-KCEPSEIFRLHYYIVPAYLQPLLGR------RTVSMYPFQIHSIALSSFASLIGPFGG 350

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF  +IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 351 FFASGFKRAFKIKDFADTIPGHGGIMDRSDCQYLMATFVHVYIASFIRGPNPS--KVLQQ 408

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L P+ Q+ ++  L+ +L+ +G+ +
Sbjct: 409 LL-VLHPEQQLNIYKALRAHLIEKGMTD 435



>gi|395834323|ref|XP_003790156.1| PREDICTED: phosphatidate cytidylyltransferase 1 [Otolemur
           garnettii]
          Length = 525

 Score =  368 bits (944), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 187/388 (48%), Positives = 256/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +   +   
Sbjct: 143 LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLSIQVKCFHEIITIGYRVYRSYD 202

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 203 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 262

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 263 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 322

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FGF  + +L ++ Y +CP +  +    + 
Sbjct: 323 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFTAAYVLSKYQYFVCPVEYRSDVNSF- 381

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y L P+L ++ RR T      V + P Q H + ++ FASLI PFGG
Sbjct: 382 VTECEPSELFQLQSYPLPPFLKAVLRRET------VSLYPFQIHSIALSTFASLIGPFGG 435

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 436 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 493

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L+ +G+L+
Sbjct: 494 LL-VLQPEQQLNIYKTLKTHLIEKGILQ 520



>gi|472343711|ref|XP_004391612.1| PREDICTED: phosphatidate cytidylyltransferase 1 [Odobenus rosmarus
           divergens]
          Length = 461

 Score =  367 bits (943), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 186/388 (47%), Positives = 256/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +   +   
Sbjct: 79  LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYRSYD 138

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 139 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 198

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 199 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 258

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FGF  + +L ++ Y +CP +  +    + 
Sbjct: 259 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFIAAYMLSKYQYFVCPVEYRSDVNSF- 317

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y + P+L ++ R+ T      V + P Q H + ++ FASLI PFGG
Sbjct: 318 VTECEPSELFQLQSYSVPPFLKAVLRQET------VSLYPFQIHSIALSTFASLIGPFGG 371

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 372 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 429

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L+ +GLL+
Sbjct: 430 LL-VLQPEQQLNIYKTLKTHLIEKGLLQ 456



>gi|254577105|ref|XP_002494539.1| ZYRO0A03872p [Zygosaccharomyces rouxii]
 gi|238937428|emb|CAR25606.1| ZYRO0A03872p [Zygosaccharomyces rouxii]
          Length = 443

 Score =  367 bits (942), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 185/385 (48%), Positives = 247/385 (64%), Gaps = 7/385 (1%)

Query: 7   NMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKLPWFKT 66
           N  VRT+WTFVMI GFF  L  GH W I L++V Q   +KE IA+     +++ LP  KT
Sbjct: 48  NFLVRTLWTFVMIAGFFATLAAGHFWCIILILVCQITTFKECIAVTSASGRKRNLPLIKT 107

Query: 67  LNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFVANLKK 126
           LNWYFL +T Y+L G+S+  +F++  +   FL   A +H+FI + LY  GFV FV +L+K
Sbjct: 108 LNWYFLFTTIYYLEGKSLFRFFQSYFLEYKFLATVAANHKFICYCLYLQGFVMFVCSLRK 167

Query: 127 HHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYICGFFWG 186
              K+QF     THMTLL+VV Q+H II N+  GL WF++P  LVI NDI AY+CG  +G
Sbjct: 168 GFLKWQFASLCVTHMTLLLVVFQAHLIIKNVINGLFWFLVPCGLVIINDISAYLCGITFG 227

Query: 187 RTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGRLTCEP 246
           +T LI++SPKKT EGF+GA   T +     + LL  + Y+ CP +D+ T  F+  + CE 
Sbjct: 228 KTKLIEISPKKTLEGFLGAWFFTAVASLLLTRLLSPYMYLTCPVKDIRTN-FFTSVNCEL 286

Query: 247 NPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGFFASGV 306
           NPVFIPQ Y L P +   F       I  V + P+ +H L +A FAS+ APFGGFFASG+
Sbjct: 287 NPVFIPQDYRLPPIIFEKF------GISVVTLKPIYFHALNLASFASIFAPFGGFFASGL 340

Query: 307 KRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTIVNSLK 366
           KR F +KDFGHSIPGHGGITDR+DCQFLMG FS++YY++FI    +TV  +L TI+ +L 
Sbjct: 341 KRTFQVKDFGHSIPGHGGITDRVDCQFLMGSFSNLYYETFISEHRITVETILSTILMNLS 400

Query: 367 PQDQIELFNRLKQYLLSQGLLEERG 391
            +  +EL N L      + L+    
Sbjct: 401 EKQILELINTLNLIFFRKNLVSANN 425



>gi|291401482|ref|XP_002717093.1| PREDICTED: CDP-diacylglycerol synthase 1-like [Oryctolagus
           cuniculus]
          Length = 461

 Score =  367 bits (941), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 187/388 (48%), Positives = 256/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +   +   
Sbjct: 79  LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYRSYD 138

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 139 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 198

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 199 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 258

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T+IFGF  + +L ++ Y +CP +  +    + 
Sbjct: 259 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVIFGFIAAYVLSKYQYFVCPVEYRSDVNSF- 317

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  + Y L P+L ++ R+ T      V + P Q H + ++ FASLI PFGG
Sbjct: 318 VTECEPSELFQLRSYSLPPFLKAVLRQET------VSLYPFQIHSVALSTFASLIGPFGG 371

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 372 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--RVLQQ 429

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L+ +GLL+
Sbjct: 430 LL-VLQPEQQLNIYKALKTHLIEKGLLQ 456



>gi|197099885|ref|NP_001125832.1| phosphatidate cytidylyltransferase 1 [Pongo abelii]
 gi|55729370|emb|CAH91417.1| hypothetical protein [Pongo abelii]
          Length = 461

 Score =  366 bits (940), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 186/388 (47%), Positives = 254/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +       
Sbjct: 79  LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYHSYD 138

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 139 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 198

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 199 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 258

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FGF  + +L ++ Y +CP +  +    + 
Sbjct: 259 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFIAAYVLSKYQYFVCPVEYRSDVNSF- 317

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y L P+L ++ R+        V + P Q H + ++ FASLI PFGG
Sbjct: 318 VTECEPSELFQLQTYSLPPFLKAVLRQ------ERVSLYPFQIHSIALSTFASLIGPFGG 371

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 372 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 429

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK YL+ +G+L+
Sbjct: 430 LL-VLQPEQQLNIYKTLKTYLIEKGILQ 456



>gi|507942614|ref|XP_004681206.1| PREDICTED: phosphatidate cytidylyltransferase 1 [Condylura
           cristata]
          Length = 462

 Score =  366 bits (940), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 187/388 (48%), Positives = 255/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +   +   
Sbjct: 80  LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYRSYD 139

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 140 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 199

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 200 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 259

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FGF  + LL ++ Y +CP +  +    + 
Sbjct: 260 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFIAAYLLSKYQYFVCPVEYRSDVNSF- 318

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y L P+L ++ R  T      V + P Q H + ++ FASLI PFGG
Sbjct: 319 VTECEPSELFQLQNYSLPPFLKAVLRWET------VSLYPFQIHSIALSTFASLIGPFGG 372

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 373 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 430

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L+ +G+L+
Sbjct: 431 LL-VLQPEQQLNIYKTLKTHLIEKGILQ 457



>gi|3219176|dbj|BAA28787.1| CDP-diacylglycerol synthase [Rattus norvegicus]
          Length = 461

 Score =  366 bits (939), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 188/388 (48%), Positives = 254/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   ++E+I I +       
Sbjct: 79  LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFQEIITIGYRVYHSYD 138

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 139 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQKEEQLQFLIRYHRFISFALYLAGFCMF 198

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 199 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 258

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T+IFGF  + +L ++ Y +CP +  +    + 
Sbjct: 259 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVIFGFIAAYVLSKYQYFVCPVEYRSDVNSF- 317

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ VF  Q Y L P+L ++  R T      V + P Q H + ++ FASLI PFGG
Sbjct: 318 VTECEPSEVFQLQNYSLPPFLQAVLSRET------VSLYPFQIHSIALSTFASLIGPFGG 371

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 372 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 429

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L  +G+L+
Sbjct: 430 LL-VLQPEQQLNIYRTLKIHLTEKGILQ 456



>gi|471416482|ref|XP_004389764.1| PREDICTED: phosphatidate cytidylyltransferase 1 [Trichechus manatus
           latirostris]
          Length = 461

 Score =  366 bits (939), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 186/388 (47%), Positives = 255/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +   +   
Sbjct: 79  LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYRSYD 138

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 139 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 198

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 199 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 258

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FGF  + +L ++ Y +CP +  +    + 
Sbjct: 259 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFIAAYVLSKYQYFVCPVEYRSDVNSF- 317

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y L  +L ++ RR T      V + P Q H + ++ FASLI PFGG
Sbjct: 318 VTECEPSELFQLQSYSLPSFLQAVLRRET------VSLYPFQIHSIALSTFASLIGPFGG 371

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 372 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 429

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L+ +G+L+
Sbjct: 430 LL-VLQPEQQLNIYKTLKTHLIEKGILQ 456



>gi|380023843|ref|XP_003695720.1| PREDICTED: phosphatidate cytidylyltransferase,
           photoreceptor-specific-like [Apis florea]
          Length = 445

 Score =  365 bits (938), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 187/390 (47%), Positives = 265/390 (67%), Gaps = 10/390 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R+I+T  MI GF  I+ +G + ++   +++Q   ++E+I I +   +   
Sbjct: 62  LSDRWKNWVIRSIFTLFMIAGFCGIIYIGPLALMATTLIVQVKCFQEIINIGYAVYRIHG 121

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF++L+WYFLI++ YF YGE+++ YF  ++    +L    T+HRFISF LY +GFV+F
Sbjct: 122 LPWFRSLSWYFLITSNYFFYGENLMDYFAVVINRTEYLRVLVTYHRFISFCLYIVGFVWF 181

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K +Y  QF+ FAWTH+ LLIVV QS+ II NIFEGLIWF++PVS+++ ND+ AY+
Sbjct: 182 VLSLVKKYYMKQFSLFAWTHVALLIVVTQSYLIIKNIFEGLIWFIVPVSMIVINDVMAYM 241

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+G+TPLIKLSPKKTWEGF+G  I T++ G   S ++ ++ Y +CP +   T    G
Sbjct: 242 FGFFFGKTPLIKLSPKKTWEGFIGGGISTVLLGLLISYIMCQYRYFVCPIEYSETL---G 298

Query: 241 RLT--CEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPF 298
           R+T  CEP+ +F PQ Y L   L  +F+  + K   ++ + P   H L M+ F+S+I PF
Sbjct: 299 RMTMDCEPSTLFQPQEYTLPNSLQVIFKMFSGKS--TITLYPFLLHSLSMSVFSSVIGPF 356

Query: 299 GGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVL 358
           GGFFASG KRAF IKDFG  IPGHGGI DR DCQ+LM  F ++Y  SFI+ +S     +L
Sbjct: 357 GGFFASGFKRAFKIKDFGDVIPGHGGIMDRFDCQYLMATFVNVYISSFIQTASPQ--KLL 414

Query: 359 QTIVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           Q  V SLKP+ Q++LF  LK  L ++GLL 
Sbjct: 415 QQ-VYSLKPEQQLQLFQTLKDSLENRGLLN 443



>gi|114593861|ref|XP_517179.2| PREDICTED: phosphatidate cytidylyltransferase 1 isoform 2 [Pan
           troglodytes]
 gi|397524622|ref|XP_003832288.1| PREDICTED: phosphatidate cytidylyltransferase 1 [Pan paniscus]
          Length = 461

 Score =  365 bits (937), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 185/388 (47%), Positives = 254/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +       
Sbjct: 79  LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYHSYD 138

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 139 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 198

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 199 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 258

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FGF  + +L ++ Y +CP +  +    + 
Sbjct: 259 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFIAAYVLSKYQYFVCPVEYRSDVNSF- 317

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y L P+L ++ R+        V + P Q H + ++ FASLI PFGG
Sbjct: 318 VTECEPSELFQLQTYSLPPFLKAVLRQ------ERVSLYPFQIHSIALSTFASLIGPFGG 371

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 372 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 429

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L+ +G+L+
Sbjct: 430 LL-VLQPEQQLNIYKTLKTHLIEKGILQ 456



>gi|307179096|gb|EFN67568.1| Phosphatidate cytidylyltransferase, photoreceptor-specific
           [Camponotus floridanus]
          Length = 445

 Score =  365 bits (937), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 188/389 (48%), Positives = 263/389 (67%), Gaps = 10/389 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +  +W+N  +RTI+T+ MI GF LI+  G + ++   +++Q   ++E+I I +   +   
Sbjct: 63  LPARWRNWIIRTIFTWFMIAGFCLIIYGGPLALMITTLIVQVKCFEEIINIGYAVYRIHG 122

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF++L+WYFLI++ YF YGE+++ YF  ++    +L    T+HRFISF LY +GFV+F
Sbjct: 123 LPWFRSLSWYFLITSNYFFYGENLMDYFAVVINRTGYLRVLVTYHRFISFCLYIVGFVWF 182

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K +Y  QF+ FAWTH+ LLIVV QS+ II NIFEGLIWF++PVS+++ ND+ AY+
Sbjct: 183 VLSLVKKYYMKQFSLFAWTHVALLIVVTQSYLIIQNIFEGLIWFIVPVSMIVINDVMAYM 242

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G  I T+I G   S ++ ++ Y +CP +    +   G
Sbjct: 243 FGFFFGRTPLIKLSPKKTWEGFIGGGISTVILGLMMSYVMCQYRYFVCPIE---YSEALG 299

Query: 241 RLT--CEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPF 298
           R+T  CEP+ +F PQ Y L   L  + R L  K   +++  P   H L M+ F+S+I PF
Sbjct: 300 RMTMDCEPSSLFQPQEYTLPKSLQVISRMLNGKSTLTLY--PFLLHSLSMSVFSSVIGPF 357

Query: 299 GGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVL 358
           GGFFASG KRAF IKDFG  IPGHGGI DR DCQ+LM  F ++Y  SFI  +S     +L
Sbjct: 358 GGFFASGFKRAFKIKDFGDVIPGHGGIMDRFDCQYLMATFVNVYISSFIHTASPQ--KLL 415

Query: 359 QTIVNSLKPQDQIELFNRLKQYLLSQGLL 387
           Q  V SLKP+ Q++LF  LK  L ++G+L
Sbjct: 416 QQ-VYSLKPEQQLQLFQTLKDSLANRGML 443



>gi|148747375|ref|NP_112521.2| phosphatidate cytidylyltransferase 1 [Rattus norvegicus]
 gi|7676150|sp|O35052.2|CDS1_RAT RecName: Full=Phosphatidate cytidylyltransferase 1; AltName:
           Full=CDP-DAG synthase 1; AltName: Full=CDP-DG synthase
           1; AltName: Full=CDP-diacylglycerol synthase 1;
           Short=CDS 1; AltName: Full=CDP-diglyceride
           pyrophosphorylase 1; AltName: Full=CDP-diglyceride
           synthase 1; AltName: Full=CTP:phosphatidate
           cytidylyltransferase 1
 gi|117558585|gb|AAI27493.1| CDP-diacylglycerol synthase 1 [Rattus norvegicus]
 gi|149046763|gb|EDL99537.1| CDP-diacylglycerol synthase 1 [Rattus norvegicus]
          Length = 461

 Score =  365 bits (937), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 187/388 (48%), Positives = 254/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   ++E+I I +       
Sbjct: 79  LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFQEIITIGYRVYHSYD 138

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 139 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 198

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 199 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 258

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T+IFGF  + +L ++ Y +CP +  +    + 
Sbjct: 259 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVIFGFIAAYVLSKYQYFVCPVEYRSDVNSF- 317

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y L P+L ++  R T      V + P Q H + ++ FASLI PFGG
Sbjct: 318 VTECEPSELFQLQNYSLPPFLQAVLSRET------VSLYPFQIHSIALSTFASLIGPFGG 371

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 372 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 429

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L  +G+L+
Sbjct: 430 LL-VLQPEQQLNIYRTLKIHLTEKGILQ 456



>gi|470325812|ref|XP_004364563.1| CDP-diacylglycerol synthase [Capsaspora owczarzaki ATCC 30864]
 gi|320166752|gb|EFW43651.1| CDP-diacylglycerol synthase [Capsaspora owczarzaki ATCC 30864]
          Length = 435

 Score =  365 bits (937), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 190/381 (49%), Positives = 249/381 (65%), Gaps = 18/381 (4%)

Query: 3   QKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKLP 62
            +W N  +R I+T++MIF F  I+ LGH  +  LV++IQ L +KE++AI +VP KEKKLP
Sbjct: 69  SRWINWAIRGIFTWIMIFAFCGIVQLGHFALTVLVMIIQILSFKEIVAINYVPYKEKKLP 128

Query: 63  WFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFVA 122
           WF+ LNW+FL +T Y+LYG ++   +  +V     L   A HH  ISF LY +GFV FVA
Sbjct: 129 WFRVLNWFFLFATNYYLYGGTLFKQYYEVVDASPILHSMARHHELISFSLYMLGFVSFVA 188

Query: 123 NLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYICG 182
            LKK HYKFQF QF +TH+ L+++V QS+ ++ NIFEGL+W +LP SLV+CND+ AY+ G
Sbjct: 189 TLKKGHYKFQFGQFGFTHIILVLIVTQSNLVMLNIFEGLVWLILPASLVVCNDVMAYMFG 248

Query: 183 FFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGRL 242
           FF+GRT L +LSPKKTWEGF+GAL  T IFGF  S  L ++D+  CP        F G  
Sbjct: 249 FFFGRTRLTQLSPKKTWEGFIGALFSTYIFGFVLSYYLAQYDFFTCP--------FTG-- 298

Query: 243 TCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGFF 302
            CE  P F  Q Y +   L  L          +V + P+Q H L M+ FAS++APFGGFF
Sbjct: 299 PCEQRPYFTLQNYTIPLDLVGL-------TPFTVAVYPVQLHSLSMSTFASIVAPFGGFF 351

Query: 303 ASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTIV 362
           ASG KRAF IKDF   IPGHGGITDR DCQFLM  F+++Y  SF+ +       +L +I 
Sbjct: 352 ASGFKRAFKIKDFADLIPGHGGITDRFDCQFLMATFAYVYLSSFVHIHPQDPARILSSIA 411

Query: 363 NSLKPQDQIELFNRLKQYLLS 383
            +L    Q++LFN LKQ L +
Sbjct: 412 -ALDIATQVDLFNTLKQRLAA 431



>gi|402869335|ref|XP_003898718.1| PREDICTED: phosphatidate cytidylyltransferase 1 [Papio anubis]
          Length = 461

 Score =  365 bits (936), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 185/388 (47%), Positives = 254/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +       
Sbjct: 79  LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYHSYD 138

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 139 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 198

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 199 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 258

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FGF  + +L ++ Y +CP +  +    + 
Sbjct: 259 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFIAAYVLSKYQYFVCPVEYRSDVNSF- 317

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y L P+L ++ R+        V + P Q H + ++ FASLI PFGG
Sbjct: 318 VTECEPSELFQLQTYSLPPFLKAVLRQ------ERVSLYPFQIHSIALSTFASLIGPFGG 371

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 372 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 429

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L+ +G+L+
Sbjct: 430 LL-VLQPEQQLNIYKTLKTHLIEKGILQ 456



>gi|33186923|ref|NP_775546.2| phosphatidate cytidylyltransferase 1 [Mus musculus]
 gi|67476861|sp|P98191.2|CDS1_MOUSE RecName: Full=Phosphatidate cytidylyltransferase 1; AltName:
           Full=CDP-DAG synthase 1; AltName: Full=CDP-DG synthase
           1; AltName: Full=CDP-diacylglycerol synthase 1;
           Short=CDS 1; AltName: Full=CDP-diglyceride
           pyrophosphorylase 1; AltName: Full=CDP-diglyceride
           synthase 1; AltName: Full=CTP:phosphatidate
           cytidylyltransferase 1
 gi|32330346|gb|AAO16167.2| CDP-diacylglycerol synthase 1 [Mus musculus]
 gi|33115158|gb|AAH55292.1| CDP-diacylglycerol synthase 1 [Mus musculus]
 gi|148688312|gb|EDL20259.1| CDP-diacylglycerol synthase 1 [Mus musculus]
          Length = 461

 Score =  365 bits (936), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 187/388 (48%), Positives = 253/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +       
Sbjct: 79  LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYHSYD 138

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 139 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 198

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 199 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 258

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T+IFGF  + +L ++ Y +CP +  +    + 
Sbjct: 259 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVIFGFIAAYVLSKYQYFVCPVEYRSDVNSF- 317

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y L P+L ++  R T      V + P Q H + ++ FASLI PFGG
Sbjct: 318 VTECEPSELFQLQNYSLPPFLQAVLSRET------VSLYPFQIHSIALSTFASLIGPFGG 371

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 372 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 429

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L  +G+L+
Sbjct: 430 LL-VLQPEQQLNIYRTLKIHLTEKGILQ 456



>gi|426344852|ref|XP_004038967.1| PREDICTED: phosphatidate cytidylyltransferase 1 [Gorilla gorilla
           gorilla]
          Length = 461

 Score =  365 bits (936), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 185/388 (47%), Positives = 254/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +       
Sbjct: 79  LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYHSYD 138

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 139 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 198

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 199 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 258

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FGF  + +L ++ Y +CP +  +    + 
Sbjct: 259 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFIAAYVLSKYQYFVCPVEYRSDVNSF- 317

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y L P+L ++ R+        V + P Q H + ++ FASLI PFGG
Sbjct: 318 VTECEPSELFQLQTYSLPPFLKAVLRQ------ERVSLYPFQIHSIALSTFASLIGPFGG 371

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 372 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 429

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L+ +G+L+
Sbjct: 430 LL-VLQPEQQLNIYKTLKTHLIEKGILQ 456



>gi|22035624|ref|NP_001254.2| phosphatidate cytidylyltransferase 1 [Homo sapiens]
 gi|3123204|sp|Q92903.2|CDS1_HUMAN RecName: Full=Phosphatidate cytidylyltransferase 1; AltName:
           Full=CDP-DAG synthase 1; AltName: Full=CDP-DG synthase
           1; AltName: Full=CDP-diacylglycerol synthase 1;
           Short=CDS 1; AltName: Full=CDP-diglyceride
           pyrophosphorylase 1; AltName: Full=CDP-diglyceride
           synthase 1; AltName: Full=CTP:phosphatidate
           cytidylyltransferase 1
 gi|1915972|gb|AAC51184.1| CDP-diacylglycerol synthase [Homo sapiens]
 gi|49902092|gb|AAH74833.1| CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 1
           [Homo sapiens]
 gi|50960117|gb|AAH74881.1| CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 1
           [Homo sapiens]
 gi|119626355|gb|EAX05950.1| CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 1,
           isoform CRA_a [Homo sapiens]
 gi|119626356|gb|EAX05951.1| CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 1,
           isoform CRA_a [Homo sapiens]
 gi|189054385|dbj|BAG36912.1| unnamed protein product [Homo sapiens]
          Length = 461

 Score =  365 bits (936), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 185/388 (47%), Positives = 254/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +       
Sbjct: 79  LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYHSYD 138

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 139 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 198

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 199 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 258

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FGF  + +L ++ Y +CP +  +    + 
Sbjct: 259 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFIAAYVLSKYQYFVCPVEYRSDVNSF- 317

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y L P+L ++ R+        V + P Q H + ++ FASLI PFGG
Sbjct: 318 VTECEPSELFQLQTYSLPPFLKAVLRQ------ERVSLYPFQIHSIALSTFASLIGPFGG 371

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 372 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 429

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L+ +G+L+
Sbjct: 430 LL-VLQPEQQLNIYKTLKTHLIEKGILQ 456



>gi|488566161|ref|XP_004472748.1| PREDICTED: phosphatidate cytidylyltransferase 1 [Dasypus
           novemcinctus]
          Length = 428

 Score =  364 bits (935), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 186/388 (47%), Positives = 255/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +   +   
Sbjct: 46  LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYRSYD 105

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 106 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 165

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 166 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 225

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FGF  + LL ++ Y +CP +  +    + 
Sbjct: 226 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFIAAYLLSKYQYFVCPVEYRSDVNSF- 284

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y L P+L ++  + T      V + P Q H + ++ FASLI PFGG
Sbjct: 285 VTECEPSELFQLQSYSLPPFLKAVLMQET------VSLYPFQIHSIALSTFASLIGPFGG 338

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 339 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 396

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L+ +G+L+
Sbjct: 397 LL-VLQPEQQLNIYKTLKIHLIEKGILQ 423



>gi|255732475|ref|XP_002551161.1| phosphatidate cytidylyltransferase [Candida tropicalis MYA-3404]
 gi|240131447|gb|EER31007.1| phosphatidate cytidylyltransferase [Candida tropicalis MYA-3404]
          Length = 454

 Score =  364 bits (935), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 190/361 (52%), Positives = 251/361 (69%), Gaps = 7/361 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K +    RTIWTFVMI GFF +L  GH+ +I LV++IQ LV+KEVIA+   P+++KK+
Sbjct: 62  EKKKEAFITRTIWTFVMIGGFFALLASGHLPLIGLVLMIQVLVFKEVIALTSEPARDKKI 121

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           PW ++L+WYFL++T+Y+L   ++  +F+  V     L     +H+FIS+ LY  GFVFFV
Sbjct: 122 PWNRSLHWYFLVTTWYYLDFPALFDFFQESVYSSKVLTLLVLNHKFISYTLYISGFVFFV 181

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
             LKK +Y+FQF Q   THM LL+VV Q+H II NI  G+IWF LP +LVI NDIFAY+C
Sbjct: 182 WTLKKGYYRFQFAQLCVTHMALLLVVFQAHLIIGNILNGIIWFFLPATLVIVNDIFAYLC 241

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LI++SPKKT EGFVGA ICT I G   S +L + DY+ICPA +L +T  Y  
Sbjct: 242 GITFGRTQLIEISPKKTVEGFVGAWICTGIAGVIASHILSKSDYLICPAINL-STHLYNF 300

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
             CEPNPVFIPQ + L   +  +        +  +   P  +H  V+A FASLIAPFGGF
Sbjct: 301 PHCEPNPVFIPQVFQLPANIVEM------TGVEIITFKPFYFHTAVLATFASLIAPFGGF 354

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KRAF IKDFG +IPGHGG+TDR DCQFLMG F+++YYQ+F+   S+ +G +LQ  
Sbjct: 355 FASGLKRAFGIKDFGDTIPGHGGLTDRFDCQFLMGSFTYLYYQTFVTNRSMNLGKILQMA 414

Query: 362 V 362
           +
Sbjct: 415 I 415



>gi|344284801|ref|XP_003414153.1| PREDICTED: phosphatidate cytidylyltransferase 1 [Loxodonta
           africana]
          Length = 461

 Score =  364 bits (934), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 185/388 (47%), Positives = 255/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +   +   
Sbjct: 79  LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLSIQVKCFHEIITIGYRVYRSYD 138

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 139 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 198

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 199 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 258

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FGF  + +L ++ Y +CP +  +    + 
Sbjct: 259 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFIAAYVLSKYQYFVCPVEYRSDINSF- 317

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y L  +L ++ R+ T      V + P Q H + ++ FASLI PFGG
Sbjct: 318 VTECEPSELFQLQSYSLPSFLQAVLRQET------VSMYPFQIHSIALSTFASLIGPFGG 371

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 372 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 429

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L+ +G+L+
Sbjct: 430 LL-VLQPEQQLNIYKTLKTHLIEKGILQ 456



>gi|432876101|ref|XP_004072977.1| PREDICTED: phosphatidate cytidylyltransferase 1-like [Oryzias
           latipes]
          Length = 452

 Score =  363 bits (933), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 187/392 (47%), Positives = 260/392 (66%), Gaps = 11/392 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +  +WKN  +R + +  MI GFFLI+ +G I +IF+V+ +Q   ++E+I I +       
Sbjct: 71  LPPRWKNYWIRGVLSLAMISGFFLIIYMGPIALIFVVMCVQIKCFQEIITIGYRVYHSYH 130

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF A+V  +  L   A +HRFISF LY  GF  F
Sbjct: 131 LPWFRTLSWYFLVCVNYFFYGETVADYFGALVQREEPLKFLARYHRFISFALYLAGFCMF 190

Query: 121 VANLKKHHYKFQFT-QFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAY 179
           V +L K HY   F  QFAWTH+TLLIVV QSH +I N+FEG+IWF++P+S+VICNDI AY
Sbjct: 191 VLSLVKKHYCLCFPFQFAWTHVTLLIVVTQSHLVIQNLFEGMIWFIVPISIVICNDIMAY 250

Query: 180 ICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFY 239
           + GFF+GRTPLIKLSPKKTWEGF+G    T++FGF  + LL ++ + +CP +  + T  +
Sbjct: 251 LFGFFFGRTPLIKLSPKKTWEGFIGGYFGTVVFGFILAFLLSQFQHFVCPVEFNSETNSF 310

Query: 240 GRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFG 299
             + CEP+ +F+ Q Y L   L +  R       ++V + P Q H + ++ FASLI PFG
Sbjct: 311 A-VECEPSDIFVVQEYTLPAVLQNTLR------WKTVNLYPFQIHSIFLSSFASLIGPFG 363

Query: 300 GFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQ 359
           GFFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ
Sbjct: 364 GFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQ 421

Query: 360 TIVNSLKPQDQIELFNRLKQYLLSQGLLEERG 391
            ++  L+P+ Q+ +F+ L  +L  +G+L    
Sbjct: 422 QLLK-LQPEQQLNIFHSLHAHLRDRGMLAPEA 452



>gi|355749268|gb|EHH53667.1| Phosphatidate cytidylyltransferase 1, partial [Macaca fascicularis]
          Length = 421

 Score =  363 bits (932), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 184/388 (47%), Positives = 254/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +       
Sbjct: 39  LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYHSYD 98

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+W+FL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 99  LPWFRTLSWHFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 158

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 159 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 218

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FGF  + +L ++ Y +CP +  +    + 
Sbjct: 219 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFIAAYVLSKYQYFVCPVEYRSDVNSF- 277

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y L P+L ++ R+        V + P Q H + ++ FASLI PFGG
Sbjct: 278 VTECEPSELFQLQTYSLPPFLKAVLRQ------ERVSLYPFQIHSIALSTFASLIGPFGG 331

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 332 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 389

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L+ +G+L+
Sbjct: 390 LL-VLQPEQQLNIYKTLKTHLIEKGILQ 416



>gi|401840154|gb|EJT43061.1| CDS1-like protein [Saccharomyces kudriavzevii IFO 1802]
          Length = 457

 Score =  363 bits (932), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 186/390 (47%), Positives = 253/390 (64%), Gaps = 8/390 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
           S+K+ N  +RT+WTFVMI GFF+ L  GH W I L++  Q   +KE IA+     +EK L
Sbjct: 57  SRKY-NFFIRTVWTFVMISGFFITLASGHAWCIVLILGCQIATFKECIAVTSASGREKNL 115

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           P  KTLNWY L +T Y+L G S+  +F+        L    T+H+F+ + LY +GFV FV
Sbjct: 116 PLTKTLNWYLLFTTIYYLDGRSLFKFFQTTFYEYPVLNFIVTNHKFMCYCLYLLGFVLFV 175

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K   KFQF     THM LL+VV Q+H II N+  GL WF+LP  LVI NDIFAY+C
Sbjct: 176 CSLRKGFLKFQFGSLCVTHMVLLLVVFQAHLIIKNVLNGLFWFLLPCGLVIVNDIFAYLC 235

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +G+T LI++SPKKT EGF+GA   T +     + +L  + Y+ CP +DL T  F+  
Sbjct: 236 GITFGKTKLIEISPKKTLEGFLGAWFFTALASIILTRILSPYSYLTCPVEDLHTN-FFSN 294

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           LTCE NPVF+PQ Y L P    +        I S+ + P+ +H L +A FASL APFGGF
Sbjct: 295 LTCELNPVFLPQVYRLPPIFFDI------AQISSITVKPIYFHALNLATFASLFAPFGGF 348

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F +KDFGHSIPGHGGITDR+DCQF+MG F+++YY++FI    +TV  VL TI
Sbjct: 349 FASGLKRTFKVKDFGHSIPGHGGITDRVDCQFIMGSFANLYYETFISEHRITVDTVLSTI 408

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEERG 391
           + +L  +  I+L + L ++L  +G++  + 
Sbjct: 409 LMNLNDKQIIDLIDILIRFLSKKGIIAPKN 438



>gi|332016494|gb|EGI57387.1| Phosphatidate cytidylyltransferase, photoreceptor-specific
           [Acromyrmex echinatior]
          Length = 447

 Score =  363 bits (932), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 186/390 (47%), Positives = 263/390 (67%), Gaps = 10/390 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +  +W+N  +RTI+T+ MI GF LI+  G + ++   +++Q   ++E+I I +   +   
Sbjct: 66  LPDRWRNWIIRTIFTWFMIAGFCLIIYGGPLALMITTLIVQVKCFEEIINIGYAVYRIHG 125

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF++L+WYFLI++ YF YGE+++ YF  ++    +L    T+HRFISF LY +GFV+F
Sbjct: 126 LPWFRSLSWYFLITSNYFFYGENLMDYFAVVINRTGYLRVLVTYHRFISFCLYIVGFVWF 185

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K +Y  QF+ FAWTH+ LLIVV QS+ II NIFEGLIWF++PVS+++ ND+ AY+
Sbjct: 186 VLSLVKKYYMKQFSLFAWTHVALLIVVTQSYLIIQNIFEGLIWFIVPVSMIVINDVMAYM 245

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G  I T+I G   S ++ ++ Y +CP +    +   G
Sbjct: 246 FGFFFGRTPLIKLSPKKTWEGFIGGGISTVILGLLMSYIMCQYRYFVCPIE---YSEALG 302

Query: 241 RLT--CEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPF 298
           R+T  CEP+ +F PQ Y L   L  + R L  K   +++  P   H L ++ F+S+I PF
Sbjct: 303 RMTMDCEPSSLFQPQEYTLPSSLQVISRMLNGKSTLTIY--PFILHSLSLSIFSSVIGPF 360

Query: 299 GGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVL 358
           GGFFASG KRAF IKDFG  IPGHGGI DR DCQ+LM  F ++Y  SFI  +S     +L
Sbjct: 361 GGFFASGFKRAFKIKDFGDIIPGHGGIMDRFDCQYLMATFVNVYISSFIHTASPQ--KLL 418

Query: 359 QTIVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           Q  V SLKP+ Q++LF  L+  L ++G+L 
Sbjct: 419 QQ-VYSLKPEQQLQLFQTLRDSLENRGMLN 447



>gi|94468722|gb|ABF18210.1| phosphatidate cytidylyltransferase [Aedes aegypti]
          Length = 458

 Score =  363 bits (932), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 187/389 (48%), Positives = 259/389 (66%), Gaps = 16/389 (4%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +  KW+N  +R I+T VMI GF +I+  G + ++   +++Q   ++E+I I +   +   
Sbjct: 82  LPDKWRNWVIRGIFTMVMIGGFAIIVYCGPLALMITALLVQVKCFEEIINIGYSVYRIHG 141

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFK-AIVMVDAFLLPFATHHRFISFVLYCIGFVF 119
           LPWF++L+WYFLI++ YF YGE+++ YF  A+  +DA       +HRF+SF LYCIGFV+
Sbjct: 142 LPWFRSLSWYFLITSNYFFYGENLVDYFGVAVNQIDALRF-LVKYHRFLSFCLYCIGFVW 200

Query: 120 FVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAY 179
           FV +L K +Y  QF+ FAWTH+ LLIVV QS+ II NIFEGLIWF++PVS+++CND+ AY
Sbjct: 201 FVLSLVKKYYMKQFSLFAWTHVALLIVVTQSYLIIQNIFEGLIWFIVPVSMIVCNDVMAY 260

Query: 180 ICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFY 239
           + GFF+GRTPLIKLSPKKTWEGF+G    T+IFG  +S  L  + + +CP Q   +T+  
Sbjct: 261 MFGFFFGRTPLIKLSPKKTWEGFIGGGFATVIFGLIFSYWLCHYQFFVCPIQYSESTSSM 320

Query: 240 GRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFG 299
             + CEP+ +F PQ Y              F   RS+ I P   H L ++ F+S+I PFG
Sbjct: 321 -MIKCEPSYIFQPQEYSFP----------LFGSYRSITIYPFMLHSLSLSIFSSVIGPFG 369

Query: 300 GFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQ 359
           GFFASG KRAF IKDFG  IPGHGGI DR DCQFLM  F ++Y  SFI+ +S      L 
Sbjct: 370 GFFASGFKRAFKIKDFGDVIPGHGGIMDRFDCQFLMATFVNVYISSFIRSAS---PQKLL 426

Query: 360 TIVNSLKPQDQIELFNRLKQYLLSQGLLE 388
            +V SLKP+ Q+ LFN+LK+ L+ + ++ 
Sbjct: 427 NMVYSLKPEQQLYLFNQLKESLIERNIIN 455



>gi|355687278|gb|EHH25862.1| Phosphatidate cytidylyltransferase 1 [Macaca mulatta]
          Length = 461

 Score =  363 bits (931), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 184/388 (47%), Positives = 254/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +       
Sbjct: 79  LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYHSYD 138

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+W+FL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 139 LPWFRTLSWHFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 198

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 199 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 258

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FGF  + +L ++ Y +CP +  +    + 
Sbjct: 259 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFIAAYVLSKYQYFVCPVEYRSDVNSF- 317

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y L P+L ++ R+        V + P Q H + ++ FASLI PFGG
Sbjct: 318 VTECEPSELFQLQTYSLPPFLKAVLRQ------ERVSLYPFQIHSIALSTFASLIGPFGG 371

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 372 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 429

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L+ +G+L+
Sbjct: 430 LL-VLQPEQQLNIYKTLKTHLIEKGILQ 456



>gi|507555647|ref|XP_004661593.1| PREDICTED: phosphatidate cytidylyltransferase 1 [Jaculus jaculus]
          Length = 541

 Score =  363 bits (931), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 186/388 (47%), Positives = 253/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +       
Sbjct: 159 LSSRWKNWWIRGILTLTMISLFFLIISMGSFMLMLLVLGIQVKCFHEIITIGYRVYHSYD 218

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 219 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 278

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 279 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 338

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T+IFGF  + +L ++ Y +CP +  +    + 
Sbjct: 339 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVIFGFIAAYVLSKYQYFVCPVEYRSDINSF- 397

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  QRY L P+L ++          +V + P Q H + ++ FASLI PFGG
Sbjct: 398 VTECEPSELFQLQRYSLPPFLKAVL------GWDTVSLYPFQIHSIALSTFASLIGPFGG 451

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 452 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 509

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L  +G+L+
Sbjct: 510 LL-VLQPEQQLNIYKTLKTHLTEKGILQ 536



>gi|507637090|ref|XP_004629325.1| PREDICTED: phosphatidate cytidylyltransferase 1 [Octodon degus]
          Length = 460

 Score =  363 bits (931), Expect = 7e-98,   Method: Compositional matrix adjust.
 Identities = 187/388 (48%), Positives = 252/388 (64%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFL + +G   ++ LV+ IQ   + E+I I +      +
Sbjct: 78  LSSRWKNWWIRGILTLTMISLFFLTIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYHSYE 137

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 138 LPWFRTLSWYFLLCVNYFFYGETVADYFATYVQREEQLQFLIRYHRFISFALYLAGFCMF 197

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 198 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 257

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FGF  + LL ++ Y +CP +  +    + 
Sbjct: 258 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFIAAYLLSQYQYFVCPVEYRSDVNSF- 316

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP  +F    Y L P+L ++ R  T      V + P Q H + ++ FASLI PFGG
Sbjct: 317 VTECEPTDLFQLHSYSLPPFLQAVLRWET------VSLYPFQIHSIALSTFASLIGPFGG 370

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 371 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 428

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +LL +GLL+
Sbjct: 429 LL-VLQPEQQLNIYRTLKMHLLEKGLLQ 455



>gi|327273030|ref|XP_003221286.1| PREDICTED: phosphatidate cytidylyltransferase 1-like [Anolis
           carolinensis]
          Length = 443

 Score =  362 bits (930), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 187/388 (48%), Positives = 252/388 (64%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T +MI  FFLI+ +G   ++ LV+ IQ   + E+I I +   +   
Sbjct: 61  LSSRWKNWWIRGILTLLMISVFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYRSYD 120

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V     L     +HRFISF LY  GF  F
Sbjct: 121 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQRREQLQFLIRYHRFISFTLYLAGFCLF 180

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AYI
Sbjct: 181 VLSLVKRHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDIAAYI 240

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FGF  + LL ++ Y +CP +  + T  + 
Sbjct: 241 FGFFFGRTPLIKLSPKKTWEGFIGGFFTTVVFGFIAAYLLAQYQYFVCPVEYNSETNRF- 299

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q+Y L P L  L  +       SV + P Q H + ++ FASLI PFGG
Sbjct: 300 VTECEPSELFQLQKYSLPPLLQVLLGK------ESVNLYPFQMHSIALSTFASLIGPFGG 353

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF  +IPGHGGI DR DCQ+LM  F H+Y  SFI+  +    + L  
Sbjct: 354 FFASGFKRAFKIKDFADTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPN---PSKLLK 410

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
            +  L+P++Q+ ++  LK +L+ +G+L+
Sbjct: 411 QLLVLQPEEQLSVYKTLKLHLIEKGILQ 438



>gi|357624919|gb|EHJ75514.1| phosphatidate cytidylyltransferase [Danaus plexippus]
          Length = 446

 Score =  362 bits (930), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 182/388 (46%), Positives = 263/388 (67%), Gaps = 8/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +W+N  +R I+T++MI GF L++  G + ++  V+ +Q   ++E+I I +   +   
Sbjct: 64  LSSRWRNWVIRGIFTWLMIGGFCLLIYGGPLALMITVLCVQVKCFEEIINIGYAVYRVHG 123

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF++L+WYFL+++ YF YGE++I YF  ++    +L    T+HRFISF LYC+GFV+F
Sbjct: 124 LPWFRSLSWYFLLTSNYFFYGENLIDYFGVVINRTDYLRFLVTYHRFISFSLYCVGFVWF 183

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K +Y  QF+ FAWTH+ LLIVV QS+ II NIFEGLIWF++PVS++ICND+ AY+
Sbjct: 184 VLSLVKRYYMRQFSLFAWTHVALLIVVTQSYLIIQNIFEGLIWFIVPVSMIICNDVMAYV 243

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+G+TPLIKLSPKKTWEGF+G    T++FG   S L+ ++ Y++CP +   + +   
Sbjct: 244 FGFFFGKTPLIKLSPKKTWEGFIGGGFSTVVFGLVLSYLMSQYPYLVCPIE--YSESLGM 301

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
            + CEP+ +F  Q Y    ++  L R    + I    + P   H L ++ F+S+I PFGG
Sbjct: 302 TMDCEPSGLFRLQEYTTPAFMLPLVRAFGREKIN---LYPFMIHSLALSIFSSVIGPFGG 358

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDFG  IPGHGGI DR DCQFLM  F ++Y  SFI+ +  T   +LQ 
Sbjct: 359 FFASGFKRAFKIKDFGDVIPGHGGIMDRFDCQFLMATFVNVYITSFIRTA--TPQKLLQQ 416

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           + N LKP+ Q++LF  LK+ L ++ +L 
Sbjct: 417 VYN-LKPEQQLQLFYALKESLENRNILN 443



>gi|334331033|ref|XP_001364720.2| PREDICTED: phosphatidate cytidylyltransferase 1 [Monodelphis
           domestica]
          Length = 467

 Score =  362 bits (930), Expect = 8e-98,   Method: Compositional matrix adjust.
 Identities = 186/388 (47%), Positives = 253/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +   +  +
Sbjct: 85  LSARWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYRSYE 144

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 145 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 204

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 205 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 264

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FGF  + +L ++ Y +CP +  +    + 
Sbjct: 265 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFIAAYILAKYQYFVCPIEYRSEINSF- 323

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y + P L  + R  T      V + P Q H + ++ FASLI PFGG
Sbjct: 324 VTECEPSELFQLQTYSVPPLLKGVLRWDT------VSLYPFQIHSIALSTFASLIGPFGG 377

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 378 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 435

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L  +GLL+
Sbjct: 436 LL-VLQPEQQLNIYKTLKSHLTEKGLLQ 462



>gi|291230676|ref|XP_002735291.1| PREDICTED: phosphatidate cytidylyltransferase 1-like [Saccoglossus
           kowalevskii]
          Length = 452

 Score =  362 bits (930), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 185/392 (47%), Positives = 257/392 (65%), Gaps = 20/392 (5%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +  +W+N  +R IW+ +M+ GF LI+ +G + ++ L+++IQ   ++E+I I +   K + 
Sbjct: 76  LPPRWRNWIIRGIWSIIMVAGFLLIIWIGPLGLVALIMLIQLACFREIINIGYAVYKSQD 135

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVD-AFLLPFATHHRFISFVLYCIGFVF 119
           LPWF+TL+WYFL+   YF YGES   YF  +V  D  FL P A +HRFISF LY +GF  
Sbjct: 136 LPWFRTLSWYFLLCANYFFYGESTKDYFGILVHKDLEFLQPLADYHRFISFTLYVLGFCA 195

Query: 120 FVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAY 179
           FV +L K HY  QFT F WTH+TLLIVV QSH ++  IFEGLIWF+L  S++ICNDI AY
Sbjct: 196 FVLSLVKQHYLVQFTLFGWTHVTLLIVVTQSHLLVQCIFEGLIWFLLSTSMIICNDIMAY 255

Query: 180 ICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPA---QDLTTT 236
           I GFF+GRT LIKLSPKKTWEGF+GA   T+++ F  +  L  + + +CPA    DL   
Sbjct: 256 IFGFFFGRTSLIKLSPKKTWEGFIGAFFSTVLYAFAMAYFLAPYQHFVCPANYDDDLKRI 315

Query: 237 AFYGRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIA 296
                + CEP+  FI   Y++   L  + +        ++W+ P+Q H L +A FASL++
Sbjct: 316 T----MDCEPSSTFIMTEYNIP--LFGIHQ-------STIWLYPIQIHALALATFASLVS 362

Query: 297 PFGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGA 356
           PFGGFFASG KRAF IKDFG  +PGHGGI DR DCQ+LM  F H+Y  SFI+ ++     
Sbjct: 363 PFGGFFASGFKRAFKIKDFGDVLPGHGGIMDRFDCQYLMASFLHVYLSSFIRTAN--PAK 420

Query: 357 VLQTIVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           +LQ ++  L P  Q+ +F + +++L+  GLL+
Sbjct: 421 LLQQVLQ-LNPDQQLNVFLQFQEHLIKNGLLK 451



>gi|157125436|ref|XP_001654340.1| phosphatidate cytidylyltransferase [Aedes aegypti]
 gi|108882704|gb|EAT46929.1| AAEL001940-PA [Aedes aegypti]
          Length = 458

 Score =  362 bits (929), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 187/389 (48%), Positives = 258/389 (66%), Gaps = 16/389 (4%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +  KW+N  +R I+T VMI GF +I+  G + ++   +++Q   ++E+I I +   +   
Sbjct: 82  LPDKWRNWVIRGIFTMVMIGGFAIIVYCGPLALMITALLVQVKCFEEIINIGYSVYRIHG 141

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFK-AIVMVDAFLLPFATHHRFISFVLYCIGFVF 119
           LPWF++L+WYFLI++ YF YGE+++ YF  A+  +DA       +HRF+SF LYCIGFV+
Sbjct: 142 LPWFRSLSWYFLITSNYFFYGENLVDYFGVAVNQIDALRF-LVKYHRFLSFCLYCIGFVW 200

Query: 120 FVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAY 179
           FV +L K +Y  QF+ FAWTH+ LLIVV QS+ II NIFEGLIWF++PVS+++CND+ AY
Sbjct: 201 FVLSLVKKYYMKQFSLFAWTHVALLIVVTQSYLIIQNIFEGLIWFIVPVSMIVCNDVMAY 260

Query: 180 ICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFY 239
           + GFF+GRTPLIKLSPKKTWEGF+G    T+IFG  +S  L  + + +CP Q   +T+  
Sbjct: 261 MFGFFFGRTPLIKLSPKKTWEGFIGGGFATVIFGLMFSYWLCHYQFFVCPIQYSESTSSM 320

Query: 240 GRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFG 299
             + CEP+ +F PQ Y              F   RS+ I P   H L ++ F+S+I PFG
Sbjct: 321 -MIKCEPSYIFQPQEYSFP----------LFGSYRSITIYPFMLHSLSLSIFSSVIGPFG 369

Query: 300 GFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQ 359
           GFFASG KRAF IKDFG  IPGHGGI DR DCQFLM  F ++Y  SFI+ +S      L 
Sbjct: 370 GFFASGFKRAFKIKDFGDVIPGHGGIMDRFDCQFLMATFVNVYISSFIRSAS---PQKLL 426

Query: 360 TIVNSLKPQDQIELFNRLKQYLLSQGLLE 388
            +V SLKP+ Q+ LFN+LK+ L  + ++ 
Sbjct: 427 NMVYSLKPEQQLYLFNQLKESLTERNIIN 455



>gi|383848195|ref|XP_003699737.1| PREDICTED: phosphatidate cytidylyltransferase,
           photoreceptor-specific-like [Megachile rotundata]
          Length = 445

 Score =  362 bits (929), Expect = 9e-98,   Method: Compositional matrix adjust.
 Identities = 187/390 (47%), Positives = 265/390 (67%), Gaps = 10/390 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +RTI+T  MI GF  I+  G + ++   +++Q   ++E+I I +   +   
Sbjct: 62  LSDRWKNWVIRTIFTLFMITGFCGIIYAGPLALMATTLIVQVKCFQEIINIGYAVYRIHG 121

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF++L+WYFLI++ YF YGE+++ YF  ++    +L    T+HRFISF LY +GFV+F
Sbjct: 122 LPWFRSLSWYFLITSNYFFYGENLMDYFAVVINRTEYLRLLVTYHRFISFCLYIVGFVWF 181

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K +Y  QF+ FAWTH+ LLIVV QS+ II NIF+GLIWF++PVS+++ NDI AY+
Sbjct: 182 VLSLVKKYYMKQFSLFAWTHVALLIVVTQSYLIITNIFQGLIWFIVPVSMIVINDIMAYM 241

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+G+TPLIKLSPKKTWEGF+G  I T+I G   S ++ ++ Y +CP +    +   G
Sbjct: 242 FGFFFGKTPLIKLSPKKTWEGFIGGGISTVILGLVISYIMCQYRYFVCPIE---YSEALG 298

Query: 241 RLT--CEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPF 298
           ++T  CEP+ +F PQ Y L   L  +++ ++ K   S++  P   H L M+ F+S+I PF
Sbjct: 299 QMTMDCEPSALFQPQEYSLPGSLQVVWKMISGKSTMSLY--PFLLHSLSMSVFSSVIGPF 356

Query: 299 GGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVL 358
           GGFFASG KRAF IKDFG  IPGHGGI DR DCQ+LM  F ++Y  SFI+ +S     +L
Sbjct: 357 GGFFASGFKRAFKIKDFGDIIPGHGGIMDRFDCQYLMATFVNVYISSFIQTASPQ--KLL 414

Query: 359 QTIVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           Q  V SLKP+ Q++LF  LK  L ++GLL 
Sbjct: 415 QQ-VYSLKPEQQLQLFQTLKDSLENRGLLN 443



>gi|340720098|ref|XP_003398480.1| PREDICTED: phosphatidate cytidylyltransferase,
           photoreceptor-specific-like [Bombus terrestris]
          Length = 445

 Score =  362 bits (929), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 184/390 (47%), Positives = 265/390 (67%), Gaps = 10/390 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +W+N  +R+I+T  MI GF  I+ +G + ++   +V+Q   ++E+I I +   +   
Sbjct: 62  LSDRWRNWVIRSIFTLFMIVGFCGIIYIGPLALMATTLVVQVKCFQEIINIGYAVYRIHG 121

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF++L+WYFLI++ YF YGE+++ YF  ++    +L    T+HRFISF LY +GFV+F
Sbjct: 122 LPWFRSLSWYFLITSNYFFYGENLMDYFAVVINRTEYLRVLVTYHRFISFCLYIVGFVWF 181

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K +Y  QF+ FAWTH+ LLIVV QS+ II NIFEGLIWF++PVS+++ ND+ AY+
Sbjct: 182 VLSLVKKYYMKQFSLFAWTHVALLIVVTQSYLIIQNIFEGLIWFIVPVSMIVINDVMAYM 241

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+G+TPLIKLSPKKTWEGF+G  I T++ G   S ++ ++ Y +CP +    +   G
Sbjct: 242 FGFFFGKTPLIKLSPKKTWEGFIGGGISTVLLGLLVSYIMCQYRYFVCPIE---YSEALG 298

Query: 241 RLT--CEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPF 298
           R+T  CEP+ +F PQ Y L   L  +++  + K   ++ + P   H L M+ F+S+I PF
Sbjct: 299 RMTMDCEPSSLFQPQEYILPNSLQVVWKMFSGKS--TITLYPFLLHSLSMSVFSSVIGPF 356

Query: 299 GGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVL 358
           GGFFASG KRAF IKDFG  IPGHGGI DR DCQ+LM  F ++Y  SFI+ +S     +L
Sbjct: 357 GGFFASGFKRAFKIKDFGDVIPGHGGIMDRFDCQYLMATFVNVYISSFIQTASPQ--KLL 414

Query: 359 QTIVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           Q + N LKP+ Q++LF  LK  L ++GLL 
Sbjct: 415 QQVYN-LKPEQQLQLFQTLKDSLQNRGLLN 443



>gi|513022291|ref|XP_004872397.1| PREDICTED: phosphatidate cytidylyltransferase 1 isoform X1
           [Heterocephalus glaber]
          Length = 460

 Score =  362 bits (929), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 185/388 (47%), Positives = 251/388 (64%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +       
Sbjct: 78  LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYHSYD 137

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 138 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 197

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 198 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 257

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FGF  + +L ++ Y +CP +  +    + 
Sbjct: 258 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFMAAYMLSKYQYFVCPIEYRSDVNSF- 316

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP  +F    Y L  +L ++ RR T      V + P Q H + ++ FASLI PFGG
Sbjct: 317 VTECEPADLFQLHSYSLPSFLKAVLRRET------VSLYPFQIHSIALSTFASLIGPFGG 370

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 371 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 428

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P  Q+ ++  LK +L+ +G+L+
Sbjct: 429 LL-VLQPDQQLSIYRTLKMHLIEKGILQ 455



>gi|350408246|ref|XP_003488349.1| PREDICTED: phosphatidate cytidylyltransferase,
           photoreceptor-specific-like [Bombus impatiens]
          Length = 445

 Score =  362 bits (928), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 184/390 (47%), Positives = 265/390 (67%), Gaps = 10/390 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +W+N  +R+I+T  MI GF  I+ +G + ++   +V+Q   ++E+I I +   +   
Sbjct: 62  LSDRWRNWVIRSIFTLFMIVGFCGIIYIGPLALMATTLVVQVKCFQEIINIGYAVYRIHG 121

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF++L+WYFLI++ YF YGE+++ YF  ++    +L    T+HRFISF LY +GFV+F
Sbjct: 122 LPWFRSLSWYFLITSNYFFYGENLMDYFAVVINRTEYLRVLVTYHRFISFCLYIVGFVWF 181

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K +Y  QF+ FAWTH+ LLIVV QS+ II NIFEGLIWF++PVS+++ ND+ AY+
Sbjct: 182 VLSLVKKYYMKQFSLFAWTHVALLIVVTQSYLIIQNIFEGLIWFIVPVSMIVINDVMAYM 241

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+G+TPLIKLSPKKTWEGF+G  I T++ G   S ++ ++ Y +CP +    +   G
Sbjct: 242 FGFFFGKTPLIKLSPKKTWEGFIGGGISTVLLGLLVSYIMCQYRYFVCPIE---YSEALG 298

Query: 241 RLT--CEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPF 298
           R+T  CEP+ +F PQ Y L   L  +++  + K   ++ + P   H L M+ F+S+I PF
Sbjct: 299 RMTMDCEPSSLFQPQEYILPNSLQVVWKMFSGKS--TITLYPFLLHSLSMSVFSSVIGPF 356

Query: 299 GGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVL 358
           GGFFASG KRAF IKDFG  IPGHGGI DR DCQ+LM  F ++Y  SFI+ +S     +L
Sbjct: 357 GGFFASGFKRAFKIKDFGDVIPGHGGIMDRFDCQYLMATFVNVYISSFIQTASPQ--KLL 414

Query: 359 QTIVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           Q + N LKP+ Q++LF  LK  L ++GLL 
Sbjct: 415 QQVYN-LKPEQQLQLFQTLKDSLQNRGLLN 443



>gi|507648191|ref|XP_004703300.1| PREDICTED: phosphatidate cytidylyltransferase 1 [Echinops telfairi]
          Length = 461

 Score =  362 bits (928), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 185/388 (47%), Positives = 254/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +   +   
Sbjct: 79  LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYRSYD 138

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 139 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 198

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 199 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 258

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF GRTPLIKLSPKKTWEGF+G    T++FGF  + +L ++ Y +CP +  +    + 
Sbjct: 259 FGFFLGRTPLIKLSPKKTWEGFIGGFFSTVVFGFIAAYVLSKYQYFVCPVEYRSDVNSF- 317

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  + Y L  +L ++ RR T      V + P Q H + ++ FASLI PFGG
Sbjct: 318 VTECEPSELFQLRSYTLPLFLQAVLRRET------VSLYPFQIHSIALSSFASLIGPFGG 371

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 372 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--RVLQQ 429

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L+ +G+L+
Sbjct: 430 LL-VLQPEQQLNIYKTLKTHLIEKGILQ 456



>gi|512823574|ref|XP_004880163.1| PREDICTED: phosphatidate cytidylyltransferase 1 isoform X1
           [Heterocephalus glaber]
 gi|351697246|gb|EHB00165.1| Phosphatidate cytidylyltransferase 1 [Heterocephalus glaber]
          Length = 460

 Score =  361 bits (927), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 185/388 (47%), Positives = 251/388 (64%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +       
Sbjct: 78  LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYHSYD 137

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 138 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 197

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 198 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 257

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FGF  + +L ++ Y +CP +  +    + 
Sbjct: 258 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFMAAYMLSKYQYFVCPIEYRSDVNSF- 316

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP  +F    Y L  +L ++ RR T      V + P Q H + ++ FASLI PFGG
Sbjct: 317 VTECEPADLFQLHSYSLPSFLKAVLRRET------VSLYPFQIHSIALSTFASLIGPFGG 370

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 371 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 428

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P  Q+ ++  LK +L+ +G+L+
Sbjct: 429 LL-VLQPDQQLSIYRTLKMHLIEKGILQ 455



>gi|156379863|ref|XP_001631675.1| predicted protein [Nematostella vectensis]
 gi|156218719|gb|EDO39612.1| predicted protein [Nematostella vectensis]
          Length = 449

 Score =  361 bits (927), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 182/390 (46%), Positives = 263/390 (67%), Gaps = 7/390 (1%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +  KW+N  +R  ++ VM+ GF LI+  G + +I L+  +Q   + E+I+I H   ++  
Sbjct: 64  LQPKWRNWWIRGAFSAVMLSGFGLIMYTGPLGLIILIQCLQIKCFHEIISIGHKKYQKHN 123

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVM---VDAFLLPFATHHRFISFVLYCIGF 117
           LPWF++L+WYFL+ + YF YGESI  + +   +    D  +  +  +HR ISF+LY IG 
Sbjct: 124 LPWFRSLSWYFLLGSNYFFYGESITDFIRGKGVHNESDEVVKAYFPYHRLISFMLYTIGI 183

Query: 118 VFFVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIF 177
           + FV +LKK  YK QF+ F WTH+TLLIVV QSH I+  +FEGLIWF LPV++VICNDI+
Sbjct: 184 ILFVLSLKKDFYKVQFSLFGWTHVTLLIVVTQSHLIMQTLFEGLIWFFLPVTMVICNDIW 243

Query: 178 AYICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTA 237
           AYI GFF+GRTPLIK+SPKKTWEGF+G    TII+G+     + R+++ +CP +   T++
Sbjct: 244 AYIFGFFFGRTPLIKISPKKTWEGFIGGGFATIIYGWIACYFMIRYEFFVCPVEYDETSS 303

Query: 238 FYGRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAP 297
           F  +++C+P+P+F+   Y L   L  L   +  +    VW+ P+  H L++A F+S+IAP
Sbjct: 304 FMFKMSCQPSPIFVLTPYSLPGPLRFLISLIGIRQ-EVVWMYPMHLHSLILALFSSIIAP 362

Query: 298 FGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAV 357
           FGGFFASG KRAF +KDF  +IPGHGGI DR DCQFLM  F H+Y+ +FI+        +
Sbjct: 363 FGGFFASGFKRAFKVKDFSDTIPGHGGILDRFDCQFLMATFVHVYHFTFIRAPQ--PHKL 420

Query: 358 LQTIVNSLKPQDQIELFNRLKQYLLSQGLL 387
           LQ ++ +LKP  Q+ +F RL++ L ++GLL
Sbjct: 421 LQQVL-TLKPSQQLVIFKRLQEALSARGLL 449



>gi|512823578|ref|XP_004880164.1| PREDICTED: phosphatidate cytidylyltransferase 1 isoform X2
           [Heterocephalus glaber]
 gi|512823581|ref|XP_004880165.1| PREDICTED: phosphatidate cytidylyltransferase 1 isoform X3
           [Heterocephalus glaber]
 gi|513022293|ref|XP_004872398.1| PREDICTED: phosphatidate cytidylyltransferase 1 isoform X2
           [Heterocephalus glaber]
 gi|513022295|ref|XP_004872399.1| PREDICTED: phosphatidate cytidylyltransferase 1 isoform X3
           [Heterocephalus glaber]
          Length = 429

 Score =  361 bits (926), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 185/388 (47%), Positives = 251/388 (64%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +       
Sbjct: 47  LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYHSYD 106

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 107 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 166

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 167 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 226

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FGF  + +L ++ Y +CP +  +    + 
Sbjct: 227 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFMAAYMLSKYQYFVCPIEYRSDVNSF- 285

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP  +F    Y L  +L ++ RR T      V + P Q H + ++ FASLI PFGG
Sbjct: 286 VTECEPADLFQLHSYSLPSFLKAVLRRET------VSLYPFQIHSIALSTFASLIGPFGG 339

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 340 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 397

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P  Q+ ++  LK +L+ +G+L+
Sbjct: 398 LL-VLQPDQQLSIYRTLKMHLIEKGILQ 424



>gi|395542210|ref|XP_003773027.1| PREDICTED: phosphatidate cytidylyltransferase 1 [Sarcophilus
           harrisii]
          Length = 731

 Score =  361 bits (926), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 187/388 (48%), Positives = 253/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +   +  +
Sbjct: 349 LSARWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYRSYE 408

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 409 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 468

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 469 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 528

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T+IFGF  +  L ++ Y +CP +  +    + 
Sbjct: 529 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVIFGFIAAYFLAKYQYFVCPVEYRSEVNSF- 587

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y + P L  + R  T      V + P Q H + ++ FASLI PFGG
Sbjct: 588 VTECEPSELFQLQTYSVPPLLKGVLRWDT------VSLYPFQIHSIALSTFASLIGPFGG 641

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 642 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 699

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L+ +GLL+
Sbjct: 700 LL-VLQPEQQLNIYKTLKSHLIEKGLLQ 726



>gi|50290049|ref|XP_447456.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49526766|emb|CAG60393.1| unnamed protein product [Candida glabrata]
          Length = 431

 Score =  361 bits (926), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 183/389 (47%), Positives = 250/389 (64%), Gaps = 8/389 (2%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
           S+K+ N  +RTIWTF+MI GFF +L  GHIW + L+++ Q  ++ E IA+    S+E+ L
Sbjct: 35  SRKY-NFLIRTIWTFIMIGGFFAVLASGHIWCVMLILLCQIAIFMECIAVTSGSSRERDL 93

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           P  KTLNWYFLI+T Y+L G S+  + +        L     HH+FI +  Y  G V FV
Sbjct: 94  PLTKTLNWYFLITTIYYLEGSSLFRFLEPAFYKYTLLRMVVEHHKFICYCFYVFGVVLFV 153

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K H KFQF     THM +L VV Q++ +  N+  GL WF+LP  LVI NDIFAY+C
Sbjct: 154 CSLRKGHLKFQFASLCITHMVMLFVVAQAYLVTKNVLNGLFWFLLPCGLVIVNDIFAYLC 213

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G   GRT LI +SPKKT EGF+GA   T +     + LL  + Y+ CP QDL T  F+  
Sbjct: 214 GITLGRTKLIAISPKKTLEGFLGAWFFTALASIILTRLLSPYMYLTCPVQDLHTN-FFSN 272

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           LTC+ NPVF+ Q Y   P++   +       I  + + P+ +H L +A FASL+APFGGF
Sbjct: 273 LTCDLNPVFLKQDYKTPPFIAEKY------GINVITVKPIYFHALNLATFASLVAPFGGF 326

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KRAF +KDFGHSIPGHGGITDR+DCQ LMG F+++YY +FI    +T+ +++ TI
Sbjct: 327 FASGLKRAFKVKDFGHSIPGHGGITDRVDCQILMGSFTYLYYTTFINERGITIESIISTI 386

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           + +   +  IE+  RL + LL  GLLE++
Sbjct: 387 LINFNEKQIIEIVLRLNKKLLESGLLEKK 415



>gi|403217066|emb|CCK71561.1| hypothetical protein KNAG_0H01470 [Kazachstania naganishii CBS
           8797]
          Length = 446

 Score =  360 bits (924), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 188/387 (48%), Positives = 247/387 (63%), Gaps = 6/387 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
            +K  N  VRT+WT VMI GFF+ L  GHIW + LVV  Q   ++E I +  + S+EKKL
Sbjct: 50  EKKKYNFFVRTVWTLVMICGFFVTLASGHIWCVLLVVYCQVATFRECIGVTTLSSREKKL 109

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           P  +TLNWY L +T Y+L  +    +F    +    L    ++H FI +  Y  GFV FV
Sbjct: 110 PLTRTLNWYMLFTTIYYLDSQEFYQFFGPSFLEYKVLSIIRSNHGFICYCAYLFGFVIFV 169

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
           ++L+K H KFQ      THM LL +V Q H II NI  GL WF+LP  LVI NDIFAY+C
Sbjct: 170 SSLRKGHLKFQMGSLCITHMALLFIVFQGHLIIKNILNGLFWFLLPCGLVIVNDIFAYLC 229

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +G+T LI++SPKKT EGF+GA   T +     + LL  + Y+ CP +DL T  F+  
Sbjct: 230 GITFGKTKLIEISPKKTLEGFMGAWFFTALASVILTRLLSPYTYLTCPTKDLKTN-FFSA 288

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           LTCE NPVF+PQ Y L P    +F    F  I S+ I P+ +H L +A FASL APFGGF
Sbjct: 289 LTCELNPVFLPQTYKL-PL---VFFEEKF-GISSITIKPIYFHALNLATFASLFAPFGGF 343

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KRAF +KDFGHSIPGHGGITDR+DCQFLMG F+++YY++FI  + +TV  VL TI
Sbjct: 344 FASGLKRAFKVKDFGHSIPGHGGITDRVDCQFLMGSFANLYYETFISENRITVETVLSTI 403

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLE 388
           + +L  ++ ++L   L   L  + +L 
Sbjct: 404 LMNLNEREILQLVATLLDTLKKRDVLN 430



>gi|113205588|ref|NP_001037999.1| phosphatidate cytidylyltransferase 1 [Sus scrofa]
 gi|74054295|gb|AAZ95510.1| CDP-diacylglycerol synthase 1 [Sus scrofa]
          Length = 461

 Score =  360 bits (924), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 183/388 (47%), Positives = 254/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFL++ +G   ++ LV+ IQ   + E+I I +   +   
Sbjct: 79  LSSRWKNWWIRGILTLTMISLFFLVIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYRSYD 138

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 139 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 198

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 199 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 258

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FGF  + +L ++ Y +CP +  +    + 
Sbjct: 259 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFIAAYVLSKYQYFVCPVEYRSDINSF- 317

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y L P L ++ R+       +V + P Q H + ++ FASLI P GG
Sbjct: 318 VTECEPSELFQLQSYSLPPSLKAVLRQ------EAVSLYPFQIHSIALSTFASLIGPCGG 371

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 372 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 429

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L+ +G+L+
Sbjct: 430 LL-VLQPEQQLNIYKTLKIHLIEKGILQ 456



>gi|187607503|ref|NP_001119975.1| CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2
           [Xenopus (Silurana) tropicalis]
 gi|165970783|gb|AAI58219.1| LOC100144929 protein [Xenopus (Silurana) tropicalis]
          Length = 465

 Score =  360 bits (923), Expect = 5e-97,   Method: Compositional matrix adjust.
 Identities = 184/392 (46%), Positives = 253/392 (64%), Gaps = 10/392 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  VR I T  MI  FF+I+ LG I ++ +V+ +Q   ++E+I I +       
Sbjct: 83  LSSRWKNWWVRGILTLAMISFFFIIIYLGPIVLMMIVMCVQIKCFQEIIMIGYNVYHSYD 142

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF  +V  +  L   + +HRFISF LY  GF  F
Sbjct: 143 LPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSKYHRFISFALYLTGFCMF 202

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  F WTH+TLLIVV QSH II+N+FEG+IWF++P+S VICNDI AY+
Sbjct: 203 VLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLIIHNLFEGMIWFIVPISCVICNDIMAYM 262

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FG   S ++  + Y +CP +    T  + 
Sbjct: 263 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGLLLSYVMAGYSYFVCPVEFNNETNRF- 321

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
            + CEP+ +F  Q Y +     S+         ++VW+ P Q H + ++ FASLI PFGG
Sbjct: 322 TVDCEPSELFQLQEYHIPAMFHSVI------SWKTVWMYPFQIHSIALSTFASLIGPFGG 375

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F ++Y  SFI+  + +   ++Q 
Sbjct: 376 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPS--KLIQQ 433

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLEERGA 392
            + +L+P  QI +FN LK +L   G+L     
Sbjct: 434 FL-TLRPDQQIHIFNTLKSHLTENGILANDNG 464



>gi|390460673|ref|XP_003732522.1| PREDICTED: LOW QUALITY PROTEIN: phosphatidate cytidylyltransferase
           1-like [Callithrix jacchus]
          Length = 461

 Score =  359 bits (922), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 184/387 (47%), Positives = 253/387 (65%), Gaps = 10/387 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +       
Sbjct: 79  LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYHSYD 138

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 139 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 198

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K H + QF  FAWTH+TLLI+V QSH +I ++FEG+IWF+LP+S VICNDI AY+
Sbjct: 199 VLSLVKKHCRLQFYMFAWTHVTLLIIVTQSHLVIQSLFEGMIWFLLPISSVICNDITAYL 258

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FGF  + +L ++ Y +CP +  +    + 
Sbjct: 259 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFIAAYVLSKYQYFVCPVEYRSDVNSF- 317

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y L P+L ++ R+        V + P Q H + ++ FASLI PFGG
Sbjct: 318 VTECEPSELFQLQNYSLPPFLKAVLRQ------ERVSLYPFQLHSIALSTFASLIGPFGG 371

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 372 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYIASFIRGPNPS--KVLQQ 429

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLL 387
           ++  L+P+ Q+ ++  LK +L+ +G+L
Sbjct: 430 LL-VLQPEHQLNIYKTLKIHLIEKGIL 455



>gi|482552507|gb|EOA16700.1| hypothetical protein CARUB_v10004892mg [Capsella rubella]
          Length = 423

 Score =  359 bits (922), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 186/387 (48%), Positives = 256/387 (66%), Gaps = 14/387 (3%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
           S K+K+  VR   T  MI GF LI+ LGH+++  +VVVIQ  + +E+  +     ++K+L
Sbjct: 43  SSKYKSFLVRAYSTIWMIGGFALIVYLGHLYITAMVVVIQIFMARELFNLLRKTHEDKQL 102

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFAT----HHRFISFVLYCIGF 117
           P F+ LNW+F  +   F+YG  +       V  D  L    T    +H  I + LY  GF
Sbjct: 103 PGFRLLNWHFFFTAMLFVYGRILSQRLVNTVTPDKVLYRLVTSLIRYHMAICYSLYISGF 162

Query: 118 VFFVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIF 177
           V+F+  LKK  YK+QF+Q+AWTHM L++V  QS F + NIFEG+ WF+LP SL++ NDIF
Sbjct: 163 VWFILTLKKKMYKYQFSQYAWTHMILIVVFTQSSFTVANIFEGIFWFLLPASLIVINDIF 222

Query: 178 AYICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTA 237
           AYICGFF+GRTPLIKLSPKKTWEGF+GA I T+I  F  ++++ R+ ++ CP +DL+T  
Sbjct: 223 AYICGFFFGRTPLIKLSPKKTWEGFIGASITTVISAFLLANIMGRFLWLTCPREDLST-- 280

Query: 238 FYGRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAP 297
             G L C+P P+F  + + L  W++ L   L +K+I    I P+QWH L +  FAS+IAP
Sbjct: 281 --GWLHCDPGPLFKQETHTLPGWISDL---LPWKEIT---ILPVQWHALCLGLFASIIAP 332

Query: 298 FGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAV 357
           FGGFFASG KRAF IKDFG SIPGHGG+TDRMDCQ +M  F+++Y+QSF+    L+V  +
Sbjct: 333 FGGFFASGFKRAFKIKDFGDSIPGHGGMTDRMDCQMVMAVFAYIYHQSFVVPEVLSVDKL 392

Query: 358 LQTIVNSLKPQDQIELFNRLKQYLLSQ 384
           L  I+ SL  ++Q  LF +L Q L  +
Sbjct: 393 LDQIITSLTLEEQQALFMKLGQMLQEK 419



>gi|374107996|gb|AEY96903.1| FAEL084Wp [Ashbya gossypii FDAG1]
          Length = 433

 Score =  359 bits (922), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 183/384 (47%), Positives = 241/384 (62%), Gaps = 7/384 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
             K  N  VRTIWT +MI GFF+ L +GH W + L++  Q   ++E IA+     +EK L
Sbjct: 41  DSKVYNFVVRTIWTLIMIAGFFITLAMGHFWCVILILGCQIATFQECIAVTAESGREKNL 100

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           P  +TLNWYFL +T Y+L G+S+   F+   +    L   A +H+FIS+ +   GFV FV
Sbjct: 101 PLTRTLNWYFLFTTIYYLDGKSLYKLFRHYTINYRVLGFIAANHKFISYCMLVFGFVVFV 160

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K   KFQF     THM LL+VV Q+H IINN+  GLIWF+LP  LVI NDIFAY+C
Sbjct: 161 CSLRKGFLKFQFASLCVTHMVLLLVVFQAHLIINNVLNGLIWFLLPCGLVIVNDIFAYLC 220

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LI +SPKKT EGF+GA   T +     + LL  + YM CP Q++ T  F   
Sbjct: 221 GITFGRTKLIAISPKKTLEGFLGAWFFTGLAALILTRLLTPYTYMTCPVQNIHTNVF-SP 279

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L CE NPVFIPQ Y L P +   F      ++ ++   P+  H   +A FASL APFGGF
Sbjct: 280 LNCETNPVFIPQTYRLPPIIFDRF------NVSTITFKPIYMHAFNLATFASLFAPFGGF 333

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F +KDFGHSIPGHGGITDR+DCQF+MG F ++YY++FI    +TV  VL TI
Sbjct: 334 FASGLKRTFKVKDFGHSIPGHGGITDRVDCQFMMGSFMNLYYETFISEKRITVETVLSTI 393

Query: 362 VNSLKPQDQIELFNRLKQYLLSQG 385
           + +   +  ++L   L + L   G
Sbjct: 394 LMNFDERQILQLIAALNRVLWENG 417



>gi|403263807|ref|XP_003924202.1| PREDICTED: phosphatidate cytidylyltransferase 1 [Saimiri
           boliviensis boliviensis]
          Length = 497

 Score =  359 bits (922), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 184/388 (47%), Positives = 254/388 (65%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFLI+ +G   ++ LV+ IQ   + E+I I +       
Sbjct: 115 LSSRWKNWWIRGILTLTMISLFFLIIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYHSYD 174

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 175 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 234

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K H + QF  FAWTH+TLLI+V QSH +I ++FEG+IWF+LP+S VICNDI AY+
Sbjct: 235 VLSLVKKHCRLQFYMFAWTHVTLLIIVTQSHLVIQSLFEGMIWFLLPISSVICNDITAYL 294

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FGF  + +L ++ Y +CP +  +    + 
Sbjct: 295 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFIAAYVLSKYQYFVCPVEYRSDVNSF- 353

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  Q Y L P+L ++ R+        V + P Q H + ++ FASLI PFGG
Sbjct: 354 VTECEPSELFQLQNYSLPPFLKAVLRQ------ERVSLYPFQIHSIALSTFASLIGPFGG 407

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 408 FFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVHVYIASFIRGPNPS--KVLQQ 465

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L+ +G+L+
Sbjct: 466 LL-VLQPEHQLNIYKTLKIHLIEKGILQ 492



>gi|297837175|ref|XP_002886469.1| CDP-diacylglycerol synthase 1 [Arabidopsis lyrata subsp. lyrata]
 gi|297332310|gb|EFH62728.1| CDP-diacylglycerol synthase 1 [Arabidopsis lyrata subsp. lyrata]
          Length = 421

 Score =  359 bits (922), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 184/386 (47%), Positives = 252/386 (65%), Gaps = 14/386 (3%)

Query: 3   QKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKLP 62
            K+K+  VRT  T  MI GF L++ +GH+++  +VVVIQ  + KE+  +     ++K LP
Sbjct: 44  NKYKSFMVRTYSTLWMIGGFVLVVYMGHLYITAMVVVIQIFMAKELFNLLRKAPEDKCLP 103

Query: 63  WFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFAT----HHRFISFVLYCIGFV 118
           W K LNW+F  +   F+YG  +       +  D F     T    +H  I ++LY IGF+
Sbjct: 104 WIKQLNWHFFFTAMLFVYGRILSQRLANTMTADQFFYRLVTGLIKYHMAICYLLYIIGFM 163

Query: 119 FFVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFA 178
           +F+  LKK  YK+QF Q+AWTHM L++V  QS F + NIFEG+ WF+LP SL+I NDIFA
Sbjct: 164 WFILTLKKKMYKYQFGQYAWTHMILIVVFTQSSFTVANIFEGIFWFLLPASLIIINDIFA 223

Query: 179 YICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAF 238
           YI GFF+GRTPLIKLSPKKTWEGF+GA + TII  F  +++L R+ ++ CP QDL+T   
Sbjct: 224 YIFGFFFGRTPLIKLSPKKTWEGFIGASVTTIISAFVVANILGRYPWLTCPRQDLST--- 280

Query: 239 YGRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPF 298
            G L C+ +P+F P+ + L  W+   F        + + + P+QWH L +  FAS+IAPF
Sbjct: 281 -GWLQCDADPLFKPEPFALPAWIPEWF------PWKEMTVLPVQWHALCLGLFASIIAPF 333

Query: 299 GGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVL 358
           GGFFASG KRAF IKDFG SIPGHGGITDRMDCQ +M  F+++Y QSFI   S++V  +L
Sbjct: 334 GGFFASGFKRAFKIKDFGDSIPGHGGITDRMDCQMVMAVFAYIYLQSFIVSQSVSVDKIL 393

Query: 359 QTIVNSLKPQDQIELFNRLKQYLLSQ 384
             I+ +L  ++Q  LF +L Q L  +
Sbjct: 394 DQILTNLTFEEQQALFVKLGQMLKDK 419



>gi|328856067|gb|EGG05190.1| hypothetical protein MELLADRAFT_43988 [Melampsora larici-populina
           98AG31]
          Length = 365

 Score =  359 bits (922), Expect = 8e-97,   Method: Compositional matrix adjust.
 Identities = 179/377 (47%), Positives = 238/377 (63%), Gaps = 31/377 (8%)

Query: 26  LGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKLP----------------WFKTLNW 69
           + +GH+++I LV + Q  V++EV  +  V  K                     W K ++W
Sbjct: 1   MAMGHVYLIVLVFICQFSVFREVTNLFQVGYKASAKEHAKKQAIMLANIDNNRWSKVMSW 60

Query: 70  YFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFVANLKKHHY 129
           YF  +  YFLYGESIIYYFK IV +DA+LLPFA HHRFIS +LY IGF+ FV NL K   
Sbjct: 61  YFFCAVNYFLYGESIIYYFKHIVFIDAYLLPFARHHRFISLLLYLIGFLAFVTNLVKGQL 120

Query: 130 KFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYICGFFWGRTP 189
           + QF  F+W HM+LL++V    F++NNI EG+IWF +P SLVI ND+ AY+ G  +GR  
Sbjct: 121 RRQFGLFSWIHMSLLLIVASGQFMVNNILEGMIWFWVPASLVIMNDVAAYVFGMLFGRHQ 180

Query: 190 LIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGRLTCEPNPV 249
           LIKLSPKKT EGFVG    T+IF   W +L   W+YMICP +DL  TAF   + C PN  
Sbjct: 181 LIKLSPKKTIEGFVGGYFATVIFAVLWGTLFMGWNYMICPVRDLGVTAF-SPVECVPNNA 239

Query: 250 FIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGFFASGVKRA 309
           F+ + ++                 R++W  P Q H +V+  FA L+APFGGFFASG KRA
Sbjct: 240 FVWRAFEFQG--------------RTIWWTPFQIHCMVLGTFAGLVAPFGGFFASGFKRA 285

Query: 310 FNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTIVNSLKPQD 369
           F IKDF  +IPGHGG+TDR DCQF+MG F+H YY S ++  ++TVG +L+ I +SL    
Sbjct: 286 FGIKDFADTIPGHGGLTDRFDCQFIMGLFTHFYYTSLVREQNVTVGTILELIASSLNSSQ 345

Query: 370 QIELFNRLKQYLLSQGL 386
           QIEL++ L + L+ +G+
Sbjct: 346 QIELYSDLGKVLIQKGI 362



>gi|45190523|ref|NP_984777.1| AEL084Wp [Ashbya gossypii ATCC 10895]
 gi|44983465|gb|AAS52601.1| AEL084Wp [Ashbya gossypii ATCC 10895]
          Length = 433

 Score =  359 bits (921), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 183/384 (47%), Positives = 241/384 (62%), Gaps = 7/384 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
             K  N  VRTIWT +MI GFF+ L +GH W + L++  Q   ++E IA+     +EK L
Sbjct: 41  DSKVYNFVVRTIWTLIMIAGFFITLAMGHFWCVILILGCQIATFQECIAVTAESGREKNL 100

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           P  +TLNWYFL +T Y+L G+S+   F+   +    L   A +H+FIS+ +   GFV FV
Sbjct: 101 PLTRTLNWYFLFTTIYYLDGKSLYKLFRHYTINYRVLGFIAANHKFISYCMLVFGFVVFV 160

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K   KFQF     THM LL+VV Q+H IINN+  GLIWF+LP  LVI NDIFAY+C
Sbjct: 161 CSLRKGFLKFQFASLCVTHMVLLLVVFQAHLIINNVLNGLIWFLLPCGLVIVNDIFAYLC 220

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LI +SPKKT EGF+GA   T +     + LL  + YM CP Q++ T  F   
Sbjct: 221 GITFGRTKLIAISPKKTLEGFLGAWFFTGLAALVLTRLLTPYTYMTCPVQNIHTNVF-SP 279

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L CE NPVFIPQ Y L P +   F      ++ ++   P+  H   +A FASL APFGGF
Sbjct: 280 LNCETNPVFIPQTYRLPPIIFDRF------NVSTITFKPIYMHAFNLATFASLFAPFGGF 333

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F +KDFGHSIPGHGGITDR+DCQF+MG F ++YY++FI    +TV  VL TI
Sbjct: 334 FASGLKRTFKVKDFGHSIPGHGGITDRVDCQFMMGSFMNLYYETFISEKRITVETVLSTI 393

Query: 362 VNSLKPQDQIELFNRLKQYLLSQG 385
           + +   +  ++L   L + L   G
Sbjct: 394 LMNFDERQILQLIAALNRVLWENG 417



>gi|344279397|ref|XP_003411474.1| PREDICTED: phosphatidate cytidylyltransferase 2-like [Loxodonta
           africana]
          Length = 457

 Score =  358 bits (920), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 181/388 (46%), Positives = 258/388 (66%), Gaps = 12/388 (3%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  VR I T  MI  FF+I+ LG + ++ +V+ +Q   + E+I I +       
Sbjct: 75  LSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMMIVMCVQIKCFHEIITIGYNVYHSYD 134

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF  +V  +  L   + +HRFISF LY  GF  F
Sbjct: 135 LPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSKYHRFISFTLYLTGFCMF 194

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  F WTH+TLLIVV QSH +I+N+FEG+IWF++P+S VICNDI AY+
Sbjct: 195 VLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYM 254

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQ-DLTTTAFY 239
            GFF+GRTPLIKLSPKKTWEGF+G    T++FG   S ++  + Y +CP + +  T +F 
Sbjct: 255 FGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRYFVCPVEYNNDTNSF- 313

Query: 240 GRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFG 299
             + C+P+ +F  Q Y++   + S+         ++VW+ P Q H + ++ FASLI PFG
Sbjct: 314 -TVDCQPSDLFRLQEYNIPGVIQSVI------GWKTVWMYPFQSHSVALSTFASLIGPFG 366

Query: 300 GFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQ 359
           GFFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F ++Y  SFI+  + +   ++Q
Sbjct: 367 GFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPS--KLIQ 424

Query: 360 TIVNSLKPQDQIELFNRLKQYLLSQGLL 387
             + +L+P+ Q+ +FN LK +L  +G+L
Sbjct: 425 QFL-TLRPEQQLHIFNTLKSHLTDKGML 451



>gi|281351254|gb|EFB26838.1| hypothetical protein PANDA_014276 [Ailuropoda melanoleuca]
          Length = 425

 Score =  358 bits (919), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 181/388 (46%), Positives = 257/388 (66%), Gaps = 12/388 (3%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  VR I T  MI  FF+I+ LG + ++ +V+ +Q   + E+I I +       
Sbjct: 43  LSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMIIVMCVQIKCFHEIITIGYNVYHSYD 102

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF  +V  +  L   + +HRFISF LY IGF  F
Sbjct: 103 LPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSKYHRFISFTLYLIGFCMF 162

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  F WTH+TLLIVV QSH +I+N+FEG+IWF++P+S VICNDI AY+
Sbjct: 163 VLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYM 222

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQ-DLTTTAFY 239
            GFF+GRTPLIKLSPKKTWEGF+G    T++FG   S ++  +   +CP + +  T +F 
Sbjct: 223 FGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSF- 281

Query: 240 GRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFG 299
             + CEP+ +F  Q Y++   + S+        + +VW+ P Q H + ++ FASLI PFG
Sbjct: 282 -TVDCEPSDLFRLQEYNIPEVIQSVI------GVTTVWMYPFQIHSIALSTFASLIGPFG 334

Query: 300 GFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQ 359
           GFFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F ++Y  SFI+  + +   ++Q
Sbjct: 335 GFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPS--KLIQ 392

Query: 360 TIVNSLKPQDQIELFNRLKQYLLSQGLL 387
             + +L+P  Q+ +FN L+ +L  +G+L
Sbjct: 393 QFL-TLRPDQQLHIFNTLRSHLADKGML 419



>gi|73991700|ref|XP_542903.2| PREDICTED: phosphatidate cytidylyltransferase 2 [Canis lupus
           familiaris]
          Length = 454

 Score =  358 bits (919), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 181/388 (46%), Positives = 257/388 (66%), Gaps = 12/388 (3%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  VR I T  MI  FF+I+ LG + ++ +V+ +Q   + E+I I +       
Sbjct: 71  LSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMIIVMCVQIKCFHEIITIGYNVYHSYD 130

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF  +V  +  L   + +HRFISF LY IGF  F
Sbjct: 131 LPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSKYHRFISFTLYLIGFCMF 190

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  F WTH+TLLIVV QSH +I+N+FEG+IWF++P+S VICNDI AY+
Sbjct: 191 VLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYM 250

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQ-DLTTTAFY 239
            GFF+GRTPLIKLSPKKTWEGF+G    T++FG   S ++  +   +CP + +  T +F 
Sbjct: 251 FGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSF- 309

Query: 240 GRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFG 299
             + CEP+ +F  Q Y++   + S+        + +VW+ P Q H + ++ FASLI PFG
Sbjct: 310 -TVDCEPSDLFRLQEYNIPEVIQSVI------GLTTVWMYPFQIHSIALSTFASLIGPFG 362

Query: 300 GFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQ 359
           GFFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F ++Y  SFI+  + +   ++Q
Sbjct: 363 GFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPS--KLIQ 420

Query: 360 TIVNSLKPQDQIELFNRLKQYLLSQGLL 387
             + +L+P  Q+ +FN L+ +L  +G+L
Sbjct: 421 QFL-TLRPDQQLHIFNTLRSHLADKGML 447



>gi|15235611|ref|NP_193965.1| cytidinediphosphate diacylglycerol synthase 2 [Arabidopsis
           thaliana]
 gi|4455156|emb|CAA16784.1| CDP-diacylglycerol synthetase-like protein [Arabidopsis thaliana]
 gi|7269080|emb|CAB79189.1| CDP-diacylglycerol synthetase-like protein [Arabidopsis thaliana]
 gi|17644177|gb|AAL38786.1| putative CDP-diacylglycerol synthetase [Arabidopsis thaliana]
 gi|20259077|gb|AAM14254.1| putative CDP-diacylglycerol synthetase [Arabidopsis thaliana]
 gi|21536804|gb|AAM61136.1| CDP-diacylglycerol synthetase-like protein [Arabidopsis thaliana]
 gi|332659195|gb|AEE84595.1| cytidinediphosphate diacylglycerol synthase 2 [Arabidopsis
           thaliana]
          Length = 423

 Score =  358 bits (919), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 185/387 (47%), Positives = 256/387 (66%), Gaps = 14/387 (3%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
           S+K+K+  +R   TF MI GF LI+ LGH+++  +VVVIQ  + +E+  +     ++K+L
Sbjct: 43  SKKYKSFLIRAYSTFWMIGGFALIVYLGHLYITAMVVVIQIFMARELFNLLRKTHEDKQL 102

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFAT----HHRFISFVLYCIGF 117
           P F+ LNW+F  +   F+YG  +       V  D  L    T    +H  I + LY  GF
Sbjct: 103 PGFRLLNWHFFFTAMLFVYGRILSQRLVNTVTPDKVLYRLVTSLIKYHMAICYSLYISGF 162

Query: 118 VFFVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIF 177
           V+F+  LKK  YK+QF+Q+AWTHM L++V  QS F + NIFEG+ WF+LP SL++ NDIF
Sbjct: 163 VWFILTLKKKMYKYQFSQYAWTHMILIVVFTQSSFTVANIFEGIFWFLLPASLIVINDIF 222

Query: 178 AYICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTA 237
           AYICGFF+GRTPLIKLSPKKTWEGF+GA I T+I  F  ++++ R+ ++ CP +DL+T  
Sbjct: 223 AYICGFFFGRTPLIKLSPKKTWEGFIGASITTVISAFLLANIMGRFLWLTCPREDLST-- 280

Query: 238 FYGRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAP 297
             G L C+P P+F  + + L  W++     L +K+I    I P+QWH L +  FAS+IAP
Sbjct: 281 --GWLLCDPGPLFKQETHALPGWISDW---LPWKEIS---ILPVQWHALCLGLFASIIAP 332

Query: 298 FGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAV 357
           FGGFFASG KRAF IKDFG SIPGHGGITDRMDCQ +M  F+++Y+QSF+    L+V  +
Sbjct: 333 FGGFFASGFKRAFKIKDFGDSIPGHGGITDRMDCQMVMAVFAYIYHQSFVVPEVLSVDKL 392

Query: 358 LQTIVNSLKPQDQIELFNRLKQYLLSQ 384
           L  I+ SL  ++Q  L  +L Q L  +
Sbjct: 393 LDQIITSLTLEEQQALLVKLGQMLQEK 419



>gi|472357270|ref|XP_004398264.1| PREDICTED: phosphatidate cytidylyltransferase 2 [Odobenus rosmarus
           divergens]
          Length = 445

 Score =  358 bits (918), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 181/388 (46%), Positives = 256/388 (65%), Gaps = 12/388 (3%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  VR I T  MI  FF+I+ LG + ++ +V+ +Q   + E+I I +       
Sbjct: 62  LSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMIIVMCVQIKCFHEIITIGYNVYHSYD 121

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF  +V  +  L   + +HRFISF LY IGF  F
Sbjct: 122 LPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSKYHRFISFTLYLIGFCMF 181

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  F WTH+TLLIVV QSH +I+N+FEG+IWF++P+S VICNDI AY+
Sbjct: 182 VLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYM 241

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQ-DLTTTAFY 239
            GFF+GRTPLIKLSPKKTWEGF+G    T++FG   S ++  +   +CP + +  T +F 
Sbjct: 242 FGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSF- 300

Query: 240 GRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFG 299
             + CEP+ +F  Q Y +   + S+        + +VW+ P Q H + ++ FASLI PFG
Sbjct: 301 -TVDCEPSDLFRLQEYSIPEVIQSVI------GLTTVWMYPFQIHSIALSTFASLIGPFG 353

Query: 300 GFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQ 359
           GFFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F ++Y  SFI+  + +   ++Q
Sbjct: 354 GFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPS--KLIQ 411

Query: 360 TIVNSLKPQDQIELFNRLKQYLLSQGLL 387
             + +L+P  Q+ +FN L+ +L  +G+L
Sbjct: 412 QFL-TLRPDQQLHIFNTLRSHLADKGML 438



>gi|79325225|ref|NP_001031697.1| cytidinediphosphate diacylglycerol synthase 2 [Arabidopsis
           thaliana]
 gi|332659197|gb|AEE84597.1| cytidinediphosphate diacylglycerol synthase 2 [Arabidopsis
           thaliana]
          Length = 447

 Score =  358 bits (918), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 185/387 (47%), Positives = 256/387 (66%), Gaps = 14/387 (3%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
           S+K+K+  +R   TF MI GF LI+ LGH+++  +VVVIQ  + +E+  +     ++K+L
Sbjct: 67  SKKYKSFLIRAYSTFWMIGGFALIVYLGHLYITAMVVVIQIFMARELFNLLRKTHEDKQL 126

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFAT----HHRFISFVLYCIGF 117
           P F+ LNW+F  +   F+YG  +       V  D  L    T    +H  I + LY  GF
Sbjct: 127 PGFRLLNWHFFFTAMLFVYGRILSQRLVNTVTPDKVLYRLVTSLIKYHMAICYSLYISGF 186

Query: 118 VFFVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIF 177
           V+F+  LKK  YK+QF+Q+AWTHM L++V  QS F + NIFEG+ WF+LP SL++ NDIF
Sbjct: 187 VWFILTLKKKMYKYQFSQYAWTHMILIVVFTQSSFTVANIFEGIFWFLLPASLIVINDIF 246

Query: 178 AYICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTA 237
           AYICGFF+GRTPLIKLSPKKTWEGF+GA I T+I  F  ++++ R+ ++ CP +DL+T  
Sbjct: 247 AYICGFFFGRTPLIKLSPKKTWEGFIGASITTVISAFLLANIMGRFLWLTCPREDLST-- 304

Query: 238 FYGRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAP 297
             G L C+P P+F  + + L  W++     L +K+I    I P+QWH L +  FAS+IAP
Sbjct: 305 --GWLLCDPGPLFKQETHALPGWISDW---LPWKEIS---ILPVQWHALCLGLFASIIAP 356

Query: 298 FGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAV 357
           FGGFFASG KRAF IKDFG SIPGHGGITDRMDCQ +M  F+++Y+QSF+    L+V  +
Sbjct: 357 FGGFFASGFKRAFKIKDFGDSIPGHGGITDRMDCQMVMAVFAYIYHQSFVVPEVLSVDKL 416

Query: 358 LQTIVNSLKPQDQIELFNRLKQYLLSQ 384
           L  I+ SL  ++Q  L  +L Q L  +
Sbjct: 417 LDQIITSLTLEEQQALLVKLGQMLQEK 443



>gi|301778911|ref|XP_002924874.1| PREDICTED: phosphatidate cytidylyltransferase 2-like [Ailuropoda
           melanoleuca]
          Length = 443

 Score =  358 bits (918), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 181/388 (46%), Positives = 257/388 (66%), Gaps = 12/388 (3%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  VR I T  MI  FF+I+ LG + ++ +V+ +Q   + E+I I +       
Sbjct: 61  LSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMIIVMCVQIKCFHEIITIGYNVYHSYD 120

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF  +V  +  L   + +HRFISF LY IGF  F
Sbjct: 121 LPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSKYHRFISFTLYLIGFCMF 180

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  F WTH+TLLIVV QSH +I+N+FEG+IWF++P+S VICNDI AY+
Sbjct: 181 VLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYM 240

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQ-DLTTTAFY 239
            GFF+GRTPLIKLSPKKTWEGF+G    T++FG   S ++  +   +CP + +  T +F 
Sbjct: 241 FGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSF- 299

Query: 240 GRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFG 299
             + CEP+ +F  Q Y++   + S+        + +VW+ P Q H + ++ FASLI PFG
Sbjct: 300 -TVDCEPSDLFRLQEYNIPEVIQSVI------GVTTVWMYPFQIHSIALSTFASLIGPFG 352

Query: 300 GFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQ 359
           GFFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F ++Y  SFI+  + +   ++Q
Sbjct: 353 GFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPS--KLIQ 410

Query: 360 TIVNSLKPQDQIELFNRLKQYLLSQGLL 387
             + +L+P  Q+ +FN L+ +L  +G+L
Sbjct: 411 QFL-TLRPDQQLHIFNTLRSHLADKGML 437



>gi|410922279|ref|XP_003974610.1| PREDICTED: phosphatidate cytidylyltransferase 2-like [Takifugu
           rubripes]
          Length = 451

 Score =  358 bits (918), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 188/388 (48%), Positives = 256/388 (65%), Gaps = 12/388 (3%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  VR I T  MIF FF I+ LG I ++ +V+ +Q   ++E+I I +       
Sbjct: 68  LSSRWKNWWVRGILTLAMIFFFFFIVYLGPIVLMVIVLCVQIKCFQEIITIGYSVYHSYD 127

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF  +V  +  L   + +HRFISF LY IGF  F
Sbjct: 128 LPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSRYHRFISFALYVIGFCMF 187

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  F WTH+TLLIVV QSH II+N+FEG+IWF++P+S VICNDI AY+
Sbjct: 188 VLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLIIHNLFEGMIWFIVPISCVICNDIMAYM 247

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQ-DLTTTAFY 239
            GFF+GRTPLIKLSPKKTWEGF+G    TI+FG   S ++  + Y +CP + +  + +F 
Sbjct: 248 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTIVFGILLSYVMASYRYFVCPVEFNNDSNSF- 306

Query: 240 GRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFG 299
            ++ CEP+ +F  Q Y L   L S     T      V + P Q H + ++ FAS++ PFG
Sbjct: 307 -QVDCEPSELFQLQEYVLPSILESATGWTT------VRLYPFQIHSIALSSFASIVGPFG 359

Query: 300 GFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQ 359
           GFFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F ++Y  SFI+  + T   V+Q
Sbjct: 360 GFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPT--KVIQ 417

Query: 360 TIVNSLKPQDQIELFNRLKQYLLSQGLL 387
            ++ +L+   Q+ +FN LK +L  +GLL
Sbjct: 418 QLL-ALRFDQQLHIFNSLKAHLTEKGLL 444



>gi|498955367|ref|XP_004523818.1| PREDICTED: phosphatidate cytidylyltransferase,
           photoreceptor-specific-like isoform X1 [Ceratitis
           capitata]
 gi|498955373|ref|XP_004523819.1| PREDICTED: phosphatidate cytidylyltransferase,
           photoreceptor-specific-like isoform X2 [Ceratitis
           capitata]
 gi|498955379|ref|XP_004523820.1| PREDICTED: phosphatidate cytidylyltransferase,
           photoreceptor-specific-like isoform X3 [Ceratitis
           capitata]
 gi|498955385|ref|XP_004523821.1| PREDICTED: phosphatidate cytidylyltransferase,
           photoreceptor-specific-like isoform X4 [Ceratitis
           capitata]
          Length = 447

 Score =  358 bits (918), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 180/383 (46%), Positives = 258/383 (67%), Gaps = 18/383 (4%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +  +WKN  +R I+T++MI GF LI+  G + ++   +++Q   ++E+I+I +   +   
Sbjct: 75  LPDRWKNYVIRGIFTWIMICGFALIIYGGPLALMITTLLVQVKCFQEIISIGYQVYRIHG 134

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF++L+WYFL+++ YF YGE+++ YF  ++    +L    T+HRF+SF LYCIGFV+F
Sbjct: 135 LPWFRSLSWYFLLTSNYFFYGENLVDYFGVVINRVEYLKFLVTYHRFLSFALYCIGFVWF 194

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K +Y  QF+ FAWTH++LLIVV QS+ II NIFE LIWF++PVS+++CND+ AY+
Sbjct: 195 VLSLVKKYYMKQFSLFAWTHVSLLIVVTQSYLIIQNIFEALIWFIVPVSMIVCNDVMAYM 254

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T+IFG  +S +L  + Y +CP   +  +   G
Sbjct: 255 FGFFFGRTPLIKLSPKKTWEGFIGGGFATVIFGIIFSYILCNYQYFVCP---ILYSEEVG 311

Query: 241 RLT--CEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPF 298
           R+T  CEP+ +F  Q Y L            F   R++ + P  WH + ++ F+S+I PF
Sbjct: 312 RMTMACEPSYLFTKQEYSLG----------VFGIGRTINMYPFVWHSIALSLFSSIIGPF 361

Query: 299 GGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVL 358
           GGFFASG KRAF IKDFG  IPGHGGI DR DCQFLM  F ++Y  SFI+  + +   +L
Sbjct: 362 GGFFASGFKRAFKIKDFGDMIPGHGGIMDRFDCQFLMATFVNVYISSFIRTPAPS--KIL 419

Query: 359 QTIVNSLKPQDQIELFNRLKQYL 381
             I N LKP+ Q++++  LK  L
Sbjct: 420 TQIYN-LKPEQQLQIYQSLKDSL 441



>gi|410954322|ref|XP_003983814.1| PREDICTED: phosphatidate cytidylyltransferase 2 [Felis catus]
          Length = 435

 Score =  357 bits (917), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 181/388 (46%), Positives = 257/388 (66%), Gaps = 12/388 (3%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  VR I T  MI  FF+I+ LG + ++ +V+ +Q   + E+I I +       
Sbjct: 52  LSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMIIVMCVQIKCFHEIITIGYNVYHSYD 111

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF  +V  +  L   + +HRFISF LY IGF  F
Sbjct: 112 LPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSKYHRFISFTLYLIGFCMF 171

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  F WTH+TLLIVV QSH +I+N+FEG+IWF++P+S VICNDI AY+
Sbjct: 172 VLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYM 231

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQ-DLTTTAFY 239
            GFF+GRTPLIKLSPKKTWEGF+G    T++FG   S ++  +   +CP + +  T +F 
Sbjct: 232 FGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSF- 290

Query: 240 GRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFG 299
             + CEP+ +F  Q Y++   + S+        + +VW+ P Q H + ++ FASLI PFG
Sbjct: 291 -TVDCEPSDLFRLQEYNIPEVIRSVI------GLTTVWMYPFQIHSIALSTFASLIGPFG 343

Query: 300 GFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQ 359
           GFFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F ++Y  SFI+  + +   ++Q
Sbjct: 344 GFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPS--KLIQ 401

Query: 360 TIVNSLKPQDQIELFNRLKQYLLSQGLL 387
             + +L+P  Q+ +FN L+ +L  +G+L
Sbjct: 402 QFL-TLRPDQQLHIFNTLRSHLADKGML 428



>gi|511855754|ref|XP_004751577.1| PREDICTED: phosphatidate cytidylyltransferase 2 [Mustela putorius
           furo]
          Length = 445

 Score =  357 bits (917), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 181/388 (46%), Positives = 256/388 (65%), Gaps = 12/388 (3%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  VR I T  MI  FF+I+ LG + ++ +V+ +Q   + E+I I +       
Sbjct: 62  LSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMIIVMCVQIKCFHEIITIGYNVYHSYD 121

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF  +V  +  L   + +HRFISF LY IGF  F
Sbjct: 122 LPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSKYHRFISFTLYLIGFCMF 181

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  F WTH+TLLIVV QSH +I+N+FEG+IWF++P+S VICNDI AY+
Sbjct: 182 VLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYM 241

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQ-DLTTTAFY 239
            GFF+GRTPLIKLSPKKTWEGF+G    T++FG   S ++  +   +CP + +  T +F 
Sbjct: 242 FGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSF- 300

Query: 240 GRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFG 299
             + CEP+ +F  Q Y +   + S+        + +VW+ P Q H + ++ FASLI PFG
Sbjct: 301 -TVDCEPSDLFRLQEYSIPEVIQSVI------GLTTVWMYPFQIHSIALSTFASLIGPFG 353

Query: 300 GFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQ 359
           GFFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F ++Y  SFI+  + +   ++Q
Sbjct: 354 GFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPS--KLIQ 411

Query: 360 TIVNSLKPQDQIELFNRLKQYLLSQGLL 387
             + +L+P  Q+ +FN L+ +L  +G+L
Sbjct: 412 QFL-TLRPDQQLHIFNTLRSHLADKGVL 438



>gi|348567310|ref|XP_003469443.1| PREDICTED: phosphatidate cytidylyltransferase 1 [Cavia porcellus]
          Length = 453

 Score =  357 bits (917), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 184/388 (47%), Positives = 249/388 (64%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI  FFL + +G   ++ LV+ IQ   + E+I I +      +
Sbjct: 71  LSSRWKNWWIRGILTLTMISLFFLTIYMGSFMLMLLVLGIQVKCFHEIITIGYRVYHSYE 130

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF   V  +  L     +HRFISF LY  GF  F
Sbjct: 131 LPWFRTLSWYFLLCVNYFFYGETVADYFATFVQREEQLQFLIRYHRFISFALYLAGFCMF 190

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AY+
Sbjct: 191 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYL 250

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FGF  + +L ++ Y +CP +  +    + 
Sbjct: 251 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFIAAYVLSKYQYFVCPVEYRSDVNSF- 309

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP  +F    Y L  +L  + RR T      V + P Q H + ++ FASLI PFGG
Sbjct: 310 VTECEPADLFQLHSYSLPSFLKVVLRRET------VSLYPFQIHSIALSTFASLIGPFGG 363

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF  +IPGHGGI DR DCQ+LM  F H+Y  SFI+  + +   VLQ 
Sbjct: 364 FFASGFKRAFKIKDFADTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPNPS--KVLQQ 421

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
           ++  L+P+ Q+ ++  LK +L  +G+L+
Sbjct: 422 LL-VLQPEQQLSIYRTLKTHLTEKGILQ 448



>gi|158286129|ref|XP_308594.4| AGAP007175-PA [Anopheles gambiae str. PEST]
 gi|157020320|gb|EAA04188.4| AGAP007175-PA [Anopheles gambiae str. PEST]
          Length = 468

 Score =  357 bits (916), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 187/397 (47%), Positives = 261/397 (65%), Gaps = 26/397 (6%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +  +WKN  +R I+T +MI GF LI+  G + ++   + +Q   ++E+I+I +   +   
Sbjct: 94  LPDRWKNWVIRGIFTMIMISGFCLIIYGGPLALMVTALAVQVKCFQEIISIGYSVYRIHG 153

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFK-AIVMVDAFLLPFATHHRFISFVLYCIGFVF 119
           LPWF++L+WYFL+++ YF YGE+++ YF  A+  VD+       +HRF+SF LYCIGFV+
Sbjct: 154 LPWFRSLSWYFLLTSNYFFYGENLVDYFGVAVSRVDSLRF-LVKYHRFLSFCLYCIGFVW 212

Query: 120 FVANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAY 179
           FV +L K +Y  QF+ FAWTH+ LLIVV QS+ II NIFEGLIWF++PVS+++CND+ AY
Sbjct: 213 FVLSLVKKYYMKQFSLFAWTHVALLIVVTQSYLIIQNIFEGLIWFIVPVSMIVCNDVMAY 272

Query: 180 ICGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFY 239
           + GFF+GRTPLI+LSPKKTWEGF+G    T+IFG   S  L ++ + +CP +   T    
Sbjct: 273 MFGFFFGRTPLIQLSPKKTWEGFIGGGFATVIFGLIASYFLCQFQFFVCPIEYSETE--- 329

Query: 240 GRL--TCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAP 297
           GR+   CEP+ +F PQ Y +            F   +++ + P   H L M+ F+S+I P
Sbjct: 330 GRMIIECEPSYLFRPQEYSIA----------LFGASKTITMYPFLLHSLSMSIFSSVIGP 379

Query: 298 FGGFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAV 357
           FGGFFASG KRAF IKDFG  IPGHGGI DR DCQFLM  F ++Y  SFI+ +S      
Sbjct: 380 FGGFFASGFKRAFKIKDFGDMIPGHGGIMDRFDCQFLMATFVNVYISSFIRYAS---PQK 436

Query: 358 LQTIVNSLKPQDQIELFNRLKQYLLSQGLLEERGATN 394
           L  +V +LKP++Q++LFN+LK        LEER   N
Sbjct: 437 LLNMVYNLKPEEQLQLFNQLKDS------LEERNIIN 467



>gi|410923487|ref|XP_003975213.1| PREDICTED: phosphatidate cytidylyltransferase 1-like [Takifugu
           rubripes]
          Length = 454

 Score =  357 bits (916), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 176/349 (50%), Positives = 240/349 (68%), Gaps = 9/349 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +  +WKN  +R + +  MI GFFLI+ +G I ++ +V+ IQ   ++E+I I +   +   
Sbjct: 73  LPPRWKNYWIRGVLSLAMISGFFLIICMGPIALLLIVMTIQIKCFEEIITIGYRVYRSYD 132

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFLI   YF YGE++  YF A+V  +  L   A +HRFISF LY  GF  F
Sbjct: 133 LPWFRTLSWYFLICVNYFFYGETLADYFGALVQREEPLQFLARYHRFISFALYLAGFCMF 192

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLIVV QSH +I N+FEG+IWF++P+S+VICNDI AY+
Sbjct: 193 VLSLVKKHYRLQFYMFAWTHVTLLIVVTQSHLVIQNLFEGMIWFIVPISIVICNDIMAYL 252

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQ-DLTTTAFY 239
            GFF+GRTPLIKLSPKKTWEGF+G    T++FGF  + LL ++ Y +CP   +  T  F 
Sbjct: 253 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFLLAYLLSQFQYFVCPVGFNSETNGF- 311

Query: 240 GRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFG 299
             + CEP+ +F+ Q Y     + ++F++     ++ V + P Q H + ++ FASLI PFG
Sbjct: 312 -TVECEPSDIFVMQEY----AVPAVFQKTL--GLKRVDMYPFQIHSIFLSSFASLIGPFG 364

Query: 300 GFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIK 348
           GFFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F+H+Y  SFI+
Sbjct: 365 GFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFTHVYIASFIR 413



>gi|449274401|gb|EMC83594.1| Phosphatidate cytidylyltransferase 1, partial [Columba livia]
          Length = 422

 Score =  357 bits (916), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 186/388 (47%), Positives = 249/388 (64%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I T  MI GFFLI+ LG   ++ LV+ IQ   Y E+I I +       
Sbjct: 40  LSARWKNWWIRGILTLAMISGFFLIIYLGSFMLMLLVLSIQVKCYHEIITIGYRVYHSYD 99

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF++L+WYFL+   YF YGE++  YF   V     L     +HRFISF LY  GF  F
Sbjct: 100 LPWFRSLSWYFLLCVNYFFYGETVADYFATFVQRREQLQFLIRYHRFISFALYLAGFCMF 159

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AYI
Sbjct: 160 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDITAYI 219

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T+IFGF +S  L +  Y +CP +  + T  + 
Sbjct: 220 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVIFGFIFSYFLAQHQYFVCPVEYNSETNRF- 278

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  ++Y + P L ++          +V + P Q H + ++ FASLI PFGG
Sbjct: 279 VTECEPSELFQMKKYSVPPLLQAVL------GWETVNMYPFQMHSIALSTFASLIGPFGG 332

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF  +IPGHGGI DR DCQ+LM  F H+Y  SFI+  +    + L  
Sbjct: 333 FFASGFKRAFKIKDFADTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPN---PSKLLK 389

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
            +  L+P+ Q+ ++  LK +L+ +G+L+
Sbjct: 390 QLLILQPEQQLSVYKILKSHLVEKGILQ 417



>gi|511947739|ref|XP_004792353.1| PREDICTED: phosphatidate cytidylyltransferase 2 [Mustela putorius
           furo]
          Length = 444

 Score =  357 bits (915), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 181/388 (46%), Positives = 256/388 (65%), Gaps = 12/388 (3%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  VR I T  MI  FF+I+ LG + ++ +V+ +Q   + E+I I +       
Sbjct: 61  LSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMIIVMCVQIKCFHEIITIGYNVYHSYD 120

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF+TL+WYFL+   YF YGE++  YF  +V  +  L   + +HRFISF LY IGF  F
Sbjct: 121 LPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSKYHRFISFTLYLIGFCMF 180

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  F WTH+TLLIVV QSH +I+N+FEG+IWF++P+S VICNDI AY+
Sbjct: 181 VLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYM 240

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQ-DLTTTAFY 239
            GFF+GRTPLIKLSPKKTWEGF+G    T++FG   S ++  +   +CP + +  T +F 
Sbjct: 241 FGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSF- 299

Query: 240 GRLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFG 299
             + CEP+ +F  Q Y +   + S+        + +VW+ P Q H + ++ FASLI PFG
Sbjct: 300 -TVDCEPSDLFRLQEYSIPEVIQSVI------GLTTVWMYPFQIHSIALSTFASLIGPFG 352

Query: 300 GFFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQ 359
           GFFASG KRAF IKDF ++IPGHGGI DR DCQ+LM  F ++Y  SFI+  + +   ++Q
Sbjct: 353 GFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPS--KLIQ 410

Query: 360 TIVNSLKPQDQIELFNRLKQYLLSQGLL 387
             + +L+P  Q+ +FN L+ +L  +G+L
Sbjct: 411 QFL-TLRPDQQLHIFNTLRSHLADKGVL 437



>gi|449499796|ref|XP_002189814.2| PREDICTED: phosphatidate cytidylyltransferase 1-like [Taeniopygia
           guttata]
          Length = 435

 Score =  357 bits (915), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 183/388 (47%), Positives = 250/388 (64%), Gaps = 10/388 (2%)

Query: 1   MSQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKK 60
           +S +WKN  +R I +  MI GFFLI+ LG   ++ LV+ IQ   Y E+I I +      +
Sbjct: 53  LSARWKNWWIRGILSLAMISGFFLIIYLGSFMLMLLVLSIQVKCYHEIITIGYRVYHSYE 112

Query: 61  LPWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFF 120
           LPWF++L+WYFL+   YF YGE++  YF   V     L     +HRFISF LY  GF  F
Sbjct: 113 LPWFRSLSWYFLLCVNYFFYGETVADYFATFVQRREQLQFLIRYHRFISFALYLTGFCMF 172

Query: 121 VANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYI 180
           V +L K HY+ QF  FAWTH+TLLI V QSH +I N+FEG+IWF++P+S VICNDI AYI
Sbjct: 173 VLSLVKKHYRLQFYMFAWTHVTLLITVTQSHLVIQNLFEGMIWFLVPISSVICNDIAAYI 232

Query: 181 CGFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYG 240
            GFF+GRTPLIKLSPKKTWEGF+G    T++FGF +S  L ++ Y +CP +  + T  + 
Sbjct: 233 FGFFFGRTPLIKLSPKKTWEGFIGGFFSTVVFGFIFSYFLAQYQYFVCPVEYNSETNRF- 291

Query: 241 RLTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGG 300
              CEP+ +F  ++Y + P + ++          +V + P Q H   ++ FASLI PFGG
Sbjct: 292 VTECEPSELFQMKKYSVPPLIQAVL------GWETVNMYPFQMHSFALSTFASLIGPFGG 345

Query: 301 FFASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQT 360
           FFASG KRAF IKDF  +IPGHGGI DR DCQ+LM  F H+Y  SFI+  +    + L  
Sbjct: 346 FFASGFKRAFKIKDFADTIPGHGGIMDRFDCQYLMATFVHVYITSFIRGPN---PSKLLK 402

Query: 361 IVNSLKPQDQIELFNRLKQYLLSQGLLE 388
            +  L+P+ Q+ ++  LK +L+ +G+L+
Sbjct: 403 QLLILQPEQQLSVYKTLKSHLVEKGILQ 430



>gi|513032283|gb|AGO12275.1| AaceriAEL084Wp [Saccharomycetaceae sp. 'Ashbya aceri']
          Length = 433

 Score =  356 bits (914), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 181/389 (46%), Positives = 240/389 (61%), Gaps = 7/389 (1%)

Query: 2   SQKWKNMTVRTIWTFVMIFGFFLILGLGHIWVIFLVVVIQTLVYKEVIAIAHVPSKEKKL 61
             K  N  +RTIWT +MI GFF  L +GH W + L++  Q   ++E IA+     +EK L
Sbjct: 41  DSKIYNFVIRTIWTLIMIVGFFFTLAMGHFWCVVLILGCQIATFQECIAVTAESGREKNL 100

Query: 62  PWFKTLNWYFLISTYYFLYGESIIYYFKAIVMVDAFLLPFATHHRFISFVLYCIGFVFFV 121
           P  +TLNWYFL +T Y+L G+S+   F+   +    L   A +H+FI + +   GFV FV
Sbjct: 101 PLTRTLNWYFLFTTLYYLDGKSLFKLFRHYTINYRVLGFIAANHKFICYCMLVFGFVVFV 160

Query: 122 ANLKKHHYKFQFTQFAWTHMTLLIVVCQSHFIINNIFEGLIWFVLPVSLVICNDIFAYIC 181
            +L+K   KFQF     THM LL+VV Q+H IINN+  GLIWF+LP  LVI NDIFAY+C
Sbjct: 161 CSLRKGFLKFQFASLCITHMVLLLVVFQAHLIINNVLNGLIWFLLPCGLVIVNDIFAYLC 220

Query: 182 GFFWGRTPLIKLSPKKTWEGFVGALICTIIFGFFWSSLLRRWDYMICPAQDLTTTAFYGR 241
           G  +GRT LI +SPKKT EGF+GA   T +     + LL  + YM CP Q++ T  F   
Sbjct: 221 GITFGRTKLIAISPKKTLEGFLGAWFFTGLAALILTRLLTPYTYMTCPVQNIHTNVF-TP 279

Query: 242 LTCEPNPVFIPQRYDLNPWLTSLFRRLTFKDIRSVWIAPLQWHVLVMACFASLIAPFGGF 301
           L CE NPVFIPQ Y L P +   F      ++ ++   P+  H   +A FASL APFGGF
Sbjct: 280 LNCETNPVFIPQTYRLPPIIFDRF------NVSTITFKPIYMHAFNLATFASLFAPFGGF 333

Query: 302 FASGVKRAFNIKDFGHSIPGHGGITDRMDCQFLMGCFSHMYYQSFIKMSSLTVGAVLQTI 361
           FASG+KR F +KDFGHSIPGHGGITDR+DCQF+MG F ++YY++FI    +TV  VL TI
Sbjct: 334 FASGLKRTFKVKDFGHSIPGHGGITDRVDCQFMMGSFMNLYYETFISEKRITVETVLSTI 393

Query: 362 VNSLKPQDQIELFNRLKQYLLSQGLLEER 390
           + +   +  ++L   L + L   G +   
Sbjct: 394 LMNFDERQILQLIAALNKVLWENGRMASE 422