BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10188_c0_seq1-m.78 complete 47-739(+) 231 (+)
         (230 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|384489791|gb|EIE81013.1| hypothetical protein RO3G_05718 [Rhi...   244   2e-62   Rhizopus delemar RA 99-880
gi|511000296|gb|EPB81846.1| hypothetical protein HMPREF1544_1143...   243   4e-62   Mucor circinelloides f. circinelloides 1006PhL
gi|328770766|gb|EGF80807.1| hypothetical protein BATDEDRAFT_8845...   211   9e-53   Batrachochytrium dendrobatidis JAM81
gi|358401127|gb|EHK50442.1| hypothetical protein TRIATDRAFT_2545...   209   5e-52   Trichoderma atroviride IMI 206040
gi|470305005|ref|XP_004348255.1| glutamine amidotransferase subu...   206   5e-51   Capsaspora owczarzaki ATCC 30864
gi|470455541|ref|XP_004340967.1| pyridoxine synthesis protein PD...   200   2e-49   Acanthamoeba castellanii str. Neff
gi|326436957|gb|EGD82527.1| SNO glutamine amidotransferase [Salp...   199   4e-49   Salpingoeca rosetta
gi|475662976|gb|EMT60772.1| Pyridoxal biosynthesis protein PDX2 ...   199   6e-49   Fusarium oxysporum f. sp. cubense race 4
gi|340521162|gb|EGR51397.1| predicted protein [Trichoderma reese...   198   1e-48   Trichoderma reesei QM6a
gi|358380435|gb|EHK18113.1| hypothetical protein TRIVIDRAFT_4477...   197   1e-48   Trichoderma virens Gv29-8
gi|399172624|emb|CCE26771.1| probable Sno-type pyridoxine vitami...   197   1e-48   Claviceps purpurea 20.1
gi|388582136|gb|EIM22442.1| SNO glutamine amidotransferase [Wall...   197   1e-48   Wallemia mellicola CBS 633.66
gi|71001022|ref|XP_755192.1| pyridoxine [Aspergillus fumigatus A...   197   2e-48   Aspergillus fumigatus Af293
gi|407921597|gb|EKG14738.1| Glutamine amidotransferase subunit P...   197   2e-48   Macrophomina phaseolina MS6
gi|296415876|ref|XP_002837610.1| hypothetical protein [Tuber mel...   197   2e-48   Tuber melanosporum Mel28
gi|342879962|gb|EGU81194.1| hypothetical protein FOXB_08344 [Fus...   197   2e-48   Fusarium oxysporum Fo5176
gi|400600478|gb|EJP68152.1| SNO glutamine amidotransferase [Beau...   196   3e-48   Beauveria bassiana ARSEF 2860
gi|115443018|ref|XP_001218316.1| glutamine amidotransferase subu...   196   5e-48   Aspergillus terreus NIH2624
gi|508785780|gb|EOY33036.1| Pyridoxine biosynthesis 2 [Theobroma...   195   6e-48   Theobroma cacao [chocolate]
gi|425766492|gb|EKV05101.1| Pyridoxine [Penicillium digitatum Pd...   194   1e-47   Penicillium digitatum Pd1
gi|167520764|ref|XP_001744721.1| hypothetical protein [Monosiga ...   194   1e-47   Monosiga brevicollis MX1
gi|46121315|ref|XP_385212.1| hypothetical protein FG05036.1 [Fus...   194   1e-47   
gi|465793243|emb|CCU98370.1| unnamed protein product [Malassezia...   194   2e-47   Malassezia sympodialis ATCC 42132
gi|440635469|gb|ELR05388.1| hypothetical protein GMDG_07371 [Geo...   193   2e-47   Pseudogymnoascus destructans 20631-21
gi|383762497|ref|YP_005441479.1| putative glutamine amidotransfe...   193   3e-47   
gi|451850515|gb|EMD63817.1| hypothetical protein COCSADRAFT_3319...   192   4e-47   Bipolaris sorokiniana ND90Pr
gi|408395714|gb|EKJ74890.1| hypothetical protein FPSE_04926 [Fus...   192   4e-47   Fusarium pseudograminearum CS3096
gi|449529939|ref|XP_004171955.1| PREDICTED: pyridoxal biosynthes...   192   7e-47   
gi|322694635|gb|EFY86459.1| pyridoxine [Metarhizium acridum CQMa...   192   7e-47   Metarhizium acridum CQMa 102
gi|449455996|ref|XP_004145736.1| PREDICTED: pyridoxal biosynthes...   192   8e-47   Cucumis sativus [cucumbers]
gi|255935631|ref|XP_002558842.1| Pc13g04060 [Penicillium chrysog...   191   9e-47   Penicillium rubens Wisconsin 54-1255
gi|258574203|ref|XP_002541283.1| glutamine amidotransferase subu...   191   1e-46   Uncinocarpus reesii 1704
gi|477529453|gb|ENH81215.1| pyridoxine [Colletotrichum orbicular...   191   1e-46   Colletotrichum orbiculare MAFF 240422
gi|346325709|gb|EGX95306.1| pyridoxine [Cordyceps militaris CM01]     191   1e-46   Cordyceps militaris CM01
gi|302848806|ref|XP_002955934.1| hypothetical protein VOLCADRAFT...   191   1e-46   Volvox carteri f. nagariensis
gi|225435289|ref|XP_002285095.1| PREDICTED: pyridoxal biosynthes...   191   2e-46   Vitis vinifera
gi|302893925|ref|XP_003045843.1| hypothetical protein NECHADRAFT...   190   2e-46   Nectria haematococca mpVI 77-13-4
gi|320033669|gb|EFW15616.1| pyridoxine [Coccidioides posadasii s...   190   2e-46   Coccidioides posadasii str. Silveira
gi|452000550|gb|EMD93011.1| hypothetical protein COCHEDRAFT_1154...   190   2e-46   Bipolaris maydis C5
gi|303312475|ref|XP_003066249.1| glutamine amidotransferase, SNO...   190   2e-46   Coccidioides posadasii C735 delta SOWgp
gi|358369813|dbj|GAA86426.1| pyridoxine [Aspergillus kawachii IF...   190   2e-46   Aspergillus kawachii IFO 4308
gi|119192918|ref|XP_001247065.1| hypothetical protein CIMG_00836...   190   2e-46   Coccidioides immitis RS
gi|46399273|gb|AAS92257.1| putative pyridoxine biosynthesis prot...   190   3e-46   Nicotiana tabacum [American tobacco]
gi|145246438|ref|XP_001395468.1| pyridoxine [Aspergillus niger C...   190   3e-46   Aspergillus niger CBS 513.88
gi|402077635|gb|EJT72984.1| glutamine amidotransferase subunit p...   190   3e-46   Gaeumannomyces graminis var. tritici R3-111a-1
gi|121698321|ref|XP_001267783.1| pyridoxine [Aspergillus clavatu...   189   4e-46   Aspergillus clavatus NRRL 1
gi|67539942|ref|XP_663745.1| hypothetical protein AN6141.2 [Aspe...   189   4e-46   Aspergillus nidulans FGSC A4
gi|119480673|ref|XP_001260365.1| pyridoxine [Neosartorya fischer...   189   6e-46   Aspergillus fischeri NRRL 181
gi|485924722|gb|EOD49464.1| putative pyridoxine protein [Neofusi...   189   6e-46   Neofusicoccum parvum UCRNP2
gi|322711851|gb|EFZ03424.1| pyridoxine [Metarhizium anisopliae A...   188   8e-46   Metarhizium robertsii ARSEF 23
gi|359806630|ref|NP_001241020.1| uncharacterized protein LOC1007...   188   1e-45   Glycine max [soybeans]
gi|317157669|ref|XP_001826418.2| pyridoxine [Aspergillus oryzae ...   187   1e-45   Aspergillus oryzae RIB40
gi|212532791|ref|XP_002146552.1| pyridoxine [Talaromyces marneff...   187   1e-45   Talaromyces marneffei ATCC 18224
gi|345569053|gb|EGX51922.1| hypothetical protein AOL_s00043g656 ...   187   1e-45   Arthrobotrys oligospora ATCC 24927
gi|238493739|ref|XP_002378106.1| pyridoxine [Aspergillus flavus ...   187   2e-45   Aspergillus flavus NRRL3357
gi|83775162|dbj|BAE65285.1| unnamed protein product [Aspergillus...   187   2e-45   Aspergillus oryzae RIB40
gi|159491116|ref|XP_001703519.1| predicted protein [Chlamydomona...   187   2e-45   Chlamydomonas reinhardtii
gi|391869497|gb|EIT78694.1| imidazoleglycerol-phosphate synthase...   187   2e-45   Aspergillus oryzae 3.042
gi|85106827|ref|XP_962256.1| pyridoxine-2 [Neurospora crassa OR7...   187   2e-45   Neurospora crassa OR74A
gi|297796999|ref|XP_002866384.1| ATPDX2/EMB2407/PDX2 [Arabidopsi...   187   2e-45   Arabidopsis lyrata subsp. lyrata
gi|301118753|ref|XP_002907104.1| glutamine amidotransferase subu...   186   3e-45   Phytophthora infestans T30-4
gi|393215246|gb|EJD00737.1| glutamine amidotransferase subunit p...   186   3e-45   Fomitiporia mediterranea MF3/22
gi|482549688|gb|EOA13882.1| hypothetical protein CARUB_v10026985...   186   3e-45   Capsella rubella
gi|297746243|emb|CBI16299.3| unnamed protein product [Vitis vini...   186   3e-45   Vitis vinifera
gi|320589359|gb|EFX01821.1| glutamine amidotransferase subunit p...   186   4e-45   Grosmannia clavigera kw1407
gi|18424366|ref|NP_568922.1| Pyridoxal biosynthesis protein PDX2...   186   4e-45   Arabidopsis thaliana [mouse-ear cress]
gi|336470730|gb|EGO58891.1| hypothetical protein NEUTE1DRAFT_128...   186   4e-45   Neurospora tetrasperma FGSC 2508
gi|482806228|gb|EOA83301.1| hypothetical protein SETTUDRAFT_1647...   186   4e-45   Setosphaeria turcica Et28A
gi|460411447|ref|XP_004251122.1| PREDICTED: pyridoxal biosynthes...   185   8e-45   Solanum lycopersicum
gi|9757756|dbj|BAB08237.1| amidotransferase hisH-like protein [A...   185   9e-45   Arabidopsis thaliana [mouse-ear cress]
gi|462401410|gb|EMJ06967.1| hypothetical protein PRUPE_ppa010384...   184   1e-44   Prunus persica
gi|500258064|gb|EOO01124.1| putative pyridoxine protein [Tognini...   184   1e-44   Phaeoacremonium minimum UCRPA7
gi|9954418|gb|AAG09049.1|AF294268_1 pyridoxine synthesis protein...   184   2e-44   Cercospora nicotianae
gi|347975819|ref|XP_003437239.1| unnamed protein product [Podosp...   184   2e-44   Podospora anserina S mat+
gi|169612938|ref|XP_001799886.1| hypothetical protein SNOG_09597...   184   2e-44   Parastagonospora nodorum SN15
gi|315050524|ref|XP_003174636.1| glutamine amidotransferase subu...   183   2e-44   Microsporum gypseum CBS 118893
gi|145355644|ref|XP_001422068.1| predicted protein [Ostreococcus...   183   3e-44   Ostreococcus lucimarinus CCE9901
gi|261190114|ref|XP_002621467.1| glutamine amidotransferase subu...   183   3e-44   Blastomyces gilchristii SLH14081
gi|429854779|gb|ELA29766.1| pyridoxine [Colletotrichum gloeospor...   183   3e-44   Colletotrichum gloeosporioides Nara gc5
gi|348684935|gb|EGZ24750.1| hypothetical protein PHYSODRAFT_4840...   183   4e-44   Phytophthora sojae
gi|470117766|ref|XP_004295020.1| PREDICTED: pyridoxal biosynthes...   182   4e-44   Fragaria vesca subsp. vesca
gi|396474118|ref|XP_003839495.1| similar to glutamine amidotrans...   182   5e-44   Leptosphaeria maculans JN3
gi|388511885|gb|AFK44004.1| unknown [Lotus japonicus]                 182   5e-44   Lotus japonicus
gi|452843111|gb|EME45046.1| hypothetical protein DOTSEDRAFT_7092...   182   5e-44   Dothistroma septosporum NZE10
gi|378734573|gb|EHY61032.1| glutamine amidotransferase [Exophial...   182   5e-44   Exophiala dermatitidis NIH/UT8656
gi|296812789|ref|XP_002846732.1| glutamine amidotransferase subu...   182   6e-44   Arthroderma otae CBS 113480
gi|357468741|ref|XP_003604655.1| Glutamine amidotransferase subu...   182   7e-44   Medicago truncatula
gi|453085089|gb|EMF13132.1| pyridoxine synthesis protein PDX2 [M...   181   9e-44   Sphaerulina musiva SO2202
gi|325975749|gb|ADZ47881.1| pyridoxial biosynthesis 2 [Arabidops...   181   1e-43   Arabidopsis thaliana [mouse-ear cress]
gi|388512311|gb|AFK44217.1| unknown [Lotus japonicus]                 181   1e-43   Lotus japonicus
gi|242776513|ref|XP_002478851.1| pyridoxine [Talaromyces stipita...   181   1e-43   Talaromyces stipitatus ATCC 10500
gi|270307960|ref|YP_003330018.1| SNO glutamine amidotransferase ...   181   1e-43   
gi|189188794|ref|XP_001930736.1| glutamine amidotransferase subu...   181   1e-43   Pyrenophora tritici-repentis Pt-1C-BFP
gi|217073258|gb|ACJ84988.1| unknown [Medicago truncatula]             181   1e-43   Medicago truncatula
gi|494827711|gb|EON64636.1| glutamine amidotransferase [Coniospo...   181   1e-43   Coniosporium apollinis CBS 100218
gi|389628346|ref|XP_003711826.1| glutamine amidotransferase subu...   181   1e-43   Magnaporthe oryzae 70-15
gi|116195050|ref|XP_001223337.1| hypothetical protein CHGG_04123...   181   1e-43   Chaetomium globosum CBS 148.51
gi|225678864|gb|EEH17148.1| glutamine amidotransferase subunit p...   181   2e-43   Paracoccidioides brasiliensis Pb03
gi|225559400|gb|EEH07683.1| glutamine amidotransferase subunit p...   181   2e-43   Histoplasma capsulatum G186AR
gi|470117764|ref|XP_004295019.1| PREDICTED: pyridoxal biosynthes...   180   2e-43   Fragaria vesca subsp. vesca
gi|357146498|ref|XP_003574014.1| PREDICTED: pyridoxal biosynthes...   180   2e-43   Brachypodium distachyon [annual false brome]
gi|502147413|ref|XP_004506773.1| PREDICTED: pyridoxal biosynthes...   180   2e-43   Cicer arietinum [garbanzo]
gi|255578878|ref|XP_002530293.1| Glutamine amidotransferase subu...   180   2e-43   Ricinus communis
gi|406602993|emb|CCH45461.1| CTP synthase [Wickerhamomyces cifer...   180   3e-43   Wickerhamomyces ciferrii
gi|449298183|gb|EMC94200.1| hypothetical protein BAUCODRAFT_5873...   180   3e-43   Baudoinia panamericana UAMH 10762
gi|57234604|ref|YP_181340.1| glutamine amidotransferase subunit ...   180   3e-43   
gi|353237153|emb|CCA69133.1| probable Sno-type pyridoxine vitami...   179   3e-43   Serendipita indica DSM 11827
gi|330939417|ref|XP_003305845.1| hypothetical protein PTT_18795 ...   179   5e-43   Pyrenophora teres f. teres 0-1
gi|224104651|ref|XP_002313515.1| predicted protein [Populus tric...   179   6e-43   Populus trichocarpa [western balsam poplar]
gi|116781483|gb|ABK22118.1| unknown [Picea sitchensis]                179   7e-43   Picea sitchensis
gi|302763393|ref|XP_002965118.1| hypothetical protein SELMODRAFT...   178   8e-43   Selaginella moellendorffii
gi|169865642|ref|XP_001839419.1| glutamine amidotransferase subu...   178   8e-43   Coprinopsis cinerea okayama7#130
gi|398404630|ref|XP_003853781.1| hypothetical protein MYCGRDRAFT...   178   1e-42   Zymoseptoria tritici IPO323
gi|115444005|ref|NP_001045782.1| Os02g0130100 [Oryza sativa Japo...   178   1e-42   
gi|440463600|gb|ELQ33170.1| glutamine amidotransferase subunit p...   178   1e-42   Magnaporthe oryzae Y34
gi|327303372|ref|XP_003236378.1| pyridoxine [Trichophyton rubrum...   178   1e-42   Trichophyton rubrum CBS 118892
gi|412985545|emb|CCO18991.1| SNO glutamine amidotransferase [Bat...   178   1e-42   Bathycoccus prasinos
gi|302672956|ref|XP_003026165.1| hypothetical protein SCHCODRAFT...   178   1e-42   Schizophyllum commune H4-8
gi|302657683|ref|XP_003020558.1| hypothetical protein TRV_05345 ...   177   2e-42   Trichophyton verrucosum HKI 0517
gi|393246781|gb|EJD54289.1| SNO glutamine amidotransferase [Auri...   177   2e-42   Auricularia subglabra TFB-10046 SS5
gi|512199871|gb|EPE28704.1| Class I glutamine amidotransferase-l...   177   2e-42   Glarea lozoyensis ATCC 20868
gi|302757561|ref|XP_002962204.1| hypothetical protein SELMODRAFT...   177   2e-42   Selaginella moellendorffii
gi|170111769|ref|XP_001887088.1| predicted protein [Laccaria bic...   177   2e-42   Laccaria bicolor S238N-H82
gi|302509344|ref|XP_003016632.1| hypothetical protein ARB_04923 ...   177   2e-42   Arthroderma benhamiae CBS 112371
gi|409075734|gb|EKM76111.1| hypothetical protein AGABI1DRAFT_637...   176   3e-42   Agaricus bisporus var. burnettii JB137-S8
gi|310791731|gb|EFQ27258.1| SNO glutamine amidotransferase [Glom...   176   4e-42   Colletotrichum graminicola M1.001
gi|426191764|gb|EKV41704.1| hypothetical protein AGABI2DRAFT_230...   176   4e-42   Agaricus bisporus var. bisporus H97
gi|226496607|ref|NP_001147279.1| LOC100280887 [Zea mays] >gi|195...   176   5e-42   Zea mays [maize]
gi|326469568|gb|EGD93577.1| pyridoxine [Trichophyton tonsurans C...   176   6e-42   Trichophyton tonsurans CBS 112818
gi|505754544|gb|EOQ98857.1| Glutamine amidotransferase subunit P...   175   6e-42   Wallemia ichthyophaga EXF-994
gi|389744148|gb|EIM85331.1| SNO glutamine amidotransferase [Ster...   175   7e-42   Stereum hirsutum FP-91666 SS1
gi|406864531|gb|EKD17576.1| pyridoxine [Marssonina brunnea f. sp...   175   7e-42   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|379735750|ref|YP_005329256.1| glutamine amidotransferase subu...   175   8e-42   
gi|269126341|ref|YP_003299711.1| SNO glutamine amidotransferase ...   175   9e-42   
gi|326478906|gb|EGE02916.1| SNO glutamine amidotransferase famil...   174   1e-41   Trichophyton equinum CBS 127.97
gi|474204355|gb|EMS58613.1| hypothetical protein TRIUR3_04173 [T...   174   1e-41   Triticum urartu
gi|326499656|dbj|BAJ86139.1| predicted protein [Hordeum vulgare ...   174   1e-41   Hordeum vulgare subsp. vulgare [barley]
gi|344233214|gb|EGV65087.1| SNO glutamine amidotransferase [Cand...   174   1e-41   Candida tenuis ATCC 10573
gi|380484216|emb|CCF40137.1| SNO glutamine amidotransferase, par...   174   1e-41   Colletotrichum higginsianum
gi|452984801|gb|EME84558.1| hypothetical protein MYCFIDRAFT_2109...   173   3e-41   Cercospora fijiensis CIRAD86
gi|498534330|ref|WP_010832796.1| SNO glutamine amidotransferase ...   173   3e-41   Nocardioides sp. CF8
gi|374855140|dbj|BAL58004.1| SNO glutamine amidotransferase [unc...   173   4e-41   uncultured Chloroflexi bacterium
gi|147669218|ref|YP_001214036.1| glutamine amidotransferase subu...   172   4e-41   
gi|390594897|gb|EIN04305.1| SNO glutamine amidotransferase [Punc...   172   5e-41   Punctularia strigosozonata HHB-11173 SS5
gi|402220226|gb|EJU00298.1| SNO glutamine amidotransferase [Dacr...   172   6e-41   Dacryopinax primogenitus
gi|150864768|ref|XP_001383739.2| hypothetical protein PICST_5712...   172   6e-41   Scheffersomyces stipitis CBS 6054
gi|403418261|emb|CCM04961.1| predicted protein [Fibroporia radic...   172   6e-41   Fibroporia radiculosa
gi|336373092|gb|EGO01430.1| hypothetical protein SERLA73DRAFT_17...   172   8e-41   Serpula lacrymans var. lacrymans S7.3
gi|354543908|emb|CCE40630.1| hypothetical protein CPAR2_106650 [...   171   1e-40   Candida parapsilosis
gi|475446797|gb|EMT01574.1| hypothetical protein F775_16936 [Aeg...   171   1e-40   Aegilops tauschii
gi|73748438|ref|YP_307677.1| glutamine amidotransferase subunit ...   171   1e-40   
gi|403511167|ref|YP_006642805.1| pyridoxal 5'-phosphate synthase...   171   2e-40   
gi|357113804|ref|XP_003558691.1| PREDICTED: pyridoxal biosynthes...   171   2e-40   Brachypodium distachyon [annual false brome]
gi|395327648|gb|EJF60046.1| SNO glutamine amidotransferase [Dich...   171   2e-40   Dichomitus squalens LYAD-421 SS1
gi|223995393|ref|XP_002287380.1| predicted protein [Thalassiosir...   170   2e-40   Thalassiosira pseudonana CCMP1335
gi|367044508|ref|XP_003652634.1| hypothetical protein THITE_2114...   170   2e-40   Thielavia terrestris NRRL 8126
gi|389865012|ref|YP_006367253.1| glutamine amidotransferase subu...   170   2e-40   
gi|156048300|ref|XP_001590117.1| hypothetical protein SS1G_08881...   170   3e-40   Sclerotinia sclerotiorum 1980 UF-70
gi|325184607|emb|CCA19100.1| glutamine amidotransferase subunit ...   170   3e-40   Albugo laibachii Nc14
gi|297559800|ref|YP_003678774.1| SNO glutamine amidotransferase ...   170   3e-40   
gi|254566813|ref|XP_002490517.1| hypothetical protein [Komagatae...   170   3e-40   Komagataella phaffii GS115
gi|168011955|ref|XP_001758668.1| predicted protein [Physcomitrel...   169   3e-40   Physcomitrella patens
gi|289432485|ref|YP_003462358.1| SNO glutamine amidotransferase ...   169   4e-40   
gi|506932978|ref|YP_008013416.1| glutamine amidotransferase [Amy...   169   5e-40   
gi|125537943|gb|EAY84338.1| hypothetical protein OsI_05715 [Oryz...   169   6e-40   Oryza sativa Indica Group [Indian rice]
gi|336320689|ref|YP_004600657.1| SNO glutamine amidotransferase ...   167   1e-39   
gi|336263435|ref|XP_003346497.1| hypothetical protein SMAC_04670...   167   1e-39   Sordaria macrospora k-hell
gi|392408580|ref|YP_006445187.1| pyridoxal phosphate synthase ya...   167   2e-39   
gi|300087850|ref|YP_003758372.1| SNO glutamine amidotransferase ...   167   2e-39   
gi|392569056|gb|EIW62230.1| SNO glutamine amidotransferase [Tram...   167   2e-39   Trametes versicolor FP-101664 SS1
gi|491301085|ref|WP_005159088.1| Pyridoxine biosynthesis glutami...   167   2e-39   Amycolatopsis azurea
gi|296270040|ref|YP_003652672.1| SNO glutamine amidotransferase ...   167   3e-39   
gi|255078250|ref|XP_002502705.1| predicted protein [Micromonas s...   166   3e-39   Micromonas commoda
gi|168058973|ref|XP_001781480.1| predicted protein [Physcomitrel...   166   3e-39   Physcomitrella patens
gi|497855315|ref|WP_010169471.1| glutamine amidotransferase [Bac...   166   4e-39   Bacillus coahuilensis
gi|495751105|ref|WP_008475684.1| glutamine amidotransferase [Nit...   166   4e-39   Nitrolancea hollandica
gi|489428328|ref|WP_003333954.1| glutamine amidotransferase [Bre...   166   4e-39   Brevibacillus laterosporus
gi|494094103|ref|WP_007034927.1| glutamine amidotransferase invo...   166   4e-39   Amycolatopsis decaplanina
gi|154300237|ref|XP_001550535.1| hypothetical protein BC1G_10494...   166   4e-39   Botrytis cinerea B05.10
gi|367033557|ref|XP_003666061.1| hypothetical protein MYCTH_2310...   166   5e-39   Myceliophthora thermophila ATCC 42464
gi|489167738|ref|WP_003077332.1| glutamine amidotransferase invo...   165   8e-39   Amycolatopsis vancoresmycina
gi|284032310|ref|YP_003382241.1| SNO glutamine amidotransferase ...   165   8e-39   
gi|226366276|ref|YP_002784059.1| glutamine amidotransferase subu...   165   8e-39   
gi|448518192|ref|XP_003867932.1| Sno1 protein [Candida orthopsil...   165   1e-38   Candida orthopsilosis Co 90-125
gi|111023840|ref|YP_706812.1| glutamine amidotransferase subunit...   165   1e-38   
gi|269925157|ref|YP_003321780.1| SNO glutamine amidotransferase ...   165   1e-38   
gi|449550162|gb|EMD41127.1| hypothetical protein CERSUDRAFT_8077...   164   1e-38   Gelatoporia subvermispora B
gi|294658100|ref|XP_460421.2| DEHA2F01342p [Debaryomyces hanseni...   164   1e-38   Debaryomyces hansenii CBS767
gi|68536135|ref|YP_250840.1| amidotransferase [Corynebacterium j...   164   1e-38   
gi|491598035|ref|WP_005455597.1| glutamine amidotransferase [Sac...   164   1e-38   Saccharomonospora cyanea
gi|494688487|ref|YP_007954061.1| SNO glutamine amidotransferase ...   164   2e-38   
gi|386851479|ref|YP_006269492.1| glutamine amidotransferase [Act...   164   2e-38   
gi|495188513|ref|WP_007913303.1| glutamine amidotransferase [Kte...   164   2e-38   Ktedonobacter racemifer
gi|470243036|ref|XP_004355240.1| SNO glutamine amidotransferase ...   164   2e-38   Dictyostelium fasciculatum
gi|493492101|ref|WP_006446785.1| glutamine amidotransferase [Ali...   164   2e-38   
gi|446163591|ref|WP_000241446.1| glutamine amidotransferase [Bac...   164   2e-38   Bacillus cereus
gi|149244454|ref|XP_001526770.1| conserved hypothetical protein ...   164   2e-38   Lodderomyces elongisporus NRRL YB-4239
gi|229820479|ref|YP_002882005.1| SNO glutamine amidotransferase ...   164   2e-38   
gi|495006924|ref|WP_007732937.1| glutamine amidotransferase subu...   163   3e-38   Rhodococcus
gi|363754924|ref|XP_003647677.1| hypothetical protein Ecym_7001 ...   163   3e-38   Eremothecium cymbalariae DBVPG#7215
gi|406955008|gb|EKD83655.1| hypothetical protein ACD_39C00542G00...   163   3e-38   uncultured bacterium
gi|496748865|ref|WP_009360709.1| glutamine amidotransferase subu...   163   3e-38   Anoxybacillus sp. DT3-1
gi|491437167|ref|WP_005294960.1| glutamine amidotransferase [Cor...   163   3e-38   Corynebacterium jeikeium
gi|303289979|ref|XP_003064277.1| predicted protein [Micromonas p...   163   3e-38   Micromonas pusilla CCMP1545
gi|300787178|ref|YP_003767469.1| pyridoxine biosynthesis glutami...   163   3e-38   Amycolatopsis mediterranei U32
gi|284991603|ref|YP_003410157.1| SNO glutamine amidotransferase ...   163   4e-38   
gi|442771079|gb|AGC71776.1| pyridoxine biosynthesis glutamine am...   162   4e-38   uncultured bacterium A1Q1_fos_2116
gi|138893691|ref|YP_001124144.1| glutamine amidotransferase subu...   162   4e-38   
gi|491383102|ref|WP_005240983.1| glutamine amidotransferase [Rho...   162   4e-38   Rhodococcus
gi|490715118|ref|WP_004577776.1| glutamine amidotransferase subu...   162   4e-38   Anoxybacillus
gi|307108967|gb|EFN57206.1| hypothetical protein CHLNCDRAFT_1196...   162   5e-38   Chlorella variabilis
gi|494004318|ref|WP_006946839.1| glutamine amidotransferase [Der...   162   5e-38   Dermacoccus sp. Ellin185
gi|493381252|ref|WP_006337514.1| glutamine amidotransferase [Gor...   162   5e-38   Gordonia rhizosphera
gi|464806598|gb|EMP12880.1| glutamine amidotransferase subunit p...   162   5e-38   
gi|459367728|gb|EMG46671.1| Glutamine amidotransferase subunit p...   162   6e-38   Candida maltosa Xu316
gi|493426959|ref|WP_006382646.1| pyridoxal 5'-phosphate synthase...   162   6e-38   Streptomyces turgidiscabies
gi|119716609|ref|YP_923574.1| SNO glutamine amidotransferase [No...   162   7e-38   
gi|490040910|ref|WP_003943308.1| glutamine amidotransferase [Rho...   162   8e-38   Rhodococcus
gi|152973865|ref|YP_001373382.1| glutamine amidotransferase subu...   162   9e-38   
gi|226185519|dbj|BAH33623.1| probable pyridoxal phosphate syntha...   162   9e-38   Rhodococcus erythropolis PR4
gi|71024311|ref|XP_762385.1| hypothetical protein UM06238.1 [Ust...   162   9e-38   
gi|487953339|ref|WP_002026805.1| glutamine amidotransferase [Bac...   161   9e-38   
gi|446160925|ref|WP_000238780.1| glutamine amidotransferase [Bac...   161   9e-38   Bacillus cereus
gi|489487704|ref|WP_003392666.1| glutamine amidotransferase subu...   161   1e-37   Brevibacillus borstelensis
gi|489446856|ref|WP_003352268.1| glutamine amidotransferase [Bac...   161   1e-37   Bacillus smithii
gi|490111752|ref|WP_004012426.1| glutamine amidotransferase [Mob...   161   1e-37   Mobiluncus mulieris
gi|488059339|ref|WP_002130736.1| glutamine amidotransferase [Bac...   161   1e-37   Bacillus cereus group
gi|383788743|ref|YP_005473312.1| glutamine amidotransferase subu...   161   1e-37   
gi|488052146|ref|WP_002123543.1| glutamine amidotransferase [Bac...   161   1e-37   Bacillus cereus
gi|490114359|ref|WP_004014976.1| glutamine amidotransferase [Mob...   161   1e-37   
gi|271967395|ref|YP_003341591.1| SNO glutamine amidotransferase ...   161   1e-37   
gi|494085018|ref|WP_007027055.1| glutamine amidotransferase [Sac...   161   1e-37   
gi|446160922|ref|WP_000238777.1| glutamine amidotransferase [Bac...   161   1e-37   Bacillus cereus
gi|42779093|ref|NP_976340.1| glutamine amidotransferase, SNO fam...   161   1e-37   
gi|219849800|ref|YP_002464233.1| SNO glutamine amidotransferase ...   161   1e-37   
gi|487946685|ref|WP_002020151.1| glutamine amidotransferase [Bac...   161   1e-37   
gi|470319633|gb|EMR11243.1| hypothetical protein PNEG_00274 [Pne...   161   1e-37   Pneumocystis murina B123
gi|488119978|ref|WP_002191375.1| glutamine amidotransferase [Bac...   161   1e-37   Bacillus cereus
gi|358060162|dbj|GAA94221.1| hypothetical protein E5Q_00870 [Mix...   161   1e-37   Mixia osmundae IAM 14324
gi|495001375|ref|WP_007727389.1| glutamine amidotransferase [Bre...   161   1e-37   Brevibacillus sp. BC25
gi|496446162|ref|WP_009155007.1| glutamine amidotransferase [Sac...   161   1e-37   Saccharomonospora marina
gi|446160921|ref|WP_000238776.1| glutamine amidotransferase [Bac...   161   1e-37   Bacillus cereus
gi|446160920|ref|WP_000238775.1| glutamine amidotransferase subu...   161   1e-37   Bacillus cereus group
gi|256391545|ref|YP_003113109.1| SNO glutamine amidotransferase ...   160   2e-37   
gi|52145198|ref|YP_081630.1| glutamine amidotransferase subunit ...   160   2e-37   
gi|212637861|ref|YP_002314381.1| glutamine amidotransferase subu...   160   2e-37   
gi|495051367|ref|WP_007776203.1| glutamine amidotransferase [Bre...   160   2e-37   Brevibacillus sp. CF112
gi|116491066|ref|YP_810610.1| glutamine amidotransferase [Oenoco...   160   2e-37   
gi|496370335|ref|WP_009079325.1| glutamine amidotransferase [Str...   160   2e-37   Streptomyces sp. AA4
gi|340794515|ref|YP_004759978.1| amidotransferase involved in py...   160   2e-37   
gi|488103129|ref|WP_002174526.1| glutamine amidotransferase [Bac...   160   2e-37   Bacillus cereus
gi|262202228|ref|YP_003273436.1| SNO glutamine amidotransferase ...   160   2e-37   
gi|492734012|ref|WP_005939335.1| glutamine amidotransferase subu...   160   2e-37   Gordonia hirsuta
gi|495773083|ref|WP_008497662.1| Pyridoxine biosynthesis glutami...   160   2e-37   Planococcus halocryophilus
gi|294496886|ref|YP_003560586.1| glutamine amidotransferase subu...   160   2e-37   
gi|443923465|gb|ELU42703.1| glutamine amidotransferase subunit p...   160   2e-37   Rhizoctonia solani AG-1 IA
gi|45185353|ref|NP_983070.1| ABR123Wp [Ashbya gossypii ATCC 1089...   160   3e-37   Eremothecium gossypii ATCC 10895
gi|163938024|ref|YP_001642908.1| glutamine amidotransferase subu...   160   3e-37   
gi|508091718|gb|EOT02207.1| glutamine amidotransferase subunit P...   160   3e-37   Streptomyces albulus CCRC 11814
gi|388857658|emb|CCF48807.1| related to Sno-type pyridoxine vita...   160   3e-37   Ustilago hordei
gi|492404942|ref|WP_005833556.1| glutamine amidotransferase subu...   160   3e-37   Bacillales
gi|146414570|ref|XP_001483255.1| hypothetical protein PGUG_03984...   160   3e-37   Meyerozyma guilliermondii ATCC 6260
gi|239825596|ref|YP_002948220.1| glutamine amidotransferase subu...   160   3e-37   
gi|507030638|ref|WP_016102350.1| glutamine amidotransferase subu...   160   3e-37   Bacillus cereus
gi|308813439|ref|XP_003084026.1| putative amidotransferase (ISS)...   160   3e-37   Ostreococcus tauri
gi|497958438|ref|WP_010272594.1| glutamine amidotransferase [Cor...   159   3e-37   Corynebacterium bovis
gi|507035110|ref|WP_016106807.1| glutamine amidotransferase subu...   159   4e-37   Bacillus cereus
gi|159900324|ref|YP_001546571.1| SNO glutamine amidotransferase ...   159   4e-37   
gi|449086681|ref|YP_007419122.1| Glutamine amidotransferase subu...   159   4e-37   
gi|507051374|ref|WP_016122365.1| glutamine amidotransferase subu...   159   4e-37   Bacillus cereus
gi|296129638|ref|YP_003636888.1| SNO glutamine amidotransferase ...   159   4e-37   
gi|493656056|ref|WP_006607491.1| glutamine amidotransferase [Str...   159   4e-37   Streptomyces auratus
gi|226309604|ref|YP_002769498.1| glutamine amidotransferase subu...   159   4e-37   
gi|491348088|ref|WP_005206024.1| glutamine amidotransferase [Gor...   159   5e-37   Gordonia
gi|512484704|ref|WP_016428954.1| glutamine amidotransferase subu...   159   5e-37   Paenisporosarcina sp. HGH0030
gi|507045807|ref|WP_016116858.1| glutamine amidotransferase subu...   159   5e-37   Bacillus cereus
gi|213402377|ref|XP_002171961.1| imidazoleglycerol-phosphate syn...   159   5e-37   Schizosaccharomyces japonicus yFS275
gi|488067507|ref|WP_002138904.1| glutamine amidotransferase [Bac...   159   5e-37   Bacillus cereus
gi|493955386|ref|WP_006899109.1| glutamine amidotransferase subu...   159   5e-37   Gordonia paraffinivorans
gi|506988200|ref|WP_016079534.1| glutamine amidotransferase subu...   159   5e-37   
gi|312109163|ref|YP_003987479.1| SNO glutamine amidotransferase ...   159   5e-37   
gi|497971443|ref|WP_010285599.1| glutamine amidotransferase [Bac...   159   5e-37   
gi|446156855|ref|WP_000234710.1| glutamine amidotransferase [Bac...   159   6e-37   
gi|513030551|gb|AGO10576.1| AaceriABR123Wp [Saccharomycetaceae s...   159   6e-37   
gi|487991155|ref|WP_002063361.1| glutamine amidotransferase [Bac...   159   6e-37   
gi|446160924|ref|WP_000238779.1| glutamine amidotransferase [Bac...   159   6e-37   
gi|446160916|ref|WP_000238771.1| glutamine amidotransferase [Bac...   159   7e-37   
gi|295702253|ref|YP_003595328.1| glutamine amidotransferase subu...   159   7e-37   
gi|30018289|ref|NP_829920.1| glutamine amidotransferase subunit ...   159   7e-37   
gi|446160929|ref|WP_000238784.1| glutamine amidotransferase [Bac...   159   7e-37   
gi|158316904|ref|YP_001509412.1| glutamine amidotransferase subu...   159   7e-37   
gi|218234434|ref|YP_002364866.1| glutamine amidotransferase subu...   159   7e-37   
gi|488570496|ref|YP_007908295.1| glutamine amidotransferase subu...   159   7e-37   
gi|497363900|ref|WP_009678113.1| glutamine amidotransferase [Gor...   159   7e-37   
gi|448118671|ref|XP_004203559.1| Piso0_001171 [Millerozyma farin...   159   7e-37   
gi|446160917|ref|WP_000238772.1| glutamine amidotransferase [Bac...   158   8e-37   
gi|384184099|ref|YP_005569995.1| glutamine amidotransferase subu...   158   8e-37   
gi|111221571|ref|YP_712365.1| glutamine amidotransferase subunit...   158   8e-37   
gi|218895152|ref|YP_002443563.1| glutamine amidotransferase subu...   158   8e-37   
gi|490100775|ref|WP_004002663.1| putative Glutamine amidotransfe...   158   8e-37   
gi|340373187|ref|XP_003385123.1| PREDICTED: pyridoxal biosynthes...   158   8e-37   
gi|117928554|ref|YP_873105.1| glutamine amidotransferase subunit...   158   8e-37   
gi|488035872|ref|WP_002107269.1| glutamine amidotransferase [Bac...   158   9e-37   
gi|448236322|ref|YP_007400380.1| pyridoxal-5'-phosphate synthase...   158   9e-37   
gi|446160940|ref|WP_000238795.1| glutamine amidotransferase [Bac...   158   9e-37   
gi|446160928|ref|WP_000238783.1| glutamine amidotransferase [Bac...   158   9e-37   
gi|446160931|ref|WP_000238786.1| glutamine amidotransferase [Bac...   158   9e-37   
gi|488080534|ref|WP_002151931.1| glutamine amidotransferase [Bac...   158   1e-36   
gi|491191167|ref|WP_005049523.1| glutamine amidotransferase [Mic...   158   1e-36   
gi|491461986|ref|WP_005319761.1| glutamine amidotransferase [Str...   158   1e-36   
gi|66806155|ref|XP_636799.1| SNO glutamine amidotransferase fami...   158   1e-36   
gi|495228943|ref|WP_007953714.1| glutamine amidotransferase [Pel...   158   1e-36   
gi|446160919|ref|WP_000238774.1| glutamine amidotransferase [Bac...   158   1e-36   
gi|488041849|ref|WP_002113246.1| glutamine amidotransferase [Bac...   158   1e-36   
gi|493110798|ref|WP_006141621.1| glutamine amidotransferase [Str...   158   1e-36   
gi|446160927|ref|WP_000238782.1| glutamine amidotransferase subu...   158   1e-36   
gi|488909344|ref|WP_002820419.1| glutamine amidotransferase [Oen...   158   1e-36   
gi|493400885|ref|WP_006356984.1| glutamine amidotransferase [Gor...   158   1e-36   
gi|446160937|ref|WP_000238792.1| glutamine amidotransferase [Bac...   158   1e-36   
gi|56418547|ref|YP_145865.1| glutamine amidotransferase subunit ...   158   1e-36   
gi|491026786|ref|WP_004888479.1| glutamine amidotransferase subu...   157   1e-36   
gi|383781454|ref|YP_005466021.1| putative glutamine amidotransfe...   157   1e-36   
gi|493921367|ref|WP_006866371.1| glutamine amidotransferase [Gor...   157   1e-36   
gi|297528388|ref|YP_003669663.1| SNO glutamine amidotransferase ...   157   1e-36   
gi|357402867|ref|YP_004914792.1| glutamine amidotransferase for ...   157   2e-36   
gi|495953958|ref|WP_008678537.1| glutamine amidotransferase [Clo...   157   2e-36   
gi|485647857|gb|EOD40891.1| hypothetical protein EMIHUDRAFT_2222...   157   2e-36   
gi|446160918|ref|WP_000238773.1| glutamine amidotransferase [Bac...   157   2e-36   
gi|493367581|ref|WP_006323976.1| glutamine amidotransferase subu...   157   2e-36   
gi|495707307|ref|WP_008431886.1| glutamine amidotransferase [Pla...   157   2e-36   
gi|498797577|ref|WP_010838831.1| glutamine amidotransferase subu...   157   2e-36   
gi|147676345|ref|YP_001210560.1| glutamine amidotransferase subu...   157   2e-36   
gi|378717711|ref|YP_005282600.1| glutamine amidotransferase subu...   157   2e-36   
gi|347751639|ref|YP_004859204.1| SNO glutamine amidotransferase ...   157   2e-36   
gi|497458089|ref|WP_009772287.1| glutamine amidotransferase [mar...   157   2e-36   
gi|497297254|ref|WP_009611471.1| glutamine amidotransferase [act...   157   2e-36   
gi|386839035|ref|YP_006244093.1| glutamine amidotransferase [Str...   157   2e-36   
gi|497888548|ref|WP_010202704.1| glutamine amidotransferase [Sal...   157   2e-36   
gi|312139490|ref|YP_004006826.1| glutamine amidotransferase [Rho...   157   2e-36   
gi|493481467|ref|WP_006436342.1| glutamine amidotransferase subu...   157   2e-36   
gi|332670542|ref|YP_004453550.1| SNO glutamine amidotransferase ...   157   2e-36   
gi|446160935|ref|WP_000238790.1| glutamine amidotransferase [Bac...   157   2e-36   
gi|446160936|ref|WP_000238791.1| glutamine amidotransferase [Bac...   157   2e-36   
gi|407707967|ref|YP_006831552.1| hypothetical protein MC28_4731 ...   157   2e-36   
gi|491339228|ref|WP_005197183.1| glutamine amidotransferase [Gor...   157   2e-36   
gi|507005492|ref|WP_016085328.1| glutamine amidotransferase subu...   157   2e-36   
gi|343427985|emb|CBQ71510.1| related to Sno-type pyridoxine vita...   157   2e-36   
gi|334337151|ref|YP_004542303.1| glutamine amidotransferase subu...   157   2e-36   
gi|497804555|ref|WP_010118739.1| glutamine amidotransferase [Cor...   157   2e-36   
gi|497663607|ref|WP_009977791.1| glutamine amidotransferase [Myc...   157   2e-36   
gi|446160934|ref|WP_000238789.1| glutamine amidotransferase [Bac...   157   2e-36   
gi|512642679|ref|WP_016465237.1| pyridoxal 5'-phosphate synthase...   157   2e-36   
gi|443899783|dbj|GAC77112.1| imidazoleglycerol-phosphate synthas...   157   2e-36   
gi|488088255|ref|WP_002159652.1| glutamine amidotransferase [Bac...   157   3e-36   
gi|118475789|ref|YP_892940.1| glutamine amidotransferase subunit...   157   3e-36   
gi|493278947|ref|WP_006236728.1| glutamine amidotransferase [Sac...   157   3e-36   
gi|296131561|ref|YP_003638808.1| SNO glutamine amidotransferase ...   156   3e-36   
gi|50553566|ref|XP_504194.1| YALI0E20603p [Yarrowia lipolytica] ...   156   3e-36   
gi|490109929|ref|WP_004010637.1| glutamine amidotransferase [Mob...   156   3e-36   
gi|451822530|ref|YP_007458731.1| glutamine amidotransferase subu...   156   3e-36   
gi|496354266|ref|WP_009063442.1| glutamine amidotransferase [Str...   156   3e-36   
gi|497829655|ref|WP_010143811.1| glutamine amidotransferase [Cit...   156   3e-36   
gi|379748029|ref|YP_005338850.1| glutamine amidotransferase subu...   156   3e-36   
gi|256825361|ref|YP_003149321.1| pyridoxal phosphate synthase ya...   156   3e-36   
gi|488911446|ref|WP_002822521.1| glutamine amidotransferase [Oen...   156   3e-36   
gi|49479020|ref|YP_034371.1| glutamine amidotransferase subunit ...   156   4e-36   
gi|495533740|ref|WP_008258327.1| glutamine amidotransferase subu...   156   4e-36   
gi|72162496|ref|YP_290153.1| glutamine amidotransferase subunit ...   156   4e-36   
gi|497949362|ref|WP_010263518.1| glutamine amidotransferase [Str...   156   4e-36   
gi|489286608|ref|WP_003194184.1| glutamine amidotransferase [Bac...   156   4e-36   
gi|298346877|ref|YP_003719564.1| glutamine amidotransferase subu...   156   4e-36   
gi|118465637|ref|YP_882664.1| glutamine amidotransferase subunit...   156   4e-36   
gi|256376240|ref|YP_003099900.1| SNO glutamine amidotransferase ...   156   4e-36   
gi|317124986|ref|YP_004099098.1| pyridoxal phosphate synthase ya...   156   4e-36   
gi|336112751|ref|YP_004567518.1| SNO glutamine amidotransferase ...   156   5e-36   
gi|494785198|ref|WP_007520606.1| glutamine amidotransferase [Fra...   156   5e-36   
gi|494895292|ref|WP_007621337.1| glutamine amidotransferase subu...   156   5e-36   
gi|297582351|ref|YP_003698131.1| SNO glutamine amidotransferase ...   156   5e-36   
gi|333919480|ref|YP_004493061.1| glutamine amidotransferase subu...   155   5e-36   
gi|490017444|ref|WP_003919976.1| glutamine amidotransferase [Myc...   155   6e-36   
gi|446160941|ref|WP_000238796.1| glutamine amidotransferase [Bac...   155   6e-36   
gi|493592782|ref|WP_006545613.1| glutamine amidotransferase [Fra...   155   6e-36   
gi|495865688|ref|WP_008590267.1| glutamine amidotransferase [Sal...   155   6e-36   
gi|494770594|ref|WP_007506002.1| glutamine amidotransferase [Cal...   155   6e-36   
gi|154684530|ref|YP_001419691.1| glutamine amidotransferase subu...   155   6e-36   
gi|493883274|ref|WP_006829493.1| glutamine amidotransferase [Pla...   155   6e-36   
gi|152967002|ref|YP_001362786.1| SNO glutamine amidotransferase ...   155   7e-36   
gi|494145899|ref|WP_007085645.1| glutamine amidotransferase subu...   155   7e-36   
gi|446160923|ref|WP_000238778.1| glutamine amidotransferase [Bac...   155   7e-36   
gi|374853422|dbj|BAL56331.1| glutamine amidotransferase [uncultu...   155   7e-36   
gi|490087034|ref|WP_003988988.1| glutamine amidotransferase [Str...   155   7e-36   
gi|498316701|ref|WP_010630857.1| glutamine amidotransferase [Spo...   155   8e-36   
gi|18076243|emb|CAC81976.1| SNO protein [Suberites domuncula]         155   8e-36   
gi|30260205|ref|NP_842582.1| glutamine amidotransferase subunit ...   155   8e-36   
gi|494711702|ref|WP_007447572.1| glutamine amidotransferase [Str...   155   9e-36   
gi|430756719|ref|YP_007211245.1| Glutamine amidotransferase subu...   155   1e-35   
gi|488608562|ref|YP_007929898.1| Glutamine amidotransferase subu...   155   1e-35   
gi|375360702|ref|YP_005128741.1| glutamine amidotransferase subu...   155   1e-35   
gi|16077080|ref|NP_387893.1| glutamine amidotransferase subunit ...   155   1e-35   
gi|514327664|gb|EPH40711.1| putative Glutamine amidotransferase ...   154   1e-35   
gi|384263643|ref|YP_005419350.1| glutamine amidotransferase subu...   154   1e-35   
gi|493101557|ref|WP_006136198.1| glutamine amidotransferase subu...   154   1e-35   
gi|405970101|gb|EKC35034.1| Glutamine amidotransferase subunit p...   154   1e-35   
gi|497877168|ref|WP_010191324.1| glutamine amidotransferase [Bac...   154   1e-35   
gi|493548544|ref|WP_006502255.1| glutamine amidotransferase [Aus...   154   1e-35   
gi|501306009|dbj|GAC95115.1| hypothetical protein PHSY_002690 [P...   154   1e-35   
gi|491287985|ref|WP_005146006.1| glutamine amidotransferase [Myc...   154   1e-35   
gi|494756102|ref|WP_007491510.1| glutamine amidotransferase [Str...   154   1e-35   
gi|489859731|ref|WP_003763378.1| glutamine amidotransferase subu...   154   1e-35   
gi|212225043|ref|YP_002308279.1| glutamine amidotransferase subu...   154   1e-35   
gi|494473588|ref|WP_007263066.1| glutamine amidotransferase [Str...   154   1e-35   
gi|493394181|ref|WP_006350316.1| glutamine amidotransferase [Str...   154   2e-35   
gi|429221232|ref|YP_007182876.1| pyridoxal 5'-phosphate synthase...   154   2e-35   
gi|308171903|ref|YP_003918608.1| glutamine amidotransferase [Bac...   154   2e-35   
gi|258510033|ref|YP_003183467.1| SNO glutamine amidotransferase ...   154   2e-35   
gi|291300121|ref|YP_003511399.1| SNO glutamine amidotransferase ...   154   2e-35   
gi|357388392|ref|YP_004903231.1| putative glutamine amidotransfe...   154   2e-35   
gi|15612586|ref|NP_240889.1| glutamine amidotransferase subunit ...   154   2e-35   
gi|494650799|ref|WP_007408743.1| glutamine amidotransferase [Bac...   154   2e-35   
gi|491587742|ref|WP_005445309.1| glutamine amidotransferase [Sac...   154   2e-35   
gi|489866091|ref|WP_003769677.1| glutamine amidotransferase [Lis...   154   2e-35   
gi|182439806|ref|YP_001827525.1| glutamine amidotransferase subu...   154   2e-35   
gi|297566449|ref|YP_003685421.1| SNO glutamine amidotransferase ...   154   2e-35   
gi|18076241|emb|CAC81978.1| SNO protein [Suberites domuncula]         154   2e-35   
gi|301051752|ref|YP_003789963.1| glutamine-hydrolyzing GMP synth...   154   2e-35   
gi|490068149|ref|WP_003970326.1| glutamine amidotransferase [Str...   154   2e-35   
gi|494382547|ref|WP_007203801.1| glutamine amidotransferase [Bac...   154   2e-35   
gi|302392251|ref|YP_003828071.1| pyridoxal phosphate synthase ya...   154   2e-35   
gi|497743103|ref|WP_010057287.1| glutamine amidotransferase subu...   153   3e-35   
gi|126434875|ref|YP_001070566.1| glutamine amidotransferase subu...   153   3e-35   
gi|452854074|ref|YP_007495757.1| glutamine amidotransferase for ...   153   3e-35   
gi|508734467|dbj|BAN30902.1| glutamine amidotransferase subunit ...   153   3e-35   
gi|255713338|ref|XP_002552951.1| KLTH0D05280p [Lachancea thermot...   153   3e-35   
gi|325280724|ref|YP_004253266.1| Glutamine amidotransferase subu...   153   3e-35   
gi|386756592|ref|YP_006229808.1| glutamine amidotransferase subu...   153   3e-35   
gi|332288696|ref|YP_004419548.1| glutamine amidotransferase subu...   153   3e-35   
gi|305672710|ref|YP_003864381.1| glutamine amidotransferase subu...   153   3e-35   
gi|269956456|ref|YP_003326245.1| SNO glutamine amidotransferase ...   153   3e-35   
gi|296139639|ref|YP_003646882.1| SNO glutamine amidotransferase ...   153   3e-35   
gi|489335140|ref|WP_003242371.1| glutamine amidotransferase subu...   153   3e-35   
gi|16801271|ref|NP_471539.1| glutamine amidotransferase subunit ...   153   4e-35   
gi|497965630|ref|WP_010279786.1| glutamine amidotransferase [Pae...   153   4e-35   
gi|498018580|ref|WP_010332736.1| glutamine amidotransferase [Bac...   153   4e-35   
gi|337744376|ref|YP_004638538.1| protein PdxT [Paenibacillus muc...   153   4e-35   
gi|495213141|ref|WP_007937920.1| glutamine amidotransferase [Pel...   153   4e-35   
gi|494800297|ref|WP_007535705.1| glutamine amidotransferase subu...   153   4e-35   
gi|350264113|ref|YP_004875420.1| glutamine amidotransferase subu...   153   4e-35   
gi|433647441|ref|YP_007292443.1| pyridoxal phosphate synthase ya...   153   4e-35   
gi|328854857|gb|EGG03987.1| hypothetical protein MELLADRAFT_4437...   152   4e-35   
gi|404214813|ref|YP_006669008.1| putative glutamine amidotransfe...   152   5e-35   
gi|281202045|gb|EFA76250.1| SNO glutamine amidotransferase famil...   152   5e-35   
gi|108799217|ref|YP_639414.1| glutamine amidotransferase subunit...   152   5e-35   
gi|498487073|ref|WP_010788761.1| Pyridoxine biosynthesis glutami...   152   5e-35   
gi|39654645|pdb|1Q7R|A Chain A, X-Ray Crystallographic Analysis ...   152   6e-35   
gi|495104434|ref|WP_007829257.1| glutamine amidotransferase [Str...   152   6e-35   
gi|510815395|ref|WP_016188966.1| glutamine amidotransferase subu...   152   6e-35   
gi|489864220|ref|WP_003767825.1| glutamine amidotransferase subu...   152   6e-35   
gi|496479059|ref|WP_009187629.1| glutamine amidotransferase [Str...   152   6e-35   
gi|383790850|ref|YP_005475424.1| pyridoxal 5'-phosphate synthase...   152   6e-35   
gi|496739420|ref|WP_009357446.1| glutamine amidotransferase subu...   152   6e-35   
gi|407646941|ref|YP_006810700.1| glutamine amidotransferase subu...   152   6e-35   
gi|119390641|pdb|2NV2|B Chain B, Structure Of The Plp Synthase C...   152   7e-35   
gi|498217101|ref|WP_010531257.1| glutamine amidotransferase [Len...   152   7e-35   
gi|497482078|ref|WP_009796276.1| glutamine amidotransferase [Bac...   152   7e-35   
gi|451944348|ref|YP_007464984.1| glutamine amidotransferase subu...   152   7e-35   
gi|493414295|ref|WP_006370212.1| glutamine amidotransferase [Gor...   152   8e-35   
gi|449092727|ref|YP_007425218.1| glutamine amidotransferase subu...   152   8e-35   
gi|384133802|ref|YP_005516516.1| SNO glutamine amidotransferase ...   152   8e-35   
gi|493076024|ref|WP_006123226.1| glutamine amidotransferase [Str...   152   8e-35   
gi|490118252|ref|WP_004018796.1| glutamine amidotransferase [Gor...   152   8e-35   
gi|480329453|ref|YP_007871215.1| glutamine amidotransferase subu...   152   8e-35   
gi|78042673|ref|YP_361484.1| glutamine amidotransferase subunit ...   152   8e-35   
gi|163847785|ref|YP_001635829.1| SNO glutamine amidotransferase ...   152   9e-35   
gi|494722307|ref|WP_007458173.1| glutamine amidotransferase [Mic...   152   9e-35   
gi|495992109|ref|WP_008716688.1| Glutamine amidotransferase subu...   152   9e-35   
gi|497755974|ref|WP_010070158.1| glutamine amidotransferase [Str...   151   9e-35   
gi|498211068|ref|WP_010525224.1| glutamine amidotransferase [Nes...   151   9e-35   
gi|471326543|ref|YP_007525573.1| Glutamine amidotransferase subu...   151   1e-34   
gi|496427985|ref|WP_009136832.1| glutamine amidotransferase [Odo...   151   1e-34   
gi|124027902|ref|YP_001013222.1| glutamine amidotransferase [Hyp...   151   1e-34   
gi|497923856|ref|WP_010238012.1| glutamine amidotransferase [Pse...   151   1e-34   
gi|514205965|gb|EPH01774.1| glutamine amidotransferase subunit p...   151   1e-34   
gi|489424087|ref|WP_003329781.1| glutamine amidotransferase subu...   151   1e-34   
gi|222152135|ref|YP_002561295.1| glutamine amidotransferase subu...   151   1e-34   
gi|491072247|ref|WP_004933870.1| glutamine amidotransferase [Str...   151   1e-34   
gi|18977900|ref|NP_579257.1| glutamine amidotransferase subunit ...   151   1e-34   
gi|408676841|ref|YP_006876668.1| Pyridoxine biosynthesis glutami...   151   1e-34   
gi|229917442|ref|YP_002886088.1| SNO glutamine amidotransferase ...   151   1e-34   
gi|495019917|ref|WP_007745738.1| glutamine amidotransferase [Oen...   151   1e-34   
gi|21220022|ref|NP_625801.1| glutamine amidotransferase subunit ...   151   1e-34   
gi|68565659|sp|P83813.1|PDXT_GEOSE RecName: Full=Glutamine amido...   151   1e-34   
gi|496234375|ref|WP_008948410.1| glutamine amidotransferase subu...   151   1e-34   
gi|290961818|ref|YP_003493000.1| glutamine amidotransferase subu...   151   1e-34   
gi|496659678|ref|WP_009302171.1| pyridoxal 5'-phosphate synthase...   151   1e-34   
gi|496015903|ref|WP_008740482.1| glutamine amidotransferase [Str...   151   1e-34   
gi|492787703|ref|WP_005963921.1| glutamine amidotransferase subu...   151   1e-34   
gi|494675825|ref|WP_007433764.1| glutamine amidotransferase [Pro...   151   1e-34   
gi|494622775|ref|WP_007380719.1| glutamine amidotransferase [Str...   151   1e-34   
gi|488483755|ref|WP_002527425.1| glutamine amidotransferase [Pro...   151   2e-34   
gi|379709796|ref|YP_005265001.1| glutamine amidotransferase subu...   151   2e-34   


>gi|384489791|gb|EIE81013.1| hypothetical protein RO3G_05718 [Rhizopus delemar RA 99-880]
          Length = 213

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 117/206 (56%), Positives = 149/206 (72%), Gaps = 3/206 (1%)

Query: 13  PQFKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAE 72
           PQ   GVLALQGAF EHIH+L+ + QV   IP+R  EQL  +DALIIPGGEST MALIAE
Sbjct: 6   PQIVIGVLALQGAFLEHIHILKKLPQVKEVIPVRTEEQLNQVDALIIPGGESTAMALIAE 65

Query: 73  RSGLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQID 132
           R  ++EPLR FV+ +KPTWGTCAGMI+LA EA+  KKGGQ L   L+++VNRNQFGSQ +
Sbjct: 66  RCNMLEPLRAFVQ-KKPTWGTCAGMIMLAKEAHGAKKGGQQLFNALDVSVNRNQFGSQKE 124

Query: 133 SFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQ 192
           SF ++LH+  +    D+ F A+FIRAP         V+++ RLE  +G+T+A + VAV Q
Sbjct: 125 SFRTMLHLPELL--GDEPFDAVFIRAPVISEIKSPKVKIVGRLEQKVGQTEAETAVAVLQ 182

Query: 193 GSLLGTAFHPELTNDDRIHKYFVQLT 218
             L  TAFHPELT+D R+H++FV L 
Sbjct: 183 EHLFATAFHPELTSDSRLHQFFVDLA 208



>gi|511000296|gb|EPB81846.1| hypothetical protein HMPREF1544_11430 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 215

 Score =  243 bits (619), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 118/204 (57%), Positives = 148/204 (72%), Gaps = 3/204 (1%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQGAF EHIHML  I QV  AIP+R  EQL ++D LIIPGGEST MALIAER  ++
Sbjct: 11  GVLALQGAFIEHIHMLNRIPQVKEAIPVRTEEQLNSVDCLIIPGGESTAMALIAERCNML 70

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
           EPLR FV+ +KPTWGTCAGMI+LA EA   KKGGQ L  GL++ VNRNQFGSQ +SF +L
Sbjct: 71  EPLRAFVQ-KKPTWGTCAGMIMLAKEATGAKKGGQQLFNGLDVVVNRNQFGSQKESFRTL 129

Query: 138 LHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGSLLG 197
           LH+  +    ++ F A+FIRAP         V+++ RLEH  G+T+A + VAV +  L  
Sbjct: 130 LHLPELL--GEEPFDAVFIRAPIIAEIKSPKVKIVGRLEHKHGQTEAETAVAVIEDHLFA 187

Query: 198 TAFHPELTNDDRIHKYFVQLTQDH 221
           TAFHPELT+D+R+H++FV +   H
Sbjct: 188 TAFHPELTSDNRLHEFFVNMAIKH 211



>gi|328770766|gb|EGF80807.1| hypothetical protein BATDEDRAFT_88454 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 233

 Score =  211 bits (538), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 116/223 (52%), Positives = 149/223 (66%), Gaps = 21/223 (9%)

Query: 10  QVQPQFKFGVLALQGAFQEHIHMLQNISQ-VSSAIPIRKAEQLE--TIDALIIPGGESTT 66
           Q +P  + GVLALQGAF EHI++L  +SQ V  AIPIR  EQLE   +DALI+PGGEST 
Sbjct: 3   QAKP-LRIGVLALQGAFSEHINILNRMSQWVDMAIPIRTKEQLENSCLDALILPGGESTA 61

Query: 67  MALIAERSGLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQ 126
           +AL AER+GLMEPLR++VR   P WGTCAGMILL++ A   K+GGQ+LIGGL++ V RN 
Sbjct: 62  IALAAERNGLMEPLRQWVRSGNPIWGTCAGMILLSDTAQGTKEGGQELIGGLHVQVKRNA 121

Query: 127 FGSQIDSFESLLHINHITTSSDDLFPAIFIRAPXXXX---------XXXXXVEVLARLEH 177
           FG Q+DSF   + I  I    D  F A+FIRAP                  V++LAR+  
Sbjct: 122 FGHQLDSFVECIDIPVI---GDTPFQAVFIRAPLISSICVDEMAKHVTTAPVQILARV-- 176

Query: 178 DIGETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQD 220
               +  + IVAV+QG++L T+FHPELT D R H+YFV+ +Q+
Sbjct: 177 ---PSKDNCIVAVQQGNILATSFHPELTQDTRFHQYFVKFSQE 216



>gi|358401127|gb|EHK50442.1| hypothetical protein TRIATDRAFT_254530 [Trichoderma atroviride IMI
           206040]
          Length = 240

 Score =  209 bits (531), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 112/229 (48%), Positives = 151/229 (65%), Gaps = 30/229 (13%)

Query: 18  GVLALQGAFQEHIHMLQN-----ISQVSS-----AIPIRKAEQLETIDALIIPGGESTTM 67
           GVLALQG F EH+++L+       SQ  S     AI +R AE+L   DALIIPGGESTT+
Sbjct: 7   GVLALQGGFVEHLNLLRKAASAVFSQSKSDTSFEAIEVRTAEELARCDALIIPGGESTTI 66

Query: 68  ALIAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQ 126
           + +A++SGL+EPLR FV+  +KP WGTCAG+ILL+N+AN  KKGGQ+LIGGLN+ V+RN 
Sbjct: 67  SFVAQQSGLLEPLRDFVKVQKKPVWGTCAGLILLSNQANATKKGGQELIGGLNVRVHRNH 126

Query: 127 FGSQIDSFESLLHINHITTSSD-DLFPAIFIRAPXXXXXXXX-------XVEVLARL--- 175
           FG QI+SFE+ L +  +   +D   FP +FIRAP                VEV+A+L   
Sbjct: 127 FGRQIESFEAPLQLPFLADEADPSPFPGVFIRAPVVEEILSKGESEQGPKVEVMAKLPGR 186

Query: 176 --------EHDIGETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
                      + + D+  I+AVRQGS+LGT+FHPELT+D RIH ++++
Sbjct: 187 INRMKSGVSQAVTKDDSGDIIAVRQGSILGTSFHPELTDDARIHAWWLK 235



>gi|470305005|ref|XP_004348255.1| glutamine amidotransferase subunit pdxT [Capsaspora owczarzaki ATCC
           30864]
 gi|320169560|gb|EFW46459.1| glutamine amidotransferase subunit pdxT [Capsaspora owczarzaki ATCC
           30864]
          Length = 220

 Score =  206 bits (523), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 144/210 (68%), Gaps = 8/210 (3%)

Query: 13  PQFKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLE--TIDALIIPGGESTTMALI 70
           P  K GVLALQGAF EHIH+L  I  V+ A+ IR   ++   T+DALIIPGGESTTM L+
Sbjct: 4   PAVKIGVLALQGAFIEHIHVLGRIENVT-AVQIRTPAEVNDPTLDALIIPGGESTTMGLV 62

Query: 71  AERSGLMEPLRKFV-RDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGS 129
           AERSG++EPLR +  +  KP WGTCAGMILLAN A ++K GGQ L+GGL++ V+RN FG+
Sbjct: 63  AERSGIVEPLRLWAHQGVKPVWGTCAGMILLANSALQMKIGGQPLLGGLDVCVDRNHFGA 122

Query: 130 QIDSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVA 189
           Q+ SFE  + I  +    ++ F A+FIRAP         V V+A+LE    + +   I+A
Sbjct: 123 QLQSFEMPVSIPVL---GEEPFQAVFIRAP-VIVSHKPNVTVIAKLEKKNADDEHERIIA 178

Query: 190 VRQGSLLGTAFHPELTNDDRIHKYFVQLTQ 219
            RQ +LL TAFHPELT D R H+YFV++ +
Sbjct: 179 ARQSNLLATAFHPELTGDSRFHRYFVEMVR 208



>gi|470455541|ref|XP_004340967.1| pyridoxine synthesis protein PDX2, putative [Acanthamoeba
           castellanii str. Neff]
 gi|440797829|gb|ELR18903.1| pyridoxine synthesis protein PDX2, putative [Acanthamoeba
           castellanii str. Neff]
          Length = 237

 Score =  200 bits (509), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 105/207 (50%), Positives = 137/207 (66%), Gaps = 7/207 (3%)

Query: 17  FGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGL 76
            GVLALQGAF+EH+  L++++ V+  + +R + QLE++D L+IPGGEST +ALIAE SGL
Sbjct: 21  IGVLALQGAFREHVEKLKSLAGVT-VVEVRTSAQLESVDGLLIPGGESTAIALIAEASGL 79

Query: 77  MEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFE 135
           +EPLR F+R   K  WGTCAG+I+++N     K GGQ ++GG  I+  RN FG Q+DSF 
Sbjct: 80  LEPLRSFIRHPRKAVWGTCAGLIMMSNHVEGQKAGGQAVLGGFEISTARNYFGRQLDSFV 139

Query: 136 SLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASS---IVAVRQ 192
           +           D  FPA+FIRAP         VEVLA +      TDA     IVAVRQ
Sbjct: 140 ADTLTVPALADGDRPFPAVFIRAPAVTAVHSPDVEVLASVPAK--PTDAEHKEVIVAVRQ 197

Query: 193 GSLLGTAFHPELTNDDRIHKYFVQLTQ 219
           G LLGTAFHPELT+D R H++FV +T+
Sbjct: 198 GRLLGTAFHPELTDDARWHQFFVDMTR 224



>gi|326436957|gb|EGD82527.1| SNO glutamine amidotransferase [Salpingoeca sp. ATCC 50818]
          Length = 272

 Score =  199 bits (506), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 140/223 (62%), Gaps = 7/223 (3%)

Query: 5   CNDFQQVQPQFKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGES 64
           C      +   + GVLALQGAF EH+ ML+ I  V  A  +R A+ LE  D L+IPGGES
Sbjct: 18  CTTSMMTEQSVRIGVLALQGAFAEHVAMLRRIEGVE-AFEVRNAKDLEAADGLVIPGGES 76

Query: 65  TTMALIAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVN 123
           TTM LIAER+G++  LR+FV   +KP +GTCAG+I+LA+ A  +K+GGQ L+GGLN+ V+
Sbjct: 77  TTMGLIAERTGILSSLREFVSLRKKPVFGTCAGLIMLADSAKHMKEGGQPLLGGLNVLVD 136

Query: 124 RNQFGSQIDSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETD 183
           RN FGSQ+ SFE+ L ++            +FIRAP         V++LAR+  +  +  
Sbjct: 137 RNHFGSQLQSFETELQVSEDEGLDLSACHGVFIRAPVVLKTLGPHVKILARVSGNPEKAA 196

Query: 184 A-----SSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQDH 221
                   IVAV Q  +LGTAFHPELT DDR H+YFV + + H
Sbjct: 197 PLAAGEERIVAVHQDHMLGTAFHPELTADDRWHRYFVAMVRRH 239



>gi|475662976|gb|EMT60772.1| Pyridoxal biosynthesis protein PDX2 [Fusarium oxysporum f. sp.
           cubense race 4]
          Length = 238

 Score =  199 bits (505), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 107/228 (46%), Positives = 149/228 (65%), Gaps = 31/228 (13%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSA-----------IPIRKAEQLETIDALIIPGGESTT 66
           GVLALQG F EHI ++Q  ++  S+           I +R  E+L+  +ALIIPGGESTT
Sbjct: 7   GVLALQGGFAEHIDLVQKAAEYLSSTEGISKTKFHCIEVRTKEELDQCNALIIPGGESTT 66

Query: 67  MALIAERSGLMEPLRKFVRDEK-PTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRN 125
           ++ +A +SGL+EPLR FV+ +K P WGTCAG+ILL++EAN  KKGGQ+LIGGL + V+RN
Sbjct: 67  ISFVAAQSGLLEPLRDFVKVQKRPVWGTCAGLILLSDEANATKKGGQELIGGLAVRVHRN 126

Query: 126 QFGSQIDSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXX------VEVLARLEHDI 179
            FG Q++SFES +++  +  + D  FP +FIRAP               VEVLA+L   +
Sbjct: 127 HFGRQMESFESGMNLPFL--NDDKPFPGVFIRAPVVEEVIGSSDDGRPPVEVLAKLPGRV 184

Query: 180 GET-----------DASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
            +            D+  IVAVRQG++LGT+FHPELT D+RIH ++++
Sbjct: 185 DKMKSGVSQANTKDDSGDIVAVRQGNVLGTSFHPELTKDERIHVWWLK 232



>gi|340521162|gb|EGR51397.1| predicted protein [Trichoderma reesei QM6a]
          Length = 238

 Score =  198 bits (503), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 105/226 (46%), Positives = 141/226 (62%), Gaps = 27/226 (11%)

Query: 18  GVLALQGAFQEHIHMLQNISQVS----------SAIPIRKAEQLETIDALIIPGGESTTM 67
           GVLALQG F EHI +L   + V           +AI +R    L+  DALIIPGGESTT+
Sbjct: 7   GVLALQGGFFEHIDLLHRAASVVFPSMRPEAVFTAIEVRTPADLDKSDALIIPGGESTTI 66

Query: 68  ALIAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQ 126
           A +A++SGL+EPLR FV+   KP WGTCAG+ILLA +AN  K GGQ+LIGGL++ V RN 
Sbjct: 67  AFVAQQSGLLEPLRDFVKVKRKPVWGTCAGLILLAEQANGAKIGGQELIGGLDVAVARNH 126

Query: 127 FGSQIDSFESLLHINHI--------TTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHD 178
           FG Q+ SF++ +H+  +            D+ FPAIFIRAP         VEVLA +  +
Sbjct: 127 FGRQLQSFQATIHLPFLGENQPVNQAEPVDEFFPAIFIRAPIVEEILNDNVEVLATVPRE 186

Query: 179 --------IGETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
                   + E +   ++AVRQGS++G +FHPELT D RIH ++++
Sbjct: 187 EKAKRGSTLDEKEKDDVIAVRQGSIVGMSFHPELTEDPRIHVWWLR 232



>gi|358380435|gb|EHK18113.1| hypothetical protein TRIVIDRAFT_44779 [Trichoderma virens Gv29-8]
          Length = 235

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 105/223 (47%), Positives = 145/223 (65%), Gaps = 24/223 (10%)

Query: 18  GVLALQGAFQEHIHMLQNISQ-------VSSAIPIRKAEQLETIDALIIPGGESTTMALI 70
           GVLALQG F EHI +L   +           A+ +R A++L   DAL+IPGGESTT++ +
Sbjct: 7   GVLALQGGFIEHIELLNKAASSIFSQDFAFEAVEVRTAQELARCDALVIPGGESTTISFV 66

Query: 71  AERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGS 129
           A++SGL+EPLR FV+  +KP WGTCAG+ILL +EAN  KKGGQ LIGGL++ V+RN FG 
Sbjct: 67  AQQSGLLEPLRDFVKVQKKPVWGTCAGLILLCDEANGTKKGGQALIGGLSVRVHRNHFGR 126

Query: 130 QIDSFESLLHINHITTSSD-DLFPAIFIRAPXXXXXX----XXXVEVLARLEH------- 177
           Q++SF + + +  +    + + FP IFIRAP             VEVLARL +       
Sbjct: 127 QMESFATPVDLPFLAGEGNSEQFPGIFIRAPVVEEVLPHGDGPEVEVLARLANRVERAKA 186

Query: 178 ----DIGETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
                + + DA  I+AVRQGS++GT+FHPELT+D RIH ++++
Sbjct: 187 GLSLAVTKGDAGDIIAVRQGSIMGTSFHPELTSDARIHSWWLK 229



>gi|399172624|emb|CCE26771.1| probable Sno-type pyridoxine vitamin B6 biosynthetic protein SNO1
           [Claviceps purpurea 20.1]
          Length = 230

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 105/221 (47%), Positives = 143/221 (64%), Gaps = 22/221 (9%)

Query: 17  FGVLALQGAFQEHIHMLQNISQV----SSAIPIRKAEQLETIDALIIPGGESTTMALIAE 72
            GVLALQG F EHI++++  +       + + +R AE+L   D LIIPGGESTT++ +A 
Sbjct: 6   IGVLALQGGFIEHINLVRAAAAQLHLNVTTLEVRTAEELARCDGLIIPGGESTTISFVAA 65

Query: 73  RSGLMEPLRKFVRDEK-PTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQI 131
           +SGL+EPLR +V+ +K P WGTCAG+ILL+NEAN  KK GQ+LIGGL + V+RN FG QI
Sbjct: 66  QSGLLEPLRDYVKTQKRPVWGTCAGLILLSNEANATKKNGQELIGGLGVRVHRNHFGRQI 125

Query: 132 DSFESLLHINHITTSSDDLFPAIFIRAPX-----XXXXXXXXVEVLARLEHDIGE----- 181
           +SFE+ + +  +   S   FP +FIRAP              VEVLA+L   +       
Sbjct: 126 ESFEADMDLPFLGEGSSP-FPGVFIRAPVVEEILSASGSGSDVEVLAKLPGRVDRMKAGV 184

Query: 182 ------TDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
                  DA  I+AVRQG++LGT+FHPELTND RIH ++++
Sbjct: 185 SQANTSNDAGDIIAVRQGNILGTSFHPELTNDARIHAWWLK 225



>gi|388582136|gb|EIM22442.1| SNO glutamine amidotransferase [Wallemia sebi CBS 633.66]
          Length = 214

 Score =  197 bits (502), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 102/204 (50%), Positives = 146/204 (71%), Gaps = 8/204 (3%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVL+LQGAF EHIH L+ ++  ++ + ++  E LE   ALIIPGGESTT++L+A+RSGL+
Sbjct: 8   GVLSLQGAFIEHIHRLKQLTD-ATVLQVKTPEDLEKCHALIIPGGESTTISLVAQRSGLL 66

Query: 78  EPLRKFVRD-EKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFES 136
           EPLR F  +  K  WGTCAGMILL+ EA K  +GGQ+L GG++ITVNRNQ+GSQI+SF++
Sbjct: 67  EPLRAFCNNPNKAVWGTCAGMILLSKEATKTMRGGQELFGGMDITVNRNQYGSQIESFQA 126

Query: 137 LLHINHITTSSDDLFPAIFIRAPXXXXXXXXX--VEVLARLEHDIGETDA--SSIVAVRQ 192
            L  N ++T  D+ F AIFIRAP           +E+ + +++ I +  A   ++VA+RQ
Sbjct: 127 DLQFNCLST--DESFNAIFIRAPILHSYDQDKGIIELASLIDNPIDDKLAPKGNVVALRQ 184

Query: 193 GSLLGTAFHPELTNDDRIHKYFVQ 216
            + + T+FHPELT D R+H+YF++
Sbjct: 185 FNKMCTSFHPELTQDKRLHEYFLK 208



>gi|71001022|ref|XP_755192.1| pyridoxine [Aspergillus fumigatus Af293]
 gi|66852830|gb|EAL93154.1| pyridoxine [Aspergillus fumigatus Af293]
 gi|159129281|gb|EDP54395.1| pyridoxine [Aspergillus fumigatus A1163]
          Length = 267

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 113/261 (43%), Positives = 150/261 (57%), Gaps = 52/261 (19%)

Query: 18  GVLALQGAFQEHIHMLQN-ISQVSSA-----IPIRKAEQLETIDALIIPGGESTTMALIA 71
           GVLALQGAF EHI +L+  +S+ SS      I +R  ++L+  DALI+PGGESTT++L+A
Sbjct: 7   GVLALQGAFYEHIQLLKKAVSEQSSTTQWEFIEVRTPQELDRCDALILPGGESTTISLVA 66

Query: 72  ERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQ 130
            RS L+EPLR FV+   KPTWGTCAG+ILLA  AN+ KKGGQ+LIGGL++ VNRN FG Q
Sbjct: 67  ARSNLLEPLRDFVKVHRKPTWGTCAGLILLAESANRTKKGGQELIGGLDVRVNRNHFGRQ 126

Query: 131 IDSFESLLHINHITTSSDDLFPAIFIRAP------------------------------- 159
            +SFE+ L +  +   ++  FPA+FIRAP                               
Sbjct: 127 TESFEAPLDLPFL-GPTEQSFPAVFIRAPVVEKILPHQQGIQVDETQRDETVVAPSRQPQ 185

Query: 160 --XXXXXXXXXVEVLARLE-----------HDIGETDASSIVAVRQGSLLGTAFHPELTN 206
                      VEVLARL            H   E +   IVAV+QG++ GT+FHPELT 
Sbjct: 186 DQAAKAAMADEVEVLARLSGRAAELAAVGTHIDAEKETGDIVAVKQGNVFGTSFHPELTG 245

Query: 207 DDRIHKYFVQLTQDHYNTGKG 227
           D RIH ++++  ++      G
Sbjct: 246 DARIHSWWLRQVEESVRKRNG 266



>gi|407921597|gb|EKG14738.1| Glutamine amidotransferase subunit PdxT [Macrophomina phaseolina
           MS6]
          Length = 293

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 112/268 (41%), Positives = 152/268 (56%), Gaps = 65/268 (24%)

Query: 14  QFKFGVLALQGAFQEHIHMLQ------------NISQVS-SAIPIRKAEQLETIDALIIP 60
           Q   GVLALQGAF EHI +L+            + +QV  S I +R   +L + DALI+P
Sbjct: 11  QITIGVLALQGAFSEHIQLLRIAIASLRARKVHDAAQVDWSCIEVRTPAELASCDALILP 70

Query: 61  GGESTTMALIAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLN 119
           GGESTTM+L+AERSG++EPLR+FV+   KPTWGTCAG+ILLA  AN+ KKGGQ+LIGGL+
Sbjct: 71  GGESTTMSLVAERSGMLEPLREFVKVQRKPTWGTCAGLILLAESANRTKKGGQELIGGLD 130

Query: 120 ITVNRNQFGSQIDSFESLLHINHI-------TTSSDDLFPAIFIRAP------------- 159
           + V+RN FG Q +SF + L ++ +       T +++  FP++FIRAP             
Sbjct: 131 VRVSRNHFGRQTESFTADLDLSFLRSAQGVETQTNEKPFPSVFIRAPVVEKLLPHKDGIQ 190

Query: 160 --------------------XXXXXXXXXVEVLARLEHD-----------IGETDASSIV 188
                                        VEV+ARL                E +A  I+
Sbjct: 191 TEEAAKEETIVAPSKVPADDAARAEFEAQVEVMARLPERAKALSKEGVTACDEGEAGDII 250

Query: 189 AVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
           AVRQG++ GT+FHPELT D RIH ++++
Sbjct: 251 AVRQGNVFGTSFHPELTGDSRIHVWWLE 278



>gi|296415876|ref|XP_002837610.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295633486|emb|CAZ81801.1| unnamed protein product [Tuber melanosporum]
          Length = 223

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 106/205 (51%), Positives = 144/205 (70%), Gaps = 18/205 (8%)

Query: 18  GVLALQGAFQEHIHMLQNIS-QVSSA-----IPIRKAEQLETIDALIIPGGESTTMALIA 71
           GVLALQGAF EH+ +L+  + Q+ +      I ++    LE   ALIIPGGESTTMALIA
Sbjct: 10  GVLALQGAFSEHLELLKKAAEQIETPKKIGFISVKTPVDLEKCSALIIPGGESTTMALIA 69

Query: 72  ERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQ 130
           ERS ++EPLR+FV+   +PTWGTCAGMILL+  AN+ KKGGQ LIGGL++ VNRN FG Q
Sbjct: 70  ERSNILEPLREFVKVHRRPTWGTCAGMILLSEAANRTKKGGQALIGGLSVRVNRNHFGRQ 129

Query: 131 IDSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAV 190
           ++SF++ L ++ +  + +  F  +FIRAP           V + L  +   T+ASSIVAV
Sbjct: 130 VESFDAPLDLSFL-GNDEAPFRGVFIRAPI----------VESILPKEECCTNASSIVAV 178

Query: 191 RQGSLLGTAFHPELTNDDRIHKYFV 215
           RQG+++GT+FHPELT D R+HK+++
Sbjct: 179 RQGNVVGTSFHPELTGDLRMHKWWL 203



>gi|342879962|gb|EGU81194.1| hypothetical protein FOXB_08344 [Fusarium oxysporum Fo5176]
 gi|477510023|gb|ENH63311.1| Pyridoxal biosynthesis protein PDX2 [Fusarium oxysporum f. sp.
           cubense race 1]
          Length = 238

 Score =  197 bits (501), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 106/228 (46%), Positives = 149/228 (65%), Gaps = 31/228 (13%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSA-----------IPIRKAEQLETIDALIIPGGESTT 66
           GVLALQG F EHI +++  ++  S+           I +R  E+L+  +ALIIPGGESTT
Sbjct: 7   GVLALQGGFAEHIDLVRKAAEYLSSTEGISKTKFHCIEVRTKEELDQCNALIIPGGESTT 66

Query: 67  MALIAERSGLMEPLRKFVRDEK-PTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRN 125
           ++ +A +SGL+EPLR FV+ +K P WGTCAG+ILL++EAN  KKGGQ+LIGGL + V+RN
Sbjct: 67  ISFVAAQSGLLEPLRDFVKVQKRPVWGTCAGLILLSDEANATKKGGQELIGGLAVRVHRN 126

Query: 126 QFGSQIDSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXX------VEVLARLEHDI 179
            FG Q++SFES +++  +  + D  FP +FIRAP               VEVLA+L   +
Sbjct: 127 HFGRQMESFESGMNLPFL--NDDKPFPGVFIRAPVVEEVIGSSDDGRPPVEVLAKLPGRV 184

Query: 180 GET-----------DASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
            +            D+  IVAVRQG++LGT+FHPELT D+RIH ++++
Sbjct: 185 DKMKSGVSQANTKDDSGDIVAVRQGNVLGTSFHPELTKDERIHVWWLK 232



>gi|400600478|gb|EJP68152.1| SNO glutamine amidotransferase [Beauveria bassiana ARSEF 2860]
          Length = 235

 Score =  196 bits (498), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 102/221 (46%), Positives = 141/221 (63%), Gaps = 22/221 (9%)

Query: 18  GVLALQGAFQEHIHMLQNISQ--------VSSAIPIRKAEQLETIDALIIPGGESTTMAL 69
           GVLALQG F EH+ +++  +            AI +R  ++L   DALIIPGGESTT++ 
Sbjct: 9   GVLALQGGFAEHVALVRKAAAQLPDTYPTAVVAIEVRTPDELARCDALIIPGGESTTISF 68

Query: 70  IAERSGLMEPLRKFVRD-EKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFG 128
           +A +SGL+EPLR+FV+  +KPTWGTCAG+ILL+ +AN  KKGGQ LIGGL++ V+RN FG
Sbjct: 69  VAAQSGLLEPLREFVKVLKKPTWGTCAGLILLSEQANATKKGGQALIGGLDVRVHRNHFG 128

Query: 129 SQIDSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIG-------- 180
            QI+SF + L +  +  ++   F  +FIRAP         V V+A L   +         
Sbjct: 129 RQIESFIAPLDLPFLPDATSRPFDGVFIRAPVVEALLSPAVAVVATLPDRVNKAKPKSAV 188

Query: 181 -----ETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
                E +A  I+AVRQG++LGT+FHPELT D R+H +F+Q
Sbjct: 189 SEANPEDNAGDIIAVRQGNVLGTSFHPELTTDARMHAWFLQ 229



>gi|115443018|ref|XP_001218316.1| glutamine amidotransferase subunit pdxT [Aspergillus terreus
           NIH2624]
 gi|114188185|gb|EAU29885.1| glutamine amidotransferase subunit pdxT [Aspergillus terreus
           NIH2624]
          Length = 540

 Score =  196 bits (497), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 112/257 (43%), Positives = 146/257 (56%), Gaps = 54/257 (21%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSA------IPIRKAEQLETIDALIIPGGESTTMALIA 71
           GVLALQGAF EHI +L+  +   S       I +R  ++LE  DALI+PGGESTTM+L+A
Sbjct: 273 GVLALQGAFYEHIQLLKQAAAGWSHSSQWDFIEVRTPQELERCDALILPGGESTTMSLVA 332

Query: 72  ERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQ 130
            RS L+EPLR+FV+   KPTWGTCAG+ILLA  AN+ KKGGQ+LIGGL++ VNRN FG Q
Sbjct: 333 ARSNLLEPLREFVKVHRKPTWGTCAGLILLAESANRTKKGGQELIGGLDVRVNRNHFGRQ 392

Query: 131 IDSFESLLHINHITTSSDD--LFPAIFIRAP----------------------------- 159
            +SF++ L +  + T   +   FPA+FIRAP                             
Sbjct: 393 TESFQAPLELPFLNTPGQEEASFPAVFIRAPVVEKVLPHHEGIQTGEVERDETIVAPSKS 452

Query: 160 ----XXXXXXXXXVEVLARLEHDIG------------ETDASSIVAVRQGSLLGTAFHPE 203
                        VEVLA L                 E +A  IVAVRQG++ GT+FHPE
Sbjct: 453 AKDAAARDAMATDVEVLATLPGRAAKLVASQGTAINPEKEAGDIVAVRQGNVFGTSFHPE 512

Query: 204 LTNDDRIHKYFVQLTQD 220
           LT D RIH ++++  ++
Sbjct: 513 LTGDARIHSWWLRQVEE 529



>gi|508785780|gb|EOY33036.1| Pyridoxine biosynthesis 2 [Theobroma cacao]
          Length = 253

 Score =  195 bits (496), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 106/222 (47%), Positives = 140/222 (63%), Gaps = 21/222 (9%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG+F EHI  L+ +      + +RK EQL+TI +LIIPGGESTTMA +AE   L 
Sbjct: 5   GVLALQGSFNEHIAALKRLG--VKGVEVRKPEQLQTISSLIIPGGESTTMAKLAEFHNLF 62

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             LR+FV+  KP WGTCAG+I LAN+A   K+GGQ+L+GGL+ TV+RN FGSQI SFE+ 
Sbjct: 63  PALREFVQMGKPVWGTCAGLIFLANKAVGQKEGGQELVGGLDCTVHRNYFGSQIQSFEAE 122

Query: 138 LHINHITT--SSDDLFPAIFIRAPXXXXXXXXXVEVLA----------------RLEHDI 179
           L +  + +     + FP +FIRAP         VEVLA                 ++ + 
Sbjct: 123 LLVPELASREGGPETFPGVFIRAP-AVLEVGPEVEVLADYPIPSNKVLYSSSAVEIQEEN 181

Query: 180 GETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQDH 221
              +   IVA+RQG+LLGTAFHPELT D R H YF+++ + +
Sbjct: 182 AVPEKKVIVAIRQGNLLGTAFHPELTADTRWHSYFLKMARGY 223



>gi|425766492|gb|EKV05101.1| Pyridoxine [Penicillium digitatum Pd1]
 gi|425775338|gb|EKV13616.1| Pyridoxine [Penicillium digitatum PHI26]
          Length = 267

 Score =  194 bits (494), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 113/252 (44%), Positives = 148/252 (58%), Gaps = 51/252 (20%)

Query: 18  GVLALQGAFQEHIHMLQNIS-QVSSA----IPIRKAEQLETIDALIIPGGESTTMALIAE 72
           GVLALQGAF EH+ +L+N + QV  +    I +R  ++L T D L++PGGESTTM+L+A 
Sbjct: 6   GVLALQGAFFEHMQLLKNAAEQVPQSEWHFIEVRTPQELATCDGLVLPGGESTTMSLVAA 65

Query: 73  RSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQI 131
           RS L+EPLR+FV+ D KPTWGTCAG+ILLA  ANK KKGGQ+LIGGL++ VNRN FG Q 
Sbjct: 66  RSNLLEPLREFVKVDRKPTWGTCAGLILLAESANKTKKGGQELIGGLDVRVNRNHFGRQT 125

Query: 132 DSFESLLHINHITTSSDDLFPAIFIRAP-------------------------------- 159
           +SF+  L++  +   +   FPA+FIRAP                                
Sbjct: 126 ESFQGPLNLPFLGQGAPP-FPAVFIRAPIVEKILPHHEGIQTEEIQQEEIVVAPSKEARD 184

Query: 160 -XXXXXXXXXVEVLARL----------EHDIG-ETDASSIVAVRQGSLLGTAFHPELTND 207
                     VEVLA L            DI  + +   IVAVRQG++ GT+FHPELT D
Sbjct: 185 SVAQAATAEHVEVLATLVGPAAQNATEGRDINPDQEVGDIVAVRQGNVFGTSFHPELTGD 244

Query: 208 DRIHKYFVQLTQ 219
            RIH ++++  Q
Sbjct: 245 SRIHTWWLREVQ 256



>gi|167520764|ref|XP_001744721.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163777052|gb|EDQ90670.1| predicted protein [Monosiga brevicollis MX1]
          Length = 215

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 133/218 (61%), Gaps = 9/218 (4%)

Query: 13  PQFKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAE 72
           P    GVLALQGAF+EH+  L     VS A+P+R  EQL T+DAL+IPGGESTTM L+AE
Sbjct: 4   PSVTIGVLALQGAFREHLRALSEFEGVS-ALPVRTKEQLATVDALVIPGGESTTMGLVAE 62

Query: 73  RSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQI 131
           RSGL+E LR   R  +KP + TCAG+I+LA  A   K GGQ L+GGL++ V+RN FG+Q+
Sbjct: 63  RSGLLEELRAMTRARQKPVFATCAGLIMLAQRAQHEKTGGQPLLGGLDVVVDRNFFGTQL 122

Query: 132 DSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGET--DASSIVA 189
            SFE+ + +      +     A+FIRAP         VEVLA L  D      +   IVA
Sbjct: 123 QSFEATMDVRLPGDEAASTCHAVFIRAP-AILEVGIRVEVLATLPVDKSPRPLEKPCIVA 181

Query: 190 VRQGSLLGTAFHPELTNDDRIHKYFVQLTQDHYNTGKG 227
            RQG  L TAFHPELT D R H YFV    D     KG
Sbjct: 182 ARQGPFLVTAFHPELTADRRWHAYFV----DQVRATKG 215



>gi|46121315|ref|XP_385212.1| hypothetical protein FG05036.1 [Fusarium graminearum PH-1]
          Length = 237

 Score =  194 bits (493), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 106/230 (46%), Positives = 148/230 (64%), Gaps = 30/230 (13%)

Query: 15  FKFGVLALQGAFQEHIHML----------QNISQVS-SAIPIRKAEQLETIDALIIPGGE 63
              GVLALQG F EHI ++          +NIS+ +   I +R  EQL+   ALIIPGGE
Sbjct: 4   LTIGVLALQGGFSEHIDLVRKAAESISCTENISKNNIQCIEVRTKEQLDQCSALIIPGGE 63

Query: 64  STTMALIAERSGLMEPLRKFVRDEK-PTWGTCAGMILLANEANKVKKGGQDLIGGLNITV 122
           STT++ +A +SGL+EPLR FV+ +K P WGTCAG+ILL++EAN  KKGGQ+LIGGL + V
Sbjct: 64  STTISFVAAQSGLLEPLRDFVKVQKRPVWGTCAGLILLSDEANATKKGGQELIGGLAVRV 123

Query: 123 NRNQFGSQIDSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXX-----VEVLARLEH 177
           +RN FG Q +SFE+ +++  +  + +  +P +FIRAP              VEVLA+L  
Sbjct: 124 HRNHFGRQTESFEAGMNLPFL--NDEKPYPGVFIRAPVVEQVIGASDGRQPVEVLAKLPG 181

Query: 178 DIGET-----------DASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
            + +            D+  IVAVRQG++LGT+FHPELT D+RIH ++++
Sbjct: 182 RVDKMKSGVSQANTKDDSGDIVAVRQGNVLGTSFHPELTKDERIHVWWLK 231



>gi|465793243|emb|CCU98370.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 239

 Score =  194 bits (492), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 105/229 (45%), Positives = 133/229 (58%), Gaps = 31/229 (13%)

Query: 17  FGVLALQGAFQEHIHMLQNISQVSS-----AIPIRKAEQLETIDALIIPGGESTTMALIA 71
            GVLALQGAF EHI    ++S  +S     +I +R+ EQL   DAL+IPGGEST +AL  
Sbjct: 9   IGVLALQGAFHEHIARFASLSASASHVSVRSIAVRRPEQLAQCDALVIPGGESTAIALGL 68

Query: 72  ERSGLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQI 131
             +GL EPLR ++R+ +P WGTCAGMI+LAN A   K+GGQ+L+GGL+I V RN FGSQ+
Sbjct: 69  HNAGLTEPLRTWIREGRPVWGTCAGMIMLANTATGGKRGGQELLGGLHIQVGRNGFGSQV 128

Query: 132 DSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGE---------- 181
           +SFE  +    I    D  FP +FIRAP             A + H   +          
Sbjct: 129 NSFECDVQCPAI---GDTPFPGVFIRAPVVEALGGGGAAAAAPVSHSPDDMHGLFPGTPV 185

Query: 182 -------------TDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQL 217
                         D S +VAVRQG LL T+FHPELT D R+H YFVQ+
Sbjct: 186 EPIAWLPPASDTAADPSRVVAVRQGRLLATSFHPELTTDTRLHNYFVQM 234



>gi|440635469|gb|ELR05388.1| hypothetical protein GMDG_07371 [Geomyces destructans 20631-21]
          Length = 273

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 113/251 (45%), Positives = 143/251 (56%), Gaps = 50/251 (19%)

Query: 15  FKFGVLALQGAFQEHIHMLQNISQVSSA-----IPIRKAEQLETIDALIIPGGESTTMAL 69
           F  GVLALQGAF EH  +L++ +Q   A     + +R A QL + DAL+IPGGESTT++L
Sbjct: 10  FTVGVLALQGAFSEHTQLLRSAAQFHPATQFTFLEVRTAAQLASCDALVIPGGESTTISL 69

Query: 70  IAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFG 128
           IAER  L+EPLR FV+   KPTWGTCAG+ILLA  AN+ K GGQ+LIGGL++ VNRN FG
Sbjct: 70  IAERCNLLEPLRDFVKVQRKPTWGTCAGLILLAESANRTKAGGQELIGGLDVRVNRNHFG 129

Query: 129 SQIDSFESLLHINHITTSSD--DLFPAIFIRAPXXXXXXXXX------------------ 168
            Q +SF++ L +  +       D F AIFIRAP                           
Sbjct: 130 RQTESFQADLDLKFLGAEGGMADPFRAIFIRAPIVETLLKDSDGAQEGEAQKPETVIAPS 189

Query: 169 ---------------VEVL-------ARLEHDIGETD--ASSIVAVRQGSLLGTAFHPEL 204
                          VE+L       A  +H  G TD  A  IVAVRQG++ GT+FHPEL
Sbjct: 190 KDVAEGIDPSIKQQPVEILGTVQGRSAAAKHQDGATDNEAGDIVAVRQGNVFGTSFHPEL 249

Query: 205 TNDDRIHKYFV 215
           T D RIH +++
Sbjct: 250 TGDARIHAWWL 260



>gi|383762497|ref|YP_005441479.1| putative glutamine amidotransferase subunit PdxT [Caldilinea
           aerophila DSM 14535 = NBRC 104270]
 gi|504245718|ref|WP_014432820.1| glutamine amidotransferase [Caldilinea aerophila]
 gi|381382765|dbj|BAL99581.1| putative glutamine amidotransferase subunit PdxT [Caldilinea
           aerophila DSM 14535 = NBRC 104270]
          Length = 214

 Score =  193 bits (491), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 106/205 (51%), Positives = 133/205 (64%), Gaps = 10/205 (4%)

Query: 15  FKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERS 74
              GVLALQGAF EH  MLQ +      + +RK E L  +D LI+PGGESTTM L+AER 
Sbjct: 3   LTIGVLALQGAFIEHEAMLQRLG--VQTVEVRKPEHLVGLDGLILPGGESTTMGLVAERW 60

Query: 75  GLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSF 134
           GL+ PL+ +VR  KP WGTCAGMILLA  A   K GGQ LIGGLN+TV+RN FG Q +SF
Sbjct: 61  GLVAPLKAWVRAGKPIWGTCAGMILLAERAIGQKAGGQPLIGGLNVTVSRNYFGRQNESF 120

Query: 135 ESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGS 194
           E+ LH+  +    ++   A+FIRAP         VE LARL    GE     +VAV+Q +
Sbjct: 121 ETFLHVPRL---GEEPVRAVFIRAP-AIVEVGENVETLARLTGR-GE---EVVVAVQQAN 172

Query: 195 LLGTAFHPELTNDDRIHKYFVQLTQ 219
           +L TAFHPELT D R H+ F+++ +
Sbjct: 173 ILATAFHPELTQDLRWHQLFIEMVE 197



>gi|451850515|gb|EMD63817.1| hypothetical protein COCSADRAFT_331904 [Bipolaris sorokiniana
           ND90Pr]
          Length = 285

 Score =  192 bits (489), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 112/253 (44%), Positives = 145/253 (57%), Gaps = 55/253 (21%)

Query: 18  GVLALQGAFQEHIHMLQNI-SQVSSAIP-----IRKAEQLETIDALIIPGGESTTMALIA 71
           GVLALQGAF EHI +L++  S ++SA P     +R  EQLE  D LIIPGGESTTM+L+A
Sbjct: 13  GVLALQGAFSEHIQLLRSAASNIASAPPFQFIQVRTPEQLEQCDGLIIPGGESTTMSLVA 72

Query: 72  ERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQ 130
            RS L+EPLR FV+   KPTWGTCAG+ILLA  AN+ KKGGQ+LIGGL++ VNRN FG Q
Sbjct: 73  ARSNLLEPLRDFVKVQRKPTWGTCAGLILLAESANRTKKGGQELIGGLDVRVNRNHFGRQ 132

Query: 131 IDSFESLLHINHITTSSD----DLFPAIFIRAP-----------------------XXXX 163
            +SF++ L++  +  +SD    D +  +FIRAP                           
Sbjct: 133 QESFQANLNLPFLDATSDTGKSDPYRCVFIRAPVVEKVLPTSKAVGVQKDESEREDTVVA 192

Query: 164 XXXXXVEVLARLEHDI---------------------GETDASSIVAVRQGSLLGTAFHP 202
                V+ LAR E D                          A  I+AVRQG++ G +FHP
Sbjct: 193 PSKTPVDDLARKELDREVEIMATLSTNAKPLQDNQEHNHAGAEDIIAVRQGNVFGCSFHP 252

Query: 203 ELTNDDRIHKYFV 215
           ELT+D RIH +++
Sbjct: 253 ELTDDSRIHVWWL 265



>gi|408395714|gb|EKJ74890.1| hypothetical protein FPSE_04926 [Fusarium pseudograminearum CS3096]
          Length = 237

 Score =  192 bits (489), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 104/228 (45%), Positives = 146/228 (64%), Gaps = 30/228 (13%)

Query: 17  FGVLALQGAFQEHIHMLQNISQVSSA-----------IPIRKAEQLETIDALIIPGGEST 65
            GVLALQG F EHI +++  ++  S+           I +R  EQLE   ALIIPGGEST
Sbjct: 6   IGVLALQGGFSEHIDLVRKAAESISSTENISKNKIQCIEVRTKEQLEQCSALIIPGGEST 65

Query: 66  TMALIAERSGLMEPLRKFVRDEK-PTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNR 124
           T++ +A +SGL+EPLR FV+ +K P WGTCAG+ILL++EAN  KKGGQ+LIGGL + V+R
Sbjct: 66  TISFVAAQSGLLEPLRDFVKVQKRPVWGTCAGLILLSDEANATKKGGQELIGGLAVRVHR 125

Query: 125 NQFGSQIDSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXX-----VEVLARLEHDI 179
           N FG Q +SFE+ +++  +  + +  +P +FIRAP              VEVLA+L   +
Sbjct: 126 NHFGRQTESFEAGMNLPFL--NDEKPYPGVFIRAPVVEQVIGASDDRQPVEVLAKLPGRV 183

Query: 180 GET-----------DASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
            +            D+  IVAVRQ ++LGT+FHPELT D+RIH ++++
Sbjct: 184 DKMKSGVSQANTKDDSGDIVAVRQENVLGTSFHPELTKDERIHVWWLK 231



>gi|449529939|ref|XP_004171955.1| PREDICTED: pyridoxal biosynthesis protein PDX2-like [Cucumis
           sativus]
          Length = 250

 Score =  192 bits (487), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 138/220 (62%), Gaps = 20/220 (9%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG+F EHI  L+ +      + IRK EQL  + +LIIPGGESTTMA +AE   L 
Sbjct: 5   GVLALQGSFNEHIAALRRLG--VKGVEIRKPEQLLNVASLIIPGGESTTMAKLAELHNLF 62

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             LR+FVR  KP WGTCAG+I LAN+A   K GGQ L+GGL+ TV+RN FGSQ+ SFES 
Sbjct: 63  PALREFVRMGKPVWGTCAGLIFLANKATGQKTGGQGLVGGLDCTVHRNFFGSQLQSFESE 122

Query: 138 LHINHITTS--SDDLFPAIFIRAPXXXXXXXXXVEVLARLE---------HDIGE----- 181
           L I  + +S    + F  +FIRAP         V+VLAR              GE     
Sbjct: 123 LSIPELVSSEGGPETFRGVFIRAP-AILDAGPEVQVLARCPVSSNSNLHSSSSGEGKKEK 181

Query: 182 -TDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQD 220
            +++  IVAVRQG+LL TAFHPELT+D+R H YF+++  D
Sbjct: 182 DSESKVIVAVRQGNLLATAFHPELTSDNRWHSYFLKMAGD 221



>gi|322694635|gb|EFY86459.1| pyridoxine [Metarhizium acridum CQMa 102]
          Length = 228

 Score =  192 bits (487), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 103/221 (46%), Positives = 143/221 (64%), Gaps = 20/221 (9%)

Query: 15  FKFGVLALQGAFQEHIHMLQNISQV----SSAIPIRKAEQLETIDALIIPGGESTTMALI 70
              GVLALQG F EHI++++  ++      S I +R A++L   D LIIPGGESTT++L+
Sbjct: 4   LTIGVLALQGGFIEHINLVRKAAEQLKLHVSVIEVRTAQELARCDGLIIPGGESTTISLV 63

Query: 71  AERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGS 129
           A +SGL+EPLR +V+  +KP WGTCAG+ILL+++AN  K+GGQ+LIGGL + V+RN FG 
Sbjct: 64  AAQSGLLEPLRDYVKVQKKPVWGTCAGLILLSDQANATKEGGQELIGGLGVRVHRNHFGR 123

Query: 130 QIDSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXX---VEVLARLEHDIGETDA-- 184
           Q +SFES L +  +   +   FP +FIRAP            VEVLA+L   +    A  
Sbjct: 124 QTESFESDLDLAFLGDGAAP-FPGVFIRAPVVEEVLEGSGDGVEVLAKLPGRLDRMKAGV 182

Query: 185 ---------SSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
                      I+AVRQG++LGT+FHPELT D RIH ++++
Sbjct: 183 SQAKTKDGSGDIIAVRQGNVLGTSFHPELTADARIHAWWLR 223



>gi|449455996|ref|XP_004145736.1| PREDICTED: pyridoxal biosynthesis protein PDX2-like [Cucumis
           sativus]
          Length = 250

 Score =  192 bits (487), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 110/220 (50%), Positives = 138/220 (62%), Gaps = 20/220 (9%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG+F EHI  L+ +      + IRK EQL  + +LIIPGGESTTMA +AE   L 
Sbjct: 5   GVLALQGSFNEHIAALRRLG--VKGVEIRKPEQLLNVASLIIPGGESTTMAKLAELHNLF 62

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             LR+FVR  KP WGTCAG+I LAN+A   K GGQ L+GGL+ TV+RN FGSQ+ SFES 
Sbjct: 63  PALREFVRMGKPVWGTCAGLIFLANKATGQKTGGQGLVGGLDCTVHRNFFGSQLQSFESE 122

Query: 138 LHINHITTS--SDDLFPAIFIRAPXXXXXXXXXVEVLARLE---------HDIGE----- 181
           L I  + +S    + F  +FIRAP         V+VLAR              GE     
Sbjct: 123 LSIPELVSSEGGPETFRGVFIRAP-AILDVGPEVQVLARCPVSSNSNLHSSSSGEGKKEK 181

Query: 182 -TDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQD 220
            +++  IVAVRQG+LL TAFHPELT+D+R H YF+++  D
Sbjct: 182 DSESKVIVAVRQGNLLATAFHPELTSDNRWHSYFLKMAGD 221



>gi|255935631|ref|XP_002558842.1| Pc13g04060 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211583462|emb|CAP91475.1| Pc13g04060 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 267

 Score =  191 bits (486), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 110/252 (43%), Positives = 147/252 (58%), Gaps = 51/252 (20%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSA-----IPIRKAEQLETIDALIIPGGESTTMALIAE 72
           GVLALQGAF EH+ +L+  ++ +       I +R  ++L T D L++PGGESTTM+L+A 
Sbjct: 6   GVLALQGAFFEHVQLLKKAAEQAQPSEWHFIEVRTPQELATCDGLVLPGGESTTMSLVAA 65

Query: 73  RSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQI 131
           RS L+EPLR+FV+ D KPTWGTCAG+ILLA  ANK KKGGQ+LIGGL++ VNRN FG Q 
Sbjct: 66  RSNLLEPLREFVKVDRKPTWGTCAGLILLAESANKTKKGGQELIGGLDVRVNRNHFGRQT 125

Query: 132 DSFESLLHINHITTSSDDLFPAIFIRAP-------------------------------- 159
           +SF+  L +  +   +   FPA+FIRAP                                
Sbjct: 126 ESFQGPLDLPFLGQDAPP-FPAVFIRAPIVEKILPHHEGIQAEEIQQEDVVVAPSREARD 184

Query: 160 -XXXXXXXXXVEVLARL-----EH-----DIG-ETDASSIVAVRQGSLLGTAFHPELTND 207
                     VEVLA L     +H     D+  + +   IVAVRQG++ GT+FHPELT D
Sbjct: 185 SVAQAATAEHVEVLATLVGPAAQHATEGRDVNPDQEVGDIVAVRQGNVFGTSFHPELTGD 244

Query: 208 DRIHKYFVQLTQ 219
            RIH ++++  Q
Sbjct: 245 ARIHAWWLREVQ 256



>gi|258574203|ref|XP_002541283.1| glutamine amidotransferase subunit pdxT [Uncinocarpus reesii 1704]
 gi|237901549|gb|EEP75950.1| glutamine amidotransferase subunit pdxT [Uncinocarpus reesii 1704]
          Length = 283

 Score =  191 bits (486), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 114/261 (43%), Positives = 149/261 (57%), Gaps = 59/261 (22%)

Query: 18  GVLALQGAFQEHIHMLQNIS--------QVSSAIPIRKAEQLETIDALIIPGGESTTMAL 69
           GVLALQGAF EH+ +LQ  S        Q  S + +R   QLE+ DALIIPGGEST +AL
Sbjct: 6   GVLALQGAFAEHLKLLQAASRSLVAKQPQTWSFLEVRTQAQLESCDALIIPGGESTAIAL 65

Query: 70  IAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFG 128
           +A RS L+EPLR FV+   KPTWGTCAG+ILLA  AN+ K+GGQ+LIGGL++ VNRN FG
Sbjct: 66  VAARSNLLEPLRDFVKVHRKPTWGTCAGLILLAESANRTKQGGQELIGGLDVRVNRNHFG 125

Query: 129 SQIDSFESLLHINHITTSSDDLFP-----AIFIRAP------------------------ 159
            Q +SF++ L +  + +S D++ P      +FIRAP                        
Sbjct: 126 RQTESFQAGLELPFL-SSVDNIEPPQPFQGVFIRAPVVEKVLPHSDSIQSGEQKKEDTVI 184

Query: 160 ---------XXXXXXXXXVEVLARLEH----------DI-GETDASSIVAVRQGSLLGTA 199
                             V+VLA+L            D+  + DA  IVAVRQG++ GT+
Sbjct: 185 APSRQPENIVAQKAMSDHVDVLAKLPGRAARLANRGLDVAADPDAGDIVAVRQGNVFGTS 244

Query: 200 FHPELTNDDRIHKYFVQLTQD 220
           FHPELT D RIH +++Q  Q+
Sbjct: 245 FHPELTEDPRIHMWWLQQVQE 265



>gi|477529453|gb|ENH81215.1| pyridoxine [Colletotrichum orbiculare MAFF 240422]
          Length = 253

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 105/240 (43%), Positives = 143/240 (59%), Gaps = 36/240 (15%)

Query: 13  PQFKFGVLALQGAFQEHIHMLQNISQVS------------SAIPIRKAEQLETIDALIIP 60
           P    GVLALQG FQEH+ +++  +               +AI +R  E+L   DALIIP
Sbjct: 2   PAVTVGVLALQGGFQEHVQLVRKAAAALAKAPTLTTTPEITAIEVRTEEELRRCDALIIP 61

Query: 61  GGESTTMALIAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLN 119
           GGESTT++L+A +SG+MEPL++FV+   KP WGTCAG ILLA+EAN  KKGGQ+LIGGL 
Sbjct: 62  GGESTTISLVATQSGVMEPLKEFVKIKRKPVWGTCAGAILLADEANATKKGGQELIGGLG 121

Query: 120 ITVNRNQFGSQIDSFESLLHINHI------TTSSDDLFPAIFIRAPXXXX-------XXX 166
           + V+RN FG QI+SF + L +  +      + ++D  +P +FIRAP              
Sbjct: 122 VRVHRNHFGRQIESFVADLKLPFLSRGDGASKAADTPYPGVFIRAPVVEAILSEDPKQPA 181

Query: 167 XXVEVLARL----------EHDIGETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
             VEVLA L               +     IVAVRQG++  T+FHPELT+D RIH ++++
Sbjct: 182 ASVEVLAVLPGRKTMVEGVSQSTADDATGDIVAVRQGNIFATSFHPELTDDIRIHVWWLE 241



>gi|346325709|gb|EGX95306.1| pyridoxine [Cordyceps militaris CM01]
          Length = 236

 Score =  191 bits (485), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 101/222 (45%), Positives = 142/222 (63%), Gaps = 23/222 (10%)

Query: 18  GVLALQGAFQEHIHMLQNIS-QVSSAIP-------IRKAEQLETIDALIIPGGESTTMAL 69
           GVLALQG F EHI +++  + Q++ + P       +R   +L   DALIIPGGESTT++ 
Sbjct: 9   GVLALQGGFAEHIVLVRKAAAQLADSFPTAIEAIEVRTPAELARCDALIIPGGESTTISF 68

Query: 70  IAERSGLMEPLRKFVRD-EKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFG 128
           +A +SGL+EPLR+FV+  +KPTWGTCAG+ILL+ +AN  K+GGQ LIGGL++ V+RN FG
Sbjct: 69  VAAQSGLLEPLREFVKVLKKPTWGTCAGLILLSEQANATKQGGQALIGGLDVRVHRNHFG 128

Query: 129 SQIDSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGET------ 182
            Q +SF + L +  +  ++   F  +FIRAP         V V+A L   + +       
Sbjct: 129 RQTESFAAPLDLPFLPDAAARPFEGVFIRAPVVEAVLDGAVTVVATLPDRVNKVRPRAGV 188

Query: 183 --------DASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
                   +A  IVAVRQG++LGT+FHPELT D R+H +F+Q
Sbjct: 189 VSEARVTDNAGDIVAVRQGNVLGTSFHPELTPDARMHAWFLQ 230



>gi|302848806|ref|XP_002955934.1| hypothetical protein VOLCADRAFT_66485 [Volvox carteri f.
           nagariensis]
 gi|300258660|gb|EFJ42894.1| hypothetical protein VOLCADRAFT_66485 [Volvox carteri f.
           nagariensis]
          Length = 202

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 132/202 (65%), Gaps = 8/202 (3%)

Query: 14  QFKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAER 73
           + + GVLALQG+F+EH+ +LQ I  V  A+ +R  E+LE++  LIIPGGESTTMAL+AER
Sbjct: 2   RIRIGVLALQGSFREHMFLLQKIPGVE-AVEVRTKEELESVAGLIIPGGESTTMALVAER 60

Query: 74  SGLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDS 133
            GL+  L+ F +  KP WGTCAGMI LA  A   KKGGQ L+GGL+ITV+RN FG+QI+S
Sbjct: 61  WGLLPELQSFAKAGKPVWGTCAGMIFLAEAAEGQKKGGQALLGGLDITVSRNFFGAQINS 120

Query: 134 FESLLHINHITTS--SDDLFPAIFIRAPXXXXXXXXXVEVLARL----EHDIGETDASSI 187
           FE+ L       S  S + F A+FIRAP         VEVLA      E  +       I
Sbjct: 121 FETRLPAPDCIKSYGSTEDFRAVFIRAP-AVLSAGPEVEVLAEYTLMPEEAVAYGRDKVI 179

Query: 188 VAVRQGSLLGTAFHPELTNDDR 209
           VAVR+G L+ TAFHPELT D R
Sbjct: 180 VAVRKGVLMATAFHPELTTDLR 201



>gi|225435289|ref|XP_002285095.1| PREDICTED: pyridoxal biosynthesis protein PDX2-like [Vitis
           vinifera]
          Length = 252

 Score =  191 bits (484), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 107/221 (48%), Positives = 136/221 (61%), Gaps = 21/221 (9%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG+F EHI  L+ +      + IRK EQLE + +LIIPGGESTTMA +AE   L 
Sbjct: 4   GVLALQGSFNEHIAALRKLG--VKGVEIRKPEQLEQVGSLIIPGGESTTMAKLAEYHNLF 61

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             LR+FV+  KP WGTCAG+I LAN+A   K GGQ+L+GGL+ TV+RN FGSQI SFE+ 
Sbjct: 62  PALREFVKLGKPVWGTCAGLIFLANKAVGQKTGGQELVGGLDCTVHRNFFGSQIQSFETQ 121

Query: 138 LHINHITT--SSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGE-------------- 181
           L +  +       + F  +FIRAP         VEVLA      G+              
Sbjct: 122 LSVPELAAKEGGPETFRGVFIRAP-AILEVGPKVEVLADYPVPSGKLFDSISALEAPQEN 180

Query: 182 --TDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQD 220
             ++   IVAV+QG+LLGTAFHPELT D R H YF+++T +
Sbjct: 181 AGSEKKVIVAVKQGNLLGTAFHPELTADTRWHSYFLKMTSE 221



>gi|302893925|ref|XP_003045843.1| hypothetical protein NECHADRAFT_32830 [Nectria haematococca mpVI
           77-13-4]
 gi|256726770|gb|EEU40130.1| hypothetical protein NECHADRAFT_32830 [Nectria haematococca mpVI
           77-13-4]
          Length = 238

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 104/229 (45%), Positives = 143/229 (62%), Gaps = 31/229 (13%)

Query: 17  FGVLALQGAFQEHIHMLQNISQVSSA-----------IPIRKAEQLETIDALIIPGGEST 65
            GVLALQG F EH+ ++   ++  S+           I +R  EQL   + LIIPGGEST
Sbjct: 6   IGVLALQGGFSEHVDLVHKAAEYLSSTDGISKTKFNCIEVRTEEQLAQCNGLIIPGGEST 65

Query: 66  TMALIAERSGLMEPLRKFVRDEK-PTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNR 124
           T++ +A +SGL+EPLR FV+ +K P WGTCAG+ILL++EAN  KKGGQ+LIGGL + V+R
Sbjct: 66  TISFVAAQSGLLEPLRHFVKVQKRPVWGTCAGLILLSDEANATKKGGQELIGGLAVRVHR 125

Query: 125 NQFGSQIDSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXX------VEVLARLEHD 178
           N FG QI+SFES L +  +     + FP +FIRAP               V+VLA+L   
Sbjct: 126 NHFGRQIESFESGLDLPFL--QDGEPFPGVFIRAPVVEEIISTSQDERPPVQVLAKLPGR 183

Query: 179 IGET-----------DASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
           + +            D+  I+AVRQG++LGT+FHPELT D RIH ++++
Sbjct: 184 VDKMKPGLSQANTKDDSGDIIAVRQGNVLGTSFHPELTKDARIHVWWLR 232



>gi|320033669|gb|EFW15616.1| pyridoxine [Coccidioides posadasii str. Silveira]
          Length = 277

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 112/257 (43%), Positives = 153/257 (59%), Gaps = 59/257 (22%)

Query: 18  GVLALQGAFQEHIHMLQNISQ-VSSAIP-------IRKAEQLETIDALIIPGGESTTMAL 69
           GVLALQGAF EH+ +LQ  ++ +++++P       +R   QLE+ DALIIPGGEST +AL
Sbjct: 6   GVLALQGAFIEHLKLLQEAAKRLAASVPQSWNFVEVRTPSQLESCDALIIPGGESTAIAL 65

Query: 70  IAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFG 128
           +A RS L+EPLR+FV+   KPTWGTCAG+ILLA  AN+ K+GGQ+LIGGL++ VNRN FG
Sbjct: 66  VAARSNLLEPLREFVKIRRKPTWGTCAGLILLAESANRTKQGGQELIGGLDVRVNRNHFG 125

Query: 129 SQIDSFESLLHINHITTSSDDL-----FPAIFIRAPXXXX-------------------- 163
            Q +SF++ L +  + +S DD+     F  +FIRAP                        
Sbjct: 126 RQTESFQASLDLPFL-SSLDDIELPQPFQGVFIRAPVVEKILTCGDSIQAEKQRKDGTVI 184

Query: 164 -------------XXXXXVEVLARLE------HDIG-----ETDASSIVAVRQGSLLGTA 199
                             V+VLA+L        D G     ++DA  IVAVRQG++ GT+
Sbjct: 185 APSPHPESLVAQGAMSDHVDVLAKLPGRAARLADRGVDVTTDSDAGDIVAVRQGNVFGTS 244

Query: 200 FHPELTNDDRIHKYFVQ 216
           FHPELT D RIH ++++
Sbjct: 245 FHPELTEDPRIHMWWLR 261



>gi|452000550|gb|EMD93011.1| hypothetical protein COCHEDRAFT_1154715 [Bipolaris maydis C5]
 gi|477587521|gb|ENI04602.1| hypothetical protein COCC4DRAFT_169827 [Bipolaris maydis ATCC
           48331]
          Length = 285

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 111/255 (43%), Positives = 145/255 (56%), Gaps = 59/255 (23%)

Query: 18  GVLALQGAFQEHIHMLQNI-SQVSSAIP-----IRKAEQLETIDALIIPGGESTTMALIA 71
           GVLALQGAF EHI +L++  S ++SA P     +R  EQLE  D LIIPGGESTTM+L+A
Sbjct: 13  GVLALQGAFSEHIQLLRSAASNIASAPPFQFIQVRTPEQLEQCDGLIIPGGESTTMSLVA 72

Query: 72  ERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQ 130
            RS L+EPLR FV+   KPTWGTCAG+ILLA  AN+ KKGGQ+LIGGL++ VNRN FG Q
Sbjct: 73  ARSNLLEPLRDFVKVQRKPTWGTCAGLILLAESANRTKKGGQELIGGLDVRVNRNHFGRQ 132

Query: 131 IDSFESLLHINHI----TTSSDDLFPAIFIRAPXXXXXXXXX------------------ 168
            +SF++ L++  +    +T   D +  +FIRAP                           
Sbjct: 133 QESFQANLNLPFLDATSSTGKSDPYRCVFIRAPVVEKVLPTSKAVGIQKSESEREDTVVA 192

Query: 169 -----------------VEVLARL-----------EHDIGETDASSIVAVRQGSLLGTAF 200
                            VE++A L           EH+     A  I+AVRQG++ G +F
Sbjct: 193 PSKTPVDDLARKELDREVEIMATLSTNAKPLQDNQEHN--HVGAEDIIAVRQGNVFGCSF 250

Query: 201 HPELTNDDRIHKYFV 215
           HPELT D RIH +++
Sbjct: 251 HPELTEDSRIHVWWL 265



>gi|303312475|ref|XP_003066249.1| glutamine amidotransferase, SNO family protein [Coccidioides
           posadasii C735 delta SOWgp]
 gi|240105911|gb|EER24104.1| glutamine amidotransferase, SNO family protein [Coccidioides
           posadasii C735 delta SOWgp]
          Length = 277

 Score =  190 bits (483), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 112/257 (43%), Positives = 153/257 (59%), Gaps = 59/257 (22%)

Query: 18  GVLALQGAFQEHIHMLQNISQ-VSSAIP-------IRKAEQLETIDALIIPGGESTTMAL 69
           GVLALQGAF EH+ +LQ  ++ +++++P       +R   QLE+ DALIIPGGEST +AL
Sbjct: 6   GVLALQGAFIEHLKLLQEAAKRLAASVPQSWNFVEVRTPSQLESCDALIIPGGESTAIAL 65

Query: 70  IAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFG 128
           +A RS L+EPLR+FV+   KPTWGTCAG+ILLA  AN+ K+GGQ+LIGGL++ VNRN FG
Sbjct: 66  VAARSNLLEPLREFVKIRRKPTWGTCAGLILLAESANRTKQGGQELIGGLDVRVNRNHFG 125

Query: 129 SQIDSFESLLHINHITTSSDDL-----FPAIFIRAPXXXX-------------------- 163
            Q +SF++ L +  + +S DD+     F  +FIRAP                        
Sbjct: 126 RQTESFQASLDLPFL-SSLDDIELPQPFQGVFIRAPVVEKILTCGDSIQAEKQRKDGTVI 184

Query: 164 -------------XXXXXVEVLARLE------HDIG-----ETDASSIVAVRQGSLLGTA 199
                             V+VLA+L        D G     ++DA  IVAVRQG++ GT+
Sbjct: 185 APSRHPESLVAQGAMSDHVDVLAKLPGRAARLADRGVDVTTDSDAGDIVAVRQGNVFGTS 244

Query: 200 FHPELTNDDRIHKYFVQ 216
           FHPELT D RIH ++++
Sbjct: 245 FHPELTEDPRIHMWWLR 261



>gi|358369813|dbj|GAA86426.1| pyridoxine [Aspergillus kawachii IFO 4308]
          Length = 275

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 110/259 (42%), Positives = 148/259 (57%), Gaps = 57/259 (22%)

Query: 18  GVLALQGAFQEHIHMLQNIS------QVSSA-----IPIRKAEQLETIDALIIPGGESTT 66
           GVLALQGAF EHI +L++ +        SSA     I +R  ++LE  DAL++PGGESTT
Sbjct: 7   GVLALQGAFYEHIQLLKSAAADLPAKDRSSASQWDFIEVRTPQELERCDALVLPGGESTT 66

Query: 67  MALIAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRN 125
           MAL+A RS L+EPLR FV+   +PTWGTCAG+ILLA  AN+ KKGGQDLIGGL++ VNRN
Sbjct: 67  MALVAARSNLLEPLRDFVKVHRRPTWGTCAGLILLAESANRTKKGGQDLIGGLDVRVNRN 126

Query: 126 QFGSQIDSFESLLHINHITTSSDDLFPAIFIRAP-------------------------- 159
            FG Q +SF++ L +  +  ++   FPA+FIRAP                          
Sbjct: 127 HFGRQTESFQAPLDLPFL-GANQPAFPAVFIRAPVVEKILPHQEGEQVAEAQREETVIAP 185

Query: 160 -------XXXXXXXXXVEVLARLEHDI-----------GETDASSIVAVRQGSLLGTAFH 201
                           VEVLA L                + +   I+AVRQG++ GT+FH
Sbjct: 186 ARQAEDEVARQAMADSVEVLAALPGRAARLACQGTPINADDETGDIIAVRQGNVFGTSFH 245

Query: 202 PELTNDDRIHKYFVQLTQD 220
           PELT+D RIH ++++  ++
Sbjct: 246 PELTDDARIHAWWLRQVEE 264



>gi|119192918|ref|XP_001247065.1| hypothetical protein CIMG_00836 [Coccidioides immitis RS]
 gi|392863700|gb|EAS35531.2| pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2
           [Coccidioides immitis RS]
          Length = 277

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 112/257 (43%), Positives = 153/257 (59%), Gaps = 59/257 (22%)

Query: 18  GVLALQGAFQEHIHMLQNISQ-VSSAIP-------IRKAEQLETIDALIIPGGESTTMAL 69
           GVLALQGAF EH+ +LQ  ++ +++++P       +R   QLE+ DALIIPGGEST +AL
Sbjct: 6   GVLALQGAFIEHLKLLQEAAKRLAASVPQSWNFVEVRTPSQLESCDALIIPGGESTAIAL 65

Query: 70  IAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFG 128
           +A RS L+EPLR+FV+   KPTWGTCAG+ILLA  AN+ K+GGQ+LIGGL++ VNRN FG
Sbjct: 66  VAARSNLLEPLREFVKIRRKPTWGTCAGLILLAESANRTKQGGQELIGGLDVRVNRNHFG 125

Query: 129 SQIDSFESLLHINHITTSSDDL-----FPAIFIRAPXXXX-------------------- 163
            Q +SF++ L +  + +S DD+     F  +FIRAP                        
Sbjct: 126 RQTESFQASLDLPFL-SSLDDIELPQPFQGVFIRAPVVEKILTCGDSIQAEKQRKDGTVI 184

Query: 164 -------------XXXXXVEVLARLE------HDIG-----ETDASSIVAVRQGSLLGTA 199
                             V+VLA+L        D G     ++DA  IVAVRQG++ GT+
Sbjct: 185 APSRHPESVVAQGAMSDHVDVLAKLPGRAARLADRGVDVTTDSDAGDIVAVRQGNVFGTS 244

Query: 200 FHPELTNDDRIHKYFVQ 216
           FHPELT D RIH ++++
Sbjct: 245 FHPELTEDPRIHMWWLR 261



>gi|46399273|gb|AAS92257.1| putative pyridoxine biosynthesis protein [Nicotiana tabacum]
          Length = 251

 Score =  190 bits (482), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 134/218 (61%), Gaps = 21/218 (9%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG+F EHI  L+ +      + +RK EQL+ + +LIIPGGESTTMA +AE   L 
Sbjct: 4   GVLALQGSFNEHIAALKRLG--VKGVEVRKPEQLQNVSSLIIPGGESTTMAKLAELHNLF 61

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             LR+FV+  KP WGTCAG+I LAN+A   K GGQ+LIGGL+ TV+RN FGSQI SFE+ 
Sbjct: 62  PALREFVQLGKPVWGTCAGLIFLANKATGQKTGGQELIGGLDCTVHRNFFGSQIQSFETE 121

Query: 138 LHINHITTS--SDDLFPAIFIRAPXXXXXXXXXVEVLARL----------------EHDI 179
           L I  I         F A+FIRAP         VEVLA +                E D 
Sbjct: 122 LPIPQIVAKEGGPPSFRAVFIRAP-AILDVGPDVEVLADIPLSAVETINSNHAIQKEEDS 180

Query: 180 GETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQL 217
            E+    IVAV+QG+LL TAFHPELT D R H YF+++
Sbjct: 181 TESQKKVIVAVKQGNLLATAFHPELTADTRWHSYFLKM 218



>gi|145246438|ref|XP_001395468.1| pyridoxine [Aspergillus niger CBS 513.88]
 gi|134080184|emb|CAK46164.1| unnamed protein product [Aspergillus niger]
 gi|350636822|gb|EHA25180.1| hypothetical protein ASPNIDRAFT_54027 [Aspergillus niger ATCC 1015]
          Length = 275

 Score =  190 bits (482), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 110/259 (42%), Positives = 148/259 (57%), Gaps = 57/259 (22%)

Query: 18  GVLALQGAFQEHIHMLQNIS------QVSSA-----IPIRKAEQLETIDALIIPGGESTT 66
           GVLALQGAF EHI +L++ +        SSA     I +R  ++LE  DAL++PGGESTT
Sbjct: 7   GVLALQGAFYEHIQLLKSAAADLPAKDRSSASQWDFIEVRTPQELERCDALVLPGGESTT 66

Query: 67  MALIAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRN 125
           MAL+A RS L+EPLR FV+   +PTWGTCAG+ILLA  AN+ KKGGQDLIGGL++ VNRN
Sbjct: 67  MALVAARSNLLEPLRDFVKVHRRPTWGTCAGLILLAESANRTKKGGQDLIGGLDVRVNRN 126

Query: 126 QFGSQIDSFESLLHINHITTSSDDLFPAIFIRAP-------------------------- 159
            FG Q +SF++ L +  +  ++   FPA+FIRAP                          
Sbjct: 127 HFGRQTESFQAPLDLPFL-GANQPAFPAVFIRAPVVEKILPHQEGEQVGEAQREETVIAP 185

Query: 160 -------XXXXXXXXXVEVLARLEHDI-----------GETDASSIVAVRQGSLLGTAFH 201
                           VEVLA L                + +   I+AVRQG++ GT+FH
Sbjct: 186 ARQAEDEVARQAMADSVEVLAALPGRAARLACEGTPINADDETGDIIAVRQGNVFGTSFH 245

Query: 202 PELTNDDRIHKYFVQLTQD 220
           PELT+D RIH ++++  ++
Sbjct: 246 PELTDDARIHAWWLRQVEE 264



>gi|402077635|gb|EJT72984.1| glutamine amidotransferase subunit pdxT [Gaeumannomyces graminis
           var. tritici R3-111a-1]
          Length = 242

 Score =  190 bits (482), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 106/225 (47%), Positives = 140/225 (62%), Gaps = 27/225 (12%)

Query: 18  GVLALQGAFQEHIHMLQ----NISQVSSA---IPIRKAEQLETIDALIIPGGESTTMALI 70
           GVLALQGAF EH+ +L+     I+  S A   I +R  EQL   DAL+IPGGESTT+A +
Sbjct: 10  GVLALQGAFAEHLTLLRRAGATIAGESPAFEFIEVRTPEQLARCDALVIPGGESTTLAFV 69

Query: 71  AERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGS 129
           A+++ LMEPLR+FV+ D KP WGTCAG+ILLA+EA   KKGGQ+L+GGL+I  +RN FG 
Sbjct: 70  AKQTNLMEPLRQFVKVDSKPIWGTCAGLILLADEATGAKKGGQELVGGLHIRAHRNHFGR 129

Query: 130 QIDSFESLLHINHITTSSDDL------------FPAIFIRAPXXXX------XXXXXVEV 171
           Q+ SF++ L +  +     D             FP +FIRAP               VEV
Sbjct: 130 QVHSFQAGLDLTFLADLQQDGGGGGKEAVASGPFPGVFIRAPVVEKILAGDGAAGPHVEV 189

Query: 172 LARLEHDIGETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
           L  +    GE     IVAVRQG++  T+FHPELT+D R+H +++Q
Sbjct: 190 LGSVSRG-GEGGEEDIVAVRQGNIFATSFHPELTDDVRVHLWWLQ 233



>gi|121698321|ref|XP_001267783.1| pyridoxine [Aspergillus clavatus NRRL 1]
 gi|119395925|gb|EAW06357.1| pyridoxine [Aspergillus clavatus NRRL 1]
          Length = 272

 Score =  189 bits (480), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 110/265 (41%), Positives = 147/265 (55%), Gaps = 57/265 (21%)

Query: 18  GVLALQGAFQEHIHMLQNIS------QVSSA-----IPIRKAEQLETIDALIIPGGESTT 66
           GVLALQGAF EHI +L+  +      Q  SA     I +R  ++LE  DAL++PGGEST 
Sbjct: 7   GVLALQGAFYEHIQLLKQAAASLPTVQSPSASQWEFIEVRTPQELERCDALVLPGGESTA 66

Query: 67  MALIAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRN 125
           ++L+A RS ++EPLR FV+   KPTWGTCAG+ILLA  AN+ KKGGQDLIGGL++ VNRN
Sbjct: 67  ISLVAARSNVLEPLRDFVKVHRKPTWGTCAGLILLAESANRTKKGGQDLIGGLDVRVNRN 126

Query: 126 QFGSQIDSFESLLHINHITTSSDDLFPAIFIRAP-------------------------- 159
            FG Q +SFE+ L +  +  + +  FPA+FIRAP                          
Sbjct: 127 HFGRQTESFEAPLDLPFL-GAGEQPFPAVFIRAPVVEKILPHQEGVQVSETQRDDTVVAP 185

Query: 160 -------XXXXXXXXXVEVLARLEHDI-----------GETDASSIVAVRQGSLLGTAFH 201
                           VEVLA L                + +A  IVAV+QG++ GT+FH
Sbjct: 186 SRQPEDHAAKAAMANEVEVLASLPGRAAKLAALVSNIDADKEAGDIVAVKQGNVFGTSFH 245

Query: 202 PELTNDDRIHKYFVQLTQDHYNTGK 226
           PELT D RIH ++++  ++     K
Sbjct: 246 PELTGDARIHSWWLRQVEESVKQRK 270



>gi|67539942|ref|XP_663745.1| hypothetical protein AN6141.2 [Aspergillus nidulans FGSC A4]
 gi|13937025|gb|AAK50016.1|AF363613_1 pyridoxine [Emericella nidulans]
 gi|40738737|gb|EAA57927.1| hypothetical protein AN6141.2 [Aspergillus nidulans FGSC A4]
 gi|259479667|tpe|CBF70100.1| TPA: Putative uncharacterized proteinPyridoxine ;
           [Source:UniProtKB/TrEMBL;Acc:Q96X05] [Aspergillus
           nidulans FGSC A4]
          Length = 271

 Score =  189 bits (480), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 110/263 (41%), Positives = 148/263 (56%), Gaps = 56/263 (21%)

Query: 14  QFKFGVLALQGAFQEHIHMLQNI-----SQVSSA----IPIRKAEQLETIDALIIPGGES 64
           +   GVLALQGAF EH+ +L+       SQ SS     + IR  ++L+  DAL++PGGES
Sbjct: 3   KITVGVLALQGAFLEHLELLKKAAASLGSQQSSPQWEFLEIRTPQELKRCDALVLPGGES 62

Query: 65  TTMALIAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVN 123
           T ++L+A RS L+EPLR FV+   KPTWGTCAG+ILLA  AN+ KKGGQ+LIGGL++ VN
Sbjct: 63  TAISLVAARSNLLEPLRDFVKVHRKPTWGTCAGLILLAESANRTKKGGQELIGGLDVRVN 122

Query: 124 RNQFGSQIDSFESLLHINHITTSS--DDLFPAIFIRAP---------------------- 159
           RN FG Q +SF++ L +  ++TS      FPA+FIRAP                      
Sbjct: 123 RNHFGRQTESFQAPLDLPFLSTSGTPQQPFPAVFIRAPVVEKILPHHDGIQVDEAKRVET 182

Query: 160 -----------XXXXXXXXXVEVLARLEHDI-----------GETDASSIVAVRQGSLLG 197
                               VEVLA L                + +   IVAVRQG++ G
Sbjct: 183 VVAPSRQAESEASRRAMSRDVEVLASLPGRAAHLAVSGTPIRADEETGDIVAVRQGNVFG 242

Query: 198 TAFHPELTNDDRIHKYFVQLTQD 220
           T+FHPELT D+RIH ++++  +D
Sbjct: 243 TSFHPELTGDERIHAWWLRQVED 265



>gi|119480673|ref|XP_001260365.1| pyridoxine [Neosartorya fischeri NRRL 181]
 gi|119408519|gb|EAW18468.1| pyridoxine [Neosartorya fischeri NRRL 181]
          Length = 267

 Score =  189 bits (479), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 109/261 (41%), Positives = 146/261 (55%), Gaps = 52/261 (19%)

Query: 18  GVLALQGAFQEHIHML------QNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIA 71
           GVLALQGAF EHI +L      Q+ +     I +R  ++L+  DALI+PGGESTT++L+A
Sbjct: 7   GVLALQGAFYEHIQLLKKAVSEQSFTAQWEFIEVRTPQELDRCDALILPGGESTTISLVA 66

Query: 72  ERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQ 130
            RS L+EPLR FV+   KPTWGTCAG+ILLA  AN+ KKGGQ+LIGGL++ VNRN FG Q
Sbjct: 67  ARSNLLEPLRDFVKVHRKPTWGTCAGLILLAESANRTKKGGQELIGGLDVRVNRNHFGRQ 126

Query: 131 IDSFESLLHINHITTSSDDLFPAIFIRAP------------------------------- 159
            +SFE+ L +  +   ++  FPA+FIRAP                               
Sbjct: 127 TESFEAPLDLPFL-GPTEQSFPAVFIRAPVVEKILPHQQGIQVDETRRDETVVAPSKQPQ 185

Query: 160 --XXXXXXXXXVEVLARLEHDIGETDASS-----------IVAVRQGSLLGTAFHPELTN 206
                      VEVLA L     +  A+            IVAV+QG++ GT+FHPELT 
Sbjct: 186 DQAAKAAMADGVEVLASLPGRAAKLAAAGTRIDADKETGDIVAVKQGNVFGTSFHPELTG 245

Query: 207 DDRIHKYFVQLTQDHYNTGKG 227
           D RIH ++++  ++      G
Sbjct: 246 DARIHSWWLRQVEESVRKRNG 266



>gi|485924722|gb|EOD49464.1| putative pyridoxine protein [Neofusicoccum parvum UCRNP2]
          Length = 294

 Score =  189 bits (479), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 110/268 (41%), Positives = 151/268 (56%), Gaps = 65/268 (24%)

Query: 14  QFKFGVLALQGAFQEHIHMLQ------NISQVSSA-------IPIRKAEQLETIDALIIP 60
           Q   GVLALQGAF EHI +L+         +V+ A       I +R   +L T DALI+P
Sbjct: 11  QVTVGVLALQGAFSEHIQLLRLAIASLRARKVNDAAAVDWACIEVRTPAELATCDALILP 70

Query: 61  GGESTTMALIAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLN 119
           GGESTTM+L+AERSG++EPLR FV+   KPTWGTCAG+ILLA  AN+ KKGGQ+LIGGL+
Sbjct: 71  GGESTTMSLVAERSGMLEPLRDFVKVQRKPTWGTCAGLILLAESANRTKKGGQELIGGLD 130

Query: 120 ITVNRNQFGSQIDSFESLLHINHI-------TTSSDDLFPAIFIRAP------------- 159
           + V+RN FG Q +SF + L +  +       T +++  FP++FIRAP             
Sbjct: 131 VRVSRNHFGRQTESFTADLDLPFLRSAQGVETQTTEKPFPSVFIRAPVVEKLLQHTDGIQ 190

Query: 160 --------------------XXXXXXXXXVEVLARL---EHDIGETDASS--------IV 188
                                        VE +ARL      +G++  ++        I+
Sbjct: 191 AEEAAKEETIVAPSKVPKDDVARAAFDAHVETMARLPGRAKALGKSGVTASEEGEDGDII 250

Query: 189 AVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
           AVRQG++ GT+FHPELT D RIH ++++
Sbjct: 251 AVRQGNVFGTSFHPELTGDSRIHVWWLE 278



>gi|322711851|gb|EFZ03424.1| pyridoxine [Metarhizium anisopliae ARSEF 23]
          Length = 230

 Score =  188 bits (478), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 105/225 (46%), Positives = 141/225 (62%), Gaps = 26/225 (11%)

Query: 15  FKFGVLALQGAFQEHIHMLQNISQV----SSAIPIRKAEQLETIDALIIPGGESTTMALI 70
              GVLALQG F EHI++++  +       S I +R  ++L   D LIIPGGESTT++L+
Sbjct: 4   LTIGVLALQGGFIEHINLVRKAADRLKLHVSVIEVRTTQELARCDGLIIPGGESTTISLV 63

Query: 71  AERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGS 129
           A +SGL+EPLR +V+  +KP WGTCAG+ILL+++AN  KKGGQ+LIGGL + V+RN FG 
Sbjct: 64  AAQSGLLEPLRDYVKVQKKPVWGTCAGLILLSDQANATKKGGQELIGGLGVRVHRNHFGR 123

Query: 130 QIDSFESLLHINHITTSSDDL--FPAIFIRAPXXXXXXX-----XXVEVLARLEHDIGET 182
           Q +SFE+ L +  +    DD   FP +FIRAP              VEVLA L   +   
Sbjct: 124 QTESFEADLDLAFL---GDDAAPFPGVFIRAPVVEEVLAGPGSGVEVEVLATLPGRLDRA 180

Query: 183 DA-----------SSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
            A             IVAVRQG++LGT+FHPELT D RIH ++++
Sbjct: 181 AAGVSQANAKHGSGDIVAVRQGNVLGTSFHPELTGDARIHAWWLR 225



>gi|359806630|ref|NP_001241020.1| uncharacterized protein LOC100776337 [Glycine max]
 gi|255639403|gb|ACU19997.1| unknown [Glycine max]
          Length = 254

 Score =  188 bits (477), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 107/221 (48%), Positives = 136/221 (61%), Gaps = 21/221 (9%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG+F EHI  L+ +      + IRK EQL TI +LIIPGGESTTMA +AE   L 
Sbjct: 5   GVLALQGSFNEHIAALRRLG--VQGVEIRKPEQLNTISSLIIPGGESTTMAKLAEYHNLF 62

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             LR+FV+  KP WGTCAG+I LAN+A   K GGQ L+GGL+ TV+RN FGSQI SFE+ 
Sbjct: 63  PALREFVQMGKPVWGTCAGLIFLANKAIGQKTGGQYLVGGLDCTVHRNFFGSQIQSFEAE 122

Query: 138 LHINHITTS--SDDLFPAIFIRAPXXXXXXXXXVEVLARL----------------EHDI 179
           L +  + +     + F  IFIRAP         V+VLA                  + + 
Sbjct: 123 LSVPELVSKEGGPETFCGIFIRAP-AILEAGPEVQVLADYPVPSSRLLSSDSSIEDQTEN 181

Query: 180 GETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQD 220
            E ++  IVAVRQG++L TAFHPELT D R H YFV+++ +
Sbjct: 182 AEKESKVIVAVRQGNILATAFHPELTADTRWHSYFVKMSNE 222



>gi|317157669|ref|XP_001826418.2| pyridoxine [Aspergillus oryzae RIB40]
          Length = 293

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 106/260 (40%), Positives = 148/260 (56%), Gaps = 57/260 (21%)

Query: 18  GVLALQGAFQEHIHMLQ----NISQVSSAIP------IRKAEQLETIDALIIPGGESTTM 67
           GVLALQGAF EH+ +L+    N++  + A P      +R  ++L+  DALI+PGGESTT+
Sbjct: 6   GVLALQGAFYEHVQLLKQAAANLATETHASPKWEFIEVRTPQELDRCDALILPGGESTTI 65

Query: 68  ALIAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQ 126
           +L+A RS L+EPLR FV+   +PTWGTCAG+ILLA  AN+ KKGGQ+LIGGL++ VNRN 
Sbjct: 66  SLVAARSNLLEPLRDFVKVHRRPTWGTCAGLILLAESANRTKKGGQELIGGLDVRVNRNH 125

Query: 127 FGSQIDSFESLLHINHITTSSDDL--FPAIFIRAPXXXX--------------------- 163
           FG Q +SF++ L +  + +   D   FPA+FIRAP                         
Sbjct: 126 FGRQTESFQAPLDLPFLNSCGKDQPPFPAVFIRAPVVEKILPHEEGIQTSEVGRDETVVA 185

Query: 164 ------------XXXXXVEVLARLEHDI-----------GETDASSIVAVRQGSLLGTAF 200
                            VEVLA L                + +A  I+AV+QG++ GT+F
Sbjct: 186 PSKHVKDQAALDAMATQVEVLATLPGRAAKLASEGRNIDADKEAGDIIAVKQGNVFGTSF 245

Query: 201 HPELTNDDRIHKYFVQLTQD 220
           HPELT D RIH ++++  ++
Sbjct: 246 HPELTGDARIHSWWLRQVEE 265



>gi|212532791|ref|XP_002146552.1| pyridoxine [Talaromyces marneffei ATCC 18224]
 gi|210071916|gb|EEA26005.1| pyridoxine [Talaromyces marneffei ATCC 18224]
          Length = 280

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 113/277 (40%), Positives = 154/277 (55%), Gaps = 62/277 (22%)

Query: 13  PQFKFGVLALQGAFQEHIHMLQNISQVSSA-------------IPIRKAEQLETIDALII 59
           P+   GVLALQGAF EH+ +LQ  + + ++             I +R   QL+  DALII
Sbjct: 2   PKITVGVLALQGAFYEHLQLLQKAANILASSSSSSQGPCQWDFIEVRTKAQLDACDALII 61

Query: 60  PGGESTTMALIAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGL 118
           PGGESTT++L+A RS L+EPLR FV+   KPTWGTCAG+ILLA  AN+ KKGGQ+LIGG+
Sbjct: 62  PGGESTTISLVAARSNLLEPLRDFVKLHRKPTWGTCAGLILLAESANRTKKGGQELIGGI 121

Query: 119 NITVNRNQFGSQIDSFESLLHINHI--TTSSDDL-FPAIFIRAP---------------- 159
           ++ VNRN FG Q +SF++ L +  +  +TS ++L F  +FIRAP                
Sbjct: 122 DVRVNRNHFGRQTESFQAPLDLPFLQDSTSPENLPFNGVFIRAPVVEKILPHQKGIQIEE 181

Query: 160 -----------------XXXXXXXXXVEVL-------ARLEHDIG-----ETDASSIVAV 190
                                     VEVL       ARL  + G     E +A  I+AV
Sbjct: 182 DQREETVVAPSREVIDTAAQQVLEDEVEVLAILPGRAARLIANSGVNIDAEKEAGDIIAV 241

Query: 191 RQGSLLGTAFHPELTNDDRIHKYFVQLTQDHYNTGKG 227
           +QG++ GT+FHPELT+D RIH ++++   D      G
Sbjct: 242 KQGNVFGTSFHPELTDDPRIHLWWLRQVADAVQKRSG 278



>gi|345569053|gb|EGX51922.1| hypothetical protein AOL_s00043g656 [Arthrobotrys oligospora ATCC
           24927]
          Length = 276

 Score =  187 bits (476), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 113/262 (43%), Positives = 145/262 (55%), Gaps = 55/262 (20%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSA------IPIRKAEQLETIDALIIPGGESTTMALIA 71
           GVLALQGAF EH+ +L+  SQ   +      + IR  E L + DALI+PGGESTTM+L+A
Sbjct: 11  GVLALQGAFSEHLQLLKKASQALPSNITFRFLEIRTKEALSSCDALIVPGGESTTMSLVA 70

Query: 72  ERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQ 130
           ERSGL+EPLR+FV+   KP WGTCAGMILLA EAN+ KKGGQ+LIGGL++ V RN FGSQ
Sbjct: 71  ERSGLLEPLREFVKVYRKPVWGTCAGMILLAEEANRTKKGGQELIGGLDVRVKRNHFGSQ 130

Query: 131 IDSFESLLHINHITTSSDDLFPAIFIRAP------------------------------- 159
            +SF + L +  +   +   F   FIRAP                               
Sbjct: 131 TESFSTPLSLPFLGDPTP--FYGYFIRAPIVEHILPPTTPASSLENNTADTVTAPSKKPI 188

Query: 160 ---XXXXXXXXXVEVLARL--------EHD--IGETDASS--IVAVRQGSLLGTAFHPEL 204
                       V +L RL        E D  +G T  S   IVAV QG+  GT+FHPEL
Sbjct: 189 NDVAASFTSPDEVRILGRLTPSKLTTTEEDAKLGITSPSEGRIVAVEQGNCFGTSFHPEL 248

Query: 205 TNDDRIHKYFVQLTQDHYNTGK 226
            +D RIHK++++   +   T +
Sbjct: 249 GSDIRIHKWWLEKVVEKVETKR 270



>gi|238493739|ref|XP_002378106.1| pyridoxine [Aspergillus flavus NRRL3357]
 gi|220696600|gb|EED52942.1| pyridoxine [Aspergillus flavus NRRL3357]
          Length = 276

 Score =  187 bits (476), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 106/260 (40%), Positives = 148/260 (56%), Gaps = 57/260 (21%)

Query: 18  GVLALQGAFQEHIHMLQ----NISQVSSAIP------IRKAEQLETIDALIIPGGESTTM 67
           GVLALQGAF EH+ +L+    N++  + A P      +R  ++L+  DALI+PGGESTT+
Sbjct: 6   GVLALQGAFYEHVQLLKQAAANLATETHASPKWEFIEVRTPQELDRCDALILPGGESTTI 65

Query: 68  ALIAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQ 126
           +L+A RS L+EPLR FV+   +PTWGTCAG+ILLA  AN+ KKGGQ+LIGGL++ VNRN 
Sbjct: 66  SLVAARSNLLEPLRDFVKVHRRPTWGTCAGLILLAESANRTKKGGQELIGGLDVRVNRNH 125

Query: 127 FGSQIDSFESLLHINHITTSSDD--LFPAIFIRAPXXXX--------------------- 163
           FG Q +SF++ L +  + +   D   FPA+FIRAP                         
Sbjct: 126 FGRQTESFQAPLDLPFLNSCGKDQPPFPAVFIRAPVVEKILPHEEGIQTSEVGRDETVVA 185

Query: 164 ------------XXXXXVEVLARLEHDI-----------GETDASSIVAVRQGSLLGTAF 200
                            VEVLA L                + +A  I+AV+QG++ GT+F
Sbjct: 186 PSKHVKDQAALDAMATQVEVLATLPGRAAKLASEGRNIDADKEAGDIIAVKQGNVFGTSF 245

Query: 201 HPELTNDDRIHKYFVQLTQD 220
           HPELT D RIH ++++  ++
Sbjct: 246 HPELTGDARIHSWWLRQVEE 265



>gi|83775162|dbj|BAE65285.1| unnamed protein product [Aspergillus oryzae RIB40]
          Length = 336

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 106/260 (40%), Positives = 148/260 (56%), Gaps = 57/260 (21%)

Query: 18  GVLALQGAFQEHIHMLQ----NISQVSSAIP------IRKAEQLETIDALIIPGGESTTM 67
           GVLALQGAF EH+ +L+    N++  + A P      +R  ++L+  DALI+PGGESTT+
Sbjct: 6   GVLALQGAFYEHVQLLKQAAANLATETHASPKWEFIEVRTPQELDRCDALILPGGESTTI 65

Query: 68  ALIAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQ 126
           +L+A RS L+EPLR FV+   +PTWGTCAG+ILLA  AN+ KKGGQ+LIGGL++ VNRN 
Sbjct: 66  SLVAARSNLLEPLRDFVKVHRRPTWGTCAGLILLAESANRTKKGGQELIGGLDVRVNRNH 125

Query: 127 FGSQIDSFESLLHINHITTSSDD--LFPAIFIRAPXXXX--------------------- 163
           FG Q +SF++ L +  + +   D   FPA+FIRAP                         
Sbjct: 126 FGRQTESFQAPLDLPFLNSCGKDQPPFPAVFIRAPVVEKILPHEEGIQTSEVGRDETVVA 185

Query: 164 ------------XXXXXVEVLARLEHDI-----------GETDASSIVAVRQGSLLGTAF 200
                            VEVLA L                + +A  I+AV+QG++ GT+F
Sbjct: 186 PSKHVKDQAALDAMATQVEVLATLPGRAAKLASEGRNIDADKEAGDIIAVKQGNVFGTSF 245

Query: 201 HPELTNDDRIHKYFVQLTQD 220
           HPELT D RIH ++++  ++
Sbjct: 246 HPELTGDARIHSWWLRQVEE 265



>gi|159491116|ref|XP_001703519.1| predicted protein [Chlamydomonas reinhardtii]
 gi|158280443|gb|EDP06201.1| predicted protein [Chlamydomonas reinhardtii]
          Length = 211

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 130/203 (64%), Gaps = 8/203 (3%)

Query: 13  PQFKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAE 72
           P+ + GVLALQG+F+EH+ +LQ +  V   + +R  ++LE++  LIIPGGESTTMAL+AE
Sbjct: 10  PRIRVGVLALQGSFREHMTLLQKVPGVE-VVEVRTKDELESVAGLIIPGGESTTMALVAE 68

Query: 73  RSGLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQID 132
           R GL+  LR F +  KP WGTCAGMI LA  A   K+GGQ L+GGL+ITV+RN FG+QI+
Sbjct: 69  RWGLIPELRSFAKAGKPVWGTCAGMIFLAEGAEGQKEGGQTLLGGLDITVSRNFFGAQIN 128

Query: 133 SFESLLHINHITTS--SDDLFPAIFIRAPXXXXXXXXXVEVLARL----EHDIGETDASS 186
           SFE+ L       S  S D F A+FIRAP         VEVLA      E          
Sbjct: 129 SFETRLPAPECVKSHGSTDDFRAVFIRAP-AVLAAGPGVEVLAEYALTPEERAKHGRDKV 187

Query: 187 IVAVRQGSLLGTAFHPELTNDDR 209
           IV VR+G L+ TAFHPELT D R
Sbjct: 188 IVGVRKGVLMATAFHPELTTDIR 210



>gi|391869497|gb|EIT78694.1| imidazoleglycerol-phosphate synthase subunit [Aspergillus oryzae
           3.042]
          Length = 327

 Score =  187 bits (475), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 106/260 (40%), Positives = 148/260 (56%), Gaps = 57/260 (21%)

Query: 18  GVLALQGAFQEHIHMLQ----NISQVSSAIP------IRKAEQLETIDALIIPGGESTTM 67
           GVLALQGAF EH+ +L+    N++  + A P      +R  ++L+  DALI+PGGESTT+
Sbjct: 6   GVLALQGAFYEHVQLLKQAAANLATETHASPKWEFIEVRTPQELDRCDALILPGGESTTI 65

Query: 68  ALIAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQ 126
           +L+A RS L+EPLR FV+   +PTWGTCAG+ILLA  AN+ KKGGQ+LIGGL++ VNRN 
Sbjct: 66  SLVAARSNLLEPLRDFVKVHRRPTWGTCAGLILLAESANRTKKGGQELIGGLDVRVNRNH 125

Query: 127 FGSQIDSFESLLHINHITTSSDD--LFPAIFIRAPXXXX--------------------- 163
           FG Q +SF++ L +  + +   D   FPA+FIRAP                         
Sbjct: 126 FGRQTESFQAPLDLPFLNSCGKDQPPFPAVFIRAPVVEKILPHEEGIQTSEVGRDETVVA 185

Query: 164 ------------XXXXXVEVLARLEHDI-----------GETDASSIVAVRQGSLLGTAF 200
                            VEVLA L                + +A  I+AV+QG++ GT+F
Sbjct: 186 PSKHVKDQAALDAMATQVEVLATLPGRAAKLASEGRNIDADKEAGDIIAVKQGNVFGTSF 245

Query: 201 HPELTNDDRIHKYFVQLTQD 220
           HPELT D RIH ++++  ++
Sbjct: 246 HPELTGDARIHSWWLRQVEE 265



>gi|85106827|ref|XP_962256.1| pyridoxine-2 [Neurospora crassa OR74A]
 gi|12802368|gb|AAK07851.1|AF309689_13 Sno-type pyridoxine vitamin B6 biosynthetic protein SNO1
           [Neurospora crassa]
 gi|28923857|gb|EAA33020.1| pyridoxine-2 [Neurospora crassa OR74A]
          Length = 252

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 105/241 (43%), Positives = 144/241 (59%), Gaps = 28/241 (11%)

Query: 14  QFKFGVLALQGAFQEHIHMLQNI-----SQVSSAIP------IRKAEQLETIDALIIPGG 62
           Q   GVLALQG   EHI +LQ       SQ S+  P      +R A QL   DALIIPGG
Sbjct: 10  QITVGVLALQGGVIEHISLLQKAAAQLSSQSSTPTPQFSFIQVRTAAQLSQCDALIIPGG 69

Query: 63  ESTTMALIAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNIT 121
           ESTTMA++A R GL++PLR+FV+   KPTWGTCAG+++LA+ A+  K+GGQ+LIGGL++ 
Sbjct: 70  ESTTMAIVARRLGLLDPLREFVKVQHKPTWGTCAGLVMLASAASATKQGGQELIGGLDVK 129

Query: 122 VNRNQFGSQIDSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXX------------- 168
           V RN++G+Q+ SF   L +  +     + F  +FIRAP                      
Sbjct: 130 VLRNRYGTQLQSFVGDLRLPFL--EEGEPFRGVFIRAPVVEEIITTTAGDDEVTKLKGNL 187

Query: 169 VEVLARLEHDIGETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQDHYNTGKGR 228
           VEV+       G  +   IVAVRQG++ GT+FHPELT+D RIH ++++   +   +G GR
Sbjct: 188 VEVMGTYPKPQGTGEGDDIVAVRQGNVFGTSFHPELTDDVRIHTWWLKQVVEGLKSG-GR 246

Query: 229 N 229
           +
Sbjct: 247 D 247



>gi|297796999|ref|XP_002866384.1| ATPDX2/EMB2407/PDX2 [Arabidopsis lyrata subsp. lyrata]
 gi|297312219|gb|EFH42643.1| ATPDX2/EMB2407/PDX2 [Arabidopsis lyrata subsp. lyrata]
          Length = 255

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 103/221 (46%), Positives = 140/221 (63%), Gaps = 21/221 (9%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG+F EHI  L+ +      + IRKA+QL T+ +LIIPGGESTTMA +AE   L 
Sbjct: 4   GVLALQGSFNEHIAALRRLG--VQGVEIRKADQLLTVSSLIIPGGESTTMAKLAEYHNLF 61

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             LR+FV+  KP WGTCAG+I LA+ A   K+GGQ+L+GGL+ TV+RN FGSQI SFE+ 
Sbjct: 62  PALREFVKMGKPVWGTCAGLIFLADRAVGQKEGGQELVGGLDCTVHRNFFGSQIQSFEAD 121

Query: 138 LHINHITT--SSDDLFPAIFIRAPXXXXXXXXXVEVLA----------------RLEHDI 179
           + +  +T+     + +  +FIRAP         VEVLA                +++ + 
Sbjct: 122 ISVPQLTSQEGGPETYRGVFIRAP-AVLDVGPDVEVLADYPVPSNKVLYSSSTVQIQEED 180

Query: 180 GETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQD 220
              +   IVAV+QG+LL TAFHPELT D R H YF+++T++
Sbjct: 181 ALPETKVIVAVKQGNLLATAFHPELTADTRWHSYFIKMTKE 221



>gi|301118753|ref|XP_002907104.1| glutamine amidotransferase subunit pdxT, putative [Phytophthora
           infestans T30-4]
 gi|262105616|gb|EEY63668.1| glutamine amidotransferase subunit pdxT, putative [Phytophthora
           infestans T30-4]
          Length = 224

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 97/213 (45%), Positives = 139/213 (65%), Gaps = 14/213 (6%)

Query: 15  FKFGVLALQGAFQEHIHMLQNISQ--------VSSAIPIRKAEQLETIDALIIPGGESTT 66
              GVLALQGAF+EHI ML+ ++         + SA+ IR  EQL+ +DAL++PGGESTT
Sbjct: 8   LTVGVLALQGAFEEHIAMLEGLTSTTSAGQRVIVSAVAIRLPEQLQNVDALVLPGGESTT 67

Query: 67  MALIAERSGLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQ 126
           +  +A R GL+EPL+K+V D +P WGTCAGMI+L+ +A   ++GGQ LIGGL++ V+RN 
Sbjct: 68  IGKVAVRWGLVEPLKKWVADGRPIWGTCAGMIMLSQQAKHAEEGGQTLIGGLDVEVSRNF 127

Query: 127 FGSQIDSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDI---GETD 183
           FG+Q+ SFE L  +        + + A+FIRAP         +EVL+R+ +     G   
Sbjct: 128 FGAQVRSFEML--VAGPPGFDTEPYNAVFIRAP-AIISVGEEIEVLSRVANAKPADGSDP 184

Query: 184 ASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
              I+A R+ ++L TAFHPE+T D R H+YF++
Sbjct: 185 VDVIIAARKENILVTAFHPEITTDARWHQYFIE 217



>gi|393215246|gb|EJD00737.1| glutamine amidotransferase subunit pdxT [Fomitiporia mediterranea
           MF3/22]
          Length = 260

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 109/235 (46%), Positives = 144/235 (61%), Gaps = 26/235 (11%)

Query: 4   TCNDFQQVQPQFKFGVLALQGAFQEHIHMLQNISQVSSAIPI---RKAEQLETIDALIIP 60
           +C    Q  P    G+LA+QGAF EH  MLQ + +V   I I   R+AE L   D LIIP
Sbjct: 18  SCCKMTQEAP-IIIGILAMQGAFAEHQVMLQKV-RVHRPIKIALIRQAEDLVQCDGLIIP 75

Query: 61  GGESTTMALIAERSGLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNI 120
           GGESTT+AL+A  +GL EPLR+FV++ KP WGTCAG ILL+ +A  +KKGGQ+L+GG++I
Sbjct: 76  GGESTTIALLARLAGLTEPLREFVQN-KPVWGTCAGAILLSRDAEGMKKGGQELLGGVDI 134

Query: 121 TVNRNQFGSQIDSFESLLHINHITTSSDDLFPAIFIRAPX----XXXXXXXXVEVLARL- 175
              RN +GSQ++SFE+ L+   +   S+  F  IFIRAP             V+++ARL 
Sbjct: 135 KTARNGWGSQVESFEAPLYTEGL-RESNRPFTGIFIRAPVITDITPSALAPPVQIVARLS 193

Query: 176 --------------EHDIGETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
                         E D    DA ++VA+RQG  L T FHPELT DDR H++FV+
Sbjct: 194 TGLLPKGQQIVSIDEDDTDPRDARTVVALRQGRHLVTTFHPELTKDDRFHEFFVK 248



>gi|482549688|gb|EOA13882.1| hypothetical protein CARUB_v10026985mg [Capsella rubella]
          Length = 255

 Score =  186 bits (473), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 103/221 (46%), Positives = 138/221 (62%), Gaps = 21/221 (9%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG+F EHI  L+ +      + IRKA+QL T+ +LIIPGGESTTMA +AE   L 
Sbjct: 4   GVLALQGSFNEHIAALRRLG--VQGVEIRKADQLLTVSSLIIPGGESTTMAKLAEYHNLF 61

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             LR FV+  KP WGTCAG+I LA+ A   K+GGQ+L+GGL+ TV+RN FGSQI SFE+ 
Sbjct: 62  PALRDFVKTGKPVWGTCAGLIFLADRAVGQKEGGQELVGGLDCTVHRNFFGSQIQSFEAD 121

Query: 138 LHINHITT--SSDDLFPAIFIRAPXXXXXXXXXVEVLA----------------RLEHDI 179
           + +  +T+     + +  +FIRAP         VEVLA                +++ + 
Sbjct: 122 ISVPQLTSKEGGSETYRGVFIRAP-AVLDVGPDVEVLADYPVPSNKVLYSSSTVQIQEED 180

Query: 180 GETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQD 220
              +   IVAV+QG+LL TAFHPELT D R H YF+++T +
Sbjct: 181 ALPETKVIVAVKQGNLLATAFHPELTADTRWHSYFIKMTNE 221



>gi|297746243|emb|CBI16299.3| unnamed protein product [Vitis vinifera]
          Length = 252

 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 106/221 (47%), Positives = 134/221 (60%), Gaps = 21/221 (9%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG+F EHI  +         + IRK EQLE + +LIIPGGESTTMA +AE   L 
Sbjct: 4   GVLALQGSFNEHIAGIS--LYFRDGVEIRKPEQLEQVGSLIIPGGESTTMAKLAEYHNLF 61

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             LR+FV+  KP WGTCAG+I LAN+A   K GGQ+L+GGL+ TV+RN FGSQI SFE+ 
Sbjct: 62  PALREFVKLGKPVWGTCAGLIFLANKAVGQKTGGQELVGGLDCTVHRNFFGSQIQSFETQ 121

Query: 138 LHINHITT--SSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGE-------------- 181
           L +  +       + F  +FIRAP         VEVLA      G+              
Sbjct: 122 LSVPELAAKEGGPETFRGVFIRAP-AILEVGPKVEVLADYPVPSGKLFDSISALEAPQEN 180

Query: 182 --TDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQD 220
             ++   IVAV+QG+LLGTAFHPELT D R H YF+++T +
Sbjct: 181 AGSEKKVIVAVKQGNLLGTAFHPELTADTRWHSYFLKMTSE 221



>gi|320589359|gb|EFX01821.1| glutamine amidotransferase subunit pdxt [Grosmannia clavigera
           kw1407]
          Length = 238

 Score =  186 bits (472), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 103/221 (46%), Positives = 137/221 (61%), Gaps = 25/221 (11%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSA--------IPIRKAEQLETIDALIIPGGESTTMAL 69
           GVLALQGAF EHI +LQ  +  S          + +R  ++L   D L+IPGGESTT+AL
Sbjct: 27  GVLALQGAFVEHISLLQQAAASSPGLALRSFDFVQVRTVDELGRCDGLVIPGGESTTLAL 86

Query: 70  IAERSGLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGS 129
           +A RSGLM+ LR+FV  +KPTWGTCAG+ILLA   +  K+GGQ  IGGL++ V+RN FG 
Sbjct: 87  VATRSGLMDGLRQFVGAKKPTWGTCAGLILLAERVDAAKEGGQQHIGGLDVCVHRNHFGR 146

Query: 130 QIDSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXX-----VEVLARLEHDIGETDA 184
           QI+SFE+ + +  +     DLF A+FIRAP              V VL R+  D      
Sbjct: 147 QINSFEADVELPFLK----DLFHAVFIRAPVVSELLDPGHGHHPVRVLGRVNGD------ 196

Query: 185 SSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQDHYNTG 225
             IVAV+Q ++ GT+FHPELT+D RIH ++++      N G
Sbjct: 197 --IVAVQQDNIFGTSFHPELTDDTRIHAWWLEQLCGGTNEG 235



>gi|18424366|ref|NP_568922.1| Pyridoxal biosynthesis protein PDX2 [Arabidopsis thaliana]
 gi|75154761|sp|Q8LAD0.1|PDX2_ARATH RecName: Full=Pyridoxal biosynthesis protein PDX2; AltName:
           Full=Probable glutamine amidotransferase; Short=AtPDX2;
           AltName: Full=Protein EMBRYO DEFECTIVE 2407
 gi|21593486|gb|AAM65453.1| imidazoleglycerol-phosphate synthase subunit H-like [Arabidopsis
           thaliana]
 gi|26449721|dbj|BAC41984.1| putative imidazoleglycerol-phosphate synthase subunit H
           [Arabidopsis thaliana]
 gi|28950813|gb|AAO63330.1| At5g60540 [Arabidopsis thaliana]
 gi|332009958|gb|AED97341.1| Pyridoxal biosynthesis protein PDX2 [Arabidopsis thaliana]
          Length = 255

 Score =  186 bits (472), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 103/221 (46%), Positives = 140/221 (63%), Gaps = 21/221 (9%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG+F EHI  L+ +      + IRKA+QL T+ +LIIPGGESTTMA +AE   L 
Sbjct: 4   GVLALQGSFNEHIAALRRLG--VQGVEIRKADQLLTVSSLIIPGGESTTMAKLAEYHNLF 61

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             LR+FV+  KP WGTCAG+I LA+ A   K+GGQ+L+GGL+ TV+RN FGSQI SFE+ 
Sbjct: 62  PALREFVKMGKPVWGTCAGLIFLADRAVGQKEGGQELVGGLDCTVHRNFFGSQIQSFEAD 121

Query: 138 LHINHITT--SSDDLFPAIFIRAPXXXXXXXXXVEVLA----------------RLEHDI 179
           + +  +T+     + +  +FIRAP         VEVLA                +++ + 
Sbjct: 122 ILVPQLTSQEGGPETYRGVFIRAP-AVLDVGPDVEVLADYPVPSNKVLYSSSTVQIQEED 180

Query: 180 GETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQD 220
              +   IVAV+QG+LL TAFHPELT D R H YF+++T++
Sbjct: 181 ALPETKVIVAVKQGNLLATAFHPELTADTRWHSYFIKMTKE 221



>gi|336470730|gb|EGO58891.1| hypothetical protein NEUTE1DRAFT_128413 [Neurospora tetrasperma
           FGSC 2508]
 gi|350291797|gb|EGZ72992.1| SNO glutamine amidotransferase [Neurospora tetrasperma FGSC 2509]
          Length = 255

 Score =  186 bits (472), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 105/244 (43%), Positives = 144/244 (59%), Gaps = 31/244 (12%)

Query: 14  QFKFGVLALQGAFQEHIHMLQNI-----SQVSSAIP------IRKAEQLETIDALIIPGG 62
           Q   GVLALQG   EHI +LQ       SQ S+  P      +R A QL   DALIIPGG
Sbjct: 10  QITVGVLALQGGVIEHISLLQKAAAQLSSQSSTPTPQFSFIQVRTAAQLSQCDALIIPGG 69

Query: 63  ESTTMALIAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNIT 121
           ESTTMA++A R GL++PLR+FV+   KPTWGTCAG+++LA+ A+  K+GGQ+LIGGL++ 
Sbjct: 70  ESTTMAIVARRLGLLDPLREFVKVQHKPTWGTCAGLVMLASAASATKQGGQELIGGLDVK 129

Query: 122 VNRNQFGSQIDSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXX-------------- 167
           V RN++G+Q+ SF   L +  +     + F  +FIRAP                      
Sbjct: 130 VLRNRYGTQLQSFVGDLRLPFL--EEGEPFRGVFIRAPVVEEIISSGPGTAEVDEVAKLK 187

Query: 168 --XVEVLARLEHDIGETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQDHYNTG 225
              VEV+       G  +   IVAVRQG++ GT+FHPELT+D RIH ++++   +   +G
Sbjct: 188 GNQVEVMGTYPKPQGTGEGEDIVAVRQGNVFGTSFHPELTDDVRIHTWWLKQVVEGLKSG 247

Query: 226 KGRN 229
            GR+
Sbjct: 248 -GRD 250



>gi|482806228|gb|EOA83301.1| hypothetical protein SETTUDRAFT_164736 [Setosphaeria turcica Et28A]
          Length = 285

 Score =  186 bits (472), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 107/253 (42%), Positives = 140/253 (55%), Gaps = 55/253 (21%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIP------IRKAEQLETIDALIIPGGESTTMALIA 71
           GVLALQGAF EHI +L+  +   +A P      +R   QLE  D LIIPGGESTTM+L+A
Sbjct: 13  GVLALQGAFSEHIQLLRAAASNIAASPLFQFIQVRTPAQLEQCDGLIIPGGESTTMSLVA 72

Query: 72  ERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQ 130
            RS L+EPLR FV+   KPTWGTCAG+ILLA  AN+ KKGGQ+LIGGL++ VNRN FG Q
Sbjct: 73  ARSNLLEPLRDFVKVQRKPTWGTCAGLILLAESANRTKKGGQELIGGLDVRVNRNHFGRQ 132

Query: 131 IDSFESLLHINHITTSSD----DLFPAIFIRAPX-------------------------- 160
            +SF++ L++  +  S +    D +  +FIRAP                           
Sbjct: 133 QESFQAHLNLPFLGASKEASKSDPYRCVFIRAPVVEKILPSKKAVGIQEGESQREDTVIA 192

Query: 161 ---------XXXXXXXXVEVLARLEHDIG---------ETDASSIVAVRQGSLLGTAFHP 202
                            VE++A L  D              A  I+AVRQG++ G +FHP
Sbjct: 193 PSKTPADDLARKELDCQVEIMATLSTDAAPLQENQEHKHAGAEDIIAVRQGNVFGCSFHP 252

Query: 203 ELTNDDRIHKYFV 215
           ELT+D RIH +++
Sbjct: 253 ELTDDPRIHVWWL 265



>gi|460411447|ref|XP_004251122.1| PREDICTED: pyridoxal biosynthesis protein PDX2-like [Solanum
           lycopersicum]
          Length = 251

 Score =  185 bits (469), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 106/221 (47%), Positives = 134/221 (60%), Gaps = 21/221 (9%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG+F EHI +L+ +      + +RK EQL  + +LIIPGGESTTMA +AE   L 
Sbjct: 4   GVLALQGSFNEHIAVLKRLG--VKGVEVRKPEQLLNVSSLIIPGGESTTMAKLAELHNLF 61

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             LR+FV+  KP WGTCAG+I LAN+A   K GGQ LIGGL+ TV+RN FGSQI SFE+ 
Sbjct: 62  PALREFVQMGKPVWGTCAGLIFLANKATGQKTGGQKLIGGLDCTVHRNFFGSQIQSFETE 121

Query: 138 LHINHITT--SSDDLFPAIFIRAPXXXXXXXXXVEVLARL----------------EHDI 179
           L I  +         F A+FIRAP         VEVL+ +                E + 
Sbjct: 122 LPIPQVVAEDGGPPSFRAVFIRAP-AILDVGPDVEVLSDIPLSAIETLNSNPAIQKEEES 180

Query: 180 GETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQD 220
            E+    IVAV+QG+LL TAFHPELT D R H YF+++  +
Sbjct: 181 TESGKKVIVAVKQGNLLATAFHPELTADTRWHSYFLKMVPE 221



>gi|9757756|dbj|BAB08237.1| amidotransferase hisH-like protein [Arabidopsis thaliana]
          Length = 240

 Score =  185 bits (469), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 104/209 (49%), Positives = 137/209 (65%), Gaps = 12/209 (5%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG+F EHI  L+ +      + IRKA+QL T+ +LIIPGGESTTMA +AE   L 
Sbjct: 4   GVLALQGSFNEHIAALRRLG--VQGVEIRKADQLLTVSSLIIPGGESTTMAKLAEYHNLF 61

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             LR+FV+  KP WGTCAG+I LA+ A    +GGQ+L+GGL+ TV+RN FGSQI SFE+ 
Sbjct: 62  PALREFVKMGKPVWGTCAGLIFLADRA---VEGGQELVGGLDCTVHRNFFGSQIQSFEAD 118

Query: 138 LHINHITT--SSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDA----SSIVAVR 191
           + +  +T+     + +  +FIRAP         VEVLA       + DA      IVAV+
Sbjct: 119 ILVPQLTSQEGGPETYRGVFIRAP-AVLDVGPDVEVLADYPVPSNKEDALPETKVIVAVK 177

Query: 192 QGSLLGTAFHPELTNDDRIHKYFVQLTQD 220
           QG+LL TAFHPELT D R H YF+++T++
Sbjct: 178 QGNLLATAFHPELTADTRWHSYFIKMTKE 206



>gi|462401410|gb|EMJ06967.1| hypothetical protein PRUPE_ppa010384mg [Prunus persica]
          Length = 252

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 107/222 (48%), Positives = 136/222 (61%), Gaps = 23/222 (10%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG+F EHI  L+ +      + IRK EQLET+ +LIIPGGESTTMA +AE   L 
Sbjct: 5   GVLALQGSFNEHIAALRRLG--VKGVEIRKPEQLETVASLIIPGGESTTMAKLAEYHNLF 62

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             LR+FV+  KP WGTCAG+I LAN+A   K GGQ+LIGGL+ TV+RN FGSQI SFE+ 
Sbjct: 63  PALREFVKMGKPVWGTCAGLIFLANKATGQKIGGQELIGGLDCTVHRNFFGSQIRSFEAE 122

Query: 138 LHINHITTS--SDDLFPAIFIRAPXXXXXXXXXVEVLARL-----------------EHD 178
           L +  +       ++F  +FIRAP         V+VLA                   E +
Sbjct: 123 LAVPELAAKEGGPEVFRGVFIRAP-AILDVGPEVKVLADYLVPSNEALDSNSAVEAQEEN 181

Query: 179 IGETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQD 220
            G ++   IVAVRQ +LL TAFHPELT D R H YF+++  +
Sbjct: 182 TG-SEKKVIVAVRQRNLLATAFHPELTADTRWHSYFLKMATE 222



>gi|500258064|gb|EOO01124.1| putative pyridoxine protein [Togninia minima UCRPA7]
          Length = 265

 Score =  184 bits (468), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 111/250 (44%), Positives = 146/250 (58%), Gaps = 53/250 (21%)

Query: 18  GVLALQGAFQEHIHMLQNIS-QVS---------SAIPIRKAEQLETIDALIIPGGESTTM 67
           GVLALQG F EH+ +L   S Q++         S I +R  E L   +ALIIPGGESTT+
Sbjct: 6   GVLALQGGFWEHMSLLHKASAQLTDSGRWNEEFSFIEVRTPEDLARCEALIIPGGESTTI 65

Query: 68  ALIAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQ 126
           ALIA +SGL+EPLR FV+   KPTWGTCAG+ILL+ +AN  KKGGQ+LIGG+++ V+RN 
Sbjct: 66  ALIAAQSGLLEPLRDFVKVSRKPTWGTCAGLILLSEQANATKKGGQELIGGIDVRVHRNH 125

Query: 127 FGSQIDSFESLLHINHIT-TSSDDLFPAIFIRAP------------------------XX 161
           FG QI+SF + + +  +  T +   FP +FIRAP                          
Sbjct: 126 FGRQIESFVADVDLPFLAETGAAASFPGVFIRAPIVEKLLPHNAEQRRGDDSSGDGQDAA 185

Query: 162 XXXXXXXVEVLA---------------RLEHDIGETDASSIVAVRQGSLLGTAFHPELTN 206
                  VEVLA                LE D GE +   IVAVRQG+++GT+FHPELT+
Sbjct: 186 AQTDKTDVEVLAVLPGRTKRVKGGGVDGLEEDSGEVN--DIVAVRQGNIIGTSFHPELTD 243

Query: 207 DDRIHKYFVQ 216
           D RIH ++++
Sbjct: 244 DSRIHVWWLE 253



>gi|9954418|gb|AAG09049.1|AF294268_1 pyridoxine synthesis protein PDX2 [Cercospora nicotianae]
          Length = 278

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 109/262 (41%), Positives = 143/262 (54%), Gaps = 68/262 (25%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSA--------IPIRKAEQLETIDALIIPGGESTTMAL 69
           GVLALQGAF EHI +L+  +   +A        I +R  EQL+  DALI+PGGEST ++L
Sbjct: 13  GVLALQGAFIEHITLLRQAAPALTAGYGVHFTFIEVRTPEQLDRCDALILPGGESTAISL 72

Query: 70  IAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFG 128
           IAER GL+EPLR FV+   +PTWGTCAG+ILLA EANK K  GQ+LIGGL++ V RN FG
Sbjct: 73  IAERCGLLEPLRNFVKWQRRPTWGTCAGLILLAEEANKSKATGQELIGGLDVRVQRNYFG 132

Query: 129 SQIDSFESLLHINHITTSSDDLFPAIFIRAPXXX-------------------------- 162
            Q++SFE+ L +  +     D F ++FIRAP                             
Sbjct: 133 RQVESFEAALQLPFL---GPDPFHSVFIRAPVVENILASSAKDVTTEIVEKSAGESKAVR 189

Query: 163 ---------------XXXXXXVEVLARL-------------EHDIGETDASSIVAVRQGS 194
                                VE+L RL               ++GE     IVAV+QG+
Sbjct: 190 PSMPNRADTISAPQIKATSAPVEILGRLPGRAKAIKDKTSTAEELGEE--GDIVAVKQGN 247

Query: 195 LLGTAFHPELTNDDRIHKYFVQ 216
           + GT+FHPELT DDRIH ++++
Sbjct: 248 VFGTSFHPELTGDDRIHAWWLR 269



>gi|347975819|ref|XP_003437239.1| unnamed protein product [Podospora anserina S mat+]
 gi|170940097|emb|CAP65323.1| unnamed protein product [Podospora anserina S mat+]
          Length = 239

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 99/206 (48%), Positives = 137/206 (66%), Gaps = 12/206 (5%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIP-----IRKAEQLETIDALIIPGGESTTMALIAE 72
           GVLALQG   EHI +L   S    ++      +R  EQL   DALIIPGGESTTMA++A 
Sbjct: 9   GVLALQGGVVEHIALLNRASANYPSVTFHFLEVRTPEQLSLCDALIIPGGESTTMAIVAR 68

Query: 73  RSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQI 131
           R GL+EPLR+FV+ + KP WGTCAG+++LA EA+  K+GGQ+LIGGL++ V RN+FG+Q+
Sbjct: 69  RLGLLEPLREFVKINNKPVWGTCAGLVMLAEEASATKQGGQELIGGLDVRVLRNKFGTQV 128

Query: 132 DSFESLLHINHITTSSDDLFPAIFIRAPXXXXX--XXXXVEVLARLEHDIGETDASSIVA 189
            SF + L+++ +    +  F  +FIRAP           V+VL  ++    E D   IVA
Sbjct: 129 QSFVADLNLDFL-GEGEGPFRGVFIRAPVVEEVIDGDGRVKVLGTVKKPGEEED---IVA 184

Query: 190 VRQGSLLGTAFHPELTNDDRIHKYFV 215
           VRQG++ GT+FHPELT D R+H +++
Sbjct: 185 VRQGNVFGTSFHPELTGDVRVHAWWL 210



>gi|169612938|ref|XP_001799886.1| hypothetical protein SNOG_09597 [Phaeosphaeria nodorum SN15]
 gi|111061742|gb|EAT82862.1| hypothetical protein SNOG_09597 [Phaeosphaeria nodorum SN15]
          Length = 281

 Score =  184 bits (466), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 109/259 (42%), Positives = 143/259 (55%), Gaps = 59/259 (22%)

Query: 13  PQFKFGVLALQGAFQEHIHMLQNISQV------SSAIPIRKAEQLETIDALIIPGGESTT 66
           P    GVLALQGAF EHI +L++ S         + I +R   +L   D LIIPGGEST 
Sbjct: 6   PDLTIGVLALQGAFSEHIQLLRHASTSLPTNLKCAFIEVRTPSELAQCDGLIIPGGESTA 65

Query: 67  MALIAERSGLMEPLRKFVRD-EKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRN 125
           M+L+A RSGL+EPLR FV+   +PTWGTCAG+ILLA  AN+ KKGGQDLIGGL++ VNRN
Sbjct: 66  MSLVAARSGLLEPLRDFVKVLRRPTWGTCAGLILLAESANRTKKGGQDLIGGLDVRVNRN 125

Query: 126 QFGSQIDSFESLLHINHI----TTSSDDLFPAIFIRAPX--------------------- 160
            FG Q +SF++ L +  +    T + +  +  +FIRAP                      
Sbjct: 126 HFGRQQESFQANLDLPFLGSTATMAKEQPYRCVFIRAPVVEKLLPHVKGEQKEEADLDAT 185

Query: 161 ------------XXXXXXXXVEVLARL-----------EHD-IGETDASSIVAVRQGSLL 196
                               VEV+ARL           EH+  G+ D   I+AVRQG++ 
Sbjct: 186 IVAPSKTPVDEFAKKELNAQVEVMARLSLKNPGLQENQEHEHKGKED---IIAVRQGNVF 242

Query: 197 GTAFHPELTNDDRIHKYFV 215
           G +FHPELT D RIH +++
Sbjct: 243 GCSFHPELTEDARIHAWWL 261



>gi|315050524|ref|XP_003174636.1| glutamine amidotransferase subunit pdxT [Arthroderma gypseum CBS
           118893]
 gi|311339951|gb|EFQ99153.1| glutamine amidotransferase subunit pdxT [Arthroderma gypseum CBS
           118893]
          Length = 265

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 136/244 (55%), Gaps = 47/244 (19%)

Query: 18  GVLALQGAFQEHIHMLQNIS-----------QVSSAIPIRKAEQLETIDALIIPGGESTT 66
           GVLALQGAF EHI +L+  +           Q    I +R A +L   D LIIPGGEST 
Sbjct: 6   GVLALQGAFYEHIQLLKVAAEKLRGSKTYAKQQWEFIEVRTAAELARCDGLIIPGGESTA 65

Query: 67  MALIAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRN 125
           MAL+A RS L+EPLR FV+   KPTWGTCAG+ILLA  AN+ K+GGQDLIGGL++ VNRN
Sbjct: 66  MALVAARSNLLEPLRDFVKLHRKPTWGTCAGLILLAESANRTKRGGQDLIGGLDVRVNRN 125

Query: 126 QFGSQIDSFESLLHINHITTSSDDLFPAIFIRAP-------------------------- 159
            FG Q +SF + L +  +   +   F A+FIRAP                          
Sbjct: 126 HFGRQTESFYAPLDLPFLPGDAGP-FRAVFIRAPVVEKVLSAKDGIQDEELAIDGTVVAP 184

Query: 160 -------XXXXXXXXXVEVLARLEHDI-GETDASSIVAVRQGSLLGTAFHPELTNDDRIH 211
                           VE+L +L     G  +   IVAV+QG++ GT+FHPELT+D RIH
Sbjct: 185 SRKPESEVARKAMANKVEILGKLPAKADGSGEPGDIVAVKQGNVFGTSFHPELTDDARIH 244

Query: 212 KYFV 215
            +++
Sbjct: 245 MWWL 248



>gi|145355644|ref|XP_001422068.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144582307|gb|ABP00362.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 216

 Score =  183 bits (465), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 133/216 (61%), Gaps = 14/216 (6%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLA+QG+F+EH  +++     + A+ +RK   L  +  LIIPGGESTTMA IA R GL 
Sbjct: 2   GVLAIQGSFREHAALVRKAHPRARAVEVRKGCHLRDVRGLIIPGGESTTMANIARRFGLF 61

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANK-VKKGGQDLIGGLNITVNRNQFGSQIDSFES 136
           EPLR F    +  WGTCAG+I LA    +  K+GGQ+L+GGL++ VNRN FGSQIDSFE 
Sbjct: 62  EPLRAFQASGRCVWGTCAGLIFLAERLERGGKEGGQELLGGLDVGVNRNFFGSQIDSFEC 121

Query: 137 LLHINHITTSSDDLFP--AIFIRAPXXXXXXXXXVEVLARL-------EHDIGETDAS-- 185
           ++     T++ DD  P  A+FIRAP         VEVLA+        +  +G  D    
Sbjct: 122 MIPWTATTSNGDDDAPFRAVFIRAP-AITSCGPDVEVLAKYALPEAKKQKLVGTADEGLN 180

Query: 186 -SIVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQD 220
             +VAVRQG LL T+FHPE+T D R HK FV +  +
Sbjct: 181 EVVVAVRQGKLLATSFHPEITADARWHKLFVDMCAE 216



>gi|261190114|ref|XP_002621467.1| glutamine amidotransferase subunit pdxT [Ajellomyces dermatitidis
           SLH14081]
 gi|239591295|gb|EEQ73876.1| glutamine amidotransferase subunit pdxT [Ajellomyces dermatitidis
           SLH14081]
 gi|239606355|gb|EEQ83342.1| glutamine amidotransferase subunit pdxT [Ajellomyces dermatitidis
           ER-3]
 gi|327353069|gb|EGE81926.1| glutamine amidotransferase subunit pdxT [Ajellomyces dermatitidis
           ATCC 18188]
          Length = 277

 Score =  183 bits (465), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 110/260 (42%), Positives = 148/260 (56%), Gaps = 61/260 (23%)

Query: 18  GVLALQGAFQEHIHMLQ--------NISQVSSAIPIRKAEQLETIDALIIPGGESTTMAL 69
           GVLALQGAF EH+ +L+        N +Q  + I +R   +LE  DALIIPGGEST ++L
Sbjct: 6   GVLALQGAFYEHLKLLRKAAASLSPNETQKWNFIEVRTPAELEICDALIIPGGESTAISL 65

Query: 70  IAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFG 128
           +A RS L+EPLR FV+   +PTWGTCAG+ILLA  AN+ K+GGQ+LIGGL++ VNRN FG
Sbjct: 66  VAARSQLLEPLRDFVKLRRRPTWGTCAGLILLAESANRTKEGGQELIGGLDVRVNRNHFG 125

Query: 129 SQIDSFESLLHINHIT------TSSDD--LFPAIFIRA---------------------- 158
            Q +SF++ L +  ++       SSD    F  +FIRA                      
Sbjct: 126 RQTESFQAPLKLPFLSEVRQGGESSDQSATFMGVFIRAPVVEKLLPFVDDIQVEEQKREG 185

Query: 159 -----------PXXXXXXXXXVEVLARLE----------HDI-GETDASSIVAVRQGSLL 196
                      P         V+VLA+L            DI  +TD+  IVAV+QG++ 
Sbjct: 186 TVVAPSRHPKDPAARKAMSDHVDVLAKLPGRAARLAQTGADIHADTDSGDIVAVKQGNVF 245

Query: 197 GTAFHPELTNDDRIHKYFVQ 216
           GT+FHPELT+D RIH +++Q
Sbjct: 246 GTSFHPELTDDPRIHAWWLQ 265



>gi|429854779|gb|ELA29766.1| pyridoxine [Colletotrichum gloeosporioides Nara gc5]
          Length = 252

 Score =  183 bits (464), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 104/239 (43%), Positives = 143/239 (59%), Gaps = 35/239 (14%)

Query: 13  PQFKFGVLALQGAFQEHIHMLQNISQVSSA------IP------IRKAEQLETIDALIIP 60
           P    GVLALQG F EH+ +++  +   ++      IP      +R  EQL   DALIIP
Sbjct: 2   PAVTVGVLALQGGFHEHLELVRKAAASLASAPAPSPIPEIETTEVRTEEQLRRCDALIIP 61

Query: 61  GGESTTMALIAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLN 119
           GGESTT++L+A +SGLMEPLR+FV+ + KP WGTCAG ILLA+EAN  KKGGQ+LIGGL 
Sbjct: 62  GGESTTISLVATQSGLMEPLREFVKINRKPVWGTCAGAILLADEANSTKKGGQELIGGLA 121

Query: 120 ITVNRNQFGSQIDSFESLLHINHI------TTSSDDLFPAIFIRAP------XXXXXXXX 167
           + V+RN FG QI+SF + L++  +      + ++   FP +FIRAP              
Sbjct: 122 VRVHRNHFGRQIESFVADLNLPFLSRGDGGSKTASAPFPGVFIRAPIVEEILSKDAEPKS 181

Query: 168 XVEVLARL----------EHDIGETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
            VE+LA L               +     IVAV+Q ++  T+FHPELT+D RIH ++++
Sbjct: 182 SVEILAVLPGRKTKVEGVSQSTADDSVGDIVAVQQRNIFATSFHPELTDDIRIHVWWLE 240



>gi|348684935|gb|EGZ24750.1| hypothetical protein PHYSODRAFT_484036 [Phytophthora sojae]
          Length = 227

 Score =  183 bits (464), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 97/213 (45%), Positives = 139/213 (65%), Gaps = 14/213 (6%)

Query: 15  FKFGVLALQGAFQEHIHMLQNI--------SQVSSAIPIRKAEQLETIDALIIPGGESTT 66
              GVLALQGAF+EHI ML+ +        S V +A+ IR  EQL+ +DAL++PGGESTT
Sbjct: 11  LTVGVLALQGAFEEHIDMLEGLRATSASGQSVVVTAVAIRLPEQLQGVDALVLPGGESTT 70

Query: 67  MALIAERSGLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQ 126
           +  +A R GL+EPL+++V   +P WGTCAGMI+L+N+A   ++GGQ LIGGL++ V+RN 
Sbjct: 71  IGKVAVRWGLIEPLKQWVAAGRPIWGTCAGMIMLSNQAKHAEEGGQTLIGGLDVEVSRNF 130

Query: 127 FGSQIDSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDI---GETD 183
           FG+Q+ SFE L  +        + + A+FIRAP         +EVL+R+ +     G   
Sbjct: 131 FGAQVRSFEML--VAGPPGFDAEPYNAVFIRAP-AIISVGEQIEVLSRVANAKPADGSDP 187

Query: 184 ASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
              I+A R+  +L TAFHPE+T+D R H+YF++
Sbjct: 188 VDVIIAARKDHILVTAFHPEITDDARWHQYFLE 220



>gi|470117766|ref|XP_004295020.1| PREDICTED: pyridoxal biosynthesis protein PDX2-like isoform 2
           [Fragaria vesca subsp. vesca]
          Length = 251

 Score =  182 bits (463), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 102/221 (46%), Positives = 135/221 (61%), Gaps = 21/221 (9%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG++ EHI +L+ +      + I+K EQLE + +LIIPGGESTTMA +AE   L 
Sbjct: 5   GVLALQGSYNEHIAVLRRLG--VKGVEIKKPEQLENLASLIIPGGESTTMAKLAEYHNLF 62

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             LR+FV+  KP WGTCAG+I LAN A   K GGQ+L+GGL+  V+RN FGSQI SFE+ 
Sbjct: 63  PALREFVKMGKPVWGTCAGLIFLANRATGQKIGGQELVGGLDCMVHRNFFGSQIQSFETE 122

Query: 138 LHINHITT--SSDDLFPAIFIRAPXXXXXXXXXVEVLARL----------------EHDI 179
           L +  + +     ++F  +FIRAP         VEVLA                  + + 
Sbjct: 123 LSVPELASKEGGPEVFRGVFIRAP-AILEVGPGVEVLADYPVPANKWKNSNPGVEGDKEN 181

Query: 180 GETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQD 220
             ++   IVAVRQG+LL TAFHPELT D R H YF+++  +
Sbjct: 182 SGSEKKVIVAVRQGNLLATAFHPELTADTRWHSYFLKMATE 222



>gi|396474118|ref|XP_003839495.1| similar to glutamine amidotransferase subunit pdxT [Leptosphaeria
           maculans JN3]
 gi|312216064|emb|CBX96016.1| similar to glutamine amidotransferase subunit pdxT [Leptosphaeria
           maculans JN3]
          Length = 281

 Score =  182 bits (463), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 108/248 (43%), Positives = 140/248 (56%), Gaps = 49/248 (19%)

Query: 17  FGVLALQGAFQEHIHMLQNISQ-----VSSAIPIRKAEQLETIDALIIPGGESTTMALIA 71
            GVLALQGAF EHI +L+  S+         + IR AEQL   DALIIPGGESTTM+L+A
Sbjct: 13  IGVLALQGAFSEHIQLLRAASRQYPNHTFYLLEIRTAEQLAQCDALIIPGGESTTMSLVA 72

Query: 72  ERSGLMEPLRKFVRD-EKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQ 130
            RS L+EPLR FV+   +PTWGTCAG+ILLA  AN+ KKGGQ+L+GGL++ V RN FG Q
Sbjct: 73  SRSNLLEPLRSFVKVLRRPTWGTCAGLILLAESANRTKKGGQELVGGLDVRVRRNHFGRQ 132

Query: 131 IDSFESLLHINHITTSSDD-----LFPAIFIRAPXXXX---------------------- 163
            +SF   L++  +++ + D      +  +FIRAP                          
Sbjct: 133 QESFVKGLNLPFLSSGNQDEKEQEPYRCVFIRAPVVEKILPHKQEGEQDGEKGLEDTVVA 192

Query: 164 ------------XXXXXVEVLARLEHDI--GETDAS--SIVAVRQGSLLGTAFHPELTND 207
                            VEV+A L  D   GE       I+AVRQG++ G +FHPELTND
Sbjct: 193 PSQTPGDELARLELNAQVEVMATLGADTTNGEQGQGHEEIIAVRQGNVFGCSFHPELTND 252

Query: 208 DRIHKYFV 215
            RIH +++
Sbjct: 253 ARIHSWWL 260



>gi|388511885|gb|AFK44004.1| unknown [Lotus japonicus]
          Length = 253

 Score =  182 bits (462), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 105/219 (47%), Positives = 138/219 (63%), Gaps = 21/219 (9%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG+F EHI  L+ +    + + IRK EQL  +++LIIPGGEST MA +AE   L 
Sbjct: 5   GVLALQGSFHEHIAALRKLG--VNGVEIRKPEQLLNVNSLIIPGGESTAMAKLAEYHNLF 62

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             LR+FV+  KP WGTCAG+I LAN+A   K GGQ+L+GGL+ TV+RN FGSQI SFE+ 
Sbjct: 63  PALREFVQLGKPVWGTCAGLIFLANKAAGQKIGGQELVGGLDCTVHRNFFGSQIQSFETE 122

Query: 138 LHINHITTS--SDDLFPAIFIRAPXXXXXXXXXVEVLA-------RL---------EHDI 179
           L +  + +     + F  IFIRAP         V+VLA       RL         + + 
Sbjct: 123 LSVPELASKEGGPETFRGIFIRAP-AIIEAGPDVQVLADYPVRSNRLSTADSPTEDKKEN 181

Query: 180 GETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQLT 218
            E ++  IVAVRQG+++GTAFHPELT D R H YF+++ 
Sbjct: 182 VEEESKVIVAVRQGNIMGTAFHPELTADTRWHSYFLKMA 220



>gi|452843111|gb|EME45046.1| hypothetical protein DOTSEDRAFT_70925 [Dothistroma septosporum
           NZE10]
          Length = 262

 Score =  182 bits (462), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 106/256 (41%), Positives = 143/256 (55%), Gaps = 60/256 (23%)

Query: 14  QFKFGVLALQGAFQEHIHMLQNISQVSSA-----------------IPIRKAEQLETIDA 56
           Q   GVLALQGAF EHI +LQ  ++  +                  + +R  EQL+  DA
Sbjct: 3   QLTVGVLALQGAFVEHIKLLQQAAEHWTDSSLGSHHEGAKDVSFHFLEVRTPEQLQKCDA 62

Query: 57  LIIPGGESTTMALIAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLI 115
           L++PGGEST+++LIAER+GL+EPLR+FV+   KP WGTCAG+ILLA  ANK K  GQ+LI
Sbjct: 63  LVLPGGESTSISLIAERTGLLEPLREFVKVQRKPVWGTCAGLILLAESANKSKATGQELI 122

Query: 116 GGLNITVNRNQFGSQIDSFESLLHINHITTSSDDLFPAIFIRAPX--------------- 160
           GGL++ V RN FG Q++SFE+ L +  +    D  F ++FIRAP                
Sbjct: 123 GGLDVRVQRNYFGRQVESFEANLDLPFL----DSPFHSVFIRAPVVEKVLPSSKALSAES 178

Query: 161 --------XXXXXXXXVEVLARLE-------------HDIGETDASSIVAVRQGSLLGTA 199
                           VE+L RL               D+GE     I+AV+QG++  TA
Sbjct: 179 TPQVVLAPAKQATDAPVEILGRLSGRARAIRDRTTTAEDLGED--GDIIAVKQGNVFATA 236

Query: 200 FHPELTNDDRIHKYFV 215
           FHPELT D+RIH +++
Sbjct: 237 FHPELTGDERIHAWWL 252



>gi|378734573|gb|EHY61032.1| glutamine amidotransferase [Exophiala dermatitidis NIH/UT8656]
          Length = 270

 Score =  182 bits (462), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 106/257 (41%), Positives = 146/257 (56%), Gaps = 58/257 (22%)

Query: 18  GVLALQGAFQEHIHML----------QNISQVSSAIPIRKAEQLETIDALIIPGGESTTM 67
           GVLALQGAF EH+ +L          + + +  + I +R AEQL   DALIIPGGESTT+
Sbjct: 6   GVLALQGAFLEHLILLKRAADYLQQHEGVKESFNFIEVRNAEQLARCDALIIPGGESTTI 65

Query: 68  ALIAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQ 126
           + +A +SGL+EPLR+FV+   KPTWGTCAG+ILLA  AN  K+GGQ+LIGGL++ VNRN 
Sbjct: 66  SFVAAQSGLLEPLREFVKVSRKPTWGTCAGLILLAEAANATKQGGQELIGGLDVRVNRNH 125

Query: 127 FGSQIDSFESLLHINHITTS---SDDLFPAIFIRAPXXXX-------------------- 163
           FG QI+SF++ L +  + +    S + FP IFIRAP                        
Sbjct: 126 FGRQIESFQADLDLPFLKSEGSMSQEPFPGIFIRAPVVEKILPNVDGIQDGEKQVAETVV 185

Query: 164 -------------XXXXXVEVLARLEHDIGETDA-----------SSIVAVRQGSLLGTA 199
                             V+V+  L   + + +A             I+AVRQG++ GT+
Sbjct: 186 APAKAAKDDHAKAAMSSHVDVMGSLPGRLKKAEAMGADVHAGEEVGDIIAVRQGNVFGTS 245

Query: 200 FHPELTNDDRIHKYFVQ 216
           FHPELT+D RIH ++++
Sbjct: 246 FHPELTSDIRIHVWWLR 262



>gi|296812789|ref|XP_002846732.1| glutamine amidotransferase subunit pdxT [Arthroderma otae CBS
           113480]
 gi|238841988|gb|EEQ31650.1| glutamine amidotransferase subunit pdxT [Arthroderma otae CBS
           113480]
          Length = 269

 Score =  182 bits (462), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 111/258 (43%), Positives = 143/258 (55%), Gaps = 52/258 (20%)

Query: 18  GVLALQGAFQEHIHMLQNIS-----------QVSSAIPIRKAEQLETIDALIIPGGESTT 66
           GVLALQGAF EHI +L+  +           Q    + +R   +L   D LIIPGGEST 
Sbjct: 6   GVLALQGAFHEHIQLLRVAAAKLRGNKSMTKQQWEFVEVRTPAELARCDGLIIPGGESTA 65

Query: 67  MALIAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRN 125
           MAL+A RS L+EPLR+FV+   KPTWGTCAG+ILLA  AN+ K+GGQ+LIGGL++ VNRN
Sbjct: 66  MALVAARSNLLEPLREFVKLHRKPTWGTCAGLILLAESANRTKRGGQELIGGLDVRVNRN 125

Query: 126 QFGSQIDSFESLLHINHITTSSDDLFPAIFIRAPX------------------------- 160
            FG Q++SF + L +  +   S   F A+FIRAP                          
Sbjct: 126 HFGRQMESFYAPLDLPFLPGDSGP-FRAVFIRAPVVEKVLSPKEGIQDEEFARDGAVVAP 184

Query: 161 --------XXXXXXXXVEVLARLEHDI-GETD---ASSIVAVRQGSLLGTAFHPELTNDD 208
                           VEVL +L   + G  D   A  IVAV+QG++ GT+FHPELT+D 
Sbjct: 185 SVRPESALAREVMAGKVEVLGKLPAKVDGNGDPQEAGDIVAVKQGNVFGTSFHPELTDDA 244

Query: 209 RIHKYFVQLTQDHYNTGK 226
           RIH ++  LTQ   +  K
Sbjct: 245 RIHMWW--LTQVSESVAK 260



>gi|357468741|ref|XP_003604655.1| Glutamine amidotransferase subunit pdxT [Medicago truncatula]
 gi|355505710|gb|AES86852.1| Glutamine amidotransferase subunit pdxT [Medicago truncatula]
 gi|388521797|gb|AFK48960.1| unknown [Medicago truncatula]
          Length = 252

 Score =  182 bits (461), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 105/218 (48%), Positives = 136/218 (62%), Gaps = 21/218 (9%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG+F EHI +L+ +      + IRK EQL TI++LIIPGGESTTMA +A+   L 
Sbjct: 5   GVLALQGSFNEHIAVLRRLG--VKGVEIRKPEQLLTINSLIIPGGESTTMAKLAQYFNLF 62

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             LR+FV+  KP WGTCAG+I LA++A   K GGQ+L+GGL+ TV+RN FGSQI SFE+ 
Sbjct: 63  PALREFVQMGKPVWGTCAGLIFLADKATGQKTGGQELVGGLDCTVHRNFFGSQIQSFETE 122

Query: 138 LHINHITTS--SDDLFPAIFIRAPXXXXXXXXXVEVLA--------------RLEHDIGE 181
           L +  + +     + F  +FIRAP         V+VLA               +E     
Sbjct: 123 LAVPELVSKEGGPETFRGVFIRAP-AILDVGPEVQVLADYPVPSDKKLSSDSSVEDKKEN 181

Query: 182 TDASS--IVAVRQGSLLGTAFHPELTNDDRIHKYFVQL 217
            D  S  IVAVRQG++L TAFHPELT D R H YF+++
Sbjct: 182 ADEKSKVIVAVRQGNILATAFHPELTADTRWHSYFLKM 219



>gi|453085089|gb|EMF13132.1| pyridoxine synthesis protein PDX2 [Mycosphaerella populorum SO2202]
          Length = 273

 Score =  181 bits (460), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 107/251 (42%), Positives = 146/251 (58%), Gaps = 54/251 (21%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSA--------IPIRKAEQLETIDALIIPGGESTTMAL 69
           GVLALQGAF EHI +L   +   ++        + +R A+QL   +ALI+PGGEST ++L
Sbjct: 14  GVLALQGAFIEHITLLTQAAPSLTSQHNTTFTFLEVRTADQLSRCNALILPGGESTAISL 73

Query: 70  IAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFG 128
           IAER G++EPLR+FV+   +PTWGTCAG+ILLA EANK K  GQ+LIGGL++ V+RN FG
Sbjct: 74  IAERCGMLEPLRQFVKFHRRPTWGTCAGLILLAEEANKSKATGQELIGGLDVRVHRNYFG 133

Query: 129 SQIDSFESLLHINHITT----SSDDLFP--AIFIRAPXXXX------------------- 163
            Q++SFE+ L +  +       +DD  P  ++FIRAP                       
Sbjct: 134 RQVESFEAALDLPFLKEEGNGKNDDEQPFHSVFIRAPVVESILKTPSEDDETEKEAVTVS 193

Query: 164 -----XXXXXVEVLARLE-------------HDIGETDASSIVAVRQGSLLGTAFHPELT 205
                     VE+L RL               D+GE     IVAVRQG++ GT+FHPELT
Sbjct: 194 APQIKATSAPVEILGRLPGRARAIKNKTSTAEDLGE--EGDIVAVRQGNVFGTSFHPELT 251

Query: 206 NDDRIHKYFVQ 216
            D+RIH ++++
Sbjct: 252 GDERIHAWWLK 262



>gi|325975749|gb|ADZ47881.1| pyridoxial biosynthesis 2 [Arabidopsis thaliana]
          Length = 255

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 101/221 (45%), Positives = 138/221 (62%), Gaps = 21/221 (9%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG+F EHI  L+ +      + IRKA+QL T+ + IIPGGESTTMA +AE   L 
Sbjct: 4   GVLALQGSFNEHIAALRRLG--VQGVEIRKADQLLTVSSPIIPGGESTTMAKLAEYHNLF 61

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             LR+FV+  KP WGTCAG+I LA  A   K+GGQ+L+GGL+ TV+RN FGSQI SFE+ 
Sbjct: 62  PALREFVKMGKPVWGTCAGLIFLAGRAVGQKEGGQELVGGLDCTVHRNFFGSQIQSFEAD 121

Query: 138 LHINHITT--SSDDLFPAIFIRAPXXXXXXXXXVEVLA----------------RLEHDI 179
           + +  +T+     + +  +FIRAP         VEVLA                +++ + 
Sbjct: 122 ILVPQLTSQEGGPETYRGVFIRAP-AVLDVGPDVEVLADYPVPSNKVLYSSSTVQIQEED 180

Query: 180 GETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQD 220
              +   IVAV+QG+LL TAF+PELT D R H YF+++T++
Sbjct: 181 ALPETKVIVAVKQGNLLATAFYPELTADTRWHSYFIKMTKE 221



>gi|388512311|gb|AFK44217.1| unknown [Lotus japonicus]
          Length = 221

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 105/217 (48%), Positives = 137/217 (63%), Gaps = 21/217 (9%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG+F EHI  L+ +    + + IRK EQL  +++LIIPGGEST MA +AE   L 
Sbjct: 5   GVLALQGSFHEHIAALRKLG--VNGVEIRKPEQLLNVNSLIIPGGESTAMAKLAEYHNLF 62

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             LR+FV+  KP WGTCAG+I LAN+A   K GGQ+L+GGL+ TV+RN FGSQI SFE+ 
Sbjct: 63  PALREFVQLGKPVWGTCAGLIFLANKAAGQKIGGQELVGGLDCTVHRNFFGSQIQSFETE 122

Query: 138 LHINHITT--SSDDLFPAIFIRAPXXXXXXXXXVEVLA-------RL---------EHDI 179
           L +  + +     + F  IFIRAP         V+VLA       RL         + + 
Sbjct: 123 LSVPELASKEGGPETFRGIFIRAP-AIIEAGPDVQVLADYPVRSNRLSTADSPTEDKKEN 181

Query: 180 GETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
            E ++  IVAVRQG+++GTAFHPELT D R H YF++
Sbjct: 182 VEEESKVIVAVRQGNIMGTAFHPELTADTRWHSYFLR 218



>gi|242776513|ref|XP_002478851.1| pyridoxine [Talaromyces stipitatus ATCC 10500]
 gi|218722470|gb|EED21888.1| pyridoxine [Talaromyces stipitatus ATCC 10500]
          Length = 292

 Score =  181 bits (460), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 107/274 (39%), Positives = 153/274 (55%), Gaps = 62/274 (22%)

Query: 9   QQVQPQFK---FGVLALQGAFQEHIHMLQNISQVSSA----------IPIRKAEQLETID 55
           Q ++P+      GVLALQGAF EH+ +L+  + + ++          I +R   QL+  D
Sbjct: 10  QDIEPKMSKITAGVLALQGAFYEHLQLLRKAADILNSSSQQQTQWKFIEVRTKAQLDACD 69

Query: 56  ALIIPGGESTTMALIAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDL 114
           ALI+PGGESTT++L+A  SGL+EPLR FV+   KPTWGTCAG+ILLA  AN+ KKGGQ+L
Sbjct: 70  ALILPGGESTTISLVAASSGLLEPLRDFVKLHRKPTWGTCAGLILLAESANRTKKGGQEL 129

Query: 115 IGGLNITVNRNQFGSQIDSFESLLHINHITTSS--DDL-FPAIFIRAP------------ 159
           IGG+++ VNRN FG Q +SF++ + +  +  S+  + L F  +FIRAP            
Sbjct: 130 IGGIDVRVNRNHFGRQTESFQAPIDLPFLQDSTIPETLPFNGVFIRAPVVERILPHQQGI 189

Query: 160 ---------------------XXXXXXXXXVEVLARLEHDI------------GETDASS 186
                                         VEVLA+L                 E +A  
Sbjct: 190 QIEENQREETIVAPSRSAVDTAAQKILEDQVEVLAKLPGRAARLVANSGVNIDAEKEAED 249

Query: 187 IVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQD 220
           I+AV+QG++ GT+FHPELT+D RIH ++++  +D
Sbjct: 250 IIAVKQGNVFGTSFHPELTDDPRIHLWWLRQVRD 283



>gi|270307960|ref|YP_003330018.1| SNO glutamine amidotransferase family [Dehalococcoides sp. VS]
 gi|502645496|ref|WP_012881854.1| glutamine amidotransferase [Dehalococcoides mccartyi]
 gi|270153852|gb|ACZ61690.1| SNO glutamine amidotransferase family [Dehalococcoides sp. VS]
          Length = 195

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 97/207 (46%), Positives = 133/207 (64%), Gaps = 14/207 (6%)

Query: 15  FKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERS 74
            K GVLALQGAF+EHIHML+ +   + A+ +RKAE+L  +  LIIPGGESTT+  +    
Sbjct: 1   MKIGVLALQGAFREHIHMLRTLG--AEAVEVRKAEELPELSGLIIPGGESTTITKLLYTF 58

Query: 75  GLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSF 134
           GL +P++   R+  P WGTCAGMI LA E +    G + L   ++ITV RN FG Q+DSF
Sbjct: 59  GLAKPIKDLARNGMPVWGTCAGMICLAKELSGDISGVKTL-ELMDITVRRNAFGRQVDSF 117

Query: 135 ESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGS 194
           E++L I  +       FPA+FIRAP         V++LA+L   I       IVAVR+ +
Sbjct: 118 EAMLKIKGLEGGD---FPAVFIRAP-LVEKTGKDVDILAKLPDGI-------IVAVRENN 166

Query: 195 LLGTAFHPELTNDDRIHKYFVQLTQDH 221
           LL T+FHPEL+ D+R H+YF+Q+ +D+
Sbjct: 167 LLATSFHPELSVDNRFHRYFIQMAKDY 193



>gi|189188794|ref|XP_001930736.1| glutamine amidotransferase subunit pdxT [Pyrenophora
           tritici-repentis Pt-1C-BFP]
 gi|187972342|gb|EDU39841.1| glutamine amidotransferase subunit pdxT [Pyrenophora
           tritici-repentis Pt-1C-BFP]
          Length = 285

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 105/253 (41%), Positives = 141/253 (55%), Gaps = 55/253 (21%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSA------IPIRKAEQLETIDALIIPGGESTTMALIA 71
           GVLALQGAF EH+ +L++ S    +      I +R   QLE  D LIIPGGEST M+L+A
Sbjct: 13  GVLALQGAFSEHVQLLRSASSSLPSSLKFQFIQVRTPNQLEQCDGLIIPGGESTAMSLVA 72

Query: 72  ERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQ 130
            RS L+EPLR FV+   +PTWGTCAG+ILLA  AN+ KKGGQDLIGGL++ VNRN FG Q
Sbjct: 73  ARSNLLEPLRDFVKVQRRPTWGTCAGLILLAESANRTKKGGQDLIGGLDVRVNRNHFGRQ 132

Query: 131 IDSFESLLHINHI----TTSSDDLFPAIFIRAPX-------------------------- 160
            +SF++ L +  +     TS ++ +  +FIRAP                           
Sbjct: 133 TESFQANLRLPFLESTKETSKNEPYRCVFIRAPVVEKVLPSKKAVGIQEGEQERDDTIVA 192

Query: 161 ---------XXXXXXXXVEVLARLEHDI---------GETDASSIVAVRQGSLLGTAFHP 202
                            VE++A L  D           ++ +  I+AVRQG++ G +FHP
Sbjct: 193 PSKTPVDDLARKELDQEVEIMATLSTDAKPLQVNQQHDDSGSEDIIAVRQGNVFGCSFHP 252

Query: 203 ELTNDDRIHKYFV 215
           ELTND RIH +++
Sbjct: 253 ELTNDARIHAWWL 265



>gi|217073258|gb|ACJ84988.1| unknown [Medicago truncatula]
          Length = 252

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 105/218 (48%), Positives = 135/218 (61%), Gaps = 21/218 (9%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG+F EHI +L+ +      + IRK EQL TI+ LIIPGGESTTMA +A+   L 
Sbjct: 5   GVLALQGSFNEHIAVLRRLG--VKGVEIRKPEQLLTINPLIIPGGESTTMAKLAQYFNLF 62

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             LR+FV+  KP WGTCAG+I LA++A   K GGQ+L+GGL+ TV+RN FGSQI SFE+ 
Sbjct: 63  PALREFVQMGKPVWGTCAGLIFLADKATGQKTGGQELVGGLDCTVHRNFFGSQIQSFETE 122

Query: 138 LHINHITTS--SDDLFPAIFIRAPXXXXXXXXXVEVLA--------------RLEHDIGE 181
           L +  + +     + F  +FIRAP         V+VLA               +E     
Sbjct: 123 LAVPELVSKEGGPETFRGVFIRAP-AILDVGPEVQVLADYPVPSDKKLSSDSSVEDKKEN 181

Query: 182 TDASS--IVAVRQGSLLGTAFHPELTNDDRIHKYFVQL 217
            D  S  IVAVRQG++L TAFHPELT D R H YF+++
Sbjct: 182 ADEKSKVIVAVRQGNILATAFHPELTADTRWHSYFLKM 219



>gi|494827711|gb|EON64636.1| glutamine amidotransferase [Coniosporium apollinis CBS 100218]
          Length = 286

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 112/272 (41%), Positives = 149/272 (54%), Gaps = 67/272 (24%)

Query: 10  QVQPQFKFGVLALQGAFQEHIHMLQNISQVSS----AIP------IRKAEQLETIDALII 59
           Q +PQ   GVLALQGAF EH+ +LQ  +   +    A P      +R   +L+  DALII
Sbjct: 3   QSRPQITVGVLALQGAFSEHLQLLQQAAAALAANRVAGPAWRFTEVRTPAELDRCDALII 62

Query: 60  PGGESTTMALIAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGL 118
           PGGESTTM+L+A RSG++EPLR FV+   KPTWGTCAG+ILLA  ANK KKGGQ+LIGGL
Sbjct: 63  PGGESTTMSLVASRSGMLEPLRDFVKAHRKPTWGTCAGLILLAESANKTKKGGQELIGGL 122

Query: 119 NITVNRNQFGSQIDSFESLLHINHI-------TTSSDDLFPAIFIRAP------------ 159
           ++ V RN FG Q++SF + L +  +       T +    F ++FIRAP            
Sbjct: 123 DVRVERNHFGRQVESFTAELDLPFLAATEAVETKTDKRPFRSVFIRAPVVEKILPHTAGM 182

Query: 160 ---------------------XXXXXXXXXVEVLARL--------------EHDIGETDA 184
                                         VE++ARL                +IGE   
Sbjct: 183 QVVEAAKDGTIVAPSRMPTDEVARREFDKEVEIMARLPGRAKAWSKFSDATAREIGEE-- 240

Query: 185 SSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
             I+AVRQG++ GT+FHPELT D+RIH ++++
Sbjct: 241 GDIIAVRQGNVFGTSFHPELTGDERIHVWWLE 272



>gi|389628346|ref|XP_003711826.1| glutamine amidotransferase subunit pdxT [Magnaporthe oryzae 70-15]
 gi|351644158|gb|EHA52019.1| glutamine amidotransferase subunit pdxT [Magnaporthe oryzae 70-15]
          Length = 246

 Score =  181 bits (459), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 101/230 (43%), Positives = 138/230 (60%), Gaps = 36/230 (15%)

Query: 18  GVLALQGAFQEHIHMLQNISQV-------SSAIP------IRKAEQLETIDALIIPGGES 64
           GVLALQGAF+EH+ +LQ  S +       +  +P      +R  +QL   D L+IPGGES
Sbjct: 11  GVLALQGAFEEHLKLLQRASTLFGSRHVAAKRVPEFEFLEVRTPDQLARCDGLVIPGGES 70

Query: 65  TTMALIAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVN 123
           TT+A +A ++ LMEPLR FV+ D K TWGTCAG+ILLA+EA   KKGGQ+L+GGL++  +
Sbjct: 71  TTLAFVARQTNLMEPLRDFVKVDRKSTWGTCAGLILLADEATGAKKGGQELVGGLHVRAH 130

Query: 124 RNQFGSQIDSFESLLHINHITTSS------DDL-----FPAIFIRAPXX-------XXXX 165
           RN FG Q+ SF++ L +  +   +      DD      FP +FIRAP             
Sbjct: 131 RNHFGRQVHSFQADLELPFLGDKAGSGGEGDDSTATRPFPGVFIRAPVVETILSGDAAGD 190

Query: 166 XXXVEVLARLEHDIGETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFV 215
              VEVL      +   D   I+AVRQG++  T+FHPELT+D RIH +++
Sbjct: 191 GDRVEVLG----TVARGDEKDIIAVRQGNVFATSFHPELTDDARIHLWWL 236



>gi|116195050|ref|XP_001223337.1| hypothetical protein CHGG_04123 [Chaetomium globosum CBS 148.51]
 gi|88180036|gb|EAQ87504.1| hypothetical protein CHGG_04123 [Chaetomium globosum CBS 148.51]
          Length = 244

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 102/229 (44%), Positives = 138/229 (60%), Gaps = 20/229 (8%)

Query: 18  GVLALQGAFQEHIHMLQN-ISQVSSA-------IPIRKAEQLETIDALIIPGGESTTMAL 69
           GVLALQG   EH+++L+   S V S          +R A QL   DALIIPGGESTTMA+
Sbjct: 10  GVLALQGGVVEHLNLLRKATSHVQSPDSIRFTFTEVRTAPQLAQCDALIIPGGESTTMAI 69

Query: 70  IAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFG 128
           +A R GL++PLR+FV+   KP WGTCAG+++LA +A   K+GGQ+ IGGL++ V RN++G
Sbjct: 70  VARRLGLLDPLREFVKVQHKPVWGTCAGLVMLAEQAAATKQGGQEQIGGLDVRVLRNRYG 129

Query: 129 SQIDSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXX--------VEVLARLEHDIG 180
           +Q+ SF + L +  I       F A+FIRAP                 VEVL       G
Sbjct: 130 TQMQSFVAGLDLGSILGEDAAPFRAVFIRAPVVEEVIAEAGSQKQGHRVEVLGLCRGPGG 189

Query: 181 ETDASS---IVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQDHYNTGK 226
           + +      IVAVRQG++ GT+FHPELT+D RIH ++++   D    GK
Sbjct: 190 QVEGEGKGDIVAVRQGNVFGTSFHPELTDDVRIHVWWLEQVADAVRHGK 238



>gi|225678864|gb|EEH17148.1| glutamine amidotransferase subunit pdxT [Paracoccidioides
           brasiliensis Pb03]
          Length = 279

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 107/264 (40%), Positives = 148/264 (56%), Gaps = 61/264 (23%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSA--------IPIRKAEQLETIDALIIPGGESTTMAL 69
           GVLALQGAF EH+ +L   +   S         I +R + QL++ D LIIPGGESTT++L
Sbjct: 6   GVLALQGAFYEHLKLLHKAATTLSPDDPKKWKFIEVRTSAQLDSCDGLIIPGGESTTISL 65

Query: 70  IAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFG 128
           +A RS L++PLR FV+   +PTWGTCAG+ILLA  AN+ KKGGQ+LIGGL++ VNRN FG
Sbjct: 66  VAARSQLLDPLRDFVKLHRRPTWGTCAGLILLAESANRTKKGGQELIGGLDVRVNRNHFG 125

Query: 129 SQIDSFESLLHINHITT--------SSDDLFPAIFIRA---------------------- 158
            Q +SF++ +++  ++         SS   F  +FIRA                      
Sbjct: 126 RQAESFQAPVNLPFLSEVCQEARNGSSPASFMGVFIRAPVVEKLLSFEDGVQVEEQRREG 185

Query: 159 -----------PXXXXXXXXXVEVLARLEH----------DI-GETDASSIVAVRQGSLL 196
                      P         V+VLA+L            DI  E DA  IVAV+QG++ 
Sbjct: 186 TVVAPSRQTEDPAALKVMSNHVDVLAKLPGRATRLTGAGVDIEAEADAGDIVAVKQGNVF 245

Query: 197 GTAFHPELTNDDRIHKYFVQLTQD 220
           GT+FHPELT+D RIH ++++  ++
Sbjct: 246 GTSFHPELTDDPRIHIWWLRQVEN 269



>gi|225559400|gb|EEH07683.1| glutamine amidotransferase subunit pdxT [Ajellomyces capsulatus
           G186AR]
 gi|240282338|gb|EER45841.1| glutamine amidotransferase subunit pdxT [Ajellomyces capsulatus
           H143]
 gi|325088473|gb|EGC41783.1| glutamine amidotransferase subunit pdxT [Ajellomyces capsulatus
           H88]
          Length = 279

 Score =  181 bits (458), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 109/260 (41%), Positives = 144/260 (55%), Gaps = 61/260 (23%)

Query: 18  GVLALQGAFQEHIHMLQ--------NISQVSSAIPIRKAEQLETIDALIIPGGESTTMAL 69
           GVLALQGAF EH+ +L+        N  Q  + I +R   +LE  D LIIPGGESTT++L
Sbjct: 6   GVLALQGAFYEHLKLLRKAAASLSPNEPQKWNFIEVRTPTELERCDGLIIPGGESTTISL 65

Query: 70  IAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFG 128
           +A RS L+EPLR FV+   +PTWGTCAG+ILLA  AN+ K+GGQ+LIGGL++ VNRN FG
Sbjct: 66  VAARSQLLEPLRDFVKFHRRPTWGTCAGLILLAESANRTKEGGQELIGGLDVRVNRNHFG 125

Query: 129 SQIDSFESLLHINHIT--------TSSDDLFPAIFIRA---------------------- 158
            Q +SF++ L++  +         +     F  +FIRA                      
Sbjct: 126 RQTESFQTPLNLPFLAEGRLKSEVSDQATTFMGVFIRAPVVEKVLPFVNDIQVEEQKREG 185

Query: 159 -----------PXXXXXXXXXVEVLARLE----------HDI-GETDASSIVAVRQGSLL 196
                      P         V+VLA L            DI  ETDA  IVAV+QG++ 
Sbjct: 186 TIVAPSRHPRDPVARKAISHHVDVLATLPGRAAKLAGTGADIHSETDAGDIVAVKQGNVF 245

Query: 197 GTAFHPELTNDDRIHKYFVQ 216
           GT+FHPELT+D RIH +++Q
Sbjct: 246 GTSFHPELTDDPRIHAWWLQ 265



>gi|470117764|ref|XP_004295019.1| PREDICTED: pyridoxal biosynthesis protein PDX2-like isoform 1
           [Fragaria vesca subsp. vesca]
          Length = 256

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 105/226 (46%), Positives = 139/226 (61%), Gaps = 26/226 (11%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG++ EHI +L+ +      + I+K EQLE + +LIIPGGESTTMA +AE   L 
Sbjct: 5   GVLALQGSYNEHIAVLRRLG--VKGVEIKKPEQLENLASLIIPGGESTTMAKLAEYHNLF 62

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             LR+FV+  KP WGTCAG+I LAN A   K GGQ+L+GGL+  V+RN FGSQI SFE+ 
Sbjct: 63  PALREFVKMGKPVWGTCAGLIFLANRATGQKIGGQELVGGLDCMVHRNFFGSQIQSFETE 122

Query: 138 LHINHITT--SSDDLFPAIFIRAPXXXXXXXXXVEVLAR--------------LEHD--- 178
           L +  + +     ++F  +FIRAP         VEVLA               +E D   
Sbjct: 123 LSVPELASKEGGPEVFRGVFIRAP-AILEVGPGVEVLADYPVPANKWKNSNPGVEGDKDW 181

Query: 179 IGETDASS----IVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQD 220
           + + ++ S    IVAVRQG+LL TAFHPELT D R H YF+++  +
Sbjct: 182 VFQENSGSEKKVIVAVRQGNLLATAFHPELTADTRWHSYFLKMATE 227



>gi|357146498|ref|XP_003574014.1| PREDICTED: pyridoxal biosynthesis protein PDX2-like [Brachypodium
           distachyon]
          Length = 254

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 104/220 (47%), Positives = 135/220 (61%), Gaps = 20/220 (9%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG++ EH+  L+ I   +  + +RKAEQL  ID+LIIPGGESTTMA +A    L 
Sbjct: 5   GVLALQGSYNEHMAALRRIG--AKGVEVRKAEQLGAIDSLIIPGGESTTMAKLANYHNLF 62

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             LR+FV   KP WGTCAG+I LAN+A   K GGQ+L+GGL+ TV+RN FGSQ+ SFE+ 
Sbjct: 63  PALREFVGAGKPVWGTCAGLIFLANKAVGQKSGGQELVGGLDCTVHRNFFGSQLQSFETE 122

Query: 138 LHINHIT--TSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIG-----------ETDA 184
           L +  +       ++   +FIRAP         VEVLA      G           E + 
Sbjct: 123 LSVPMLAEKEGGSNICRGVFIRAP-AILEVGPDVEVLADCPVPAGRPSITISAEGAEDEV 181

Query: 185 SS----IVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQD 220
            S    IVAVRQG++L TAFHPELT+D R H+ F+ + +D
Sbjct: 182 YSKDRVIVAVRQGNILATAFHPELTSDSRWHRLFLDMDKD 221



>gi|502147413|ref|XP_004506773.1| PREDICTED: pyridoxal biosynthesis protein PDX2-like [Cicer
           arietinum]
          Length = 253

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 103/218 (47%), Positives = 134/218 (61%), Gaps = 21/218 (9%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG+F EHI  L+ +      + IRK EQL T+++LIIPGGESTTMA +AE   L 
Sbjct: 5   GVLALQGSFNEHIAALKRLG--VKGVEIRKPEQLLTVNSLIIPGGESTTMAKLAEYFNLF 62

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             LR+FV+  KP WGTCAG+I LA++A   K GGQ L+GGL+ TV+RN FGSQI SFE+ 
Sbjct: 63  PALREFVQMGKPVWGTCAGLIFLADKAIGQKIGGQQLVGGLDCTVHRNFFGSQIQSFETE 122

Query: 138 LHINHITTS--SDDLFPAIFIRAPXXXXXXXXXVEVLARL----------------EHDI 179
           L +  + +     + F  +FIRAP         V+VLA                  + + 
Sbjct: 123 LAVPELASKEGGPETFRGVFIRAP-AILDVGPEVQVLADYPVPSDKVTSSDSSVEDKKEN 181

Query: 180 GETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQL 217
            E +   IVAVRQG++L TAFHPELT D R H YF+++
Sbjct: 182 AEEENKVIVAVRQGNILATAFHPELTADTRWHSYFLKM 219



>gi|255578878|ref|XP_002530293.1| Glutamine amidotransferase subunit pdxT, putative [Ricinus
           communis]
 gi|223530191|gb|EEF32100.1| Glutamine amidotransferase subunit pdxT, putative [Ricinus
           communis]
          Length = 253

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 97/220 (44%), Positives = 133/220 (60%), Gaps = 19/220 (8%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG+F EHI  L+ +      + IRK EQL+ + +LIIPGGESTTMA +AE   L 
Sbjct: 5   GVLALQGSFNEHIAALKRLG--VKGVEIRKPEQLDNVTSLIIPGGESTTMAKLAEYHNLF 62

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             LR+FV+  KP WGTCAG+I LA++A   K GGQ+L+GGL+ TV+RN FGSQI SFE+ 
Sbjct: 63  PALREFVQTGKPVWGTCAGLIFLADKAVGQKTGGQELVGGLDCTVHRNYFGSQIQSFETE 122

Query: 138 LHINHITT--SSDDLFPAIFIRAPXXXXXXXXXVEV---------------LARLEHDIG 180
           L +  + +     + F  +FIRAP           +                 +++ +  
Sbjct: 123 LSVPELVSKEGGPETFRGVFIRAPAVVEVGPGVEVLAEYPVPSTNVLYSSSAVQIQEENA 182

Query: 181 ETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQD 220
             +   IVAV+QG++LGTAFHPELT D R H +F+++  D
Sbjct: 183 LPEKRVIVAVKQGNMLGTAFHPELTADTRWHSFFLKMGGD 222



>gi|406602993|emb|CCH45461.1| CTP synthase [Wickerhamomyces ciferrii]
          Length = 242

 Score =  180 bits (456), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 104/242 (42%), Positives = 135/242 (55%), Gaps = 46/242 (19%)

Query: 11  VQPQFKFGVLALQGAFQEHIHMLQNISQVSS-----AIPIRKAEQLETIDALIIPGGEST 65
           V  Q+  GVLALQGAF+EHI +LQ  +Q  S      I +R  E+L T D+L+IPGGEST
Sbjct: 3   VLKQYTVGVLALQGAFKEHIELLQAATQTYSDLNFKFIEVRTPEELITCDSLVIPGGEST 62

Query: 66  TMALIAERSGLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRN 125
            M+LIAER+G+ EPL K+++ +KP WGTCAG+I LA +     +  Q ++G L+I V RN
Sbjct: 63  AMSLIAERTGMFEPLLKYIQSDKPIWGTCAGLIFLAKQIIN-GRPEQKILGALDIQVKRN 121

Query: 126 QFGSQIDSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXX----------------- 168
            FG Q +SFES L         D+ FP +FIRAP                          
Sbjct: 122 AFGRQQESFESPLDFGSFIPGVDN-FPTVFIRAPVISKILETSYNKEFIPIESIIDNQDQ 180

Query: 169 ---------------VEVLARLEHDIGETDASSIVAVRQGSLLGTAFHPELTNDDRIHKY 213
                          V+VL +L       D+  IVAVRQG +LGT+FHPELTND R HK+
Sbjct: 181 NIIYSNNKDFQNNSPVQVLHKL-------DSGLIVAVRQGKILGTSFHPELTNDFRFHKW 233

Query: 214 FV 215
           F+
Sbjct: 234 FI 235



>gi|449298183|gb|EMC94200.1| hypothetical protein BAUCODRAFT_58739, partial [Baudoinia
           compniacensis UAMH 10762]
          Length = 258

 Score =  180 bits (456), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 113/256 (44%), Positives = 144/256 (56%), Gaps = 61/256 (23%)

Query: 17  FGVLALQGAFQEHIHML----------QNISQVSSA----IPIRKAEQLETIDALIIPGG 62
            GVLALQGAF EHI +L          Q+   V +     I +R A +L    ALIIPGG
Sbjct: 6   IGVLALQGAFIEHIKLLHQAAVELRLQQDALYVDNKDLRFIEVRNASELAHCHALIIPGG 65

Query: 63  ESTTMALIAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNIT 121
           EST+M+LIAERSGL+EPLR FV+ D KP WGTCAG+ILLA  AN+ K  GQ+LIGGL++ 
Sbjct: 66  ESTSMSLIAERSGLLEPLRDFVKVDRKPVWGTCAGLILLAESANRSKTTGQELIGGLDVR 125

Query: 122 VNRNQFGSQIDSFESLLHINHITTSSDDL-FPAIFIRAPX-------------------- 160
           V RN FG Q++SFE+ L +  +    D L F ++FIRAP                     
Sbjct: 126 VQRNYFGRQVESFEADLELPFL---EDGLPFHSVFIRAPVVEKVLPSTTSNTADSNAATI 182

Query: 161 -------XXXXXXXXVEVLARL-------------EHDIGETDASSIVAVRQGSLLGTAF 200
                          VE+L RL               D+GE     IVAVRQG+++GTAF
Sbjct: 183 GGNVIAPSKRATTAPVEILGRLPGRARTLKDRTTTAEDLGED--GDIVAVRQGNVVGTAF 240

Query: 201 HPELTNDDRIHKYFVQ 216
           HPELT+D RIH ++++
Sbjct: 241 HPELTDDPRIHVWWLK 256



>gi|57234604|ref|YP_181340.1| glutamine amidotransferase subunit PdxT [Dehalococcoides
           ethenogenes 195]
 gi|499238833|ref|WP_010936373.1| glutamine amidotransferase [Dehalococcoides mccartyi]
 gi|119388909|sp|Q3Z8V9.1|PDXT_DEHE1 RecName: Full=Glutamine amidotransferase subunit PdxT; AltName:
           Full=Glutamine amidotransferase glutaminase subunit PdxT
 gi|57225052|gb|AAW40109.1| SNO glutamine amidotransferase family [Dehalococcoides ethenogenes
           195]
          Length = 195

 Score =  180 bits (456), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 96/207 (46%), Positives = 133/207 (64%), Gaps = 14/207 (6%)

Query: 15  FKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERS 74
            K GVLALQGAF+EHI+ML+ +   + A+ +RKAE+L  +  LIIPGGESTT+  +    
Sbjct: 1   MKIGVLALQGAFREHINMLRTLG--AEAVEVRKAEELAELSGLIIPGGESTTITKLLYTF 58

Query: 75  GLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSF 134
           GL +P++   R+  P WGTCAGMI LA E +    G + L   ++ITV RN FG Q+DSF
Sbjct: 59  GLAKPVKDLARNGMPVWGTCAGMICLAKELSGDISGVKTL-ELMDITVRRNAFGRQVDSF 117

Query: 135 ESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGS 194
           E++L +  +       FPA+FIRAP         VEVLA+L          ++VAVR+ +
Sbjct: 118 EAMLKVKALEGGD---FPAVFIRAP-LVEKTGQWVEVLAKLPD-------GTMVAVRENN 166

Query: 195 LLGTAFHPELTNDDRIHKYFVQLTQDH 221
           LL T+FHPEL+ D+R H+YFVQ+ +D+
Sbjct: 167 LLATSFHPELSADNRFHRYFVQMAKDY 193



>gi|353237153|emb|CCA69133.1| probable Sno-type pyridoxine vitamin B6 biosynthetic protein SNO1
           [Piriformospora indica DSM 11827]
          Length = 251

 Score =  179 bits (455), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 105/226 (46%), Positives = 133/226 (58%), Gaps = 30/226 (13%)

Query: 19  VLALQGAFQEHIHMLQNISQVSS----AIP------IRKAEQLETIDALIIPGGESTTMA 68
           +LALQGAF EH   L N++  S     ++P      +R   +L   DALIIPGGESTTMA
Sbjct: 12  ILALQGAFAEHQTTLNNLANKSCTKVKSMPKLLSKLVRTPAELAECDALIIPGGESTTMA 71

Query: 69  LIAERSGLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFG 128
           L+A  SGL+EPLR+FV+  KP WGTCAG ILLA      KKGGQ+L+GG+ + + RN FG
Sbjct: 72  LLARISGLLEPLREFVQ-RKPVWGTCAGAILLAESIEGSKKGGQELLGGMAVKIGRNGFG 130

Query: 129 SQIDSFESLLHINH---ITTSSDDLFPAIFIRAPX----XXXXXXXXVEVLARLEHD--- 178
           SQIDSFE+ L  +      T   + F  +FIRAP             ++VLA++  +   
Sbjct: 131 SQIDSFEAPLLCSPEAVALTKRPEEFVGVFIRAPVVLGITEDPSRPKIQVLAKISPEALP 190

Query: 179 ---------IGETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFV 215
                      E D   IVA+RQG L+ T FHPELT DDR H+YFV
Sbjct: 191 KSEDATDSTTPEDDPRLIVALRQGHLVLTTFHPELTKDDRFHEYFV 236



>gi|330939417|ref|XP_003305845.1| hypothetical protein PTT_18795 [Pyrenophora teres f. teres 0-1]
 gi|311316987|gb|EFQ86078.1| hypothetical protein PTT_18795 [Pyrenophora teres f. teres 0-1]
          Length = 285

 Score =  179 bits (454), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 105/253 (41%), Positives = 138/253 (54%), Gaps = 55/253 (21%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSA------IPIRKAEQLETIDALIIPGGESTTMALIA 71
           GVLALQGAF EH+ +L++ S    +      I +R   QLE  D LIIPGGEST M+L+A
Sbjct: 13  GVLALQGAFSEHVQLLRSASSSLPSSLKFQFIEVRTPSQLEQCDGLIIPGGESTAMSLVA 72

Query: 72  ERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQ 130
            RS L+EPLR FV+   +PTWGTCAG+ILLA  AN+ KKGGQDLIGGL++ VNRN FG Q
Sbjct: 73  ARSNLLEPLRDFVKVQRRPTWGTCAGLILLAESANRTKKGGQDLIGGLDVRVNRNHFGRQ 132

Query: 131 IDSFESLLHINHITT----SSDDLFPAIFIRAPX-------------------------- 160
            +SF++ L +  +      S ++ +  +FIRAP                           
Sbjct: 133 TESFQANLRLPFLACTKEASKNEPYRCVFIRAPVVEKVLPSKKAVGIQEGEQERDDTIVA 192

Query: 161 ---------XXXXXXXXVEVLARLEHDIG---------ETDASSIVAVRQGSLLGTAFHP 202
                            VEV+A L  D              +  I+AVRQG++ G +FHP
Sbjct: 193 PSKTPVDDLARKQLDREVEVMATLSTDAKPLQENQHHEHPGSEDIIAVRQGNVFGCSFHP 252

Query: 203 ELTNDDRIHKYFV 215
           ELTND RIH +++
Sbjct: 253 ELTNDARIHAWWL 265



>gi|224104651|ref|XP_002313515.1| predicted protein [Populus trichocarpa]
 gi|222849923|gb|EEE87470.1| predicted protein [Populus trichocarpa]
          Length = 254

 Score =  179 bits (453), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 101/221 (45%), Positives = 134/221 (60%), Gaps = 21/221 (9%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG+F EHI  L  +      + IRK EQL+ + +LIIPGGESTTMA +AE   L 
Sbjct: 5   GVLALQGSFNEHIAALARLG--VKGMEIRKPEQLQNVTSLIIPGGESTTMAKLAEFHNLF 62

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             LR+FV+  KP WGTCAG+I LAN+A   K GGQ+L+GGL+ TV+RN FGSQI SFE+ 
Sbjct: 63  PALREFVQMGKPVWGTCAGLIFLANKAIGQKTGGQELVGGLDCTVHRNYFGSQIQSFEAE 122

Query: 138 LHINHITT--SSDDLFPAIFIRAPXXXXXXXXXVEVLA----------------RLEHDI 179
           L +  +       + F  +FIRAP         V+VLA                +++ + 
Sbjct: 123 LTVPELACKEGGPETFRGVFIRAP-AILEVGPGVDVLAECPVPSTNVLYSSSAVQIQEEN 181

Query: 180 GETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQD 220
              +   IVA++Q +LLGTAFHPELT D R H YF+++  +
Sbjct: 182 SVPEEKVIVAIKQRNLLGTAFHPELTADTRWHSYFLKMASE 222



>gi|116781483|gb|ABK22118.1| unknown [Picea sitchensis]
          Length = 263

 Score =  179 bits (453), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 104/220 (47%), Positives = 134/220 (60%), Gaps = 23/220 (10%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG+F EH+  L  +      + ++K EQLE +  LIIPGGESTTMA +AE   L+
Sbjct: 4   GVLALQGSFHEHLAALGKLG--VKGVLVKKPEQLEGLVGLIIPGGESTTMARLAEYHNLI 61

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
           + L+ F +  KP WGTCAG+I LAN+A   K GGQ+LIGGL+ TV+RN FG Q++SFE+ 
Sbjct: 62  QALQNFYKKGKPIWGTCAGLIFLANKAIGQKSGGQELIGGLDCTVHRNFFGCQLNSFETE 121

Query: 138 LHINHITT--SSDDLFPAIFIRAPXXXXXXXXXVEVLAR--------------LEHDIGE 181
           L I  I       + F A+FIRAP         VEVLA               +E+   E
Sbjct: 122 LPIPKIAAEEGGPETFRAVFIRAP-AILEAGPSVEVLAEYTLLSNESTKFCSTIENTENE 180

Query: 182 ----TDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQL 217
               T    IVAV+QG+LL TAFHPELT+D R H YF+++
Sbjct: 181 GQCQTGQKVIVAVKQGNLLATAFHPELTSDTRWHSYFLKM 220



>gi|302763393|ref|XP_002965118.1| hypothetical protein SELMODRAFT_167143 [Selaginella moellendorffii]
 gi|300167351|gb|EFJ33956.1| hypothetical protein SELMODRAFT_167143 [Selaginella moellendorffii]
          Length = 255

 Score =  178 bits (452), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 104/214 (48%), Positives = 132/214 (61%), Gaps = 15/214 (7%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG+F EH+  L+ +     AI +RKA+QLE +  LIIPGGESTTMA +A +  L 
Sbjct: 4   GVLALQGSFHEHVLALRRLG--VHAIEVRKADQLEGLAGLIIPGGESTTMAKLANQYNLF 61

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             L+ F    KP WGTCAG+I LA+ A  +K GGQ+L+GGL+ TV+RN FGSQ++SFE+ 
Sbjct: 62  PALKDFSTSGKPMWGTCAGLIFLADRATGLKDGGQELLGGLDCTVHRNFFGSQVNSFETE 121

Query: 138 LHINHITTS--SDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDI--------GE--TDAS 185
           L +  +  S        A+FIRAP         VE +A  E           GE  T   
Sbjct: 122 LAVPALAASEGGPPRCRAVFIRAP-AIVEFGSSVEQIADCEVPSFSAPPSLEGEMFTRRR 180

Query: 186 SIVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQ 219
             VAVRQG+ LGTAFHPELT+D R H YFV++ Q
Sbjct: 181 VAVAVRQGNFLGTAFHPELTSDTRWHSYFVKMVQ 214



>gi|169865642|ref|XP_001839419.1| glutamine amidotransferase subunit pdxT [Coprinopsis cinerea
           okayama7#130]
 gi|116499427|gb|EAU82322.1| glutamine amidotransferase subunit pdxT [Coprinopsis cinerea
           okayama7#130]
          Length = 230

 Score =  178 bits (452), Expect = 8e-43,   Method: Compositional matrix adjust.
 Identities = 99/214 (46%), Positives = 135/214 (63%), Gaps = 17/214 (7%)

Query: 17  FGVLALQGAFQEHIHMLQNI--SQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERS 74
            G+LALQGAF EH   L+ +  S+    I ++  E+L   DALIIPGGESTT+AL+A+ S
Sbjct: 10  IGILALQGAFVEHQSSLERLRLSRTIQVILVKTLEELNQCDALIIPGGESTTIALLAKLS 69

Query: 75  GLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSF 134
           GL+EPLR+FV+ EKP WGTCAG ILLA +    KKGGQ+++GG++IT+ RN +GSQ++SF
Sbjct: 70  GLLEPLRQFVK-EKPVWGTCAGAILLAEKVENTKKGGQEVLGGMSITIARNGWGSQVESF 128

Query: 135 ESLLHINHITTSSDDLFPAIFIRAPXXXXXXXX----XVEVLARLEHDI---------GE 181
           E  L ++ +  S +  +   FIRAP             ++V+A L   +           
Sbjct: 129 EGDLTVDGLRNSGEP-YKGFFIRAPVVVALHPKPEDLPIQVIASLSPALLPPALQSPDHS 187

Query: 182 TDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFV 215
            +  + VA+RQG  L T FHPELT DDR H+YFV
Sbjct: 188 DEPKTYVALRQGLHLLTTFHPELTKDDRFHEYFV 221



>gi|398404630|ref|XP_003853781.1| hypothetical protein MYCGRDRAFT_69702, partial [Zymoseptoria
           tritici IPO323]
 gi|339473664|gb|EGP88757.1| hypothetical protein MYCGRDRAFT_69702 [Zymoseptoria tritici IPO323]
          Length = 306

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 103/250 (41%), Positives = 141/250 (56%), Gaps = 55/250 (22%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSA--------------IPIRKAEQLETIDALIIPGGE 63
           GVLALQGAF EHI +L+  +   ++              I +R  EQL   DAL++PGGE
Sbjct: 7   GVLALQGAFVEHIVLLKQAAAFLASSNDPTSGKIRNFTCIEVRTEEQLRQCDALVLPGGE 66

Query: 64  STTMALIAERSGLMEPLRKFVRD-EKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITV 122
           ST ++L+AERSG++EPLR +V+   KP WGTCAG+ILLA  ANK K  GQ+LIGGL++ V
Sbjct: 67  STAISLVAERSGILEPLRDYVKVLRKPVWGTCAGLILLAESANKSKSTGQELIGGLDVRV 126

Query: 123 NRNQFGSQIDSFESLLHINHITTSSDDLFPAIFIRAPXXXXX------------------ 164
           +RN FG Q++SF + L +  +  S    FP++FIRAP                       
Sbjct: 127 HRNYFGRQVESFTADLDLPFLGDSRR--FPSVFIRAPVVEKVLPPSAAPIDHSAEGRISA 184

Query: 165 -----XXXXVEVLARL-------------EHDIGETDASSIVAVRQGSLLGTAFHPELTN 206
                    VE+L RL               ++GE     I+AVRQG++ GT+FHPELT 
Sbjct: 185 PPRRETSATVEILGRLPGRAKAIRDKTVTAEELGED--GDIIAVRQGNVFGTSFHPELTG 242

Query: 207 DDRIHKYFVQ 216
           D RIH ++++
Sbjct: 243 DSRIHAWWLK 252



>gi|115444005|ref|NP_001045782.1| Os02g0130100 [Oryza sativa Japonica Group]
 gi|41052553|dbj|BAD07735.1| putative amidotransferase [Oryza sativa Japonica Group]
 gi|41053060|dbj|BAD07990.1| putative amidotransferase [Oryza sativa Japonica Group]
 gi|113535313|dbj|BAF07696.1| Os02g0130100 [Oryza sativa Japonica Group]
 gi|125580681|gb|EAZ21612.1| hypothetical protein OsJ_05242 [Oryza sativa Japonica Group]
 gi|215768467|dbj|BAH00696.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 255

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 102/222 (45%), Positives = 135/222 (60%), Gaps = 23/222 (10%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG+F EH+  L+ I      + +RK EQL+ +D+LIIPGGESTTMA +A    L 
Sbjct: 5   GVLALQGSFNEHLAALRRIG--VRGVEVRKPEQLQGLDSLIIPGGESTTMAKLANYHNLF 62

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             LR+FV   +P WGTCAG+I LAN+A   K GGQ+LIGGL+ TV+RN FGSQ+ SFE+ 
Sbjct: 63  PALREFVGTGRPVWGTCAGLIFLANKAVGQKSGGQELIGGLDCTVHRNFFGSQLQSFETE 122

Query: 138 LHINHIT--TSSDDLFPAIFIRAPXXXXXXXXXVEVLAR-----------------LEHD 178
           L +  +       D    +FIRAP         VEVLA                  +E +
Sbjct: 123 LSVPMLAEKEGGSDTCRGVFIRAP-AILDVGSNVEVLADCPVPSDRPSITIASGEGVEEE 181

Query: 179 IGETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQD 220
           +   D   IVAVRQG++L TAFHPELT+D R H++F+ + ++
Sbjct: 182 VYSKD-RVIVAVRQGNILATAFHPELTSDSRWHRFFLDMDKE 222



>gi|440463600|gb|ELQ33170.1| glutamine amidotransferase subunit pdxT [Magnaporthe oryzae Y34]
 gi|440479186|gb|ELQ59969.1| glutamine amidotransferase subunit pdxT [Magnaporthe oryzae P131]
          Length = 256

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 101/240 (42%), Positives = 138/240 (57%), Gaps = 46/240 (19%)

Query: 18  GVLALQGAFQEHIHMLQNISQV-------SSAIP------IRKAEQLETIDALIIPGGES 64
           GVLALQGAF+EH+ +LQ  S +       +  +P      +R  +QL   D L+IPGGES
Sbjct: 11  GVLALQGAFEEHLKLLQRASTLFGSRHVAAKRVPEFEFLEVRTPDQLARCDGLVIPGGES 70

Query: 65  TTMALIAERSGLMEPLRKFVR-----------DEKPTWGTCAGMILLANEANKVKKGGQD 113
           TT+A +A ++ LMEPLR FV+           D K TWGTCAG+ILLA+EA   KKGGQ+
Sbjct: 71  TTLAFVARQTNLMEPLRDFVKQKLTWRGKKRVDRKSTWGTCAGLILLADEATGAKKGGQE 130

Query: 114 LIGGLNITVNRNQFGSQIDSFESLLHINHITTSS------DDL-----FPAIFIRAPXX- 161
           L+GGL++  +RN FG Q+ SF++ L +  +   +      DD      FP +FIRAP   
Sbjct: 131 LVGGLHVRAHRNHFGRQVHSFQADLELPFLGDKAGSGGEGDDSTATRPFPGVFIRAPVVE 190

Query: 162 ------XXXXXXXVEVLARLEHDIGETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFV 215
                        VEVL      +   D   I+AVRQG++  T+FHPELT+D RIH +++
Sbjct: 191 TILSGDAAGDGDRVEVLG----TVARGDEKDIIAVRQGNVFATSFHPELTDDARIHLWWL 246



>gi|327303372|ref|XP_003236378.1| pyridoxine [Trichophyton rubrum CBS 118892]
 gi|326461720|gb|EGD87173.1| pyridoxine [Trichophyton rubrum CBS 118892]
          Length = 267

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 103/245 (42%), Positives = 134/245 (54%), Gaps = 48/245 (19%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSA------------IPIRKAEQLETIDALIIPGGEST 65
           GVLALQGAF EHI  L+  ++                I +R+  +L   D LIIPGGEST
Sbjct: 6   GVLALQGAFHEHIQQLKVAAEKLRGSSKTFTKEQWEFIEVRRPAELARCDGLIIPGGEST 65

Query: 66  TMALIAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNR 124
            MAL+A RS L+EPLR FV+   KPTWGTCAG+ILLA  AN+ K+GGQ+LIGGL++ VNR
Sbjct: 66  AMALVAARSNLLEPLRDFVKLHRKPTWGTCAGLILLAESANRTKRGGQELIGGLDVRVNR 125

Query: 125 NQFGSQIDSFESLLHINHITTSSDDLFPAIFIRAP------------------------- 159
           N FG Q +SF + L +  +   +   F A+FIRAP                         
Sbjct: 126 NHFGRQTESFYAPLDLPFLPGDAGP-FRAVFIRAPVVEKVLSAKEGIQDEELAIDGTVVA 184

Query: 160 --------XXXXXXXXXVEVLARLEHDI-GETDASSIVAVRQGSLLGTAFHPELTNDDRI 210
                            VE+L +L     G      IVAV+QG++ GT+FHPELT+D RI
Sbjct: 185 PSRKPESEVARKAMADKVEILGKLPAKADGSGGPGDIVAVKQGNVFGTSFHPELTDDARI 244

Query: 211 HKYFV 215
           H +++
Sbjct: 245 HMWWL 249



>gi|412985545|emb|CCO18991.1| SNO glutamine amidotransferase [Bathycoccus prasinos]
          Length = 263

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 101/220 (45%), Positives = 143/220 (65%), Gaps = 12/220 (5%)

Query: 9   QQVQPQFKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMA 68
           +Q + + K GVLALQG+F+EH  M++       A+ IR A QLE    +IIPGGESTTMA
Sbjct: 4   EQQEDKIKIGVLALQGSFREHCSMIRRCG--GEAVEIRSASQLEGCQGMIIPGGESTTMA 61

Query: 69  LIAERSGLMEPLRKFVRD-EKPTWGTCAGMILLANEANK-VKKGGQDLIGGLNITVNRNQ 126
            IA R  L + LR+F  + E+  WGTCAG+I LA+   +  K+GGQ+L+GG+N+ V+RN 
Sbjct: 62  NIARRWNLFDALREFEDEGERCVWGTCAGLIFLADRIEQGAKQGGQELLGGINVDVSRNF 121

Query: 127 FGSQIDSFESLLHINHITTSSDDL-FPAIFIRAPXXXXXXXXXVEVLARL------EHDI 179
           FGSQIDSFE+ +  +    S +D+   AIFIRAP         VEVLA+       + ++
Sbjct: 122 FGSQIDSFETTIPCDIPGCSENDVKCRAIFIRAP-AIKKVGENVEVLAKYYLSEEKKKEM 180

Query: 180 GETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQ 219
           G    S +VAV+Q +LL T+FHPELT+D R H+ F+++++
Sbjct: 181 GVDIESVVVAVKQKNLLATSFHPELTSDLRWHELFMRMSK 220



>gi|302672956|ref|XP_003026165.1| hypothetical protein SCHCODRAFT_83636 [Schizophyllum commune H4-8]
 gi|300099846|gb|EFI91262.1| hypothetical protein SCHCODRAFT_83636 [Schizophyllum commune H4-8]
          Length = 224

 Score =  178 bits (451), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 99/211 (46%), Positives = 133/211 (63%), Gaps = 16/211 (7%)

Query: 20  LALQGAFQEHIHMLQNI--SQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           +ALQGAF EH   LQ +   +  + + +R  E+L+  DALIIPGGESTT+AL+A   GL+
Sbjct: 5   IALQGAFVEHEKALQRLRLKRRITVLQVRTREELDRCDALIIPGGESTTIALLARLEGLL 64

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
           EPLR+F R  KP WGTCAG ILL+      KKGGQ+++GG++IT+ RN +GSQ++SFE+ 
Sbjct: 65  EPLREF-RTRKPVWGTCAGAILLSQSVENTKKGGQEVLGGMSITIARNGWGSQVESFEAR 123

Query: 138 LHINHITTSSDDLFPAIFIRAPXXXXXXXX----XVEVLARLEHDI--------GETDAS 185
           L +  +    D+ F  +FIRAP             V+V+ARL   +           D  
Sbjct: 124 LQVEGL-RDPDEPFTGVFIRAPVVLKIDPSPNDPPVQVVARLPPGLLPPSLASDDPADPK 182

Query: 186 SIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
           +IVA+RQG  L T FHPELT DDR H+YFV+
Sbjct: 183 AIVALRQGLHLLTTFHPELTADDRFHEYFVR 213



>gi|302657683|ref|XP_003020558.1| hypothetical protein TRV_05345 [Trichophyton verrucosum HKI 0517]
 gi|291184403|gb|EFE39940.1| hypothetical protein TRV_05345 [Trichophyton verrucosum HKI 0517]
          Length = 304

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 103/244 (42%), Positives = 134/244 (54%), Gaps = 49/244 (20%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSA------------IPIRKAEQLETIDALIIPGGEST 65
           GVLALQGAF EHI  L+  ++                I +R   +L   D LIIPGGEST
Sbjct: 46  GVLALQGAFYEHIQQLKVAAEKLRGSSKTFTKEQWEFIEVRTPAELARCDGLIIPGGEST 105

Query: 66  TMALIAERSGLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRN 125
            MAL+A RS L+EPLR FV+  KPTWGTCAG+ILLA  AN+ K+GGQ+LIGGL++ VNRN
Sbjct: 106 AMALVAARSNLLEPLRDFVK--KPTWGTCAGLILLAESANRTKRGGQELIGGLDVRVNRN 163

Query: 126 QFGSQIDSFESLLHINHITTSSDDLFPAIFIRAP-------------------------- 159
            FG Q +SF + L +  +   +   F A+FIRAP                          
Sbjct: 164 HFGRQTESFYAPLDLPFLPGDAGP-FRAVFIRAPVVEKVLSAKDGIQDGELAIDGTVVAP 222

Query: 160 -------XXXXXXXXXVEVLARLEHDIGETDA-SSIVAVRQGSLLGTAFHPELTNDDRIH 211
                           VE+L +L      +D    IVAV+QG++ GT+FHPELT+D RIH
Sbjct: 223 SRKPESEVAREAMADKVEILGKLPAKADGSDGPGDIVAVKQGNVFGTSFHPELTDDVRIH 282

Query: 212 KYFV 215
            +++
Sbjct: 283 MWWL 286



>gi|393246781|gb|EJD54289.1| SNO glutamine amidotransferase [Auricularia delicata TFB-10046 SS5]
          Length = 246

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 100/225 (44%), Positives = 137/225 (60%), Gaps = 26/225 (11%)

Query: 17  FGVLALQGAFQEHIHMLQNISQVSS----AIPIRKAEQLETIDALIIPGGESTTMALIAE 72
            GVLALQGAF EH+  L  +   S+      P+R  E L T  ALIIPGGESTT+AL+A 
Sbjct: 14  IGVLALQGAFAEHVAALSRLQSPSAQKIVPRPVRTKEDLATCRALIIPGGESTTIALLAR 73

Query: 73  RSGLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQID 132
            +GL+EPLR+FVR  KP WGTCAG ILLA+     K GGQ+L+GG+++ + RN +GSQ++
Sbjct: 74  LAGLLEPLREFVRSGKPVWGTCAGAILLADSVEGAKAGGQELLGGMDVRIARNGYGSQVE 133

Query: 133 SFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXV----EVLARLEHDIGETDAS--- 185
           SFE+ L ++ +   ++  FP +FIRAP         +    +++AR+  D+    AS   
Sbjct: 134 SFEAPLDVDGL-RDAEKPFPGVFIRAPVVLSIHHPPMRPKPQIIARVAADLVPVGASDYP 192

Query: 186 --------------SIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
                         ++VAVRQG+ + T FHPELT D R H YFV+
Sbjct: 193 PDPLDDPTDPQDDRTVVAVRQGACMLTTFHPELTKDTRFHDYFVR 237



>gi|512199871|gb|EPE28704.1| Class I glutamine amidotransferase-like protein [Glarea lozoyensis
           ATCC 20868]
          Length = 291

 Score =  177 bits (449), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 103/261 (39%), Positives = 144/261 (55%), Gaps = 61/261 (23%)

Query: 17  FGVLALQGAFQEHIHMLQNISQVSSAI----------PIRKAEQLETIDALIIPGGESTT 66
            GVLALQGAF EH+ +L+  +Q+ +             IR   +L++ DALIIPGGEST 
Sbjct: 12  IGVLALQGAFNEHVQLLREAAQILATKDIIQRTWTFKEIRNKPELDSCDALIIPGGESTA 71

Query: 67  MALIAERSGLMEPLRKFVRD-EKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRN 125
           ++L+A+R  ++EPLR FV+   KPTWGTCAG+ILLA  AN  KKGGQ+LIGGL++ VNRN
Sbjct: 72  ISLVAQRCNMLEPLRDFVKVIRKPTWGTCAGLILLAEAANATKKGGQELIGGLDVRVNRN 131

Query: 126 QFGSQIDSFESLLHINHITT-------SSDDLFPAIFIRAPXXXXX-------------- 164
            FG QI+SF++ L++  +         +S   F AIFIRAP                   
Sbjct: 132 HFGRQIESFQADLNLPFLQQADGKDFDTSQKPFRAIFIRAPIVEKVLPHVSGAQTGQASL 191

Query: 165 -------------------XXXXVEVLARL----------EHDIGETDASSIVAVRQGSL 195
                                  VE++A L          + +  + +A  I+AVRQ ++
Sbjct: 192 DETVTAPSRTIDENVAKGIKLADVEIMATLPGRAAAVQDDKKEKLDAEAGDIIAVRQANV 251

Query: 196 LGTAFHPELTNDDRIHKYFVQ 216
            GT+FHPELT D RIH ++++
Sbjct: 252 FGTSFHPELTGDPRIHVWWLE 272



>gi|302757561|ref|XP_002962204.1| hypothetical protein SELMODRAFT_165081 [Selaginella moellendorffii]
 gi|300170863|gb|EFJ37464.1| hypothetical protein SELMODRAFT_165081 [Selaginella moellendorffii]
          Length = 255

 Score =  177 bits (448), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 103/214 (48%), Positives = 132/214 (61%), Gaps = 15/214 (7%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG+F EH+  L+ +     AI +RKA+QL+ +  LIIPGGESTTMA +A +  L 
Sbjct: 4   GVLALQGSFHEHVLALRRLG--VHAIEVRKADQLDGLAGLIIPGGESTTMAKLANQYNLF 61

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             L+ F    KP WGTCAG+I LA+ A  +K GGQ+L+GGL+ TV+RN FGSQ++SFE+ 
Sbjct: 62  PALKDFSTSGKPMWGTCAGLIFLADRATGLKDGGQELLGGLDCTVHRNFFGSQVNSFETE 121

Query: 138 LHINHITTS--SDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDI--------GE--TDAS 185
           L +  +  S        A+FIRAP         VE +A  E           GE  T   
Sbjct: 122 LAVPALAASEGGPPRCRAVFIRAP-AIVEFGSSVEQIADCEVPSFSAPPSLEGEMFTRRR 180

Query: 186 SIVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQ 219
             VAVRQG+ LGTAFHPELT+D R H YFV++ Q
Sbjct: 181 VAVAVRQGNFLGTAFHPELTSDTRWHSYFVKMVQ 214



>gi|170111769|ref|XP_001887088.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164638131|gb|EDR02411.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 235

 Score =  177 bits (448), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 104/216 (48%), Positives = 133/216 (61%), Gaps = 21/216 (9%)

Query: 18  GVLALQGAFQEHIHMLQNIS--QVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSG 75
           G+LALQGAF EH   LQ +S  +    I +R AE L+  DALIIPGGESTT+AL+A  SG
Sbjct: 13  GILALQGAFAEHQTALQRLSLNRTIDTIFVRTAEDLDRCDALIIPGGESTTIALLARLSG 72

Query: 76  LMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFE 135
           ++EPL+ FV+  KP WGTCAG ILL+      KKGGQ+L+G ++IT+ RN +GSQ++SFE
Sbjct: 73  VLEPLKLFVK-TKPVWGTCAGAILLSQAVEGAKKGGQELLGAMSITIARNGWGSQVESFE 131

Query: 136 SLLHINHITTSSDDLFP--AIFIRAPXXXXXXXX----XVEVLARLEHDIGETDASS--- 186
           + L +  +    D + P   IFIRAP             + V+A L  D+  +  SS   
Sbjct: 132 ADLQVPGL---RDPVVPFTGIFIRAPVILALTPTPSDHSIIVVAHLSPDLLPSALSSPDH 188

Query: 187 ------IVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
                  VAVRQG    T FHPELTNDDR H YFV+
Sbjct: 189 SAEPRTYVAVRQGLHFLTTFHPELTNDDRFHDYFVR 224



>gi|302509344|ref|XP_003016632.1| hypothetical protein ARB_04923 [Arthroderma benhamiae CBS 112371]
 gi|291180202|gb|EFE35987.1| hypothetical protein ARB_04923 [Arthroderma benhamiae CBS 112371]
          Length = 264

 Score =  177 bits (448), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 103/244 (42%), Positives = 134/244 (54%), Gaps = 49/244 (20%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSA------------IPIRKAEQLETIDALIIPGGEST 65
           GVLALQGAF EHI  L+  ++                I +R   +L   D LIIPGGEST
Sbjct: 6   GVLALQGAFYEHIQQLKVAAEKLRGSSKTFTKEQWEFIEVRTPAELARCDGLIIPGGEST 65

Query: 66  TMALIAERSGLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRN 125
            MAL+A RS L+EPLR FV+  KPTWGTCAG+ILLA  AN+ K+GGQ+LIGGL++ VNRN
Sbjct: 66  AMALVAARSNLLEPLRDFVK--KPTWGTCAGLILLAESANRTKRGGQELIGGLDVRVNRN 123

Query: 126 QFGSQIDSFESLLHINHITTSSDDLFPAIFIRAP-------------------------- 159
            FG Q +SF + L +  +   +   F A+FIRAP                          
Sbjct: 124 HFGRQTESFYAPLDLPFLPGDAGP-FRAVFIRAPVVEKVLSAKDGIQDEELAIDGTVVAP 182

Query: 160 -------XXXXXXXXXVEVLARLEHDIGETDA-SSIVAVRQGSLLGTAFHPELTNDDRIH 211
                           VE+L +L      +D    IVAV+QG++ GT+FHPELT+D RIH
Sbjct: 183 SRKPESEVAREAMADKVEILGKLPAKADGSDGPGDIVAVKQGNVFGTSFHPELTDDVRIH 242

Query: 212 KYFV 215
            +++
Sbjct: 243 MWWL 246



>gi|409075734|gb|EKM76111.1| hypothetical protein AGABI1DRAFT_63730 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 236

 Score =  176 bits (447), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 136/215 (63%), Gaps = 17/215 (7%)

Query: 17  FGVLALQGAFQEHIHMLQNIS--QVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERS 74
            G+LALQGAF EH   LQ IS  +    I +R AE+L    AL+IPGGESTT+AL+A  S
Sbjct: 12  IGILALQGAFIEHQDALQKISLQKKIEVIQVRTAEELAKCAALVIPGGESTTIALLARLS 71

Query: 75  GLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSF 134
           GL+EPLR+FV+  KP WGTCAG ILL+      KKGGQ+L+GG++IT+ RN +GSQ++SF
Sbjct: 72  GLLEPLRQFVKT-KPVWGTCAGAILLSKNVEGAKKGGQELLGGISITIARNGWGSQVESF 130

Query: 135 ESLLHINHITTSSDDLFPAIFIRAPXXXXXXXX----XVEVLARLE-HDIGETDASS--- 186
           E+ L +  +    +  F  IFIRAP             ++V++RL  H + E+  SS   
Sbjct: 131 EADLDVP-LLRDPERPFTGIFIRAPVVLSLDTTPEDPPIKVISRLSPHYLPESLTSSNLT 189

Query: 187 -----IVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
                 VA++QG    T FHPELT D+R H+YFV+
Sbjct: 190 HEPKTFVALQQGLHFLTTFHPELTQDNRFHEYFVR 224



>gi|310791731|gb|EFQ27258.1| SNO glutamine amidotransferase [Glomerella graminicola M1.001]
          Length = 257

 Score =  176 bits (446), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 100/237 (42%), Positives = 139/237 (58%), Gaps = 38/237 (16%)

Query: 18  GVLALQGAFQEHIHMLQNISQV---------------SSAIPIRKAEQLETIDALIIPGG 62
           GVLALQG F EH+ + +  +                  +AI +R   +L   DALIIPGG
Sbjct: 7   GVLALQGGFHEHVQLTRKAAAWLATAQSPTTPSPNADIAAIEVRTDAELRRCDALIIPGG 66

Query: 63  ESTTMALIAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNIT 121
           ESTT++ +A +SGLMEPLR+FV+   KP WGTCAG ILLA+EAN  KKGGQ+LIGGL + 
Sbjct: 67  ESTTISFVATQSGLMEPLREFVKVKRKPVWGTCAGAILLADEANATKKGGQELIGGLGVR 126

Query: 122 VNRNQFGSQIDSFESLLHINHIT------TSSDDLFPAIFIRAP-----XXXXXXXXXVE 170
           V+RN FG Q++SF + L +  ++       ++   +P +FIRAP              V+
Sbjct: 127 VHRNHFGRQMESFVADLELPFLSQGDGGAATAPAPYPGVFIRAPIVEEILTTEAAAPSVQ 186

Query: 171 VLARL-------EHDIGETDA----SSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
           VLA L          + ++ A      IVAV+Q ++  T+FHPELTND RIH ++++
Sbjct: 187 VLAVLPGRKTMAAEGVSQSKADDAVGDIVAVKQDNIFATSFHPELTNDMRIHVWWLK 243



>gi|426191764|gb|EKV41704.1| hypothetical protein AGABI2DRAFT_230018 [Agaricus bisporus var.
           bisporus H97]
          Length = 236

 Score =  176 bits (446), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 136/215 (63%), Gaps = 17/215 (7%)

Query: 17  FGVLALQGAFQEHIHMLQNIS--QVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERS 74
            G+LALQGAF EH   LQ IS  +    I +R AE+L    AL+IPGGESTT+AL+A  S
Sbjct: 12  IGILALQGAFIEHQDALQKISLQKKIEIIQVRTAEELAKCAALVIPGGESTTIALLARLS 71

Query: 75  GLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSF 134
           GL+EPLR+FV+  KP WGTCAG ILL+      KKGGQ+L+GG++IT+ RN +GSQ++SF
Sbjct: 72  GLLEPLRQFVKT-KPVWGTCAGAILLSKNVEGAKKGGQELLGGMSITIARNGWGSQVESF 130

Query: 135 ESLLHINHITTSSDDLFPAIFIRAPXXXXXXXX----XVEVLARLE-HDIGETDASS--- 186
           E+ L +  +    +  F  IFIRAP             ++V++RL  H + E+  SS   
Sbjct: 131 EADLDVP-LLRDPERPFTGIFIRAPVVLSLDTTPEDPPIKVISRLSPHYLPESLTSSNLT 189

Query: 187 -----IVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
                 VA++QG    T FHPELT D+R H+YFV+
Sbjct: 190 HEPKTFVALQQGLHFLTTFHPELTQDNRFHEYFVR 224



>gi|226496607|ref|NP_001147279.1| LOC100280887 [Zea mays]
 gi|195609434|gb|ACG26547.1| glutamine amidotransferase subunit pdxT [Zea mays]
 gi|219887391|gb|ACL54070.1| unknown [Zea mays]
 gi|413926762|gb|AFW66694.1| glutamine amidotransferase subunit pdxT [Zea mays]
          Length = 255

 Score =  176 bits (445), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 101/221 (45%), Positives = 135/221 (61%), Gaps = 21/221 (9%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG++ EH+  L+ I      + +RK EQL  ID+LIIPGGESTTMA +A    L 
Sbjct: 5   GVLALQGSYNEHMAALRRIG--VKGVEVRKPEQLLGIDSLIIPGGESTTMAKLANYHNLF 62

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             LR+FV   KP WGTCAG+I LAN+A   K GGQ+L+GGL+ TV+RN FGSQ+ SFE+ 
Sbjct: 63  PALREFVGGGKPVWGTCAGLIFLANKAVGQKTGGQELVGGLDCTVHRNFFGSQLQSFETE 122

Query: 138 LHINHIT--TSSDDLFPAIFIRAPXXXXXXXXXVEVLA---------RLEHDIGE----- 181
           L +  ++     +D    +FIRAP         VE+LA          +    GE     
Sbjct: 123 LSVPKLSEKEGGNDTCRGVFIRAP-AILEVGPDVEILADCPVPVDRPSITISFGEGTEEE 181

Query: 182 --TDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQD 220
             +    IVAVRQG++L TAFHPELT+D R H++F+ + ++
Sbjct: 182 EYSKDRVIVAVRQGNILATAFHPELTSDSRWHRFFLDMDKE 222



>gi|326469568|gb|EGD93577.1| pyridoxine [Trichophyton tonsurans CBS 112818]
          Length = 267

 Score =  176 bits (445), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 102/245 (41%), Positives = 133/245 (54%), Gaps = 48/245 (19%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSA------------IPIRKAEQLETIDALIIPGGEST 65
           GVLALQGAF EHI  L+  ++                I +R   +L   D L+IPGGEST
Sbjct: 6   GVLALQGAFYEHIQQLKVAAEKLRGSSKTFSKEQWEFIEVRTPAELARCDGLVIPGGEST 65

Query: 66  TMALIAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNR 124
            MAL+A RS L+EPLR FV+   KPTWGTCAG+ILLA  AN+ K+GGQ+LIGGL++ VNR
Sbjct: 66  AMALVAARSNLLEPLRDFVKIHRKPTWGTCAGLILLAESANRTKRGGQELIGGLDVRVNR 125

Query: 125 NQFGSQIDSFESLLHINHITTSSDDLFPAIFIRAP------------------------- 159
           N FG Q +SF + L +  +   +   F A+FIRAP                         
Sbjct: 126 NHFGRQTESFYAPLDLPFLPGDAGP-FRAVFIRAPVVEKVLSAKEGIQDEELAIDGTVVA 184

Query: 160 --------XXXXXXXXXVEVLARLEHDI-GETDASSIVAVRQGSLLGTAFHPELTNDDRI 210
                            VE+L +L     G      IVAV+QG++ GT+FHPELT+D RI
Sbjct: 185 PSRKPESEAAREAMADKVEILGKLPAKADGNDGPGDIVAVKQGNVFGTSFHPELTDDARI 244

Query: 211 HKYFV 215
           H +++
Sbjct: 245 HMWWL 249



>gi|505754544|gb|EOQ98857.1| Glutamine amidotransferase subunit PdxT [Wallemia ichthyophaga
           EXF-994]
          Length = 213

 Score =  175 bits (444), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 95/205 (46%), Positives = 133/205 (64%), Gaps = 9/205 (4%)

Query: 17  FGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGL 76
            GVLALQGAF+EH ++L++IS  +  I +R  E+L +   LIIPGGESTTM+L+A RSGL
Sbjct: 7   IGVLALQGAFEEHCNILKSISNYN-IIQVRSIEELRSCCGLIIPGGESTTMSLVASRSGL 65

Query: 77  MEPLRKFVRD-EKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFE 135
           +  LR+F  +     WGTCAGMILLA EA++ KKGGQ+L GG+++ VNRNQ+G Q++SF+
Sbjct: 66  LGALREFCSNPNTAVWGTCAGMILLAKEASQTKKGGQELFGGMDMIVNRNQYGCQLESFQ 125

Query: 136 SLLHINHITTSSDDLFPAIFIRAPX--XXXXXXXXVEVLARLEHDIGETDASS--IVAVR 191
             +  N I     +    IFIRAP           +E+ +   + +  + A    +VA+R
Sbjct: 126 EDIPFNCINGGPVN---GIFIRAPILHSYSDNKNIIELASLPSNPVDHSVAPQGHVVALR 182

Query: 192 QGSLLGTAFHPELTNDDRIHKYFVQ 216
           Q + + T FHPELT D R+H YFV+
Sbjct: 183 QANKMCTTFHPELTRDYRLHVYFVE 207



>gi|389744148|gb|EIM85331.1| SNO glutamine amidotransferase [Stereum hirsutum FP-91666 SS1]
          Length = 245

 Score =  175 bits (444), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 106/235 (45%), Positives = 142/235 (60%), Gaps = 27/235 (11%)

Query: 6   NDFQQVQPQFKFGVLALQGAFQEHIHMLQNIS--QVSSAIPIRKAEQLETIDALIIPGGE 63
            D Q        G+LALQGAF EH  MLQ +S  QV++ + +R  E L   DALIIPGGE
Sbjct: 2   QDTQGSSSHATIGILALQGAFAEHQTMLQKVSKHQVTTIL-VRTPEDLAQCDALIIPGGE 60

Query: 64  STTMALIAERSGLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVN 123
           STT+AL+A+ SGL+EPL++FV+  K  WGTCAG ILLA   +  KKGGQ+++GG+ +TV 
Sbjct: 61  STTIALLAKLSGLLEPLKEFVQT-KVVWGTCAGAILLAQHVSNPKKGGQEVLGGMTLTVA 119

Query: 124 RNQFGSQIDSFESLLHINHITTSSDDLFPAIFIRAPX----XXXXXXXXVEVLARL---- 175
           RN +GSQ++SFE+ L I+ +   S+  F  IFIRAP             ++++ARL    
Sbjct: 120 RNGWGSQVESFEAPLEIDGL-RDSNIPFIGIFIRAPVIQHLTPTPSSPPIKIVARLPPGI 178

Query: 176 -------------EHDIGETDA-SSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
                        E +  +     +IVA+RQG  L T FHPELT D R H+YFV+
Sbjct: 179 LPPPHPTSTLPSTEIETAQPHPDETIVALRQGRHLLTTFHPELTRDHRFHEYFVK 233



>gi|406864531|gb|EKD17576.1| pyridoxine [Marssonina brunnea f. sp. 'multigermtubi' MB_m1]
          Length = 290

 Score =  175 bits (444), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 102/263 (38%), Positives = 142/263 (53%), Gaps = 64/263 (24%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAI------------PIRKAEQLETIDALIIPGGEST 65
           GVLALQGAF EH+ +L+  +Q+ +               +R  E+L + DALI+PGGEST
Sbjct: 16  GVLALQGAFNEHVQLLRQAAQILATKDKDIVQRNWTFKEVRTEEELSSCDALILPGGEST 75

Query: 66  TMALIAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNR 124
            ++L+A+RS ++EPLR FV+   KP WGTCAG+ILLA  AN+ KKGGQ+LIGGL++ VNR
Sbjct: 76  AISLVAQRSNMLEPLRDFVKVKRKPAWGTCAGLILLAESANRTKKGGQELIGGLDVRVNR 135

Query: 125 NQFGSQIDSFESLLHINHITTSSDDL-------FPAIFIRAP------------------ 159
           N FG QI+SFE+ L +  +  +  +        F AIFIRAP                  
Sbjct: 136 NHFGRQIESFEANLDLPFLKQADGESLDANQTPFRAIFIRAPIVERLLPTVTGIQEGEAK 195

Query: 160 ---------------XXXXXXXXXVEVLARL-----------EHDIGETDASSIVAVRQG 193
                                   VEV+  L             +  + +A  I+AVRQ 
Sbjct: 196 IDDTVVAPSREINQEAARSINIGNVEVMGTLPGRTTVIKDDATKEKLDAEAGDIIAVRQA 255

Query: 194 SLLGTAFHPELTNDDRIHKYFVQ 216
           ++ GT+FHPELT D RIH ++++
Sbjct: 256 NVFGTSFHPELTGDPRIHVWWLK 278



>gi|379735750|ref|YP_005329256.1| glutamine amidotransferase subunit pdxT [Blastococcus saxobsidens
           DD2]
 gi|504189006|ref|WP_014376108.1| glutamine amidotransferase [Blastococcus saxobsidens]
 gi|378783557|emb|CCG03225.1| Glutamine amidotransferase subunit pdxT [Blastococcus saxobsidens
           DD2]
          Length = 230

 Score =  175 bits (443), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 94/202 (46%), Positives = 129/202 (63%), Gaps = 10/202 (4%)

Query: 20  LALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLMEP 79
           LALQG  +EH+  L+  ++ + A P+R+ E+L  +D +++PGGESTTMA +A RSGL+EP
Sbjct: 18  LALQGDVREHVSALR--AEGADARPVRRPEELADVDGIVLPGGESTTMAKLAARSGLLEP 75

Query: 80  LRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESLLH 139
           LR+ +R   P +GTCAGMILLA+        GQ  +GGL+ITV RN FG Q+DSFES + 
Sbjct: 76  LREALRAGLPAYGTCAGMILLADRLVDAPP-GQPTVGGLDITVRRNAFGRQVDSFESGVE 134

Query: 140 INHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGSLLGTA 199
           +  +         A+FIRAP         VEVL R+   +G      IVAVRQG+++ T+
Sbjct: 135 LAGVDGGP---LQAVFIRAP-WVEEAGPGVEVLGRV---VGGAADGRIVAVRQGNVVATS 187

Query: 200 FHPELTNDDRIHKYFVQLTQDH 221
           FHPELT D R+H  FV + + H
Sbjct: 188 FHPELTGDRRVHALFVDVVRRH 209



>gi|269126341|ref|YP_003299711.1| SNO glutamine amidotransferase [Thermomonospora curvata DSM 43183]
 gi|502615539|ref|WP_012852457.1| glutamine amidotransferase [Thermomonospora curvata]
 gi|268311299|gb|ACY97673.1| SNO glutamine amidotransferase [Thermomonospora curvata DSM 43183]
          Length = 219

 Score =  175 bits (443), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 95/215 (44%), Positives = 134/215 (62%), Gaps = 13/215 (6%)

Query: 13  PQFKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAE 72
           P    GVLALQG  +EH   L++    + A+P+R+ ++LE +D L+IPGGESTTM  +A 
Sbjct: 16  PVPTIGVLALQGDVREHARALRSAG--ARAVPVRRPQELEQVDGLVIPGGESTTMWKLAR 73

Query: 73  RSGLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKG--GQDLIGGLNITVNRNQFGSQ 130
              L++PLRK V    P +G+CAGMI+L   A++++ G  GQ+ +GG+++TV RN FG Q
Sbjct: 74  AFDLLDPLRKRVEAGMPAYGSCAGMIML---ADRIRDGVAGQETVGGIDMTVRRNAFGRQ 130

Query: 131 IDSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAV 190
           +DSFE+ + +  +       F A+FIRAP         VE+L R+E   G      IVAV
Sbjct: 131 VDSFETDVTLPVLQPPGP--FRAVFIRAP-WVESVGDSVEILGRIE---GGERTGRIVAV 184

Query: 191 RQGSLLGTAFHPELTNDDRIHKYFVQLTQDHYNTG 225
           RQG L+ TAFHPELT D R+H+YF +L +     G
Sbjct: 185 RQGRLVATAFHPELTGDFRVHRYFAELVRQAMEEG 219



>gi|326478906|gb|EGE02916.1| SNO glutamine amidotransferase family protein [Trichophyton equinum
           CBS 127.97]
          Length = 256

 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 103/248 (41%), Positives = 133/248 (53%), Gaps = 49/248 (19%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSA------------IPIRKAEQLETIDALIIPGGEST 65
           GVLALQGAF EHI  L+  ++                I +R   +L   D L+IPGGEST
Sbjct: 6   GVLALQGAFYEHIQQLKVAAEKLRGSSKTFSKEQWEFIEVRTPAELARCDGLVIPGGEST 65

Query: 66  TMALIAERSGLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRN 125
            MAL+A RS L+EPLR FV+  KPTWGTCAG+ILLA  AN+ K+GGQ+LIGGL++ VNRN
Sbjct: 66  AMALVAARSNLLEPLRDFVK--KPTWGTCAGLILLAESANRTKRGGQELIGGLDVRVNRN 123

Query: 126 QFGSQIDSFESLLHINHITTSSDDLFPAIFIRAP-------------------------- 159
            FG Q +SF + L +  +   +   F A+FIRAP                          
Sbjct: 124 HFGRQTESFYAPLDLPFLPGDAGP-FRAVFIRAPVVEKVLSAKEGIQDEELAIDGTVVAP 182

Query: 160 -------XXXXXXXXXVEVLARLEHDI-GETDASSIVAVRQGSLLGTAFHPELTNDDRIH 211
                           VE+L +L     G      IVAV+QG++ GT+FHPELT+D RIH
Sbjct: 183 SRKPESEAAREAMADKVEILGKLPAKADGNDGPGDIVAVKQGNVFGTSFHPELTDDARIH 242

Query: 212 KYFVQLTQ 219
               +L +
Sbjct: 243 IVVAKLQK 250



>gi|474204355|gb|EMS58613.1| hypothetical protein TRIUR3_04173 [Triticum urartu]
          Length = 256

 Score =  174 bits (442), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 103/222 (46%), Positives = 133/222 (59%), Gaps = 23/222 (10%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG++ EH+  L+ I   +  + +RKAEQL  ID+LIIPGGESTTMA +A    L 
Sbjct: 6   GVLALQGSYNEHMAALRRIG--AKGVEVRKAEQLLGIDSLIIPGGESTTMAKLANFHNLF 63

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             LR+FV   KP WGTCAG+I LAN+A   K GGQ+L+GGL+ TV+RN FGSQ+ SFE+ 
Sbjct: 64  PALREFVGTGKPVWGTCAGLIFLANKAVGQKTGGQELVGGLDCTVHRNFFGSQLQSFETE 123

Query: 138 LHINHIT--TSSDDLFPAIFIRAPXXXXXXXXXVEVLAR-----------------LEHD 178
           L +  +            +FIRAP         VEVLA                  LE  
Sbjct: 124 LSVPMLAEKEGGSHTCRGVFIRAP-AILEVGQDVEVLADCPVPAGRPSITITSGEGLEDQ 182

Query: 179 IGETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQD 220
           +   D   IVAVRQG++L TAFHPELT+D R H+ F+ + ++
Sbjct: 183 VYSKD-RVIVAVRQGNILATAFHPELTSDSRWHRLFLDMDKE 223



>gi|326499656|dbj|BAJ86139.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 256

 Score =  174 bits (441), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 99/221 (44%), Positives = 131/221 (59%), Gaps = 21/221 (9%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG++ EH+  L+ I   +  + +RK EQL  +D+LIIPGGESTTMA +A    L 
Sbjct: 6   GVLALQGSYNEHMAALRRIG--AKGVEVRKPEQLLAVDSLIIPGGESTTMAKLANYDNLF 63

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             LR+FV   KP WGTCAG+I LAN+A   K GGQ+L+GGL+ TV+RN FGSQ+ SFE+ 
Sbjct: 64  PALREFVGTGKPVWGTCAGLIFLANKAVGQKTGGQELVGGLDCTVHRNFFGSQLQSFETE 123

Query: 138 LHINHIT--TSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDAS---------- 185
           L +  +       +    +FIRAP         VEVLA      G    +          
Sbjct: 124 LSVPMLAEKEGGSNTCRGVFIRAP-AILEVGQDVEVLADCPVPAGRPSITITSGEGVEDQ 182

Query: 186 ------SIVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQD 220
                  IVAVRQG++L TAFHPELT+D R H+ F+ + ++
Sbjct: 183 VYSKDRVIVAVRQGNILATAFHPELTSDSRWHQLFLDMDKE 223



>gi|344233214|gb|EGV65087.1| SNO glutamine amidotransferase [Candida tenuis ATCC 10573]
 gi|344233215|gb|EGV65088.1| hypothetical protein CANTEDRAFT_113447 [Candida tenuis ATCC 10573]
          Length = 229

 Score =  174 bits (441), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 99/230 (43%), Positives = 136/230 (59%), Gaps = 33/230 (14%)

Query: 11  VQPQFKFGVLALQGAFQEHIHMLQ----NISQVS-SAIPIRKAEQLETIDALIIPGGEST 65
           V   +  GVLALQGAF EHIH  Q    +  Q + + + +R  EQL + DAL+IPGGEST
Sbjct: 3   VTSHYNVGVLALQGAFIEHIHHFQQCVDDFPQATFTFLEVRTPEQLGSCDALVIPGGEST 62

Query: 66  TMALIAERSGLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRN 125
           +++LIAER+GL+ PL +FV+  KP WGTCAG+I L+ +    ++ GQ L+GG++I V RN
Sbjct: 63  SISLIAERTGLLTPLFEFVKTGKPIWGTCAGLIFLSKQVINGRQ-GQQLLGGMDIEVKRN 121

Query: 126 QFGSQIDSFESLLHINHITTSSDDLFPAIFIRAPXXX-------------------XXXX 166
            FG Q+DSF + L  +      D  FP +FIRAP                          
Sbjct: 122 AFGRQLDSFITDLDFSSFVPGCDK-FPTVFIRAPVVSQILHGDGDHKEGVIYSKNDYVND 180

Query: 167 XXVEVLARLEHDIGETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
             VEVL RL       D+  +VAVRQG+ LGT+FHPEL++D   H++F++
Sbjct: 181 ATVEVLHRL-------DSGLLVAVRQGNKLGTSFHPELSDDVAFHRWFLE 223



>gi|380484216|emb|CCF40137.1| SNO glutamine amidotransferase, partial [Colletotrichum
           higginsianum]
          Length = 244

 Score =  174 bits (441), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 98/231 (42%), Positives = 130/231 (56%), Gaps = 39/231 (16%)

Query: 24  GAFQEHIHMLQNISQV--------------SSAIPIRKAEQLETIDALIIPGGESTTMAL 69
           G F EH+ + +  +                 +AI +R   +L   DALIIPGGESTT++ 
Sbjct: 1   GGFHEHVQLTRKAAAWLATAQPPAPSPRPDIAAIEVRTEAELRRCDALIIPGGESTTISF 60

Query: 70  IAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFG 128
           +A +SGLMEPLR+FV+ + KP WGTCAG ILLA+EAN  KKGGQ+LIGGL + V+RN FG
Sbjct: 61  VATQSGLMEPLREFVKVNRKPVWGTCAGAILLADEANATKKGGQELIGGLGVRVHRNHFG 120

Query: 129 SQIDSFESLLHINHITTSSDDL-------FPAIFIRAP------XXXXXXXXXVEVLARL 175
            QI+SF + L +  +T   D L       +P +FIRAP               VEVLA L
Sbjct: 121 RQIESFVADLDLPFLTQGDDALKAASSSPYPGVFIRAPIVEEILSTEAKPSSSVEVLAVL 180

Query: 176 -----------EHDIGETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFV 215
                           +     IVAVRQ ++  T+FHPELT+D RIH +++
Sbjct: 181 PGRKTRAAEGVSQSTADDSVGDIVAVRQANIFATSFHPELTDDIRIHAWWL 231



>gi|452984801|gb|EME84558.1| hypothetical protein MYCFIDRAFT_210911 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 333

 Score =  173 bits (439), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 96/217 (44%), Positives = 130/217 (59%), Gaps = 48/217 (22%)

Query: 43  IPIRKAEQLETIDALIIPGGESTTMALIAERSGLMEPLRKFVR-DEKPTWGTCAGMILLA 101
           I +R AEQL   DALI+PGGEST+++LIAER GL+EPLR++V+   KP WGTCAG+ILLA
Sbjct: 111 IQVRTAEQLSESDALILPGGESTSISLIAERCGLLEPLRQYVKVQRKPVWGTCAGLILLA 170

Query: 102 NEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESLLHINHITTSSDDLFPAIFIRAPXX 161
             ANK K+ GQ+LIGGL++ V+RN FG Q++SFE+ L +  +   +   FPA+FIRAP  
Sbjct: 171 ESANKTKETGQELIGGLDVRVHRNYFGRQVESFEADLELPFLQGGN---FPAVFIRAPVV 227

Query: 162 XX-----------------------------XXXXXVEVLARLE-------------HDI 179
                                               VE+LA+L               D+
Sbjct: 228 EKVLSTSSAIIDESEAAKKVDVETILAPPRQATNAPVEILAKLPGRARAIKDKTTTAEDL 287

Query: 180 GETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
           GE     IVAV+QG++ GTAFHPELT+D+RIH ++++
Sbjct: 288 GED--GDIVAVKQGNVFGTAFHPELTSDERIHAWWLR 322



>gi|498534330|ref|WP_010832796.1| SNO glutamine amidotransferase [Nocardioides sp. CF8]
 gi|490487706|gb|EON24120.1| SNO glutamine amidotransferase [Nocardioides sp. CF8]
          Length = 215

 Score =  173 bits (438), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 100/206 (48%), Positives = 134/206 (65%), Gaps = 13/206 (6%)

Query: 17  FGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGL 76
            GVLALQG  +EH+ +L  + +   A+ +R+  +L ++D LIIPGGESTTM  +A+   L
Sbjct: 5   IGVLALQGDVREHLAVLTRLGE--RAVAVRRPAELASVDGLIIPGGESTTMIKLAKIFEL 62

Query: 77  MEPLRKFVRDEKPTWGTCAGMILLANEANKVKKG--GQDLIGGLNITVNRNQFGSQIDSF 134
            EPLR  +RD  PT+GTCAGMILL   A++++ G  GQ+ +GGL+ITV RN FG Q+DSF
Sbjct: 63  YEPLRARIRDGLPTFGTCAGMILL---ADRIEGGAVGQETLGGLDITVRRNAFGRQVDSF 119

Query: 135 ESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASS-IVAVRQG 193
           E  L +    T  D+   A+FIRAP         VEVLAR+  D     A+  IVAVRQG
Sbjct: 120 EGDLPL----TGLDEPVHAVFIRAP-WVEAVGDGVEVLARVPADPARGAAAGRIVAVRQG 174

Query: 194 SLLGTAFHPELTNDDRIHKYFVQLTQ 219
           SL+ T+FHPE+  D R+H+ FV L +
Sbjct: 175 SLMATSFHPEVGGDARVHELFVDLVR 200



>gi|374855140|dbj|BAL58004.1| SNO glutamine amidotransferase [uncultured Chloroflexi bacterium]
          Length = 242

 Score =  173 bits (438), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 99/207 (47%), Positives = 128/207 (61%), Gaps = 15/207 (7%)

Query: 15  FKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERS 74
            K GVLALQG F EH++ML+ +   +S +  R  ++L+ +D LIIPGGESTT+  +A + 
Sbjct: 34  LKIGVLALQGDFLEHLNMLRRLGVNASEV--RLPDELDGLDGLIIPGGESTTIGKLAAQF 91

Query: 75  GLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQ---DLIGGLNITVNRNQFGSQI 131
           GLMEPLR+FV   K  WGTCAG+I LA    +   GG    + +  ++ITV+RN FG Q+
Sbjct: 92  GLMEPLRQFVAQGKAVWGTCAGLIFLARHIGQTGSGGHVIPNRLAVMDITVDRNAFGRQV 151

Query: 132 DSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVR 191
           DSFE+ L+           F A+FIRAP         VEVLARLE         SIVA R
Sbjct: 152 DSFEADLYPAF--DPEKRPFRAVFIRAP-RIQAVGKTVEVLARLED-------GSIVAAR 201

Query: 192 QGSLLGTAFHPELTNDDRIHKYFVQLT 218
           QG LL TAFHPELT+D R H+YF+ + 
Sbjct: 202 QGPLLVTAFHPELTDDARFHRYFLSMV 228



>gi|147669218|ref|YP_001214036.1| glutamine amidotransferase subunit PdxT [Dehalococcoides sp. BAV1]
 gi|500357557|ref|WP_011928942.1| glutamine amidotransferase [Dehalococcoides mccartyi]
 gi|189036903|sp|A5FRL6.1|PDXT_DEHSB RecName: Full=Glutamine amidotransferase subunit PdxT; AltName:
           Full=Glutamine amidotransferase glutaminase subunit PdxT
 gi|146270166|gb|ABQ17158.1| pyridoxal phosphate synthase yaaE subunit [Dehalococcoides sp.
           BAV1]
          Length = 195

 Score =  172 bits (437), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 91/207 (43%), Positives = 131/207 (63%), Gaps = 14/207 (6%)

Query: 15  FKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERS 74
            K GVLALQGAF+EH++ML  +   + A+ +RKAE+L  +  LIIPGGESTT+  + +  
Sbjct: 1   MKIGVLALQGAFREHLNMLGTLG--AEAVEVRKAEELPELSGLIIPGGESTTITKLLDIF 58

Query: 75  GLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSF 134
           G+ EP++   +   P WGTCAGMI LA E      G + L G ++ITV RN FG Q++SF
Sbjct: 59  GMAEPIKALAKKGMPIWGTCAGMICLAKELPGDISGVKPL-GLMDITVRRNAFGRQVNSF 117

Query: 135 ESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGS 194
           E++L +  +  +    FPA+FIRAP         VE+L++L          +IVAVR+ +
Sbjct: 118 EAMLKVKGLDKAD---FPAVFIRAP-LVEKTGKGVEILSKLPD-------GTIVAVRENN 166

Query: 195 LLGTAFHPELTNDDRIHKYFVQLTQDH 221
           LL  +FHPEL+ D+R H+YFVQ+ + +
Sbjct: 167 LLAISFHPELSGDNRFHRYFVQMAKTY 193



>gi|390594897|gb|EIN04305.1| SNO glutamine amidotransferase [Punctularia strigosozonata
           HHB-11173 SS5]
          Length = 243

 Score =  172 bits (436), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 100/221 (45%), Positives = 138/221 (62%), Gaps = 22/221 (9%)

Query: 17  FGVLALQGAFQEHIHMLQNISQVSSAIPI---RKAEQLETIDALIIPGGESTTMALIAER 73
            G+LALQGAF EH  +L+ +      I I   R  + L+  DALIIPGGESTT+AL+A  
Sbjct: 15  IGILALQGAFAEHQVILKKLPMGGHKIKIELVRVPDDLQRCDALIIPGGESTTIALLARL 74

Query: 74  SGLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDS 133
           +GL+EPLR F+R ++P WGTCAG ILL+  A   KKGGQ+L+GG+NI++ RN +GSQI+S
Sbjct: 75  AGLLEPLRDFIRRQRPVWGTCAGAILLSERAEGTKKGGQELLGGVNISIARNGWGSQIES 134

Query: 134 FESLLHINHITTSSDDLFPAIFIRAP---XXXXXXXXXVEVLARL--------------- 175
           FE+ L ++     +D  F  +FIRAP            +++++RL               
Sbjct: 135 FEAPL-LSDDLKEADRPFTGVFIRAPVILSVSPTPEHPIQIISRLPADHLPRTGDPALEE 193

Query: 176 EHDIGETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
           E D    D  +IVA+RQG  + T FHPELTND+R H+YF++
Sbjct: 194 EDDTDPRDPRTIVALRQGRHMVTTFHPELTNDNRFHEYFLR 234



>gi|402220226|gb|EJU00298.1| SNO glutamine amidotransferase [Dacryopinax sp. DJM-731 SS1]
          Length = 240

 Score =  172 bits (436), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 93/221 (42%), Positives = 135/221 (61%), Gaps = 22/221 (9%)

Query: 17  FGVLALQGAFQEHIHMLQNISQVS---SAIPIRKAEQLETIDALIIPGGESTTMALIAER 73
            G+LALQGAF EH  +L  +   S   +++ +R  + L    ALIIPGGESTT+A +A R
Sbjct: 11  IGILALQGAFAEHQTILSRLKLPSHPLTSLLVRTPQDLAQCSALIIPGGESTTIASVAAR 70

Query: 74  SGLMEPLRKFVRD-EKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQID 132
           +G+++ L++F ++ +KP WGTCAG ILLA EA  +KKGGQ+L GG+ + V RN +G+Q++
Sbjct: 71  TGMLDLLKEFCQNVDKPVWGTCAGCILLAKEATGLKKGGQELFGGMGVGVKRNGYGTQLE 130

Query: 133 SFESLLHINHITTSSDDLFPAIFIRAP-------XXXXXXXXXVEVLARLE--------H 177
           SFE +L +  +    +  F  +FIRAP                 E++AR+         H
Sbjct: 131 SFEVMLDVPAL-RDPERPFAGVFIRAPIIEHVNESAPTSISIHTEIVARVPPSCLPAELH 189

Query: 178 DIGETDAS--SIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
           D  ET     ++VA+RQG    T FHPELT DDR+H+YF++
Sbjct: 190 DAAETSNKDYTVVAMRQGKKFVTTFHPELTKDDRLHEYFIK 230



>gi|150864768|ref|XP_001383739.2| hypothetical protein PICST_57121 [Scheffersomyces stipitis CBS
           6054]
 gi|149386024|gb|ABN65710.2| predicted protein [Scheffersomyces stipitis CBS 6054]
          Length = 251

 Score =  172 bits (436), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 97/235 (41%), Positives = 133/235 (56%), Gaps = 36/235 (15%)

Query: 14  QFKFGVLALQGAFQEHIHMLQNISQ---------VSSAIPIRKAEQLETIDALIIPGGES 64
           +   GVLALQGAF+EHI   Q + +           + I ++  +QL   D+L+IPGGES
Sbjct: 6   EITLGVLALQGAFREHIEYFQKVIESHPQEYSKFTFTFIEVKTEDQLRRCDSLVIPGGES 65

Query: 65  TTMALIAERSGLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNR 124
           T+++LIAER+ L++PL  +V+ E P WGTCAG+I L+ +  K  + GQ L+GGLN+ V R
Sbjct: 66  TSISLIAERTNLLQPLMDYVKSENPIWGTCAGLIFLSKQL-KNGRVGQKLLGGLNVEVTR 124

Query: 125 NQFGSQIDSFESLLHINHITTSSDDLFPAIFIRAPXXX---------------------- 162
           N FG Q+DSFES L  +         FP +FIRAP                         
Sbjct: 125 NAFGRQLDSFESPLDFSSFIPDC-HAFPTVFIRAPVITELLHDGPTESKSESDSIFYSQN 183

Query: 163 -XXXXXXVEVLARLEHDIGETDASSIVAVRQGSLLGTAFHPELTNDD-RIHKYFV 215
                  +EVL  L++  G+ D   IVAVRQG +LGT+FHPEL  DD R HK+++
Sbjct: 184 NYNNKAPIEVLHSLKNH-GKIDHELIVAVRQGHILGTSFHPELATDDYRFHKWYI 237



>gi|403418261|emb|CCM04961.1| predicted protein [Fibroporia radiculosa]
          Length = 240

 Score =  172 bits (436), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 106/222 (47%), Positives = 139/222 (62%), Gaps = 25/222 (11%)

Query: 17  FGVLALQGAFQEHIHMLQNISQVSSAIPI---RKAEQLETIDALIIPGGESTTMALIAER 73
            G+LALQGAF EH  ML+ +S V   I I   R  E LE+ DALIIPGGESTT+AL+A  
Sbjct: 12  IGILALQGAFAEHQVMLKKLS-VKKRIVILLVRTQEDLESCDALIIPGGESTTIALLARL 70

Query: 74  SGLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDS 133
           +GL+ PLR FV+  KP WGTCAG ILLA      K+GGQ+L+GG+++TV RN +GSQ++S
Sbjct: 71  AGLLGPLRDFVK-TKPVWGTCAGAILLAQSVEGAKQGGQELLGGMSVTVARNGWGSQVES 129

Query: 134 FESLLHINHITTSSDDLFPAIFIRAPXXXXX----XXXXVEVLARL-------------- 175
           FE+ L +  +   SD  F  +FIRAP             +++L+R+              
Sbjct: 130 FEAPLEVEAL-RDSDRPFHGVFIRAPVIIALHPSPSDPPMQILSRISTSLLPRTQTLVPY 188

Query: 176 -EHDIGETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
            E D    D+ +IVA+RQG  L T+FHPELT DDR H+YFV+
Sbjct: 189 DEDDTDPRDSRTIVALRQGHHLLTSFHPELTKDDRFHEYFVR 230



>gi|336373092|gb|EGO01430.1| hypothetical protein SERLA73DRAFT_176695 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336385913|gb|EGO27059.1| hypothetical protein SERLADRAFT_459857 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 230

 Score =  172 bits (435), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 103/219 (47%), Positives = 134/219 (61%), Gaps = 24/219 (10%)

Query: 17  FGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGL 76
            G+LALQGAF EH   LQN   +   + +R  E LE  DALIIPGGESTT+AL+A  +GL
Sbjct: 9   IGILALQGAFAEHQIALQNKVDI---VLVRTVEDLEKCDALIIPGGESTTIALLARLAGL 65

Query: 77  MEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFES 136
           +EPLR F++ +KP WGTCAG ILL+      KKGGQ+L+GG ++T  RN +GSQI+SFE+
Sbjct: 66  LEPLRTFLK-KKPVWGTCAGAILLSQAVENAKKGGQELLGGFSVTTARNGWGSQIESFEA 124

Query: 137 LLHINHITTSSDDLFPAIFIRAPXXXXXXX----XXVEVLARL---------------EH 177
            L ++ +   +   F  +FIRAP             +E++ARL               E 
Sbjct: 125 PLLVDGLRDPNRS-FMGVFIRAPVVLSLNPSPHDSPIEIVARLPAGLLPQSQRVVMPDED 183

Query: 178 DIGETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
           D    D  +IVA+RQG+   T FHPELT DDR H+YFVQ
Sbjct: 184 DTDPRDPKTIVAMRQGNHFLTTFHPELTKDDRFHEYFVQ 222



>gi|354543908|emb|CCE40630.1| hypothetical protein CPAR2_106650 [Candida parapsilosis]
          Length = 241

 Score =  171 bits (434), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 102/232 (43%), Positives = 135/232 (58%), Gaps = 37/232 (15%)

Query: 17  FGVLALQGAFQEHIHMLQNISQVS---------SAIPIRKAEQLETIDALIIPGGESTTM 67
            GVLALQGAF+EHI   +++ Q S         + I +R  E+LE  DAL+IPGGES++M
Sbjct: 9   LGVLALQGAFREHITYFKSVIQQSEEKYSSYSINIIAVRTKEELENCDALVIPGGESSSM 68

Query: 68  ALIAERSGLMEPLRKFVRDE-KPTWGTCAGMILLANE-ANKVKKGGQDLIGGLNITVNRN 125
           + IAER+ L+  L  FV DE K  WGTCAG+I LA E  N V+   Q  +GGL+I V+RN
Sbjct: 69  SYIAERTNLLPHLYDFVSDESKSIWGTCAGLIFLAKEIKNAVEN--QTCLGGLDIQVSRN 126

Query: 126 QFGSQIDSFESLLHINHITTSSDDLFPAIFIRAPXXX----------------------X 163
            FG Q+DSFE  L  +      D+ FP +FIRAP                          
Sbjct: 127 AFGRQVDSFEQNLDFSGFIPGCDN-FPTVFIRAPVVTKILENEELGGSASDKVVRSKNHY 185

Query: 164 XXXXXVEVLARLEHDIGETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFV 215
                VEVL +L +  GE +   IVAVRQG +LGT+FHPEL++D+R H++F+
Sbjct: 186 VNKAPVEVLYKLHNYDGEKN-ELIVAVRQGRILGTSFHPELSDDNRFHQWFI 236



>gi|475446797|gb|EMT01574.1| hypothetical protein F775_16936 [Aegilops tauschii]
          Length = 255

 Score =  171 bits (433), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 98/223 (43%), Positives = 132/223 (59%), Gaps = 21/223 (9%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG++ EH+  L+ I      + +RK EQL+ +D+LIIP GESTTMA +A    L 
Sbjct: 5   GVLALQGSYNEHMSALRRIG--VKGVEVRKPEQLQGLDSLIIPRGESTTMAKLANYHNLF 62

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             LR+FV   KP WGTCAG+I LAN+A   K GGQ+L+GGL+ TV+RN FGSQ+ SFE+ 
Sbjct: 63  PALREFVGAGKPVWGTCAGLIFLANKAVGQKLGGQELVGGLDCTVHRNFFGSQLQSFETE 122

Query: 138 LHINHIT--TSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGE-------------- 181
           L +  +       +    +FIRAP         VE+LA      G               
Sbjct: 123 LSVPMLADKEGGSNTCRGVFIRAP-AILEVGSDVEILAECPVPSGRPSITIPSAEGVEEE 181

Query: 182 --TDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQDHY 222
             T    IVAVRQG++L TAFHPELT+D R H++F+ + ++ +
Sbjct: 182 VYTKDRVIVAVRQGNILATAFHPELTSDCRWHRFFLDMDKESH 224



>gi|73748438|ref|YP_307677.1| glutamine amidotransferase subunit PdxT [Dehalococcoides sp. CBDB1]
 gi|452203442|ref|YP_007483575.1| glutamine amidotransferase subunit PdxT [Dehalococcoides mccartyi
           DCMB5]
 gi|452204878|ref|YP_007485007.1| glutamine amidotransferase subunit PdxT [Dehalococcoides mccartyi
           BTF08]
 gi|499628378|ref|WP_011309112.1| glutamine amidotransferase [Dehalococcoides mccartyi]
 gi|119388910|sp|Q3ZX06.1|PDXT_DEHSC RecName: Full=Glutamine amidotransferase subunit PdxT; AltName:
           Full=Glutamine amidotransferase glutaminase subunit PdxT
 gi|73660154|emb|CAI82761.1| SNO glutamine amidotransferase family protein [Dehalococcoides sp.
           CBDB1]
 gi|452110501|gb|AGG06233.1| glutamine amidotransferase subunit PdxT [Dehalococcoides mccartyi
           DCMB5]
 gi|452111934|gb|AGG07665.1| glutamine amidotransferase subunit PdxT [Dehalococcoides mccartyi
           BTF08]
          Length = 195

 Score =  171 bits (433), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 91/207 (43%), Positives = 130/207 (62%), Gaps = 14/207 (6%)

Query: 15  FKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERS 74
            K GVLALQGAF+EH++ML  +   + A+ +RKAE L  +  LIIPGGESTT+  + +  
Sbjct: 1   MKIGVLALQGAFREHLNMLGTLG--AEAVEVRKAEGLPELSGLIIPGGESTTITKLLDIF 58

Query: 75  GLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSF 134
           G+ EP++   +   P WGTCAGMI LA E      G + L G ++ITV RN FG Q++SF
Sbjct: 59  GMAEPIKALAKKGMPIWGTCAGMICLAKELPGDISGVKPL-GLMDITVRRNAFGRQVNSF 117

Query: 135 ESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGS 194
           E++L +  +  +    FPA+FIRAP         VE+L++L          +IVAVR+ +
Sbjct: 118 EAMLKVKGLDEAD---FPAVFIRAP-LVEKTGKGVEILSKLPD-------GTIVAVRENN 166

Query: 195 LLGTAFHPELTNDDRIHKYFVQLTQDH 221
           LL  +FHPEL+ D+R H+YFVQ+ + +
Sbjct: 167 LLAISFHPELSGDNRFHRYFVQMAKTY 193



>gi|403511167|ref|YP_006642805.1| pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2
           [Nocardiopsis alba ATCC BAA-2165]
 gi|504722614|ref|WP_014909716.1| glutamine amidotransferase [Nocardiopsis alba]
 gi|402799842|gb|AFR07252.1| pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2
           [Nocardiopsis alba ATCC BAA-2165]
          Length = 202

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 131/205 (63%), Gaps = 10/205 (4%)

Query: 17  FGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGL 76
            GVLALQG   EH+ +L+ +  VS+   +   E L+++DALIIPGGESTTM+ +A R GL
Sbjct: 7   IGVLALQGDVAEHVAVLETLG-VSTG-KVLSPEHLDSVDALIIPGGESTTMSKLARRYGL 64

Query: 77  MEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFES 136
           ++PLRK V    P +GTCAGMI+LA+E        Q+ +GG+++TV RN FG Q +SFE+
Sbjct: 65  IDPLRKRVAAGMPAYGTCAGMIMLADEILG-GTADQETVGGIDMTVRRNAFGRQTESFET 123

Query: 137 LLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGSLL 196
            + I+ I    D+ F A+FIRAP         V VL R+    G  +A  IVAV QG L+
Sbjct: 124 GVRIDGI---GDEPFDAVFIRAP-WVERVGPEVTVLGRVP---GPGEAGRIVAVLQGGLM 176

Query: 197 GTAFHPELTNDDRIHKYFVQLTQDH 221
            T+FHPELT D RIH+ FV + + H
Sbjct: 177 ATSFHPELTGDTRIHRLFVDIVKGH 201



>gi|357113804|ref|XP_003558691.1| PREDICTED: pyridoxal biosynthesis protein PDX2-like [Brachypodium
           distachyon]
          Length = 255

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 97/223 (43%), Positives = 129/223 (57%), Gaps = 21/223 (9%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG++ EH+  L+ I      + +RK EQL+ +D+LIIPGGESTTMA +A    L 
Sbjct: 5   GVLALQGSYNEHMAALRRIG--VKGVEVRKPEQLQGLDSLIIPGGESTTMAKLANYHNLF 62

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             LR+FV   KP WGTCAG+I LAN+A   K GGQ+ +GGL+ TV+RN FGSQ+ SFE+ 
Sbjct: 63  PALREFVGAGKPVWGTCAGLIFLANKAVGQKSGGQEFVGGLDCTVHRNFFGSQLQSFETE 122

Query: 138 LHINHIT--TSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDAS---------- 185
           L +  +            +FIRAP         VE+LA      G    +          
Sbjct: 123 LSVPMLAEKEGGSHTCRGVFIRAP-GILEVGSDVEILADCPVPAGRASITITSGEGFEEG 181

Query: 186 ------SIVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQDHY 222
                  IVAVRQG++L TAFHPELT+D R H+ F+ + +  +
Sbjct: 182 MYSKDRVIVAVRQGNILATAFHPELTSDSRWHRLFLDMDKGSH 224



>gi|395327648|gb|EJF60046.1| SNO glutamine amidotransferase [Dichomitus squalens LYAD-421 SS1]
          Length = 267

 Score =  171 bits (432), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 102/218 (46%), Positives = 136/218 (62%), Gaps = 23/218 (10%)

Query: 20  LALQGAFQEHIHMLQNISQVSSAIP--IRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           +ALQGAF EH  MLQ +S     +   IR+ E L+  DALIIPGGESTT+AL+A  +GL+
Sbjct: 37  IALQGAFAEHQVMLQKLSLKKRVVIVLIRQPEDLDKCDALIIPGGESTTIALLARLAGLL 96

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
           EP+R+F++  KP WGTCAG ILLA      KKGGQ+L+GG+++TV RN FGSQ++SFE+ 
Sbjct: 97  EPIREFLKT-KPVWGTCAGAILLAQWVENAKKGGQELLGGISVTVERNGFGSQVESFEAP 155

Query: 138 LHINHITTSSDDLFPAIFIRAPX----XXXXXXXXVEVLARL---------------EHD 178
           L +  +   S+  F  IFIRAP             +++++R+               E D
Sbjct: 156 LEVEGL-RESNRPFHGIFIRAPVVVNLKPSPTDPPIQIISRISASLLPASQTVIPPDEDD 214

Query: 179 IGETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
               D  +IVA+RQG  L T FHPELT DDR H+YFV+
Sbjct: 215 TDPRDPRTIVALRQGLHLLTTFHPELTKDDRFHEYFVR 252



>gi|223995393|ref|XP_002287380.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220976496|gb|EED94823.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 238

 Score =  170 bits (431), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 101/228 (44%), Positives = 134/228 (58%), Gaps = 24/228 (10%)

Query: 13  PQFKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAE 72
           P    GVLALQGAF+EH   +++IS   + + IR   QL  ID +I PGGEST M LI +
Sbjct: 4   PSITIGVLALQGAFEEHQRCIESISPSITTLQIRTPSQLSQIDGIIFPGGESTAMGLIGD 63

Query: 73  -RSGLMEPLRKFVRDE-KPTWGTCAGMILLANEA---NKVKKGGQDLIGGLNITVNRNQF 127
             +GL   LR FVR+  KPTWGTCAGMILLA      + V   GQ LIGG++I V RN F
Sbjct: 64  ATTGLWGALRTFVRESGKPTWGTCAGMILLAERCVGTSAVITKGQSLIGGVDILVCRNYF 123

Query: 128 GSQIDSFE--------SLLHINHITTSS------DDLFPAIFIRAPXXXXXXXXXVEVLA 173
           GSQI SFE          + ++ +T+ S      +  FP +FIRAP         VEVL 
Sbjct: 124 GSQISSFEMDTPAPPRPEVCVDGMTSCSSAEEGENASFPGVFIRAP-AILTAGAGVEVLG 182

Query: 174 RLEHDIGETDASS----IVAVRQGSLLGTAFHPELTNDDRIHKYFVQL 217
           ++      +D ++    I AV++G++L TAFHPE+ +D R H+YFV +
Sbjct: 183 KVVAAPWASDETNAREVICAVKKGNILCTAFHPEIADDLRWHEYFVGM 230



>gi|367044508|ref|XP_003652634.1| hypothetical protein THITE_2114296 [Thielavia terrestris NRRL 8126]
 gi|346999896|gb|AEO66298.1| hypothetical protein THITE_2114296 [Thielavia terrestris NRRL 8126]
          Length = 258

 Score =  170 bits (431), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 101/252 (40%), Positives = 143/252 (56%), Gaps = 50/252 (19%)

Query: 18  GVLALQGAFQEHI--------HMLQNISQVSSA-------IPIRKAEQLETIDALIIPGG 62
           GVLALQG   EH+        H+L +  Q S+        I +R A QL   DALIIPGG
Sbjct: 8   GVLALQGGVVEHLNLLRKAATHVLTSQPQPSADNGIDFAFIEVRTAPQLAQCDALIIPGG 67

Query: 63  ESTTMALIAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNIT 121
           ESTTMA++A R GL++PLR FV+   KP WGTCAG+++LA +A+  K+GGQ+L+GGL++ 
Sbjct: 68  ESTTMAIVARRLGLLDPLRDFVKVQHKPVWGTCAGLVMLAEQASATKQGGQELVGGLDVR 127

Query: 122 VNRNQFGSQIDSFESLLHINHITTSSDD-----LFPAIFIRAPXXXXXXXXXVEVLARLE 176
           V RN++G+Q+ SF + L +  +  + +       F A+FIRAP          E++A   
Sbjct: 128 VLRNRYGTQMQSFVAGLDLGFLKEAKNGEAAAAPFRAVFIRAPVVE-------EIIADGR 180

Query: 177 HDIGETDASS----------------------IVAVRQGSLLGTAFHPELTNDDRIHKYF 214
            D GE    +                      IVAVRQG++ GT+FHPELT+D RIH ++
Sbjct: 181 QDGGEGKGKAPVEVLGVYGGEGGTGGGEGKGDIVAVRQGNVFGTSFHPELTDDVRIHVWW 240

Query: 215 VQLTQDHYNTGK 226
           ++   D    G+
Sbjct: 241 LRQVVDAARHGR 252



>gi|389865012|ref|YP_006367253.1| glutamine amidotransferase subunit pdxT [Modestobacter marinus]
 gi|504554256|ref|WP_014741358.1| glutamine amidotransferase [Modestobacter marinus]
 gi|388487216|emb|CCH88774.1| Glutamine amidotransferase subunit pdxT [Modestobacter marinus]
          Length = 221

 Score =  170 bits (431), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 91/203 (44%), Positives = 124/203 (61%), Gaps = 10/203 (4%)

Query: 17  FGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGL 76
            GVLALQG  +EH+  L+     +  + +R+  +L  +D L++PGGESTTMA +A+R GL
Sbjct: 6   IGVLALQGDVREHLAALRAAG--AEPVTVRRPAELAAVDGLVVPGGESTTMATLADRFGL 63

Query: 77  MEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFES 136
           +EPLR  VR   P +G+CAGMILLA+        GQ  +GGL++ V RN FG Q+DSFE+
Sbjct: 64  LEPLRTAVRGGLPAYGSCAGMILLADRVLDAPA-GQRTVGGLDVVVRRNAFGRQVDSFET 122

Query: 137 LLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGSLL 196
            + +  +         A+FIRAP         VEVL R+   +G      IVAVRQG L+
Sbjct: 123 EVEVEGVAGGP---VHAVFIRAP-WVEEVGPDVEVLGRV---VGGPADGKIVAVRQGRLV 175

Query: 197 GTAFHPELTNDDRIHKYFVQLTQ 219
            T+FHPELT D R+H  FV+L +
Sbjct: 176 ATSFHPELTGDSRVHAMFVELVR 198



>gi|156048300|ref|XP_001590117.1| hypothetical protein SS1G_08881 [Sclerotinia sclerotiorum 1980]
 gi|154693278|gb|EDN93016.1| hypothetical protein SS1G_08881 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 303

 Score =  170 bits (430), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 106/276 (38%), Positives = 145/276 (52%), Gaps = 77/276 (27%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSA--------------IPIRKAEQLETIDALIIPGGE 63
           GVLALQGAF EHI +L+   Q+ +               I +R   +L + DALIIPGGE
Sbjct: 12  GVLALQGAFNEHIQLLRAARQILATKTKTTHDLDVKYNFIEVRNEIELNSCDALIIPGGE 71

Query: 64  STTMALIAERSGLMEPLRKFVRDEK-PTWGTCAGMILLANEANKVKKGGQDLIGGLNITV 122
           ST ++L+A+RSGL+EPLR FV+  + PTWGTCAG+ILL+  AN+ K GGQ+LIGGL++ V
Sbjct: 72  STAISLVAQRSGLLEPLRDFVKLHRYPTWGTCAGLILLSESANRTKAGGQELIGGLDVRV 131

Query: 123 NRNQFGSQIDSFESLLHINHITTSS---------------DDLFPAIFIRAPXXX----- 162
           NRN FG Q++SF + L +  +++ +                  F AIFIRAP        
Sbjct: 132 NRNHFGRQVESFSADLDLPFLSSVTLSPSSPSSEKEPKEKTAPFQAIFIRAPVVEKLLPH 191

Query: 163 -------------------------------XXXXXXVEVLARL--------EHDIGE-- 181
                                                VE+LA L        +  I E  
Sbjct: 192 LPGPQISESKLESTVIAPSRPIDKNNIPNPDSILSAPVEILATLPGRTASIPDPQIQEKL 251

Query: 182 -TDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
            ++A  IVAVRQ ++ GT+FHPELT D RIH ++++
Sbjct: 252 NSEAGDIVAVRQANVFGTSFHPELTGDARIHAWWLE 287



>gi|325184607|emb|CCA19100.1| glutamine amidotransferase subunit pdxT putative [Albugo laibachii
           Nc14]
          Length = 225

 Score =  170 bits (430), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 136/215 (63%), Gaps = 13/215 (6%)

Query: 13  PQFKFGVLALQGAFQEHIHMLQNISQVSSA-----IPIRKAEQLETIDALIIPGGESTTM 67
           P+ + GVLALQG+F+EHI +LQ +    +      + +R   ++E++DALI+PGGESTT+
Sbjct: 3   PKLRIGVLALQGSFKEHIEILQQLENTQNKYELDIVEVRLPSEIESLDALILPGGESTTI 62

Query: 68  ALIAERSGLMEPLRKF-VRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQ 126
             +A    L++ LR + + + KP WGTCAGMI+L  +A   + GGQ+LIGGL   ++RN 
Sbjct: 63  GKLAAECNLLDALRNWTLVERKPIWGTCAGMIMLCEDAKHTETGGQNLIGGLKAQISRNF 122

Query: 127 FGSQIDSFESLLHINHITTSSDDLFPAIFIRAPXXXX---XXXXXVEVLARLEH-DIGET 182
           FG+Q+ SFE L  I+     +   + AIFIRAP            +++L+RL      E+
Sbjct: 123 FGAQVRSFEKL--IDGPPEFNTQPYKAIFIRAPAIVSIDEKSADEIQILSRLSAIPEDES 180

Query: 183 DASS-IVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
           D S  I++ R+ ++L TAFHPELT DDR H+YF++
Sbjct: 181 DPSDVIISARKENILVTAFHPELTQDDRWHRYFIE 215



>gi|297559800|ref|YP_003678774.1| SNO glutamine amidotransferase [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
 gi|502916899|ref|WP_013151875.1| glutamine amidotransferase [Nocardiopsis dassonvillei]
 gi|296844248|gb|ADH66268.1| SNO glutamine amidotransferase [Nocardiopsis dassonvillei subsp.
           dassonvillei DSM 43111]
          Length = 202

 Score =  170 bits (430), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 95/207 (45%), Positives = 129/207 (62%), Gaps = 14/207 (6%)

Query: 17  FGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGL 76
            GVLALQG   EH+  LQ +   +  + +   +QL+ +D L+IPGGESTTM+ +A R GL
Sbjct: 7   IGVLALQGDVAEHLRALQALD--AHTVKVLSPDQLDALDGLVIPGGESTTMSKLAVRYGL 64

Query: 77  MEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQD--LIGGLNITVNRNQFGSQIDSF 134
           MEPLRK +    P +GTCAGMI+L   A+++  G  D   +GG+++TV RN FG Q +SF
Sbjct: 65  MEPLRKRIAAGMPAYGTCAGMIML---ADRILGGTADQQTVGGIDMTVRRNAFGRQTESF 121

Query: 135 ESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGS 194
           E+ + I+ +     D F A+FIRAP         VEVL  +    G  +A  IVAVRQG 
Sbjct: 122 EAAVDIDGL---EGDPFDAVFIRAP-WVESVGPGVEVLGAVP---GPDEAGRIVAVRQGG 174

Query: 195 LLGTAFHPELTNDDRIHKYFVQLTQDH 221
           L+ T+FHPELT D RIH+ FV + + H
Sbjct: 175 LMATSFHPELTGDTRIHRLFVDIVKGH 201



>gi|254566813|ref|XP_002490517.1| hypothetical protein [Komagataella pastoris GS115]
 gi|238030313|emb|CAY68236.1| hypothetical protein PAS_chr1-4_0392 [Komagataella pastoris GS115]
 gi|328350907|emb|CCA37307.1| glutamine amidotransferase [Komagataella pastoris CBS 7435]
          Length = 225

 Score =  170 bits (430), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 97/216 (44%), Positives = 129/216 (59%), Gaps = 19/216 (8%)

Query: 14  QFKFGVLALQGAFQEHI-HMLQNISQVS-------SAIPIRKAEQLETIDALIIPGGEST 65
           Q   GVLA+QGAF+EHI H+++ I ++        S   +R  E L   DAL+IPGGEST
Sbjct: 6   QIVIGVLAIQGAFREHIQHLVKAIDELGLQEKLEISVFEVRDEETLVRCDALVIPGGEST 65

Query: 66  TMALIAERSGLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRN 125
           TM+L+A+R  L+EPLR+F+   KP WGTCAG+I+L++     K   Q L+GGL+I   RN
Sbjct: 66  TMSLVAQRLNLLEPLRQFIASGKPAWGTCAGLIMLSSSLQN-KSCDQQLLGGLDIETTRN 124

Query: 126 QFGSQIDSFESLLHINHITTSSDDLFPAIFIRAPXXXXXX-----XXXVEVLARLEHDIG 180
            FG Q+DSF + L  +         F  +FIR P              VEVLA L  + G
Sbjct: 125 AFGRQLDSFIADLDYSKFIPGLTA-FQTVFIRGPVISKILPPSPGKPKVEVLASLPEERG 183

Query: 181 ETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
               S I+AVRQG +LGT+FHPEL+ D   HK++VQ
Sbjct: 184 ----SQIIAVRQGDILGTSFHPELSEDVSFHKWWVQ 215



>gi|168011955|ref|XP_001758668.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162690278|gb|EDQ76646.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 212

 Score =  169 bits (429), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 97/202 (48%), Positives = 130/202 (64%), Gaps = 15/202 (7%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG+F+EHI  L+ +     A+ +RK EQL  +  LIIPGGESTTMA +AE++ L 
Sbjct: 4   GVLALQGSFKEHIVCLRKLG--VDAVEVRKLEQLVGLSGLIIPGGESTTMAKLAEKNNLF 61

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             LR+F    KP WGTCAG+I LA+ A+ VK+GGQ L+GGL+ TV+RN FGSQ++SFE  
Sbjct: 62  PALREFSTAGKPIWGTCAGLIFLADRASGVKEGGQKLLGGLDCTVHRNFFGSQLNSFEME 121

Query: 138 LHINHITT--SSDDLFPAIFIRAPXXXXXXXXXVEVLARL--------EHDIGETDASSI 187
           L +  + +     +   A+FIRAP         VEVLA          + ++G+     I
Sbjct: 122 LSVPTLASREGGAETCRAVFIRAP-AIVDVGSSVEVLAEYPLAPGQAPQQEVGKDKV--I 178

Query: 188 VAVRQGSLLGTAFHPELTNDDR 209
           VAV+Q ++L TAFHPELT+D R
Sbjct: 179 VAVKQNNMLATAFHPELTSDLR 200



>gi|289432485|ref|YP_003462358.1| SNO glutamine amidotransferase [Dehalococcoides sp. GT]
 gi|502749270|ref|WP_012984254.1| glutamine amidotransferase [Dehalococcoides mccartyi]
 gi|288946205|gb|ADC73902.1| SNO glutamine amidotransferase [Dehalococcoides sp. GT]
          Length = 195

 Score =  169 bits (429), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 90/207 (43%), Positives = 130/207 (62%), Gaps = 14/207 (6%)

Query: 15  FKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERS 74
            K GVLALQGAF+EH+++L  +   + A+ +RKAE L  +  LIIPGGESTT+  + +  
Sbjct: 1   MKIGVLALQGAFREHLNILGTLG--AEAVEVRKAEGLPELSGLIIPGGESTTITKLLDIF 58

Query: 75  GLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSF 134
           G+ EP++   +   P WGTCAGMI LA E      G + L G ++ITV RN FG Q++SF
Sbjct: 59  GMAEPIKALAKKGMPIWGTCAGMICLAKELPGDISGVKPL-GLMDITVRRNAFGRQVNSF 117

Query: 135 ESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGS 194
           E++L +  +  +    FPA+FIRAP         VE+L++L          +IVAVR+ +
Sbjct: 118 EAMLKVKGLDEAD---FPAVFIRAP-LVEKTGKGVEILSKLPD-------GTIVAVRENN 166

Query: 195 LLGTAFHPELTNDDRIHKYFVQLTQDH 221
           LL  +FHPEL+ D+R H+YFVQ+ + +
Sbjct: 167 LLAISFHPELSGDNRFHRYFVQMAKTY 193



>gi|506932978|ref|YP_008013416.1| glutamine amidotransferase [Amycolatopsis orientalis HCCB10007]
 gi|511267581|ref|WP_016334763.1| glutamine amidotransferase [Amycolatopsis orientalis]
 gi|505817090|gb|AGM07013.1| glutamine amidotransferase [Amycolatopsis orientalis HCCB10007]
          Length = 209

 Score =  169 bits (428), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 130/203 (64%), Gaps = 8/203 (3%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG  +EH  M++     + A+P+R+A +L  +D L++PGGESTTM+ + E   L+
Sbjct: 12  GVLALQGDVREHAAMVERAG--ARALPVRRANELSEVDGLVLPGGESTTMSRLLETFELL 69

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
           EPLR+ + D  P +G+CAGMILLA +A    +  Q  +GGL++ V RN FG Q+DSFE+ 
Sbjct: 70  EPLRERIADGMPAFGSCAGMILLARQALD-GRPDQRQLGGLDVVVRRNAFGRQVDSFEAD 128

Query: 138 LHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASS-IVAVRQGSLL 196
           L    I         A+FIRAP         VEVLA +    G  DA++ IVAVRQG++L
Sbjct: 129 LDFTGIEGGP---VHAVFIRAP-WVEKAGDGVEVLASVPEMPGSEDAAARIVAVRQGAVL 184

Query: 197 GTAFHPELTNDDRIHKYFVQLTQ 219
            T+FHPELT D+R+H+ FV L +
Sbjct: 185 ATSFHPELTGDERVHRLFVDLVR 207



>gi|125537943|gb|EAY84338.1| hypothetical protein OsI_05715 [Oryza sativa Indica Group]
          Length = 268

 Score =  169 bits (427), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 101/214 (47%), Positives = 128/214 (59%), Gaps = 23/214 (10%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG+F EH+  L+ I      + +RK EQL+ +D+LIIPGGESTTMA +A    L 
Sbjct: 5   GVLALQGSFNEHLAALRRIG--VRGVEVRKPEQLQGLDSLIIPGGESTTMAKLANYHNLF 62

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             LR+FV   +P WGTCAG+I LAN+A   K GGQ+LIGGL+ TV+RN FGSQ+ SFE+ 
Sbjct: 63  PALREFVGTGRPVWGTCAGLIFLANKAVGQKSGGQELIGGLDCTVHRNFFGSQLQSFETE 122

Query: 138 LHINHIT--TSSDDLFPAIFIRAPXXXXXXXXXVEVLAR-----------------LEHD 178
           L +  +       D    +FIRAP         VEVLA                  +E +
Sbjct: 123 LSVPMLAEKEGGSDTCRGVFIRAP-AILDVGSDVEVLADCPVPSDRPSITIASGEGVEEE 181

Query: 179 IGETDASSIVAVRQGSLLGTAFHPELTNDDRIHK 212
           +   D   IVAVRQG++L TAFHPELT+D R  K
Sbjct: 182 VYSKD-RVIVAVRQGNILATAFHPELTSDSRWLK 214



>gi|336320689|ref|YP_004600657.1| SNO glutamine amidotransferase [[Cellvibrio] gilvus ATCC 13127]
 gi|503649532|ref|WP_013883608.1| glutamine amidotransferase [[Cellvibrio] gilvus]
 gi|336104270|gb|AEI12089.1| SNO glutamine amidotransferase [[Cellvibrio] gilvus ATCC 13127]
          Length = 201

 Score =  167 bits (424), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 132/205 (64%), Gaps = 14/205 (6%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG  +EH+H L+ +   + A+P+R+  +L+ +DAL+IPGGESTT+  +     L+
Sbjct: 6   GVLALQGDVREHVHALEAVG--ARAVPVRRRSELDAVDALVIPGGESTTIDKLLRAFELV 63

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKG--GQDLIGGLNITVNRNQFGSQIDSFE 135
           +P+R+ +R   P +G+CAGMILL   A++V  G  GQ  +GG+++TV RN FG Q+DSFE
Sbjct: 64  DPVRERLRAGMPAYGSCAGMILL---ADRVLGGIEGQQTLGGVDVTVRRNAFGRQVDSFE 120

Query: 136 SLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGSL 195
           + L I+ I    D    A+FIRAP           V+ R+E       A  IVAVRQG L
Sbjct: 121 TDLAIDGI---EDGPLHAVFIRAPWVEEVGPAAT-VVGRVEAG---PAAGRIVAVRQGPL 173

Query: 196 LGTAFHPELTNDDRIHKYFVQLTQD 220
           L T+FHPE+T D R+H+ FVQ+ +D
Sbjct: 174 LVTSFHPEVTGDTRVHRLFVQIVRD 198



>gi|336263435|ref|XP_003346497.1| hypothetical protein SMAC_04670 [Sordaria macrospora k-hell]
 gi|380090391|emb|CCC11687.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 293

 Score =  167 bits (424), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 102/278 (36%), Positives = 139/278 (50%), Gaps = 64/278 (23%)

Query: 14  QFKFGVLALQGAFQEHIHMLQNISQVSSA----------------IPIRKAEQLETIDAL 57
           Q   GVLALQG   EHI +LQ  +   S+                I +R   QL   DAL
Sbjct: 10  QITVGVLALQGGVIEHISLLQKAAVQLSSQQSTDSSSTSTPQFNFIQVRTTAQLSQCDAL 69

Query: 58  IIPGGESTTMALIAERSGLMEPLRKFVRD---------------------EKPTWGTCAG 96
           +IPGGESTTMA++A R GL++PLR+FV+                       KPTWGTCAG
Sbjct: 70  VIPGGESTTMAIVARRLGLLDPLREFVKQVLFVAFTRSSLSSTHLPLSVQHKPTWGTCAG 129

Query: 97  MILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESLLHINHITTSSDDL-FPAIF 155
           +++LA+ A+  K+GGQ+LIGGL++ V RN +G+QI SF   L +  +    D   F  +F
Sbjct: 130 LVMLASAASATKQGGQELIGGLDVKVLRNWYGTQIQSFVGDLRLPFLEEEQDKKPFRGVF 189

Query: 156 IRAPX--------------------------XXXXXXXXVEVLARLEHDIGETDASSIVA 189
           IRAP                                   V+VL       G  +   IVA
Sbjct: 190 IRAPVVEEIITSGSGTAENAVELGNDEIARLKERQKTEKVQVLGTYPKPQGTGEGDDIVA 249

Query: 190 VRQGSLLGTAFHPELTNDDRIHKYFVQLTQDHYNTGKG 227
           VRQG++ GT+FHPELT+D RIH ++++   +   +G G
Sbjct: 250 VRQGNVFGTSFHPELTDDVRIHVWWLKQVVEGLRSGGG 287



>gi|392408580|ref|YP_006445187.1| pyridoxal phosphate synthase yaaE subunit [Desulfomonile tiedjei
           DSM 6799]
 gi|504620980|ref|WP_014808082.1| glutamine amidotransferase [Desulfomonile tiedjei]
 gi|390621716|gb|AFM22923.1| pyridoxal phosphate synthase yaaE subunit [Desulfomonile tiedjei
           DSM 6799]
          Length = 191

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 92/205 (44%), Positives = 124/205 (60%), Gaps = 18/205 (8%)

Query: 15  FKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERS 74
            K GVLALQGAFQEH  +L+ +     A+ +R  EQLE +D LIIPGGEST++  +A+  
Sbjct: 1   MKIGVLALQGAFQEHCAILKRLG--VEAVQVRLPEQLEDLDGLIIPGGESTSIGKLADWY 58

Query: 75  GLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSF 134
           GLMEPL K  R   P WGTCAG++ +A +        Q ++  +++ + RN FG Q+DSF
Sbjct: 59  GLMEPLVKVSRS-VPVWGTCAGLVFMARDVGM----DQPVLKAMDMVIERNAFGRQVDSF 113

Query: 135 ESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGS 194
           E  L I+ +       F  +FIRAP         VE++ +L+          IVA RQG 
Sbjct: 114 EEDLEISGLEGGP---FHGVFIRAPAIVRVGKE-VEIIGKLKD-------GRIVAARQGK 162

Query: 195 LLGTAFHPELTNDDRIHKYFVQLTQ 219
           LL TAFHPELT+DDR+HKYFV + +
Sbjct: 163 LLVTAFHPELTSDDRLHKYFVDMCK 187



>gi|300087850|ref|YP_003758372.1| SNO glutamine amidotransferase [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
 gi|502983221|ref|WP_013218197.1| glutamine amidotransferase [Dehalogenimonas lykanthroporepellens]
 gi|299527583|gb|ADJ26051.1| SNO glutamine amidotransferase [Dehalogenimonas
           lykanthroporepellens BL-DC-9]
          Length = 202

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 96/207 (46%), Positives = 123/207 (59%), Gaps = 12/207 (5%)

Query: 15  FKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERS 74
            K GVLALQGAF EHIHML+ +  V  A+ +R+  Q++ +  LIIPGGESTT+  +  + 
Sbjct: 1   MKIGVLALQGAFIEHIHMLERVPSVE-AVEVRRTSQIQGLSGLIIPGGESTTILKLIRQH 59

Query: 75  GLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSF 134
           G+   L +   +  P WGTCAG ILLA +           +G +NITV RN FG Q+DSF
Sbjct: 60  GIDSRLTELSGNGFPIWGTCAGTILLAGQIANTNPNMPAGLGLMNITVVRNAFGRQVDSF 119

Query: 135 ESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGS 194
           ES L I  +    D  FPA+FIRAP         VEVLARL +        SIVA RQ +
Sbjct: 120 ESNLQIPVL---GDIPFPAVFIRAP-LIEETQPPVEVLARLGN-------GSIVAARQEN 168

Query: 195 LLGTAFHPELTNDDRIHKYFVQLTQDH 221
           LL T FHPEL  DDR H+YF+ + + +
Sbjct: 169 LLATTFHPELGQDDRFHRYFITMAEAY 195



>gi|392569056|gb|EIW62230.1| SNO glutamine amidotransferase [Trametes versicolor FP-101664 SS1]
          Length = 245

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 100/221 (45%), Positives = 139/221 (62%), Gaps = 23/221 (10%)

Query: 17  FGVLALQGAFQEHIHMLQNISQVSSAIP--IRKAEQLETIDALIIPGGESTTMALIAERS 74
            G+LALQGAF EH  MLQ +S     +   IR+ E L+  DA+IIPGGESTT+AL+A  +
Sbjct: 12  IGILALQGAFAEHQVMLQKLSLKRKVVIVLIRQPEDLDKCDAMIIPGGESTTIALLARLA 71

Query: 75  GLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSF 134
           GL+EPLR+F++  KP WGTCAG ILLA      K+GGQ+L+GG+++ V RN FGSQ++SF
Sbjct: 72  GLLEPLREFLK-AKPVWGTCAGAILLARAVAGAKRGGQELLGGISVAVERNGFGSQVESF 130

Query: 135 ESLLHINHITTSSDDLFPAIFIRAPXXXXX----XXXXVEVLARLEHDI---GETDAS-- 185
           E+ L ++ +   S+  F  IFIRAP             +++++R+   +   G+T     
Sbjct: 131 EAPLEVDGL-RESNRAFHGIFIRAPVVMSLDPTPTDPPIQIISRISTSLLPEGQTAVPDD 189

Query: 186 ----------SIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
                     +IVA+RQG  L T FHPELT DDR H+YF++
Sbjct: 190 EDDTDPRDPRTIVALRQGLHLLTTFHPELTKDDRFHEYFIR 230



>gi|491301085|ref|WP_005159088.1| Pyridoxine biosynthesis glutamine amidotransferase, glutaminase
           subunit [Amycolatopsis azurea]
 gi|449420546|gb|EMD26022.1| Pyridoxine biosynthesis glutamine amidotransferase, glutaminase
           subunit [Amycolatopsis azurea DSM 43854]
          Length = 209

 Score =  167 bits (423), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 129/203 (63%), Gaps = 8/203 (3%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG  +EH  M++     + A+P+R+A +L  +D L++PGGESTTM+ + E   L+
Sbjct: 12  GVLALQGDVREHAAMVERAG--ARALPVRRASELSEVDGLVLPGGESTTMSRLLETFELL 69

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
           EPLR+ +    P +G+CAGMILLA +A   +   Q L GGL++ V RN FG Q+DSFE+ 
Sbjct: 70  EPLRERIAGGLPAFGSCAGMILLARQALDGRPDQQQL-GGLDVVVRRNAFGRQVDSFEAD 128

Query: 138 LHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASS-IVAVRQGSLL 196
           L    I         A+FIRAP         VEVLA +    G  DA++ IVAVRQG++L
Sbjct: 129 LDFTGIEGGP---VHAVFIRAP-WVEKAGDGVEVLASVPEMPGSDDAAARIVAVRQGAVL 184

Query: 197 GTAFHPELTNDDRIHKYFVQLTQ 219
            T+FHPELT D+R+H+ FV L +
Sbjct: 185 ATSFHPELTGDERVHRLFVDLVR 207



>gi|296270040|ref|YP_003652672.1| SNO glutamine amidotransferase [Thermobispora bispora DSM 43833]
 gi|502897336|ref|WP_013132312.1| glutamine amidotransferase [Thermobispora bispora]
 gi|296092827|gb|ADG88779.1| SNO glutamine amidotransferase [Thermobispora bispora DSM 43833]
          Length = 196

 Score =  167 bits (422), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 129/206 (62%), Gaps = 19/206 (9%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG  +EHI  L+     + A+P+R+  +L+ +D L+IPGGESTT+  +A    L 
Sbjct: 8   GVLALQGDVREHIRALEAAG--ARAVPVRRKAELDAVDGLVIPGGESTTIWKLAVAFDLF 65

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKG--GQDLIGGLNITVNRNQFGSQIDSFE 135
           EPLR  ++D  P +G+CAGMI+L   A++++ G  GQ   GG+++ V RN FG Q+DSFE
Sbjct: 66  EPLRLRIKDGMPAYGSCAGMIML---ADRIEGGIEGQQTFGGIDMLVRRNAFGRQVDSFE 122

Query: 136 SLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGSL 195
           + L      T       A+FIRAP         VEVL R    +G  D   IVAVRQGSL
Sbjct: 123 TDLEFAGRGT-----IRAVFIRAP-WVESVGPDVEVLGR----VGPED--RIVAVRQGSL 170

Query: 196 LGTAFHPELTNDDRIHKYFVQLTQDH 221
           L T+FHPELT D R+H YFV++ ++H
Sbjct: 171 LATSFHPELTGDARVHSYFVEMVREH 196



>gi|255078250|ref|XP_002502705.1| predicted protein [Micromonas sp. RCC299]
 gi|226517970|gb|ACO63963.1| predicted protein [Micromonas sp. RCC299]
          Length = 258

 Score =  166 bits (421), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 100/215 (46%), Positives = 125/215 (58%), Gaps = 12/215 (5%)

Query: 14  QFKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAER 73
           + K GVLA+QG+F EH   ++       A+ +RKAEQL     LIIPGGESTTMA I  R
Sbjct: 6   KVKIGVLAIQGSFAEHCAHVRRAG--GEAVEVRKAEQLSGCHGLIIPGGESTTMANICRR 63

Query: 74  SGLMEPLRKFVRDEKPTWGTCAGMILLANEANK-VKKGGQDLIGGLNITVNRNQFGSQID 132
             L + LR F       WGTCAG+I LA   N+  K+GGQ+L+GGL++TV+RN FGSQID
Sbjct: 64  WNLFDSLRDFQAKGGAVWGTCAGLIFLAERINRGAKEGGQELLGGLDVTVDRNFFGSQID 123

Query: 133 SFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARL---EHDIGETDASS--- 186
           SFE+ L    I    +  F AIFIRAP         VEVL           E D  +   
Sbjct: 124 SFETNLPCK-IPGDDNGPFRAIFIRAP-AILSVGDGVEVLGEYVLPAEKRAEIDDKALEK 181

Query: 187 -IVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQD 220
            IVAV+   L+ T+FHPE+T D R HK FV++  D
Sbjct: 182 IIVAVKSKRLMATSFHPEITADTRWHKLFVEMAGD 216



>gi|168058973|ref|XP_001781480.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162667117|gb|EDQ53755.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 234

 Score =  166 bits (421), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 103/233 (44%), Positives = 131/233 (56%), Gaps = 32/233 (13%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG+F EHI  L+ +     A+ IRK EQL  +  LIIPGGESTTMA +AE++ L 
Sbjct: 4   GVLALQGSFNEHIACLRKLG--VDAVEIRKPEQLAELSGLIIPGGESTTMAKLAEKNNLF 61

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
             LRKF    KP WGTCAG+I LA +A  VK+GGQ+L+GGL+ TV+RN FGSQI+SFE  
Sbjct: 62  PALRKFGSSGKPIWGTCAGLIFLAAKAVGVKEGGQELLGGLDCTVHRNFFGSQINSFEME 121

Query: 138 LHINHITTSSD-DLFPAIFIRAPXXXXXXXXXVEVLARLEH------DIGETDASS---- 186
           L +  + +        A+FIRAP         VEVLA          D+ E    S    
Sbjct: 122 LSVPSLASDGGAQTCRAVFIRAP-AIIDVGSSVEVLAECPLAPKQAVDLPEQVTISLTQL 180

Query: 187 ------------------IVAVRQGSLLGTAFHPELTNDDRIHKYFVQLTQDH 221
                             IVAV+Q ++L TAFHPELT+D R + + +     H
Sbjct: 181 MPKFSVWASFHRQSKDKVIVAVKQNNMLATAFHPELTSDLRWYIFLLHFKLQH 233



>gi|497855315|ref|WP_010169471.1| glutamine amidotransferase [Bacillus coahuilensis]
          Length = 194

 Score =  166 bits (421), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 93/207 (44%), Positives = 126/207 (60%), Gaps = 18/207 (8%)

Query: 15  FKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERS 74
            K GVL LQGA +EH+  ++     + A+ I++AEQLE +D LI+PGGESTTM  + +R 
Sbjct: 1   MKIGVLGLQGAVREHVLAIEE--NGAEALVIKRAEQLEEVDGLILPGGESTTMRRLIDRY 58

Query: 75  GLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSF 134
           G MEPLR F   +KP +GTCAG+ILLA E   +    +  +G ++ITV RN FG Q +SF
Sbjct: 59  GFMEPLRAFAASKKPMYGTCAGLILLAKE---IVGYDEPHLGVMDITVERNSFGRQKESF 115

Query: 135 ESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGS 194
           E+ L +  + T     FPA+FIRAP         V VLA  EH         IV  R G 
Sbjct: 116 EASLEVKEVGTD----FPAVFIRAP-HIVSVGERVNVLA--EH------GDRIVIARDGQ 162

Query: 195 LLGTAFHPELTNDDRIHKYFVQLTQDH 221
            LG +FHPELT+D R+ KYF+ + +++
Sbjct: 163 YLGCSFHPELTDDHRLTKYFLTMVEEY 189



>gi|495751105|ref|WP_008475684.1| glutamine amidotransferase [Nitrolancetus hollandicus]
 gi|390174049|emb|CCF83013.1| glutamine amidotransferase for pyridoxal phosphate synthesis
           [Nitrolancetus hollandicus Lb]
          Length = 206

 Score =  166 bits (420), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 94/202 (46%), Positives = 123/202 (60%), Gaps = 14/202 (6%)

Query: 17  FGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGL 76
            GVLALQGAF EHI  L+ +   +  +  R    LE +D LIIPGGESTT+  + +R GL
Sbjct: 4   IGVLALQGAFIEHIEKLKRLGIETREV--RLPADLEGLDGLIIPGGESTTIGKLIDRFGL 61

Query: 77  MEPLRKFVRDEKPTWGTCAGMILLANEANK-VKKGGQDLIGGLNITVNRNQFGSQIDSFE 135
            EP+ +   +    WGTCAGMIL+A E ++  +   Q L+G +++TV RN FGSQ++SFE
Sbjct: 62  REPITRMAAEGTAIWGTCAGMILVAREVDQETRARSQPLLGLMDMTVRRNAFGSQLESFE 121

Query: 136 SLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGSL 195
           + L I  +       FPA+FIRAP         V+VLARL           IVA RQG+L
Sbjct: 122 TALDIPEMGGPP---FPAVFIRAP-IISTIGPGVQVLARL-------PGGEIVAARQGNL 170

Query: 196 LGTAFHPELTNDDRIHKYFVQL 217
           + TAFHPELT DDR+H +F  L
Sbjct: 171 IATAFHPELTTDDRLHAWFASL 192



>gi|489428328|ref|WP_003333954.1| glutamine amidotransferase [Brevibacillus laterosporus]
 gi|338775901|gb|EGP35429.1| glutamine amidotransferase subunit PdxT [Brevibacillus laterosporus
           LMG 15441]
 gi|372456776|emb|CCF15277.1| glutamine amidotransferase subunit pdxT [Brevibacillus laterosporus
           GI-9]
          Length = 200

 Score =  166 bits (420), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 91/212 (42%), Positives = 130/212 (61%), Gaps = 18/212 (8%)

Query: 16  KFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSG 75
           + GVLALQGA  EH+ ML+     + AI I+K ++L  ID LIIPGGESTT++ +  + G
Sbjct: 5   RIGVLALQGAVAEHMRMLELAG--AEAIAIKKVDELSEIDGLIIPGGESTTISKLMHKYG 62

Query: 76  LMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFE 135
            M+ +R+F  ++KP +GTCAG IL+ANE   ++   +  +G +++ V RN FG Q +SFE
Sbjct: 63  FMDAIRQFANEKKPVFGTCAGAILIANE---IEHAPEAHLGLMDMKVARNAFGRQKESFE 119

Query: 136 SLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGSL 195
             + I  + +     FPA+FIRAP          EVLA+ E         +IVA RQG  
Sbjct: 120 IKMPIAGVASD----FPAVFIRAPLILKIGNKG-EVLAKHE--------DNIVAARQGQF 166

Query: 196 LGTAFHPELTNDDRIHKYFVQLTQDHYNTGKG 227
           L  +FHPELT+D R+HKYF+ +  ++  TGK 
Sbjct: 167 LAASFHPELTDDYRLHKYFLDMVNEYQTTGKA 198



>gi|494094103|ref|WP_007034927.1| glutamine amidotransferase involved in pyridoxine biosynthesis
           [Amycolatopsis decaplanina]
 gi|452946148|gb|EME51648.1| glutamine amidotransferase involved in pyridoxine biosynthesis
           [Amycolatopsis decaplanina DSM 44594]
          Length = 209

 Score =  166 bits (420), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 128/204 (62%), Gaps = 8/204 (3%)

Query: 17  FGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGL 76
            GVLALQG  +EH  M++     + A+P+R+A +L  +D L++PGGESTTM+ + E   L
Sbjct: 11  IGVLALQGDVREHAAMVERAG--ARALPVRRASELSEVDGLVLPGGESTTMSRLLETFEL 68

Query: 77  MEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFES 136
           +EPLR+ +    P +G+CAGMILLA +A    +  Q  +GGL++ V RN FG Q+DSFE+
Sbjct: 69  LEPLRERIAGGMPAFGSCAGMILLARQALD-GRSDQRQLGGLDVVVRRNAFGRQVDSFEA 127

Query: 137 LLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETD-ASSIVAVRQGSL 195
            L    +         A+FIRAP         VEVLA +    G  D A+ IVAVRQG++
Sbjct: 128 DLDFTGVEGGP---VHAVFIRAP-WVEKAGDGVEVLASVPEMPGSDDSAARIVAVRQGAV 183

Query: 196 LGTAFHPELTNDDRIHKYFVQLTQ 219
           L T+FHPELT D+R+H+ FV L +
Sbjct: 184 LATSFHPELTGDERVHRLFVDLVR 207



>gi|154300237|ref|XP_001550535.1| hypothetical protein BC1G_10494 [Botryotinia fuckeliana B05.10]
 gi|472236567|gb|EMR81496.1| putative pyridoxine protein [Botryotinia fuckeliana BcDW1]
          Length = 317

 Score =  166 bits (420), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 109/299 (36%), Positives = 144/299 (48%), Gaps = 92/299 (30%)

Query: 14  QFKFGVLALQGAFQEHIHMLQNISQVSSA-----------------------IPIRKAEQ 50
           +   GVLALQGAF EHI  L++ S++ +                        I +R   +
Sbjct: 8   KVTVGVLALQGAFNEHIQCLRSASEILATKSKSKSKSTSKDPKGDFSVEYKFIEVRNEAE 67

Query: 51  LETIDALIIPGGESTTMALIAERSGLMEPLRKFVRDEK-PTWGTCAGMILLANEANKVKK 109
           L + DALIIPGGEST ++L+A+RSGL+EPLR +V+  + PTWGTCAG+ILLA  AN+ K 
Sbjct: 68  LNSCDALIIPGGESTAISLVAQRSGLLEPLRSYVKYHRYPTWGTCAGLILLAESANRTKA 127

Query: 110 GGQDLIGGLNITVNRNQFGSQIDSFE---------------------SLLHINHITTSSD 148
           GGQ+LIGGL++ VNRN FG Q++SF                      S       T    
Sbjct: 128 GGQELIGGLDVRVNRNHFGRQVESFSANLDLPFLSSLSSTSSDLDPTSTSLTAQETEEKP 187

Query: 149 DLFPAIFIRAPXXX------------------------------------XXXXXXVEVL 172
             F AIFIRAP                                             VE+L
Sbjct: 188 APFSAIFIRAPIVEKLLPHVPGAQISESTLDSTVIAPSVPIDSKSIPNPDTILSAPVEIL 247

Query: 173 A----RLEHDIGE------TDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFV-QLTQD 220
           A    R  H   E      ++A  IVAVRQ ++ GT+FHPELT D RIH +++ Q+ +D
Sbjct: 248 ATLPGRTTHSNPEIQESLNSEAGDIVAVRQANVFGTSFHPELTGDARIHAWWLEQVVED 306



>gi|367033557|ref|XP_003666061.1| hypothetical protein MYCTH_2310453 [Myceliophthora thermophila ATCC
           42464]
 gi|347013333|gb|AEO60816.1| hypothetical protein MYCTH_2310453 [Myceliophthora thermophila ATCC
           42464]
          Length = 264

 Score =  166 bits (420), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 99/247 (40%), Positives = 140/247 (56%), Gaps = 40/247 (16%)

Query: 18  GVLALQGAFQEHIHMLQNIS---QVSSAIP-----IRKAEQLETIDALIIPGGESTTMAL 69
           GVLALQG   EHI++L+  S   Q   A+      +R + +L   DALIIPGGESTTMA+
Sbjct: 10  GVLALQGGVVEHINLLRKASSHIQSPDALQFNFLQVRTSAELSQCDALIIPGGESTTMAI 69

Query: 70  IAERSGLMEPLRKFVR-DEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFG 128
           +A R GL++PLR+FV+   KP WGTCAG+I+L+ +A   K+GGQ+L+GGL++ V RN++G
Sbjct: 70  VARRLGLLDPLREFVKVQHKPVWGTCAGLIMLSEQAAATKQGGQELVGGLDVRVLRNRYG 129

Query: 129 SQIDSFESLLHINHITTSSDDLFPAIFIRAPXXXXX------------------------ 164
           +Q+ SF + L +  +   +   F A+FIRAP                             
Sbjct: 130 TQLQSFVAELDLAFLGEGAAP-FKAVFIRAPVVERVIASEEKEQEQEEEGEAGSVASQGK 188

Query: 165 ---XXXXVEVLARLEHDIGETDASS---IVAVRQGSLLGTAFHPELTNDDRIHKYFVQLT 218
                  VEVL        + +A     IVAVRQG++ GT+FHPELT+D RIH ++++  
Sbjct: 189 GQGKGAPVEVLGVYRGQGKQEEAGEEGDIVAVRQGNVFGTSFHPELTDDVRIHVWWLRQV 248

Query: 219 QDHYNTG 225
            D    G
Sbjct: 249 VDATRHG 255



>gi|489167738|ref|WP_003077332.1| glutamine amidotransferase involved in pyridoxine biosynthesis
           [Amycolatopsis vancoresmycina]
 gi|486085839|gb|EOD68121.1| glutamine amidotransferase involved in pyridoxine biosynthesis
           [Amycolatopsis vancoresmycina DSM 44592]
          Length = 206

 Score =  165 bits (418), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 126/204 (61%), Gaps = 8/204 (3%)

Query: 17  FGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGL 76
            GVLA+QGA +EH+ ML      + A+P+R+A +L  +D L++PGGESTTM+ + E   L
Sbjct: 7   IGVLAMQGAVREHVAMLAEAG--ARAVPVRRAGELSEVDGLVLPGGESTTMSRLLESFEL 64

Query: 77  MEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFES 136
           +EPLR  +    P +G+CAGMILLA +    +   Q L GGL++ V RN FG Q+DSFE+
Sbjct: 65  LEPLRARIAGGMPAFGSCAGMILLARQTLDGRPDQQQL-GGLDVVVRRNAFGRQVDSFEA 123

Query: 137 LLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIG-ETDASSIVAVRQGSL 195
            L    I         A+FIRAP         VEVLA +    G + D + IVAVRQG++
Sbjct: 124 DLDFAGIEAEP---VHAVFIRAP-WVEKAGDGVEVLASVSGVPGVDDDTARIVAVRQGAV 179

Query: 196 LGTAFHPELTNDDRIHKYFVQLTQ 219
           L TAFHPELT D R+H+ FV L +
Sbjct: 180 LATAFHPELTPDVRVHRLFVDLVR 203



>gi|284032310|ref|YP_003382241.1| SNO glutamine amidotransferase [Kribbella flavida DSM 17836]
 gi|502686445|ref|WP_012921996.1| glutamine amidotransferase [Kribbella flavida]
 gi|283811603|gb|ADB33442.1| SNO glutamine amidotransferase [Kribbella flavida DSM 17836]
          Length = 210

 Score =  165 bits (417), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 94/212 (44%), Positives = 124/212 (58%), Gaps = 16/212 (7%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GV ALQG  +EH+ ML  +       P+R+  +L+ +D L++PGGESTTM  +A    L 
Sbjct: 7   GVFALQGNVREHLAMLAEVG--VEGKPVRRPSELDAVDGLVLPGGESTTMGKLARSFELF 64

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
           EPLRK + D  P +GTCAGMI+LA +       GQ+ +GGL++TV RN FG Q+DSFE+ 
Sbjct: 65  EPLRKRIADGMPVFGTCAGMIMLAEDITG-GIAGQETLGGLDVTVRRNAFGRQVDSFEAD 123

Query: 138 LHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEH--DIG------ETDASSIVA 189
           L     +T     + A+FIRAP         VEVL+ +    D G      E   S IVA
Sbjct: 124 LDFAAFSTP----YHAVFIRAP-WVERVGRDVEVLSTVSEGPDAGWDRAGPEAQHSRIVA 178

Query: 190 VRQGSLLGTAFHPELTNDDRIHKYFVQLTQDH 221
           VR   LL T+FHPE+T D R+H YF  L +DH
Sbjct: 179 VRHDRLLATSFHPEMTGDARLHGYFADLVRDH 210



>gi|226366276|ref|YP_002784059.1| glutamine amidotransferase subunit PdxT [Rhodococcus opacus B4]
 gi|506370825|ref|WP_015890544.1| glutamine amidotransferase [Rhodococcus opacus]
 gi|254781662|sp|C1B4C5.1|PDXT_RHOOB RecName: Full=Glutamine amidotransferase subunit PdxT; AltName:
           Full=Glutamine amidotransferase glutaminase subunit PdxT
 gi|226244766|dbj|BAH55114.1| pyridoxal phosphate synthase component Pdx2 [Rhodococcus opacus B4]
          Length = 202

 Score =  165 bits (417), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 94/202 (46%), Positives = 128/202 (63%), Gaps = 8/202 (3%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG  +EH+  L +    + A+ IR+ E+LE ID L+IPGGESTTM+ + +   L+
Sbjct: 7   GVLALQGDVREHLAALNDSG--ADAVGIRRPEELEKIDGLVIPGGESTTMSKLLQIFELL 64

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
           EPL+  +RD  P +G+CAGMILLA+E    +   Q L G +++TV RN FG Q+DSFES 
Sbjct: 65  EPLKARLRDGLPAYGSCAGMILLASEILDTRPDAQHL-GAIDMTVRRNAFGRQVDSFESD 123

Query: 138 LHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGSLLG 197
           L    I     D   A+FIRAP         V++LAR+    G   A  IVAVRQGS++ 
Sbjct: 124 LEFEGIVG---DPMRAVFIRAP-WVERVGDDVQILARVPES-GGAAAGRIVAVRQGSVVA 178

Query: 198 TAFHPELTNDDRIHKYFVQLTQ 219
           T+FHPE+T D R+H+ FV + +
Sbjct: 179 TSFHPEVTGDRRVHELFVDIVR 200



>gi|448518192|ref|XP_003867932.1| Sno1 protein [Candida orthopsilosis Co 90-125]
 gi|380352271|emb|CCG22495.1| Sno1 protein [Candida orthopsilosis]
          Length = 241

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 100/232 (43%), Positives = 134/232 (57%), Gaps = 37/232 (15%)

Query: 17  FGVLALQGAFQEHIHMLQNI--------SQVS-SAIPIRKAEQLETIDALIIPGGESTTM 67
            GVLALQGAF+EHI+  +++        S  S + I +R  E L+  D+L+IPGGES++M
Sbjct: 9   LGVLALQGAFREHINYFKSVIEQDEEKYSNYSINIIAVRTKEDLDKCDSLVIPGGESSSM 68

Query: 68  ALIAERSGLMEPLRKFVRDE-KPTWGTCAGMILLANE-ANKVKKGGQDLIGGLNITVNRN 125
           + IAER+ L+  L KFV +E K  WGTCAG+I LA E  N V+   Q  +GGL+I V+RN
Sbjct: 69  SYIAERTNLLPHLCKFVSNESKSIWGTCAGLIFLAKEIENAVE--NQTCLGGLDIQVSRN 126

Query: 126 QFGSQIDSFESLLHINHITTSSDDLFPAIFIRAPXXXXX--------------------- 164
            FG Q+DSFE  L  +      D  FP IFIRAP                          
Sbjct: 127 AFGRQVDSFEQKLDFSGFIPGCDS-FPTIFIRAPVVTKILPNGAESGSSPNKIVRSKSNY 185

Query: 165 -XXXXVEVLARLEHDIGETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFV 215
                VEVL +L H+    +   IVAVRQG +LGT+FHPEL++D+R H++F+
Sbjct: 186 HNKAPVEVLYKL-HNYDGKENELIVAVRQGRILGTSFHPELSDDNRFHQWFI 236



>gi|111023840|ref|YP_706812.1| glutamine amidotransferase subunit PdxT [Rhodococcus jostii RHA1]
 gi|497125038|ref|WP_009480131.1| glutamine amidotransferase [Rhodococcus sp. JVH1]
 gi|118582357|sp|Q0S1D2.1|PDXT_RHOSR RecName: Full=Glutamine amidotransferase subunit PdxT; AltName:
           Full=Glutamine amidotransferase glutaminase subunit PdxT
 gi|110823370|gb|ABG98654.1| conserved hypothetical protein [Rhodococcus jostii RHA1]
 gi|396926815|gb|EJI94052.1| SNO glutamine amidotransferase family protein [Rhodococcus sp.
           JVH1]
          Length = 202

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 94/202 (46%), Positives = 128/202 (63%), Gaps = 8/202 (3%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG  +EH+  L +    + A+ IR+ E+LE ID L+IPGGESTTM+ + +   L+
Sbjct: 7   GVLALQGDVREHLAALNDSG--ADAVGIRRPEELEKIDGLVIPGGESTTMSKLLQIFELL 64

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
           EPL+  +RD  P +G+CAGMILLA+E    +   Q L G +++TV RN FG Q+DSFES 
Sbjct: 65  EPLKARLRDGLPAYGSCAGMILLASEILDTRPDAQHL-GAIDMTVRRNAFGRQVDSFESD 123

Query: 138 LHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGSLLG 197
           L    I     D   A+FIRAP         V+VLAR+    G   A  IVAVRQG+++ 
Sbjct: 124 LEFEGIVG---DPMRAVFIRAP-WVERVGDDVQVLARVPES-GGAAAGRIVAVRQGAVVA 178

Query: 198 TAFHPELTNDDRIHKYFVQLTQ 219
           T+FHPE+T D R+H+ FV + +
Sbjct: 179 TSFHPEVTGDRRVHELFVDIVR 200



>gi|269925157|ref|YP_003321780.1| SNO glutamine amidotransferase [Thermobaculum terrenum ATCC
           BAA-798]
 gi|502637494|ref|WP_012873993.1| glutamine amidotransferase [Thermobaculum terrenum]
 gi|269788817|gb|ACZ40958.1| SNO glutamine amidotransferase [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 196

 Score =  165 bits (417), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 93/212 (43%), Positives = 126/212 (59%), Gaps = 17/212 (8%)

Query: 15  FKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERS 74
            K GVLALQG F+EH  ML  I  V   + +RK E L  +D +IIPGGESTT+  +A   
Sbjct: 1   MKIGVLALQGDFREHEQMLHRIGIVP--VEVRKPEHLYGLDGIIIPGGESTTIGKLAVNY 58

Query: 75  GLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSF 134
           GLMEPL+ F    KP WGTCAGMI L+ +        Q L+G L++ V RN FG Q+DSF
Sbjct: 59  GLMEPLKDFAAQGKPVWGTCAGMIFLSKDVGM----EQPLLGLLDVKVRRNAFGRQLDSF 114

Query: 135 ESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGS 194
           E+ + +  +   S+    A+FIRAP         V+VL +L+         +IVAVRQG+
Sbjct: 115 EADIEMPEV---SERPVHAVFIRAP-IVESVGPGVQVLGKLQD-------GTIVAVRQGN 163

Query: 195 LLGTAFHPELTNDDRIHKYFVQLTQDHYNTGK 226
           +L T+FHPELT D  +H YF+ + ++   T +
Sbjct: 164 ILATSFHPELTQDPTMHLYFISMAKEDLVTNR 195



>gi|449550162|gb|EMD41127.1| hypothetical protein CERSUDRAFT_80770 [Ceriporiopsis subvermispora
           B]
          Length = 241

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 102/221 (46%), Positives = 133/221 (60%), Gaps = 23/221 (10%)

Query: 17  FGVLALQGAFQEHIHMLQNIS--QVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERS 74
            G+LALQGAF EH  MLQ +S  +    + +R  E L   DALIIPGGESTT+AL+A  +
Sbjct: 12  IGILALQGAFAEHQVMLQKLSLRKRIVIVLVRTQEDLARCDALIIPGGESTTIALLARLA 71

Query: 75  GLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSF 134
           GL+ PLR FV+  KP WGTCAG ILLA      KKGGQ+L+ G++I V RN +GSQ++SF
Sbjct: 72  GLLGPLRDFVK-TKPVWGTCAGAILLAQAIEGAKKGGQELLNGISINVARNGWGSQVESF 130

Query: 135 ESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXX----VEVLARL--------------- 175
           E+ L +  +  S+   F  +FIRAP             ++V++R+               
Sbjct: 131 EAPLEVEGLRDSNRP-FQGVFIRAPVVLSLCLTADDPPIQVISRISAGLLPSNQTLVPMD 189

Query: 176 EHDIGETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
           E D    D  +IVA+RQG  L T FHPELT DDR H+YFV+
Sbjct: 190 EDDTDPRDPRTIVALRQGLHLLTTFHPELTKDDRFHEYFVK 230



>gi|294658100|ref|XP_460421.2| DEHA2F01342p [Debaryomyces hansenii CBS767]
 gi|202952874|emb|CAG88725.2| DEHA2F01342p [Debaryomyces hansenii CBS767]
          Length = 234

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 93/233 (39%), Positives = 132/233 (56%), Gaps = 37/233 (15%)

Query: 11  VQPQFKFGVLALQGAFQEHIHMLQNISQVSSA------IPIRKAEQLETIDALIIPGGES 64
           +  +   GVLALQGAF EHI   +  ++   +      I +R  EQL+    L+IPGGES
Sbjct: 3   ITKKLTVGVLALQGAFIEHIKHFEGATKNGYSDFEFDFIEVRTEEQLDRCHGLVIPGGES 62

Query: 65  TTMALIAERSGLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNR 124
           T+++LIA+R+ L+ PL  +V+ E+P WGTCAG+I L+ +     + GQ L+GG+NI V R
Sbjct: 63  TSISLIAQRTDLLGPLMHYVKSERPIWGTCAGLIFLSTQVEN-GRPGQQLLGGMNIQVKR 121

Query: 125 NQFGSQIDSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXX------------------ 166
           N FG Q+ SF+S L  +    S  D FP IFIRAP                         
Sbjct: 122 NAFGRQLQSFQSDLDFSSFIPSVSD-FPTIFIRAPVITSVLSDINGSENVDNEIIHSKND 180

Query: 167 ----XXVEVLARLEHDIGETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFV 215
                 V++L +L++ +       IVAVRQG+ LGT+FHPEL++D R HK+F+
Sbjct: 181 YENKAPVQILHQLDNGL-------IVAVRQGTKLGTSFHPELSDDYRFHKWFI 226



>gi|68536135|ref|YP_250840.1| amidotransferase [Corynebacterium jeikeium K411]
 gi|499592887|ref|WP_011273621.1| glutamine amidotransferase [Corynebacterium jeikeium]
 gi|119388908|sp|Q4JVD5.1|PDXT_CORJK RecName: Full=Glutamine amidotransferase subunit PdxT; AltName:
           Full=Glutamine amidotransferase glutaminase subunit PdxT
 gi|68263734|emb|CAI37222.1| putative amidotransferase involved in pyridoxine biosynthesis
           [Corynebacterium jeikeium K411]
          Length = 195

 Score =  164 bits (416), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 87/203 (42%), Positives = 128/203 (63%), Gaps = 15/203 (7%)

Query: 17  FGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGL 76
            GVL++QG F EH+  ++ +   + A+  R+AEQLE +D LI+PGGESTTM+ + E  G+
Sbjct: 3   IGVLSVQGGFVEHMRSIERLGHEARAV--RRAEQLEGLDGLIMPGGESTTMSKLLELGGM 60

Query: 77  MEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFES 136
           +EPLR+ + D  P +GTCAG+ILLA+     +     L   ++ITV RN FG Q+DSFE+
Sbjct: 61  LEPLRELIADGLPVFGTCAGLILLADRVLDTRSDAHSL-HAMDITVRRNAFGRQVDSFET 119

Query: 137 LLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGSLL 196
            L    I T  +    A+FIRAP         VEV++ L          ++V VRQG++L
Sbjct: 120 QLPFGDIDTPVE----AVFIRAP-KVEEVGDGVEVVSTLPD-------GTVVGVRQGNVL 167

Query: 197 GTAFHPELTNDDRIHKYFVQLTQ 219
           G +FHPEL+ DDR+H+YF+++ +
Sbjct: 168 GCSFHPELSEDDRVHEYFLRMVK 190



>gi|491598035|ref|WP_005455597.1| glutamine amidotransferase [Saccharomonospora cyanea]
 gi|374660882|gb|EHR60760.1| pyridoxal 5''-phosphate synthase, glutaminase subunit Pdx2
           [Saccharomonospora cyanea NA-134]
          Length = 213

 Score =  164 bits (415), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 125/204 (61%), Gaps = 9/204 (4%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG  +EH  ML+     +  +P+R+  +L  +D L++PGGESTTM+ +    GL+
Sbjct: 16  GVLALQGDVREHAAMLERAG--ARVLPVRRVSELAEVDGLVLPGGESTTMSRLLGSFGLL 73

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
           EPLR+ +RD  P +G+CAGM+LLA +     +  Q  +G L++ V RN FG Q+DSFE+ 
Sbjct: 74  EPLRQRIRDGLPVFGSCAGMVLLARQVLD-GRPDQHQLGALDVVVRRNAFGRQVDSFEAE 132

Query: 138 LHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASS-IVAVRQGSLL 196
           L    I       F A+FIRAP         VEVLA +  D     A+  IVAVRQG +L
Sbjct: 133 LEFEGIEGG----FHAVFIRAP-WVEKAGSEVEVLATVGDDTTPGAAADRIVAVRQGRVL 187

Query: 197 GTAFHPELTNDDRIHKYFVQLTQD 220
            TAFHPELT D+RIH+ FV+   +
Sbjct: 188 ATAFHPELTGDERIHRLFVRTVSE 211



>gi|494688487|ref|YP_007954061.1| SNO glutamine amidotransferase [Actinoplanes sp. N902-109]
 gi|505437037|ref|WP_015624139.1| SNO glutamine amidotransferase [Actinoplanes sp. N902-109]
 gi|492008261|gb|AGL19581.1| SNO glutamine amidotransferase [Actinoplanes sp. N902-109]
          Length = 201

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 90/205 (43%), Positives = 128/205 (62%), Gaps = 10/205 (4%)

Query: 15  FKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERS 74
              GVLALQG  +EH+  L     ++   P+R+  +L+ +DAL+IPGGESTTM+ +A   
Sbjct: 1   MNIGVLALQGDVREHLAALAESDVLAR--PVRRPAELDDVDALVIPGGESTTMSNLAISF 58

Query: 75  GLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSF 134
           GL++P+RK + D+ P +G+CAG+I+LA       +  Q+   G+++TV RN FG Q+DSF
Sbjct: 59  GLLDPIRKRIADDLPVYGSCAGLIMLAGTVLD-GRPDQETFQGIDMTVRRNAFGRQVDSF 117

Query: 135 ESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGS 194
           E+ + I  +       F A+FIRAP         V VL R+    G   A  IVAVRQG+
Sbjct: 118 EAPVRIEDVEGGD---FHAVFIRAP-WVERTGPGVRVLGRV---TGGDAAGRIVAVRQGN 170

Query: 195 LLGTAFHPELTNDDRIHKYFVQLTQ 219
           LL TAFHPELT D R+H+YFV++ +
Sbjct: 171 LLATAFHPELTGDLRVHRYFVEMVR 195



>gi|386851479|ref|YP_006269492.1| glutamine amidotransferase [Actinoplanes sp. SE50/110]
 gi|504506387|ref|WP_014693489.1| glutamine amidotransferase [Actinoplanes sp. SE50/110]
 gi|359838983|gb|AEV87424.1| glutamine amidotransferase [Actinoplanes sp. SE50/110]
          Length = 201

 Score =  164 bits (415), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 126/206 (61%), Gaps = 12/206 (5%)

Query: 15  FKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERS 74
              GVLALQG  +EH+  L     ++   PIR+ E+L  +DAL+IPGGESTTM+ +A   
Sbjct: 1   MNIGVLALQGDVREHLSALAESDVLAR--PIRRPEELADVDALVIPGGESTTMSNLAITF 58

Query: 75  GLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSF 134
           GL++P+RK + D  P +G+CAGMI+LA       +  Q+   G+ +TV RN FG QIDSF
Sbjct: 59  GLLDPIRKRIADGMPVYGSCAGMIMLATTVLD-GRPDQESFQGIEMTVRRNAFGRQIDSF 117

Query: 135 ESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASS-IVAVRQG 193
           E  + I  I       F A+FIRAP         V VL R    +   DA+  IVAVRQG
Sbjct: 118 EGAVEIEGIEGGE---FHAVFIRAP-WVEQVGPDVRVLGR----VASGDAAGRIVAVRQG 169

Query: 194 SLLGTAFHPELTNDDRIHKYFVQLTQ 219
           +LL TAFHPELT D R+H+YFV++ +
Sbjct: 170 NLLATAFHPELTGDLRVHRYFVEMVR 195



>gi|495188513|ref|WP_007913303.1| glutamine amidotransferase [Ktedonobacter racemifer]
 gi|297553946|gb|EFH87811.1| SNO glutamine amidotransferase [Ktedonobacter racemifer DSM 44963]
          Length = 203

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 94/208 (45%), Positives = 125/208 (60%), Gaps = 14/208 (6%)

Query: 16  KFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSG 75
           + GVLALQG F+ H+ ML  +     AI  R  EQLE I+ +IIPGGESTT+  +     
Sbjct: 10  RIGVLALQGDFEAHLRMLAELGAEGKAI--RLPEQLEEINGIIIPGGESTTIGKLMIEYN 67

Query: 76  LMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFE 135
           L+EPLR+ +RD  P WGTCAG+ILL+ E +     GQ L+  L+I V RN FGSQ +SFE
Sbjct: 68  LLEPLRQKIRDGIPVWGTCAGLILLSQETDNA-LAGQPLLASLDIKVRRNAFGSQRESFE 126

Query: 136 SLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGSL 195
           + L +  +  +    F   FIR P         VEVLA L       D  +IVAVR+G+ 
Sbjct: 127 TDLVVPELGEAP---FHTFFIRGP-LVEKVGPGVEVLATL-------DDGTIVAVREGTR 175

Query: 196 LGTAFHPELTNDDRIHKYFVQLTQDHYN 223
           LGTAFHPE++ D R H+YF+++ +   N
Sbjct: 176 LGTAFHPEVSGDTRFHQYFLRIVESVSN 203



>gi|470243036|ref|XP_004355240.1| SNO glutamine amidotransferase family protein [Dictyostelium
           fasciculatum]
 gi|328868388|gb|EGG16766.1| SNO glutamine amidotransferase family protein [Dictyostelium
           fasciculatum]
          Length = 235

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 93/216 (43%), Positives = 132/216 (61%), Gaps = 21/216 (9%)

Query: 16  KFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETID--ALIIPGGESTTMALIAER 73
           + GVL+LQG   EH++ML+ I+ V     ++  EQ++  D   +I+PGGEST MA+IAE+
Sbjct: 7   RVGVLSLQGGVIEHVNMLKKIANVIVK-ELKSTEQIKVFDPHGMILPGGESTAMAIIAEK 65

Query: 74  SGLMEP-LRKFVRDEK-PTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQI 131
              + P L++ V  +K   WGTCAG I+L+N+ +  KKGGQ LIGGL + ++RN FG QI
Sbjct: 66  DQELFPYLQQLVHSQKIAVWGTCAGSIMLSNQVDHQKKGGQSLIGGLEVQISRNYFGRQI 125

Query: 132 DSFESLLHINHITTSSDDL-----------FPAIFIRAPXXXXXXXXXVEVLARLEHDIG 180
           +SFE+ L +N      DD            F  IFIRAP         V +++   H   
Sbjct: 126 NSFETTLTLN----LHDDQEEGGASINKMEFEGIFIRAPAILKTLSDKVHIISDFNHTKP 181

Query: 181 E-TDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFV 215
           + T+ + IVAV+Q ++L T FHPELTND+R H+YFV
Sbjct: 182 DGTEETVIVAVQQDNMLATVFHPELTNDNRFHQYFV 217



>gi|493492101|ref|WP_006446785.1| glutamine amidotransferase [Alicyclobacillus hesperidum]
 gi|403121599|gb|EJY55886.1| SNO glutamine amidotransferase [Alicyclobacillus hesperidum
           URH17-3-68]
          Length = 195

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 91/207 (43%), Positives = 131/207 (63%), Gaps = 19/207 (9%)

Query: 15  FKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERS 74
            K  V+A+QGAF+EHI  L+ +   + A+  R+A +LE +D ++IPGGEST +  +    
Sbjct: 3   MKIAVIAVQGAFREHIQALRQLG--ADAVEARRAGELENVDGVVIPGGESTAIGKLMREY 60

Query: 75  GLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDL-IGGLNITVNRNQFGSQIDS 133
            +++P+RK   D KP +GTCAGMI+LA    K  +G + + +G +++TVNRN FG Q +S
Sbjct: 61  DMIDPVRKMAADGKPIFGTCAGMIVLA----KRIEGEETVHLGLMDVTVNRNSFGRQRES 116

Query: 134 FESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQG 193
           FE+ L I  +  ++   FPA+FIRAP         VEVLAR            IVAVRQG
Sbjct: 117 FEADLEIPALGEAT---FPAVFIRAP-HIAAVGDEVEVLARYR--------DRIVAVRQG 164

Query: 194 SLLGTAFHPELTNDDRIHKYFVQLTQD 220
           +LL T+FHPELT D R+H+YF+ L ++
Sbjct: 165 NLLATSFHPELTGDLRLHQYFLNLAKE 191



>gi|446163591|ref|WP_000241446.1| glutamine amidotransferase [Bacillus cereus]
 gi|228699975|gb|EEL52600.1| Glutamine amidotransferase subunit pdxT [Bacillus cereus Rock3-44]
          Length = 196

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 126/205 (61%), Gaps = 18/205 (8%)

Query: 16  KFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSG 75
           K GVL LQGA +EHI  ++  +  + A+ I++ EQLE ID LI+PGGESTTM  + ++  
Sbjct: 3   KVGVLGLQGAVREHIKAVE--ASGAEAVVIKRIEQLEEIDGLILPGGESTTMRRLIDKYN 60

Query: 76  LMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFE 135
            MEPLR+F +  KP +GTCAGMILLAN     +   +  IG ++ITV RN FG Q DSFE
Sbjct: 61  FMEPLREFAKSGKPMFGTCAGMILLANNLIGYE---ESHIGAMDITVERNAFGRQKDSFE 117

Query: 136 SLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGSL 195
           + L I  +       F  +FIRAP         VE+L+ + +D        +VAVRQG  
Sbjct: 118 AALSIKGVGED----FIGVFIRAP-YVVSVGDDVEILS-MHND-------RMVAVRQGPF 164

Query: 196 LGTAFHPELTNDDRIHKYFVQLTQD 220
           L  +FHPELT+D R+  YFVQ+ ++
Sbjct: 165 LAASFHPELTDDHRVTAYFVQMVKE 189



>gi|149244454|ref|XP_001526770.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146449164|gb|EDK43420.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 237

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 97/231 (41%), Positives = 131/231 (56%), Gaps = 41/231 (17%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSS---------AIPIRKAEQLETIDALIIPGGESTTMA 68
           GVLALQGAF EHI       Q++S          IPI+  E+L+  DAL+IPGGES++M+
Sbjct: 10  GVLALQGAFIEHIEYFNKAIQLNSDNYLSYTFTIIPIKTKEELQQCDALVIPGGESSSMS 69

Query: 69  LIAERSGLMEPLRKFVRDE-KPTWGTCAGMILLANEANKVKKG--GQDLIGGLNITVNRN 125
            IAER+ L+  L  FV DE K  WGTCAG+I L+ +   ++ G   Q  +GGL+I  NRN
Sbjct: 70  YIAERTNLLPHLYAFVADENKTVWGTCAGLIFLSKQ---IQNGLENQKCLGGLSIETNRN 126

Query: 126 QFGSQIDSFESLLHINHITTSSDDLFPAIFIRAPXX---------------------XXX 164
            FG Q+DSF + L  +    + ++ FPA+FIRAP                          
Sbjct: 127 AFGRQLDSFVTNLDFSKFIPNCNN-FPAVFIRAPVVTKIFAENDSSVLTKIPKSGNNTST 185

Query: 165 XXXXVEVLARLEHDIGETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFV 215
               V+VL +LE D  +     IVAVRQG +LGT+FHPEL +D R H++F+
Sbjct: 186 NTEKVQVLYQLELDKNDL----IVAVRQGRILGTSFHPELADDYRFHQWFI 232



>gi|229820479|ref|YP_002882005.1| SNO glutamine amidotransferase [Beutenbergia cavernae DSM 12333]
 gi|506362764|ref|WP_015882483.1| glutamine amidotransferase [Beutenbergia cavernae]
 gi|229566392|gb|ACQ80243.1| SNO glutamine amidotransferase [Beutenbergia cavernae DSM 12333]
          Length = 200

 Score =  164 bits (414), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 95/203 (46%), Positives = 132/203 (65%), Gaps = 13/203 (6%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG F+EHI +L ++    SA+P+R+  +L+ +D L++PGGESTT++ +    GL+
Sbjct: 5   GVLALQGDFREHIAVLGSLG--VSAVPVRRPSELD-VDGLVLPGGESTTISKLLVTFGLL 61

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKG--GQDLIGGLNITVNRNQFGSQIDSFE 135
           EPLR+ VR   P +G+CAGMILL   A+++  G   Q+ IGG+++TV RN FG Q+DSFE
Sbjct: 62  EPLREAVRSGLPVYGSCAGMILL---ADRILDGTVDQETIGGIDMTVRRNAFGRQVDSFE 118

Query: 136 SLLHINHIT-TSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGS 194
             L    +   +  +L  A+FIRAP         VEVLAR+        A  IVAVRQGS
Sbjct: 119 VDLDAPGLAGEAGSELLRAVFIRAP-WAEDVGDGVEVLARVASG---PAAGRIVAVRQGS 174

Query: 195 LLGTAFHPELTNDDRIHKYFVQL 217
           LL TAFHPE+  D R+H  F+++
Sbjct: 175 LLATAFHPEIGADARVHSTFLRM 197



>gi|495006924|ref|WP_007732937.1| glutamine amidotransferase subunit PdxT [Rhodococcus qingshengii]
 gi|452760067|gb|EME18410.1| glutamine amidotransferase subunit PdxT [Rhodococcus qingshengii
           BKS 20-40]
          Length = 201

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 93/203 (45%), Positives = 129/203 (63%), Gaps = 8/203 (3%)

Query: 17  FGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGL 76
            GVLALQG  +EH+  L +    + A+ IR+ E+L+ +D ++IPGGESTTM+ + +   L
Sbjct: 6   IGVLALQGDVREHLAALDDSG--ADAVGIRRPEELDKVDGIVIPGGESTTMSRLLQVFEL 63

Query: 77  MEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFES 136
           +EPLR+ +R   P +G+CAGMILLA+E    +   + L G +++TV RN FG Q+DSFES
Sbjct: 64  LEPLRERLRGGLPAYGSCAGMILLASEVLDTRPDAEHL-GAIDMTVRRNAFGRQVDSFES 122

Query: 137 LLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGSLL 196
            L    I     D   A+FIRAP         VEVLA++    GE  A  IVAVRQGS++
Sbjct: 123 DLEFEGIIG---DPIRAVFIRAP-WVERVGPGVEVLAQVPAAAGEA-AGRIVAVRQGSVI 177

Query: 197 GTAFHPELTNDDRIHKYFVQLTQ 219
            T+FHPE+T D R+H+ FV L +
Sbjct: 178 ATSFHPEVTGDRRVHEMFVDLVR 200



>gi|363754924|ref|XP_003647677.1| hypothetical protein Ecym_7001 [Eremothecium cymbalariae
           DBVPG#7215]
 gi|356891713|gb|AET40860.1| hypothetical protein Ecym_7001 [Eremothecium cymbalariae
           DBVPG#7215]
          Length = 209

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 97/209 (46%), Positives = 127/209 (60%), Gaps = 20/209 (9%)

Query: 18  GVLALQGAFQEHIHMLQNISQVS----SAIPIRKAEQLETIDALIIPGGESTTMALIAER 73
           GVLALQG+F EHI  L+            + ++  EQL   D+L+IPGGESTT++ IAER
Sbjct: 6   GVLALQGSFNEHIECLKKCVDEKGYNIEVLTVKTIEQLLKCDSLVIPGGESTTISQIAER 65

Query: 74  SGLMEPLRKFVRDE-KPTWGTCAGMILLA----NEANKVKKGGQDLIGGLNITVNRNQFG 128
           +GL + L KFVR E K  WGTCAGMI LA    N+AN +K      +G L++ V+RN FG
Sbjct: 66  TGLYDHLYKFVRTEGKSVWGTCAGMIFLARDVRNQANLLKP-----LGALDVAVDRNAFG 120

Query: 129 SQIDSFESLLHINHITTSSDDLFPAIFIRAP-XXXXXXXXXVEVLARLEHDIGETDASSI 187
            Q+DSF S    +   T  D  F A+FIRAP          V+VL ++E +  E     I
Sbjct: 121 RQLDSFVSDCDFSFWGTQEDS-FSAVFIRAPIVSEIYNNERVQVLHKVEKNGQEY----I 175

Query: 188 VAVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
           VAVRQG +LGT+FHPEL +D R H +F++
Sbjct: 176 VAVRQGKILGTSFHPELGSDIRFHNWFIE 204



>gi|406955008|gb|EKD83655.1| hypothetical protein ACD_39C00542G0002 [uncultured bacterium]
          Length = 197

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 126/206 (61%), Gaps = 22/206 (10%)

Query: 16  KFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSG 75
           K G+LALQGA +EH+  ++       A+ ++ AE+L+ +D LI+PGGESTTM  + +   
Sbjct: 3   KIGILALQGAVREHVVAIKKCGM--EAVEVKSAEELQKVDGLILPGGESTTMRRLIDTYD 60

Query: 76  LMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQD--LIGGLNITVNRNQFGSQIDS 133
           L++PL++F+  +KP +GTCAG+ILLA         GQD   IG ++I V RN +G QI S
Sbjct: 61  LLKPLKRFISVDKPVFGTCAGLILLARSIE-----GQDDNHIGMMDIVVRRNSYGRQIHS 115

Query: 134 FESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQG 193
           FE+ L+I  + +S    FP +FIRAP         VEVL   EHD        IV  RQG
Sbjct: 116 FEASLNIKDVGSS----FPGVFIRAP-HILEVGEGVEVLC--EHD------GKIVMARQG 162

Query: 194 SLLGTAFHPELTNDDRIHKYFVQLTQ 219
            LLG AFHPELT+D R+  YF ++ +
Sbjct: 163 CLLGCAFHPELTDDTRVMSYFAKMVR 188



>gi|496748865|ref|WP_009360709.1| glutamine amidotransferase subunit PdxT [Anoxybacillus sp. DT3-1]
 gi|460134575|gb|EMI11701.1| glutamine amidotransferase subunit PdxT [Anoxybacillus sp. DT3-1]
          Length = 192

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 127/205 (61%), Gaps = 18/205 (8%)

Query: 16  KFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSG 75
           K GVL LQGA +EH+  ++     + A+ I+K EQL  ID LIIPGGESTTM  + ++ G
Sbjct: 3   KIGVLGLQGAVREHVRSIEACG--AEAVVIKKVEQLAHIDGLIIPGGESTTMRRLMDKYG 60

Query: 76  LMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFE 135
            MEPL++F R+ KP +GTCAG+I+L   A K+    +  +G ++ITV RN FG Q +SFE
Sbjct: 61  FMEPLKQFAREGKPMFGTCAGLIIL---AKKIVGYDEPHLGLMDITVERNSFGRQRESFE 117

Query: 136 SLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGSL 195
           + L I  +   +DD F  +FIRAP         V+VLA  E          IVA RQG  
Sbjct: 118 ASLTIKGV---ADD-FIGVFIRAP-HIVSVGDDVDVLATYE--------DRIVAARQGQF 164

Query: 196 LGTAFHPELTNDDRIHKYFVQLTQD 220
           LG +FHPELT+D R+ KYF+ + ++
Sbjct: 165 LGCSFHPELTDDHRMTKYFINMVKE 189



>gi|491437167|ref|WP_005294960.1| glutamine amidotransferase [Corynebacterium jeikeium]
 gi|258603128|gb|EEW16398.1| pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2
           [Corynebacterium jeikeium ATCC 43734]
          Length = 195

 Score =  163 bits (413), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 87/203 (42%), Positives = 127/203 (62%), Gaps = 15/203 (7%)

Query: 17  FGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGL 76
            GVL++QG F EH+  ++ +   + A+  R+AE LE +D LI+PGGESTTM+ + E  G+
Sbjct: 3   IGVLSVQGGFVEHMRSIERLGHEARAV--RRAEHLEGLDGLIMPGGESTTMSKLLELGGM 60

Query: 77  MEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFES 136
           +EPLR+ V D  P +GTCAG+ILLA+     +     L   ++ITV RN FG Q+DSFE+
Sbjct: 61  LEPLRQLVADGLPVFGTCAGLILLADRVLDTRSDAHSL-HAMDITVRRNAFGRQVDSFET 119

Query: 137 LLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGSLL 196
            L    I T  +    A+FIRAP         VEV++ L          ++V VRQG++L
Sbjct: 120 QLPFGDIDTPVE----AVFIRAP-KVEEVGDGVEVVSTLPD-------GTVVGVRQGNVL 167

Query: 197 GTAFHPELTNDDRIHKYFVQLTQ 219
           G +FHPEL+ DDR+H+YF+++ +
Sbjct: 168 GCSFHPELSEDDRVHEYFLRMVK 190



>gi|303289979|ref|XP_003064277.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226454593|gb|EEH51899.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 277

 Score =  163 bits (412), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 100/219 (45%), Positives = 128/219 (58%), Gaps = 19/219 (8%)

Query: 16  KFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSG 75
           K GVLALQG+F EH   ++        + +RKAEQL     LIIPGGESTTMA I  R  
Sbjct: 15  KIGVLALQGSFAEHCAHVRRCG--GEPVEVRKAEQLVGCSGLIIPGGESTTMANICRRWN 72

Query: 76  LMEPLRKFVRDEKPTWGTCAGMILLANEANK-VKKGGQDLIGGLNITVNRNQFGSQIDSF 134
           L EPLR F       WGTCAG+I LA+   +  K+GGQ+L+GGL++TV+RN FGSQ  S 
Sbjct: 73  LFEPLRDFAASGGAVWGTCAGLIFLADRIGRGAKQGGQELLGGLDVTVDRNFFGSQARSI 132

Query: 135 ESLLHINHITTSSDD----LFPAIFIRAPXXXXXXXXXVEVLARL------EHDIGETDA 184
            +   +      +DD     F AIFIRAP         VEVLA          ++  TDA
Sbjct: 133 TTPTSMRCAVPDADDGSDTPFRAIFIRAP-AILSAGPGVEVLAEYALPEEKRAELRGTDA 191

Query: 185 SS----IVAVRQ-GSLLGTAFHPELTNDDRIHKYFVQLT 218
                 IVAV+Q G+LL T+FHPE+T+D R HK F++++
Sbjct: 192 EDVEKIIVAVKQGGNLLATSFHPEVTSDVRWHKLFLEMS 230



>gi|300787178|ref|YP_003767469.1| pyridoxine biosynthesis glutamine amidotransferase [Amycolatopsis
           mediterranei U32]
 gi|384150523|ref|YP_005533339.1| glutamine amidotransferase involved in pyridoxine biosynthesis
           [Amycolatopsis mediterranei S699]
 gi|399539061|ref|YP_006551723.1| glutamine amidotransferase involved in pyridoxine biosynthesis
           [Amycolatopsis mediterranei S699]
 gi|502992151|ref|WP_013227127.1| glutamine amidotransferase [Amycolatopsis mediterranei]
 gi|299796692|gb|ADJ47067.1| glutamine amidotransferase involved in pyridoxine biosynthesis
           [Amycolatopsis mediterranei U32]
 gi|340528677|gb|AEK43882.1| glutamine amidotransferase involved in pyridoxine biosynthesis
           [Amycolatopsis mediterranei S699]
 gi|398319831|gb|AFO78778.1| glutamine amidotransferase involved in pyridoxine biosynthesis
           [Amycolatopsis mediterranei S699]
          Length = 206

 Score =  163 bits (412), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 91/204 (44%), Positives = 128/204 (62%), Gaps = 8/204 (3%)

Query: 17  FGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGL 76
            GVLA+QGA +EH+ ML      + A+P+R+A +L  +D L++PGGESTTM+ + E   L
Sbjct: 7   IGVLAMQGAVREHVAMLAEAG--ARAVPVRRAGELSGVDGLVLPGGESTTMSRLLESFEL 64

Query: 77  MEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFES 136
           +EPL+  + +  P +G+CAGMILLA +    +   Q L GGL++ V RN FG Q+DSFE+
Sbjct: 65  LEPLKARIAEGLPAFGSCAGMILLARQTLDGRPDQQQL-GGLDVVVRRNAFGRQVDSFEA 123

Query: 137 LLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIG-ETDASSIVAVRQGSL 195
            L    + +       A+FIRAP         VEVLA +    G + + + IVAVRQG++
Sbjct: 124 DLDFAQVDSGP---VHAVFIRAP-WVEKAGDGVEVLATVSGVPGVDEETARIVAVRQGAV 179

Query: 196 LGTAFHPELTNDDRIHKYFVQLTQ 219
           L TAFHPELT D R+H+ FV L +
Sbjct: 180 LATAFHPELTPDVRVHRLFVDLVR 203



>gi|284991603|ref|YP_003410157.1| SNO glutamine amidotransferase [Geodermatophilus obscurus DSM
           43160]
 gi|502714140|ref|WP_012949216.1| glutamine amidotransferase [Geodermatophilus obscurus]
 gi|284064848|gb|ADB75786.1| SNO glutamine amidotransferase [Geodermatophilus obscurus DSM
           43160]
          Length = 217

 Score =  163 bits (412), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 124/204 (60%), Gaps = 10/204 (4%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG  +EH+  L  +   + A+ +R+  +L  +DAL++PGGESTTM  +A R GL+
Sbjct: 8   GVLALQGDVREHLATLPELG--AEAVTVRRPGELAAVDALVVPGGESTTMTKLAARFGLL 65

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
            PLR  V    P +G+CAGMI+LA+         Q  +GGL++TV RN FG Q+DSFES 
Sbjct: 66  GPLRDAVAGGLPVYGSCAGMIMLADRLLDAPA-DQVTVGGLDVTVRRNAFGRQVDSFESQ 124

Query: 138 LHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGSLLG 197
           + I+ +         A+FIRAP         V+VL R+   +G      IVAVRQG+L+ 
Sbjct: 125 VEIDGVAGGP---VHAVFIRAP-WVEQAGEGVQVLGRV---VGGPADGRIVAVRQGNLVA 177

Query: 198 TAFHPELTNDDRIHKYFVQLTQDH 221
           T+FHPELT D R+H  FV + + H
Sbjct: 178 TSFHPELTGDRRVHALFVDIVRRH 201



>gi|442771079|gb|AGC71776.1| pyridoxine biosynthesis glutamine amidotransferase, glutaminase
           subunit [uncultured bacterium A1Q1_fos_2116]
          Length = 202

 Score =  162 bits (411), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 97/200 (48%), Positives = 119/200 (59%), Gaps = 11/200 (5%)

Query: 16  KFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSG 75
           +FGVLALQG F+EH   L+ +     A  +R  E+L+  DAL+IPGGEST M L+AE  G
Sbjct: 5   RFGVLALQGDFREHAASLERLG--VQAHKVRTLEELDACDALVIPGGESTAMLLLAESQG 62

Query: 76  LMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFE 135
           ++EPLR  +       GTCAGM+LLA E     K GQ  +GGL+I V RN FG QI SFE
Sbjct: 63  ILEPLRTKIASGLTVLGTCAGMVLLAREVLD-GKAGQQTLGGLDIVVRRNAFGGQIHSFE 121

Query: 136 SLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGSL 195
           + L    + T       A+FIRAP         VEVLA +     E     IVAVRQGS+
Sbjct: 122 TDLDFAGLDTP----VHAVFIRAP-WVEELGPDVEVLASVPT---EAQGDRIVAVRQGSV 173

Query: 196 LGTAFHPELTNDDRIHKYFV 215
             T+FHPE+  DDRIHK FV
Sbjct: 174 WATSFHPEVNGDDRIHKLFV 193



>gi|138893691|ref|YP_001124144.1| glutamine amidotransferase subunit PdxT [Geobacillus
           thermodenitrificans NG80-2]
 gi|496157579|ref|WP_008882086.1| glutamine amidotransferase [Geobacillus sp. G11MC16]
 gi|166980436|sp|A4IJ95.1|PDXT_GEOTN RecName: Full=Glutamine amidotransferase subunit PdxT; AltName:
           Full=Glutamine amidotransferase glutaminase subunit PdxT
 gi|134265204|gb|ABO65399.1| Glutamine amidotransferase Sno family [Geobacillus
           thermodenitrificans NG80-2]
 gi|196209314|gb|EDY04097.1| SNO glutamine amidotransferase [Geobacillus sp. G11MC16]
          Length = 195

 Score =  162 bits (411), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 125/206 (60%), Gaps = 18/206 (8%)

Query: 15  FKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERS 74
            K GVL LQGA QEH+  ++     + A+ ++K EQL  +D L++PGGESTTM  + +R 
Sbjct: 1   MKIGVLGLQGAVQEHVRAIEACG--AEAVVVKKTEQLTGLDGLVLPGGESTTMRRLIDRY 58

Query: 75  GLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSF 134
           GLMEPL++F  D KP +GTCAG+ILL   A ++    +  +G ++ITV RN FG Q +SF
Sbjct: 59  GLMEPLKQFAADGKPMFGTCAGLILL---AKRIVGYDEPHLGLMDITVERNSFGRQRESF 115

Query: 135 ESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGS 194
           E+ L I  +     D F  +FIRAP         VEVLA        T    IVA RQG 
Sbjct: 116 EAELSIKGV----GDGFVGVFIRAP-HIVEVGDEVEVLA--------TYNDRIVAARQGQ 162

Query: 195 LLGTAFHPELTNDDRIHKYFVQLTQD 220
            LG +FHPELT+D R+ +YF+ + ++
Sbjct: 163 FLGCSFHPELTDDHRLMRYFLNMVKE 188



>gi|491383102|ref|WP_005240983.1| glutamine amidotransferase [Rhodococcus opacus]
 gi|356666963|gb|EHI47034.1| pyridoxal phosphate synthase component Pdx2 [Rhodococcus opacus
           PD630]
 gi|383838753|gb|EID78121.1| glutamine amidotransferase subunit PdxT [Rhodococcus imtechensis
           RKJ300 = JCM 13270]
 gi|414568880|gb|EKT79633.1| glutamine amidotransferase subunit PdxT [Rhodococcus opacus M213]
 gi|430776438|gb|ELB91872.1| glutamine amidotransferase subunit PdxT [Rhodococcus
           wratislaviensis IFP 2016]
          Length = 202

 Score =  162 bits (411), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 94/202 (46%), Positives = 127/202 (62%), Gaps = 8/202 (3%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG  +EH+  L +    + A+ IR+ E+LE ID L+IPGGESTTM+ + +   L+
Sbjct: 7   GVLALQGDVREHLAALNDSG--ADAVGIRRPEELEKIDGLVIPGGESTTMSKLLQIFELL 64

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
           EPL+  + D  P +G+CAGMILLA+E    +   Q L G +++TV RN FG Q+DSFES 
Sbjct: 65  EPLKARLHDGLPAYGSCAGMILLASEILDTRPDAQHL-GAIDMTVRRNAFGRQVDSFESD 123

Query: 138 LHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGSLLG 197
           L    I     D   A+FIRAP         V+VLAR+    G   A  IVAVRQGS++ 
Sbjct: 124 LEFEGIVG---DPMRAVFIRAP-WVERVGDDVQVLARVPES-GGAAAGRIVAVRQGSVVA 178

Query: 198 TAFHPELTNDDRIHKYFVQLTQ 219
           T+FHPE+T D R+H+ FV + +
Sbjct: 179 TSFHPEVTGDRRVHELFVDIVR 200



>gi|490715118|ref|WP_004577776.1| glutamine amidotransferase subunit PdxT [Anoxybacillus
           flavithermus]
 gi|475640968|gb|EMT44762.1| glutamine amidotransferase subunit PdxT [Anoxybacillus flavithermus
           AK1]
          Length = 192

 Score =  162 bits (411), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 92/205 (44%), Positives = 127/205 (61%), Gaps = 18/205 (8%)

Query: 16  KFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSG 75
           K GVL LQGA +EH+  ++     + A+ I+K EQL  ID LIIPGGESTTM  + ++ G
Sbjct: 3   KIGVLGLQGAVREHVRSIEACD--AEAVVIKKTEQLAHIDGLIIPGGESTTMRRLMDKYG 60

Query: 76  LMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFE 135
            +EPL++F RD KP +GTCAG+I+L   A K+    +  +G ++ITV RN FG Q +SFE
Sbjct: 61  FIEPLKQFARDGKPMFGTCAGLIIL---AKKIVGYDEAHLGLMDITVERNSFGRQRESFE 117

Query: 136 SLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGSL 195
           + L I  +   +DD F  +FIRAP         V+VLA  E          IVA RQG  
Sbjct: 118 ASLSIKGV---ADD-FIGVFIRAP-HIVSVGSDVDVLATYE--------DRIVAARQGQF 164

Query: 196 LGTAFHPELTNDDRIHKYFVQLTQD 220
           LG +FHPELT+D R+ +YF+ + ++
Sbjct: 165 LGCSFHPELTDDHRMTQYFINMVKE 189



>gi|307108967|gb|EFN57206.1| hypothetical protein CHLNCDRAFT_11969, partial [Chlorella
           variabilis]
          Length = 199

 Score =  162 bits (411), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 122/201 (60%), Gaps = 16/201 (7%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGE------STTMALIA 71
           GVLALQG+F+EH+ +L+       AI +R  E+L +   LIIPG        STTMAL+A
Sbjct: 2   GVLALQGSFREHMALLERCG--VEAIEVRTKEELGSCAGLIIPGARRGPRCLSTTMALVA 59

Query: 72  ERSGLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQI 131
           ER GL+  LR+F   ++P WGTCAG+I LA+ A+ +K+GGQ L+GGL+ TV RN FG+QI
Sbjct: 60  ERWGLIPELRQFAAQQRPIWGTCAGLIFLADRASGMKEGGQALLGGLDCTVQRNFFGAQI 119

Query: 132 DSFESLLHINHITTSSDD---LFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDA---- 184
           +SFE+ L        S D    F A+FIRAP         VEVLA      GE       
Sbjct: 120 NSFETQLPAPACLPRSADPSETFRALFIRAP-AITETGPGVEVLAEYCLSEGERAQQQRD 178

Query: 185 SSIVAVRQGSLLGTAFHPELT 205
           S  VAVR G L+ TAFHPELT
Sbjct: 179 SVAVAVRSGPLMATAFHPELT 199



>gi|494004318|ref|WP_006946839.1| glutamine amidotransferase [Dermacoccus sp. Ellin185]
 gi|308433178|gb|EFP57077.1| pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2
           [Dermacoccus sp. Ellin185]
          Length = 205

 Score =  162 bits (411), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 131/211 (62%), Gaps = 18/211 (8%)

Query: 13  PQFKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAE 72
           P+   GVLA+QG   EH+ ML+++   + A+ +R+A  L  +DAL+IPGGEST M  +  
Sbjct: 5   PRTVIGVLAVQGDVVEHVRMLEDVG--AHAVRVRRAADLANVDALVIPGGESTVMMRLIA 62

Query: 73  RSGLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKG--GQDLIGGLNITVNRNQFGSQ 130
           +  L+EPLR+ +    P +G+CAGMILL   A+++  G  GQ  +GGL++TV RN FG Q
Sbjct: 63  QGDLLEPLRERIAAGMPAYGSCAGMILL---ADRILDGTAGQQTLGGLDVTVRRNAFGRQ 119

Query: 131 IDSFESLLHINHITTSSDDLFP--AIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIV 188
           + SFE+      +T    D  P  A+FIRAP         VEVL+ +    G     ++V
Sbjct: 120 VASFEA-----DVTVDGVDGGPVRAVFIRAP-WVEEVGAGVEVLSSVALPTG---GEAVV 170

Query: 189 AVRQGSLLGTAFHPELTNDDRIHKYFVQLTQ 219
           AVRQG+LL T+FHPE+TND R+H  FV++ +
Sbjct: 171 AVRQGNLLATSFHPEVTNDARVHALFVRMVE 201



>gi|493381252|ref|WP_006337514.1| glutamine amidotransferase [Gordonia rhizosphera]
 gi|403203070|dbj|GAB92803.1| glutamine amidotransferase subunit PdxT [Gordonia rhizosphera NBRC
           16068]
          Length = 210

 Score =  162 bits (410), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 90/204 (44%), Positives = 125/204 (61%), Gaps = 7/204 (3%)

Query: 16  KFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSG 75
           + GVLALQG  +EH+  L      + A  +R+ E+L  +DA++IPGGESTTM+ +     
Sbjct: 8   RIGVLALQGDVREHLAALTVAG--AQAATVRRPEELAAVDAIVIPGGESTTMSRLLTVFD 65

Query: 76  LMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFE 135
           L +PLR+ + D  P +G+CAGMILLA      +   + L   L+ITV RN FG Q++SFE
Sbjct: 66  LFDPLRQRLADGMPAYGSCAGMILLATTILDTRPDARHL-DALDITVRRNAFGRQVESFE 124

Query: 136 SLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGSL 195
           + L  + I+  S D   A+FIRAP         VEVLAR+ H   +     IVAVRQG++
Sbjct: 125 ADLEFDGISEWSGDTMRAVFIRAP-WVESISPDVEVLARVPHGPAQ---GRIVAVRQGNV 180

Query: 196 LGTAFHPELTNDDRIHKYFVQLTQ 219
           L T+FHPE+T D R+H YFV + +
Sbjct: 181 LATSFHPEVTGDRRVHAYFVDMVR 204



>gi|464806598|gb|EMP12880.1| glutamine amidotransferase subunit pdxT [Gordonia sp. NB4-1Y]
          Length = 207

 Score =  162 bits (410), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 94/209 (44%), Positives = 129/209 (61%), Gaps = 13/209 (6%)

Query: 13  PQFKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAE 72
           P  + GVLALQG  +EH+  L   S  + AI +R+A +LE++D ++IPGGESTTM+ +  
Sbjct: 3   PTPRIGVLALQGDVREHLAALD--SAGAEAITVRRAAELESVDGIVIPGGESTTMSHLLG 60

Query: 73  RSGLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQID 132
             GL EPLR  + D  P +G+CAGMI+LA+     +   +DL   L+ITV RN FG Q++
Sbjct: 61  VFGLYEPLRARLADGLPAYGSCAGMIMLASNILDTRPDARDL-DALDITVRRNAFGRQVE 119

Query: 133 SFESLLHINHITTSSDDLFP--AIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAV 190
           SFE+ L I  +T    D  P  A+FIRAP         VEVLA++        A  +VAV
Sbjct: 120 SFETDLEIAGVT----DEVPMRAVFIRAP-WVEKVGDGVEVLAKVPDGPA---AGRVVAV 171

Query: 191 RQGSLLGTAFHPELTNDDRIHKYFVQLTQ 219
           RQG +L T+FHPE+T D R+H YFV + +
Sbjct: 172 RQGQVLATSFHPEVTGDRRVHAYFVDMVR 200



>gi|459367728|gb|EMG46671.1| Glutamine amidotransferase subunit pdxT [Candida maltosa Xu316]
          Length = 242

 Score =  162 bits (410), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 101/228 (44%), Positives = 133/228 (58%), Gaps = 34/228 (14%)

Query: 18  GVLALQGAFQEHI----HML-QNISQVSSA----IPIRKAEQLETIDALIIPGGESTTMA 68
           GVLALQGAF+EHI    H+L  N S+ S      I +R  EQL+T D+L+IPGGES++++
Sbjct: 10  GVLALQGAFREHIAYFNHILASNPSEYSEYDFKIIEVRTKEQLDTCDSLVIPGGESSSIS 69

Query: 69  LIAERSGLMEPLRKFVRDE-KPTWGTCAGMILLANE-ANKVKKGGQDLIGGLNITVNRNQ 126
            IAER+  ++ L  FV DE K  WGTCAG+I L+    N +++  Q  +G LNI V+RN 
Sbjct: 70  YIAERTNFLQSLYDFVSDESKSVWGTCAGLIFLSKHLINGIEQ--QKTLGALNIEVSRNA 127

Query: 127 FGSQIDSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXX------------------ 168
           FG QIDSFE  L  +       D FP +FIRAP                           
Sbjct: 128 FGRQIDSFEQNLDFSSFIPGCTD-FPTVFIRAPVVTKILTAKDELKEGVLKSPNSYENKA 186

Query: 169 -VEVLARLEHDIGETDASSIVAVRQGSLLGTAFHPELTNDDRIHKYFV 215
            VEVL  L++  G+ D   IVAV+QG +LGT+FHPEL +D R HK+F+
Sbjct: 187 PVEVLYSLKNYDGK-DNELIVAVQQGHVLGTSFHPELADDYRFHKWFL 233



>gi|493426959|ref|WP_006382646.1| pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2
           [Streptomyces turgidiscabies]
 gi|440273743|gb|ELP62449.1| pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2
           [Streptomyces turgidiscabies Car8]
          Length = 210

 Score =  162 bits (410), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 94/213 (44%), Positives = 126/213 (59%), Gaps = 15/213 (7%)

Query: 17  FGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGL 76
            GVLALQG  QEH+  L     ++   P+R+ E+L  +D LIIPGGESTT++ +A   G+
Sbjct: 7   IGVLALQGDVQEHLIALAEADALAR--PVRRPEELAEVDGLIIPGGESTTISKLAVLFGV 64

Query: 77  MEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFES 136
           MEPLR  VR   P +GTCAGMI+LA++     + GQ+ +GG+++ V RN FG Q +SFE+
Sbjct: 65  MEPLRARVRAGMPVYGTCAGMIMLADKILD-PRSGQETVGGIDMIVRRNAFGRQNESFEA 123

Query: 137 LLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGSLL 196
            +    +T    D    +FIRAP          EVLA  EH      A  IVAVRQG+ L
Sbjct: 124 AV---DVTGVEGDPVEGVFIRAP-WVESVGAEAEVLA--EH------AGHIVAVRQGNAL 171

Query: 197 GTAFHPELTNDDRIHKYFVQLTQDHYNTGKGRN 229
            T+FHPELT D R+H  FV + + H     G +
Sbjct: 172 ATSFHPELTGDHRVHSLFVDMVRAHMGRAVGAD 204



>gi|119716609|ref|YP_923574.1| SNO glutamine amidotransferase [Nocardioides sp. JS614]
 gi|500079815|ref|WP_011755828.1| glutamine amidotransferase [Nocardioides sp. JS614]
 gi|150403913|sp|A1SJA2.1|PDXT_NOCSJ RecName: Full=Glutamine amidotransferase subunit PdxT; AltName:
           Full=Glutamine amidotransferase glutaminase subunit PdxT
 gi|119537270|gb|ABL81887.1| pyridoxal phosphate synthase yaaE subunit [Nocardioides sp. JS614]
          Length = 201

 Score =  162 bits (409), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 93/207 (44%), Positives = 129/207 (62%), Gaps = 15/207 (7%)

Query: 17  FGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGL 76
            GV ALQG  +EH+ ML  +     AI +R+  +L+    L+IPGGESTTMA +A    L
Sbjct: 7   IGVFALQGDVREHLGMLTGLG--VEAIAVRRPAELDVCAGLVIPGGESTTMAKLARTFDL 64

Query: 77  MEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQD--LIGGLNITVNRNQFGSQIDSF 134
            EP+R+ +++  P +GTCAGMI+L   A++++ G +D   +GGL+ITV RN FG Q++SF
Sbjct: 65  FEPIRQRIKEGMPAFGTCAGMIML---ADRIEDGTRDQETLGGLDITVRRNAFGRQVESF 121

Query: 135 ESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGS 194
           E  + +  +    D    A+FIRAP         VEVLAR+E   GE  A  IVAVRQGS
Sbjct: 122 EGEIDVVGL----DAPLHAVFIRAP-WVEAVGDSVEVLARVEQ--GEA-AGRIVAVRQGS 173

Query: 195 LLGTAFHPELTNDDRIHKYFVQLTQDH 221
           L+ T+FHPE+  D R+H+ FV L  + 
Sbjct: 174 LMATSFHPEVGGDSRVHRLFVDLVTEE 200



>gi|490040910|ref|WP_003943308.1| glutamine amidotransferase [Rhodococcus erythropolis]
 gi|229321098|gb|EEN86902.1| pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2
           [Rhodococcus erythropolis SK121]
          Length = 201

 Score =  162 bits (409), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 91/203 (44%), Positives = 129/203 (63%), Gaps = 8/203 (3%)

Query: 17  FGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGL 76
            GVLALQG  +EH+  L +    + A+ +R+ E+L+ +D ++IPGGESTTM+ + +   L
Sbjct: 6   IGVLALQGDVREHLAALDDSG--ADAVGVRRPEELDKVDGIVIPGGESTTMSRLLQVFEL 63

Query: 77  MEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFES 136
           ++PLR+ +R   P +G+CAGMILLA+E    +   + L G +++TV RN FG Q+DSFES
Sbjct: 64  LDPLRERLRGGLPAYGSCAGMILLASEVLDTRPDAEHL-GAIDMTVRRNAFGRQVDSFES 122

Query: 137 LLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGSLL 196
            L    I     D   A+FIRAP         VEVLA++    GE  A  IVAVRQGS++
Sbjct: 123 DLEFEGIIG---DPIRAVFIRAP-WVERVGPGVEVLAQVPAAAGEA-AGRIVAVRQGSVI 177

Query: 197 GTAFHPELTNDDRIHKYFVQLTQ 219
            T+FHPE+T D R+H+ FV L +
Sbjct: 178 ATSFHPEVTGDRRVHEMFVDLVR 200



>gi|152973865|ref|YP_001373382.1| glutamine amidotransferase subunit PdxT [Bacillus cytotoxicus NVH
           391-98]
 gi|500738559|ref|WP_011983158.1| glutamine amidotransferase [Bacillus cytotoxicus]
 gi|189036893|sp|A7GJS9.1|PDXT_BACCN RecName: Full=Glutamine amidotransferase subunit PdxT; AltName:
           Full=Glutamine amidotransferase glutaminase subunit PdxT
 gi|152022617|gb|ABS20387.1| SNO glutamine amidotransferase [Bacillus cytotoxicus NVH 391-98]
          Length = 196

 Score =  162 bits (409), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 126/205 (61%), Gaps = 18/205 (8%)

Query: 16  KFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSG 75
           K GVL LQGA +EH+  ++  +  + A+ +++ EQL+ ID LI+PGGESTTM  + ++  
Sbjct: 3   KIGVLGLQGAVREHVKAIE--ASGAEAVVVKQVEQLQEIDGLILPGGESTTMRRLIDKYH 60

Query: 76  LMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFE 135
            MEPLR+F R  KP +GTCAGMILL   ANK+    +  IG ++ITV RN FG Q DSFE
Sbjct: 61  FMEPLREFARSRKPMFGTCAGMILL---ANKLIGYEEAHIGAMDITVERNAFGRQKDSFE 117

Query: 136 SLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGSL 195
           + L I  +       F  +FIRAP         VEVL+   H+        +VAV+QG  
Sbjct: 118 ATLSIKGVGED----FTGVFIRAP-YVVDIADDVEVLSM--HN------GRMVAVKQGPF 164

Query: 196 LGTAFHPELTNDDRIHKYFVQLTQD 220
           L  +FHPELT+D R+  YFV++ ++
Sbjct: 165 LAASFHPELTDDYRVTAYFVEMVEE 189



>gi|226185519|dbj|BAH33623.1| probable pyridoxal phosphate synthase component Pdx2 [Rhodococcus
           erythropolis PR4]
          Length = 202

 Score =  162 bits (409), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 91/203 (44%), Positives = 129/203 (63%), Gaps = 8/203 (3%)

Query: 17  FGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGL 76
            GVLALQG  +EH+  L +    + A+ +R+ E+L+ +D ++IPGGESTTM+ + +   L
Sbjct: 7   IGVLALQGDVREHLAALDDSG--ADAVGVRRPEELDKVDGIVIPGGESTTMSRLLQVFEL 64

Query: 77  MEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFES 136
           ++PLR+ +R   P +G+CAGMILLA+E    +   + L G +++TV RN FG Q+DSFES
Sbjct: 65  LDPLRERLRGGLPAYGSCAGMILLASEVLDTRPDAEHL-GAIDMTVRRNAFGRQVDSFES 123

Query: 137 LLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGSLL 196
            L    I     D   A+FIRAP         VEVLA++    GE  A  IVAVRQGS++
Sbjct: 124 DLEFEGIIG---DPIRAVFIRAP-WVERVGPGVEVLAQVPAAAGEA-AGRIVAVRQGSVI 178

Query: 197 GTAFHPELTNDDRIHKYFVQLTQ 219
            T+FHPE+T D R+H+ FV L +
Sbjct: 179 ATSFHPEVTGDRRVHEMFVDLVR 201



>gi|71024311|ref|XP_762385.1| hypothetical protein UM06238.1 [Ustilago maydis 521]
 gi|46101885|gb|EAK87118.1| hypothetical protein UM06238.1 [Ustilago maydis 521]
          Length = 660

 Score =  162 bits (409), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 84/148 (56%), Positives = 105/148 (70%), Gaps = 8/148 (5%)

Query: 18  GVLALQGAFQEH------IHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIA 71
           GVLA+QGAF+EH      ++ L  +  + S + +R  EQL   DALIIPGGEST ++L  
Sbjct: 43  GVLAIQGAFREHASHINRLNTLHPLHTIRSTL-VRTPEQLADCDALIIPGGESTAISLGC 101

Query: 72  ERSGLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQI 131
           ER GL+EPLRK+VRD +P WGTCAGMI+LA EA+  KKGGQ LIGG+++ V RN FGSQI
Sbjct: 102 ERIGLLEPLRKWVRDGRPVWGTCAGMIMLAREASGGKKGGQQLIGGVDVRVGRNGFGSQI 161

Query: 132 DSFESLLHINHITTSSDDLFPAIFIRAP 159
           DSFE+ L I H      +LF  +FIRAP
Sbjct: 162 DSFETGLEI-HGLDRPQELFNGVFIRAP 188



>gi|487953339|ref|WP_002026805.1| glutamine amidotransferase [Bacillus cereus]
 gi|228646594|gb|EEL02799.1| Glutamine amidotransferase subunit pdxT [Bacillus cereus BDRD-ST26]
          Length = 202

 Score =  161 bits (408), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 92/211 (43%), Positives = 124/211 (58%), Gaps = 30/211 (14%)

Query: 16  KFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSG 75
           K GVL LQGA +EH+  ++  +  + A+ +++ EQLE ID LI+PGGESTTM  + ++  
Sbjct: 9   KIGVLGLQGAVREHVKSVE--ASGAEAVVVKRIEQLEEIDGLILPGGESTTMRRLIDKYA 66

Query: 76  LMEPLRKFVRDEKPTWGTCAGMILLA------NEANKVKKGGQDLIGGLNITVNRNQFGS 129
            MEPLR F +  KP +GTCAGMILLA      +EA+         IG ++ITV RN FG 
Sbjct: 67  FMEPLRTFAKSGKPMFGTCAGMILLAKTLIGYDEAH---------IGAMDITVERNAFGR 117

Query: 130 QIDSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVA 189
           Q DSFE+ L I  +       F  +FIRAP         VEVL+        T    +VA
Sbjct: 118 QKDSFEAALSIKGVGED----FVGVFIRAP-YVVNVADNVEVLS--------THGDRMVA 164

Query: 190 VRQGSLLGTAFHPELTNDDRIHKYFVQLTQD 220
           VRQG  L  +FHPELT+D R+  YFV++ ++
Sbjct: 165 VRQGPFLAASFHPELTDDHRVTAYFVEMVKE 195



>gi|446160925|ref|WP_000238780.1| glutamine amidotransferase [Bacillus cereus]
 gi|228589062|gb|EEK47075.1| Glutamine amidotransferase subunit pdxT [Bacillus cereus m1293]
 gi|401216528|gb|EJR23237.1| glutamine amidotransferase subunit pdxT [Bacillus cereus MSX-D12]
          Length = 196

 Score =  161 bits (408), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 92/211 (43%), Positives = 124/211 (58%), Gaps = 30/211 (14%)

Query: 16  KFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSG 75
           K GVL LQGA +EH+  ++  +  + A+ +++ EQLE ID LI+PGGESTTM  + ++  
Sbjct: 3   KIGVLGLQGAVREHVKSVE--ASGAEAVVVKRIEQLEEIDGLILPGGESTTMRRLIDKYA 60

Query: 76  LMEPLRKFVRDEKPTWGTCAGMILLA------NEANKVKKGGQDLIGGLNITVNRNQFGS 129
            MEPLR F +  KP +GTCAGMILLA      +EA+         IG ++ITV RN FG 
Sbjct: 61  FMEPLRTFAKSGKPMFGTCAGMILLAKTLIGYDEAH---------IGAMDITVERNAFGR 111

Query: 130 QIDSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVA 189
           Q DSFE+ L I  +       F  +FIRAP         VEVL+        T    +VA
Sbjct: 112 QKDSFEAALSIKGVGED----FVGVFIRAP-YVVNVADDVEVLS--------THGDRMVA 158

Query: 190 VRQGSLLGTAFHPELTNDDRIHKYFVQLTQD 220
           VRQG  L  +FHPELT+D R+  YFV++ ++
Sbjct: 159 VRQGPFLAASFHPELTDDHRVTAYFVEMVKE 189



>gi|489487704|ref|WP_003392666.1| glutamine amidotransferase subunit PdxT [Brevibacillus
           borstelensis]
 gi|475657050|gb|EMT50088.1| glutamine amidotransferase subunit PdxT [Brevibacillus borstelensis
           AK1]
          Length = 191

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 90/209 (43%), Positives = 125/209 (59%), Gaps = 22/209 (10%)

Query: 15  FKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERS 74
            K GVL+LQGA  EHI ML+     ++A+ ++K ++LE +D L+IPGGESTT++ +  + 
Sbjct: 1   MKIGVLSLQGAVAEHIRMLEAAG--ATAVAVKKVDELEDLDGLVIPGGESTTISKLMHKY 58

Query: 75  GLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQD--LIGGLNITVNRNQFGSQID 132
           G +E LR+F +  KP +GTCAG ILLA   N     GQD   +G ++I V RN FG Q +
Sbjct: 59  GFIEALREFGQARKPIFGTCAGAILLAKRIN-----GQDDCHLGLMDIKVERNAFGRQKE 113

Query: 133 SFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQ 192
           SFE  L +  +       +PA+FIRAP          +VLA+ E          IVA RQ
Sbjct: 114 SFEVELPVAGVAAD----YPAVFIRAPYIMEVGEAG-QVLAKYE--------EKIVAARQ 160

Query: 193 GSLLGTAFHPELTNDDRIHKYFVQLTQDH 221
           G  L  AFHPELT D R+H+YFV + +++
Sbjct: 161 GHYLAAAFHPELTEDARLHQYFVDMVKEY 189



>gi|489446856|ref|WP_003352268.1| glutamine amidotransferase [Bacillus smithii]
 gi|363629043|gb|EHL79730.1| glutamine amidotransferase subunit pdxT [Bacillus smithii
           7_3_47FAA]
          Length = 194

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 126/205 (61%), Gaps = 18/205 (8%)

Query: 16  KFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSG 75
           K GVL LQGA +EHI  ++   +   A  I+K +QL+ +D LI+PGGESTTM  + +R G
Sbjct: 2   KIGVLGLQGAVREHIRSVEACGE--EAFEIKKVDQLKDLDGLILPGGESTTMRRLIDRYG 59

Query: 76  LMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFE 135
            +EP+++     KP +GTCAG+ILLA E    +   Q  +G +++TV RN FG Q +SFE
Sbjct: 60  FLEPIKELANSGKPIFGTCAGLILLAKEIVGYQ---QPHLGLMDVTVERNSFGRQRESFE 116

Query: 136 SLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGSL 195
           + L I  +  S    FPA+FIRAP         VEVLA+ E          IVA R+G+L
Sbjct: 117 AELDIKDVGES----FPAVFIRAP-HIVKVGPNVEVLAKHE--------DRIVAAREGNL 163

Query: 196 LGTAFHPELTNDDRIHKYFVQLTQD 220
           LG +FHPELT+D R  KYF+ + ++
Sbjct: 164 LGCSFHPELTDDYRFTKYFLNMVKE 188



>gi|490111752|ref|WP_004012426.1| glutamine amidotransferase [Mobiluncus mulieris]
 gi|227844009|gb|EEJ54177.1| pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2
           [Mobiluncus mulieris ATCC 35243]
 gi|304648453|gb|EFM45756.1| pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2
           [Mobiluncus mulieris ATCC 35239]
          Length = 208

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 131/212 (61%), Gaps = 16/212 (7%)

Query: 14  QFKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAER 73
           +F+ GVL LQG+  EHI  L  +   ++ + ++ ++ LE +D LIIPGGESTTM  +A  
Sbjct: 7   KFRVGVLGLQGSVIEHIQALHELG--ATPVEVKLSKHLEDLDGLIIPGGESTTMYKLAHA 64

Query: 74  SGLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKG--GQDLIGGLNITVNRNQFGSQI 131
             + E L+ FV   +  +G+CAGMI+LA+    +  G  GQ+ +GGL++TV RN FG Q+
Sbjct: 65  FDVFEALKTFVHSGRAVYGSCAGMIMLADH---ILDGIEGQETLGGLDVTVRRNAFGRQV 121

Query: 132 DSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASS--IVA 189
           DS  S  H+N      D   PA+FIRAP         V+VLA  +    +T  SS   VA
Sbjct: 122 DSAAS--HVNPGEFGGDTPLPAVFIRAP-WVESVGSKVQVLATWQ----QTPESSPRAVA 174

Query: 190 VRQGSLLGTAFHPELTNDDRIHKYFVQLTQDH 221
           VRQGSLL T+FHPE+T+D R+H+YF+ +  D+
Sbjct: 175 VRQGSLLATSFHPEVTSDRRVHRYFLDMVADY 206



>gi|488059339|ref|WP_002130736.1| glutamine amidotransferase [Bacillus cereus]
 gi|228751737|gb|EEM01534.1| Glutamine amidotransferase subunit pdxT [Bacillus mycoides DSM
           2048]
 gi|401149175|gb|EJQ56652.1| glutamine amidotransferase subunit pdxT [Bacillus cereus CER057]
 gi|401163911|gb|EJQ71254.1| glutamine amidotransferase subunit pdxT [Bacillus cereus CER074]
 gi|401222272|gb|EJR28867.1| glutamine amidotransferase subunit pdxT [Bacillus cereus VD078]
 gi|401286642|gb|EJR92459.1| glutamine amidotransferase subunit pdxT [Bacillus cereus VDM022]
 gi|402427102|gb|EJV59215.1| glutamine amidotransferase subunit pdxT [Bacillus cereus BtB2-4]
 gi|500315239|gb|EOO35875.1| glutamine amidotransferase subunit pdxT [Bacillus cereus VDM019]
 gi|500417656|gb|EOP33115.1| glutamine amidotransferase subunit pdxT [Bacillus cereus VD146]
          Length = 196

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 92/206 (44%), Positives = 126/206 (61%), Gaps = 20/206 (9%)

Query: 16  KFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSG 75
           K GVL LQGA +EH+  ++  +  + A+ +++ EQLE ID LI+PGGESTTM  + ++  
Sbjct: 3   KIGVLGLQGAVREHVKSVE--ASGAEAVVVKRVEQLEEIDGLILPGGESTTMRRLIDKYA 60

Query: 76  LMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDL-IGGLNITVNRNQFGSQIDSF 134
            MEPLR F +  KP +GTCAGMILLA    K   G ++  IG ++ITV RN FG Q DSF
Sbjct: 61  FMEPLRTFAKSGKPMFGTCAGMILLA----KTLIGYEEAHIGAMDITVERNAFGRQKDSF 116

Query: 135 ESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGS 194
           E+ L +  +    +D F  +FIRAP         VEVL+        T    +VAVRQG 
Sbjct: 117 EAALSMKGV---GED-FVGVFIRAP-YVVNVADDVEVLS--------THGERMVAVRQGP 163

Query: 195 LLGTAFHPELTNDDRIHKYFVQLTQD 220
            L  +FHPELT+D R+  YFV++ ++
Sbjct: 164 FLAASFHPELTDDHRVTAYFVEMVKE 189



>gi|383788743|ref|YP_005473312.1| glutamine amidotransferase subunit PdxT [Caldisericum exile
           AZM16c01]
 gi|504266504|ref|WP_014453606.1| glutamine amidotransferase [Caldisericum exile]
 gi|381364380|dbj|BAL81209.1| glutamine amidotransferase subunit PdxT [Caldisericum exile
           AZM16c01]
          Length = 192

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 93/209 (44%), Positives = 127/209 (60%), Gaps = 18/209 (8%)

Query: 15  FKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERS 74
            K GVLALQGA  EH++ML+++     AIP++ AE+++ ID LI+PGGESTTM  +  + 
Sbjct: 1   MKIGVLALQGAVSEHLNMLKSLG--VEAIPVKTAEEIKAIDGLIMPGGESTTMGRLITKF 58

Query: 75  GLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSF 134
            L   +++ + +  P +GTCAGMILL   + ++K   Q  +G L+ITV RN FG QIDS 
Sbjct: 59  ELENVIKERINEGMPVYGTCAGMILL---SKRIKNYSQFTLGILDITVIRNAFGRQIDSM 115

Query: 135 ESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGS 194
           E  LH+  +    DD F AIFIRAP         VE LA LE          +V +RQG+
Sbjct: 116 EVDLHVKGL----DDSFHAIFIRAP-IAVDLGTDVEALASLEE--------GVVFLRQGN 162

Query: 195 LLGTAFHPELTNDDRIHKYFVQLTQDHYN 223
           +  +AFHPEL ND RIHK F++  +   N
Sbjct: 163 VYASAFHPELGNDPRIHKMFIESVEKFLN 191



>gi|488052146|ref|WP_002123543.1| glutamine amidotransferase [Bacillus cereus]
 gi|401138318|gb|EJQ45889.1| glutamine amidotransferase subunit pdxT [Bacillus cereus BAG6X1-2]
          Length = 196

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 124/206 (60%), Gaps = 20/206 (9%)

Query: 16  KFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSG 75
           K GVL LQGA +EH+  ++  +  + A+ +++ EQLE ID LI+PGGESTTM  + ++  
Sbjct: 3   KIGVLGLQGAVREHVKSVE--ASGAEAVVVKRIEQLEEIDGLILPGGESTTMRRLIDKYA 60

Query: 76  LMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDL-IGGLNITVNRNQFGSQIDSF 134
            MEPLR F +  KP +GTCAGMILLA    K   G ++  IG ++ITV RN FG Q DSF
Sbjct: 61  FMEPLRTFAKSGKPMFGTCAGMILLA----KTLIGYEEAHIGAMDITVERNAFGRQKDSF 116

Query: 135 ESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGS 194
           E+ L +  +       F  +FIRAP         VEVL+        T    +VAVRQG 
Sbjct: 117 EAALSMKGVGED----FVGVFIRAP-YVVNVADDVEVLS--------THGDRMVAVRQGQ 163

Query: 195 LLGTAFHPELTNDDRIHKYFVQLTQD 220
            L  +FHPELT+D R+  YFV++ ++
Sbjct: 164 FLAASFHPELTDDHRVTAYFVEMVKE 189



>gi|490114359|ref|WP_004014976.1| glutamine amidotransferase [Mobiluncus mulieris]
 gi|269934595|gb|EEZ91156.1| pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2
           [Mobiluncus mulieris 28-1]
 gi|307613758|gb|EFN93002.1| pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2
           [Mobiluncus mulieris FB024-16]
          Length = 206

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 131/212 (61%), Gaps = 16/212 (7%)

Query: 14  QFKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAER 73
           +F+ GVL LQG+  EHI  L  +   ++ + ++ ++ LE +D LIIPGGESTTM  +A  
Sbjct: 5   KFRVGVLGLQGSVIEHIQALHELG--ATPVEVKLSKHLEDLDGLIIPGGESTTMYKLAHA 62

Query: 74  SGLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKG--GQDLIGGLNITVNRNQFGSQI 131
             + E L+ FV   +  +G+CAGMI+LA+    +  G  GQ+ +GGL++TV RN FG Q+
Sbjct: 63  FDVFEALKTFVHSGRAVYGSCAGMIMLADH---ILDGIEGQETLGGLDVTVRRNAFGRQV 119

Query: 132 DSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASS--IVA 189
           DS  S  H+N      D   PA+FIRAP         V+VLA  +    +T  SS   VA
Sbjct: 120 DSAAS--HVNPGEFGGDTPLPAVFIRAP-WVESVGSKVQVLATWQ----QTPESSPRAVA 172

Query: 190 VRQGSLLGTAFHPELTNDDRIHKYFVQLTQDH 221
           VRQGSLL T+FHPE+T+D R+H+YF+ +  D+
Sbjct: 173 VRQGSLLATSFHPEVTSDRRVHRYFLDMVADY 204



>gi|271967395|ref|YP_003341591.1| SNO glutamine amidotransferase [Streptosporangium roseum DSM 43021]
 gi|502656396|ref|WP_012892583.1| glutamine amidotransferase [Streptosporangium roseum]
 gi|270510570|gb|ACZ88848.1| SNO glutamine amidotransferase family [Streptosporangium roseum DSM
           43021]
          Length = 196

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 126/206 (61%), Gaps = 19/206 (9%)

Query: 17  FGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGL 76
            GV ALQG  +EH   L+     + A+ +R+  +LE +DAL+IPGGESTTM  +AE   L
Sbjct: 7   IGVFALQGDVREHARSLETAG--AKAVAVRRPGELEAVDALVIPGGESTTMWKLAETFDL 64

Query: 77  MEPLRKFVRDEKPTWGTCAGMILLANEANKVKKG--GQDLIGGLNITVNRNQFGSQIDSF 134
           +EPLR  +++  P +G+CAGMI+L   A++++ G  GQ  IGG+++ V RN FG Q+DSF
Sbjct: 65  LEPLRLRIKNGMPAYGSCAGMIML---ADRIEGGIEGQQTIGGIDMVVRRNAFGRQVDSF 121

Query: 135 ESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGS 194
           E+      +  +      A+FIRAP         VEVLAR E          IVAVRQG 
Sbjct: 122 EA-----DVDFAGRGPLRAVFIRAP-WVESVGSDVEVLARAEA------GDRIVAVRQGP 169

Query: 195 LLGTAFHPELTNDDRIHKYFVQLTQD 220
           LL T+FHPELT D  +H YFV++ ++
Sbjct: 170 LLATSFHPELTGDVGVHSYFVEMVRE 195



>gi|494085018|ref|WP_007027055.1| glutamine amidotransferase [Saccharomonospora paurometabolica]
 gi|353218583|gb|EHB83313.1| Glutamine amidotransferase subunit pdxT [Saccharomonospora
           paurometabolica YIM 90007]
          Length = 212

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 90/208 (43%), Positives = 128/208 (61%), Gaps = 10/208 (4%)

Query: 11  VQPQFKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALI 70
           +Q + + GVLA+QG   EH  ML      + A P+R+  +L  +D L++PGGESTTM+ +
Sbjct: 1   MQRRPEVGVLAVQGDVAEHAAMLDRAG--ARARPVRRVAELADVDGLVLPGGESTTMSRL 58

Query: 71  AERSGLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQ 130
               GL++PLR+ +RD  P +G+CAG++LLA       +  Q  + GL++ V RN FG Q
Sbjct: 59  LASFGLLDPLRERIRDGLPVYGSCAGLVLLARRVYD-GRPDQHQLDGLDVVVRRNAFGRQ 117

Query: 131 IDSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASS--IV 188
           +DSFE+ L +  +    D    A+FIRAP         VEVLAR+  D  E  A++  IV
Sbjct: 118 VDSFETDLEVRGV---DDGPVHAVFIRAP-WVEKAGADVEVLARIP-DTAEAGAAADRIV 172

Query: 189 AVRQGSLLGTAFHPELTNDDRIHKYFVQ 216
           AVRQG +  TAFHPELT D+R+H+ FV+
Sbjct: 173 AVRQGRVFATAFHPELTGDERLHRLFVR 200



>gi|446160922|ref|WP_000238777.1| glutamine amidotransferase [Bacillus cereus]
 gi|401238571|gb|EJR45009.1| glutamine amidotransferase subunit pdxT [Bacillus cereus VD102]
          Length = 196

 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 92/211 (43%), Positives = 124/211 (58%), Gaps = 30/211 (14%)

Query: 16  KFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSG 75
           K GVL LQGA +EH+  ++  +  + A+ +++ EQLE ID LI+PGGESTTM  + ++  
Sbjct: 3   KIGVLGLQGAVREHVKSVE--ASGAEAVVVKRIEQLEDIDGLILPGGESTTMRRLIDKYA 60

Query: 76  LMEPLRKFVRDEKPTWGTCAGMILLA------NEANKVKKGGQDLIGGLNITVNRNQFGS 129
            MEPLR F +  KP +GTCAGMILLA      +EA+         IG ++ITV RN FG 
Sbjct: 61  FMEPLRTFAKSGKPMFGTCAGMILLAKTLIGYDEAH---------IGAMDITVERNAFGR 111

Query: 130 QIDSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVA 189
           Q DSFE+ L I  +       F  +FIRAP         VEVL+        T    +VA
Sbjct: 112 QKDSFEAALSIKGVGED----FVGVFIRAP-YVVNVADDVEVLS--------THGDRMVA 158

Query: 190 VRQGSLLGTAFHPELTNDDRIHKYFVQLTQD 220
           VRQG  L  +FHPELT+D R+  YFV++ ++
Sbjct: 159 VRQGPFLAASFHPELTDDHRVTAYFVEMVKE 189



>gi|42779093|ref|NP_976340.1| glutamine amidotransferase, SNO family [Bacillus cereus ATCC 10987]
 gi|217957592|ref|YP_002336134.1| glutamine amidotransferase subunit PdxT [Bacillus cereus AH187]
 gi|222093785|ref|YP_002527833.1| glutamine amidotransferase subunit pdxt [Bacillus cereus Q1]
 gi|375282112|ref|YP_005102545.1| glutamine amidotransferase, SNO family [Bacillus cereus NC7401]
 gi|384177921|ref|YP_005563683.1| glutamine amidotransferase subunit PdxT [Bacillus thuringiensis
           serovar finitimus YBT-020]
 gi|402554397|ref|YP_006595668.1| glutamine amidotransferase subunit PdxT [Bacillus cereus FRI-35]
 gi|446160926|ref|WP_000238781.1| glutamine amidotransferase [Bacillus cereus]
 gi|68565761|sp|Q73FJ4.1|PDXT_BACC1 RecName: Full=Glutamine amidotransferase subunit PdxT; AltName:
           Full=Glutamine amidotransferase glutaminase subunit PdxT
 gi|254781640|sp|B7HPS7.1|PDXT_BACC7 RecName: Full=Glutamine amidotransferase subunit PdxT; AltName:
           Full=Glutamine amidotransferase glutaminase subunit PdxT
 gi|254781641|sp|B9IYH9.1|PDXT_BACCQ RecName: Full=Glutamine amidotransferase subunit PdxT; AltName:
           Full=Glutamine amidotransferase glutaminase subunit PdxT
 gi|42735008|gb|AAS38948.1| glutamine amidotransferase, SNO family [Bacillus cereus ATCC 10987]
 gi|206743438|gb|EDZ54871.1| glutamine amidotransferase, SNO family [Bacillus cereus H3081.97]
 gi|217068118|gb|ACJ82368.1| pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2 [Bacillus
           cereus AH187]
 gi|221237831|gb|ACM10541.1| GMP synthase, glutamine-hydrolyzing (glutamine amidotransferase)
           [Bacillus cereus Q1]
 gi|324324005|gb|ADY19265.1| glutamine amidotransferase subunit PdxT [Bacillus thuringiensis
           serovar finitimus YBT-020]
 gi|358350633|dbj|BAL15805.1| glutamine amidotransferase, SNO family [Bacillus cereus NC7401]
 gi|401073705|gb|EJP82119.1| glutamine amidotransferase subunit pdxT [Bacillus cereus IS075]
 gi|401093305|gb|EJQ01414.1| glutamine amidotransferase subunit pdxT [Bacillus cereus AND1407]
 gi|401195954|gb|EJR02903.1| glutamine amidotransferase subunit pdxT [Bacillus cereus MSX-A12]
 gi|401795607|gb|AFQ09466.1| glutamine amidotransferase subunit PdxT [Bacillus cereus FRI-35]
 gi|500375268|gb|EOO91829.1| glutamine amidotransferase subunit pdxT [Bacillus cereus IS845/00]
 gi|500381587|gb|EOO97914.1| glutamine amidotransferase subunit pdxT [Bacillus cereus IS195]
          Length = 196

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 92/211 (43%), Positives = 124/211 (58%), Gaps = 30/211 (14%)

Query: 16  KFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSG 75
           K GVL LQGA +EH+  ++  +  + A+ +++ EQLE ID LI+PGGESTTM  + ++  
Sbjct: 3   KIGVLGLQGAVREHVKSVE--ASGAEAVVVKRIEQLEEIDGLILPGGESTTMRRLIDKYA 60

Query: 76  LMEPLRKFVRDEKPTWGTCAGMILLA------NEANKVKKGGQDLIGGLNITVNRNQFGS 129
            MEPLR F +  KP +GTCAGMILLA      +EA+         IG ++ITV RN FG 
Sbjct: 61  FMEPLRTFAKSGKPMFGTCAGMILLAKTLIGYDEAH---------IGAMDITVERNAFGR 111

Query: 130 QIDSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVA 189
           Q DSFE+ L I  +       F  +FIRAP         VEVL+        T    +VA
Sbjct: 112 QKDSFEAALSIKGVGED----FVGVFIRAP-YVVNVADNVEVLS--------THGDRMVA 158

Query: 190 VRQGSLLGTAFHPELTNDDRIHKYFVQLTQD 220
           VRQG  L  +FHPELT+D R+  YFV++ ++
Sbjct: 159 VRQGPFLAASFHPELTDDHRVTAYFVEMVKE 189



>gi|219849800|ref|YP_002464233.1| SNO glutamine amidotransferase [Chloroflexus aggregans DSM 9485]
 gi|506421934|ref|WP_015941653.1| glutamine amidotransferase [Chloroflexus aggregans]
 gi|254781644|sp|B8G664.1|PDXT_CHLAD RecName: Full=Glutamine amidotransferase subunit PdxT; AltName:
           Full=Glutamine amidotransferase glutaminase subunit PdxT
 gi|219544059|gb|ACL25797.1| SNO glutamine amidotransferase [Chloroflexus aggregans DSM 9485]
          Length = 190

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 88/203 (43%), Positives = 122/203 (60%), Gaps = 13/203 (6%)

Query: 15  FKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERS 74
              GVLALQG F+EH  +L+ I      I +R   QL  +D LIIPGGESTT+  +    
Sbjct: 1   MTVGVLALQGDFREHCAVLRRIG--VEPIEVRLPHQLAQVDHLIIPGGESTTIGRLLAIY 58

Query: 75  GLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSF 134
            ++EP+R     +   WGTCAG ILLANE    K+GGQ  +G +N+T+ RN +GSQ+DSF
Sbjct: 59  QMLEPIRTRGGCDLAIWGTCAGAILLANEVMDQKQGGQPTLGLMNLTIRRNAYGSQLDSF 118

Query: 135 ESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGS 194
           E+ + +  I    ++  P +FIRAP         +  L +    +G  +  S+VA RQG 
Sbjct: 119 EAPITMPII---GEEPLPGVFIRAP--------QIMALGQGCEAVGWLEDGSVVAARQGR 167

Query: 195 LLGTAFHPELTNDDRIHKYFVQL 217
           LL T FHPELT+DDR+H+ F++L
Sbjct: 168 LLATTFHPELTHDDRVHRLFLEL 190



>gi|487946685|ref|WP_002020151.1| glutamine amidotransferase [Bacillus cereus]
 gi|228629664|gb|EEK86359.1| Glutamine amidotransferase subunit pdxT [Bacillus cereus ATCC 4342]
          Length = 202

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 92/211 (43%), Positives = 124/211 (58%), Gaps = 30/211 (14%)

Query: 16  KFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSG 75
           K GVL LQGA +EH+  ++  +  + A+ +++ EQLE ID LI+PGGESTTM  + ++  
Sbjct: 9   KIGVLGLQGAVREHVKSVE--ASGAEAVIVKRIEQLEEIDGLILPGGESTTMRRLIDKYA 66

Query: 76  LMEPLRKFVRDEKPTWGTCAGMILLA------NEANKVKKGGQDLIGGLNITVNRNQFGS 129
            MEPLR F +  KP +GTCAGMILLA      +EA+         IG ++ITV RN FG 
Sbjct: 67  FMEPLRTFAKSGKPMFGTCAGMILLAKTLIGYDEAH---------IGAMDITVERNAFGR 117

Query: 130 QIDSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVA 189
           Q DSFE+ L I  +       F  +FIRAP         VEVL+        T    +VA
Sbjct: 118 QKDSFEAALSIKGVGED----FVGVFIRAP-YVVNVADDVEVLS--------THGDRMVA 164

Query: 190 VRQGSLLGTAFHPELTNDDRIHKYFVQLTQD 220
           VRQG  L  +FHPELT+D R+  YFV++ ++
Sbjct: 165 VRQGPFLAASFHPELTDDHRVTAYFVEMVKE 195



>gi|470319633|gb|EMR11243.1| hypothetical protein PNEG_00274 [Pneumocystis murina B123]
          Length = 218

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 87/209 (41%), Positives = 131/209 (62%), Gaps = 9/209 (4%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQGAF EH  +L++   V++++ +R    L ++  LIIPGGESTT+  +    GL 
Sbjct: 12  GVLALQGAFYEHYKLLKSFCFVNASL-VRNVADLSSLHGLIIPGGESTTIGYLLSIDGLG 70

Query: 78  EPLRKFVRDEKPT-WGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFES 136
           E ++  V+++  + WGTCAGMILLA +   +KKGGQ ++G L+I + RN FG QI+SF S
Sbjct: 71  EEIKARVKNKSLSIWGTCAGMILLAKKVEGMKKGGQYILGCLDIVIKRNYFGRQINSFSS 130

Query: 137 LLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLE---HDIGETDASSIVAVRQG 193
           +L    I       F A+FIRAP         V VLA +     D    ++ +IVAV+Q 
Sbjct: 131 ILSSKVIKKE----FLAVFIRAPVVLSIISPNVSVLATINKAGEDNKILESGAIVAVQQD 186

Query: 194 SLLGTAFHPELTNDDRIHKYFVQLTQDHY 222
           ++L T+FHPEL+ND++ H++++   ++ Y
Sbjct: 187 NILATSFHPELSNDNQWHEWWLNNLKERY 215



>gi|488119978|ref|WP_002191375.1| glutamine amidotransferase [Bacillus cereus]
 gi|401294170|gb|EJR99800.1| glutamine amidotransferase subunit pdxT [Bacillus cereus VDM034]
 gi|401311393|gb|EJS16697.1| glutamine amidotransferase subunit pdxT [Bacillus cereus VDM062]
          Length = 196

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 124/206 (60%), Gaps = 20/206 (9%)

Query: 16  KFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSG 75
           K GVL LQGA +EH+  ++  +  + A+ +++ EQLE ID LI+PGGESTTM  + ++  
Sbjct: 3   KIGVLGLQGAVREHVKSVE--ASGAEAVVVKRIEQLEEIDGLILPGGESTTMRRLIDKYA 60

Query: 76  LMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDL-IGGLNITVNRNQFGSQIDSF 134
            MEPLR F +  KP +GTCAGMILLA    K+  G ++  IG ++ITV RN FG Q DSF
Sbjct: 61  FMEPLRTFAKSGKPMFGTCAGMILLA----KILIGYEEAHIGAMDITVERNAFGRQKDSF 116

Query: 135 ESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGS 194
           E+ L I  +       F  +FIRAP         VEVL+             +VAVRQG 
Sbjct: 117 EAALSIKGVGED----FVGVFIRAP-YVVNVADDVEVLS--------MHGERMVAVRQGP 163

Query: 195 LLGTAFHPELTNDDRIHKYFVQLTQD 220
            L  +FHPELT+D R+  YFV++ ++
Sbjct: 164 FLAASFHPELTDDHRVTAYFVEMVKE 189



>gi|358060162|dbj|GAA94221.1| hypothetical protein E5Q_00870 [Mixia osmundae IAM 14324]
          Length = 269

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 106/254 (41%), Positives = 137/254 (53%), Gaps = 59/254 (23%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIP--------IRKAEQLETIDALIIPGGESTTMAL 69
           GVLALQGAF EH   LQ++S V++A P        IR  EQL     LI+PGGESTTM+L
Sbjct: 11  GVLALQGAFAEH---LQHLSLVAAAHPELGVEPRLIRTTEQLSACHGLILPGGESTTMSL 67

Query: 70  IAERSGLMEPLRKFVRD------EKPTWGTCAGMILLANEA--NKVKKGGQDLIGGLNIT 121
           IA+R G++EPLR+F R       +K  WGTCAGMILL++       K+GGQ  + GL I+
Sbjct: 68  IADRMGMLEPLRRFARSCKGPDAQKAIWGTCAGMILLSDHVVQASTKEGGQQGLTGLAIS 127

Query: 122 VNRNQFGSQIDSFESLLHINHITTSSDDLFPAIFIRAPXX------------XXXXXXXV 169
           + RNQ+G Q +SFE  L I  I T  +  FP IFIRAP                     V
Sbjct: 128 IVRNQWGRQTESFEYPLTIAGI-TQPELPFPGIFIRAPVVHTLLAPKSDSQHLATGSDSV 186

Query: 170 EVLARLEHDI----GETDAS-----------------------SIVAVRQGSLLGTAFHP 202
            VL+ +E  +      T +S                       ++VA+RQ  +L TAFHP
Sbjct: 187 HVLSEIEWSLLPQPRRTQSSKAHQPDDNSRTGDSRLLPLGPDANVVALRQERILATAFHP 246

Query: 203 ELTNDDRIHKYFVQ 216
           ELT D R+H+YFV+
Sbjct: 247 ELTRDSRLHEYFVR 260



>gi|495001375|ref|WP_007727389.1| glutamine amidotransferase [Brevibacillus sp. BC25]
 gi|398029144|gb|EJL22631.1| pyridoxal 5''-phosphate synthase, glutaminase subunit Pdx2
           [Brevibacillus sp. BC25]
          Length = 191

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 87/209 (41%), Positives = 125/209 (59%), Gaps = 22/209 (10%)

Query: 15  FKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERS 74
            K GVLALQGA  EH+ ML+ +   ++A+P++K E+L+ +D L+IPGGESTT++ +  + 
Sbjct: 1   MKIGVLALQGAVAEHVRMLEEVG--ATAVPVKKVEELDDLDGLVIPGGESTTISKLMHKY 58

Query: 75  GLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQD--LIGGLNITVNRNQFGSQID 132
           G ME +++F +  KP +GTCAG ILLA         GQD   +G + I V RN FG Q +
Sbjct: 59  GFMEAVQEFGKVNKPIFGTCAGAILLAKRIQ-----GQDDCHLGLMEIKVERNAFGRQKE 113

Query: 133 SFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQ 192
           SFE+L+ +  +       +PA+FIRAP          +VLA+ E          IV  R 
Sbjct: 114 SFEALMPVAGVAAD----YPAVFIRAPYIMEVGENG-QVLAKHE--------DKIVVARS 160

Query: 193 GSLLGTAFHPELTNDDRIHKYFVQLTQDH 221
           G  L  AFHPELT D R+HKYF+ + +++
Sbjct: 161 GHYLAAAFHPELTEDTRLHKYFLDMVKEY 189



>gi|496446162|ref|WP_009155007.1| glutamine amidotransferase [Saccharomonospora marina]
 gi|374656792|gb|EHR51625.1| pyridoxal 5'-phosphate synthase, glutaminase subunit Pdx2
           [Saccharomonospora marina XMU15]
          Length = 209

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 94/209 (44%), Positives = 131/209 (62%), Gaps = 10/209 (4%)

Query: 12  QPQFKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIA 71
           Q Q   GVLALQG  +EH+ ML      +S   +R+  +L  +DA+++PGGESTTM+ + 
Sbjct: 3   QRQPVIGVLALQGDVREHLAMLDRAG--ASPCQVRRPTELSQVDAMVLPGGESTTMSRLL 60

Query: 72  ERSGLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQI 131
           E   L++PLRK + +  P +G+CAGMILLA +     +  Q  + GL+I V RN FG Q+
Sbjct: 61  EVFELLDPLRKRIAEGMPVFGSCAGMILLARQVLD-GRPDQHQLDGLDIVVRRNAFGRQV 119

Query: 132 DSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASS--IVA 189
           DSFE+ L +  I    D    A+FIRAP         VEVLA++  D  +T A++  IVA
Sbjct: 120 DSFETDLDVREI---EDGPVHAVFIRAP-WVEKAGASVEVLAKVP-DTPKTRAAADRIVA 174

Query: 190 VRQGSLLGTAFHPELTNDDRIHKYFVQLT 218
           VRQG +L TAFHPELT D+R+H+ FV++ 
Sbjct: 175 VRQGPVLATAFHPELTGDERVHRLFVRMV 203



>gi|446160921|ref|WP_000238776.1| glutamine amidotransferase [Bacillus cereus]
 gi|228739669|gb|EEL90077.1| Glutamine amidotransferase subunit pdxT [Bacillus cereus AH1272]
 gi|228745875|gb|EEL95873.1| Glutamine amidotransferase subunit pdxT [Bacillus cereus AH1273]
 gi|401110138|gb|EJQ18051.1| glutamine amidotransferase subunit pdxT [Bacillus cereus BAG3X2-1]
 gi|401643632|gb|EJS61327.1| glutamine amidotransferase subunit pdxT [Bacillus cereus BAG1X1-3]
 gi|500364780|gb|EOO81604.1| glutamine amidotransferase subunit pdxT [Bacillus cereus BAG1O-1]
 gi|500433640|gb|EOP47573.1| glutamine amidotransferase subunit pdxT [Bacillus cereus VDM053]
          Length = 196

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 90/205 (43%), Positives = 122/205 (59%), Gaps = 18/205 (8%)

Query: 16  KFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSG 75
           K GVL LQGA +EH+  ++  +  + A+ I++ EQLE ID LI+PGGESTTM  + ++  
Sbjct: 3   KIGVLGLQGAVREHVKSVE--ASGAEAVVIKRIEQLEEIDGLILPGGESTTMRRLIDKYA 60

Query: 76  LMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFE 135
            MEPLR F +  KP +GTCAGMILLA      +   +  IG ++ITV RN FG Q DSFE
Sbjct: 61  FMEPLRTFAKSGKPMFGTCAGMILLAKTLIGYE---ESHIGAMDITVERNAFGRQKDSFE 117

Query: 136 SLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGSL 195
           + L +  +       F  +FIRAP         VEVL+        T    +VAVRQG  
Sbjct: 118 AALSMKGVGED----FIGVFIRAP-YVVNVADDVEVLS--------THGDRMVAVRQGPF 164

Query: 196 LGTAFHPELTNDDRIHKYFVQLTQD 220
           L  +FHPELT+D R+  YFV++ ++
Sbjct: 165 LAASFHPELTDDHRVTAYFVEMVKE 189



>gi|446160920|ref|WP_000238775.1| glutamine amidotransferase subunit T [Bacillus cereus]
          Length = 196

 Score =  161 bits (407), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 92/211 (43%), Positives = 124/211 (58%), Gaps = 30/211 (14%)

Query: 16  KFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSG 75
           K GVL LQGA +EH+  ++  +  + A+ +++ EQLE ID LI+PGGESTTM  + ++  
Sbjct: 3   KIGVLGLQGAVREHVKSVE--ASGAEAVIVKRIEQLEEIDGLILPGGESTTMRRLIDKYA 60

Query: 76  LMEPLRKFVRDEKPTWGTCAGMILLA------NEANKVKKGGQDLIGGLNITVNRNQFGS 129
            MEPLR F +  KP +GTCAGMILLA      +EA+         IG ++ITV RN FG 
Sbjct: 61  FMEPLRTFAKSGKPMFGTCAGMILLAKTLIGYDEAH---------IGAMDITVERNAFGR 111

Query: 130 QIDSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVA 189
           Q DSFE+ L I  +       F  +FIRAP         VEVL+        T    +VA
Sbjct: 112 QKDSFEAALSIKGVGED----FVGVFIRAP-YVVNVADDVEVLS--------THGDRMVA 158

Query: 190 VRQGSLLGTAFHPELTNDDRIHKYFVQLTQD 220
           VRQG  L  +FHPELT+D R+  YFV++ ++
Sbjct: 159 VRQGPFLAASFHPELTDDHRVTAYFVEMVKE 189



>gi|256391545|ref|YP_003113109.1| SNO glutamine amidotransferase [Catenulispora acidiphila DSM 44928]
 gi|502439647|ref|WP_012786561.1| glutamine amidotransferase [Catenulispora acidiphila]
 gi|256357771|gb|ACU71268.1| SNO glutamine amidotransferase [Catenulispora acidiphila DSM 44928]
          Length = 204

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 94/202 (46%), Positives = 121/202 (59%), Gaps = 16/202 (7%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQG F+EH+  L  I   S+ +  R+   L+ +DALI+PGGEST M  +A  + + 
Sbjct: 10  GVLALQGDFREHVAALNAIGARSALV--RRPNDLDAVDALIVPGGESTAMWKLATTAEMF 67

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
           EP+RK + D  P +GTCAGMI+LA+        GQ+  GGL ITV RN FG Q +SFE  
Sbjct: 68  EPVRKRIADGMPAFGTCAGMIMLADRITDAAA-GQETFGGLPITVRRNAFGRQTESFEEP 126

Query: 138 LHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHD--IGETDASSIVAVRQGSL 195
           +  + I          +FIRAP         VEVLAR+     IG      IVAVRQG+L
Sbjct: 127 ISFDGIGE-----LTGVFIRAP-WVEDVDGGVEVLARVTSGPAIGR-----IVAVRQGNL 175

Query: 196 LGTAFHPELTNDDRIHKYFVQL 217
           L T+FHPELT D R+H+YFV +
Sbjct: 176 LATSFHPELTADRRVHEYFVAM 197



>gi|52145198|ref|YP_081630.1| glutamine amidotransferase subunit PdxT [Bacillus cereus E33L]
 gi|446160945|ref|WP_000238800.1| glutamine amidotransferase [Bacillus cereus]
 gi|68565712|sp|Q63HF7.1|PDXT_BACCZ RecName: Full=Glutamine amidotransferase subunit PdxT; AltName:
           Full=Glutamine amidotransferase glutaminase subunit PdxT
 gi|51978667|gb|AAU20217.1| GMP synthase, glutamine-hydrolyzing (glutamine amidotransferase)
           [Bacillus cereus E33L]
          Length = 196

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 92/211 (43%), Positives = 124/211 (58%), Gaps = 30/211 (14%)

Query: 16  KFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSG 75
           K GVL LQGA +EH+  ++  +  + A+ +++ EQLE ID LI+PGGESTTM  + ++  
Sbjct: 3   KIGVLGLQGAVREHVKSVE--ASGAEAVVVKRIEQLEEIDGLILPGGESTTMRRLIDKYD 60

Query: 76  LMEPLRKFVRDEKPTWGTCAGMILLA------NEANKVKKGGQDLIGGLNITVNRNQFGS 129
            MEPLR F +  KP +GTCAGMILLA      +EA+         IG ++ITV RN FG 
Sbjct: 61  FMEPLRTFAKSGKPMFGTCAGMILLAKTLIGYDEAH---------IGAMDITVERNAFGR 111

Query: 130 QIDSFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVA 189
           Q DSFE+ L I  +       F  +FIRAP         VEVL+        T    +VA
Sbjct: 112 QKDSFEAALSIKGVGED----FVGVFIRAP-YVVNVADDVEVLS--------THGDRMVA 158

Query: 190 VRQGSLLGTAFHPELTNDDRIHKYFVQLTQD 220
           VRQG  L  +FHPELT+D R+  YFV++ ++
Sbjct: 159 VRQGPFLAASFHPELTDDHRVTAYFVEMVKE 189



>gi|212637861|ref|YP_002314381.1| glutamine amidotransferase subunit PdxT [Anoxybacillus flavithermus
           WK1]
 gi|501569354|ref|WP_012573786.1| glutamine amidotransferase [Anoxybacillus flavithermus]
 gi|259530443|sp|B7GFL9.1|PDXT_ANOFW RecName: Full=Glutamine amidotransferase subunit PdxT; AltName:
           Full=Glutamine amidotransferase glutaminase subunit PdxT
 gi|212559341|gb|ACJ32396.1| Pyridoxine biosynthesis enzyme PDX1/PDX2, glutaminase subunit
           [Anoxybacillus flavithermus WK1]
          Length = 192

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 127/205 (61%), Gaps = 18/205 (8%)

Query: 16  KFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSG 75
           K GVL LQGA +EH+  ++     + A+ I+K EQL  ID LIIPGGESTTM  + ++ G
Sbjct: 3   KIGVLGLQGAVREHVRSIEACG--AEAVVIKKVEQLTQIDGLIIPGGESTTMRRLMDKYG 60

Query: 76  LMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFE 135
            +EPL++F R+ KP +GTCAG+I+L   A K+    +  +G ++ITV RN FG Q +SFE
Sbjct: 61  FIEPLKQFAREGKPMFGTCAGLIIL---AKKIVGYDEPHLGLMDITVERNSFGRQRESFE 117

Query: 136 SLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGSL 195
           + L I  +   +DD F  +FIRAP         V+VLA  E          IVA RQG  
Sbjct: 118 ASLAIKGV---ADD-FIGVFIRAP-HIVSVGADVDVLATYE--------DRIVAARQGQF 164

Query: 196 LGTAFHPELTNDDRIHKYFVQLTQD 220
           LG +FHPELT+D R+ +YF+ + ++
Sbjct: 165 LGCSFHPELTDDHRMTQYFINMVKE 189



>gi|495051367|ref|WP_007776203.1| glutamine amidotransferase [Brevibacillus sp. CF112]
 gi|398055784|gb|EJL47834.1| pyridoxal 5''-phosphate synthase, glutaminase subunit Pdx2
           [Brevibacillus sp. CF112]
          Length = 191

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 87/209 (41%), Positives = 125/209 (59%), Gaps = 22/209 (10%)

Query: 15  FKFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERS 74
            K GVLALQGA  EH+ ML+     ++A+P++K E+L+ +D L++PGGESTT++ +  + 
Sbjct: 1   MKIGVLALQGAVAEHLRMLEEAG--ATAVPVKKMEELDELDGLVLPGGESTTISKLMHKY 58

Query: 75  GLMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQD--LIGGLNITVNRNQFGSQID 132
           G ME L++F +  KP +GTCAG ILLA +       GQD   +G ++I V RN FG Q +
Sbjct: 59  GFMEALQEFGKAGKPIFGTCAGAILLAKQIE-----GQDDCHLGLMDIKVERNAFGRQKE 113

Query: 133 SFESLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQ 192
           SFE  + +  +       +PA+FIRAP          EVLA+ E          IV  R+
Sbjct: 114 SFEVTMPVAGVGAD----YPAVFIRAP-YIMEVGENAEVLAKYE--------EKIVVARE 160

Query: 193 GSLLGTAFHPELTNDDRIHKYFVQLTQDH 221
           G  L  AFHPELT D R+HKYF+ + +++
Sbjct: 161 GHYLAAAFHPELTEDARLHKYFLDMVKEY 189



>gi|116491066|ref|YP_810610.1| glutamine amidotransferase [Oenococcus oeni PSU-1]
 gi|488905354|ref|WP_002816429.1| glutamine amidotransferase [Oenococcus oeni]
 gi|122276752|sp|Q04F27.1|PDXT_OENOB RecName: Full=Glutamine amidotransferase subunit PdxT; AltName:
           Full=Glutamine amidotransferase glutaminase subunit PdxT
 gi|116091791|gb|ABJ56945.1| pyridoxal phosphate synthase yaaE subunit [Oenococcus oeni PSU-1]
 gi|118433293|gb|EAV40003.1| amidotransferase [Oenococcus oeni ATCC BAA-1163]
 gi|399964275|gb|EJN98929.1| glutamine amidotransferase [Oenococcus oeni AWRIB419]
 gi|399971829|gb|EJO06068.1| glutamine amidotransferase [Oenococcus oeni AWRIB553]
 gi|399972817|gb|EJO07016.1| glutamine amidotransferase [Oenococcus oeni AWRIB422]
 gi|399973511|gb|EJO07676.1| glutamine amidotransferase [Oenococcus oeni AWRIB548]
 gi|410496501|gb|EKP87984.1| glutamine amidotransferase [Oenococcus oeni DSM 20252 = AWRIB129]
          Length = 191

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 127/206 (61%), Gaps = 19/206 (9%)

Query: 16  KFGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSG 75
           K GVLALQGA  EHI  L++    +  I ++ A QLE +D L++PGGESTTM  + ++ G
Sbjct: 4   KIGVLALQGAVSEHIKALKDSG--AETIAVKDASQLEELDGLVLPGGESTTMRRLMDKYG 61

Query: 76  LMEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFE 135
           L + ++ F + +K  +GTCAG+IL+A E    +KG    +G L+I V RN FGSQ+DSFE
Sbjct: 62  LFDAIKIFAK-KKAIFGTCAGLILMAKEIEG-RKGPH--LGLLDIDVKRNAFGSQVDSFE 117

Query: 136 SLLHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGSL 195
           S L I+H+  S    F  +FIRAP         VE+L+        T    IVA RQG  
Sbjct: 118 SDLKIDHVAES----FDGVFIRAPYIKKVGPG-VEILS--------TYNQHIVACRQGRF 164

Query: 196 LGTAFHPELTNDDRIHKYFVQLTQDH 221
           L  AFHPELT D R H+YFV++T+++
Sbjct: 165 LACAFHPELTGDTRFHEYFVKITKEN 190



>gi|496370335|ref|WP_009079325.1| glutamine amidotransferase [Streptomyces sp. AA4]
 gi|302436751|gb|EFL08567.1| glutamine amidotransferase subunit PdxT [Streptomyces sp. AA4]
          Length = 211

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 90/205 (43%), Positives = 128/205 (62%), Gaps = 10/205 (4%)

Query: 18  GVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGLM 77
           GVLALQGA +EH+ ML++    + A+P+R+  +L  +D L++PGGESTTM+ + E   L+
Sbjct: 12  GVLALQGAVREHVAMLESAG--ARAVPVRRPSELSEVDGLVLPGGESTTMSRLLETFELL 69

Query: 78  EPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFESL 137
           EPLR+ +    P +G+CAGMILLA +    +   Q L GGL++ V RN FG Q+DSFE+ 
Sbjct: 70  EPLRERIAGGLPAFGSCAGMILLARQVLDGRPDQQQL-GGLDVVVRRNAFGRQVDSFEAD 128

Query: 138 LHINHITTSSDDLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETD---ASSIVAVRQGS 194
           L    +         A+FIRAP         VEVLA +       +   A  IVAVRQG+
Sbjct: 129 LPFAGLPGGP---LHAVFIRAP-WVEKAGDGVEVLATVPDPEDPPEGPRADRIVAVRQGA 184

Query: 195 LLGTAFHPELTNDDRIHKYFVQLTQ 219
           ++ TAFHPE+T D+R+H+ FV+L +
Sbjct: 185 VVATAFHPEITRDERVHRLFVELVR 209



>gi|340794515|ref|YP_004759978.1| amidotransferase involved in pyridoxine biosynthesis
           [Corynebacterium variabile DSM 44702]
 gi|503776060|ref|WP_014010070.1| glutamine amidotransferase [Corynebacterium variabile]
 gi|340534425|gb|AEK36905.1| amidotransferase involved in pyridoxine biosynthesis
           [Corynebacterium variabile DSM 44702]
          Length = 213

 Score =  160 bits (406), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 86/203 (42%), Positives = 126/203 (62%), Gaps = 5/203 (2%)

Query: 17  FGVLALQGAFQEHIHMLQNISQVSSAIPIRKAEQLETIDALIIPGGESTTMALIAERSGL 76
            GVLALQG   EH   L+ +    +A  +R+  QLE +D L++PGGESTTM+ + +  G+
Sbjct: 8   IGVLALQGGVVEHQRTLEKLG--VAARQVRRRSQLEGLDGLVLPGGESTTMSKLLDLGGM 65

Query: 77  MEPLRKFVRDEKPTWGTCAGMILLANEANKVKKGGQDLIGGLNITVNRNQFGSQIDSFES 136
           + PLR  + +  P +GTCAG+ILL +E    +      +GGL+++V RN FG Q+DSFE+
Sbjct: 66  LGPLRGLLAEGMPAFGTCAGLILLGSEILDTRADAH-CLGGLDVSVRRNAFGRQVDSFET 124

Query: 137 LLHINHITTSSD-DLFPAIFIRAPXXXXXXXXXVEVLARLEHDIGETDASSIVAVRQGSL 195
            L I  +T + D D   A+FIRAP         VEVLA ++     +   ++VAVRQ  +
Sbjct: 125 DLQIVGVTDAPDADPVHAVFIRAP-RVERVGEGVEVLATVDDVSAGSSDGAVVAVRQDKV 183

Query: 196 LGTAFHPELTNDDRIHKYFVQLT 218
           LG +FHPELT DDR+H+ F+++ 
Sbjct: 184 LGISFHPELTGDDRMHRLFLEIA 206