BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10190_c0_seq1-m.79 5prime_partial 1-1062(+) 354 (+)
         (353 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|384487375|gb|EIE79555.1| hypothetical protein RO3G_04260 [Rhi...   256   5e-66   Rhizopus delemar RA 99-880
gi|511003932|gb|EPB85316.1| hypothetical protein HMPREF1544_0793...   236   1e-59   Mucor circinelloides f. circinelloides 1006PhL
gi|511003987|gb|EPB85369.1| hypothetical protein HMPREF1544_0782...   187   5e-45   Mucor circinelloides f. circinelloides 1006PhL
gi|489289755|ref|WP_003197306.1| permease [Bacillus mycoides] >g...   140   7e-31   Bacillus
gi|310640794|ref|YP_003945552.1| permease (major facilitator sup...   135   2e-29   
gi|446082201|ref|WP_000160056.1| permease [Bacillus cereus] >gi|...   133   6e-29   Bacillus cereus
gi|488079273|ref|WP_002150670.1| permease [Bacillus cereus] >gi|...   131   3e-28   Bacillus cereus
gi|489165066|ref|WP_003074677.1| permease [Streptococcus interme...   128   2e-27   Streptococcus intermedius
gi|328770913|gb|EGF80954.1| hypothetical protein BATDEDRAFT_2451...   128   3e-27   Batrachochytrium dendrobatidis JAM81
gi|497440594|ref|WP_009754792.1| permease [Streptococcus sp. ora...   125   2e-26   Streptococcus sp. oral taxon 056
gi|392428057|ref|YP_006469068.1| hypothetical protein SCIM_0166 ...   123   7e-26   
gi|495688700|ref|WP_008413279.1| Major facilitator superfamily M...   117   4e-24   Desulfotomaculum hydrothermale
gi|328767947|gb|EGF77995.1| hypothetical protein BATDEDRAFT_3585...   110   8e-22   Batrachochytrium dendrobatidis JAM81
gi|147919579|ref|YP_686681.1| major facilitator superfamily perm...   108   2e-21   
gi|147919137|ref|YP_687130.1| major facilitator superfamily perm...   105   2e-20   
gi|470455584|ref|XP_004340972.1| transporter, major facilitator ...   105   2e-20   Acanthamoeba castellanii str. Neff
gi|495052614|ref|WP_007777450.1| arabinose ABC transporter perme...   102   2e-19   
gi|492404142|ref|WP_005833185.1| hypothetical protein [Brevibaci...   101   3e-19   Brevibacillus agri
gi|282165013|ref|YP_003357398.1| MFS transporter [Methanocella p...   101   3e-19   
gi|333923834|ref|YP_004497414.1| major facilitator superfamily p...   100   5e-19   
gi|19075881|ref|NP_588381.1| membrane transporter (predicted) [S...    99   2e-18   Schizosaccharomyces pombe 972h-
gi|495001768|ref|WP_007727782.1| arabinose ABC transporter perme...    98   4e-18   Brevibacillus sp. BC25
gi|507043617|ref|WP_016114671.1| hypothetical protein [Bacillus ...    97   6e-18   Bacillus cereus
gi|489640952|ref|WP_003545392.1| MFS transporter [Desulfotomacul...    97   8e-18   Desulfotomaculum nigrificans
gi|226311572|ref|YP_002771466.1| hypothetical protein BBR47_1985...    96   2e-17   
gi|511006063|gb|EPB87383.1| hypothetical protein HMPREF1544_0580...    94   7e-17   Mucor circinelloides f. circinelloides 1006PhL
gi|72005253|ref|XP_782213.1| PREDICTED: probable vesicular acety...    93   1e-16   
gi|333980435|ref|YP_004518380.1| major facilitator superfamily p...    93   1e-16   
gi|398398676|ref|XP_003852795.1| hypothetical protein MYCGRDRAFT...    92   2e-16   Zymoseptoria tritici IPO323
gi|491173649|ref|WP_005032015.1| major facilitator superfamily M...    92   3e-16   Holophaga foetida
gi|282164825|ref|YP_003357210.1| MFS transporter [Methanocella p...    91   5e-16   
gi|472587974|gb|EMS25470.1| MFS amine transporter [Rhodosporidiu...    91   6e-16   Rhodotorula toruloides NP11
gi|470482622|ref|XP_004343627.1| permease (Major facilitator sup...    90   8e-16   Acanthamoeba castellanii str. Neff
gi|498957625|ref|XP_004524182.1| PREDICTED: vesicular acetylchol...    90   1e-15   Ceratitis capitata
gi|195078189|ref|XP_001997230.1| GH23496 [Drosophila grimshawi] ...    89   2e-15   Drosophila grimshawi
gi|390177770|ref|XP_003736484.1| GA17179 [Drosophila pseudoobscu...    88   3e-15   Drosophila pseudoobscura pseudoobscura
gi|255955115|ref|XP_002568310.1| Pc21g12830 [Penicillium chrysog...    88   5e-15   Penicillium rubens Wisconsin 54-1255
gi|17137160|ref|NP_477138.1| VAChT [Drosophila melanogaster] >gi...    85   4e-14   Drosophila melanogaster
gi|157126210|ref|XP_001660850.1| vesamicol binding protein, puta...    84   5e-14   Aedes aegypti
gi|493727692|ref|WP_006677036.1| arabinose ABC transporter perme...    84   6e-14   Paenibacillus dendritiformis
gi|195431952|ref|XP_002063991.1| GK15611 [Drosophila willistoni]...    84   6e-14   Drosophila willistoni
gi|195484954|ref|XP_002090891.1| GE13356 [Drosophila yakuba] >gi...    84   6e-14   
gi|194883315|ref|XP_001975748.1| GG22485 [Drosophila erecta] >gi...    84   8e-14   Drosophila erecta
gi|195583086|ref|XP_002081355.1| GD25754 [Drosophila simulans] >...    84   9e-14   
gi|336087839|emb|CCA65517.1| UNC-17 protein [Caenorhabditis eleg...    83   1e-13   Caenorhabditis elegans [roundworm]
gi|350396384|ref|XP_003484536.1| PREDICTED: vesicular acetylchol...    83   1e-13   
gi|2625056|gb|AAB86609.1| vesicular acetylcholine transporter [D...    83   1e-13   Drosophila melanogaster
gi|71999703|ref|NP_001023602.1| Protein UNC-17, isoform a [Caeno...    83   1e-13   Caenorhabditis elegans [roundworm]
gi|443734916|gb|ELU18772.1| hypothetical protein CAPTEDRAFT_1846...    83   1e-13   Capitella teleta
gi|25012572|gb|AAN71386.1| RE38567p [Drosophila melanogaster]          83   1e-13   Drosophila melanogaster
gi|62471713|ref|NP_001014524.1| vesicular monoamine transporter,...    83   1e-13   Drosophila melanogaster
gi|336087847|emb|CCA65521.1| UNC-17 protein [Caenorhabditis eleg...    83   1e-13   Caenorhabditis elegans [roundworm]
gi|336087843|emb|CCA65519.1| UNC-17 protein [Caenorhabditis eleg...    83   1e-13   Caenorhabditis elegans [roundworm]
gi|340729982|ref|XP_003403271.1| PREDICTED: vesicular acetylchol...    83   1e-13   
gi|336087841|emb|CCA65518.1| UNC-17 protein [Caenorhabditis eleg...    83   1e-13   Caenorhabditis elegans [roundworm]
gi|241711519|ref|XP_002413424.1| vesamicol binding protein, puta...    82   2e-13   Ixodes scapularis [blacklegged tick]
gi|62471715|ref|NP_001014525.1| vesicular monoamine transporter,...    82   2e-13   Drosophila melanogaster
gi|242813423|ref|XP_002486165.1| MFS amine transporter, putative...    82   2e-13   Talaromyces stipitatus ATCC 10500
gi|291227901|ref|XP_002733925.1| PREDICTED: vesicular monoamine ...    82   2e-13   
gi|491688945|ref|WP_005545036.1| arabinose ABC transporter perme...    82   2e-13   Paenibacillus alvei
gi|291401063|ref|XP_002716914.1| PREDICTED: solute carrier famil...    82   3e-13   Oryctolagus cuniculus [European rabbit]
gi|170030542|ref|XP_001843147.1| vesamicol binding protein [Cule...    82   3e-13   Culex quinquefasciatus
gi|512908177|ref|XP_004926617.1| PREDICTED: vesicular acetylchol...    81   4e-13   
gi|195399638|ref|XP_002058426.1| GJ14407 [Drosophila virilis] >g...    81   4e-13   Drosophila virilis
gi|393218786|gb|EJD04274.1| MFS general substrate transporter [F...    81   4e-13   Fomitiporia mediterranea MF3/22
gi|347967725|ref|XP_312587.5| AGAP002369-PA [Anopheles gambiae s...    81   4e-13   Anopheles gambiae str. PEST
gi|307198448|gb|EFN79390.1| Chromaffin granule amine transporter...    81   5e-13   Harpegnathos saltator
gi|349986681|dbj|GAA36323.1| MFS transporter DHA1 family solute ...    81   5e-13   Clonorchis sinensis [oriental liver fluke]
gi|341878028|gb|EGT33963.1| hypothetical protein CAEBREN_17466 [...    80   6e-13   Caenorhabditis brenneri
gi|341880478|gb|EGT36413.1| hypothetical protein CAEBREN_22636 [...    80   7e-13   Caenorhabditis brenneri
gi|357624412|gb|EHJ75195.1| hypothetical protein KGM_00157 [Dana...    80   8e-13   Danaus plexippus [American monarch]
gi|291241728|ref|XP_002740762.1| PREDICTED: vesamicol binding pr...    80   8e-13   Saccoglossus kowalevskii
gi|340725698|ref|XP_003401203.1| PREDICTED: synaptic vesicular a...    80   9e-13   Bombus terrestris [large earth bumblebee]
gi|350403795|ref|XP_003486906.1| PREDICTED: synaptic vesicular a...    79   1e-12   Bombus impatiens
gi|512199806|gb|EPE28639.1| MFS general substrate transporter [G...    79   1e-12   Glarea lozoyensis ATCC 20868
gi|391341996|ref|XP_003745310.1| PREDICTED: vesicular acetylchol...    79   2e-12   Metaseiulus occidentalis
gi|307178985|gb|EFN67501.1| Vesicular acetylcholine transporter ...    79   2e-12   Camponotus floridanus
gi|383860874|ref|XP_003705913.1| PREDICTED: synaptic vesicular a...    79   2e-12   
gi|449303163|gb|EMC99171.1| hypothetical protein BAUCODRAFT_3149...    79   2e-12   Baudoinia panamericana UAMH 10762
gi|334339973|ref|YP_004544953.1| major facilitator superfamily p...    79   2e-12   
gi|321474989|gb|EFX85953.1| hypothetical protein DAPPUDRAFT_1275...    79   2e-12   Daphnia pulex
gi|195055240|ref|XP_001994527.1| GH17299 [Drosophila grimshawi] ...    79   2e-12   Drosophila grimshawi
gi|307184508|gb|EFN70897.1| Synaptic vesicular amine transporter...    79   2e-12   Camponotus floridanus
gi|242023366|ref|XP_002432105.1| Vesicular acetylcholine transpo...    78   3e-12   Pediculus humanus corporis [human body lice]
gi|339236123|ref|XP_003379616.1| vesicular acetylcholine transpo...    78   4e-12   Trichinella spiralis
gi|358374900|dbj|GAA91488.1| MFS amine transporter [Aspergillus ...    78   4e-12   Aspergillus kawachii IFO 4308
gi|332028561|gb|EGI68598.1| Vesicular acetylcholine transporter ...    77   5e-12   Acromyrmex echinatior
gi|322792819|gb|EFZ16652.1| hypothetical protein SINV_05992 [Sol...    77   5e-12   Solenopsis invicta [imported red fire ant]
gi|512205821|gb|EPE34642.1| MFS general substrate transporter [G...    77   6e-12   Glarea lozoyensis ATCC 20868
gi|134082738|emb|CAK42630.1| unnamed protein product [Aspergillu...    77   6e-12   Aspergillus niger
gi|312089425|ref|XP_003146242.1| vesicular acetylcholine transpo...    77   6e-12   Loa loa
gi|449270849|gb|EMC81497.1| Chromaffin granule amine transporter...    76   1e-11   Columba livia [carrier pigeon]
gi|328709288|ref|XP_003243921.1| PREDICTED: synaptic vesicular a...    76   1e-11   Acyrthosiphon pisum
gi|332028802|gb|EGI68831.1| Synaptic vesicular amine transporter...    76   1e-11   Acromyrmex echinatior
gi|472587973|gb|EMS25469.1| MFS transporter [Rhodosporidium toru...    76   2e-11   Rhodotorula toruloides NP11
gi|307193264|gb|EFN76155.1| Vesicular acetylcholine transporter ...    75   2e-11   Harpegnathos saltator
gi|170585872|ref|XP_001897706.1| vesicular acetylcholine transpo...    74   4e-11   Brugia malayi [agent of lymphatic filariasis]
gi|328782367|ref|XP_001120960.2| PREDICTED: vesicular acetylchol...    74   4e-11   
gi|321464361|gb|EFX75369.1| hypothetical protein DAPPUDRAFT_2143...    74   5e-11   Daphnia pulex
gi|345482461|ref|XP_001608139.2| PREDICTED: synaptic vesicular a...    74   5e-11   Nasonia vitripennis
gi|402594337|gb|EJW88263.1| vesicular acetylcholine transporter ...    74   5e-11   Wuchereria bancrofti [agent of lymphatic filariasis]
gi|327277558|ref|XP_003223531.1| PREDICTED: synaptic vesicular a...    74   6e-11   Anolis carolinensis [Carolina anole]
gi|189234210|ref|XP_970834.2| PREDICTED: similar to AGAP004476-P...    74   6e-11   
gi|270002437|gb|EEZ98884.1| hypothetical protein TcasGA2_TC00449...    74   7e-11   Tribolium castaneum [rust-red flour beetle]
gi|452989694|gb|EME89449.1| hypothetical protein MYCFIDRAFT_2534...    74   8e-11   Cercospora fijiensis CIRAD86


>gi|384487375|gb|EIE79555.1| hypothetical protein RO3G_04260 [Rhizopus delemar RA 99-880]
          Length = 426

 Score =  256 bits (655), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 139/343 (40%), Positives = 212/343 (61%), Gaps = 8/343 (2%)

Query: 1   FAVLSDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAML 60
           FA+LSDKY  R+ PM+ GML L I ++ F +A++Y  LV+AR AQG AGGASWT+ L +L
Sbjct: 74  FAILSDKYRNRRYPMLGGMLGLFISTLAFAVADTYALLVLARTAQGVAGGASWTIGLGLL 133

Query: 61  ADRFGSGPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVIS 120
           AD F +  KLGVVMGTVL+A+T             Y++ G+                 I 
Sbjct: 134 ADVFPT-RKLGVVMGTVLTAHTVGFAIGPAVGGFLYEFGGFASPFLFCAAFAIINFFAIV 192

Query: 121 MIVEPSDL---STYQSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVV 177
            + EP  +   S + S              N++   Q+ ++  L+ +W I++  L +IV 
Sbjct: 193 WLAEPDHIQHTSDHISRAQENIDENTPLIGNKK---QTVTMIGLLKNWRILSCVLCVIVS 249

Query: 178 ASILAGLEPILPIYLRKEFDADASLIGLIFIAIAIPTFLSPAVGYISFYIGQRRTCGIGM 237
           AS+ +G+EP LPI+L+ EF+A AS+IG+IF+A+ +P F +P +G++S  IG++     GM
Sbjct: 250 ASVFSGIEPALPIHLQNEFNASASMIGMIFVAMVVPAFFAPLIGHLSDKIGRQAISATGM 309

Query: 238 ILMGIATPLISLP-SKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYAL 296
           ++M I +PL+++  S  + ++LPL+ FG +  I  TP LP +G  VT+ G GAY Q+YAL
Sbjct: 310 VMMAIISPLVAIHYSSIYFIILPLMIFGLSSPITLTPVLPEMGETVTEMGSGAYAQVYAL 369

Query: 297 WNMAYSIGMFVGPVIAGLLFELFEFRNTLIIFGAAVLAITPLI 339
           +NMAYSIGMF+GPVIAG +  +  F + +++F AA+L  +P++
Sbjct: 370 YNMAYSIGMFIGPVIAGFVMSVSGFESLMLLFSAALLICSPIM 412



>gi|511003932|gb|EPB85316.1| hypothetical protein HMPREF1544_07930 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 436

 Score =  236 bits (601), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 136/355 (38%), Positives = 207/355 (58%), Gaps = 31/355 (8%)

Query: 1   FAVLSDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAML 60
           FA+LSD+Y  R+ PM+ GML L I ++ F +A++Y  LV+AR+AQG AGGASWT+ L +L
Sbjct: 80  FAILSDRYQNRRYPMLGGMLGLVISTLAFAMADTYALLVLARVAQGVAGGASWTIGLGLL 139

Query: 61  ADRFGSGPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVIS 120
           AD F +  KLG VMGTVL+A+T             Y+Y G                L I 
Sbjct: 140 ADVFPT-KKLGAVMGTVLTAHTVGFALGPGIGGALYEYGGMEAPFFFCAAFAVLNFLAIL 198

Query: 121 MIVEPSDLSTYQSVXXXXXXXXXXXXANQEFHTQSP--------------SIWNLIFDWN 166
            + EP      ++             A +E    +P              ++ +L+ +W 
Sbjct: 199 WLAEPKHNHIEET-------QDHVSRAQEEIDETTPLVNSGNRATDKKPLTMIDLLKNWR 251

Query: 167 IINICLAIIVVASILAGLEPILPIYLRKEFDADASLIGLIFIAIAIPTFLSPAVGYISFY 226
           I++  L + V AS+ AG+EP LPI+L++ F+A AS IGLIF+A+ +P FL+P +G++S  
Sbjct: 252 ILSCVLCVTVSASVFAGIEPALPIHLQQTFNASASTIGLIFVAMVVPAFLAPLIGHLSDK 311

Query: 227 IGQRRTCGIGMILMGIATPLISL--PSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQ 284
           IG++     GMI+M IA+PL++L   S +W ++ PL+ FG +  +  TP LP +G  V++
Sbjct: 312 IGRQAISAAGMIMMAIASPLVALRYTSIYW-IIPPLMVFGLSSPVTLTPVLPEMGETVSE 370

Query: 285 KGGGAYGQIYALWNMAYSIGMFVGPVIAGLLFELFEFRNTLIIFGAAVLAITPLI 339
                   IYAL+NMAYSIGMF+GPV+AG +    +F + +I+FGA++L  +P++
Sbjct: 371 M------VIYALYNMAYSIGMFIGPVVAGFIMSAADFESLMIVFGASLLICSPIM 419



>gi|511003987|gb|EPB85369.1| hypothetical protein HMPREF1544_07829 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 470

 Score =  187 bits (474), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 126/378 (33%), Positives = 186/378 (49%), Gaps = 30/378 (7%)

Query: 1   FAVLSDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAML 60
           F +LSDKY  R+  +M G   +   ++LF  A+SY  LV+AR+ QGA+ GASWT+ L ML
Sbjct: 94  FGILSDKYQNRRYGLMLGTFCIISSTLLFAWASSYIMLVMARVCQGASAGASWTIGLGML 153

Query: 61  ADRFGSGPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVIS 120
           AD F    +LG  MGTV+ ++T             Y Y G +              +   
Sbjct: 154 ADAFPVD-RLGRAMGTVILSHTVGFLLGPVMGGFLYDYGGTLAPFYFCSAFGLLTLVGTV 212

Query: 121 MIVEPSDLSTYQSVXXXXXXXXXXXXAN------------------QEFHTQSP--SIWN 160
            I EP   +  QS+                                     Q P   ++ 
Sbjct: 213 CIAEPIK-AQEQSMDTSKDPVQKARVDESAPLLSSATSSSSSTATVNSMQKQPPGRQLYT 271

Query: 161 LIFDWNIINICLAIIVVASILAGLEPILPIYLRKEFDADASLIGLIFIAIAIPTFLSPAV 220
           LI +  I    L   V ++ LAG+EP LPI+L  ++    S IG IFIA+ +P+FL P  
Sbjct: 272 LISNPRITACLLCCFVTSAALAGIEPALPIHLENKYHVSTSTIGAIFIALVVPSFLGPVT 331

Query: 221 GYISFYIGQRRTCGIGMILMGIATPLISLPSKFWLVVLPLLF-FGATYSIVTTPTLPLLG 279
           GY S   G+    GIGM++M IA+ L+ LP   +  +LP LF FG +  ++ TP +P +G
Sbjct: 332 GYFSDKFGRPLFIGIGMVVMSIASVLVGLPVSSYKHMLPALFLFGLSNPLIHTPLMPEMG 391

Query: 280 HYVTQKGGGAYGQIYALWNMAYSIGMFVGPVIAGLLFELF------EFRNTLIIFGAAVL 333
             VT  G  A+ Q+YAL+NMAYS+G+FVGP++AG++           F+  ++IF   ++
Sbjct: 392 AAVTDMGSNAFAQVYALYNMAYSLGIFVGPLLAGVIMSCNSIDLNQRFQILMLIFSGVII 451

Query: 334 AITPLIFAG-RLRDHADR 350
             +P+I    R R +  R
Sbjct: 452 ISSPVILINQRKRAYYKR 469



>gi|489289755|ref|WP_003197306.1| permease [Bacillus mycoides]
 gi|228756264|gb|EEM05582.1| Permease (Major facilitator superfamily) [Bacillus mycoides
           Rock1-4]
 gi|228762383|gb|EEM11308.1| Permease (Major facilitator superfamily) [Bacillus mycoides
           Rock3-17]
 gi|228768417|gb|EEM17022.1| Permease (Major facilitator superfamily) [Bacillus pseudomycoides
           DSM 12442]
          Length = 390

 Score =  140 bits (352), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 111/333 (33%), Positives = 167/333 (50%), Gaps = 36/333 (10%)

Query: 3   VLSDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLAD 62
           V+SDK   R++PM+ G+  LA  ++LFG+ANS+W LV+AR+ QG +  A+WT  LA+LAD
Sbjct: 70  VVSDKVG-RRLPMILGLFGLAAATLLFGLANSFWLLVLARMLQGISAAATWTAGLALLAD 128

Query: 63  RFGSGPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGY-VXXXXXXXXXXXXXXLVISM 121
            F    + G  MG  LS                YQ+ GY +              L I++
Sbjct: 129 VFPLQER-GKAMGLALSGQAAGMLLGPTIGGALYQWGGYHLPFIIAASIALIDGILRITL 187

Query: 122 I-VEPSDLSTYQSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI 180
           +  EP   S                  NQ    +S      I +   + I + II++ S 
Sbjct: 188 LHNEPKSSS------------------NQRISYRS------ILNMRSLFIMIGIIILGSA 223

Query: 181 L-AGLEPILPIYLRKEFDADASLIGLIFIAIAIPT----FLSPAVGYISFYIGQRRTCGI 235
           L + LEP LP+YL+         IGL+F   A+PT    F +P +G +S  IG+++T  +
Sbjct: 224 LPSALEPTLPLYLQDTLHLSPGTIGLLF---AVPTLAYGFTAPIIGTLSTKIGRKQTMAV 280

Query: 236 GMILMGIATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYA 295
           G+ L  +  P   + S   L +  L   G ++S++  P LP L +   + G  AYG ++A
Sbjct: 281 GIALAALCFPFTVIVSHTALEIFVLAILGISFSLLLAPALPELTYLADKNGVHAYGILFA 340

Query: 296 LWNMAYSIGMFVGPVIAGLLFELFEFRNTLIIF 328
           ++N AYSIGMF GP+++G L +LF F N   IF
Sbjct: 341 IYNTAYSIGMFFGPMLSGSLSDLFGFTNAFYIF 373



>gi|310640794|ref|YP_003945552.1| permease (major facilitator superfamily) [Paenibacillus polymyxa
           SC2]
 gi|386039903|ref|YP_005958857.1| major facilitator superfamily MFS-1 [Paenibacillus polymyxa M1]
 gi|503135281|ref|WP_013369942.1| permease [Paenibacillus polymyxa]
 gi|309245744|gb|ADO55311.1| Permease (Major facilitator superfamily) [Paenibacillus polymyxa
           SC2]
 gi|343095941|emb|CCC84150.1| major facilitator superfamily MFS-1 [Paenibacillus polymyxa M1]
          Length = 403

 Score =  135 bits (340), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 100/353 (28%), Positives = 174/353 (49%), Gaps = 31/353 (8%)

Query: 1   FAVLSDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAML 60
           F +L+D+   RK P+++G++ L   +++F IA+++W LV+AR  QG A   +WT  LA+L
Sbjct: 69  FGLLTDRIG-RKTPLLWGLIGLIASTLMFAIAHTFWLLVLARALQGVAAAMTWTAGLALL 127

Query: 61  ADRFGSGPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVIS 120
           A+ + S  + G  MG  LS                YQ+  Y                   
Sbjct: 128 AELYPSEER-GKAMGLALSGQAAGTLLGPTIGGWLYQWGSYQF----------------- 169

Query: 121 MIVEPSDLSTYQSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI 180
               P   +   +V              +E + +  S ++ + + +++ +   +I+ AS+
Sbjct: 170 ----PFYFAIALAVVDAVLRLVLLHDITEEKNEKYLSPFSFMKNKDLLLVIGVVIIGASV 225

Query: 181 LAGLEPILPIYLRKEFDADASLIGLIFIAIAIPTFL----SPAVGYISFYIGQRRTCGIG 236
            + LEP LP++L+  F+A+  +IGL+F   AIPT      +P +G  S  IG +    +G
Sbjct: 226 PSVLEPTLPLHLQHNFNANPGVIGLLF---AIPTLAYGLATPFIGQFSSKIGYKNGILLG 282

Query: 237 MILMGIATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYAL 296
           ++++ IA PL +LP+   L  + L   G +  +V  P LP L     + G  +YG  +AL
Sbjct: 283 LLMVSIALPLTALPAILSLQAVILAVLGVSMGMVLAPCLPQLADISQRSGIHSYGITFAL 342

Query: 297 WNMAYSIGMFVGPVIAGLLFELFEFRNTLIIFGAAVLAITPLIFAGRLRDHAD 349
           +N AYSIG+ +GP+++  L +L   + + ++ G  VL I  L+ A  LR   +
Sbjct: 343 YNTAYSIGLMIGPILSSTLTDLMNIKLSYLVIGIIVL-IYMLVLASALRKAKN 394



>gi|446082201|ref|WP_000160056.1| permease [Bacillus cereus]
 gi|228730567|gb|EEL81520.1| Permease (Major facilitator superfamily) [Bacillus cereus AH1271]
          Length = 400

 Score =  133 bits (335), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 94/329 (28%), Positives = 159/329 (48%), Gaps = 24/329 (7%)

Query: 3   VLSDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLAD 62
           V+SDK+  R+  M++GM+ L   +++F  AN+ + L++AR+ QG A  A+WT  LA++ D
Sbjct: 70  VVSDKFG-RRGSMLWGMVVLIASTLMFAFANNMYILILARLLQGIAAAATWTAGLALITD 128

Query: 63  RFGSGPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMI 122
            + +  K G  +GTV++  +             Y++ GY               L    +
Sbjct: 129 LYPAN-KRGKALGTVITFMSAGTLLGAPVGGLLYEWGGYQLPFLLAAGIALLDGLARMFL 187

Query: 123 VEPSDLSTYQSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASILA 182
           +E                        ++  T S  I  +  D+ ++ I   +++ +S ++
Sbjct: 188 LEDPP---------------------KDKETSSVDIAKIFKDFEVLKIFGVVLLGSSAIS 226

Query: 183 GLEPILPIYLRKEFDADASLIGLIF-IAIAIPTFLSPAVGYISFYIGQRRTCGIGMILMG 241
            LEP LPIYL +   A    IG +F I        SP  G++S   G      IG++++ 
Sbjct: 227 ILEPTLPIYLMENLGASTVHIGFLFGITTLAYGLASPIAGWLSDKSGTFHIMMIGLLILA 286

Query: 242 IATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAY 301
           +  P +++P+   L  + L F GA   +V TPTLP L + V + GGGAY   +A++N+AY
Sbjct: 287 VCLPFVTIPNTLVLEGVVLFFLGAAAGLVLTPTLPELANSVDRLGGGAYATAFAVFNVAY 346

Query: 302 SIGMFVGPVIAGLLFELFEFRNTLIIFGA 330
           S+GM +GP+  G   ++F     L I  A
Sbjct: 347 SVGMMIGPIFGGFFADMFNVSIALYILSA 375



>gi|488079273|ref|WP_002150670.1| permease [Bacillus cereus]
 gi|401167497|gb|EJQ74779.1| multidrug resistance protein [Bacillus cereus HuA4-10]
          Length = 400

 Score =  131 bits (329), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 94/329 (28%), Positives = 159/329 (48%), Gaps = 24/329 (7%)

Query: 3   VLSDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLAD 62
           V+SDK+  R+  M++GM+ L   +++F  A++ + L++AR+ QG A  A+WT  LA++ D
Sbjct: 70  VVSDKFG-RRGSMLWGMVVLIASTLMFAFASNMYILILARLLQGIAAAATWTAGLALITD 128

Query: 63  RFGSGPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMI 122
            + +  K G  +GTV++  +             Y++ GY               L    +
Sbjct: 129 LYPAN-KRGKALGTVITFMSAGTLLGAPVGGLLYEWGGYQLPFLLAAGIALLDGLARMFL 187

Query: 123 VEPSDLSTYQSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASILA 182
           +E                        ++    S  I  +  D+ ++ I   +++ +S ++
Sbjct: 188 LEDPP---------------------KDKEASSVDILKIFKDFEVLKIFGVVLLGSSAIS 226

Query: 183 GLEPILPIYLRKEFDADASLIGLIF-IAIAIPTFLSPAVGYISFYIGQRRTCGIGMILMG 241
            LEP LPIYL +   A+   IG +F I        SP  G++S   G      IG+I++ 
Sbjct: 227 ILEPTLPIYLMEHLGANTVHIGFLFGITTLAYGLASPIAGWLSDKSGTFSIMMIGLIILA 286

Query: 242 IATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAY 301
              PL+++P+   L  + L F GA   +V TPTLP L + V + GGGAY   +A++N+AY
Sbjct: 287 AFLPLVTIPNSLVLEGVILFFLGAAAGLVLTPTLPELANSVDRLGGGAYATAFAVFNVAY 346

Query: 302 SIGMFVGPVIAGLLFELFEFRNTLIIFGA 330
           S+GM +GP+  G   ++F     L I  A
Sbjct: 347 SVGMMIGPIFGGFFADMFNVSTALYILSA 375



>gi|489165066|ref|WP_003074677.1| permease [Streptococcus intermedius]
 gi|355363863|gb|EHG11598.1| hypothetical protein HMPREF9177_01480 [Streptococcus intermedius
           F0413]
          Length = 390

 Score =  128 bits (322), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 103/350 (29%), Positives = 173/350 (49%), Gaps = 31/350 (8%)

Query: 1   FAVLSDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAML 60
           F ++SDK+  R+ PM++G+L LA  ++LF  AN++W L++ARI QG A   +WT  LA+L
Sbjct: 68  FGMISDKF-GRRGPMLWGILGLAAATLLFAFANTFWFLLLARILQGCAAAITWTAGLALL 126

Query: 61  ADRFGSGPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVIS 120
           AD + S  + G  MG  LS                YQ  GY+              L+  
Sbjct: 127 ADFYPSEER-GQAMGIALSGQAMGILVGPSLGGWLYQIGGYMFPFFVAAGMAVLDGLLRL 185

Query: 121 MIVEPSDLSTYQSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI 180
           ++++       Q+                    Q P  + L+ +   + I  A+++ A++
Sbjct: 186 LLLKEEPHRGKQT-------------------EQQP--FELLRNQQFLLIVGAVMIGAAV 224

Query: 181 LAGLEPILPIYLRKEFDADASLIGLIFIAIAIPTF----LSPAVGYISFYIGQRRTCGIG 236
            + L+P LP    + F A   +IGL+F   A+PT     ++P +G IS  +G  R   +G
Sbjct: 225 PSALQPTLPARFEEVFHATPLVIGLLF---AVPTIAYAVIAPLIGRISTKLGHARMTVLG 281

Query: 237 MILMGIATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYAL 296
            I+  +A   ++LPS  +L +  L   G    ++  P+LP +     +K   +YG  +A+
Sbjct: 282 FIITALAMAFVTLPSNIYLEIAALSLIGIGMGMILAPSLPRMADLAQEKENASYGFTFAI 341

Query: 297 WNMAYSIGMFVGPVIAGLLFELFEFRNTLIIFGAAVLAITPLIFAGRLRD 346
           +N AYS+GM +GPV++GLL E F  +   +I   A++ +  ++FA RL  
Sbjct: 342 YNTAYSVGMMMGPVLSGLLSENFGLQWAYVILAGAIV-LYMMVFASRLNH 390



>gi|328770913|gb|EGF80954.1| hypothetical protein BATDEDRAFT_24519 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 602

 Score =  128 bits (321), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 70/224 (31%), Positives = 123/224 (54%), Gaps = 9/224 (4%)

Query: 118 VISMIVEPSDLSTYQSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVV 177
           V   ++ PSD   Y+SV             N        ++ +L+ D  I+   L +I+ 
Sbjct: 377 VCQPLLTPSDRIEYESVEVAENLFPQRIQQN--------TMLDLVKDSQILVTLLCVIIS 428

Query: 178 ASILAGLEPILPIYLRKEFDADASLIGLIFIAIAIPTFLSPA-VGYISFYIGQRRTCGIG 236
           +S+ AG+EP LPIYL +E  A  SL+G ++I IAIP+ L  +  G+IS   G++     G
Sbjct: 429 SSVFAGIEPTLPIYLSQELKASPSLVGALWIFIAIPSMLGCSWAGHISDKYGRKNVMAFG 488

Query: 237 MILMGIATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYAL 296
           M+   IA+P+++L    ++++  L+ F  + ++  TP +P +  ++  +   A+G +YAL
Sbjct: 489 MLFFAIASPMLALGKHMFILIPGLICFSLSNAVALTPAMPEMADFMHARDDSAFGTVYAL 548

Query: 297 WNMAYSIGMFVGPVIAGLLFELFEFRNTLIIFGAAVLAITPLIF 340
           +N+AYS G  +GP+    LF+ F+F   + +FG A+L   P+ +
Sbjct: 549 YNLAYSSGQLIGPIAGSFLFQRFDFMIQMQVFGVALLLGAPIAY 592



>gi|497440594|ref|WP_009754792.1| permease [Streptococcus sp. oral taxon 056]
 gi|339454598|gb|EGP67213.1| LacY proton/sugar symporter [Streptococcus sp. oral taxon 056 str.
           F0418]
          Length = 390

 Score =  125 bits (313), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 102/350 (29%), Positives = 171/350 (48%), Gaps = 31/350 (8%)

Query: 1   FAVLSDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAML 60
           F ++SDK   R+ PM++G+L LA  ++LF  AN++W L++ARI QG A   +WT  LA+L
Sbjct: 68  FGMISDKLG-RRGPMLWGILGLAAATLLFAFANTFWFLLLARILQGCAAAITWTAGLALL 126

Query: 61  ADRFGSGPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVIS 120
           AD + S  + G  MG  LS                YQ  GY+              L+  
Sbjct: 127 ADFYPSEER-GQAMGIALSGQAMGILVGPSLGGWLYQIGGYMFPFFVAAGMAVLDGLLRL 185

Query: 121 MIVEPSDLSTYQSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI 180
           ++++       Q+                    Q P  + L+ +   + I  A+++ A++
Sbjct: 186 LLLKEEPHRGKQT-------------------EQQP--FELLRNQQFLLIVGAVMIGAAV 224

Query: 181 LAGLEPILPIYLRKEFDADASLIGLIFIAIAIPTF----LSPAVGYISFYIGQRRTCGIG 236
            + L+P LP      F A   +IGL+F   A+PT     ++P +G +S  +G  R   +G
Sbjct: 225 PSALQPTLPARFEAVFQATPLVIGLLF---AVPTIAYAVIAPLIGRLSTKLGHARMTVLG 281

Query: 237 MILMGIATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYAL 296
            I+  +A   ++LPS  +L +  L   G    ++  P+LP +     +K   +YG  +A+
Sbjct: 282 FIITALAMAFVTLPSNIYLEIAALSLIGIGMGMILAPSLPRMADLAQEKENASYGFTFAI 341

Query: 297 WNMAYSIGMFVGPVIAGLLFELFEFRNTLIIFGAAVLAITPLIFAGRLRD 346
           +N AYS+GM +GPV++GLL E F  +   +I   A++ +  ++FA RL  
Sbjct: 342 YNTAYSVGMMMGPVLSGLLSENFGLQWAYVILAGAIV-LYMIVFASRLNH 390



>gi|392428057|ref|YP_006469068.1| hypothetical protein SCIM_0166 [Streptococcus intermedius JTH08]
 gi|489168157|ref|WP_003077747.1| permease [Streptococcus intermedius]
 gi|383845348|gb|EID82752.1| transporter, major facilitator family protein [Streptococcus
           intermedius SK54]
 gi|391757203|dbj|BAM22820.1| conserved hypothetical protein [Streptococcus intermedius JTH08]
 gi|514208791|gb|EPH04584.1| hypothetical protein HMPREF1654_00723 [Streptococcus intermedius
           ATCC 27335]
          Length = 390

 Score =  123 bits (309), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 101/350 (28%), Positives = 171/350 (48%), Gaps = 31/350 (8%)

Query: 1   FAVLSDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAML 60
           F ++SDK   R+ PM++G+L LA  ++LF  AN++W L++ARI QG A   +WT  LA+L
Sbjct: 68  FGMISDKLG-RRGPMLWGILGLAAATLLFAFANTFWFLLLARILQGCAAAITWTAGLALL 126

Query: 61  ADRFGSGPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVIS 120
           AD + S  + G  MG  LS                YQ  GY+              L+  
Sbjct: 127 ADFYPSEER-GQAMGIALSGQAMGILVGPSLGGWLYQIGGYMFPFFVAAGMAVLDGLLRL 185

Query: 121 MIVEPSDLSTYQSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI 180
           ++++       Q+                    Q P  + L+ +   + I  A+++ A++
Sbjct: 186 LLLKEEPHRGKQT-------------------EQQP--FELLRNQQFLLIVGAVMIGAAV 224

Query: 181 LAGLEPILPIYLRKEFDADASLIGLIFIAIAIPTF----LSPAVGYISFYIGQRRTCGIG 236
            + L+P LP    + F A   +IGL+F   A+PT     ++P +G IS  +G  R   +G
Sbjct: 225 PSALQPTLPARFEEVFHATPLVIGLLF---AVPTIAYAVIAPLIGRISTKLGHARMTVLG 281

Query: 237 MILMGIATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYAL 296
            I+  +A   ++L S  +L ++ L   G    ++  P+LP +     +K   +YG  +A+
Sbjct: 282 FIITALAMAFVTLTSNIYLEIVALSLIGIGMGMILAPSLPRMADLAQEKENASYGFTFAI 341

Query: 297 WNMAYSIGMFVGPVIAGLLFELFEFRNTLIIFGAAVLAITPLIFAGRLRD 346
           +N AYS+GM +GPV++GLL E F  +   +I   A++ +  ++F  RL  
Sbjct: 342 YNTAYSVGMMIGPVLSGLLSENFGLQWAYVILAGAIV-LYMMVFVSRLNH 390



>gi|495688700|ref|WP_008413279.1| Major facilitator superfamily MFS_1 [Desulfotomaculum
           hydrothermale]
 gi|411453412|emb|CCO09319.1| Major facilitator superfamily MFS_1 [Desulfotomaculum hydrothermale
           Lam5 = DSM 18033]
          Length = 394

 Score =  117 bits (294), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 100/356 (28%), Positives = 169/356 (47%), Gaps = 29/356 (8%)

Query: 1   FAVLSDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAML 60
             +LSD+Y  +KI M  G+LSL++ +I F +ANS   LVV R+ QG A  A+WT   A++
Sbjct: 61  LGILSDRYGRKKI-MFCGLLSLSLSTIGFALANSIMLLVVTRLMQGLAAAATWTAGPALV 119

Query: 61  ADRFGSGPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVIS 120
           AD F S  + G  MG + +AN              YQ+ GY               L++ 
Sbjct: 120 ADLF-SPEERGAKMGVLSAANGFGFLVGPAAGGVLYQWGGYSLPFVLCTVLAVLIGLLVL 178

Query: 121 MIVEPSDLSTYQSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI 180
           M++ P   S    V            AN +      S+  ++ +  ++    A+I++ SI
Sbjct: 179 MVI-PGHPSAVGRV------------ANGQ------SLRQVLGNRGVLTGS-AVILLGSI 218

Query: 181 LAG-LEPILPIYLRKEFDADASLIGLIFIAIAIPTFLS-PAVGYISFYIGQRRTCGIGMI 238
             G ++P+LP Y  ++F+   S IG +F  I++    + P VG +S  +G+ +   +G+I
Sbjct: 219 GFGFIDPLLPGYFTQKFNITPSTIGFLFAVISLCHIAAAPLVGRLSDRVGRLKLIRLGLI 278

Query: 239 LMGIATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYV----TQKGGGAYGQIY 294
              +A PL++      L    +   G T+S++ TP++PL+   V           YG  +
Sbjct: 279 ATALAVPLLAPAGNLLLTAAVMGLLGITFSLLLTPSMPLMADAVMPTEDNSHDAGYGAAF 338

Query: 295 ALWNMAYSIGMFVGPVIAGLLFELFEFRNTLIIFGAAVLAIT-PLIFAGRLRDHAD 349
            ++N A+S+G  +GP+  G   E F   + L+ +   +L +  P + AG     AD
Sbjct: 339 GIYNTAFSLGYLIGPLAGGGWLEFFSLPSLLVAYSVFLLLVGLPALTAGSRSLQAD 394



>gi|328767947|gb|EGF77995.1| hypothetical protein BATDEDRAFT_35854 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 409

 Score =  110 bits (274), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 97/363 (26%), Positives = 165/363 (45%), Gaps = 31/363 (8%)

Query: 3   VLSDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLAD 62
           ++SDK   R++PM+FG++ L   ++LF  A ++W L + R+ QG + G  WTL LA++AD
Sbjct: 45  IISDKLQGRRLPMIFGLVGLIASTLLFMFAKTFWVLALGRLLQGISTGTVWTLGLALVAD 104

Query: 63  RFGSGPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMI 122
              S   LG  MG +  A               Y   GY               +V+ + 
Sbjct: 105 THDSN-DLGAAMGIIYGAYAAGQLAGPPIGAVLYTRVGYQAPFIFCCSLTLIDLIVMLIY 163

Query: 123 VE-----PS----DL-STYQSVXXXXXXXXXXXXANQ-----------EFHTQSPSIWNL 161
           VE     PS    DL  T+ S                           +      + W +
Sbjct: 164 VELPISKPSLEAADLDETFDSTAVKSEENEMAVHVKSISDAKTAETLPKVRKAPETFWEI 223

Query: 162 IFDWNIINICLAIIVVASILAGLEPILPIYLRKEFDADASLIGLIFIAIAIPT-FLSPAV 220
           +    II I L  IV+    A  E  L ++LR  +  D   IGL+F+ + IP+ F +P  
Sbjct: 224 LTLPPIIIISLVTIVMGCATAAFESTLALHLRDRYGYDVERIGLVFMGMVIPSLFCTPIA 283

Query: 221 GYISFYIGQRRTCGIGMILMGIATPLISLPSKF--WLVVLPLLFFGATYSIVTTPTLPLL 278
           GY+   +G R   G+G+ +  +  P ++L      +L++L + F  +  SI  TP +P +
Sbjct: 284 GYVYDRLGFRVVSGVGVAVCAVLAPFLALYQGIVSFLIIL-ITFTMSISSIGMTPMMPEI 342

Query: 279 GHYVTQKGGGAYGQIYALWNMAYSIGMFVGPVIAGLLFELFE-FRNTLIIFGAAVLAITP 337
              V +    A+ + Y+L+N+A+S G+  GP++  L++ +   F   +++F   +L + P
Sbjct: 343 SACVPRS---AFARTYSLFNVAFSGGLLFGPIVGSLVYHVGGWFWECIVLFILLILCV-P 398

Query: 338 LIF 340
           +IF
Sbjct: 399 MIF 401



>gi|147919579|ref|YP_686681.1| major facilitator superfamily permease [Methanocella arvoryzae
           MRE50]
 gi|500971531|ref|WP_012035226.1| MFS transporter permease [Methanocella arvoryzae]
 gi|110622077|emb|CAJ37355.1| putative permease (major facilitator superfamily) [Methanocella
           arvoryzae MRE50]
          Length = 395

 Score =  108 bits (271), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 97/338 (28%), Positives = 158/338 (46%), Gaps = 34/338 (10%)

Query: 1   FAVLSDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAML 60
           F  LSD+   R + ++ GM  LA+ +++F I+++ + L+VAR+ QG +G A+W+  LA++
Sbjct: 63  FGALSDRVGRRPL-LVAGMFLLALTNLVFVISDNLYLLIVARVIQGISGAATWSAGLALI 121

Query: 61  ADRFGS---GPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXL 117
           AD F +   G KLG+ M  ++SA T             Y   GY                
Sbjct: 122 ADTFDASERGSKLGMAM-AIMSAGTLSGPVVGGIV---YDLLGYRMTFVLPSVLTILLGC 177

Query: 118 VISMIVEPSDLSTYQSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINIC-LAIIV 176
           +  +I  P      +              +  +   ++P ++          +C +A IV
Sbjct: 178 MFYLIHVPPKSQGEKG-------------SYAKLLKKAPVVFA---------VCSIATIV 215

Query: 177 VASILAGLEPILPIYLRKEFDADASLIGLIFIAIAIPTFLS-PAVGYISFYIGQRRTCGI 235
            A     LEP +P+YL ++F A  +LIGL F A+++   ++ P VG +    G R     
Sbjct: 216 GALTFGLLEPFMPLYLFEKFSATPTLIGLAFGAMSLLNMVAAPVVGNLYDRFGGRGLLAS 275

Query: 236 GMILMGIATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYA 295
           G++L G+   L  L     L +L     G T S+  TP LPLL        G + G +Y 
Sbjct: 276 GLVLSGLIIALTMLMPSMELTILAFAIVGVTMSMALTPMLPLLTDLFGGPEGSSQGFLYG 335

Query: 296 LWNMAYSIGMFVGPVIAGLLFELFEFRNTLIIFGAAVL 333
           ++N  +SIG+ +GP + G L  + +F   + IFG AVL
Sbjct: 336 IYNTLFSIGLTIGPFLGGAL--VVKFSLPITIFGQAVL 371



>gi|147919137|ref|YP_687130.1| major facilitator superfamily permease [Methanocella arvoryzae
           MRE50]
 gi|500970146|ref|WP_012034784.1| MFS transporter permease [Methanocella arvoryzae]
 gi|110622526|emb|CAJ37804.1| permease (major facilitator superfamily) [Methanocella arvoryzae
           MRE50]
          Length = 410

 Score =  105 bits (263), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 91/332 (27%), Positives = 155/332 (46%), Gaps = 30/332 (9%)

Query: 3   VLSDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLAD 62
           VLSD+   RK+PM+ G+L L   ++LF  ++    L VAR  QG + GA+WT  LA+L+D
Sbjct: 74  VLSDRVG-RKLPMLVGLLGLFGSTLLFAFSSDLTMLFVARALQGVSAGATWTAGLALLSD 132

Query: 63  RFGSGPKL-GVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLV-IS 120
            F   PK+    +G  +S +              Y+Y GY               +  + 
Sbjct: 133 LFP--PKMRQQAIGIGISGSFAGTLLGPLFGGALYEYGGYALPFLAAAGLVLIDGIARLL 190

Query: 121 MIVEPSDLSTYQSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI 180
           ++ +P  L   Q V                      S+ +++ +  I+ +   I++V++ 
Sbjct: 191 LLKDPPRLPAEQQV----------------------SLKSMLKNRTILLMAGVIVLVSAA 228

Query: 181 LAGLEPILPIYLRKEFDADASLIGLIFIAIAIPTFLSPAVGY-ISFYIGQRRTCGIGMIL 239
            A LEP+LP+YL        ++IGL+F    + + ++  + Y ++   G++R    G+I 
Sbjct: 229 TALLEPVLPLYLSDVLKVSPTMIGLLFAVTVVASLIASPLSYKVAERFGRKRVIIAGLIC 288

Query: 240 MGIATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPL-LGHYVTQKGGGAYGQIYALWN 298
             +  P ++L   F L V+ +   G   +I    ++PL +   + + G G YG +YA++N
Sbjct: 289 SALILPTLALSGSFILEVVLMAALGGVLAI-GLASVPLEMTDVIDRLGQGGYGAVYAIYN 347

Query: 299 MAYSIGMFVGPVIAGLLFELFEFRNTLIIFGA 330
           +A S GM  GP+  GLL   F     L I GA
Sbjct: 348 LALSFGMMAGPIAGGLLAGSFGITAGLGIGGA 379



>gi|470455584|ref|XP_004340972.1| transporter, major facilitator subfamily protein [Acanthamoeba
           castellanii str. Neff]
 gi|440797834|gb|ELR18908.1| transporter, major facilitator subfamily protein [Acanthamoeba
           castellanii str. Neff]
          Length = 612

 Score =  105 bits (262), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 65/215 (30%), Positives = 111/215 (51%), Gaps = 24/215 (11%)

Query: 154 QSPSIWNLIFDWNIINICLAIIVVASILAGLEPILPIYLRKEFDADASLIGLIFIAIAIP 213
           Q  S W+L+ + +I+   + +++ ++ L  LEP LP +L K FD+   L GL+F+  ++ 
Sbjct: 327 QPLSFWDLVQNKSILITSVVVLLASNALTVLEPTLPTHLEKVFDSTPMLTGLVFMCESLV 386

Query: 214 TFL-SPAVGYISFYIGQRRTCGIGMILMGIA-----------------------TPLISL 249
             + SP VG+ S  +G +     GM+L G+                         P+++L
Sbjct: 387 DIVASPLVGWYSDRVGNKPLMIAGMLLAGLVMVLHLLLVFIFFLGSVALTTHHRKPIVAL 446

Query: 250 PSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGMFVGP 309
           P+++W   L +       +++ TPTLP L   V   GGGAYGQ+YA++N  YS+GM  GP
Sbjct: 447 PTEWWQQYLAVSAMAVCNALMLTPTLPELAAQVDAMGGGAYGQVYAIYNFFYSLGMLGGP 506

Query: 310 VIAGLLFELFEFRNTLIIFGAAVLAITPLIFAGRL 344
           ++  +L +      T++IFG  V   +P++    L
Sbjct: 507 LVGSILTDHIGLFLTMVIFGGVVALFSPVLVGAHL 541



>gi|495052614|ref|WP_007777450.1| arabinose ABC transporter permease [Brevibacillus sp. CF112]
 gi|398055048|gb|EJL47140.1| arabinose efflux permease family protein [Brevibacillus sp. CF112]
          Length = 407

 Score =  102 bits (253), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 79/320 (24%), Positives = 146/320 (45%), Gaps = 26/320 (8%)

Query: 1   FAVLSDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAML 60
           F  +SD+   R + ++ G++ LA  ++LF  + +   L+ AR  QG A  A+W  +LA+L
Sbjct: 69  FGPISDRLGRRTV-LLVGLVGLAASTLLFAFSETMALLITARFVQGIAAAATWPTALALL 127

Query: 61  ADRFGSGPKL-GVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVI 119
           AD F   PK+ G VMGT L+A +             ++   +               +++
Sbjct: 128 ADLFP--PKMRGAVMGTALTAISTGTLLGAPIGGWLFEIRDHRTPFLAAAAFTVINIVLV 185

Query: 120 SMIVEPSDLSTYQSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVAS 179
            + ++     T                A+++       +   + +  ++ I   +++   
Sbjct: 186 YLFLKEETART----------------ASEKLL-----VGKFLRNPQVVFIAGIVLLAEV 224

Query: 180 ILAGLEPILPIYLRKEFDADASLIGLIFIAIAIP-TFLSPAVGYISFYIGQRRTCGIGMI 238
            L  LEP LP++L ++     ++IGL+F A+ +    ++P  G +S      +    G++
Sbjct: 225 SLCLLEPTLPVFLTQKLSITPTVIGLLFGAMTLAYGLIAPVAGSLSGRFNPYKLMFAGVV 284

Query: 239 LMGIATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWN 298
            + +  P +      W   + +   GA+     +PTLP LG  + Q G GAYG  Y+L+N
Sbjct: 285 ALAVFMPFLVWADSLWQAGIAMALVGASVGFTLSPTLPTLGGIIDQGGSGAYGTAYSLFN 344

Query: 299 MAYSIGMFVGPVIAGLLFEL 318
           M + IGM  GP+  G+L +L
Sbjct: 345 MFHGIGMVAGPLAGGILTDL 364



>gi|492404142|ref|WP_005833185.1| hypothetical protein [Brevibacillus agri]
 gi|432183201|gb|ELK40749.1| hypothetical protein D478_17724 [Brevibacillus agri BAB-2500]
          Length = 406

 Score =  101 bits (252), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 79/320 (24%), Positives = 146/320 (45%), Gaps = 26/320 (8%)

Query: 1   FAVLSDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAML 60
           F  +SD+   R + ++ G++ LA  ++LF  + +   L+ AR  QG A  A+W  +LA+L
Sbjct: 68  FGPISDRLGRRTV-LLVGLVGLAASTLLFAFSETMALLITARFVQGIAAAATWPTALALL 126

Query: 61  ADRFGSGPKL-GVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVI 119
           AD F   PK+ G VMGT L+A +             ++   +               +++
Sbjct: 127 ADLFP--PKMRGAVMGTALTAISTGTLLGAPIGGWLFEISDHRTPFLAAAAFTVINIVLV 184

Query: 120 SMIVEPSDLSTYQSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVAS 179
            + ++     T                A+++       +   + +  ++ I   +++   
Sbjct: 185 YLFLKEETART----------------ASEKLL-----VGKFLRNPQVVFIAGIVLLAEV 223

Query: 180 ILAGLEPILPIYLRKEFDADASLIGLIFIAIAIP-TFLSPAVGYISFYIGQRRTCGIGMI 238
            L  LEP LP++L ++     ++IGL+F A+ +    ++P  G +S      +    G++
Sbjct: 224 SLCLLEPTLPVFLTQKLSITPTVIGLLFGAMTLAYGLIAPVAGSLSGRFNPYKLMFAGVV 283

Query: 239 LMGIATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWN 298
            + +  P +      W   + +   GA+     +PTLP LG  + Q G GAYG  Y+L+N
Sbjct: 284 ALAVFMPFLVWADSLWQAGIAMALVGASVGFTLSPTLPTLGGIIDQGGSGAYGTAYSLFN 343

Query: 299 MAYSIGMFVGPVIAGLLFEL 318
           M + IGM  GP+  G+L +L
Sbjct: 344 MFHGIGMVAGPLAGGILTDL 363



>gi|282165013|ref|YP_003357398.1| MFS transporter [Methanocella paludicola SANAE]
 gi|502665122|ref|WP_012901089.1| MFS transporter permease [Methanocella paludicola]
 gi|282157327|dbj|BAI62415.1| MFS transporter [Methanocella paludicola SANAE]
          Length = 388

 Score =  101 bits (251), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 96/350 (27%), Positives = 151/350 (43%), Gaps = 28/350 (8%)

Query: 1   FAVLSDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAML 60
           F +LSD+   R   MM GML+LA  ++ F +++    L++AR+ QG +G A+W+  L+ML
Sbjct: 62  FGILSDQLGRRSF-MMLGMLTLAATNVAFALSSDVAVLILARLLQGMSGAATWSAGLSML 120

Query: 61  ADRFGSGPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVIS 120
           AD FG   + G  +G  +SA +             Y   GY               L   
Sbjct: 121 ADTFGPEER-GKRLGMAMSAMSVGTLIGPTMGGILYDNLGYALTFIIPSVMACIVGLAFL 179

Query: 121 MIVEPSDLSTYQSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI 180
            + EPS  +                      + +SP  +        + I LA+++ A  
Sbjct: 180 AVSEPSGHAP-----------SVPFRERLAPYLRSPRTF--------LAISLAVVIGAVT 220

Query: 181 LAGLEPILPIYLRKEFDADASLIGLIFIAIAIPTFLS-PAVGYISFYIGQRRTCGIGMIL 239
              LEP +P+Y+   F A  +++GL F A+++ + ++ P VG +    G R     G+  
Sbjct: 221 YGILEPFMPVYMYDVFSATPTMVGLAFGAMSLLSIVAQPLVGRLYDLHGGRLLITAGLAS 280

Query: 240 MGIATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNM 299
             I     +L   F L    L   G T     TP LPLL       GG + G  Y ++N 
Sbjct: 281 SAIVVAGCALTPSFALTAAVLSLLGMTMGFALTPMLPLLSDL--YGGGNSSGMAYGIYNT 338

Query: 300 AYSIGMFVGPVIAGLLFELFEFRNTLIIFGAAVLAITPLI---FAGRLRD 346
            +S+G+ VGP   G++        TL +  A +LAI  +I   F G+ R 
Sbjct: 339 LFSLGLAVGPFAGGVMVAALTLPATLYVV-AVLLAIAGIIMFLFIGQPRK 387



>gi|333923834|ref|YP_004497414.1| major facilitator superfamily protein [Desulfotomaculum
           carboxydivorans CO-1-SRB]
 gi|503576231|ref|WP_013810307.1| MFS transporter [Desulfotomaculum carboxydivorans]
 gi|333749395|gb|AEF94502.1| major facilitator superfamily MFS_1 [Desulfotomaculum
           carboxydivorans CO-1-SRB]
          Length = 395

 Score =  100 bits (250), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 83/353 (23%), Positives = 165/353 (46%), Gaps = 28/353 (7%)

Query: 1   FAVLSDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAML 60
             +LSD+Y  +++ M FG+++L++ ++ F +A S   L++ R+ QG A GA+WT   A++
Sbjct: 61  LGILSDRYGRKRV-MFFGLVALSLSTLGFALAKSIVWLIITRLLQGFAAGATWTACPALI 119

Query: 61  ADRFGSGPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVIS 120
           AD +    + G  MG + +A+              Y+  GY               + ++
Sbjct: 120 ADLYPPEQR-GSKMGLMSAASGFGFLVGPAAGGLLYEAGGYHLPFLICIILAILAVIFVA 178

Query: 121 MIVEPSDLSTYQSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI 180
           +++ P D                   +N     +S      +     +     ++++ S+
Sbjct: 179 VVI-PGD-------------------SNPVKMPKSSRPLLEVLRIRGVWQGSTMVLIGSV 218

Query: 181 LAG-LEPILPIYLRKEFDADASLIGLIFIAIAIPTFLS-PAVGYISFYIGQRRTCGIGMI 238
             G ++P+LP Y   +F A   +IGL+F  I++    S P +G +S ++G+ R   IG++
Sbjct: 219 GFGFIDPLLPGYFADKFAASPGVIGLLFGVISLFHVSSAPVIGKLSDHMGRVRLIKIGLV 278

Query: 239 LMGIATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGG----GAYGQIY 294
              +  PLI+L +      + +   G T+ ++ TPT+PLL   V  + G     +YG  +
Sbjct: 279 TTALVVPLITLAANAVTSAITMGLMGITFGLMLTPTMPLLADSVMPRRGSSDDSSYGVAF 338

Query: 295 ALWNMAYSIGMFVGPVIAGLLFELFEFRNTLIIFGAAVLAITPLIFAGRLRDH 347
            ++N A+S+G  +GP+I G   E ++  +  + +   +L    + F  +  +H
Sbjct: 339 GIYNGAFSLGYLIGPLIGGAWVEFYDLPSLFVAYSIVLLLTGLVTFRHKPYEH 391



>gi|19075881|ref|NP_588381.1| membrane transporter (predicted) [Schizosaccharomyces pombe 972h-]
 gi|74626917|sp|O74852.1|YQ92_SCHPO RecName: Full=Uncharacterized MFS-type transporter C18.02
 gi|3766364|emb|CAA21416.1| membrane transporter (predicted) [Schizosaccharomyces pombe]
          Length = 448

 Score = 99.0 bits (245), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 88/375 (23%), Positives = 155/375 (41%), Gaps = 35/375 (9%)

Query: 4   LSDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADR 63
           L+DK+ TRK+PM+ G++ L   + L    NS   L+VAR+ QG +    WT+ LA+L D 
Sbjct: 78  LADKFLTRKVPMLIGLIFLTSATALLTFGNSVPMLIVARVLQGLSAAVVWTVGLALLVDV 137

Query: 64  FGSGPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIV 123
            G+   +G  MG +    +             Y+  GY                +  +++
Sbjct: 138 VGAD-NVGSTMGGIFGFISLGEIIAPVFGGIVYESLGYYASFGVCFIILLLDIALRFLMI 196

Query: 124 EPSDLSTYQSVXXXXXXXXXXXXANQEFHTQSPS-----------IWNLIFDWNIINICL 172
           EP ++    ++              Q+ H   P            I++L+    I     
Sbjct: 197 EPREMKNDSTLQDVERTSILQRQDTQD-HELKPKRSGLFSSLCLPIYSLLHHKQIFGPFW 255

Query: 173 AIIVVASILAGLEPILPIYLRKEFDADASLIGLIFIAIAIPTFLSPA-VGYI-----SFY 226
              V + + +  +  +P+ L+  FD ++   GL+F  ++ P F   A  G +     S  
Sbjct: 256 TSFVNSCLFSAFDATIPLELKTLFDFNSLQCGLMFGVLSTPYFFCGAWAGAMVDRRGSRT 315

Query: 227 IGQRRTCGIGMILMGIATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQ-- 284
           IG+R    +G  L  +  P  +     +L    L   G   +  ++P      HYV +  
Sbjct: 316 IGKRAYAILGCTLFLLCIPRTNTSLNIYLFSAFLAINGVVLAFTSSPGFVQSSHYVAEYE 375

Query: 285 -------KGGGAYGQIYALWNMAYSIGMFVGPVIAGLLFELFEFRN-----TLIIFGAAV 332
                     G Y Q+++ +N+ YS+GM +GP++AG L + F F       +L+ F A++
Sbjct: 376 LEHPTFFGHNGPYTQLFSAYNIVYSLGMIIGPLVAGFLRDQFNFITSIACLSLLCFSASL 435

Query: 333 LAITPLIFAGRLRDH 347
           +A +   F  RL   
Sbjct: 436 MANS--CFTDRLDSE 448



>gi|495001768|ref|WP_007727782.1| arabinose ABC transporter permease [Brevibacillus sp. BC25]
 gi|398028844|gb|EJL22347.1| arabinose efflux permease family protein [Brevibacillus sp. BC25]
          Length = 405

 Score = 97.8 bits (242), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 88/354 (24%), Positives = 161/354 (45%), Gaps = 26/354 (7%)

Query: 1   FAVLSDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAML 60
           F  +SD+   R + ++ G+L LA  ++LF  + +   L+ AR  QG A  A+W  +LA+L
Sbjct: 68  FGPISDRVGRRAM-LLIGLLGLAASTLLFAFSETMALLITARFVQGIAAAATWPTALALL 126

Query: 61  ADRFGSGPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVIS 120
           AD F S  + G VMG  L+A +             ++   +               +++ 
Sbjct: 127 ADLFPSKMR-GAVMGIALTAISTGTLLGAPIGGWLFEISDHRMPFLAAAAFTVINIVLVY 185

Query: 121 MIVEPSDLSTYQSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI 180
           + ++     T                 +++ H     +   I +  +I I   I+++A I
Sbjct: 186 LFLKEDTTRT----------------VSEKLH-----VGGFIRNPQVIFIA-GIVLLAEI 223

Query: 181 -LAGLEPILPIYLRKEFDADASLIGLIFIAIAIP-TFLSPAVGYISFYIGQRRTCGIGMI 238
            L  LEP LP++  ++     + IGL+F  + +    ++P  G +S  +   +    G+I
Sbjct: 224 SLCLLEPTLPVFFTEKLSMTPTTIGLLFGVMTLAYGLIAPVAGSLSSRMNPYKLMFGGII 283

Query: 239 LMGIATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWN 298
            + +  P ++     W  +L +   GA+     +PTL  LG  + Q G GAYG  Y+L+N
Sbjct: 284 TLAVFLPFLAWADSLWQAMLAMALVGASIGFTLSPTLGTLGAIIDQGGSGAYGTAYSLFN 343

Query: 299 MAYSIGMFVGPVIAGLLFELFEFRNTLIIFGAAVLAITPLIFAGRLRDHADRIQ 352
           M + IGM  GP+  G+L ++    + L+I  A++L  + L+F       + R+ 
Sbjct: 344 MFHGIGMVAGPLAGGILTDILPVSSALLIVAASILGFSILLFVQLKASKSARLS 397



>gi|507043617|ref|WP_016114671.1| hypothetical protein [Bacillus cereus]
 gi|500442004|gb|EOP55077.1| hypothetical protein IIW_01211 [Bacillus cereus VD136]
 gi|500461269|gb|EOP73158.1| hypothetical protein KOW_00568 [Bacillus cereus VDM006]
 gi|500544826|gb|EOQ09270.1| hypothetical protein KOY_03239 [Bacillus cereus VDM021]
          Length = 284

 Score = 97.1 bits (240), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 89/291 (30%), Positives = 135/291 (46%), Gaps = 35/291 (12%)

Query: 45  QGAAGGASWTLSLAMLADRFGSGPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGY-VX 103
           QG +  A+WT  LA+LAD F    + G  MG  LS                YQ+ GY + 
Sbjct: 3   QGISAAATWTAGLALLADVFPLQER-GKAMGLALSGQAAGMLLGPTIGGALYQWGGYHLP 61

Query: 104 XXXXXXXXXXXXXLVISMI-VEPSDLSTYQSVXXXXXXXXXXXXANQEFHTQSPSIWNLI 162
                        L I+++  EP+  S                  NQ    +S      I
Sbjct: 62  FIIAASIALIDGILRITLLHNEPTSSS------------------NQRISYRS------I 97

Query: 163 FDWNIINICLAIIVVASIL-AGLEPILPIYLRKEFDADASLIGLIFIAIAIPT----FLS 217
            +   + I + II++ S L + LEP LP+YL+         IGL+F   A+PT    F +
Sbjct: 98  LNMRSLFIMIGIIILGSALPSALEPTLPLYLQDTLHLSPGTIGLLF---AVPTLAYGFTA 154

Query: 218 PAVGYISFYIGQRRTCGIGMILMGIATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPL 277
           P +G +S  IG+++T  +G+ L  +  P   + S   L +  L   G ++S++  P LP 
Sbjct: 155 PIIGTLSTKIGRKQTMAVGIALAALCFPFTVIVSHTALEIFVLAILGISFSLLLAPALPE 214

Query: 278 LGHYVTQKGGGAYGQIYALWNMAYSIGMFVGPVIAGLLFELFEFRNTLIIF 328
           L +   + G  AYG ++ ++N AYSIGMF GP+++G L +LF   NT  IF
Sbjct: 215 LTYLADKNGVHAYGILFTIYNTAYSIGMFFGPMLSGSLSDLFGLTNTFYIF 265



>gi|489640952|ref|WP_003545392.1| MFS transporter [Desulfotomaculum nigrificans]
 gi|323531167|gb|EGB21072.1| major facilitator superfamily MFS_1 [Desulfotomaculum nigrificans
           DSM 574]
          Length = 395

 Score = 96.7 bits (239), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 82/353 (23%), Positives = 163/353 (46%), Gaps = 28/353 (7%)

Query: 1   FAVLSDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAML 60
             +LSD+Y  +++ M FG+ ++++ ++ F +A S   L++ R+ QG A GA WT   A++
Sbjct: 61  LGILSDRYGRKRV-MFFGLAAISLSTLGFALAKSIVWLIITRLLQGFAAGAIWTACPALI 119

Query: 61  ADRFGSGPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVIS 120
           AD +    + G  MG + +A+              Y+  GY               + ++
Sbjct: 120 ADLYPPEQR-GSKMGLMSAASGFGFLVGPAAGGLLYEAGGYHLPFLICIILAILAVIFVA 178

Query: 121 MIVEPSDLSTYQSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI 180
           +++ P D                   +N     +S      +     +     ++++ S+
Sbjct: 179 VVI-PGD-------------------SNPVKMPKSSRPLLEVLRIRGVWQGSTMVLIGSV 218

Query: 181 LAG-LEPILPIYLRKEFDADASLIGLIFIAIAIPTFLS-PAVGYISFYIGQRRTCGIGMI 238
             G ++P+LP Y   +F A   +IGL+F  I++    S P +G +S ++G+ R   IG++
Sbjct: 219 GFGFIDPLLPGYFADKFAASPGVIGLLFGVISLFHVSSAPVIGKLSDHMGRVRLIKIGLV 278

Query: 239 LMGIATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGG----GAYGQIY 294
              +  PLI+L +      + +   G T+ ++ TPT+PLL   V  + G     +YG  +
Sbjct: 279 TTALVVPLITLAANAVTSAITMGLMGITFGLMLTPTMPLLADSVMPRRGSSDDSSYGVAF 338

Query: 295 ALWNMAYSIGMFVGPVIAGLLFELFEFRNTLIIFGAAVLAITPLIFAGRLRDH 347
            ++N A+S+G  +GP+I G   E ++  +  + +   +L    + F  +  +H
Sbjct: 339 GIYNGAFSLGYLIGPLIGGAWVEFYDLPSLFVAYSIVLLLTGLVTFRHKPYEH 391



>gi|226311572|ref|YP_002771466.1| hypothetical protein BBR47_19850 [Brevibacillus brevis NBRC 100599]
 gi|501989400|ref|WP_012685698.1| arabinose ABC transporter permease [Brevibacillus brevis]
 gi|226094520|dbj|BAH42962.1| hypothetical membrane protein [Brevibacillus brevis NBRC 100599]
          Length = 405

 Score = 95.5 bits (236), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 87/342 (25%), Positives = 157/342 (45%), Gaps = 26/342 (7%)

Query: 1   FAVLSDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAML 60
           F  +SD+   R + ++ G+L LA  ++LF  + +   L+ AR  QG A  A+W  +LA+L
Sbjct: 68  FGPISDRMGRRTM-LLIGLLGLAASTLLFAFSETMGLLITARFVQGIAAAATWPTALALL 126

Query: 61  ADRFGSGPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVIS 120
           AD F S  + G VMG  L+A +             ++   +               +++ 
Sbjct: 127 ADLFPSKMR-GTVMGIALTAISTGTLLGAPIGGWLFEISDHRMPFLAAAAFTVINIVLVY 185

Query: 121 MIVEPSDLSTYQSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI 180
           + ++     T                 +++ H     +   I +  +I I   I+++A I
Sbjct: 186 LFLKEDATKT----------------VSEKLH-----VGGFIRNPQVIFIA-GIVLLAEI 223

Query: 181 -LAGLEPILPIYLRKEFDADASLIGLIFIAIAIP-TFLSPAVGYISFYIGQRRTCGIGMI 238
            L  LEP LP++  ++     + IGL+F  + +    ++P  G +S  +   +    G++
Sbjct: 224 SLCLLEPTLPVFFTEKLSMTPTTIGLLFGVMTLAYGMIAPVAGSLSGRMNPYKLMFGGIM 283

Query: 239 LMGIATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWN 298
            + +  P ++     W  +L +   GA+     +PTL  LG  + Q G GAYG  Y+L+N
Sbjct: 284 TLAVFLPFLAWADSLWQAMLAMALIGASIGFTLSPTLGTLGAIIDQGGSGAYGTAYSLFN 343

Query: 299 MAYSIGMFVGPVIAGLLFELFEFRNTLIIFGAAVLAITPLIF 340
           M + IGM  GP+  G+L +L    + L+I  A++L    L+F
Sbjct: 344 MFHGIGMVAGPLAGGILTDLLPVSSALLIVAASILGFGILLF 385



>gi|511006063|gb|EPB87383.1| hypothetical protein HMPREF1544_05809 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 532

 Score = 93.6 bits (231), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 83/334 (24%), Positives = 147/334 (44%), Gaps = 20/334 (5%)

Query: 1   FAVLSDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAML 60
           F  L D+   R++PM+ G ++    ++LF ++ +Y  L++AR  QG +    WT+ L ++
Sbjct: 120 FGWLGDRIKQRRLPMLLGTIASMAANLLFMLSTTYPMLLIARFLQGVSNACVWTMCLCLI 179

Query: 61  ADRFGSGPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVIS 120
           AD +    +LGV MG  L                 Y   G+               L+  
Sbjct: 180 ADNWPKD-QLGVQMGK-LVGFYPLGMMVGLPAGVLYSELGHEAPFIASMILSAIDLLMRV 237

Query: 121 MIVEPS-------DLSTYQSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLA 173
           +I+E S       +    Q               N      S   W  +     + + LA
Sbjct: 238 VIIERSSAPKEWFEEQDLQRDKEKHTKTVDDDLQNSPEPGTSRVTWVQLLKQPRLIVSLA 297

Query: 174 II-VVASILAGLEPILPIYLRKEFDADASLIGLIFIAIAIPTFLSPAV-GYISFYIGQRR 231
           +  +VA++++  EP L + L +E+  +A+   LI +A  IP+ ++  V G++    G + 
Sbjct: 298 LTAIVATVMSAFEPTLSMRLAQEWGFNAAGCSLIVLAYMIPSIIASIVCGWLCDRYGTKV 357

Query: 232 TCGIGMILMGIATPLISLPSK----FWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGG 287
              + ++L   +  +I  PS+    FWL+V  L+  G T +    P  P +   V ++ G
Sbjct: 358 VALVSLLLATPSCLMIGFPSQERGSFWLLVPILIMGGITIAGCQAPVFPEIAKVVDKENG 417

Query: 288 GA-----YGQIYALWNMAYSIGMFVGPVIAGLLF 316
            +       + Y+L+N AY +GM VGP+IAG L+
Sbjct: 418 SSNSSDGLARSYSLFNAAYGVGMCVGPLIAGYLY 451



>gi|72005253|ref|XP_782213.1| PREDICTED: probable vesicular acetylcholine transporter-A-like
           [Strongylocentrotus purpuratus]
          Length = 561

 Score = 93.2 bits (230), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 89/353 (25%), Positives = 151/353 (42%), Gaps = 36/353 (10%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            IPMM G++ + + + +F    SY  L  AR  QG     + T  LAM+ADRF S  +  
Sbjct: 134 DIPMMIGLVVMFVATTVFAFGKSYGVLFFARSLQGVGSAFADTAGLAMIADRFTSEHERS 193

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             Y++ G +              L++ ++V+P     +
Sbjct: 194 RALGIALAFISFGCLVAPPFGGILYEFAGKIVPFMILALISLSDGLMLLVVVKPYAERRW 253

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASILAGLEPILPIY 191
           Q                     +   I+ LI D  I     A+ +    LA LEP + ++
Sbjct: 254 Q-------------------MPRGTPIYKLIIDPYIAVAAGALSMSNVALAFLEPTMALW 294

Query: 192 LRKEFDADASLIGLIFIAIAIPTFLSPAVGYI-SFYIGQRR------TCGIGMILMGIAT 244
           +     A +   G+I++    P F     G I +  +  R          IGM ++G++T
Sbjct: 295 MEDTMQAVSWQTGIIWL----PAFFPHVFGVILTVKLASRAPHYQWLMAAIGMTIIGLST 350

Query: 245 PLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIG 304
            ++     F ++++PL       ++V T  LP+LG+ V  +    YG IYA+ +++YS+ 
Sbjct: 351 FIVPFCKTFGVLIVPLCGICFGIALVDTALLPILGYIVDVRHNPVYGSIYAIADISYSLA 410

Query: 305 MFVGPVIAGLLFELFEFRNTLIIFGAAVLAITPLIFAGRL------RDHADRI 351
             +GP++AG + +   F N  II G   LA  PL+F  R       + H D I
Sbjct: 411 YAIGPILAGQIIQGVGFLNLNIIIGVFTLAYVPLLFLLRRVYDMKPQSHEDTI 463



>gi|333980435|ref|YP_004518380.1| major facilitator superfamily protein [Desulfotomaculum kuznetsovii
           DSM 6115]
 gi|503590013|ref|WP_013824089.1| major facilitator superfamily protein [Desulfotomaculum
           kuznetsovii]
 gi|333823916|gb|AEG16579.1| major facilitator superfamily MFS_1 [Desulfotomaculum kuznetsovii
           DSM 6115]
          Length = 404

 Score = 93.2 bits (230), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 94/364 (25%), Positives = 157/364 (43%), Gaps = 42/364 (11%)

Query: 6   DKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFG 65
           D+Y  R + M+ GM  L I +++F I+ S W LV++R+ QG A  A+W+  LA++A  + 
Sbjct: 65  DRYGYRPV-MVLGMAGLTISTLIFIISRSVWLLVISRLLQGIAAAATWSAGLALVAVLYP 123

Query: 66  SGPKL-GVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVE 124
             P L G  MG V+++               YQ+ GY               L++     
Sbjct: 124 --PHLRGQKMGIVMTSTGLGTIIGPVLGGTLYQFAGYAFPFLVTAGAGALLTLLLWFSPL 181

Query: 125 PSDLSTYQSVXXXXXXXXXXXXANQEFHTQSPSIWN-LIFDWNIINICLAIIVVASILAG 183
           P +                          Q P  W   +FD NI    ++I V  S   G
Sbjct: 182 PKN-------------------GTSTGREQLP--WQQFLFDRNIF-WGVSITVTGSFGFG 219

Query: 184 L-EPILPIYLRKEFDADASLIGLIFIAIAIP-TFLSPAVGYISFYIGQRRTCGIGMILMG 241
           L EP+LPI L K F   ++ +GL+F A+++      P  G +S  +G++     G++   
Sbjct: 220 LLEPLLPIDLHKRFGLGSAGVGLLFGALSLSFALFQPLFGILSDRLGRKPLIVAGLLGTA 279

Query: 242 IATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYV------------TQKGGGA 289
              P + +     LV   +   G T    +TP LPLL   +            T +  G 
Sbjct: 280 ATVPWLVVAPNVKLVTAAMALLGLTTGAYSTPALPLLAESMEKIHPKHPADGKTGRANGL 339

Query: 290 YGQIYALWNMAYSIGMFVGPVIAGLLFELFEFRNTLIIFGAAVLAITPLIFAGRLRDHAD 349
           YG  Y + N AYS+G+  GP++   L + ++    ++++ +A+L  T +    RL++   
Sbjct: 340 YGTTYGIANTAYSVGLLTGPLVGTFLAQRWDILTVMLLY-SALLGATAIGVLARLQETLK 398

Query: 350 RIQI 353
             +I
Sbjct: 399 AKKI 402



>gi|398398676|ref|XP_003852795.1| hypothetical protein MYCGRDRAFT_40588 [Zymoseptoria tritici IPO323]
 gi|339472677|gb|EGP87771.1| hypothetical protein MYCGRDRAFT_40588 [Zymoseptoria tritici IPO323]
          Length = 475

 Score = 92.0 bits (227), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 85/353 (24%), Positives = 146/353 (41%), Gaps = 29/353 (8%)

Query: 1   FAVLSDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAML 60
           F  L+D+  +R++P + G+L+L   + +  + NS       R+ QG +    W   LA+L
Sbjct: 84  FGYLADRNDSRQVPFLGGLLALGASTAMLCVGNSIAIFAAGRVLQGISAAVVWCTGLALL 143

Query: 61  ADRFGSGPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVIS 120
            D  G   ++GV MG V  + +             ++  GY               ++  
Sbjct: 144 VDAVGP-EEIGVAMGYVGLSMSLAVMLAPLLAGVVFETAGYYAVYAMCFGLIGVDIVMRI 202

Query: 121 MIVEPSDLSTYQSVXXXXXXXXXXXXAN-----QEFHTQSPSIWNLIFDWNIINICLAII 175
           +++EP +   +               +      + F    P I  L+    I+ I  A  
Sbjct: 203 VMIEPRNARRWLKTEDIATPPETSPPSTPPSKIRLFLHHLPPIVTLLSSRRILAILWACT 262

Query: 176 VVASILAGLEPILPIYLRKEFDADASLIGLIFIAIAIPTFLSPAVGYISFYIGQRRTCGI 235
           + +S++   + ILP+++R  F   +   GLIF+ I I + L P +G ++   G R     
Sbjct: 263 MASSLMTSFDAILPLFVRDTFSWSSLGAGLIFLPIVIASLLGPWIGGLADRYGPRWLATS 322

Query: 236 GMILMGIATPLI---------SLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKG 286
           G IL   ATP +         SL  K  L    L+  G   ++   P +  + + V  K 
Sbjct: 323 GFIL---ATPFLVLLRLVDHNSLSQKVMLCAF-LVVIGLGLNLALVPLMAEITYAVQAKA 378

Query: 287 G----------GAYGQIYALWNMAYSIGMFVGPVIAGLLFELFEFRNTLIIFG 329
                      GAY Q Y L+NMA++ G  +GP++AGL+ E   +    +I G
Sbjct: 379 ARAEVGAFGRNGAYAQAYGLFNMAWAAGSMIGPLLAGLIVEAHGWSLATLILG 431



>gi|491173649|ref|WP_005032015.1| major facilitator superfamily MFS_1 [Holophaga foetida]
 gi|372012475|gb|EHP13045.1| major facilitator superfamily MFS_1 [Holophaga foetida DSM 6591]
          Length = 385

 Score = 91.7 bits (226), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 77/327 (23%), Positives = 143/327 (43%), Gaps = 25/327 (7%)

Query: 4   LSDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADR 63
           L D++  R+  M++G++ L   ++LF  + S+W L+VAR+ QG +  A+WT  +A++AD 
Sbjct: 67  LGDRFG-RRYTMLWGLVGLGGTTLLFAFSRSFWLLLVARVLQGLSATATWTSGMALMADH 125

Query: 64  FGSGPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIV 123
           + S  + G  M T  +                 +++G                L  + ++
Sbjct: 126 WPSEHR-GKAMSTCFAFANLGVFLGPPIAGFLAEHFGLRAPFLLAGGLAILDALARAFLL 184

Query: 124 EPSDLSTYQSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASILAG 183
           E +     +++               E+         L+ +  +     A  + A I A 
Sbjct: 185 EDAPKEKGETL---------------EYRA-------LLKNGTVRLFAGATALGAGIWAT 222

Query: 184 LEPILPIYLRKEFDADASLIGLIFIAIAI-PTFLSPAVGYISFYIGQRRTCGIGMILMGI 242
           LE  LP++  +      S IGL F   A+  T  SP  G ++   G R    IG++L+  
Sbjct: 223 LESTLPLHFDRVMGWRPSSIGLCFAVAALGHTLTSPLAGALADRYGHRGILRIGLVLILF 282

Query: 243 ATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYS 302
             PL       W+++  +   G   S+V +P  P +   V + G  +Y  ++ L N++Y+
Sbjct: 283 LAPLPVFFQASWIILGSMAGLGLATSLVMSPASPAVTDAVERMGSTSYATVFGLLNLSYA 342

Query: 303 IGMFVGPVIAGLLFELFEFRNTLIIFG 329
           +GM VGP++     E    R+T+++ G
Sbjct: 343 MGMMVGPILGSAGVEALGIRSTMLLLG 369



>gi|282164825|ref|YP_003357210.1| MFS transporter [Methanocella paludicola SANAE]
 gi|502664931|ref|WP_012900901.1| MFS transporter permease [Methanocella paludicola]
 gi|282157139|dbj|BAI62227.1| MFS transporter [Methanocella paludicola SANAE]
          Length = 402

 Score = 90.9 bits (224), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 55/178 (30%), Positives = 98/178 (55%), Gaps = 1/178 (0%)

Query: 158 IWNLIFDWNIINICLAIIVVASILAGLEPILPIYLRKEFDADASLIGLIFIAIAIPTFLS 217
           I +++ D  I+ +   I++ + ++A LEP LP++L+ +       IG++F  +A+ + + 
Sbjct: 204 IRSMLKDPVILTVGGLILITSGVIAMLEPTLPLFLQMQMGTSPGAIGILFGILALASVIF 263

Query: 218 PAVGY-ISFYIGQRRTCGIGMILMGIATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLP 276
             V Y +S   G++R    GM+L  IA P ++LPS F L  + +   GA  S++ +    
Sbjct: 264 APVAYKLSDAFGRKRVILAGMVLTAIALPTLALPSSFILEAVAMAVLGAVLSVMLSSAPQ 323

Query: 277 LLGHYVTQKGGGAYGQIYALWNMAYSIGMFVGPVIAGLLFELFEFRNTLIIFGAAVLA 334
            +   V ++G  AYG +YA +N+A S GM VGPV+ G+L         L++  A ++A
Sbjct: 324 EMTDAVDRRGSNAYGSVYAYYNIAMSFGMMVGPVVGGVLAGYLGLALALVVCAAGLVA 381



>gi|472587974|gb|EMS25470.1| MFS amine transporter [Rhodosporidium toruloides NP11]
          Length = 492

 Score = 90.5 bits (223), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 92/395 (23%), Positives = 167/395 (42%), Gaps = 49/395 (12%)

Query: 4   LSDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADR 63
           ++ K   R+IP++ G +S+A   +LF     +  ++VAR+ QG +G   WT  LA++ D 
Sbjct: 79  IASKTSNRQIPLLGGAVSMAGSIVLFMECKGFAPMLVARLWQGLSGTILWTFGLALVIDS 138

Query: 64  FGSGPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIV 123
                 +G  +G V+S  +             Y++ G+               ++  +I+
Sbjct: 139 VPE-QHVGKSLGIVMSGLSVGEAIGPPIGGALYRHLGWRAPFIFLLVLLVVDIVLRLLII 197

Query: 124 E------------------------PSDLSTYQSVXXXXXXXXXXXXANQEFHT------ 153
           E                        P+  S  + V               E  T      
Sbjct: 198 EKKTALMWIKRGVTIRGFSAPDYPPPNSPSIEEVVVPLAHSSTVTSSEATEVATPVLPKS 257

Query: 154 --QSPSIWNLIFDWNII-NICLAIIVVASILAG-----LEPILPIYLRKEFDADASLIGL 205
                ++W  +  W ++ N   A+ +  + L G     LE  + +Y+++ +  D    GL
Sbjct: 258 EHDGANLWETM--WRLVHNPRAAVALSMAFLYGADFGLLEAGMVLYVKEHYGLDEQGAGL 315

Query: 206 IFIAIAIPTFL-SPAVGYISFYIGQRRTCGIGMILMGIATPLISLPSKFWLVVLPLLFFG 264
           IF+A+ IP+F+ +P  G+++   G +    +GM ++  A PL+ +     L +  L   G
Sbjct: 316 IFLAVVIPSFIIAPLAGWLTDLYGSKWPATVGMAIVTAAFPLLIIRGPLPLFIFFLALIG 375

Query: 265 ATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGMFVGPVIAGLLFELFEFRN- 323
              S V+TPT   L    T   G    Q++A +N+A+S+G FVGP+I G L      R+ 
Sbjct: 376 VGLSAVSTPTTHDLNVAATATPGATSAQVFAAFNLAFSLGSFVGPIIGGELMSGLSTRDG 435

Query: 324 --TLIIFGAAVLAI-TPLIF---AGRLRDHADRIQ 352
              +++ GA ++A+ TP +     GRL +     +
Sbjct: 436 FVAIVVIGAGLVALCTPFVLLFTGGRLGEKRRETK 470



>gi|470482622|ref|XP_004343627.1| permease (Major facilitator superfamily ) protein, putative
           [Acanthamoeba castellanii str. Neff]
 gi|440799451|gb|ELR20496.1| permease (Major facilitator superfamily ) protein, putative
           [Acanthamoeba castellanii str. Neff]
          Length = 329

 Score = 90.1 bits (222), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 85/326 (26%), Positives = 145/326 (44%), Gaps = 35/326 (10%)

Query: 40  VARIAQGAAGGASWTLSLAMLADRFGSGPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYW 99
           +AR  QGA+  A+W   LA+LAD + S  +LG  MG V++A +             YQ  
Sbjct: 1   MARFLQGASAAATWVAGLALLADTYPSH-ELGSAMGLVMTAMSLGMLLGPPFGGFVYQLG 59

Query: 100 GYVXXXXXXXXXXXXXXLVIS-------------------MIVEPSDLSTYQSVXXXXXX 140
           G                 V +                   ++ +P  +  Y S       
Sbjct: 60  GIAILDAVVRVLLITERTVPAHSMPVLGEEEGDEPTPDTYLLHQPYKVLGYSSGDDRVYT 119

Query: 141 XXXXXXANQEFHT---QSPSIWNLIFDWNIINICLAIIVVASILAGLEPILPIYLRKEFD 197
                   +       + P+ + ++F+ N++   + + + A+ +  LEP LP  L ++F+
Sbjct: 120 DEDLEKLREHLPAPARRPPTFFAIMFNRNVLVTNVIVALGANAITVLEPTLPAVLDEKFN 179

Query: 198 ADASLIGLIFIAIAIPTFLS-PAVGYISFYIGQRRTCGIGMILMGIATPLI----SLPSK 252
           + A++IGL F+ +A+   LS P  G++S  IG      IG+  + IA  L+     + + 
Sbjct: 180 SSAAVIGLAFMVMALAHGLSAPVFGWLSDKIGGPVLMLIGLSSLSIALVLLHQIAEINTA 239

Query: 253 FWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGMFVGPVIA 312
             LV  P   +    +++  PT       V + GGGAYGQ+YA++N  Y++GM  GP+I 
Sbjct: 240 QTLVSPPNSLWLTLLALLRPPT-------VDEMGGGAYGQVYAIFNWFYALGMLGGPLIG 292

Query: 313 GLLFELFEFRNTLIIFGAAVLAITPL 338
           G L +   FR  L++F A+     P+
Sbjct: 293 GALVDWLSFRAMLLVFAASCACFVPV 318



>gi|498957625|ref|XP_004524182.1| PREDICTED: vesicular acetylcholine transporter-like [Ceratitis
           capitata]
          Length = 606

 Score = 89.7 bits (221), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 85/346 (24%), Positives = 148/346 (42%), Gaps = 30/346 (8%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            +PMM G+  +   + +F    SY  L  AR  QGA    + T  LAM+ADRF    +  
Sbjct: 125 DLPMMIGLTIMFFSTAMFACGRSYSLLFFARSLQGAGSAFADTSGLAMIADRFTEENERS 184

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             YQ+ G                L++ ++++P      
Sbjct: 185 QALGIALAFISFGCLVAPPFGGALYQFAGKEVPFLILALVCLLDGLMLLLVMKPVKDQIR 244

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI-LAGLEPILPI 190
           QS               +E   QS  IW L+ D   I +C   + ++++ LA LEP + +
Sbjct: 245 QS---------------KEVQQQSIPIWRLLMD-PYIAVCAGALTMSNVALAFLEPTISL 288

Query: 191 YLRKEFDADASLIGLIFIAIAIPTFLSPAVGYISFYIGQRR-------TCGIGMILMGIA 243
           ++      D   IG++++    P F    +G +      R+          +G+ L G +
Sbjct: 289 WMEDNLTTDNWKIGMVWL----PAFFPHVLGVVITVKMARKYPHHQWLMAAVGLALEGFS 344

Query: 244 TPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSI 303
             +I   S + ++++P+       +++ T  LP LG+ V  +    YG IYA+ +++YSI
Sbjct: 345 CFIIPFSSSYKVLMIPICIICFGIALIDTALLPTLGYLVDVRYVSVYGSIYAIADISYSI 404

Query: 304 GMFVGPVIAGLLFELFEFRNTLIIFGAAVLAITPLIFAGRLRDHAD 349
              VGP+IAG + E   F     I   + L   P++   +LR+  D
Sbjct: 405 AYAVGPIIAGGVVEAIGFTALNFIIAFSNLLYVPML--RKLRNIYD 448



>gi|195078189|ref|XP_001997230.1| GH23496 [Drosophila grimshawi]
 gi|193905757|gb|EDW04624.1| GH23496 [Drosophila grimshawi]
          Length = 573

 Score = 89.0 bits (219), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 87/346 (25%), Positives = 150/346 (43%), Gaps = 30/346 (8%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            IPMM G+  +   + +F   +SY  L  AR  QGA    + T  LAM+ADRF    +  
Sbjct: 125 DIPMMIGLTIMFFSTAVFACGSSYSVLFFARSLQGAGSAFADTAGLAMIADRFTEENERS 184

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             YQ+ G                L++ ++++P      
Sbjct: 185 QALGIALAFISFGCLVAPPFGGALYQFAGKEVPFLILAMVCLLDGLMLLLVMKPVKEQLK 244

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI-LAGLEPILPI 190
           QS               +E  TQ+  IW L+ D   I +C   + ++++ LA LEP + +
Sbjct: 245 QS---------------KEVQTQTIPIWRLLMD-PYIAVCAGALTMSNVALAFLEPTISL 288

Query: 191 YLRKEFDADASLIGLIFIAIAIPTFLSPAVGYISFYIGQRR-------TCGIGMILMGIA 243
           ++      +   IG++++    P F    +G +      R+           G+ L G +
Sbjct: 289 WMEDNMTTENWKIGMVWL----PAFFPHVLGVVITVKMARKYPQHQWLMAAGGLALEGFS 344

Query: 244 TPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSI 303
             +I   S + +++LP+       +++ T  LP LG+ V  +    YG IYA+ +++YSI
Sbjct: 345 CFIIPFCSGYKMLMLPICVICFGIALIDTALLPTLGYLVDVRYVSVYGSIYAIADISYSI 404

Query: 304 GMFVGPVIAGLLFELFEFRNTLIIFGAAVLAITPLIFAGRLRDHAD 349
              VGP+IAG + E   F     +   A LA  P++   +LR+  D
Sbjct: 405 AYAVGPIIAGGVVEAIGFTALNFLIAFANLAYVPVL--RKLRNIYD 448



>gi|390177770|ref|XP_003736484.1| GA17179 [Drosophila pseudoobscura pseudoobscura]
 gi|388859189|gb|EIM52557.1| GA17179 [Drosophila pseudoobscura pseudoobscura]
          Length = 581

 Score = 88.2 bits (217), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 84/346 (24%), Positives = 149/346 (43%), Gaps = 30/346 (8%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            +PMM G+  +   + +F   +SY  L  AR  QGA    + T  LAM+ADRF    +  
Sbjct: 125 DLPMMIGLTIMFFSTAVFACGSSYSVLFFARSLQGAGSAFADTAGLAMIADRFTEENERS 184

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             YQ+ G                +++ ++++P      
Sbjct: 185 QALGIALAFISFGCLVAPPFGGALYQFAGKEVPFLILAFVCALDGVMLLLVMKPLKEQIR 244

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI-LAGLEPILPI 190
           QS               +E   Q   IW L+ D   I +C   + ++++ LA LEP + +
Sbjct: 245 QS---------------KEVQDQVIPIWRLLMD-PYIAVCAGALTMSNVALAFLEPTISL 288

Query: 191 YLRKEFDADASLIGLIFIAIAIPTFLSPAVGYISFYIGQRR-------TCGIGMILMGIA 243
           ++      D   IG++++    P F    +G +      R+          IG+ L G +
Sbjct: 289 WMEDTMTTDNWKIGMVWL----PAFFPHVLGVVITVKMARKYPQHQWLMAAIGLALEGFS 344

Query: 244 TPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSI 303
             +I   + + +++LP+       +++ T  LP LG+ V  +    YG IYA+ +++YSI
Sbjct: 345 CFIIPFCTGYKMLMLPICVICFGIALIDTALLPTLGYLVDVRYVSVYGSIYAIADISYSI 404

Query: 304 GMFVGPVIAGLLFELFEFRNTLIIFGAAVLAITPLIFAGRLRDHAD 349
              VGP+IAG + E   F     +   + LA  P++   +LR+  D
Sbjct: 405 AYAVGPIIAGGVVEAIGFTALNFMIAFSNLAYVPVL--RKLRNIYD 448



>gi|255955115|ref|XP_002568310.1| Pc21g12830 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211590021|emb|CAP96180.1| Pc21g12830 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 446

 Score = 87.8 bits (216), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 81/330 (24%), Positives = 147/330 (44%), Gaps = 34/330 (10%)

Query: 6   DKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFG 65
           DKY TRK P++ G +++A+ ++LF  A++ W L++AR+ QG +G     L L+M+A+   
Sbjct: 82  DKYRTRKAPLVCGFIAMALATVLFISASNIWVLLLARVCQGLSGAVVGVLGLSMIAET-S 140

Query: 66  SGPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEP 125
           S   LG  M    ++ T             +  +G V              ++  +IV+ 
Sbjct: 141 SPEHLGSHMACGSASLTWGMLCGPMTGGFLFSRFGTVGAFGVPMALLVVDIVLRMLIVQE 200

Query: 126 SDLST--YQSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASILAG 183
            +  T  +Q              +   +H   P +  L+F         +++V++SIL+ 
Sbjct: 201 DEDETKFHQQEDSPLLDSVSENTSLSFYHFLHPIMLGLVF---------SVLVISSILSA 251

Query: 184 LEPILPIYLRKEFDADASLIGLIFIAIAIPTFLSPAVGYISFYIGQRRTCGIGMILMGIA 243
           +E  LP+Y+   +   +   GL+F+ + IP+ LS  + +   +   R     G  LM  A
Sbjct: 252 IETTLPLYVLDTYHWSSLGAGLVFLPLTIPSVLSIPIAHFVRHFTPRTVVVTGFWLM--A 309

Query: 244 TPLISL------PSKFWLVVLPLLFFGATYSIVTTPTLPLLG------------HYVTQK 285
            P+I+L           + ++ LLF       +TT    ++G            H +T++
Sbjct: 310 VPMIALRWTEANTVHHQVAIISLLFIVGV--CLTTVQAIIMGDVSNAVRKIESLHGITEE 367

Query: 286 GGGAYGQIYALWNMAYSIGMFVGPVIAGLL 315
                G+ YAL NMA++ G  +GP+  GL+
Sbjct: 368 NSSGLGRAYALCNMAFAAGQTLGPMAGGLI 397



>gi|17137160|ref|NP_477138.1| VAChT [Drosophila melanogaster]
 gi|34924873|sp|O17444.2|VACHT_DROME RecName: Full=Vesicular acetylcholine transporter; Short=VAChT
 gi|23171672|gb|AAF55587.2| VAChT [Drosophila melanogaster]
 gi|283436232|gb|ADB13439.1| MIP14469p [Drosophila melanogaster]
          Length = 578

 Score = 84.7 bits (208), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 84/346 (24%), Positives = 149/346 (43%), Gaps = 30/346 (8%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            +PMM G+  +   + +F   +SY  L  AR  QGA    + T  LAM+ADRF    +  
Sbjct: 125 DLPMMIGLTIMFFSTAVFACGSSYSVLFFARSLQGAGSAFADTAGLAMIADRFTEENERS 184

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             YQ+ G                L++ ++++P   +  
Sbjct: 185 QALGIALAFISFGCLVAPPFGGALYQFAGKEVPFLILALVCLLDGLMLLLVMKPVKEAMK 244

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI-LAGLEPILPI 190
           QS               ++   Q   IW L+ D   I +C   + ++++ LA LEP + +
Sbjct: 245 QS---------------KDVQDQVIPIWRLLMD-PYIAVCAGALTMSNVALAFLEPTISL 288

Query: 191 YLRKEFDADASLIGLIFIAIAIPTFLSPAVGYISFYIGQRR-------TCGIGMILMGIA 243
           ++      D   IG++++    P F    +G +      R+           G+ L G +
Sbjct: 289 WMEDNMTTDNWKIGMVWL----PAFFPHVLGVVITVKMARKYPQHQWLMAAGGLALEGFS 344

Query: 244 TPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSI 303
             +I   S + +++LP+       +++ T  LP LG+ V  +    YG IYA+ +++YSI
Sbjct: 345 CFIIPFCSGYKMLMLPICVICFGIALIDTALLPTLGYLVDVRYVSVYGSIYAIADISYSI 404

Query: 304 GMFVGPVIAGLLFELFEFRNTLIIFGAAVLAITPLIFAGRLRDHAD 349
              VGP+IAG + E   F     +   + LA  P++   +LR+  D
Sbjct: 405 AYAVGPIIAGGVVEAIGFTALNFLIAFSNLAYVPVL--RKLRNIYD 448



>gi|157126210|ref|XP_001660850.1| vesamicol binding protein, putative [Aedes aegypti]
 gi|108873321|gb|EAT37546.1| AAEL010462-PA [Aedes aegypti]
          Length = 582

 Score = 84.3 bits (207), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 85/349 (24%), Positives = 149/349 (42%), Gaps = 36/349 (10%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            +PMM G+L + + +++F    SY  L  AR  QG     + T  LAM+ADRF    +  
Sbjct: 121 DLPMMVGLLIMFLSTMVFACGRSYSMLFFARSLQGVGSAFADTSGLAMIADRFTEEAERS 180

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             YQ+ G                 ++ ++++P      
Sbjct: 181 KALGIALAFISFGCLVAPPFGGALYQFAGKEVPFVILALISLMDGFMLLLVMKP------ 234

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI-LAGLEPILPI 190
                            QE    +  IW L+ D   I +C   + ++++ LA LEP + +
Sbjct: 235 ---------IKEILAERQEVKQDTIPIWRLLID-PYIAVCAGALTMSNVALAFLEPTISL 284

Query: 191 YLRKEFDADASLIGLIFIAIAIPTFLSPAVGYISFYIGQRR-------TCGIGMILMGIA 243
           ++      D   IG++++    P F     G +      R+           G+ L G+ 
Sbjct: 285 WMEDTLTNDNWKIGMVWL----PAFFPHVFGVVITVKMARKYPEKQWIMAAGGLALEGLC 340

Query: 244 TPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSI 303
             +I   S + ++++P+       +++ T  LP LG+ V  +    YG IYA+ +++YSI
Sbjct: 341 CFMIPFSSSYIMLMIPICGICFGIALIDTALLPTLGYLVDVRYVSVYGSIYAIADISYSI 400

Query: 304 GMFVGPVIAGLLFELFEFRNTLIIFGAAVLAITPLIFA---GRLRDHAD 349
              VGP+IAG + E   F  T + FG   +A + L++A   G LR+  D
Sbjct: 401 AYAVGPIIAGGVVEAIGF--TALNFG---IAFSNLLYAPVLGYLRNIYD 444



>gi|493727692|ref|WP_006677036.1| arabinose ABC transporter permease [Paenibacillus dendritiformis]
 gi|374390544|gb|EHQ61892.1| hypothetical protein PDENDC454_12685 [Paenibacillus dendritiformis
           C454]
          Length = 406

 Score = 84.0 bits (206), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 89/175 (50%), Gaps = 4/175 (2%)

Query: 148 NQEFHTQSPS---IWNLIFDWNIINICLAIIVVASILAGLEPILPIYLRKEFDADASLIG 204
            +   T  P+    ++L+    ++ I   I+   + L  LEP+LP+YL + F  D   +G
Sbjct: 189 KEPVRTNRPAQGGTFSLLRHKTVLFIACVILAAETTLTMLEPLLPLYLTERFQMDPLALG 248

Query: 205 LIFIAIAIP-TFLSPAVGYISFYIGQRRTCGIGMILMGIATPLISLPSKFWLVVLPLLFF 263
           L+F  + +   F++P  G +S      R   IG+  M +  P I++     LV+      
Sbjct: 249 LLFGLMTLCYGFIAPVAGAMSARFNPFRLMVIGVAAMAVVLPFIAVAGHPVLVLAAGCLI 308

Query: 264 GATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGMFVGPVIAGLLFEL 318
           GA      +PTLP LG  V +   G YG  YAL+NM +++GM +GP++ G+L ++
Sbjct: 309 GAAVGFTLSPTLPTLGAIVDKGDEGDYGVAYALFNMIHAVGMMLGPLVGGVLTDI 363



>gi|195431952|ref|XP_002063991.1| GK15611 [Drosophila willistoni]
 gi|194160076|gb|EDW74977.1| GK15611 [Drosophila willistoni]
          Length = 612

 Score = 84.0 bits (206), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 80/323 (24%), Positives = 136/323 (42%), Gaps = 24/323 (7%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            IPM  G + + + +I+F    SY+ L VAR  QG     S    + MLADRF    + G
Sbjct: 269 SIPMFAGFVIMFLSTIIFAFGRSYFVLFVARALQGIGSSCSSVSGMGMLADRFTDDKERG 328

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             MG  L                 Y++ G                L+   +++PS     
Sbjct: 329 NAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLILAALALGDGLLQLFMLQPSI---- 384

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASILAGLEPILPIY 191
                            Q+  ++ PS+ +LI D  I+    AI      +A LEP LP++
Sbjct: 385 -----------------QKAESEPPSLKSLISDPYILIAAGAITFANMGIAMLEPSLPLW 427

Query: 192 LRKEFDADASLIGLIFIAIAIPTFLSPAV-GYISFYIGQRRTCGIGMILMGIATPLISLP 250
           +     A     G+ F+  +I   +   + G +   IG+     +G+I++G     I + 
Sbjct: 428 MVDNMGATRWEQGVAFLPASISYLIGTNLFGPLGHRIGRWFAACLGLIIIGACLIFIPMA 487

Query: 251 SKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGMFVGPV 310
           +    +++P    G    +V +  +P LG+ V  +    YG +YAL ++A+ +G  VGP 
Sbjct: 488 TSITHLIIPNAGLGFAIGMVDSSMMPELGYLVDIRHSAVYGSVYALGDVAFCVGFAVGPA 547

Query: 311 IAGLLFELFEFRNTLIIFGAAVL 333
           ++G L +   F    ++FG A+L
Sbjct: 548 LSGSLVKSIGFE--WMLFGIAIL 568



>gi|195484954|ref|XP_002090891.1| GE13356 [Drosophila yakuba]
 gi|194176992|gb|EDW90603.1| GE13356 [Drosophila yakuba]
          Length = 498

 Score = 84.0 bits (206), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 81/324 (25%), Positives = 135/324 (41%), Gaps = 24/324 (7%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            IPM  G + + + +I+F    SY  L VAR  QG     S    + MLADRF    + G
Sbjct: 119 SIPMFAGFVIMFLSTIIFAFGRSYLVLFVARALQGIGSSCSSVSGMGMLADRFTDDKERG 178

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             MG  L                 Y++ G                L+   +++PS     
Sbjct: 179 NAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLILAALALGDGLLQLFMLQPSI---- 234

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASILAGLEPILPIY 191
                            Q+  T+ PS+ +LI D  I+    AI      +A LEP LP++
Sbjct: 235 -----------------QKAETEPPSLKSLISDPYILIAAGAITFANMGIAMLEPSLPLW 277

Query: 192 LRKEFDADASLIGLIFIAIAIPTFLSPAV-GYISFYIGQRRTCGIGMILMGIATPLISLP 250
           +     A     G+ F+  +I   +   + G +   IG+     +G+I++G     I + 
Sbjct: 278 MVDNMGATRWEQGVAFLPASISYLIGTNLFGPLGHKIGRWFAACLGLIIIGGCLIFIPMA 337

Query: 251 SKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGMFVGPV 310
           +    +++P    G    +V +  +P LG+ V  +    YG +YAL ++A+ +G  VGP 
Sbjct: 338 TSITHLIIPNAGLGFAIGMVDSSMMPELGYLVDIRHSAVYGSVYALGDVAFCVGFAVGPA 397

Query: 311 IAGLLFELFEFRNTLIIFGAAVLA 334
           ++G L +   F    ++FG A+L 
Sbjct: 398 LSGSLVKSIGFE--WMLFGIAILC 419



>gi|194883315|ref|XP_001975748.1| GG22485 [Drosophila erecta]
 gi|190658935|gb|EDV56148.1| GG22485 [Drosophila erecta]
          Length = 613

 Score = 83.6 bits (205), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 81/323 (25%), Positives = 135/323 (41%), Gaps = 24/323 (7%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            IPM  G + + + +I+F    SY  L VAR  QG     S    + MLADRF    + G
Sbjct: 270 SIPMFAGFVIMFLSTIIFAFGRSYLVLFVARALQGIGSSCSSVSGMGMLADRFTDDKERG 329

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             MG  L                 Y++ G                L+   +++PS     
Sbjct: 330 NAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLILAALALGDGLLQLFMLQPSI---- 385

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASILAGLEPILPIY 191
                            Q+  T+ PS+ +LI D  I+    AI      +A LEP LP++
Sbjct: 386 -----------------QKAETEPPSLKSLISDPYILIAAGAITFANMGIAMLEPSLPLW 428

Query: 192 LRKEFDADASLIGLIFIAIAIPTFLSPAV-GYISFYIGQRRTCGIGMILMGIATPLISLP 250
           +     A     G+ F+  +I   +   + G +   IG+     +G+I++G     I + 
Sbjct: 429 MVDNMGATRWEQGVAFLPASISYLIGTNLFGPLGHKIGRWFAACLGLIIIGGCLIFIPMA 488

Query: 251 SKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGMFVGPV 310
           +    +++P    G    +V +  +P LG+ V  +    YG +YAL ++A+ +G  VGP 
Sbjct: 489 TSITHLIIPNAGLGFAIGMVDSSMMPELGYLVDIRHSAVYGSVYALGDVAFCVGFAVGPA 548

Query: 311 IAGLLFELFEFRNTLIIFGAAVL 333
           ++G L +   F    ++FG A+L
Sbjct: 549 LSGSLVKSIGFE--WMLFGIAIL 569



>gi|195583086|ref|XP_002081355.1| GD25754 [Drosophila simulans]
 gi|194193364|gb|EDX06940.1| GD25754 [Drosophila simulans]
          Length = 613

 Score = 83.6 bits (205), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 81/323 (25%), Positives = 135/323 (41%), Gaps = 24/323 (7%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            IPM  G + + + +I+F    SY  L VAR  QG     S    + MLADRF    + G
Sbjct: 270 SIPMFAGFVIMFLSTIIFAFGRSYLVLFVARALQGIGSSCSSVSGMGMLADRFTDDKERG 329

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             MG  L                 Y++ G                L+   +++PS     
Sbjct: 330 NAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLILAALALGDGLLQLFMLQPSI---- 385

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASILAGLEPILPIY 191
                            Q+  T+ PS+ +LI D  I+    AI      +A LEP LP++
Sbjct: 386 -----------------QKAETEPPSLKSLISDPYILIAAGAITFANMGIAMLEPSLPLW 428

Query: 192 LRKEFDADASLIGLIFIAIAIPTFLSPAV-GYISFYIGQRRTCGIGMILMGIATPLISLP 250
           +     A     G+ F+  +I   +   + G +   IG+     +G+I++G     I + 
Sbjct: 429 MVDNMGATRWEQGVAFLPASISYLIGTNLFGPLGHKIGRWFAACLGLIIIGGCLIFIPMA 488

Query: 251 SKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGMFVGPV 310
           +    +++P    G    +V +  +P LG+ V  +    YG +YAL ++A+ +G  VGP 
Sbjct: 489 TSITHLIIPNAGLGFAIGMVDSSMMPELGYLVDIRHSAVYGSVYALGDVAFCVGFAVGPA 548

Query: 311 IAGLLFELFEFRNTLIIFGAAVL 333
           ++G L +   F    ++FG A+L
Sbjct: 549 LSGSLVKSIGFE--WMLFGIAIL 569



>gi|336087839|emb|CCA65517.1| UNC-17 protein [Caenorhabditis elegans]
          Length = 532

 Score = 83.2 bits (204), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 82/337 (24%), Positives = 138/337 (40%), Gaps = 22/337 (6%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
           +IPM+ G+ ++   + +F +  SY  L+ AR  QG     + T  LAM+ADRF    +  
Sbjct: 130 EIPMILGLCTMFFSTAIFALGKSYGVLLFARSLQGFGSAFADTSGLAMIADRFTEENERS 189

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             Y   G                + + M++ P    T 
Sbjct: 190 AALGIALAFISFGCLVAPPFGSVLYSLAGKPVPFLILSFVCLADAIAVFMVINPHRRGT- 248

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI-LAGLEPILPI 190
                           +     Q   +W L  D   I  C   +++A++ LA LEP +  
Sbjct: 249 ---------------DSHGEKVQGTPMWRLFMD-PFIACCSGALIMANVSLAFLEPTITT 292

Query: 191 YLRKEF-DADASLIGLIFIAIAIPTFLSPAVGYISFYIGQRRTCGIGMI---LMGIATPL 246
           ++ +   D    L+G+I++    P  L   V           T  I M+   + GIA   
Sbjct: 293 WMSEMMPDTPGWLVGVIWLPPFFPHVLGVYVTVKMLRAFPHHTWAIAMVGLAMKGIACFA 352

Query: 247 ISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGMF 306
           I   +    +V+PL F     +++ T  LP+LGH V  +    YG +YA+ +++YS+   
Sbjct: 353 IPYTTSVMQLVIPLSFVCFGIALIDTSLLPMLGHLVDTRHVSVYGSVYAIADISYSLAYA 412

Query: 307 VGPVIAGLLFELFEFRNTLIIFGAAVLAITPLIFAGR 343
            GP+IAG +   + F    II  A  +   P++F  R
Sbjct: 413 FGPIIAGWIVTNWGFTALNIIIFATNVTYAPVLFLLR 449



>gi|350396384|ref|XP_003484536.1| PREDICTED: vesicular acetylcholine transporter-like [Bombus
           impatiens]
          Length = 792

 Score = 83.2 bits (204), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 76/318 (23%), Positives = 135/318 (42%), Gaps = 28/318 (8%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            IPMM G+  + + + +F    SY  L  AR  QG     + T  LAM+ADR+    +  
Sbjct: 324 DIPMMIGLCIMFLSTAVFACGRSYGVLFFARSLQGVGSAFADTSGLAMIADRYTEESERS 383

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             YQ+ G                +++ ++++P      
Sbjct: 384 KALGIALAFISFGCLVAPPFGGALYQFAGKEVPFLILAFISLADGIMLLLVMKPLKEQVK 443

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI-LAGLEPILPI 190
            S               Q+ H Q   IW L+ D   I +C   ++++++ LA LEP + +
Sbjct: 444 DS---------------QKEHKQMIPIWRLLID-PYIAVCAGALMMSNVALAFLEPTISL 487

Query: 191 YLRKEFDADASLIGLIFIAIAIPTFLSPAVGYI-------SFYIGQRRTCGIGMILMGIA 243
           ++      D   +G+I++    P F     G +        +   Q      G+ L G+ 
Sbjct: 488 WMEDNITRDNWKMGMIWL----PAFFPHVFGVVITVKMAKQYPQHQWLMAASGLALEGLC 543

Query: 244 TPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSI 303
             +I     +W++++PL       +++ T  LP LG+ V  +    YG IYA+ +++YS+
Sbjct: 544 CFIIPFCRSYWVLMIPLCGICFGIALIDTALLPTLGYLVDVRYVSVYGSIYAIADISYSV 603

Query: 304 GMFVGPVIAGLLFELFEF 321
              VGP+IAG + E   F
Sbjct: 604 AYAVGPIIAGGVVEAIGF 621



>gi|2625056|gb|AAB86609.1| vesicular acetylcholine transporter [Drosophila melanogaster]
          Length = 578

 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 83/346 (23%), Positives = 148/346 (42%), Gaps = 30/346 (8%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            +PMM G+  +   + +F   +SY  L  AR  QG     + T  LAM+ADRF    +  
Sbjct: 125 DLPMMIGLTIMFFSTAVFACGSSYSVLFFARSLQGVGSAFADTAGLAMIADRFTEENERS 184

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             YQ+ G                L++ ++++P   +  
Sbjct: 185 QALGIALAFISFGCLVAPPFGGALYQFAGKEVPFLILALVCLLDGLMLLLVMKPVKEAMK 244

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI-LAGLEPILPI 190
           QS               ++   Q   IW L+ D   I +C   + ++++ LA LEP + +
Sbjct: 245 QS---------------KDVQDQVIPIWRLLMD-PYIAVCAGAMTMSNVALAFLEPTISL 288

Query: 191 YLRKEFDADASLIGLIFIAIAIPTFLSPAVGYISFYIGQRR-------TCGIGMILMGIA 243
           ++      D   IG++++    P F    +G +      R+           G+ L G +
Sbjct: 289 WMEDNMTTDNWKIGMVWL----PAFFPHVLGVVITVKMARKYPQHQWLMAAGGLALEGFS 344

Query: 244 TPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSI 303
             +I   S + +++LP+       +++ T  LP LG+ V  +    YG IYA+ +++YSI
Sbjct: 345 CFIIPFCSGYKMLMLPICVICFGIALIDTALLPTLGYLVDVRYVSVYGSIYAIADISYSI 404

Query: 304 GMFVGPVIAGLLFELFEFRNTLIIFGAAVLAITPLIFAGRLRDHAD 349
              VGP+IAG + E   F     +   + LA  P++   +LR+  D
Sbjct: 405 AYAVGPIIAGGVVEAIGFTALNFLIAFSNLAYVPVL--RKLRNIYD 448



>gi|71999703|ref|NP_001023602.1| Protein UNC-17, isoform a [Caenorhabditis elegans]
 gi|464998|sp|P34711.1|UNC17_CAEEL RecName: Full=Vesicular acetylcholine transporter unc-17; AltName:
           Full=Uncoordinated protein 17
 gi|385199|gb|AAC14456.1| acetylcholine transporter [Caenorhabditis elegans]
 gi|501062|gb|AAC13764.1| UNC-17 [Caenorhabditis elegans]
 gi|353245478|emb|CCD68241.1| Protein UNC-17, isoform a [Caenorhabditis elegans]
          Length = 532

 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 82/337 (24%), Positives = 138/337 (40%), Gaps = 22/337 (6%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
           +IPM+ G+ ++   + +F +  SY  L+ AR  QG     + T  LAM+ADRF    +  
Sbjct: 130 EIPMILGLCTMFFSTAIFALGKSYGVLLFARSLQGFGSAFADTSGLAMIADRFTEENERS 189

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             Y   G                + + M++ P    T 
Sbjct: 190 AALGIALAFISFGCLVAPPFGSVLYSLAGKPVPFLILSFVCLADAIAVFMVINPHRRGT- 248

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI-LAGLEPILPI 190
                           +     Q   +W L  D   I  C   +++A++ LA LEP +  
Sbjct: 249 ---------------DSHGEKVQGTPMWRLFMD-PFIACCSGALIMANVSLAFLEPTITT 292

Query: 191 YLRKEF-DADASLIGLIFIAIAIPTFLSPAVGYISFYIGQRRTCGIGMI---LMGIATPL 246
           ++ +   D    L+G+I++    P  L   V           T  I M+   + GIA   
Sbjct: 293 WMSEMMPDTPGWLVGVIWLPPFFPHVLGVYVTVKMLRAFPHHTWAIAMVGLAMEGIACFA 352

Query: 247 ISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGMF 306
           I   +    +V+PL F     +++ T  LP+LGH V  +    YG +YA+ +++YS+   
Sbjct: 353 IPYTTSVMQLVIPLSFVCFGIALIDTSLLPMLGHLVDTRHVSVYGSVYAIADISYSLAYA 412

Query: 307 VGPVIAGLLFELFEFRNTLIIFGAAVLAITPLIFAGR 343
            GP+IAG +   + F    II  A  +   P++F  R
Sbjct: 413 FGPIIAGWIVTNWGFTALNIIIFATNVTYAPVLFLLR 449



>gi|443734916|gb|ELU18772.1| hypothetical protein CAPTEDRAFT_184694 [Capitella teleta]
          Length = 557

 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 81/347 (23%), Positives = 155/347 (44%), Gaps = 28/347 (8%)

Query: 14  PMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLGVV 73
           PM+ G+  L + + +F    +Y+ L  AR  QG     + T  LAM+ADR+         
Sbjct: 133 PMILGLFILFLSTGIFAFGTTYFVLFFARSLQGVGSAFADTAGLAMIADRYKEEHARSKA 192

Query: 74  MGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTYQS 133
            G  L+  +             Y++ G                 ++ ++++P      QS
Sbjct: 193 QGIALAFISFGCLFAPPFGGVLYEFAGKAVPFLLLSLLALVDGGMLYLVMQPQR-KERQS 251

Query: 134 VXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI-LAGLEPILPIYL 192
           +             ++E    +P I+ LI D  I+ +C   +V+A++ LA LEP + +++
Sbjct: 252 L-------------SEEVPKGTP-IYKLIMDPYIL-VCAGALVMANVSLAFLEPTIALWM 296

Query: 193 RKEFDADASLIGLIFIAIAIPTFLSPAVG-YISFYIGQR------RTCGIGMILMGIATP 245
           + + +A    IG++++    P F     G Y++  + Q+        C +G+++  I+  
Sbjct: 297 KGKMNASEWEIGMVWL----PAFFPHVAGVYLTVKLLQKYPNTQWMICAVGLVVEAISCL 352

Query: 246 LISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGM 305
           +I   + +  V++P++      ++V T  LPLLG+ V  +    YG +YA+ +++YS+  
Sbjct: 353 IIPFCTNYGAVIVPIMVNCFGIALVDTAILPLLGYIVDIRHTSVYGSVYAIADISYSLAY 412

Query: 306 FVGPVIAGLLFELFEFRNTLIIFGAAVLAITPLIFAGRLRDHADRIQ 352
             GP++AG +     F    I    A L   PL+F  R     D+ +
Sbjct: 413 AFGPIVAGGIVASIGFTWLNIGIFLATLLYAPLLFTLRNVKRYDQFE 459



>gi|25012572|gb|AAN71386.1| RE38567p [Drosophila melanogaster]
          Length = 610

 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 81/323 (25%), Positives = 135/323 (41%), Gaps = 24/323 (7%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            IPM  G + + + +I+F    SY  L VAR  QG     S    + MLADRF    + G
Sbjct: 267 SIPMFAGFVIMFLSTIIFAFGRSYLVLFVARALQGIGSSCSSVSGMGMLADRFTDDKERG 326

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             MG  L                 Y++ G                L+   +++PS     
Sbjct: 327 NAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLILAALALGDGLLQLFMLQPSI---- 382

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASILAGLEPILPIY 191
                            Q+  T+ PS+ +LI D  I+    AI      +A LEP LP++
Sbjct: 383 -----------------QKAETEPPSLKSLISDPYILIAAGAITFANMGIAMLEPSLPLW 425

Query: 192 LRKEFDADASLIGLIFIAIAIPTFLSPAV-GYISFYIGQRRTCGIGMILMGIATPLISLP 250
           +     A     G+ F+  +I   +   + G +   IG+     +G+I++G     I + 
Sbjct: 426 MVDNMGATRWEQGVAFLPASISYLIGTNLFGPLGHKIGRWFAACLGLIIIGGCLIFIPMA 485

Query: 251 SKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGMFVGPV 310
           +    +++P    G    +V +  +P LG+ V  +    YG +YAL ++A+ +G  VGP 
Sbjct: 486 TSITHLIIPNAGLGFAIGMVDSSMMPELGYLVDIRHSAVYGSVYALGDVAFCVGFAVGPA 545

Query: 311 IAGLLFELFEFRNTLIIFGAAVL 333
           ++G L +   F    ++FG A+L
Sbjct: 546 LSGSLVKSIGFE--WMLFGIAIL 566



>gi|62471713|ref|NP_001014524.1| vesicular monoamine transporter, isoform C [Drosophila
           melanogaster]
 gi|62471717|ref|NP_001014526.1| vesicular monoamine transporter, isoform E [Drosophila
           melanogaster]
 gi|442623621|ref|NP_001260956.1| vesicular monoamine transporter, isoform F [Drosophila
           melanogaster]
 gi|28317214|gb|AAO39614.1| GH16917p [Drosophila melanogaster]
 gi|40882431|gb|AAR96127.1| RH74704p [Drosophila melanogaster]
 gi|61678370|gb|AAX52707.1| vesicular monoamine transporter, isoform C [Drosophila
           melanogaster]
 gi|61678371|gb|AAX52708.1| vesicular monoamine transporter, isoform E [Drosophila
           melanogaster]
 gi|219990671|gb|ACL68709.1| FI07245p [Drosophila melanogaster]
 gi|440214369|gb|AGB93488.1| vesicular monoamine transporter, isoform F [Drosophila
           melanogaster]
          Length = 610

 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 81/323 (25%), Positives = 135/323 (41%), Gaps = 24/323 (7%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            IPM  G + + + +I+F    SY  L VAR  QG     S    + MLADRF    + G
Sbjct: 267 SIPMFAGFVIMFLSTIIFAFGRSYLVLFVARALQGIGSSCSSVSGMGMLADRFTDDKERG 326

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             MG  L                 Y++ G                L+   +++PS     
Sbjct: 327 NAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLILAALALGDGLLQLFMLQPSI---- 382

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASILAGLEPILPIY 191
                            Q+  T+ PS+ +LI D  I+    AI      +A LEP LP++
Sbjct: 383 -----------------QKAETEPPSLKSLISDPYILIAAGAITFANMGIAMLEPSLPLW 425

Query: 192 LRKEFDADASLIGLIFIAIAIPTFLSPAV-GYISFYIGQRRTCGIGMILMGIATPLISLP 250
           +     A     G+ F+  +I   +   + G +   IG+     +G+I++G     I + 
Sbjct: 426 MVDNMGATRWEQGVAFLPASISYLIGTNLFGPLGHKIGRWFAACLGLIIIGGCLIFIPMA 485

Query: 251 SKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGMFVGPV 310
           +    +++P    G    +V +  +P LG+ V  +    YG +YAL ++A+ +G  VGP 
Sbjct: 486 TSITHLIIPNAGLGFAIGMVDSSMMPELGYLVDIRHSAVYGSVYALGDVAFCVGFAVGPA 545

Query: 311 IAGLLFELFEFRNTLIIFGAAVL 333
           ++G L +   F    ++FG A+L
Sbjct: 546 LSGSLVKSIGFE--WMLFGIAIL 566



>gi|336087847|emb|CCA65521.1| UNC-17 protein [Caenorhabditis elegans]
          Length = 532

 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 82/337 (24%), Positives = 138/337 (40%), Gaps = 22/337 (6%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
           +IPM+ G+ ++   + +F +  SY  L+ AR  QG     + T  LAM+ADRF    +  
Sbjct: 130 EIPMILGLCTMFFSTAIFALGKSYGVLLFARSLQGFGSAFADTSGLAMIADRFTEENERS 189

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             Y   G                + + M++ P    T 
Sbjct: 190 AALGIALAFISFGCLVAPPFGSVLYSLAGKPVPFLILSFVCLADAIAVFMVINPHRRGT- 248

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI-LAGLEPILPI 190
                           +     Q   +W L  D   I  C   +++A++ LA LEP +  
Sbjct: 249 ---------------DSHGEKVQGTPMWRLFMD-PFIACCSGALIMANVSLAFLEPTITT 292

Query: 191 YLRKEF-DADASLIGLIFIAIAIPTFLSPAVGYISFYIGQRRTCGIGMI---LMGIATPL 246
           ++ +   D    L+G+I++    P  L   V           T  I M+   + GIA   
Sbjct: 293 WMSEMMPDTPGWLVGVIWLPPFFPHVLGVYVTVKMLRAFPHHTWAIAMVGLAMEGIACFA 352

Query: 247 ISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGMF 306
           I   +    +V+PL F     +++ T  LP+LGH V  +    YG +YA+ +++YS+   
Sbjct: 353 IPYTTSVMQLVIPLSFVCFGIALIDTSLLPMLGHLVDTRHVSVYGSVYAIADISYSLAYA 412

Query: 307 VGPVIAGLLFELFEFRNTLIIFGAAVLAITPLIFAGR 343
            GP+IAG +   + F    II  A  +   P++F  R
Sbjct: 413 FGPIIAGWIVTNWGFTALNIIIFATNVTYAPVLFLLR 449



>gi|336087843|emb|CCA65519.1| UNC-17 protein [Caenorhabditis elegans]
          Length = 532

 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 82/337 (24%), Positives = 138/337 (40%), Gaps = 22/337 (6%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
           +IPM+ G+ ++   + +F +  SY  L+ AR  QG     + T  LAM+ADRF    +  
Sbjct: 130 EIPMILGLCTMFFSTAIFALGKSYGVLLFARSLQGFGSAFADTSGLAMIADRFTEENERS 189

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             Y   G                + + M++ P    T 
Sbjct: 190 AALGIALAFISFGYLVAPPFGSVLYSLAGKPVPFLILSFVCLADAIAVFMVINPHRRGT- 248

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI-LAGLEPILPI 190
                           +     Q   +W L  D   I  C   +++A++ LA LEP +  
Sbjct: 249 ---------------DSHGEKVQGTPMWRLFMD-PFIACCSGALIMANVSLAFLEPTITT 292

Query: 191 YLRKEF-DADASLIGLIFIAIAIPTFLSPAVGYISFYIGQRRTCGIGMI---LMGIATPL 246
           ++ +   D    L+G+I++    P  L   V           T  I M+   + GIA   
Sbjct: 293 WMSEMMPDTPGWLVGVIWLPPFFPHVLGVYVTVKMLRAFPHHTWAIAMVGLAMEGIACFA 352

Query: 247 ISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGMF 306
           I   +    +V+PL F     +++ T  LP+LGH V  +    YG +YA+ +++YS+   
Sbjct: 353 IPYTTSVMQLVIPLSFVCFGIALIDTSLLPMLGHLVDTRHVSVYGSVYAIADISYSLAYA 412

Query: 307 VGPVIAGLLFELFEFRNTLIIFGAAVLAITPLIFAGR 343
            GP+IAG +   + F    II  A  +   P++F  R
Sbjct: 413 FGPIIAGWIVTNWGFTALNIIIFATNVTYAPVLFLLR 449



>gi|340729982|ref|XP_003403271.1| PREDICTED: vesicular acetylcholine transporter-like [Bombus
           terrestris]
          Length = 695

 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 76/318 (23%), Positives = 135/318 (42%), Gaps = 28/318 (8%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            IPMM G+  + + + +F    SY  L  AR  QG     + T  LAM+ADR+    +  
Sbjct: 227 DIPMMIGLCIMFLSTAVFACGRSYGVLFFARSLQGVGSAFADTSGLAMIADRYTEESERS 286

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             YQ+ G                +++ ++++P      
Sbjct: 287 KALGIALAFISFGCLVAPPFGGALYQFAGKEVPFLILAFISLADGIMLLLVMKPLKEQVK 346

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI-LAGLEPILPI 190
            S               Q+ H Q   IW L+ D   I +C   ++++++ LA LEP + +
Sbjct: 347 DS---------------QKEHKQMIPIWRLLID-PYIAVCAGALMMSNVALAFLEPTISL 390

Query: 191 YLRKEFDADASLIGLIFIAIAIPTFLSPAVGYI-------SFYIGQRRTCGIGMILMGIA 243
           ++      D   +G+I++    P F     G +        +   Q      G+ L G+ 
Sbjct: 391 WMEDNITRDNWKMGMIWL----PAFFPHVFGVVITVKMAKQYPQHQWLMAASGLALEGLC 446

Query: 244 TPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSI 303
             +I     +W++++PL       +++ T  LP LG+ V  +    YG IYA+ +++YS+
Sbjct: 447 CFIIPFCRSYWVLMIPLCGICFGIALIDTALLPTLGYLVDVRYVSVYGSIYAIADISYSV 506

Query: 304 GMFVGPVIAGLLFELFEF 321
              VGP+IAG + E   F
Sbjct: 507 AYAVGPIIAGGVVEAIGF 524



>gi|336087841|emb|CCA65518.1| UNC-17 protein [Caenorhabditis elegans]
 gi|336087845|emb|CCA65520.1| UNC-17 protein [Caenorhabditis elegans]
          Length = 532

 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 82/337 (24%), Positives = 138/337 (40%), Gaps = 22/337 (6%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
           +IPM+ G+ ++   + +F +  SY  L+ AR  QG     + T  LAM+ADRF    +  
Sbjct: 130 EIPMILGLCTMFFSTAIFALGKSYGVLLFARSLQGFGSAFADTSGLAMIADRFTEENERS 189

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             Y   G                + + M++ P    T 
Sbjct: 190 AALGIALAFISFGCLVAPPFGSVLYSLAGKPVPFLILSFVCLADAIAVFMVINPHRRGT- 248

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI-LAGLEPILPI 190
                           +     Q   +W L  D   I  C   +++A++ LA LEP +  
Sbjct: 249 ---------------DSHGEKVQGTPMWRLFMD-PFIACCSGALIMANVSLAFLEPTITT 292

Query: 191 YLRKEF-DADASLIGLIFIAIAIPTFLSPAVGYISFYIGQRRTCGIGMI---LMGIATPL 246
           ++ +   D    L+G+I++    P  L   V           T  I M+   + GIA   
Sbjct: 293 WMSEMMPDTPGWLVGVIWLPPFFPHVLGVYVTVKMLRAFPHHTWAIAMVGLAMEGIACFA 352

Query: 247 ISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGMF 306
           I   +    +V+PL F     +++ T  LP+LGH V  +    YG +YA+ +++YS+   
Sbjct: 353 IPYTTSVMQLVIPLSFVCFGIALIDTSLLPMLGHLVDTRHVSVYGSVYAIADISYSLANA 412

Query: 307 VGPVIAGLLFELFEFRNTLIIFGAAVLAITPLIFAGR 343
            GP+IAG +   + F    II  A  +   P++F  R
Sbjct: 413 FGPIIAGWIVTNWGFTALNIIIFATNVTYAPVLFLLR 449



>gi|241711519|ref|XP_002413424.1| vesamicol binding protein, putative [Ixodes scapularis]
 gi|215507238|gb|EEC16732.1| vesamicol binding protein, putative [Ixodes scapularis]
          Length = 564

 Score = 82.4 bits (202), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 83/340 (24%), Positives = 140/340 (41%), Gaps = 28/340 (8%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            IPMM G+  + + + +F    SY  L  AR  QG     + T  LAM+ADRF    +  
Sbjct: 136 DIPMMVGLTIMFLSTAIFACGTSYGVLFFARSLQGVGSAFADTAGLAMIADRFTEESERS 195

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             Y++ G                 ++  +++P      
Sbjct: 196 KALGIALAFISFGCLVAPPFGGLLYEFAGKEVPFIILSLVSLLDGFLLLFVMQP------ 249

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASILAGLEPILPIY 191
                             E    +P IW L  D  I     A+++    LA LEP + I+
Sbjct: 250 --------VKQQMRAMGMERPKGTP-IWRLFIDPYIACAAGALMMSNVSLAFLEPTISIW 300

Query: 192 LRKEFDADASLIGLIFIAIAIPTFLSPAVG-YISFYIGQR-------RTCGIGMILMGIA 243
           ++     D   IGLI++    P F     G Y++  + ++         C  G+ L G++
Sbjct: 301 MKDNMHVDDWQIGLIWL----PAFFPHVAGVYLTVRLARQYPQYQWAMAC-FGLALEGLS 355

Query: 244 TPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSI 303
           + ++     +W+++LPL       + V T  LP LG+ V  +    YG IYA+ +++YS+
Sbjct: 356 SFIVPFARSYWVLILPLSGICFGIAQVDTSLLPTLGYLVDVRYVSVYGSIYAIADISYSL 415

Query: 304 GMFVGPVIAGLLFELFEFRNTLIIFGAAVLAITPLIFAGR 343
              +GP+IAG + E   F    I    + L   PL+ + R
Sbjct: 416 AYAIGPIIAGGIVESIGFTALNIFIALSNLLYCPLLMSLR 455



>gi|62471715|ref|NP_001014525.1| vesicular monoamine transporter, isoform D [Drosophila
           melanogaster]
 gi|25009995|gb|AAN71163.1| GH10249p [Drosophila melanogaster]
 gi|61678372|gb|AAX52709.1| vesicular monoamine transporter, isoform D [Drosophila
           melanogaster]
          Length = 646

 Score = 82.4 bits (202), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 81/323 (25%), Positives = 135/323 (41%), Gaps = 24/323 (7%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            IPM  G + + + +I+F    SY  L VAR  QG     S    + MLADRF    + G
Sbjct: 267 SIPMFAGFVIMFLSTIIFAFGRSYLVLFVARALQGIGSSCSSVSGMGMLADRFTDDKERG 326

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             MG  L                 Y++ G                L+   +++PS     
Sbjct: 327 NAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLILAALALGDGLLQLFMLQPSI---- 382

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASILAGLEPILPIY 191
                            Q+  T+ PS+ +LI D  I+    AI      +A LEP LP++
Sbjct: 383 -----------------QKAETEPPSLKSLISDPYILIAAGAITFANMGIAMLEPSLPLW 425

Query: 192 LRKEFDADASLIGLIFIAIAIPTFLSPAV-GYISFYIGQRRTCGIGMILMGIATPLISLP 250
           +     A     G+ F+  +I   +   + G +   IG+     +G+I++G     I + 
Sbjct: 426 MVDNMGATRWEQGVAFLPASISYLIGTNLFGPLGHKIGRWFAACLGLIIIGGCLIFIPMA 485

Query: 251 SKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGMFVGPV 310
           +    +++P    G    +V +  +P LG+ V  +    YG +YAL ++A+ +G  VGP 
Sbjct: 486 TSITHLIIPNAGLGFAIGMVDSSMMPELGYLVDIRHSAVYGSVYALGDVAFCVGFAVGPA 545

Query: 311 IAGLLFELFEFRNTLIIFGAAVL 333
           ++G L +   F    ++FG A+L
Sbjct: 546 LSGSLVKSIGFE--WMLFGIAIL 566



>gi|242813423|ref|XP_002486165.1| MFS amine transporter, putative [Talaromyces stipitatus ATCC 10500]
 gi|218714504|gb|EED13927.1| MFS amine transporter, putative [Talaromyces stipitatus ATCC 10500]
          Length = 482

 Score = 82.4 bits (202), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 91/352 (25%), Positives = 152/352 (43%), Gaps = 43/352 (12%)

Query: 5   SDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRF 64
           SD    R++P++ G+ +L   +++  +A S    VV R+ QG +    W + LA+LAD  
Sbjct: 88  SDTVSMRRLPLLLGLAALLGATVMLNVATSVAVFVVGRLLQGISAAVVWVVGLALLAD-- 145

Query: 65  GSGPK--LGVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMI 122
            + P+  L   MG V    T             Y+  GY               ++  ++
Sbjct: 146 -TVPREMLAQYMGYVSLGMTSGFMLGPLLGGVLYERTGYNGVWALCYAFIGMDFVLRIVL 204

Query: 123 VEPSDLSTYQSVX---------------------XXXXXXXXXXXANQEFHTQSPSIWNL 161
           VE  DLS    V                                 A + F  + P+++ L
Sbjct: 205 VEKKDLSQDLPVEPEHEPETKEPTRIEDNSPPADESVQSSTPRRPARKTFTQKLPAVFTL 264

Query: 162 IFDWNIINICLAIIVVASILAGLEPILPIYLRKEFDADASLIGLIFIAIAIPTFLSPAVG 221
           +    ++    A IV A+++A  + +LP+++ + F   +   G++++ I IPT +SP VG
Sbjct: 265 LASRRLLAALFASIVQATLVASFDSVLPLFVNEVFSWGSLQSGILYLTIVIPTLISPLVG 324

Query: 222 YISFYIGQRRTCGIGMIL---MGIATPLI---SLPSKFWLVVLPLLFFGATYSIVTTPTL 275
           ++    G R   G G +L   M I   LI   ++  K  LVVL L+F G   ++     +
Sbjct: 325 FLGDKYGGRWFAGAGFLLACPMFILLRLITHNTIGQKVSLVVL-LVFIGLAMTLSFPVIM 383

Query: 276 PLLGHYVTQK----------GGGAYGQIYALWNMAYSIGMFVGPVIAGLLFE 317
             + H V  K           GGAY Q Y L+NMA++ G  +GPV AG++ +
Sbjct: 384 AEITHIVAAKEQSRPLGSFGKGGAYAQAYGLFNMAFAAGTLIGPVWAGMIKQ 435



>gi|291227901|ref|XP_002733925.1| PREDICTED: vesicular monoamine transporter-like [Saccoglossus
           kowalevskii]
          Length = 519

 Score = 82.4 bits (202), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 67/303 (22%), Positives = 125/303 (41%), Gaps = 21/303 (6%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            IPM  G + + I +I+F +  SY  L++AR+ QG     S    + MLA+R+    + G
Sbjct: 169 SIPMFVGFIIMFIATIIFAVGESYSVLLIARMLQGIGSACSSVAGMGMLAERYPDDEERG 228

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             MG  L                 YQ+ G                L+  ++++P      
Sbjct: 229 NAMGIALGGLALGVLIGPPFGGVVYQFLGKEAPFYILAALALGDGLLQLLVLKPG----- 283

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASILAGLEPILPIY 191
                            +E   +   +  LI D  I+    +I      +A LEP +P++
Sbjct: 284 ---------------VGKEVQMEGTPLLTLIKDPYILIAAGSITFANMAIALLEPSMPLW 328

Query: 192 LRKEFDADASLIGLIFIAIAIPTFLSPAV-GYISFYIGQRRTCGIGMILMGIATPLISLP 250
           + +  + +   +G  F+  ++   +S  + G +   +G+     IGM + GI    I   
Sbjct: 329 MMETMETEKWQLGAAFLPASVSYLISTNIFGPLGHRMGRWLCSLIGMSITGICMAWIPFA 388

Query: 251 SKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGMFVGPV 310
           S    ++ P  F G    +V +  +P +G+ V  +    YG +YA+ ++A+ +G  +GP 
Sbjct: 389 SNINELIAPCFFLGFAIGMVDSSMMPTMGYLVDLRHVSVYGSVYAIADVAFCLGFALGPA 448

Query: 311 IAG 313
           ++G
Sbjct: 449 LSG 451



>gi|491688945|ref|WP_005545036.1| arabinose ABC transporter permease [Paenibacillus alvei]
 gi|402508051|gb|EJW18572.1| hypothetical protein PAV_2c03370 [Paenibacillus alvei DSM 29]
          Length = 420

 Score = 82.0 bits (201), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 83/339 (24%), Positives = 151/339 (44%), Gaps = 26/339 (7%)

Query: 1   FAVLSDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAML 60
           F  ++D++  RK  +M G+L + + ++LF  + +   L++AR  QG A  ASWT ++A+L
Sbjct: 68  FGRIADRFGRRKTIIM-GLLFMMMSTLLFVFSQTTAMLIMARFLQGLAAAASWTAAMALL 126

Query: 61  ADRFGSGPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXX-XXXXXXXXXXXLVI 119
           AD F  GP  G  MG  ++  +             ++   +                 V+
Sbjct: 127 ADLF-PGPVRGAAMGFAMTGISSGSLLGAPIGGWLFEVGDHHTPFWFAAALTAVISITVL 185

Query: 120 SMIVEPSDLSTYQSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVAS 179
            ++ EP                       +E   +    ++L+    I+ +   I++  +
Sbjct: 186 LLLREP---------------------VREERSAEGGGTFSLLRHRTILFVAFVILLAET 224

Query: 180 ILAGLEPILPIYLRKEFDADASLIGLIFIAIAIP-TFLSPAVGYISFYIGQRRTCGIGMI 238
            L  LEP+LP+Y+ + F      +G++F  + +    ++P  G ++      R   IG+I
Sbjct: 225 TLTMLEPLLPVYVTERFQMSPLALGMLFGVMTLSYGLIAPIAGTLAGKHNPFRLMLIGLI 284

Query: 239 LMGIATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVT-QKGGGAYGQIYALW 297
            +    PLI+      L++      GA      +PTLP LG  V     GG YG  YAL+
Sbjct: 285 GLAFTLPLIAFAGSVPLLMGAGCLIGAAIGFTLSPTLPTLGAIVDGDSSGGDYGVAYALF 344

Query: 298 NMAYSIGMFVGPVIAGLLFELFEFRNTLIIFGAAVLAIT 336
           NM ++ GM +GP+  G+L +      +LI+    ++++T
Sbjct: 345 NMIHAAGMMLGPLAGGVLTDALPVMASLIVISLLIVSVT 383



>gi|291401063|ref|XP_002716914.1| PREDICTED: solute carrier family 18 (vesicular monoamine), member 1
           isoform 1 [Oryctolagus cuniculus]
          Length = 519

 Score = 81.6 bits (200), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 80/341 (23%), Positives = 141/341 (41%), Gaps = 32/341 (9%)

Query: 8   YHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSG 67
           YH   IPM  G + + + +++F  + +Y  L VAR  QG     S    L MLA  +   
Sbjct: 160 YH---IPMFAGFVIMFLSTVMFAFSGTYALLFVARTLQGIGSSFSSVAGLGMLASVYTDD 216

Query: 68  PKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSD 127
            + G  MG  L                 Y++ G                 +   I+ PS 
Sbjct: 217 HERGRAMGIALGGLALGVLVGAPFGSVMYEFVGKSAPFLILALLALLDGALQLCILRPSK 276

Query: 128 LSTYQSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNII----NICLAIIVVASILAG 183
           +S                       TQ   ++ L+ D  I+    +IC A + VA     
Sbjct: 277 VSPES--------------------TQGTPLFMLLRDPYILVAAGSICFANMGVAM---- 312

Query: 184 LEPILPIYLRKEFDADASLIGLIFIAIAIPTFLSPAV-GYISFYIGQRRTCGIGMILMGI 242
           LEP LPI++ +   +    +GL F+  ++   +   + G ++  +G+     IGM+++G+
Sbjct: 313 LEPTLPIWMMQTMCSPEWQLGLAFLPASVSYLIGTNLFGVLANKMGRWLCSLIGMVVVGV 372

Query: 243 ATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYS 302
           +   + L    + ++ P    G    +V +  +P++GH V  +    YG +YA+ ++A+ 
Sbjct: 373 SLLCVPLAPNIFSLIGPNAGLGFAIGMVDSSLMPIMGHLVDLRHTSVYGSVYAIADVAFC 432

Query: 303 IGMFVGPVIAGLLFELFEFRNTLIIFGAAVLAITPLIFAGR 343
           +G  VGP  AG +     F   ++I G   +A  PL +  R
Sbjct: 433 LGFAVGPSTAGAIVRAIGFPGLMVIIGVINIAYAPLCYCLR 473



>gi|170030542|ref|XP_001843147.1| vesamicol binding protein [Culex quinquefasciatus]
 gi|167867823|gb|EDS31206.1| vesamicol binding protein [Culex quinquefasciatus]
          Length = 585

 Score = 81.6 bits (200), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 76/324 (23%), Positives = 138/324 (42%), Gaps = 22/324 (6%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            +PMM G++ + + +++F    SY  L  AR  QG     + T  LAM+ADRF    +  
Sbjct: 121 DLPMMVGLIIMFLSTMVFACGRSYSMLFFARSLQGVGSAFADTSGLAMIADRFTEENERS 180

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             YQ+ G                 ++ ++++P      
Sbjct: 181 KALGIALAFISFGCLVAPPFGGALYQFAGKEVPFIILALVSLLDGFMLLLVMKP------ 234

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI-LAGLEPILPI 190
                            QE   ++  IW L+ D   I +C   + ++++ LA LEP + +
Sbjct: 235 ---------IKEIMADRQELPQETVPIWRLLID-PYIAVCAGALTMSNVALAFLEPTISL 284

Query: 191 YLRKEFDADASLIGLIFIAIAIPTFLSPAVGYISFYIGQRRT---CGIGMILMGIATPLI 247
           ++     A+   IG++++    P  L   +      I   +       G+ L G+   +I
Sbjct: 285 WMEDNLTAENWKIGMVWLPAFFPHVLGVVITVKLARIYPEKQWLMAAGGLALEGLCCFII 344

Query: 248 SLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGMFV 307
              S + ++++P+       +++ T  LP LG+ V  +    YG IYA+ +++YSI   V
Sbjct: 345 PFSSSYIVLMIPICGICFGIALIDTALLPTLGYLVDVRYVSVYGSIYAIADISYSIAYAV 404

Query: 308 GPVIAGLLFELFEFR--NTLIIFG 329
           GP+IAG + E   F   N +I F 
Sbjct: 405 GPIIAGGVVEAIGFTALNFMIAFA 428



>gi|512908177|ref|XP_004926617.1| PREDICTED: vesicular acetylcholine transporter-like [Bombyx mori]
          Length = 600

 Score = 81.3 bits (199), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 81/327 (24%), Positives = 139/327 (42%), Gaps = 30/327 (9%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            IPMM G++ + + + +F    SY  L  AR  QG     + T  LAM+ADRF    +  
Sbjct: 143 DIPMMIGLIIMFLSTSIFACGRSYSMLFFARSLQGVGSAFADTSGLAMIADRFTEESERS 202

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             YQ+ G                 ++ ++++P      
Sbjct: 203 KALGIALAFISFGSLVAPPFGGALYQFAGKEVPFLILALISLMDGFMLLLVMKPIKTQIK 262

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI-LAGLEPILPI 190
           +              AN+     +P IW L+ D   I +C   ++++++ LA LEP +  
Sbjct: 263 E--------------ANEPKPAGTP-IWKLLID-PYIAVCAGALMMSNVALAFLEPTISS 306

Query: 191 YLRKEFDADASLIGLIFIAIAIPTFLSPAVGYI-------SFYIGQRRTCGIGMILMGIA 243
           ++      D   IG+I++    P F    +G I        +   Q      G+ L G+ 
Sbjct: 307 WMEDNLTKDNWKIGMIWL----PAFFPHVLGVIITVKMAKKYPQHQWLMAAGGLALEGLC 362

Query: 244 TPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSI 303
             +I   S + ++++P+       +++ T  LP LG+ V  +    YG IYA+ +++YS 
Sbjct: 363 CFIIPFASSYKMLMIPICGICFGIALIDTALLPTLGYLVDVRYVSVYGSIYAIADISYSF 422

Query: 304 GMFVGPVIAGLLFELFEFR--NTLIIF 328
              VGP+IAG + E   F   N LI F
Sbjct: 423 AYAVGPIIAGEVVEAIGFTALNLLIAF 449



>gi|195399638|ref|XP_002058426.1| GJ14407 [Drosophila virilis]
 gi|194141986|gb|EDW58394.1| GJ14407 [Drosophila virilis]
          Length = 562

 Score = 81.3 bits (199), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 85/346 (24%), Positives = 147/346 (42%), Gaps = 30/346 (8%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            IPMM G+  +   + +F    SY  L  AR  QGA    + T  LAM+ADRF    +  
Sbjct: 125 DIPMMIGLTIMFFSTAVFACGTSYSVLFFARSLQGAGSAFADTSGLAMIADRFTEENERS 184

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             YQ+ G                L++ ++++P      
Sbjct: 185 QALGIALAFISFGCLVAPPFGGALYQFAGKEVPFLILALVCLLDGLMLLLVMKPFKEQIK 244

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI-LAGLEPILPI 190
            S               +E   Q   IW L+ D   I +C   + ++++ LA LEP + +
Sbjct: 245 MS---------------KEVQNQVIPIWRLLMD-PYIAVCAGALTMSNVALAFLEPTISL 288

Query: 191 YLRKEFDADASLIGLIFIAIAIPTFLSPAVGYISFYIGQRR-------TCGIGMILMGIA 243
           ++      +   IG++++    P F    +G I      R+           G+ L G++
Sbjct: 289 WMEDTMTTENWKIGMVWL----PAFFPHVLGVIITVKMARKYPQHQWLMAAGGLALEGLS 344

Query: 244 TPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSI 303
             +I   S + +++LP+       +++ T  LP LG+ V  +    YG IYA+ +++YSI
Sbjct: 345 CFVIPFCSGYKMLMLPICVICFGIALIDTALLPTLGYLVDVRYVSVYGSIYAIADISYSI 404

Query: 304 GMFVGPVIAGLLFELFEFRNTLIIFGAAVLAITPLIFAGRLRDHAD 349
              VGP+IAG + E   F     +   + LA  P++   +LR+  D
Sbjct: 405 AYAVGPIIAGGIVEAIGFTALNFLIAFSNLAYVPVL--RKLRNIYD 448



>gi|393218786|gb|EJD04274.1| MFS general substrate transporter [Fomitiporia mediterranea MF3/22]
          Length = 452

 Score = 81.3 bits (199), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 95/399 (23%), Positives = 170/399 (42%), Gaps = 55/399 (13%)

Query: 1   FAVLSDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAML 60
           F+ LS+KYHTR+ P+++G++SL    ++F  A +Y  ++VAR  QG +    W + LA+L
Sbjct: 44  FSWLSEKYHTRRSPLIWGLISLMGFLVMFMEAPNYAVMIVARGLQGISSAVVWVVGLALL 103

Query: 61  ADRFGSGPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGY------------------- 101
           AD      K+G  +G  ++                Y ++G+                   
Sbjct: 104 ADCVPEA-KVGQQLGWAMAGMPIGALASPPVAGVLYDHFGFRAPFIFGIILTAGDLFGRI 162

Query: 102 --VXXXXXXXXXXXXXXLVISMIVEPSDLSTYQSVXXXXXXXXXXXXANQEFHTQ----- 154
             +               V + + EP + S  Q+              ++E   +     
Sbjct: 163 LLIERQDALKWGHDPVERVAASLEEPVEGSPAQTPAIGYPAGKPEGEGSKELQKKETNDA 222

Query: 155 -SPSI------------WNLIFDWNIINICLAIIVV-ASILAGLEPILPIYLRKEFDADA 200
            +PSI            W  +       + +  ++V A +  GLEP L + L+  +D D+
Sbjct: 223 KAPSINNPPLKLSECQVWKFMLKSRRTMVAITTVLVYAIVFTGLEPTLALRLQDVYDFDS 282

Query: 201 SLIGLIFIAIAIPTFLS-PAVGYISFYIGQRRTCGIGMILMGIATP-----LISLPSKFW 254
           + +GL+ +A A     + P  GYIS   G   T  I ++ + +  P     +I     F+
Sbjct: 283 TRVGLVILASAAAAIFASPISGYISDRFG---TEWITLLCLILTVPWYILLIIKGHLAFF 339

Query: 255 LVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGMFVGPVIAGL 314
           +V L +  F  T S + +P +  L   V +  G  +  +Y  +N+ Y +G  VGP+IAGL
Sbjct: 340 IVCLAMGMF--TLSGLVSPLIAELASVVRRVDGIGFAHVYGFFNLTYGLGSAVGPIIAGL 397

Query: 315 LFELFEFR-NTLIIFGAAVLAITPLI--FAGRLRDHADR 350
           ++   +   + L+ +GA +L +  ++  F G  R  A R
Sbjct: 398 VYSHAKRGWHILLAYGAGILLLCSVLNFFLGGERPLARR 436



>gi|347967725|ref|XP_312587.5| AGAP002369-PA [Anopheles gambiae str. PEST]
 gi|333468329|gb|EAA07682.6| AGAP002369-PA [Anopheles gambiae str. PEST]
          Length = 587

 Score = 81.3 bits (199), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 79/327 (24%), Positives = 138/327 (42%), Gaps = 30/327 (9%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            +PMM G++ + + +++F    SY  L  AR  QG     + T  LAM+ADRF    +  
Sbjct: 121 DLPMMVGLIIMFLSTMVFACGRSYSMLFFARSLQGVGSAFADTSGLAMIADRFTEEAERT 180

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             YQ+ G                 ++ ++++P      
Sbjct: 181 KALGIALAFISFGCLVAPPFGGALYQFAGKEVPFVILALISLIDGFMLLLVMKP------ 234

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI-LAGLEPILPI 190
                            QE    S  IW L+ D   I +C   ++++++ LA LEP + +
Sbjct: 235 ---------IKEQLADRQEVRAPSVPIWRLLMD-PYIAVCAGALMMSNVALAFLEPTISL 284

Query: 191 YLRKEFDADASLIGLIFIAIAIPTFLSPAVGYI-------SFYIGQRRTCGIGMILMGIA 243
           ++      D   IG++++    P F     G I        +   Q      G+ L G+ 
Sbjct: 285 WMEDNLTTDNWKIGMVWL----PAFFPHVFGVIITVKMAAQYPDKQWLMAAGGLALEGLC 340

Query: 244 TPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSI 303
             +I   S + ++++P+       +++ T  LP LG+ V  +    YG IYA+ +++YS+
Sbjct: 341 CFIIPFSSSYIMLMIPICGICFGIALIDTALLPTLGYLVDIRYVSVYGSIYAIADISYSL 400

Query: 304 GMFVGPVIAGLLFELFEFR--NTLIIF 328
              VGP+IAG + E   F   N LI F
Sbjct: 401 AYAVGPIIAGGVVEAIGFTALNFLIAF 427



>gi|307198448|gb|EFN79390.1| Chromaffin granule amine transporter [Harpegnathos saltator]
          Length = 517

 Score = 80.9 bits (198), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 77/323 (23%), Positives = 135/323 (41%), Gaps = 24/323 (7%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            IPM  G + + + +++F    SY  L +AR  QG     S    + MLA+R+    + G
Sbjct: 175 SIPMFTGFIIMFLSTLIFAFGRSYGILFLARALQGIGSSCSSVSGMGMLAERYQDDKERG 234

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             MG  L                 YQ+ G                L+  ++++PS + T 
Sbjct: 235 NAMGIALGGLALGVLIGPPFGGVMYQFVGKSAPFLVLSALALGDGLLQLLMLQPSVVYT- 293

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASILAGLEPILPIY 191
                                 + PS+ +LI D  I+    AI      +A LEP LPI+
Sbjct: 294 --------------------EAEPPSLKSLITDPYIVIAAGAITFANMGIAMLEPSLPIW 333

Query: 192 LRKEFDADASLIGLIFIAIAIPTFLSPAV-GYISFYIGQRRTCGIGMILMGIATPLISLP 250
           +     AD    G+ F+  +I   +   + G +   +G+     IG++++G+    I L 
Sbjct: 334 MMDTMGADRWKQGVTFLPASISYLIGTNLFGPLGHKMGRWLASLIGLVVIGLCLMCIPLA 393

Query: 251 SKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGMFVGPV 310
                +++P    G    +V +  +P LG+ V  +    YG +YA+ ++A+ +G  +GP 
Sbjct: 394 RSIGHLIIPNAGLGFAIGMVDSSMMPELGYLVDIRHTAVYGSVYAIGDVAFCLGFAIGPA 453

Query: 311 IAGLLFELFEFRNTLIIFGAAVL 333
           ++G L     F    ++FG A+L
Sbjct: 454 LSGTLVNSIGFE--WMLFGIAIL 474



>gi|349986681|dbj|GAA36323.1| MFS transporter DHA1 family solute carrier family 18 (vesicular
           acetylcholine transporter) member 3 [Clonorchis
           sinensis]
          Length = 552

 Score = 80.9 bits (198), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 77/339 (22%), Positives = 146/339 (43%), Gaps = 24/339 (7%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            +PMMFG+  + + + +F   +SY  L +AR  QG     + T  LAM+ADR+    +  
Sbjct: 131 DLPMMFGLCVIFVSTSMFAFGSSYGVLFLARGLQGVGSAFADTAGLAMIADRYTVEAERT 190

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             YQ++G                 ++ +I++P  +   
Sbjct: 191 KALGIALAFISFGSLVAPPFGGILYQFFGKELPFISLAFVALFDGFLLMIIMQPVRIER- 249

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI-LAGLEPILPI 190
                          A       +P I  L+ D   I IC   + +A++ LA LEP +  
Sbjct: 250 -----------TVLKAEGNLPKGTP-IHRLLLD-PYIAICAGCLTIANVSLAFLEPTISN 296

Query: 191 YLRKEFDADASLIGLIFIAIAIP------TFLSPAVGYISFYIGQRRTCGIGMILMGIAT 244
           ++ +   A  +  GL+++   +P      T +  A  Y  +   Q     +G+ + G++ 
Sbjct: 297 WMSETMHATNAQEGLVWLPAFLPHLAGVITTVKLAAKYPKY---QWLMAAVGLAIEGMSC 353

Query: 245 PLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIG 304
            LI   + F  +++P+       ++V T  LP +G  V  +    YG +YA+ +++YS+ 
Sbjct: 354 FLIPFCTNFLALMIPISILCYGIALVDTAILPTMGFLVDTRHVSVYGSVYAIADLSYSVA 413

Query: 305 MFVGPVIAGLLFELFEFRNTLIIFGAAVLAITPLIFAGR 343
             +GP++AG L +  +F    I+     L   P+++  R
Sbjct: 414 YALGPIVAGELVQAIKFLGLNIVMTLVTLIYVPVLYLLR 452



>gi|341878028|gb|EGT33963.1| hypothetical protein CAEBREN_17466 [Caenorhabditis brenneri]
          Length = 539

 Score = 80.5 bits (197), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 83/350 (23%), Positives = 144/350 (41%), Gaps = 30/350 (8%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
           +IPM+ G+ ++   + +F +  SY  L+ AR  QG     + T  LAM+ADRF    +  
Sbjct: 130 EIPMILGLCTMFFSTAIFALGKSYGVLLFARSLQGFGSAFADTSGLAMIADRFTEENERS 189

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             Y   G                L + M++ P    T 
Sbjct: 190 AALGIALAFISFGCLVAPPFGSVLYSIAGKPVPFLILSFVCLADALAVFMVINPHRRGT- 248

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI-LAGLEPILPI 190
                           +     Q   +W L  D   I  C   +++A++ LA LEP +  
Sbjct: 249 ---------------DSHGEKVQGTPMWRLFMD-PFIACCSGALIMANVSLAFLEPTITT 292

Query: 191 YLRKEF-DADASLIGLIFIAIAIPTFLSPAVG-YISFYIGQR------RTCGIGMILMGI 242
           ++ +   D    L+G+I++    P F    +G Y++  + +           IG+ + GI
Sbjct: 293 WMSEMMPDTPGWLVGVIWL----PPFFPHVLGVYVTVKLLKSFPGYTWAIAMIGLAMEGI 348

Query: 243 ATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYS 302
           A   I   +    ++LPL F     +++ T  LP+LGH V  +    YG +YA+ +++YS
Sbjct: 349 ACFTIPYTNSVMQLILPLSFVCFGIALIDTSLLPMLGHLVDTRHVSVYGSVYAIADISYS 408

Query: 303 IGMFVGPVIAGLLFELFEFRNTLIIFGAAVLAITPLIFAGRLRDHADRIQ 352
           +    GP+IAG +   + F    II     +   P++F  R     D + 
Sbjct: 409 LAYAFGPIIAGWIVTNWGFTALNIIIFITNVGYAPVLFLLRKVHSYDTLN 458



>gi|341880478|gb|EGT36413.1| hypothetical protein CAEBREN_22636 [Caenorhabditis brenneri]
          Length = 539

 Score = 80.5 bits (197), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 83/350 (23%), Positives = 144/350 (41%), Gaps = 30/350 (8%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
           +IPM+ G+ ++   + +F +  SY  L+ AR  QG     + T  LAM+ADRF    +  
Sbjct: 130 EIPMILGLCTMFFSTAIFALGKSYGVLLFARSLQGFGSAFADTSGLAMIADRFTEENERS 189

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             Y   G                L + M++ P    T 
Sbjct: 190 AALGIALAFISFGCLVAPPFGSVLYSIAGKPVPFLILSFVCLADALAVFMVINPHRRGT- 248

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI-LAGLEPILPI 190
                           +     Q   +W L  D   I  C   +++A++ LA LEP +  
Sbjct: 249 ---------------DSHGEKVQGTPMWRLFMD-PFIACCSGALIMANVSLAFLEPTITT 292

Query: 191 YLRKEF-DADASLIGLIFIAIAIPTFLSPAVG-YISFYIGQR------RTCGIGMILMGI 242
           ++ +   D    L+G+I++    P F    +G Y++  + +           IG+ + GI
Sbjct: 293 WMSEMMPDTPGWLVGVIWL----PPFFPHVLGVYVTVKLLKSFPGYTWAIAMIGLAMEGI 348

Query: 243 ATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYS 302
           A   I   +    ++LPL F     +++ T  LP+LGH V  +    YG +YA+ +++YS
Sbjct: 349 ACFTIPYTNSVMQLILPLSFVCFGIALIDTSLLPMLGHLVDTRHVSVYGSVYAIADISYS 408

Query: 303 IGMFVGPVIAGLLFELFEFRNTLIIFGAAVLAITPLIFAGRLRDHADRIQ 352
           +    GP+IAG +   + F    II     +   P++F  R     D + 
Sbjct: 409 LAYAFGPIIAGWIVTNWGFTALNIIIFITNVGYAPVLFLLRKVHSYDTLN 458



>gi|357624412|gb|EHJ75195.1| hypothetical protein KGM_00157 [Danaus plexippus]
          Length = 550

 Score = 80.5 bits (197), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 77/318 (24%), Positives = 136/318 (42%), Gaps = 28/318 (8%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            IPMM G++ + + + +F    SY  L  AR  QG     + T  LAM+ADRF    +  
Sbjct: 86  DIPMMIGLIIMFLSTSIFACGRSYSMLFFARSLQGVGSAFADTSGLAMIADRFTEESERS 145

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             YQ+ G                 ++ ++++P      
Sbjct: 146 KALGIALAFISFGCLVAPPFGGALYQFAGKEVPFLILALISLLDGFMLLLVMKPLKTQMK 205

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI-LAGLEPILPI 190
           +              A+Q     +P IW L+ D   I +C   ++++++ LA LEP + +
Sbjct: 206 E--------------ASQPKPAGTP-IWKLLMD-PYIAVCAGALMMSNVALAFLEPTISL 249

Query: 191 YLRKEFDADASLIGLIFIAIAIPTFLSPAVGYI-------SFYIGQRRTCGIGMILMGIA 243
           ++      D   IG+I++    P F    +G I        +   Q      G+ L G+ 
Sbjct: 250 WMEDNLTKDNWKIGMIWL----PAFFPHVLGVIITVKMAKQYPQHQWLMAAGGLALEGLC 305

Query: 244 TPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSI 303
             +I   S + ++++P+       +++ T  LP LG+ V  +    YG IYA+ +++YS 
Sbjct: 306 CFIIPFASSYKMLMIPICGICFGIALIDTALLPTLGYLVDVRYVSVYGSIYAIADISYSF 365

Query: 304 GMFVGPVIAGLLFELFEF 321
              VGP+IAG + E   F
Sbjct: 366 AYAVGPIIAGEVVEAIGF 383



>gi|291241728|ref|XP_002740762.1| PREDICTED: vesamicol binding protein, putative-like [Saccoglossus
           kowalevskii]
          Length = 538

 Score = 80.1 bits (196), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 77/342 (22%), Positives = 142/342 (41%), Gaps = 35/342 (10%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            IPM+ G++ + + + +F   ++YW L VAR  QG     + T   AM+AD F  G +  
Sbjct: 129 DIPMLIGLVIMFVATAVFAFGDTYWVLFVARSLQGVGSAFADTAGFAMIADNFQQGEERT 188

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             Y++ G                 ++  I++P D    
Sbjct: 189 RALGIALAFISFGCLVAPPFGGILYEFAGKKVPFLILATISLLDGFMLMFIIKPYD---- 244

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPS---IWNLIFDWNIINICLAIIVVASILAGLEPIL 188
                            ++   Q P    I+ L+ D  I     A+      LA +EP +
Sbjct: 245 -----------------RQKRIQMPKGTPIYKLMLDPYIATTAGALATANISLAFIEPTI 287

Query: 189 PIYLRKEFDADASLIGLIFIAIAIPTFLSPAVGYI-------SFYIGQRRTCGIGMILMG 241
            +++R   +A +   G+I++    P F+   +G +        +   Q     IG+  +G
Sbjct: 288 GVWMRDTMNAPSWQQGIIWL----PPFVPHVIGVVLTVKLAAKYPHYQWLIACIGLFTIG 343

Query: 242 IATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAY 301
            +T ++     F ++++PL       +++ T  LP LG  V  +    YG +YA+ +++Y
Sbjct: 344 ASTMIVPFSETFGVLIVPLCGICFGIALIDTALLPTLGFLVDVRHVSVYGSVYAIADISY 403

Query: 302 SIGMFVGPVIAGLLFELFEFRNTLIIFGAAVLAITPLIFAGR 343
           S+    GP++AG +     F    II G   +A  P++F  R
Sbjct: 404 SLAYAFGPILAGEIVRDIGFMWLNIIIGLLSIAYCPMLFIIR 445



>gi|340725698|ref|XP_003401203.1| PREDICTED: synaptic vesicular amine transporter-like isoform 1
           [Bombus terrestris]
 gi|340725700|ref|XP_003401204.1| PREDICTED: synaptic vesicular amine transporter-like isoform 2
           [Bombus terrestris]
          Length = 524

 Score = 80.1 bits (196), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 77/323 (23%), Positives = 133/323 (41%), Gaps = 24/323 (7%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            IPM  G + + + +++F    SY  L +AR  QG     S    + MLA+R+    + G
Sbjct: 182 SIPMFTGFIIMFLSTLIFAFGRSYGILFLARALQGIGSSCSSVSGMGMLAERYQDDKERG 241

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             MG  L                 Y+Y G                ++  ++++PS + T 
Sbjct: 242 NAMGIALGGLALGVLIGPPFGGAMYEYIGKSAPFLVLSALALGDGILQLLVLQPSVVYT- 300

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASILAGLEPILPIY 191
                                 + PS+ +L+ D  I     AI      +A LEP LPI+
Sbjct: 301 --------------------EAEPPSLKSLVTDPYISLAAGAITFANMGIAMLEPSLPIW 340

Query: 192 LRKEFDADASLIGLIFIAIAIPTFLSPAV-GYISFYIGQRRTCGIGMILMGIATPLISLP 250
           +    DA     G  F+  +I   +   + G +   +G+     IG++++GI    I L 
Sbjct: 341 MMDTMDASRWEQGAAFLPASISYLIGTNLFGPLGHRMGRWLAALIGLVVIGICLMCIPLA 400

Query: 251 SKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGMFVGPV 310
                +++P    G    +V +  +P LG+ V  +    YG +YA+ ++A+ +G  VGP 
Sbjct: 401 KSIHHLIVPNAGLGFAIGMVDSSMMPELGYLVDIRHTAVYGSVYAIGDVAFCLGFAVGPA 460

Query: 311 IAGLLFELFEFRNTLIIFGAAVL 333
           ++G L     F    ++FG A+L
Sbjct: 461 LSGTLVNSIGFE--WMLFGIAIL 481



>gi|350403795|ref|XP_003486906.1| PREDICTED: synaptic vesicular amine transporter-like [Bombus
           impatiens]
          Length = 524

 Score = 79.3 bits (194), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 77/323 (23%), Positives = 133/323 (41%), Gaps = 24/323 (7%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            IPM  G + + + +++F    SY  L +AR  QG     S    + MLA+R+    + G
Sbjct: 182 SIPMFTGFIIMFLSTLIFAFGRSYGILFLARALQGIGSSCSSVSGMGMLAERYQDDKERG 241

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             MG  L                 Y+Y G                ++  ++++PS + T 
Sbjct: 242 NAMGIALGGLALGVLIGPPFGGAMYEYVGKSAPFLVLSALALGDGILQLLVLQPSVVYT- 300

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASILAGLEPILPIY 191
                                 + PS+ +L+ D  I     AI      +A LEP LPI+
Sbjct: 301 --------------------EAEPPSLKSLVTDPYIGLAAGAITFANMGIAMLEPSLPIW 340

Query: 192 LRKEFDADASLIGLIFIAIAIPTFLSPAV-GYISFYIGQRRTCGIGMILMGIATPLISLP 250
           +    DA     G  F+  +I   +   + G +   +G+     IG++++GI    I L 
Sbjct: 341 MMDTMDASRWEQGAAFLPASISYLIGTNLFGPLGHRMGRWLAALIGLVVIGICLMCIPLA 400

Query: 251 SKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGMFVGPV 310
                +++P    G    +V +  +P LG+ V  +    YG +YA+ ++A+ +G  VGP 
Sbjct: 401 KSIHHLIVPNAGLGFAIGMVDSSMMPELGYLVDIRHTAVYGSVYAIGDVAFCLGFAVGPA 460

Query: 311 IAGLLFELFEFRNTLIIFGAAVL 333
           ++G L     F    ++FG A+L
Sbjct: 461 LSGTLVNSIGFE--WMLFGIAIL 481



>gi|512199806|gb|EPE28639.1| MFS general substrate transporter [Glarea lozoyensis ATCC 20868]
          Length = 456

 Score = 79.3 bits (194), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 83/311 (26%), Positives = 133/311 (42%), Gaps = 25/311 (8%)

Query: 31  IANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLGVVMGTVLSANTXXXXXXXX 90
           +A +   L +AR  QG A  A W++ LA+L D  G G  +  +MG V  A +        
Sbjct: 102 LAQNVATLCIARFVQGVASAAVWSVGLALLTDTVG-GDHVAEIMGWVNIAFSCGFMAGPV 160

Query: 91  XXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSD---LSTYQSVXXXXXXXXXXXXA 147
                Y   GY               +   +I+E  +   L   Q+              
Sbjct: 161 VGGLLYASAGYHAVFAIASGLLVVDLVYRLLIIEKREARQLLALQNDADEEGARRPLLEG 220

Query: 148 NQEFHT---QSPSIWNLIFDWNIINICLAIIVVASIL-AGLEPILPIYLRKEFDADASLI 203
           N+E HT   +  S ++++     + I L    V ++L A +E  LPI L+  F   +   
Sbjct: 221 NRE-HTIEHKRDSAYDILVTSRRLMISLVCAFVQALLVASIEATLPIRLKAIFGYGSGQS 279

Query: 204 GLIFIAIAIPTFLSPAVGYISFYIGQRRTCGIGMILMGIATPLISL------PSKFWLVV 257
           GL+F+ + IP+ L+P +GY     G       G ++ G A  L+ L       SK  L++
Sbjct: 280 GLMFMTLMIPSVLAPLIGYFCGRFGNAIIALSGYLVCGTAAILLRLSDHNDTESKIVLII 339

Query: 258 LPLLFFGATYSIVTTPTLPLLGHYVTQKGG---------GAYGQIYALWNMAYSIGMFVG 308
           L L+  G    ++ TP L  +   V +            GA+ Q YAL+++AY+ G F+G
Sbjct: 340 L-LVMIGIAMCMIMTPVLTEVFAAVEELEEESPGRFGQYGAFAQAYALFDIAYAGGAFIG 398

Query: 309 PVIAGLLFELF 319
           P+ AGL+   F
Sbjct: 399 PIFAGLVISKF 409



>gi|391341996|ref|XP_003745310.1| PREDICTED: vesicular acetylcholine transporter-like [Metaseiulus
           occidentalis]
          Length = 524

 Score = 79.3 bits (194), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 82/343 (23%), Positives = 144/343 (41%), Gaps = 30/343 (8%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            +PMMFG+  + + + +F    SY  L  AR  QG     + T  LAM+ADRF    +  
Sbjct: 136 DLPMMFGLTVMFLSTAIFACGQSYSVLFFARSLQGIGSAFADTGGLAMIADRFTEEAERS 195

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             +++ G                +++  ++ P      
Sbjct: 196 RALGIALAFISFGCLVAPPFGGLLFEFAGKEVPFVILSLVCLIDGILLLFVMRPVKQQMR 255

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI-LAGLEPILPI 190
                             E    +P I  L+ D   I +C   ++++++ LA LEP + I
Sbjct: 256 D--------------MGMERPKGTP-IHVLLVD-PFIAVCAGALMMSNVSLAFLEPTIAI 299

Query: 191 YLRKEFDADASLIGLIFIAIAIPTFLSPAVG-YISFYIGQR------RTCGIGMILMGIA 243
           +++     +   IGLI++    P F+   +G Y++    +R           G+ L G++
Sbjct: 300 WMKDNLHTEEWQIGLIWL----PAFIPHVLGVYLTVIASERYPQYQWAMAAFGLALEGVS 355

Query: 244 TPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSI 303
           + L+     +W +  PL       ++V T  LP LG  V  +    YG IYA+ +++YS+
Sbjct: 356 SFLVPFAKSYWFLFFPLSGICFGIAMVDTSLLPTLGFLVDYRYVSVYGSIYAIADISYSM 415

Query: 304 GMFVGPVIAGLLFELFEFRNTLIIFGAAVLAITPLIFAGRLRD 346
              +GPVIAG + E   F           LA  PL++  RL++
Sbjct: 416 AYAIGPVIAGGIVESIGFTALNFFIAITSLAYVPLLW--RLKN 456



>gi|307178985|gb|EFN67501.1| Vesicular acetylcholine transporter [Camponotus floridanus]
          Length = 582

 Score = 79.3 bits (194), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 78/318 (24%), Positives = 136/318 (42%), Gaps = 27/318 (8%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            IPMM G+  + + + +F    SY  L  AR  QG     + T  LAM+ADRF    +  
Sbjct: 114 DIPMMIGLCIMFLSTSVFACGKSYSVLFFARSLQGVGSAFADTSGLAMIADRFTEESERS 173

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             YQ+ G                 ++ ++++P      
Sbjct: 174 KALGIALAFISFGCLVAPPFGGALYQFAGKEVPFLILAFVSLADGFMLLLVMKPIKEQLR 233

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI-LAGLEPILPI 190
           +S              N E  +  P IW L+ D   I +C   ++++++ LA LEP + +
Sbjct: 234 ES-------------RNHEPKSTIP-IWRLLMD-PYIAVCAGALMMSNVALAFLEPTISL 278

Query: 191 YLRKEFDADASLIGLIFIAIAIPTFLSPAVGYI-------SFYIGQRRTCGIGMILMGIA 243
           ++      D   IG++++    P F    VG I        +   Q      G+ L G+ 
Sbjct: 279 WMEDTMTHDNWKIGMVWL----PAFFPHVVGVIITVKMAKQYPQYQWLMAAGGLALEGLC 334

Query: 244 TPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSI 303
             +I   + + ++++PL       +++ T  LP LG+ V  +    YG IYA+ +++YS+
Sbjct: 335 CFIIPFSNSYKVLMIPLCGICFGIALIDTALLPTLGYLVDVRYVSVYGSIYAIADISYSV 394

Query: 304 GMFVGPVIAGLLFELFEF 321
              VGP+IAG + E   F
Sbjct: 395 AYAVGPIIAGGVVEAIGF 412



>gi|383860874|ref|XP_003705913.1| PREDICTED: synaptic vesicular amine transporter-like [Megachile
           rotundata]
          Length = 521

 Score = 79.3 bits (194), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 79/331 (23%), Positives = 138/331 (41%), Gaps = 26/331 (7%)

Query: 13  IPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLGV 72
           IPM  G + + + +++F    SY  L +AR  QG     S    + MLA+RF    + G 
Sbjct: 180 IPMFTGFVIMFLSTLIFAFGRSYGILFLARALQGIGSSCSSVSGMGMLAERFQDDKERGN 239

Query: 73  VMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTYQ 132
            MG  L                 Y++ G                ++  ++++PS + T  
Sbjct: 240 AMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLVLSALALGDGILQLLVLQPSVVYT-- 297

Query: 133 SVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASILAGLEPILPIYL 192
                               T+ PS+ +LI D  I+    AI      +A LEP LPI++
Sbjct: 298 -------------------ETEPPSLKSLITDPYIVLAAGAITFANMGIAMLEPSLPIWM 338

Query: 193 RKEFDADASLIGLIFIAIAIPTFLSPAV-GYISFYIGQRRTCGIGMILMGIATPLISLPS 251
                A     G  F+  +I   +   + G +   +G+     IG++++GI    I L  
Sbjct: 339 MDTMGASRWKQGATFLPASISYLIGTNLFGPLGHRMGRWLASLIGLVVIGICLMCIPLAR 398

Query: 252 KFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGMFVGPVI 311
               +++P    G    +V +  +P LG+ +  +    YG +YA+ ++A+ +G  VGP +
Sbjct: 399 SIDHLIVPNAGLGFAIGMVDSSMMPELGYLMDIRHSAVYGSVYAIGDVAFCLGFAVGPAL 458

Query: 312 AGLLFELFEFRNTLIIFGAAVLAI--TPLIF 340
           +G L     F    ++FG A+L     PL++
Sbjct: 459 SGTLVNSIGFE--WMLFGIAILNFLYAPLLY 487



>gi|449303163|gb|EMC99171.1| hypothetical protein BAUCODRAFT_31492 [Baudoinia compniacensis UAMH
           10762]
          Length = 510

 Score = 79.3 bits (194), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 59/193 (30%), Positives = 95/193 (49%), Gaps = 23/193 (11%)

Query: 156 PSIWNLIFDWNIINICLAIIVVASILAGLEPILPIYLRKEFDADASLIGLIFIAIAIPTF 215
           P++  L     +++   A ++ AS+    + +LP+Y+R  F  ++   GLIF+ I I +F
Sbjct: 292 PAVIYLFSSRRVVSALWACLIQASLYTAFDSLLPLYVRDTFHWNSIGAGLIFLPIVIVSF 351

Query: 216 LSPAVGYISFYIGQRRTCGIGMILMGIATPLI---------SLPSKFWLVVLPLLFFGAT 266
           L P +G+ +  IG R     G I    A PL+         +L  K  L  L L   G T
Sbjct: 352 LGPVIGWATDKIGPRWFATAGFI---AACPLLILLRLVRYNTLSQKVLLCAL-LALIGLT 407

Query: 267 YSIVTTPTLPLLGHYVTQKG----------GGAYGQIYALWNMAYSIGMFVGPVIAGLLF 316
            ++V TP +  + + V  K            GAY Q Y+L+NMA++ G FVGP++ GL+ 
Sbjct: 408 LTLVLTPMMAEIAYAVDAKAQRHKPGFFGKNGAYAQAYSLFNMAWAAGCFVGPLLGGLIK 467

Query: 317 ELFEFRNTLIIFG 329
           E   +  T ++ G
Sbjct: 468 ERAGWGTTTLVLG 480



>gi|334339973|ref|YP_004544953.1| major facilitator superfamily protein [Desulfotomaculum ruminis DSM
           2154]
 gi|503607362|ref|WP_013841438.1| MFS transporter [Desulfotomaculum ruminis]
 gi|334091327|gb|AEG59667.1| major facilitator superfamily MFS_1 [Desulfotomaculum ruminis DSM
           2154]
          Length = 395

 Score = 79.0 bits (193), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 82/319 (25%), Positives = 148/319 (46%), Gaps = 28/319 (8%)

Query: 1   FAVLSDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAML 60
             +LSD+Y  +KI M+ G+L+L++ ++ F +ANS W L++ R+ QG + GA+WT   A++
Sbjct: 61  LGLLSDRYGRKKI-MLLGLLTLSLSTLGFTLANSLWLLILIRLIQGFSAGATWTAGPALV 119

Query: 61  ADRFGSGPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVIS 120
           AD +    + G  MG + +A               Y+  GY               L + 
Sbjct: 120 ADLYPPDQR-GAKMGIISAATGFGFLIGPAAGGLLYELGGYRLPFLIGTILSLIVGLFV- 177

Query: 121 MIVEPSDLSTYQSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI 180
           + V P+D +                  N +   +  S+   +  +  + + L +I++ S 
Sbjct: 178 LKVLPADKT------------------NGKSRKRDHSLLE-VLQFKGVPVSLTVILLGST 218

Query: 181 LAG-LEPILPIYLRKEFDADASLIGLIFIAIAIPTFLS-PAVGYISFYIGQRRTCGIGMI 238
             G ++PILP Y   +F     ++G++F  I++    S P +G +S   G+ +    G++
Sbjct: 219 GFGFIDPILPGYFMDKFGISPGIVGILFGLISLSHVSSAPVIGKLSDSWGRLKLIQWGLV 278

Query: 239 LMGIATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYV----TQKGGGAYGQIY 294
                 PL+SL +      + +   G T+ ++ TPT+PLL   V       G  +YG  +
Sbjct: 279 GTAAVIPLVSLSNSLITTAMVMGLLGITFGLILTPTMPLLADSVMLQSKDSGEASYGAAF 338

Query: 295 ALWNMAYSIGMFVGPVIAG 313
            L+N A+S+G   GP+  G
Sbjct: 339 GLYNTAFSLGYLWGPLFGG 357



>gi|321474989|gb|EFX85953.1| hypothetical protein DAPPUDRAFT_127538 [Daphnia pulex]
          Length = 553

 Score = 78.6 bits (192), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 70/310 (22%), Positives = 135/310 (43%), Gaps = 17/310 (5%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
           ++PMM G+  + + + +F    SY  L  AR  QG     + T  LAM+ADRF    +  
Sbjct: 117 ELPMMIGLTIMFLSTAVFACGRSYGVLFFARSLQGVGSAFADTSGLAMIADRFTEESERT 176

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             Y++ G                L++ +++ P  +S  
Sbjct: 177 KALGIALAFISFGCLVAPPFGGLLYEFAGKELPFLILSLVCLIDALMLKLVMRPRGMSQL 236

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI-LAGLEPILPI 190
                            Q     +P IW L+ D   I +C   +++A++ LA LEP + +
Sbjct: 237 GKSTSAVSLAAGASAGPQ---VGTP-IWRLLMD-PYIAVCSGALMMANVSLAFLEPTISV 291

Query: 191 YLRKEFDADASLIGLIFIAIAIPTFLSPAVGYI-SFYIGQRR------TCGIGMILMGIA 243
           ++    + +   +G+I++    P F    +G + +  +  R           G+ L G+ 
Sbjct: 292 WMMDTMNVEQWQLGMIWL----PAFFPHVLGVVLTVRMAARYPQYTWVMAAFGLALEGLC 347

Query: 244 TPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSI 303
             +I   + +W++++P+       +++ T  LP +G+ V  +    YG IYA+ +++YS 
Sbjct: 348 CFIIPFATSYWVLMIPICGICFGIALIDTALLPTMGYVVDVRYVSVYGSIYAIADISYSF 407

Query: 304 GMFVGPVIAG 313
              +GP+IAG
Sbjct: 408 AYAIGPIIAG 417



>gi|195055240|ref|XP_001994527.1| GH17299 [Drosophila grimshawi]
 gi|193892290|gb|EDV91156.1| GH17299 [Drosophila grimshawi]
          Length = 619

 Score = 78.6 bits (192), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 78/323 (24%), Positives = 134/323 (41%), Gaps = 23/323 (7%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            IPM  G + + + +++F    SY  L +AR  QG     S    + MLADRF    + G
Sbjct: 275 SIPMFAGFVIMFLSTLIFAFGRSYLVLFIARALQGIGSSCSSVSGMGMLADRFTDDKERG 334

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             MG  L                 Y++ G                L+   +++PS     
Sbjct: 335 NAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLVLAALALGDGLLQMFMLQPS----- 389

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASILAGLEPILPIY 191
                          A  E   + PS+ +LI D  I+    AI      +A LEP LP++
Sbjct: 390 ------------IQKAETE---EPPSLKSLISDPYILIAAGAITFANMGIAMLEPSLPLW 434

Query: 192 LRKEFDADASLIGLIFIAIAIPTFLSPAV-GYISFYIGQRRTCGIGMILMGIATPLISLP 250
           +     A     G+ F+  +I   +   + G +   IG+     +G++++G     I + 
Sbjct: 435 MVDNMGATRWEQGVAFLPASISYLIGTNLFGPLGHKIGRWFAACLGLVIIGACLIFIPMA 494

Query: 251 SKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGMFVGPV 310
           +    +++P    G    +V +  +P LG+ V  +    YG +YAL ++A+ +G  VGP 
Sbjct: 495 TSITHLIIPNAGLGFAIGMVDSSMMPELGYLVDIRHSAVYGSVYALGDVAFCVGFAVGPA 554

Query: 311 IAGLLFELFEFRNTLIIFGAAVL 333
           ++G L +   F    ++FG A+L
Sbjct: 555 LSGSLVKSIGFE--WMLFGIAIL 575



>gi|307184508|gb|EFN70897.1| Synaptic vesicular amine transporter [Camponotus floridanus]
          Length = 513

 Score = 78.6 bits (192), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 80/344 (23%), Positives = 142/344 (41%), Gaps = 26/344 (7%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            IPM  G + + + +++F    SY  L +AR  QG     S    + MLA+R+    + G
Sbjct: 171 SIPMFTGFIIMFLSTLIFAFGRSYGILFLARALQGIGSSCSSVSGMGMLAERYQDDKERG 230

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             MG  L                 Y++ G                L+  ++++PS + T 
Sbjct: 231 NAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLVLSALALGDGLLQLLMLQPSVVYT- 289

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASILAGLEPILPIY 191
                                T+ PS+ +L+ D  II    AI      +A LEP LPI+
Sbjct: 290 --------------------ETKPPSLKSLVTDPYIILAAGAITFANMGIAMLEPSLPIW 329

Query: 192 LRKEFDADASLIGLIFIAIAIPTFLSPAV-GYISFYIGQRRTCGIGMILMGIATPLISLP 250
           +     A     G  F+  +I   +   + G +   +G+     IG++++GI    I L 
Sbjct: 330 MMDTMGASRWKQGATFLPASISYLIGTNLFGPLGHKMGRWLASLIGLVVIGICLMCIPLA 389

Query: 251 SKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGMFVGPV 310
                +++P    G    +V +  +P LG+ V  +    YG +YA+ ++A+ +G  +GP 
Sbjct: 390 RSINHLIVPNAGLGFAIGMVDSSMMPQLGYLVDIRHTAVYGSVYAIGDVAFCLGFAIGPA 449

Query: 311 IAGLLFELFEFRNTLIIFGAAVLAI--TPLIFAGRLRDHADRIQ 352
           ++G L     F    ++FG A+L     PL++  R   + +  +
Sbjct: 450 LSGTLVNTIGFE--WMLFGIAMLNFMYAPLMYFLRAPPNKEEKE 491



>gi|242023366|ref|XP_002432105.1| Vesicular acetylcholine transporter, putative [Pediculus humanus
           corporis]
 gi|212517479|gb|EEB19367.1| Vesicular acetylcholine transporter, putative [Pediculus humanus
           corporis]
          Length = 604

 Score = 78.2 bits (191), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 82/330 (24%), Positives = 139/330 (42%), Gaps = 36/330 (10%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            IPMM G+  + + + +F    SY  L  AR  QG     + T  LAM+ADRF    +  
Sbjct: 129 DIPMMIGLTIMFLSTAVFACGRSYGLLFFARSLQGVGSAFADTSGLAMIADRFTEEAERS 188

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             YQ+ G                 ++ ++++P  L T 
Sbjct: 189 KALGIALAFISFGCLVAPPFGGALYQFAGKEVPFLILAFISLADGFMLLLVMKP--LKTI 246

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPS---IWNLIFDWNIINICLAIIVVASI-LAGLEPI 187
                            +E   +SP    IW L+ D   I +C   ++++++ LA LEP 
Sbjct: 247 I----------------KEAKAESPDTIPIWRLLMD-PYIAVCAGALMMSNVALAFLEPT 289

Query: 188 LPIYLRKEFDADASLIGLIFIAIAIPTFLSPAVGYI-------SFYIGQRRTCGIGMILM 240
           + +++      D   IG+I++    P F    +G +        +   Q      G+   
Sbjct: 290 ISLWMEDNLTTDNWKIGMIWL----PAFFPHVIGVVVTVKMAKKYPQWQWAMAAGGLAFE 345

Query: 241 GIATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMA 300
           G+   +I     + +++LP+       +++ T  LP LG+ V  +    YG IYA+ +++
Sbjct: 346 GMCCFIIPFSGSYKMLMLPICGICFGIALIDTALLPTLGYLVDVRYVSVYGSIYAIADIS 405

Query: 301 YSIGMFVGPVIAGLLFELFEFR--NTLIIF 328
           YSI   VGP+IAG + E   F   N LI F
Sbjct: 406 YSIAYAVGPIIAGGVVEAIGFTALNFLIAF 435



>gi|339236123|ref|XP_003379616.1| vesicular acetylcholine transporter unc-17 [Trichinella spiralis]
 gi|316977701|gb|EFV60770.1| vesicular acetylcholine transporter unc-17 [Trichinella spiralis]
          Length = 1050

 Score = 78.2 bits (191), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 74/311 (23%), Positives = 136/311 (43%), Gaps = 31/311 (9%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
           +IPM+ G++ +   + +F +  SY  L  AR  QG     + T  LAM+A+RF    +  
Sbjct: 132 EIPMIIGLVIMFSSTAIFALGQSYGILFFARSLQGLGSAFADTSGLAMIANRFTEEAERS 191

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             Y++ G                 ++ M++ P      
Sbjct: 192 KALGIALAFISFGSLVAPPFGGVLYEFCGKPVPFLLLSFVCLLDGFMVFMVIHPK----- 246

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI-LAGLEPILPI 190
                          A      + P+++ L+ D   I +C   +V A++ LA LEP +  
Sbjct: 247 ------------TQRAETGERIKGPTVFRLLLD-PYIAVCAGALVTANVSLAFLEPTISK 293

Query: 191 YLRKEFDADAS-LIGLIFIAIAIPTFLSPAVG-YISFYIGQRRT------CGIGMILMGI 242
           ++           IGL+++    P FL   +G Y++  + +R +        +G+ L GI
Sbjct: 294 WMTDTMPTVTEWQIGLVWL----PPFLPHVLGVYVAVKLLKRYSQISWLLAAVGLGLEGI 349

Query: 243 ATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYS 302
           +  ++   + +  +++PL       S+V T  LPLLG+ V  +    YG +YA+ +++YS
Sbjct: 350 SCFIVPFATTYTGLIIPLSILCFGISLVDTALLPLLGYLVDTRHASVYGSVYAIADISYS 409

Query: 303 IGMFVGPVIAG 313
           I   +GPV+AG
Sbjct: 410 IAYAIGPVVAG 420



>gi|358374900|dbj|GAA91488.1| MFS amine transporter [Aspergillus kawachii IFO 4308]
          Length = 488

 Score = 77.8 bits (190), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 96/388 (24%), Positives = 158/388 (40%), Gaps = 50/388 (12%)

Query: 1   FAVLSDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAML 60
           F   +D+  +R++P + G+L+LA  +I+F  A +   LV+AR  QG +    WT+ LA++
Sbjct: 88  FGYFADRSSSRQLPFLIGLLALAGTTIVFWFAETVSSLVIARSLQGLSAAVVWTVGLALV 147

Query: 61  ADRFGSGPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVIS 120
            D  G   ++G  MG V  A T                 GY                +  
Sbjct: 148 VDTVGK-DQVGAAMGYVSMALTVGTVFGPFIGGIMLSRVGYHAVFVLAIGLIVLDICLRL 206

Query: 121 MIVEP----------SDLST-------------YQSVXXXXXXXXXXXXANQ-------- 149
           ++VEP          SD  T             Y ++            A++        
Sbjct: 207 VMVEPKNAAQWIQSSSDGETQGLLDEAGAHSAGYNAITANAGAGQTSSIADECPTEDSGE 266

Query: 150 ----EFHTQSPSIWNLIFDWNIINICLAIIVVASILAGLEPILPIYLRKEFDADASLIGL 205
                  T  P I  LIF   ++ + LA +V A I +  + +LP+Y+ K F   +  IGL
Sbjct: 267 PLTSGRSTSVPGIIRLIFSGKLLVVLLATVVDAIIWSAFDTVLPLYVMKTFGWGSFEIGL 326

Query: 206 IFIAIAIPTFLSPAVGYISFYIGQRRTCGIGMILMGIATPLISL----PSKFWLVVLPLL 261
            F+ +  P+FLSP +G      G  R   +G +L      L  L     ++  +++   L
Sbjct: 327 CFLPLFAPSFLSPWIGDAVDRWGAPRVAFVGFLLDFPTLLLFQLVARNSTQDQILLYVFL 386

Query: 262 FFGATYSIVTTPTLPLLGHYVTQK----------GGGAYGQIYALWNMAYSIGMFVGPVI 311
           F     S +   +L    + VT++            G   Q Y L+N+A+S G  +GP++
Sbjct: 387 FLAGVASTLQMVSLMTEVNNVTERYEREFPGIFGHQGGTAQAYGLFNVAWSGGQVLGPLV 446

Query: 312 AGLLFELFEFRNTLIIFGAAVLAITPLI 339
           AGLL E   +   + + GA    I+ +I
Sbjct: 447 AGLLVERAGWTTMVTVLGAVSGGISVVI 474



>gi|332028561|gb|EGI68598.1| Vesicular acetylcholine transporter [Acromyrmex echinatior]
          Length = 585

 Score = 77.4 bits (189), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 78/321 (24%), Positives = 135/321 (42%), Gaps = 34/321 (10%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            IPMM G+  + + + +F    SY  L  AR  QG     + T  LAM+ADRF    +  
Sbjct: 115 DIPMMIGLSIMFLSTSVFACGKSYGVLFFARSLQGVGSAFADTAGLAMIADRFTEESERS 174

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             YQ+ G                 ++ ++++P      
Sbjct: 175 KALGIALAFISFGCLVAPPFGGALYQFAGKEVPFLILAFVSLADGFMLLLVMKPIKEQL- 233

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPS---IWNLIFDWNIINICLAIIVVASI-LAGLEPI 187
                            QE H +  S   IW L+ D   I +C   ++++++ LA LEP 
Sbjct: 234 -----------------QERHHEPKSTIPIWRLLMD-PYIAVCAGALMMSNVALAFLEPT 275

Query: 188 LPIYLRKEFDADASLIGLIFIAIAIPTFLSPAVGYI-------SFYIGQRRTCGIGMILM 240
           + +++      D   IG+I+    +P F    +G +        +   Q      G+ L 
Sbjct: 276 ISLWMEDTMTHDNWKIGMIW----LPAFFPHVIGVVITVRMAKQYPQYQWLMAAGGLALE 331

Query: 241 GIATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMA 300
           G+   +I   S + ++++PL       +++ T  LP LG+ V  +    YG IYA+ +++
Sbjct: 332 GLCCFIIPFCSSYKVLMIPLCGICFGIALIDTALLPTLGYLVDVRYVSVYGSIYAIADIS 391

Query: 301 YSIGMFVGPVIAGLLFELFEF 321
           YS+   VGP+IAG + E   F
Sbjct: 392 YSVAYAVGPIIAGGVVEAIGF 412



>gi|322792819|gb|EFZ16652.1| hypothetical protein SINV_05992 [Solenopsis invicta]
          Length = 584

 Score = 77.4 bits (189), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 76/320 (23%), Positives = 134/320 (41%), Gaps = 31/320 (9%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            IPMM G+  + + + +F    SY  L  AR  QG     + T  LAM+ADRF    +  
Sbjct: 116 DIPMMIGLCIMFLSTSVFACGKSYSVLFFARSLQGVGSAFADTAGLAMIADRFTEESERS 175

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             YQ+ G                 ++ ++++P      
Sbjct: 176 KALGIALAFISFGCLVAPPFGGALYQFAGKEVPFLILAFVSLADGFMLLLVMKP------ 229

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPS--IWNLIFDWNIINICLAIIVVASI-LAGLEPIL 188
                           ++  H    +  IW L+ D   I +C   ++++++ LA LEP +
Sbjct: 230 ----------IKEQLRDRNMHETKSTIPIWRLLMD-PYIAVCAGALMMSNVALAFLEPTI 278

Query: 189 PIYLRKEFDADASLIGLIFIAIAIPTFLSPAVGYI-------SFYIGQRRTCGIGMILMG 241
            +++      D   IG+I+    +P F    VG +        +   Q      G+ L G
Sbjct: 279 SLWMEDTMTHDNWKIGMIW----LPAFFPHVVGVVITVKMAKQYPQYQWLMAAGGLALEG 334

Query: 242 IATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAY 301
           +   +I   S + ++++PL       +++ T  LP LG+ V  +    YG IYA+ +++Y
Sbjct: 335 LCCFIIPFCSSYQVLMIPLCGICFGIALIDTALLPTLGYLVDVRYVSVYGSIYAIADISY 394

Query: 302 SIGMFVGPVIAGLLFELFEF 321
           S+   VGP+IAG + E   F
Sbjct: 395 SVAYAVGPIIAGGVVEAIGF 414



>gi|512205821|gb|EPE34642.1| MFS general substrate transporter [Glarea lozoyensis ATCC 20868]
          Length = 538

 Score = 77.4 bits (189), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 92/362 (25%), Positives = 151/362 (41%), Gaps = 55/362 (15%)

Query: 4   LSDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADR 63
           L+D+  +R++P++ G+L+L   +++  +A   W +++ RI QGAA    W + +A+L D 
Sbjct: 97  LADRSASRRLPLLVGLLALGGATVMLCVARVVWLIILGRILQGAAAAIVWVVGIALLVDT 156

Query: 64  FGSGPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGY----------VXXXXXXXXXXX 113
            G   ++G  +G V SA               Y+  GY          +           
Sbjct: 157 VGE-ERIGETLGWVSSAMGIGFFLAPLLGGIVYEKAGYYSVYYMAFALIAVDIVLRLALI 215

Query: 114 XXXLVISMIVE-PSDLS----------TYQSVXXXXXXXXXXXXANQEFHTQSPSIWN-- 160
              + +  +VE P+ LS            Q              AN+      PS  N  
Sbjct: 216 EKKIAVQWVVETPTPLSGSGTADLTDEEKQQGSEANVVTEPQPTANRHSLNNDPSSGNAS 275

Query: 161 ---LIFDWNIINICLA----------IIVVASILAGLEPILPIYLRKEFDADASLIGLIF 207
                F W  +   LA           +V  S++   + +LP+++ + F  ++   GLIF
Sbjct: 276 SHGTKFKWPPVITLLASRRLLTALWGCVVQGSLMTAFDSVLPLFVERVFGWNSVGAGLIF 335

Query: 208 IAIAIPTFLSPAVGYISFYIGQRRTCGIGM-------ILMGIATPLISLPSKFWLVVLPL 260
           +A+ IP+F+SPA+GY+S   G R     G        IL+ + T   +L  K     L L
Sbjct: 336 LALTIPSFISPAIGYLSDSYGPRWLAFSGFIFAIPFWILLRLVTH-NTLGQKVLFSAL-L 393

Query: 261 LFFGATYSIVTTPTLPLLGHYVTQK---------GGGAYGQIYALWNMAYSIGMFVGPVI 311
           LF G   ++V  P +  + + V  K           GAY Q Y L+  A++ G  +GPV 
Sbjct: 394 LFIGVGLALVLPPLMAEITYVVEAKEREQPGRFGATGAYAQAYGLFIAAFAAGTLIGPVW 453

Query: 312 AG 313
           AG
Sbjct: 454 AG 455



>gi|134082738|emb|CAK42630.1| unnamed protein product [Aspergillus niger]
          Length = 480

 Score = 77.4 bits (189), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 94/389 (24%), Positives = 158/389 (40%), Gaps = 52/389 (13%)

Query: 1   FAVLSDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAML 60
           F   +D+  +R++P + G+L+LA  +I+F  A +   LV+AR  QG +    WT+ LA++
Sbjct: 80  FGYFADRSSSRQLPFLIGLLALAGTTIVFWFAETVSSLVIARSLQGLSAAVVWTVGLALV 139

Query: 61  ADRFGSGPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVIS 120
            D  G   ++G  MG V  A T                 GY                +  
Sbjct: 140 VDTVGK-DQVGAAMGYVSMALTVGTVFGPFIGGIMLSRVGYHAVFVLAIGLIVLDICLRL 198

Query: 121 MIVEPSDLST-----------------------YQSVXXXXXXXXXXXXANQEFHTQS-- 155
           ++VEP + +                        Y ++             N E+ T+   
Sbjct: 199 VMVEPKNAAQWIQSGSGGETQALLNEAETHGAGYDAITANARAGQTSGLGN-EYPTEGSG 257

Query: 156 -----------PSIWNLIFDWNIINICLAIIVVASILAGLEPILPIYLRKEFDADASLIG 204
                      P I  LIF   ++ + LA +V A I +  + +LP+Y+ K F   +  IG
Sbjct: 258 EPLTSGRSTSVPGIIRLIFSGKLLVVLLATVVDAIIWSAFDTVLPLYVMKTFGWGSFEIG 317

Query: 205 LIFIAIAIPTFLSPAVGYISFYIGQRRTCGIGMILMGIATPLISL----PSKFWLVVLPL 260
           L F+ +  P+FLSP +G      G  R   +G +L      L  L     ++  +++   
Sbjct: 318 LCFLPLFAPSFLSPWIGDAVDRWGALRVAFVGFLLDFPTLLLFQLVARNTTQDQVLLYVF 377

Query: 261 LFFGATYSIVTTPTLPLLGHYVTQK----------GGGAYGQIYALWNMAYSIGMFVGPV 310
           LF     S +   +L    + VT++            G   Q Y L+N+A+S G  +GP+
Sbjct: 378 LFLAGVASTLQMVSLMTEVNNVTERYEREFPGIFGHQGGTAQAYGLFNVAWSGGQVLGPL 437

Query: 311 IAGLLFELFEFRNTLIIFGAAVLAITPLI 339
           +AGLL E   +   + + GA    I+ +I
Sbjct: 438 VAGLLVERAGWTTMVTVLGAVSGGISVVI 466



>gi|312089425|ref|XP_003146242.1| vesicular acetylcholine transporter unc-17 [Loa loa]
 gi|307758595|gb|EFO17829.1| vesicular acetylcholine transporter unc-17 [Loa loa]
          Length = 531

 Score = 77.4 bits (189), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 80/337 (23%), Positives = 140/337 (41%), Gaps = 28/337 (8%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
           ++PM+ G+  +   + +F +  SY  L  AR  QG     + T  LAM+ADRF    +  
Sbjct: 130 ELPMVIGLCVMFSSTAIFALGRSYGVLFFARSLQGFGSAFADTSGLAMIADRFTEENERS 189

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             Y   G                 ++ M+++P   +  
Sbjct: 190 AALGIALAFISFGSLVAPPYGSVLYSLAGKPIPFLILSLICLFDGFMVFMVIQPKTNNKQ 249

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI-LAGLEPILPI 190
            +             A +  H     +W L  D   I IC   ++ A+I LA LEP +  
Sbjct: 250 MNT------------AGERIH--GTPMWRLFMD-KYIAICAGALITANISLAFLEPTITT 294

Query: 191 YLRKEF-DADASLIGLIFIAIAIPTFLSPAVG-YISFYIGQRRT------CGIGMILMGI 242
           ++     D  A ++G+I+     P F    +G Y++  +  R          IG+ + G 
Sbjct: 295 WIANAIPDTPAWMVGIIWF----PPFFPHVLGVYVTVRLMHRYPQKEWLLAAIGLAMEGF 350

Query: 243 ATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYS 302
           +  +I   S    ++LPL       +++ T  LP+LG+ V  +    YG +YA+ +++YS
Sbjct: 351 SCFMIPFTSSVLQLILPLSTLCFGIALIDTSLLPMLGYLVDTRHVSVYGSVYAIADISYS 410

Query: 303 IGMFVGPVIAGLLFELFEFRNTLIIFGAAVLAITPLI 339
           +    GP+IAG +     F    II     +A TP++
Sbjct: 411 LAYAFGPIIAGEIVATMGFLALNIIIFVLNIAYTPVL 447



>gi|449270849|gb|EMC81497.1| Chromaffin granule amine transporter [Columba livia]
          Length = 515

 Score = 76.3 bits (186), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 80/340 (23%), Positives = 141/340 (41%), Gaps = 26/340 (7%)

Query: 2   AVLSDK--YHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAM 59
            VL+++  YH   IPM  G + + I +++F  A SY  L +AR  QG     S    L M
Sbjct: 148 GVLTNRIGYH---IPMFIGFIIMFISTVMFAFAGSYTLLFIARALQGIGSSFSSVAGLGM 204

Query: 60  LADRFGSGPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVI 119
           LA  +    + G  MG  L                 Y++ G                 + 
Sbjct: 205 LASVYTDDLERGNAMGIALGGLALGVLIGAPFGSVMYEFVGKSSPFLVLAFLALLDGALQ 264

Query: 120 SMIVEPSDLSTYQSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVAS 179
             I++PS +S                       T+  S+  L+ D  I+    A+     
Sbjct: 265 LCILQPSKISPES--------------------TRGTSLVTLLRDPFILVAAGALCFSNM 304

Query: 180 ILAGLEPILPIYLRKEFDADASLIGLIFIAIAIPTFLSPAV-GYISFYIGQRRTCGIGMI 238
            +A LEP LPI++ +   +    +G+ F+  +I   +   + G ++  +G+     IGM 
Sbjct: 305 GVAMLEPTLPIWMMQTMCSPKWQLGMAFLPASISYLIGTNLFGLLATRMGRWLCSLIGMG 364

Query: 239 LMGIATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWN 298
           ++GI+   + L +  + +++P    G    +V +  +P +GH V  +    YG +YA+ +
Sbjct: 365 VVGISLLCVPLATNIYGLIIPNAGLGFAIGMVDSSMMPTMGHLVDLRHSSIYGNVYAIAD 424

Query: 299 MAYSIGMFVGPVIAGLLFELFEFRNTLIIFGAAVLAITPL 338
           +A+ +G  +GP   G +     F   +II G   +A  PL
Sbjct: 425 VAFCMGFAIGPSTGGAIVRAVGFPWLMIIIGVINIAYAPL 464



>gi|328709288|ref|XP_003243921.1| PREDICTED: synaptic vesicular amine transporter-like isoform 2
           [Acyrthosiphon pisum]
 gi|328709290|ref|XP_001945866.2| PREDICTED: synaptic vesicular amine transporter-like isoform 1
           [Acyrthosiphon pisum]
          Length = 478

 Score = 76.3 bits (186), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 77/323 (23%), Positives = 133/323 (41%), Gaps = 24/323 (7%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            IPM  G   + I +I+F    SY  L +AR  QG     S    + MLA+R+    + G
Sbjct: 136 SIPMFTGFFIMFISTIIFAFGRSYGVLFLARALQGIGSSCSTVSGMGMLAERYPDDKERG 195

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             MG  L                 Y++ G                L+  ++++P  ++T 
Sbjct: 196 NAMGIALGGLALGVLIGPPFGGIMYEFVGKTAPFLILSALALGDGLLQLLLLQPGVVTT- 254

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASILAGLEPILPIY 191
                                   PS+ +L+ D  II    AI    + +A LEP LPI+
Sbjct: 255 --------------------DADPPSLKSLVMDPYIIIAAGAITFANTGIAMLEPSLPIW 294

Query: 192 LRKEFDADASLIGLIFIAIAIPTFLSPAV-GYISFYIGQRRTCGIGMILMGIATPLISLP 250
           +     A     G+ F+  +I   +   + G +   +G+     IG+I++GI   +I   
Sbjct: 295 MMDTMGAGRWKQGVTFLPASISYLIGTNLFGPLGHRMGRWLAAMIGLIVIGICLMIIPTA 354

Query: 251 SKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGMFVGPV 310
                +++P    G    +V +  +P LG+ V  +    YG +YA+ ++A+ +G  +GP 
Sbjct: 355 RDINHLIVPNAGLGFAIGMVDSSMMPELGYLVDIRHTAVYGSVYAIGDVAFCLGYTIGPA 414

Query: 311 IAGLLFELFEFRNTLIIFGAAVL 333
           ++G L     F    ++FG A+L
Sbjct: 415 LSGTLVNTIGFE--WMLFGTAML 435



>gi|332028802|gb|EGI68831.1| Synaptic vesicular amine transporter [Acromyrmex echinatior]
          Length = 504

 Score = 76.3 bits (186), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 76/323 (23%), Positives = 133/323 (41%), Gaps = 24/323 (7%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            IPM  G + + + +++F    SY  L +AR  QG     S    + MLA+R+    + G
Sbjct: 162 SIPMFTGFIIMFLSTLIFAFGRSYGILFLARALQGIGSSCSSVSGMGMLAERYQDDKERG 221

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             MG  L                 Y++ G                L+  ++++PS + T 
Sbjct: 222 NAMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLILSALALGDGLLQLLMLQPSVVYT- 280

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASILAGLEPILPIY 191
                                 + PS+ +LI D  I+    AI      +A LEP LPI+
Sbjct: 281 --------------------EAEPPSLKSLITDPYIVLAAGAITFANMGIAMLEPSLPIW 320

Query: 192 LRKEFDADASLIGLIFIAIAIPTFLSPAV-GYISFYIGQRRTCGIGMILMGIATPLISLP 250
           +     A     G  F+  +I   +   + G +   +G+     IG++++GI    I L 
Sbjct: 321 MMDTMGASRWKQGATFLPASISYLIGTNLFGPLGHKMGRWLASLIGLVVIGICLMCIPLA 380

Query: 251 SKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGMFVGPV 310
                +++P    G    +V +  +P LG+ V  +    YG +YA+ ++A+ +G  +GP 
Sbjct: 381 RSIDHLIVPNAGLGFAIGMVDSSMMPELGYLVDIRHTAVYGSVYAIGDVAFCLGFAIGPA 440

Query: 311 IAGLLFELFEFRNTLIIFGAAVL 333
           ++G L     F    ++FG A+L
Sbjct: 441 LSGTLVNSIGFE--WMLFGIALL 461



>gi|472587973|gb|EMS25469.1| MFS transporter [Rhodosporidium toruloides NP11]
          Length = 475

 Score = 75.9 bits (185), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 57/198 (28%), Positives = 100/198 (50%), Gaps = 10/198 (5%)

Query: 157 SIWNLIFDWNIINICLAIIVVASILAGL-EPILPIYLRKEFDADASLIGLIFIAIAIPTF 215
           + W L+ D    ++ + I ++  ++ GL +  + +Y++ ++  D    GLIFIA+ +P+F
Sbjct: 266 TTWRLVQDPRA-SVAIGIAMLYGVVFGLLDTGMVLYVKDQYGLDEQGAGLIFIAVVVPSF 324

Query: 216 L-SPAVGYISFYIGQRRTCGIGMILMGIATPLISLPSKFWLVVLPLLFFGATYSIVTTPT 274
           + SP  G+++   G +    +G+       PL+ +     L V  L+  G   S V TPT
Sbjct: 325 IVSPLAGWLTDRYGSKWPATLGVTTFVATYPLLLIEGPLPLFVFFLVLVGVGLSCVVTPT 384

Query: 275 LPLLGHYVTQKGGGAYGQIYALWNMAYSIGMFVGPVIAGLLFELFEFRN---TLIIFGAA 331
              L        G    Q++AL+N+A+S+G F+GP+  G +      RN   T+   G A
Sbjct: 385 THDLNVAAAATPGAEPAQVFALFNLAFSVGSFIGPICGGQIMHSMSTRNGFVTVTSIGTA 444

Query: 332 VLAI-TPLIF---AGRLR 345
           ++A+  PL+     GRLR
Sbjct: 445 LVALAAPLVLVYTGGRLR 462



>gi|307193264|gb|EFN76155.1| Vesicular acetylcholine transporter [Harpegnathos saltator]
          Length = 589

 Score = 75.5 bits (184), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 74/318 (23%), Positives = 136/318 (42%), Gaps = 28/318 (8%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            IPMM G+  + + + +F    SY  L  AR  QG     + T  LAM+ADRF    +  
Sbjct: 115 DIPMMIGLCIMFLSTSVFACGKSYGVLFFARSLQGVGSAFADTAGLAMIADRFTEEAERS 174

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             YQ+ G                 ++ ++++P      
Sbjct: 175 KALGIALAFISFGCLVAPPFGGALYQFAGKEVPFLILAFVSLADGFMLLLVMKP------ 228

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI-LAGLEPILPI 190
                           N+E  +  P IW L+ D   I +C   ++++++ LA LEP + +
Sbjct: 229 --------IKEQLRDRNREEKSTIP-IWRLLMD-PYIAVCAGALMMSNVALAFLEPTISL 278

Query: 191 YLRKEFDADASLIGLIFIAIAIPTFLSPAVG-YISFYIGQRRT------CGIGMILMGIA 243
           ++      D   IG++++    P F    +G  I+  + ++           G+ L G  
Sbjct: 279 WMEDTMTHDNWKIGMVWL----PAFFPHVMGVMITVKMAKQYPQYQWLMAACGLALEGFC 334

Query: 244 TPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSI 303
             ++   S + ++++P+       +++ T  LP LG+ V  +    YG IYA+ +++YS+
Sbjct: 335 CFIVPFCSTYKMLMIPVCGICFGIALIDTALLPTLGYLVDVRYVSVYGSIYAIADISYSL 394

Query: 304 GMFVGPVIAGLLFELFEF 321
              VGP+IAG + E   F
Sbjct: 395 AYAVGPIIAGGVVEAIGF 412



>gi|170585872|ref|XP_001897706.1| vesicular acetylcholine transporter unc-17 [Brugia malayi]
 gi|158595013|gb|EDP33590.1| vesicular acetylcholine transporter unc-17, putative [Brugia
           malayi]
          Length = 528

 Score = 74.3 bits (181), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 81/342 (23%), Positives = 141/342 (41%), Gaps = 38/342 (11%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
           + PM+ G+  +   + +F +  SY  L  AR  QG     + T  LAM+ADRF    +  
Sbjct: 130 EFPMVIGLCVMFSSTAIFALGRSYGVLFFARSLQGFGSAFADTSGLAMIADRFTEENERS 189

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             Y   G                 ++ M+++P      
Sbjct: 190 AALGIALAFISFGSLVAPPYGSVLYSLAGKPIPFLILSLICLFDGFMVFMVIQPK----- 244

Query: 132 QSVXXXXXXXXXXXXANQEFHT-----QSPSIWNLIFDWNIINICLAIIVVASI-LAGLE 185
                           N++ +T     Q   +W L  D   I IC   +++A+I LA LE
Sbjct: 245 --------------TNNKQVNTAGERIQGTPMWRLFMD-KYIAICSGALIMANISLAFLE 289

Query: 186 PILPIYLRKEF-DADASLIGLIFIAIAIPTFLSPAVG-YISFYIGQRRT------CGIGM 237
           P +  ++     D  A ++G+I+     P F    +G YI+  +  R          IG+
Sbjct: 290 PTITTWMTGAIPDTPAWMVGIIW----FPPFFPHVLGVYITVCLMHRYPQKEWLLAAIGL 345

Query: 238 ILMGIATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALW 297
            + G++  +I   +    ++LPL       +++ T  LP+LG+ V  +    YG +YA+ 
Sbjct: 346 AMEGLSCFVIPFTNSVLQLILPLSTLCFGIALIDTSLLPMLGYLVDTRHVSVYGSVYAIA 405

Query: 298 NMAYSIGMFVGPVIAGLLFELFEFRNTLIIFGAAVLAITPLI 339
           +++YS+    GP+IAG +     F    II     LA  P++
Sbjct: 406 DISYSLAYAFGPIIAGEIVATMGFLALNIIICVLNLAYAPVL 447



>gi|328782367|ref|XP_001120960.2| PREDICTED: vesicular acetylcholine transporter-like [Apis
           mellifera]
          Length = 688

 Score = 74.3 bits (181), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 75/318 (23%), Positives = 133/318 (41%), Gaps = 28/318 (8%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            IPMM G+  + + + +F    SY  L  AR  QG     + T  LAM+ADR+    +  
Sbjct: 223 DIPMMIGLCIMFLSTAVFACGRSYGVLFFARSLQGVGSAFADTSGLAMIADRYTEEAERS 282

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             YQ+ G                +++ ++++P      
Sbjct: 283 KALGIALAFISFGCLVAPPFGGALYQFAGKEVPFLILAFISLADGVMLLLVMKPVKEQVK 342

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASI-LAGLEPILPI 190
           Q                Q    Q+  IW L+ D   I +C   ++++++ LA LEP + +
Sbjct: 343 Q---------------RQGEMRQTIPIWRLLMD-PYIAVCAGALMMSNVALAFLEPTISL 386

Query: 191 YLRKEFDADASLIGLIFIAIAIPTFLSPAVGYI-------SFYIGQRRTCGIGMILMGIA 243
           ++      D   +G+I++    P F     G +        +   Q      G+ L G+ 
Sbjct: 387 WMEDNITRDNWKMGMIWL----PAFFPHVFGVMITVKMAKQYPQQQWLMAASGLALEGMC 442

Query: 244 TPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSI 303
             +I   S +  +++PL       +++ T  LP LG+ V  +    YG IYA+ +++YS+
Sbjct: 443 CFIIPFCSSYGALMIPLCGICFGIALIDTALLPTLGYLVDVRYVSVYGSIYAIADISYSV 502

Query: 304 GMFVGPVIAGLLFELFEF 321
              VGP+IAG + E   F
Sbjct: 503 AYAVGPIIAGGVVEAIGF 520



>gi|321464361|gb|EFX75369.1| hypothetical protein DAPPUDRAFT_214360 [Daphnia pulex]
          Length = 499

 Score = 74.3 bits (181), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 81/344 (23%), Positives = 144/344 (41%), Gaps = 26/344 (7%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            IPM  G + + + +I+F    +Y  L VAR  QG     S    + MLA  + +  + G
Sbjct: 156 SIPMFAGFVIMFVSTIIFAFGRNYTVLFVARALQGVGSSCSSVSGMGMLAASYPNDEERG 215

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             MG  L                 YQ+ G                L+  ++++P+     
Sbjct: 216 NAMGIALGGLALGVLIGPPFGGIMYQFVGKTAPFLILACLALGDGLLQLLVLQPA----- 270

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASILAGLEPILPIY 191
                          A QE   + PS+  L+ D  II    AI      +A LEP LPI+
Sbjct: 271 --------------IAQQE--DEPPSVKELLMDPYIIVAAGAITFGNMGIAMLEPSLPIW 314

Query: 192 LRKEFDADASLIGLIFIAIAIPTFLSPAV-GYISFYIGQRRTCGIGMILMGIATPLISLP 250
           +     A    +G+ F+  +I   +   + G +   +G+     +G++++G+   LI   
Sbjct: 315 MMDTMCAPKWQLGVAFLPASIAYLIGTNLFGPLGHKMGRWLAALVGLVVIGVCLMLIPFA 374

Query: 251 SKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGMFVGPV 310
           +    +VLP    G    +V +  +P LG+ V  +    YG +YA+ ++A+ +G  +GP 
Sbjct: 375 TNIGDLVLPNAGLGFAIGMVDSSMMPQLGYLVDIRHAAVYGSVYAIGDVAFCLGFAIGPA 434

Query: 311 IAGLLFELFEFRNTLIIFGAAVLAI--TPLIFAGRLRDHADRIQ 352
           ++G L +   F    ++FG A+++    PL++  R     +  Q
Sbjct: 435 LSGTLVQTIGFE--WMLFGIAIISFMYAPLLYYLRNPPTKEERQ 476



>gi|345482461|ref|XP_001608139.2| PREDICTED: synaptic vesicular amine transporter-like [Nasonia
           vitripennis]
          Length = 505

 Score = 74.3 bits (181), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 74/323 (22%), Positives = 132/323 (40%), Gaps = 24/323 (7%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
            IPM  G + + + +++F    SY  L +AR  QG     S    + MLA+R+    + G
Sbjct: 162 SIPMFTGFIIMFLSTLIFAFGRSYGILFLARALQGIGSSCSSVSGMGMLAERYQDDKERG 221

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             MG  L                 Y++ G                L+  ++++PS + T 
Sbjct: 222 NAMGIALGGLALGVLIGPPFGGLMYEFVGKSAPFLILSALALGDGLLQLLMLQPSVVYT- 280

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASILAGLEPILPIY 191
                                 + PS+ +L+ D  I+    AI      +A LEP LP++
Sbjct: 281 --------------------EAEPPSLKSLVTDPYILLAAGAISFGNMGIAMLEPSLPLW 320

Query: 192 LRKEFDADASLIGLIFIAIAIPTFLSPAV-GYISFYIGQRRTCGIGMILMGIATPLISLP 250
           +     A     G  F+  +I   +   + G +   +G+     IG++++G     I L 
Sbjct: 321 MMDTMSASRWKQGATFLPASISYLIGTNLFGPLGHRMGRWLAACIGLVVIGFCLMAIPLA 380

Query: 251 SKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGMFVGPV 310
                ++LP    G    +V +  +P LG+ V  +    YG +YA+ ++A+ +G  +GP 
Sbjct: 381 KSINHLILPNAGLGFAIGMVDSSMMPELGYLVDIRHSAVYGSVYAIGDVAFCLGFAIGPA 440

Query: 311 IAGLLFELFEFRNTLIIFGAAVL 333
           ++G L     F    ++FG A+L
Sbjct: 441 LSGTLVNTIGFE--WMLFGIAIL 461



>gi|402594337|gb|EJW88263.1| vesicular acetylcholine transporter unc-17 [Wuchereria bancrofti]
          Length = 512

 Score = 74.3 bits (181), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 80/342 (23%), Positives = 140/342 (40%), Gaps = 38/342 (11%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
           + PM+ G+  +   + +F +  SY  L  AR  QG     + T  LAM+ADRF    +  
Sbjct: 113 EFPMVIGLCVMFSSTAIFALGRSYGVLFFARSLQGFGSAFADTSGLAMIADRFTEENERS 172

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             +G  L+  +             Y   G                 ++ M+++P      
Sbjct: 173 AALGIALAFISFGSLVAPPYGSILYSLAGKPIPFLILSLICLFDGFMVFMVIQPKS---- 228

Query: 132 QSVXXXXXXXXXXXXANQEFHT-----QSPSIWNLIFDWNIINICLAIIVVASI-LAGLE 185
                           N++ +T     Q   +W L  D   I IC   +++A+I LA LE
Sbjct: 229 ---------------NNKQVNTAGERIQGTPMWRLFMD-KYIAICSGALIMANISLAFLE 272

Query: 186 PILPIYLRKEF-DADASLIGLIFIAIAIPTFLSPAVG-YISFYIGQRRT------CGIGM 237
           P +  ++     D  A ++G+I+     P F    +G Y++  +  R          IG+
Sbjct: 273 PTITTWMTSAIPDTPAWMVGIIWF----PPFFPHVLGVYVTVCLMHRYPQKEWLLAAIGL 328

Query: 238 ILMGIATPLISLPSKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALW 297
            + G +  +I   +    ++LPL       +++ T  LP+LG+ V  +    YG +YA+ 
Sbjct: 329 AMEGFSCFVIPFTNSVLQLILPLSTLCFGIALIDTSLLPMLGYLVDTRHVSVYGSVYAIA 388

Query: 298 NMAYSIGMFVGPVIAGLLFELFEFRNTLIIFGAAVLAITPLI 339
           +++YS+    GP+IAG +     F    II     LA  P++
Sbjct: 389 DISYSLAYAFGPIIAGEIVATMGFLALNIIICVLNLAYAPVL 430



>gi|327277558|ref|XP_003223531.1| PREDICTED: synaptic vesicular amine transporter-like [Anolis
           carolinensis]
          Length = 522

 Score = 73.9 bits (180), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 73/328 (22%), Positives = 133/328 (40%), Gaps = 21/328 (6%)

Query: 12  KIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLG 71
           +IP+  G   + + +I+F  + SY  L +AR  QG     S    + MLA  +    + G
Sbjct: 166 QIPLFAGFCIMFVSTIMFAFSESYKLLFIARSLQGVGSSCSSVAGMGMLASVYPDDEERG 225

Query: 72  VVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTY 131
             MG  L                 Y++ G                 +  +I++PS +   
Sbjct: 226 NAMGIALGGLAMGVLVGPPFGSVMYEFVGKAAPFLVLAALALLDGAIQLLILQPSRI--- 282

Query: 132 QSVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASILAGLEPILPIY 191
                            Q    +  S+  L+ D  I+    +I      +A LEP LPI+
Sbjct: 283 -----------------QPESQKGASLLTLMRDPYILIAAGSICFSNMAIAMLEPALPIW 325

Query: 192 LRKEFDADASLIGLIFIAIAIPTFLSPAV-GYISFYIGQRRTCGIGMILMGIATPLISLP 250
           + +   +    +G+ FI  +I   L   + G ++  IG+     IGMI++GI+   + L 
Sbjct: 326 MMETMCSKKWQLGVAFIPASISYLLGTNLFGVLAHKIGRWLCALIGMIVVGISILCVPLA 385

Query: 251 SKFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGMFVGPV 310
              + ++ P    G    +V +  +P++G+ V  +    YG +YA+ ++A+ +G  +GP 
Sbjct: 386 KNIYGLIAPNFGVGFAIGMVDSSMMPIMGYLVDLRHVSVYGSVYAIADVAFCMGFALGPS 445

Query: 311 IAGLLFELFEFRNTLIIFGAAVLAITPL 338
             G + +   F   + I G   +   PL
Sbjct: 446 AGGAIAKAIGFPWLMTIIGIIDILFAPL 473



>gi|189234210|ref|XP_970834.2| PREDICTED: similar to AGAP004476-PA [Tribolium castaneum]
          Length = 481

 Score = 73.9 bits (180), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 77/322 (23%), Positives = 137/322 (42%), Gaps = 24/322 (7%)

Query: 13  IPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLGV 72
           +PM  G + + + +I+F    SY  L +AR  QG     S    + MLA+R+    + G 
Sbjct: 157 VPMFAGFVIMFLSTIIFAFGRSYSVLFIARALQGVGSSCSSVSGMGMLAERYPDDKERGN 216

Query: 73  VMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTYQ 132
            MG  L                 Y++ G                L+  ++++PS      
Sbjct: 217 AMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLILSALALGDGLLQLLMLQPS------ 270

Query: 133 SVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASILAGLEPILPIYL 192
                           QE  +  PS+  LI D  I+    AI      +A LEP LPI++
Sbjct: 271 -------------VVRQE--SDPPSLKALISDPYIVIAAGAITFANMGIAMLEPSLPIWM 315

Query: 193 RKEFDADASLIGLIFIAIAIPTFLSPAV-GYISFYIGQRRTCGIGMILMGIATPLISLPS 251
                A+    G+ F+  +I   +   + G +   +G+     +G++++GI   LI L +
Sbjct: 316 MDTMGAERWKQGVTFLPASISYLIGTNLFGPLGHRMGRWLAALLGLVIIGICLMLIPLAT 375

Query: 252 KFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGMFVGPVI 311
               +++P    G    +V +  +P LG+ V  +    YG +YA+ ++A+ +G  +GP +
Sbjct: 376 SMNHLIVPNAGLGFAIGMVDSSMMPELGYLVDIRHTAVYGSVYAIGDVAFCLGFAIGPAL 435

Query: 312 AGLLFELFEFRNTLIIFGAAVL 333
           +G L +   F    ++FG A+L
Sbjct: 436 SGTLVKKIGFE--WMLFGIAIL 455



>gi|270002437|gb|EEZ98884.1| hypothetical protein TcasGA2_TC004499 [Tribolium castaneum]
          Length = 485

 Score = 73.9 bits (180), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 77/322 (23%), Positives = 137/322 (42%), Gaps = 24/322 (7%)

Query: 13  IPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRFGSGPKLGV 72
           +PM  G + + + +I+F    SY  L +AR  QG     S    + MLA+R+    + G 
Sbjct: 157 VPMFAGFVIMFLSTIIFAFGRSYSVLFIARALQGVGSSCSSVSGMGMLAERYPDDKERGN 216

Query: 73  VMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVEPSDLSTYQ 132
            MG  L                 Y++ G                L+  ++++PS      
Sbjct: 217 AMGIALGGLALGVLIGPPFGGVMYEFVGKSAPFLILSALALGDGLLQLLMLQPS------ 270

Query: 133 SVXXXXXXXXXXXXANQEFHTQSPSIWNLIFDWNIINICLAIIVVASILAGLEPILPIYL 192
                           QE  +  PS+  LI D  I+    AI      +A LEP LPI++
Sbjct: 271 -------------VVRQE--SDPPSLKALISDPYIVIAAGAITFANMGIAMLEPSLPIWM 315

Query: 193 RKEFDADASLIGLIFIAIAIPTFLSPAV-GYISFYIGQRRTCGIGMILMGIATPLISLPS 251
                A+    G+ F+  +I   +   + G +   +G+     +G++++GI   LI L +
Sbjct: 316 MDTMGAERWKQGVTFLPASISYLIGTNLFGPLGHRMGRWLAALLGLVIIGICLMLIPLAT 375

Query: 252 KFWLVVLPLLFFGATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGMFVGPVI 311
               +++P    G    +V +  +P LG+ V  +    YG +YA+ ++A+ +G  +GP +
Sbjct: 376 SMNHLIVPNAGLGFAIGMVDSSMMPELGYLVDIRHTAVYGSVYAIGDVAFCLGFAIGPAL 435

Query: 312 AGLLFELFEFRNTLIIFGAAVL 333
           +G L +   F    ++FG A+L
Sbjct: 436 SGTLVKKIGFE--WMLFGIAIL 455



>gi|452989694|gb|EME89449.1| hypothetical protein MYCFIDRAFT_25340 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 465

 Score = 73.6 bits (179), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 81/353 (22%), Positives = 137/353 (38%), Gaps = 42/353 (11%)

Query: 5   SDKYHTRKIPMMFGMLSLAICSILFGIANSYWQLVVARIAQGAAGGASWTLSLAMLADRF 64
           +D    R+IP + G+L L   +++  +A +    V  R+ QG A    WT  LA+L D  
Sbjct: 80  TDHSRNRQIPFIIGLLILLGATVMLWLAPTIHVQVAGRLLQGVASTVVWTTGLAVLVDTV 139

Query: 65  GSGPKLGVVMGTVLSANTXXXXXXXXXXXXXYQYWGYVXXXXXXXXXXXXXXLVISMIVE 124
           G   ++G   G +  A               ++  GY               +V  +I++
Sbjct: 140 GQ-EQVGEYAGYINIALNMGSLTAPLLGGIMFERRGY-NAVFALILGVIGLDIVFRLIMK 197

Query: 125 PSDLSTYQSVXXXXXXXXXXXXANQEFHTQS---------------------PSIWNLIF 163
               ST  +             A+    TQ                      P++  L+F
Sbjct: 198 ERSSSTASNHRPIDLENRRKGQASTVVDTQEIAEDTLSTASTIVSSSVNPKIPAMIRLLF 257

Query: 164 DWNIINICLAIIVVASILAGLEPILPIYLRKEFDADASLIGLIFIAIAIPTFLSPAVGYI 223
               I     I+V+A++ +G E +LP+++ K F  D+   GLIF+ +++P  L P++G I
Sbjct: 258 SVRFIVALWGILVLAAVFSGFETVLPLHVNKIFGWDSEGSGLIFLPLSLPALLGPSIGKI 317

Query: 224 SFYIGQRRTCGIGMILMGIATPLISLPSKFWL-------------------VVLPLLFFG 264
           +   G R       + +  +  L+ L     L                   ++ PL    
Sbjct: 318 TDKYGGRWFVAGAFVALCPSLVLMRLVKDNTLSQKALLVILLVVVGLCLTIILEPLFAET 377

Query: 265 ATYSIVTTPTLPLLGHYVTQKGGGAYGQIYALWNMAYSIGMFVGPVIAGLLFE 317
           A  S          G   T    G YGQ Y  +NMA+S+G  VGP+++GL+ +
Sbjct: 378 ALRSDQLRKQERDAGIARTGCSRGYYGQAYGYFNMAWSLGNTVGPLLSGLVID 430