BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10191_c0_seq1-m.80 complete 54-1259(+) 402 (+)
         (401 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|388581821|gb|EIM22128.1| chorismate synthase [Wallemia sebi C...   576   e-162   Wallemia mellicola CBS 633.66
gi|395326387|gb|EJF58797.1| chorismate synthase [Dichomitus squa...   574   e-161   Dichomitus squalens LYAD-421 SS1
gi|213407716|ref|XP_002174629.1| chorismate synthase [Schizosacc...   572   e-161   Schizosaccharomyces japonicus yFS275
gi|336365755|gb|EGN94104.1| hypothetical protein SERLA73DRAFT_18...   570   e-160   Serpula lacrymans var. lacrymans S7.3
gi|403414732|emb|CCM01432.1| predicted protein [Fibroporia radic...   568   e-159   Fibroporia radiculosa
gi|358057398|dbj|GAA96747.1| hypothetical protein E5Q_03418 [Mix...   566   e-159   Mixia osmundae IAM 14324
gi|505755773|gb|EOQ99966.1| Chorismate synthase [Wallemia ichthy...   566   e-159   Wallemia ichthyophaga EXF-994
gi|402218875|gb|EJT98950.1| chorismate synthase [Dacryopinax sp....   566   e-159   Dacryopinax primogenitus
gi|242208382|ref|XP_002470042.1| predicted protein [Postia place...   565   e-159   Postia placenta Mad-698-R
gi|472580914|gb|EMS18681.1| chorismate synthase [Rhodosporidium ...   565   e-159   Rhodotorula toruloides NP11
gi|511008076|gb|EPB89348.1| chorismate synthase [Mucor circinell...   562   e-158   Mucor circinelloides f. circinelloides 1006PhL
gi|449550419|gb|EMD41383.1| hypothetical protein CERSUDRAFT_1099...   562   e-158   Gelatoporia subvermispora B
gi|409050966|gb|EKM60442.1| hypothetical protein PHACADRAFT_2463...   561   e-157   Phanerochaete carnosa HHB-10118-sp
gi|321264868|ref|XP_003197151.1| chorismate synthase [Cryptococc...   561   e-157   Cryptococcus gattii WM276
gi|384500260|gb|EIE90751.1| chorismate synthase [Rhizopus delema...   560   e-157   Rhizopus delemar RA 99-880
gi|393247850|gb|EJD55357.1| chorismate synthase [Auricularia del...   560   e-157   Auricularia subglabra TFB-10046 SS5
gi|393218963|gb|EJD04451.1| chorismate synthase [Fomitiporia med...   559   e-157   Fomitiporia mediterranea MF3/22
gi|392572045|gb|EIW65217.1| chorismate synthase [Trametes versic...   558   e-157   Trametes versicolor FP-101664 SS1
gi|58270564|ref|XP_572438.1| chorismate synthase [Cryptococcus n...   558   e-157   Cryptococcus neoformans var. neoformans JEC21
gi|392596996|gb|EIW86318.1| chorismate synthase [Coniophora pute...   558   e-156   Coniophora puteana RWD-64-598 SS2
gi|426201626|gb|EKV51549.1| hypothetical protein AGABI2DRAFT_189...   558   e-156   Agaricus bisporus var. bisporus H97
gi|169844406|ref|XP_001828924.1| chorismate synthase [Coprinopsi...   557   e-156   Coprinopsis cinerea okayama7#130
gi|409083322|gb|EKM83679.1| hypothetical protein AGABI1DRAFT_814...   557   e-156   Agaricus bisporus var. burnettii JB137-S8
gi|405124291|gb|AFR99053.1| chorismate synthase [Cryptococcus ne...   556   e-156   Cryptococcus neoformans var. grubii H99
gi|63054453|ref|NP_588359.2| chorismate synthase (predicted) [Sc...   556   e-156   Schizosaccharomyces pombe 972h-
gi|170085343|ref|XP_001873895.1| predicted protein [Laccaria bic...   556   e-156   Laccaria bicolor S238N-H82
gi|465792761|emb|CCU98003.1| unnamed protein product [Malassezia...   555   e-156   Malassezia sympodialis ATCC 42132
gi|443921960|gb|ELU41481.1| chorismate synthase [Rhizoctonia sol...   555   e-156   Rhizoctonia solani AG-1 IA
gi|401881711|gb|EJT46001.1| chorismate synthase [Trichosporon as...   555   e-156   Trichosporon asahii var. asahii CBS 2479
gi|353237446|emb|CCA69419.1| probable ARO2-chorismate synthase [...   555   e-156   Serendipita indica DSM 11827
gi|471914516|emb|CCO26721.1| chorismate synthase [Rhizoctonia so...   555   e-156   Rhizoctonia solani AG-1 IB
gi|328768275|gb|EGF78322.1| hypothetical protein BATDEDRAFT_9081...   555   e-155   Batrachochytrium dendrobatidis JAM81
gi|164661555|ref|XP_001731900.1| hypothetical protein MGL_1168 [...   552   e-155   Malassezia globosa CBS 7966
gi|302673904|ref|XP_003026638.1| hypothetical protein SCHCODRAFT...   552   e-155   Schizophyllum commune H4-8
gi|190347159|gb|EDK39382.2| conserved hypothetical protein [Meye...   546   e-153   Meyerozyma guilliermondii ATCC 6260
gi|146416259|ref|XP_001484099.1| conserved hypothetical protein ...   545   e-152   Meyerozyma guilliermondii ATCC 6260
gi|260947470|ref|XP_002618032.1| conserved hypothetical protein ...   544   e-152   Clavispora lusitaniae ATCC 42720
gi|296423946|ref|XP_002841513.1| hypothetical protein [Tuber mel...   543   e-152   Tuber melanosporum Mel28
gi|448090895|ref|XP_004197185.1| Piso0_004425 [Millerozyma farin...   542   e-152   Millerozyma farinosa CBS 7064
gi|389742142|gb|EIM83329.1| chorismate synthase [Stereum hirsutu...   541   e-151   Stereum hirsutum FP-91666 SS1
gi|154315776|ref|XP_001557210.1| hypothetical protein BC1G_04460...   535   e-150   Botrytis cinerea B05.10
gi|340975947|gb|EGS23062.1| chorismate synthase-like protein [Ch...   535   e-150   Chaetomium thermophilum var. thermophilum DSM 1495
gi|254568902|ref|XP_002491561.1| Bifunctional chorismate synthas...   535   e-149   Komagataella phaffii GS115
gi|347842001|emb|CCD56573.1| similar to chorismate synthase [Bot...   534   e-149   Botrytis cinerea T4
gi|156059748|ref|XP_001595797.1| hypothetical protein SS1G_03887...   533   e-149   Sclerotinia sclerotiorum 1980 UF-70
gi|303316654|ref|XP_003068329.1| chorismate synthase, putative [...   533   e-149   Coccidioides posadasii C735 delta SOWgp
gi|119187965|ref|XP_001244589.1| hypothetical protein CIMG_04030...   533   e-149   Coccidioides immitis RS
gi|345563277|gb|EGX46280.1| hypothetical protein AOL_s00110g104 ...   532   e-149   Arthrobotrys oligospora ATCC 24927
gi|367035968|ref|XP_003667266.1| hypothetical protein MYCTH_2312...   531   e-148   Myceliophthora thermophila ATCC 42464
gi|500252487|gb|EON96323.1| putative chorismate synthase protein...   530   e-148   Phaeoacremonium minimum UCRPA7
gi|328857342|gb|EGG06459.1| hypothetical protein MELLADRAFT_4845...   530   e-148   Melampsora larici-populina 98AG31
gi|378729261|gb|EHY55720.1| chorismate synthase [Exophiala derma...   530   e-148   Exophiala dermatitidis NIH/UT8656
gi|327294489|ref|XP_003231940.1| chorismate synthase [Trichophyt...   530   e-148   Trichophyton rubrum CBS 118892
gi|240280144|gb|EER43648.1| chorismate synthase [Ajellomyces cap...   530   e-148   Histoplasma capsulatum H143
gi|225683638|gb|EEH21922.1| chorismate synthase [Paracoccidioide...   529   e-148   Paracoccidioides brasiliensis Pb03
gi|154278531|ref|XP_001540079.1| chorismate synthase [Ajellomyce...   529   e-148   Histoplasma capsulatum NAm1
gi|344303713|gb|EGW33962.1| hypothetical protein SPAPADRAFT_5937...   529   e-148   Spathaspora passalidarum NRRL Y-27907
gi|326469813|gb|EGD93822.1| chorismate synthase [Trichophyton to...   529   e-148   Trichophyton tonsurans CBS 112818
gi|390603848|gb|EIN13239.1| chorismate synthase [Punctularia str...   529   e-148   Punctularia strigosozonata HHB-11173 SS5
gi|501753810|emb|CCG82619.1| Chorismate synthase [Taphrina defor...   528   e-147   Taphrina deformans PYCC 5710
gi|315056511|ref|XP_003177630.1| chorismate synthase [Arthroderm...   528   e-147   Microsporum gypseum CBS 118893
gi|226292988|gb|EEH48408.1| chorismate synthase [Paracoccidioide...   528   e-147   Paracoccidioides brasiliensis Pb18
gi|389638094|ref|XP_003716680.1| chorismate synthase, variant [M...   528   e-147   Magnaporthe oryzae 70-15
gi|485922963|gb|EOD48268.1| putative chorismate synthase protein...   527   e-147   Neofusicoccum parvum UCRNP2
gi|452984697|gb|EME84454.1| hypothetical protein MYCFIDRAFT_2030...   527   e-147   Cercospora fijiensis CIRAD86
gi|116205243|ref|XP_001228432.1| hypothetical protein CHGG_10505...   527   e-147   Chaetomium globosum CBS 148.51
gi|327356702|gb|EGE85559.1| chorismate synthase [Ajellomyces der...   526   e-147   Blastomyces dermatitidis ATCC 18188
gi|261206328|ref|XP_002627901.1| chorismate synthase [Ajellomyce...   526   e-147   Blastomyces gilchristii SLH14081
gi|225560577|gb|EEH08858.1| chorismate synthase [Ajellomyces cap...   526   e-147   Histoplasma capsulatum G186AR
gi|448535748|ref|XP_003871008.1| Aro2 chorismate synthase [Candi...   525   e-146   Candida orthopsilosis Co 90-125
gi|440637547|gb|ELR07466.1| chorismate synthase [Geomyces destru...   525   e-146   Pseudogymnoascus destructans 20631-21
gi|350630819|gb|EHA19191.1| chorismate synthase activity [Asperg...   524   e-146   Aspergillus niger ATCC 1015
gi|320581923|gb|EFW96142.1| Bifunctional chorismate synthase and...   524   e-146   
gi|50421863|ref|XP_459489.1| DEHA2E03784p [Debaryomyces hansenii...   524   e-146   Debaryomyces hansenii CBS767
gi|425769900|gb|EKV08379.1| Chorismate synthase [Penicillium dig...   523   e-146   Penicillium digitatum Pd1
gi|169769693|ref|XP_001819316.1| bifunctional chorismate synthas...   523   e-146   Aspergillus oryzae RIB40
gi|363750908|ref|XP_003645671.1| hypothetical protein Ecym_3367 ...   522   e-146   Eremothecium cymbalariae DBVPG#7215
gi|354548437|emb|CCE45173.1| hypothetical protein CPAR2_701850 [...   522   e-146   Candida parapsilosis
gi|367055536|ref|XP_003658146.1| hypothetical protein THITE_2124...   521   e-145   Thielavia terrestris NRRL 8126
gi|407928748|gb|EKG21598.1| Chorismate synthase [Macrophomina ph...   520   e-145   Macrophomina phaseolina MS6
gi|50308709|ref|XP_454358.1| hypothetical protein [Kluyveromyces...   520   e-145   Kluyveromyces lactis NRRL Y-1140
gi|406606037|emb|CCH42674.1| Chorismate synthase [Wickerhamomyce...   520   e-145   Wickerhamomyces ciferrii
gi|391863482|gb|EIT72790.1| chorismate synthase [Aspergillus ory...   519   e-145   Aspergillus oryzae 3.042
gi|425771422|gb|EKV09865.1| Chorismate synthase [Penicillium dig...   519   e-145   Penicillium digitatum PHI26
gi|258576473|ref|XP_002542418.1| chorismate synthase [Uncinocarp...   518   e-145   Uncinocarpus reesii 1704
gi|255726854|ref|XP_002548353.1| chorismate synthase [Candida tr...   518   e-144   Candida tropicalis MYA-3404
gi|255716646|ref|XP_002554604.1| KLTH0F09218p [Lachancea thermot...   518   e-144   Lachancea thermotolerans CBS 6340
gi|410076640|ref|XP_003955902.1| hypothetical protein KAFR_0B047...   518   e-144   Kazachstania africana CBS 2517
gi|212547098|ref|XP_002153702.1| chorismate synthase, putative [...   518   e-144   Talaromyces marneffei ATCC 18224
gi|406863485|gb|EKD16532.1| chorismate synthase [Marssonina brun...   518   e-144   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|344232370|gb|EGV64249.1| chorismate synthase [Candida tenuis ...   517   e-144   Candida tenuis ATCC 10573
gi|392575988|gb|EIW69120.1| hypothetical protein TREMEDRAFT_3939...   517   e-144   Tremella mesenterica DSM 1558
gi|241959118|ref|XP_002422278.1| 5-enolpyruvylshikimate-3-phosph...   517   e-144   Candida dubliniensis CD36
gi|68492225|ref|XP_710110.1| hypothetical protein CaO19.1986 [Ca...   516   e-144   Candida albicans SC5314
gi|242807349|ref|XP_002484937.1| chorismate synthase, putative [...   516   e-144   Talaromyces stipitatus ATCC 10500
gi|459372659|gb|EMG50062.1| Chorismate synthase [Candida maltosa...   515   e-144   Candida maltosa Xu316
gi|512206005|gb|EPE34825.1| Chorismate synthase, AroC [Glarea lo...   515   e-144   Glarea lozoyensis ATCC 20868
gi|67539122|ref|XP_663335.1| hypothetical protein AN5731.2 [Aspe...   515   e-144   Aspergillus nidulans FGSC A4
gi|40889605|pdb|1R52|A Chain A, Crystal Structure Of The Bifunct...   515   e-144   Saccharomyces cerevisiae [brewer's yeast]
gi|6321290|ref|NP_011367.1| bifunctional chorismate synthase/rib...   515   e-143   Saccharomyces cerevisiae S288c
gi|68492031|ref|XP_710211.1| hypothetical protein CaO19.3489 [Ca...   515   e-143   Candida albicans SC5314
gi|358373457|dbj|GAA90055.1| chorismate synthase [Aspergillus ka...   514   e-143   Aspergillus kawachii IFO 4308
gi|296826856|ref|XP_002851041.1| chorismate synthase [Arthroderm...   514   e-143   Arthroderma otae CBS 113480
gi|151943663|gb|EDN61973.1| chorismate synthase [Saccharomyces c...   514   e-143   Saccharomyces cerevisiae YJM789
gi|149238536|ref|XP_001525144.1| chorismate synthase [Lodderomyc...   514   e-143   Lodderomyces elongisporus NRRL YB-4239
gi|255938850|ref|XP_002560195.1| Pc14g02010 [Penicillium chrysog...   514   e-143   Penicillium rubens Wisconsin 54-1255
gi|385305904|gb|EIF49847.1| chorismate synthase [Dekkera bruxell...   514   e-143   Brettanomyces bruxellensis AWRI1499
gi|402081369|gb|EJT76514.1| chorismate synthase [Gaeumannomyces ...   513   e-143   Gaeumannomyces graminis var. tritici R3-111a-1
gi|238487986|ref|XP_002375231.1| chorismate synthase [Aspergillu...   513   e-143   Aspergillus flavus NRRL3357
gi|50550975|ref|XP_502961.1| YALI0D17930p [Yarrowia lipolytica] ...   513   e-143   Yarrowia lipolytica CLIB122
gi|70991188|ref|XP_750443.1| chorismate synthase [Aspergillus fu...   513   e-143   Aspergillus fumigatus Af293
gi|302307221|ref|NP_983809.2| ADL287Cp [Ashbya gossypii ATCC 108...   513   e-143   Eremothecium gossypii ATCC 10895
gi|238880178|gb|EEQ43816.1| chorismate synthase [Candida albican...   513   e-143   Candida albicans WO-1
gi|212528352|ref|XP_002144333.1| chorismate synthase [Talaromyce...   513   e-143   Talaromyces marneffei ATCC 18224
gi|119496395|ref|XP_001264971.1| chorismate synthase [Neosartory...   512   e-143   Aspergillus fischeri NRRL 181
gi|444316780|ref|XP_004179047.1| hypothetical protein TBLA_0B071...   512   e-143   Tetrapisispora blattae CBS 6284
gi|50286953|ref|XP_445906.1| hypothetical protein [Candida glabr...   511   e-142   Candida glabrata CBS 138
gi|85074621|ref|XP_963243.1| chorismate synthase [Neurospora cra...   511   e-142   Neurospora crassa OR74A
gi|254576999|ref|XP_002494486.1| ZYRO0A02640p [Zygosaccharomyces...   509   e-142   Zygosaccharomyces rouxii CBS 732
gi|336263890|ref|XP_003346724.1| hypothetical protein SMAC_04156...   509   e-142   Sordaria macrospora k-hell
gi|513032990|gb|AGO12962.1| AaceriADL287Cp [Saccharomycetaceae s...   509   e-142   Saccharomycetaceae sp. 'Ashbya aceri'
gi|336468645|gb|EGO56808.1| NADPH-dependent chorismate synthase/...   509   e-142   Neurospora tetrasperma FGSC 2508
gi|512191899|gb|EPE07659.1| chorismate synthase [Ophiostoma pice...   509   e-142   Ophiostoma piceae UAMH 11346
gi|401625834|gb|EJS43824.1| aro2p [Saccharomyces arboricola H-6]      509   e-142   Saccharomyces arboricola H-6
gi|121702401|ref|XP_001269465.1| chorismate synthase [Aspergillu...   509   e-142   Aspergillus clavatus NRRL 1
gi|449301609|gb|EMC97620.1| hypothetical protein BAUCODRAFT_6828...   508   e-141   Baudoinia panamericana UAMH 10762
gi|126139149|ref|XP_001386097.1| Chorismate synthase [Schefferso...   507   e-141   Scheffersomyces stipitis CBS 6054
gi|365760791|gb|EHN02483.1| Aro2p [Saccharomyces cerevisiae x Sa...   506   e-141   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gi|367016655|ref|XP_003682826.1| hypothetical protein TDEL_0G024...   506   e-141   Torulaspora delbrueckii
gi|380485714|emb|CCF39182.1| chorismate synthase [Colletotrichum...   506   e-141   Colletotrichum higginsianum
gi|366992516|ref|XP_003676023.1| hypothetical protein NCAS_0D007...   503   e-140   Naumovozyma castellii CBS 4309
gi|482808959|gb|EOA85820.1| hypothetical protein SETTUDRAFT_1695...   503   e-140   Setosphaeria turcica Et28A
gi|403217363|emb|CCK71857.1| hypothetical protein KNAG_0I00660 [...   502   e-140   Kazachstania naganishii CBS 8797
gi|396461421|ref|XP_003835322.1| similar to chorismate synthase ...   502   e-140   Leptosphaeria maculans JN3
gi|470318503|gb|EMR10156.1| chorismate synthase [Pneumocystis mu...   501   e-139   Pneumocystis murina B123
gi|242766687|ref|XP_002341220.1| chorismate synthase [Talaromyce...   501   e-139   Talaromyces stipitatus ATCC 10500
gi|189196740|ref|XP_001934708.1| chorismate synthase [Pyrenophor...   501   e-139   Pyrenophora tritici-repentis Pt-1C-BFP
gi|471571621|gb|EMR70350.1| putative chorismate synthase protein...   501   e-139   Eutypa lata UCREL1
gi|451846844|gb|EMD60153.1| hypothetical protein COCSADRAFT_4058...   500   e-139   Bipolaris sorokiniana ND90Pr
gi|452005356|gb|EMD97812.1| hypothetical protein COCHEDRAFT_1165...   499   e-139   Bipolaris maydis C5
gi|976375|gb|AAC49056.1| chorismate synthase [Neurospora crassa]...   499   e-139   Neurospora crassa
gi|302914373|ref|XP_003051122.1| hypothetical protein NECHADRAFT...   499   e-139   Nectria haematococca mpVI 77-13-4
gi|453080391|gb|EMF08442.1| chorismate synthase [Mycosphaerella ...   498   e-138   Sphaerulina musiva SO2202
gi|331228895|ref|XP_003327114.1| chorismate synthase [Puccinia g...   498   e-138   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|408393101|gb|EKJ72369.1| hypothetical protein FPSE_07454 [Fus...   496   e-138   Fusarium pseudograminearum CS3096
gi|330906487|ref|XP_003295495.1| hypothetical protein PTT_01275 ...   496   e-138   Pyrenophora teres f. teres 0-1
gi|365989846|ref|XP_003671753.1| hypothetical protein NDAI_0H033...   496   e-138   Naumovozyma dairenensis CBS 421
gi|46109522|ref|XP_381819.1| hypothetical protein FG01643.1 [Fus...   495   e-138   
gi|258678618|emb|CAX46413.1| chorismate synthase [Verticillium l...   495   e-138   Verticillium longisporum
gi|322695965|gb|EFY87764.1| chorismate synthase [Metarhizium acr...   494   e-137   Metarhizium acridum CQMa 102
gi|342886328|gb|EGU86195.1| hypothetical protein FOXB_03274 [Fus...   493   e-137   Fusarium oxysporum Fo5176
gi|322709313|gb|EFZ00889.1| chorismate synthase [Metarhizium ani...   493   e-137   Metarhizium robertsii ARSEF 23
gi|475666917|gb|EMT64707.1| Chorismate synthase [Fusarium oxyspo...   493   e-137   Fusarium oxysporum f. sp. cubense race 4
gi|358387239|gb|EHK24834.1| hypothetical protein TRIVIDRAFT_2156...   493   e-137   Trichoderma virens Gv29-8
gi|340514700|gb|EGR44960.1| chorismate synthase [Trichoderma ree...   493   e-137   Trichoderma reesei QM6a
gi|156845616|ref|XP_001645698.1| hypothetical protein Kpol_1043p...   492   e-137   Vanderwaltozyma polyspora DSM 70294
gi|367000413|ref|XP_003684942.1| hypothetical protein TPHA_0C035...   491   e-136   Tetrapisispora phaffii CBS 4417
gi|477529024|gb|ENH80795.1| chorismate synthase [Colletotrichum ...   490   e-136   Colletotrichum orbiculare MAFF 240422
gi|470308142|ref|XP_004363761.1| chorismate synthase [Capsaspora...   489   e-136   Capsaspora owczarzaki ATCC 30864
gi|310792885|gb|EFQ28346.1| chorismate synthase [Glomerella gram...   488   e-135   Colletotrichum graminicola M1.001
gi|398389038|ref|XP_003847980.1| bifunctional chorismate synthas...   488   e-135   Zymoseptoria tritici IPO323
gi|399166611|emb|CCE32594.1| probable chorismate synthase/flavin...   486   e-135   Claviceps purpurea 20.1
gi|346326732|gb|EGX96328.1| chorismate synthase [Cordyceps milit...   485   e-134   Cordyceps militaris CM01
gi|452836660|gb|EME38604.1| hypothetical protein DOTSEDRAFT_7594...   484   e-134   Dothistroma septosporum NZE10
gi|400592553|gb|EJP60714.1| chorismate synthase [Beauveria bassi...   483   e-134   Beauveria bassiana ARSEF 2860
gi|470489457|ref|XP_004344886.1| chorismate synthase [Acanthamoe...   480   e-133   Acanthamoeba castellanii str. Neff
gi|302665968|ref|XP_003024589.1| hypothetical protein TRV_01244 ...   476   e-132   Trichophyton verrucosum HKI 0517
gi|320589232|gb|EFX01694.1| chorismate synthase [Grosmannia clav...   476   e-132   Grosmannia clavigera kw1407
gi|302503532|ref|XP_003013726.1| hypothetical protein ARB_00177 ...   476   e-132   Arthroderma benhamiae CBS 112371
gi|320352849|ref|YP_004194188.1| chorismate synthase [Desulfobul...   475   e-132   
gi|494825543|gb|EON62697.1| chorismate synthase [Coniosporium ap...   473   e-131   Coniosporium apollinis CBS 100218
gi|295659604|ref|XP_002790360.1| chorismate synthase [Paracoccid...   471   e-130   
gi|358393948|gb|EHK43349.1| hypothetical protein TRIATDRAFT_3012...   466   e-129   Trichoderma atroviride IMI 206040
gi|197117215|ref|YP_002137642.1| chorismate synthase [Geobacter ...   465   e-129   
gi|490176975|ref|WP_004075605.1| chorismate synthase [Desulfobac...   464   e-128   Desulfobacter postgatei
gi|428178292|gb|EKX47168.1| hypothetical protein GUITHDRAFT_1595...   464   e-128   Guillardia theta CCMP2712
gi|224371407|ref|YP_002605571.1| chorismate synthase [Desulfobac...   462   e-128   
gi|161485623|ref|YP_066794.2| chorismate synthase [Desulfotalea ...   461   e-127   
gi|50877947|emb|CAG37787.1| probable chorismate synthase [Desulf...   461   e-127   Desulfotalea psychrophila LSv54
gi|322418253|ref|YP_004197476.1| chorismate synthase [Geobacter ...   460   e-127   
gi|169603826|ref|XP_001795334.1| hypothetical protein SNOG_04921...   459   e-127   Parastagonospora nodorum SN15
gi|253702030|ref|YP_003023219.1| chorismate synthase [Geobacter ...   454   e-125   
gi|171689694|ref|XP_001909787.1| hypothetical protein [Podospora...   454   e-125   Podospora anserina S mat+
gi|492848994|ref|WP_006002948.1| chorismate synthase [Desulfurom...   451   e-124   Desulfuromonas acetoxidans
gi|167524727|ref|XP_001746699.1| hypothetical protein [Monosiga ...   448   e-123   Monosiga brevicollis MX1
gi|365765794|gb|EHN07300.1| Aro2p [Saccharomyces cerevisiae x Sa...   441   e-121   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gi|449464390|ref|XP_004149912.1| PREDICTED: chorismate synthase,...   427   e-117   Cucumis sativus [cucumbers]
gi|497314860|ref|WP_009629077.1| chorismate synthase [Pseudanaba...   426   e-117   Pseudanabaena biceps
gi|255577383|ref|XP_002529571.1| Chorismate synthase, chloroplas...   426   e-117   
gi|76782200|gb|ABA54870.1| putative chorismate synthase [Fagus s...   423   e-116   Fagus sylvatica
gi|350534912|ref|NP_001234422.1| chorismate synthase 1, chloropl...   422   e-116   Solanum lycopersicum
gi|224109756|ref|XP_002315301.1| chorismate synthase [Populus tr...   420   e-115   
gi|148906363|gb|ABR16336.1| unknown [Picea sitchensis]                419   e-115   Picea sitchensis
gi|350534710|ref|NP_001234411.1| chorismate synthase 2, chloropl...   418   e-114   Solanum lycopersicum
gi|218192459|gb|EEC74886.1| hypothetical protein OsI_10797 [Oryz...   417   e-114   Oryza sativa Indica Group [Indian rice]
gi|123965491|ref|YP_001010572.1| chorismate synthase [Prochloroc...   417   e-114   
gi|115451975|ref|NP_001049588.1| Os03g0254800 [Oryza sativa Japo...   417   e-114   
gi|242036289|ref|XP_002465539.1| hypothetical protein SORBIDRAFT...   417   e-114   Sorghum bicolor [broomcorn]
gi|194697622|gb|ACF82895.1| unknown [Zea mays] >gi|414865879|tpg...   416   e-114   Zea mays [maize]
gi|302782684|ref|XP_002973115.1| hypothetical protein SELMODRAFT...   416   e-114   Selaginella moellendorffii
gi|492911878|ref|WP_006042284.1| chorismate synthase [Synechococ...   416   e-114   Synechococcus sp. WH 7805
gi|168009830|ref|XP_001757608.1| predicted protein [Physcomitrel...   416   e-114   Physcomitrella patens
gi|224100795|ref|XP_002312018.1| chorismate synthase [Populus tr...   416   e-114   
gi|488897315|ref|WP_002808417.1| chorismate synthase [Prochloroc...   416   e-114   Prochlorococcus marinus
gi|182413441|ref|YP_001818507.1| chorismate synthase [Opitutus t...   415   e-113   
gi|126695584|ref|YP_001090470.1| chorismate synthase [Prochloroc...   414   e-113   
gi|302789944|ref|XP_002976740.1| hypothetical protein SELMODRAFT...   414   e-113   Selaginella moellendorffii
gi|157412583|ref|YP_001483449.1| chorismate synthase [Prochloroc...   413   e-113   
gi|123967782|ref|YP_001008640.1| chorismate synthase [Prochloroc...   412   e-113   
gi|508726731|gb|EOY18628.1| Chorismate synthase / 5-enolpyruvyls...   412   e-113   Theobroma cacao [chocolate]
gi|502118474|ref|XP_004496285.1| PREDICTED: chorismate synthase,...   412   e-113   Cicer arietinum [garbanzo]
gi|148238694|ref|YP_001224081.1| chorismate synthase [Synechococ...   411   e-112   
gi|497643721|ref|WP_009957905.1| chorismate synthase [Verrucomic...   410   e-112   Verrucomicrobium spinosum
gi|297852508|ref|XP_002894135.1| EMB1144 [Arabidopsis lyrata sub...   410   e-112   Arabidopsis lyrata subsp. lyrata
gi|33860783|ref|NP_892344.1| chorismate synthase [Prochlorococcu...   410   e-112   
gi|18402389|ref|NP_564534.1| putative chorismate synthase / 5-en...   410   e-112   Arabidopsis thaliana [mouse-ear cress]
gi|482576271|gb|EOA40458.1| hypothetical protein CARUB_v10009182...   410   e-112   Capsella rubella
gi|356576217|ref|XP_003556230.1| PREDICTED: chorismate synthase,...   408   e-111   Glycine max [soybeans]
gi|462414471|gb|EMJ19208.1| hypothetical protein PRUPE_ppa005795...   407   e-111   Prunus persica
gi|78778612|ref|YP_396724.1| chorismate synthase [Prochlorococcu...   407   e-111   
gi|225449068|ref|XP_002275232.1| PREDICTED: chorismate synthase,...   407   e-111   Vitis vinifera
gi|384250496|gb|EIE23975.1| chorismate synthase [Coccomyxa subel...   406   e-111   Coccomyxa subellipsoidea C-169
gi|427725873|ref|YP_007073150.1| chorismate synthase [Leptolyngb...   406   e-111   
gi|114182|sp|P27793.1|AROC_CORSE RecName: Full=Chorismate syntha...   405   e-111   Capnoides sempervirens [rock harlequin]
gi|493168392|ref|WP_006172327.1| chorismate synthase [Synechococ...   405   e-110   Synechococcus sp. WH 5701
gi|470143460|ref|XP_004307393.1| PREDICTED: chorismate synthase,...   405   e-110   Fragaria vesca subsp. vesca
gi|357113065|ref|XP_003558325.1| PREDICTED: chorismate synthase ...   405   e-110   Brachypodium distachyon [annual false brome]
gi|147770320|emb|CAN73646.1| hypothetical protein VITISV_025571 ...   405   e-110   Vitis vinifera
gi|428773479|ref|YP_007165267.1| chorismate synthase [Cyanobacte...   404   e-110   
gi|222136859|gb|ACM45079.1| chorismate synthase [Vitis vinifera]      404   e-110   Vitis vinifera
gi|12321114|gb|AAG50662.1|AC084242_6 chorismate synthase, putati...   403   e-110   Arabidopsis thaliana [mouse-ear cress]
gi|81299023|ref|YP_399231.1| chorismate synthase [Synechococcus ...   403   e-110   
gi|495372769|ref|WP_008097481.1| chorismate synthase [Verrucomic...   403   e-110   Verrucomicrobiae bacterium DG1235
gi|493555256|ref|WP_006508791.1| chorismate synthase [Xenococcus...   403   e-110   Xenococcus sp. PCC 7305
gi|194268461|gb|ACF36173.1| chorismate synthase [Hordeum vulgare...   403   e-110   Hordeum vulgare subsp. vulgare [barley]
gi|194477008|ref|YP_002049187.1| chorismate synthase [Paulinella...   402   e-109   Paulinella chromatophora
gi|170078745|ref|YP_001735383.1| chorismate synthase [Synechococ...   402   e-109   
gi|326508210|dbj|BAJ99372.1| predicted protein [Hordeum vulgare ...   401   e-109   Hordeum vulgare subsp. vulgare [barley]
gi|256822856|ref|YP_003146819.1| chorismate synthase [Kangiella ...   401   e-109   
gi|449015891|dbj|BAM79293.1| chorismate synthase [Cyanidioschyzo...   400   e-109   Cyanidioschyzon merolae strain 10D
gi|56751309|ref|YP_172010.1| chorismate synthase [Synechococcus ...   400   e-109   
gi|223993785|ref|XP_002286576.1| predicted protein [Thalassiosir...   400   e-109   Thalassiosira pseudonana CCMP1335
gi|294054282|ref|YP_003547940.1| chorismate synthase [Coraliomar...   400   e-109   
gi|302846180|ref|XP_002954627.1| hypothetical protein VOLCADRAFT...   400   e-109   Volvox carteri f. nagariensis
gi|434398668|ref|YP_007132672.1| chorismate synthase [Stanieria ...   400   e-109   
gi|434398292|ref|YP_007132296.1| chorismate synthase [Stanieria ...   400   e-109   
gi|384247559|gb|EIE21045.1| chorismate synthase [Coccomyxa subel...   400   e-109   Coccomyxa subellipsoidea C-169
gi|218439315|ref|YP_002377644.1| chorismate synthase [Cyanothece...   399   e-109   
gi|16330007|ref|NP_440735.1| chorismate synthase [Synechocystis ...   399   e-109   
gi|145528205|ref|XP_001449902.1| hypothetical protein [Parameciu...   399   e-108   Paramecium tetraurelia strain d4-2
gi|494160964|ref|WP_007100700.1| chorismate synthase [Synechococ...   398   e-108   Synechococcus sp. RS9917
gi|86605056|ref|YP_473819.1| chorismate synthase [Synechococcus ...   397   e-108   
gi|428305485|ref|YP_007142310.1| chorismate synthase [Crinalium ...   396   e-108   
gi|284929524|ref|YP_003422046.1| chorismate synthase [cyanobacte...   395   e-108   
gi|508726732|gb|EOY18629.1| Chorismate synthase / 5-enolpyruvyls...   395   e-108   Theobroma cacao [chocolate]
gi|427707536|ref|YP_007049913.1| chorismate synthase [Nostoc sp....   395   e-107   
gi|22298006|ref|NP_681253.1| chorismate synthase [Thermosynechoc...   395   e-107   Thermosynechococcus elongatus BP-1
gi|218246473|ref|YP_002371844.1| chorismate synthase [Cyanothece...   395   e-107   
gi|452823511|gb|EME30521.1| chorismate synthase [Galdieria sulph...   395   e-107   Galdieria sulphuraria
gi|493574366|ref|WP_006527533.1| chorismate synthase [Gloeocapsa...   395   e-107   Gloeocapsa sp. PCC 73106
gi|33239705|ref|NP_874647.1| chorismate synthase [Prochlorococcu...   395   e-107   Prochlorococcus marinus subsp. marinus str. CCMP1375
gi|159475000|ref|XP_001695611.1| chorismate synthase [Chlamydomo...   394   e-107   Chlamydomonas reinhardtii
gi|434406137|ref|YP_007149022.1| chorismate synthase [Cylindrosp...   394   e-107   
gi|145342038|ref|XP_001416103.1| predicted protein [Ostreococcus...   394   e-107   Ostreococcus lucimarinus CCE9901
gi|493561642|ref|WP_006515052.1| chorismate synthase [Leptolyngb...   394   e-107   Leptolyngbya sp. PCC 7375
gi|475598886|gb|EMT24068.1| Chorismate synthase 1, chloroplastic...   394   e-107   Aegilops tauschii
gi|493503030|ref|WP_006457509.1| chorismate synthase [Synechococ...   394   e-107   Synechococcus sp. PCC 7335
gi|86608978|ref|YP_477740.1| chorismate synthase [Synechococcus ...   393   e-107   
gi|488829624|ref|WP_002742030.1| chorismate synthase [Microcysti...   393   e-107   Microcystis aeruginosa
gi|226531167|ref|NP_001140907.1| uncharacterized protein LOC1002...   393   e-107   Zea mays [maize]
gi|427730750|ref|YP_007076987.1| chorismate synthase [Nostoc sp....   393   e-107   
gi|220906785|ref|YP_002482096.1| chorismate synthase [Cyanothece...   393   e-107   
gi|186683716|ref|YP_001866912.1| chorismate synthase [Nostoc pun...   393   e-107   
gi|428207574|ref|YP_007091927.1| chorismate synthase [Chroococci...   392   e-107   
gi|488876367|ref|WP_002788592.1| chorismate synthase [Microcysti...   392   e-106   Microcystis aeruginosa
gi|488853111|ref|WP_002765517.1| chorismate synthase [Microcysti...   392   e-106   Microcystis aeruginosa
gi|488861239|ref|WP_002773478.1| chorismate synthase [Microcysti...   391   e-106   Microcystis aeruginosa
gi|17228292|ref|NP_484840.1| chorismate synthase [Nostoc sp. PCC...   391   e-106   
gi|428203254|ref|YP_007081843.1| chorismate synthase [Pleurocaps...   391   e-106   
gi|434384771|ref|YP_007095382.1| chorismate synthase [Chamaesiph...   390   e-106   
gi|494160071|ref|WP_007099807.1| chorismate synthase [Synechococ...   390   e-106   
gi|307154887|ref|YP_003890271.1| chorismate synthase [Cyanothece...   390   e-106   
gi|428219283|ref|YP_007103748.1| chorismate synthase [Pseudanaba...   390   e-106   
gi|488887562|ref|WP_002799787.1| chorismate synthase [Microcysti...   389   e-106   
gi|488872242|ref|WP_002784467.1| chorismate synthase (5-enolpyru...   389   e-106   
gi|494595744|ref|WP_007354003.1| chorismate synthase [Oscillator...   389   e-106   
gi|434391155|ref|YP_007126102.1| chorismate synthase [Gloeocapsa...   389   e-106   
gi|412988952|emb|CCO15543.1| chorismate synthase [Bathycoccus pr...   389   e-106   
gi|494656859|ref|WP_007414803.1| chorismate synthase [Pedosphaer...   389   e-106   
gi|488842604|ref|WP_002755010.1| chorismate synthase [Microcysti...   389   e-106   
gi|308800848|ref|XP_003075205.1| chorismate synthase (ISS) [Ostr...   389   e-106   
gi|351726190|ref|NP_001237118.1| chorismate synthase [Glycine ma...   389   e-105   
gi|493029899|ref|WP_006099301.1| chorismate synthase [Coleofasci...   389   e-105   
gi|307103220|gb|EFN51482.1| hypothetical protein CHLNCDRAFT_3742...   389   e-105   
gi|497073064|ref|WP_009458824.1| chorismate synthase [Fischerell...   389   e-105   
gi|428775684|ref|YP_007167471.1| chorismate synthase [Halothece ...   388   e-105   
gi|159902788|ref|YP_001550132.1| chorismate synthase [Prochloroc...   388   e-105   
gi|471230983|ref|XP_004036701.1| hypothetical protein IMG5_07310...   388   e-105   
gi|166364651|ref|YP_001656924.1| chorismate synthase [Microcysti...   388   e-105   
gi|428308740|ref|YP_007119717.1| chorismate synthase [Microcoleu...   388   e-105   
gi|189218201|ref|YP_001938843.1| chorismate synthase [Methylacid...   387   e-105   
gi|488844420|ref|WP_002756826.1| chorismate synthase [Microcysti...   387   e-105   
gi|495459278|ref|WP_008183970.1| chorismate synthase [Moorea pro...   387   e-105   
gi|498000415|ref|WP_010314571.1| chorismate synthase [Synechococ...   387   e-105   
gi|488886102|ref|WP_002798327.1| chorismate synthase [Microcysti...   387   e-105   
gi|508726733|gb|EOY18630.1| Chorismate synthase / 5-enolpyruvyls...   387   e-105   
gi|497468463|ref|WP_009782661.1| chorismate synthase [Lyngbya sp...   387   e-105   
gi|428221079|ref|YP_007105249.1| chorismate synthase [Synechococ...   387   e-105   
gi|493683551|ref|WP_006633694.1| chorismate synthase [Microcoleu...   387   e-105   
gi|494603367|ref|WP_007361617.1| chorismate synthase [Opitutacea...   386   e-105   
gi|495550014|ref|WP_008274593.1| chorismate synthase [Cyanothece...   386   e-105   
gi|428770859|ref|YP_007162649.1| chorismate synthase [Cyanobacte...   386   e-105   
gi|323451360|gb|EGB07237.1| hypothetical protein AURANDRAFT_2803...   386   e-105   
gi|494517509|ref|WP_007306966.1| chorismate synthase [Crocosphae...   386   e-105   
gi|495585157|ref|WP_008309736.1| chorismate synthase [Leptolyngb...   385   e-104   
gi|497195818|ref|WP_009510080.1| chorismate synthase [Opitutacea...   385   e-104   
gi|494522584|ref|WP_007312037.1| chorismate synthase [Crocosphae...   385   e-104   
gi|78211856|ref|YP_380635.1| chorismate synthase [Synechococcus ...   385   e-104   
gi|427712049|ref|YP_007060673.1| chorismate synthase [Synechococ...   385   e-104   
gi|497241754|ref|WP_009555989.1| chorismate synthase [Oscillator...   385   e-104   
gi|428296832|ref|YP_007135138.1| chorismate synthase [Calothrix ...   385   e-104   
gi|118572528|sp|Q3AMV2.2|AROC_SYNSC RecName: Full=Chorismate syn...   385   e-104   
gi|440684526|ref|YP_007159321.1| chorismate synthase [Anabaena c...   385   e-104   
gi|406893497|gb|EKD38547.1| hypothetical protein ACD_75C00698G00...   385   e-104   
gi|428317238|ref|YP_007115120.1| chorismate synthase [Oscillator...   384   e-104   
gi|172039113|ref|YP_001805614.1| chorismate synthase [Cyanothece...   384   e-104   
gi|33864062|ref|NP_895622.1| chorismate synthase [Prochlorococcu...   384   e-104   
gi|427734826|ref|YP_007054370.1| chorismate synthase [Rivularia ...   384   e-104   
gi|427720256|ref|YP_007068250.1| chorismate synthase [Calothrix ...   384   e-104   
gi|397607915|gb|EJK59849.1| hypothetical protein THAOC_19884 [Th...   383   e-104   
gi|493210570|ref|WP_006195936.1| chorismate synthase [Nodularia ...   383   e-104   
gi|299472015|emb|CBN80098.1| Chorismate Synthase [Ectocarpus sil...   383   e-104   
gi|291335261|gb|ADD94880.1| chorismate synthase [uncultured mari...   382   e-103   
gi|303276390|ref|XP_003057489.1| predicted protein [Micromonas p...   381   e-103   
gi|226500284|ref|NP_001148583.1| chorismate synthase 2 [Zea mays...   381   e-103   
gi|428215778|ref|YP_007088922.1| chorismate synthase [Oscillator...   381   e-103   
gi|493966179|ref|WP_006909525.1| chorismate synthase [Cyanobium ...   381   e-103   
gi|262197294|ref|YP_003268503.1| chorismate synthase [Haliangium...   381   e-103   
gi|497997778|ref|WP_010311934.1| chorismate synthase [Synechococ...   381   e-103   
gi|390955440|ref|YP_006419198.1| chorismate synthase [Aequorivit...   380   e-103   
gi|497318049|ref|WP_009632262.1| chorismate synthase [Synechocys...   380   e-103   
gi|148243289|ref|YP_001228446.1| chorismate synthase [Synechococ...   380   e-103   
gi|255076747|ref|XP_002502043.1| predicted protein [Micromonas s...   380   e-103   
gi|427703135|ref|YP_007046357.1| chorismate synthase [Cyanobium ...   380   e-103   
gi|219112363|ref|XP_002177933.1| chorismate synthase [Phaeodacty...   380   e-103   
gi|490631322|ref|WP_004496322.1| chorismate synthase [Leptospira...   380   e-103   
gi|463350812|gb|EMK14136.1| chorismate synthase [Leptospira sp. ...   380   e-103   
gi|488811958|ref|WP_002724364.1| chorismate synthase [Leptospira...   379   e-103   
gi|502118476|ref|XP_004496286.1| PREDICTED: chorismate synthase,...   379   e-103   
gi|488696281|ref|WP_002620343.1| chorismate synthase [Leptospira...   379   e-103   
gi|428778446|ref|YP_007170232.1| chorismate synthase [Dactylococ...   379   e-103   
gi|490637572|ref|WP_004502572.1| chorismate synthase [Leptospira...   379   e-103   
gi|78185607|ref|YP_378041.1| chorismate synthase [Synechococcus ...   379   e-103   
gi|488844854|ref|WP_002757260.1| chorismate synthase [Leptospira...   379   e-102   
gi|116329476|ref|YP_799196.1| chorismate synthase [Leptospira bo...   379   e-102   
gi|262340962|ref|YP_003283817.1| chorismate synthase [Blattabact...   379   e-102   
gi|374290251|ref|YP_005037304.1| chorismate synthase [Blattabact...   379   e-102   
gi|493905256|ref|WP_006850940.1| chorismate synthase [Synechococ...   379   e-102   
gi|313205506|ref|YP_004044163.1| chorismate synthase [Paludibact...   378   e-102   
gi|113476451|ref|YP_722512.1| chorismate synthase [Trichodesmium...   378   e-102   
gi|498349882|ref|WP_010664038.1| chorismate synthase [Marinilabi...   378   e-102   
gi|261415880|ref|YP_003249563.1| chorismate synthase [Fibrobacte...   377   e-102   
gi|494036800|ref|WP_006978926.1| chorismate synthase [Chthonioba...   377   e-102   
gi|297746247|emb|CBI16303.3| unnamed protein product [Vitis vini...   377   e-102   
gi|513850221|ref|WP_016516427.1| Chorismate synthase [Microcysti...   377   e-102   
gi|490643804|ref|WP_004508799.1| chorismate synthase [Leptospira...   377   e-102   
gi|225435297|ref|XP_002282299.1| PREDICTED: chorismate synthase ...   376   e-102   
gi|113954606|ref|YP_729590.1| chorismate synthase [Synechococcus...   376   e-102   
gi|493908019|ref|WP_006853629.1| chorismate synthase [Synechococ...   376   e-102   
gi|497474649|ref|WP_009788847.1| chorismate synthase [Synechococ...   376   e-102   
gi|490588917|ref|WP_004453937.1| chorismate synthase [Leptospira...   376   e-102   
gi|498263401|ref|WP_010577557.1| chorismate synthase [Leptospira...   375   e-101   
gi|488824210|ref|WP_002736616.1| chorismate synthase [Microcysti...   375   e-101   
gi|392402438|ref|YP_006439050.1| chorismate synthase [Turneriell...   375   e-101   
gi|490601948|ref|WP_004466968.1| chorismate synthase [Leptospira...   375   e-101   
gi|298490201|ref|YP_003720378.1| chorismate synthase ['Nostoc az...   375   e-101   
gi|495507257|ref|WP_008231904.1| Chorismate synthase [Richelia i...   375   e-101   
gi|428224513|ref|YP_007108610.1| chorismate synthase [Geitlerine...   374   e-101   
gi|488879744|ref|WP_002791969.1| chorismate synthase [Microcysti...   374   e-101   
gi|490585239|ref|WP_004450259.1| chorismate synthase [Leptospira...   374   e-101   
gi|493318308|ref|WP_006275663.1| chorismate synthase [Cylindrosp...   374   e-101   
gi|390942826|ref|YP_006406587.1| chorismate synthase [Belliella ...   374   e-101   
gi|490902314|ref|WP_004764236.1| chorismate synthase [Leptospira...   373   e-101   
gi|490594253|ref|WP_004459273.1| chorismate synthase [Leptospira...   373   e-101   
gi|33864844|ref|NP_896403.1| chorismate synthase [Synechococcus ...   373   e-101   
gi|495479924|ref|WP_008204611.1| chorismate synthase [Microcysti...   373   e-101   
gi|488108053|ref|WP_002179450.1| chorismate synthase [Leptospira...   373   e-101   
gi|488078291|ref|WP_002149688.1| chorismate synthase [Leptospira...   373   e-101   
gi|490590664|ref|WP_004455684.1| chorismate synthase [Leptospira...   372   e-101   
gi|490561724|ref|WP_004426774.1| chorismate synthase [Leptospira...   372   e-101   
gi|490604802|ref|WP_004469822.1| chorismate synthase [Leptospira...   372   e-101   
gi|496700247|ref|WP_009341790.1| chorismate synthase [Raphidiops...   372   e-101   
gi|463325943|gb|EMJ91447.1| chorismate synthase [Leptospira kirs...   372   e-100   
gi|490891963|ref|WP_004753916.1| chorismate synthase [Leptospira...   372   e-100   
gi|490919159|ref|WP_004781034.1| chorismate synthase [Leptospira...   372   e-100   
gi|488850636|ref|WP_002763042.1| chorismate synthase [Leptospira...   372   e-100   
gi|493674254|ref|WP_006624570.1| chorismate synthase [Arthrospir...   371   e-100   
gi|498154224|ref|WP_010468380.1| chorismate synthase [Acaryochlo...   371   e-100   
gi|150008692|ref|YP_001303435.1| chorismate synthase [Parabacter...   371   e-100   
gi|124025017|ref|YP_001014133.1| chorismate synthase [Prochloroc...   371   e-100   
gi|357421104|ref|YP_004928553.1| chorismate synthase [Blattabact...   371   e-100   
gi|493720893|ref|WP_006670368.1| chorismate synthase [Arthrospir...   371   e-100   
gi|495890405|ref|WP_008614984.1| chorismate synthase [Joostella ...   371   e-100   
gi|158334320|ref|YP_001515492.1| chorismate synthase [Acaryochlo...   371   e-100   
gi|492495993|ref|WP_005864373.1| chorismate synthase [Bacteroide...   370   e-100   
gi|496055546|ref|WP_008780053.1| chorismate synthase [Bacteroide...   370   e-100   
gi|495326407|ref|WP_008051149.1| chorismate synthase [Arthrospir...   370   e-100   
gi|446387083|ref|WP_000464938.1| Chorismate synthase [Leptospira...   370   e-100   
gi|24212857|ref|NP_710338.1| chorismate synthase [Leptospira int...   370   e-100   
gi|498297719|ref|WP_010611875.1| chorismate synthase [Marinilabi...   370   e-100   
gi|489094525|ref|WP_003004409.1| chorismate synthase [Leptospira...   370   e-100   
gi|110636792|ref|YP_676999.1| chorismate synthase [Cytophaga hut...   370   e-100   
gi|447062591|ref|WP_001139847.1| Chorismate synthase [Leptospira...   370   e-100   
gi|479130022|ref|YP_005069982.1| chorismate synthase [Arthrospir...   369   e-100   
gi|490570856|ref|WP_004435876.1| chorismate synthase [Leptospira...   369   e-100   
gi|447063977|ref|WP_001141233.1| Chorismate synthase [Leptospira...   369   e-100   
gi|496676493|ref|WP_009318983.1| chorismate synthase [Tannerella...   369   e-100   
gi|414075859|ref|YP_006995177.1| chorismate synthase [Anabaena s...   369   e-100   
gi|495425161|ref|WP_008149858.1| chorismate synthase [Parabacter...   369   e-100   
gi|490554792|ref|WP_004419883.1| chorismate synthase [Leptospira...   369   1e-99   
gi|497326855|ref|WP_009641068.1| chorismate synthase [Capnocytop...   369   1e-99   
gi|72383429|ref|YP_292784.1| chorismate synthase [Prochlorococcu...   369   1e-99   
gi|494928473|ref|WP_007654507.1| chorismate synthase [Parabacter...   368   1e-99   
gi|512455604|ref|WP_016419646.1| chorismate synthase [Capnocytop...   368   1e-99   
gi|447063979|ref|WP_001141235.1| Chorismate synthase [Leptospira...   368   1e-99   
gi|488745073|ref|WP_002668412.1| chorismate synthase [Capnocytop...   368   1e-99   
gi|493668049|ref|WP_006618391.1| chorismate synthase [Arthrospir...   368   2e-99   
gi|325279550|ref|YP_004252092.1| chorismate synthase [Odoribacte...   368   2e-99   
gi|496427119|ref|WP_009135966.1| chorismate synthase [Odoribacte...   368   2e-99   
gi|496279970|ref|WP_008992008.1| chorismate synthase [Galbibacte...   368   2e-99   
gi|491854238|ref|WP_005634853.1| chorismate synthase [Parabacter...   368   2e-99   
gi|498214134|ref|WP_010528290.1| chorismate synthase, partial [A...   368   2e-99   
gi|495432220|ref|WP_008156915.1| chorismate synthase [Parabacter...   368   2e-99   
gi|498104449|ref|WP_010418605.1| chorismate synthase [Anaerophag...   367   3e-99   
gi|149354526|gb|EDM43091.1| chorismate synthase [unidentified eu...   367   3e-99   
gi|463333146|gb|EMJ98003.1| chorismate synthase [Leptospira alst...   367   4e-99   
gi|490490329|ref|WP_004356558.1| chorismate synthase [Prevotella...   367   5e-99   
gi|471332080|ref|YP_007539547.1| chorismate synthase [Blattabact...   366   5e-99   
gi|447063980|ref|WP_001141236.1| Chorismate synthase [Leptospira...   366   8e-99   
gi|497465413|ref|WP_009779611.1| chorismate synthase [Leeuwenhoe...   366   8e-99   
gi|491883828|ref|WP_005651325.1| chorismate synthase [Parabacter...   365   9e-99   
gi|491874667|ref|WP_005645813.1| chorismate synthase [Parabacter...   365   1e-98   
gi|495546934|ref|WP_008271513.1| chorismate synthase [Flavobacte...   365   1e-98   
gi|494045442|ref|WP_006987560.1| chorismate synthase [Gillisia l...   365   2e-98   
gi|494924665|ref|WP_007650700.1| Chorismate synthase [Formosa sp...   364   3e-98   
gi|392399276|ref|YP_006435877.1| chorismate synthase [Flexibacte...   363   5e-98   
gi|343084689|ref|YP_004773984.1| chorismate synthase [Cyclobacte...   363   5e-98   
gi|444335471|ref|YP_007391840.1| chorismate synthase [Blattabact...   363   6e-98   
gi|497431419|ref|WP_009745617.1| chorismate synthase [Capnocytop...   363   7e-98   
gi|344204471|ref|YP_004789614.1| chorismate synthase [Muricauda ...   363   7e-98   
gi|514358069|ref|WP_016549775.1| chorismate synthase [Leptospira...   362   8e-98   
gi|431796889|ref|YP_007223793.1| chorismate synthase [Echinicola...   362   9e-98   
gi|260062834|ref|YP_003195914.1| chorismate synthase [Robiginita...   362   1e-97   
gi|490502067|ref|WP_004368167.1| chorismate synthase [Prevotella...   362   1e-97   
gi|496923679|ref|WP_009410419.1| chorismate synthase [Capnocytop...   362   1e-97   
gi|261749521|ref|YP_003257207.1| chorismate synthase [Blattabact...   362   2e-97   
gi|490435675|ref|WP_004306728.1| chorismate synthase [Bacteroide...   361   2e-97   
gi|496945053|ref|WP_009415935.1| chorismate synthase [Capnocytop...   361   2e-97   
gi|347535816|ref|YP_004843241.1| chorismate synthase [Flavobacte...   361   2e-97   
gi|496958566|ref|WP_009420023.1| chorismate synthase [Capnocytop...   361   2e-97   
gi|496961776|ref|WP_009421324.1| chorismate synthase [Capnocytop...   361   2e-97   
gi|496951518|ref|WP_009417848.1| chorismate synthase [Capnocytop...   361   2e-97   
gi|238597213|ref|XP_002394265.1| hypothetical protein MPER_05874...   360   3e-97   
gi|498202528|ref|WP_010516684.1| chorismate synthase [Mesoflavib...   360   3e-97   
gi|340621900|ref|YP_004740352.1| 5-enolpyruvylshikimate-3-phosph...   360   3e-97   
gi|495516227|ref|WP_008240872.1| chorismate synthase [Imtechella...   360   3e-97   
gi|117578131|emb|CAL66600.1| chorismate synthase [Gramella forse...   360   4e-97   
gi|488749258|ref|WP_002672564.1| chorismate synthase [Capnocytop...   360   4e-97   
gi|312131699|ref|YP_003999039.1| chorismate synthase [Leadbetter...   360   5e-97   
gi|162319794|ref|YP_861667.2| chorismate synthase [Gramella fors...   360   5e-97   
gi|496036520|ref|WP_008761027.1| chorismate synthase [Bacteroide...   359   7e-97   
gi|29347494|ref|NP_810997.1| chorismate synthase [Bacteroides th...   359   7e-97   
gi|256820975|ref|YP_003142254.1| chorismate synthase [Capnocytop...   359   7e-97   
gi|512707883|ref|WP_016479396.1| chorismate synthase [Capnocytop...   359   7e-97   
gi|490441437|ref|WP_004312409.1| chorismate synthase [Bacteroide...   359   8e-97   
gi|332290716|ref|YP_004429325.1| chorismate synthase [Krokinobac...   359   8e-97   
gi|293977853|ref|YP_003543283.1| chorismate synthase [Candidatus...   358   1e-96   
gi|297172280|gb|ADI23258.1| chorismate synthase [uncultured nuHF...   358   1e-96   
gi|491932223|ref|WP_005678848.1| chorismate synthase [Bacteroide...   358   2e-96   
gi|336173696|ref|YP_004580834.1| chorismate synthase [Lacinutrix...   358   2e-96   
gi|495473544|ref|WP_008198232.1| chorismate synthase [Algoriphag...   358   2e-96   
gi|491940183|ref|WP_005682733.1| chorismate synthase [Bacteroide...   358   2e-96   
gi|497265855|ref|WP_009580072.1| Chorismate synthase [Fulvivirga...   358   2e-96   
gi|161833743|ref|YP_001597939.1| chorismate synthase [Candidatus...   358   2e-96   
gi|493795437|ref|WP_006743474.1| chorismate synthase [Bacteroide...   358   2e-96   
gi|496454310|ref|WP_009163155.1| chorismate synthase [Prevotella...   357   2e-96   
gi|496585674|ref|WP_009285498.1| chorismate synthase [Fibrisoma ...   357   3e-96   
gi|387133084|ref|YP_006299056.1| chorismate synthase [Prevotella...   357   3e-96   
gi|496529579|ref|WP_009236270.1| chorismate synthase [Prevotella...   357   3e-96   
gi|408674938|ref|YP_006874686.1| chorismate synthase [Emticicia ...   357   4e-96   
gi|495903250|ref|WP_008627829.1| Chorismate synthase [Mariniradi...   357   4e-96   
gi|375011051|ref|YP_004988039.1| chorismate synthase [Owenweeksi...   357   5e-96   
gi|150024858|ref|YP_001295684.1| Chorismate synthase [Flavobacte...   357   5e-96   
gi|496873028|ref|WP_009392943.1| chorismate synthase [Capnocytop...   356   5e-96   
gi|498225156|ref|WP_010539312.1| chorismate synthase [Bacteroide...   356   6e-96   
gi|497436861|ref|WP_009751059.1| chorismate synthase [Capnocytop...   356   6e-96   
gi|496349016|ref|WP_009058194.1| chorismate synthase [Methylacid...   356   7e-96   
gi|496475394|ref|WP_009184155.1| chorismate synthase [Cecembia l...   356   7e-96   
gi|490427307|ref|WP_004299467.1| chorismate synthase [Bacteroide...   356   7e-96   
gi|490450984|ref|WP_004321863.1| chorismate synthase [Bacteroide...   356   8e-96   


>gi|388581821|gb|EIM22128.1| chorismate synthase [Wallemia sebi CBS 633.66]
          Length = 414

 Score =  576 bits (1484), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 279/404 (69%), Positives = 322/404 (79%), Gaps = 3/404 (0%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFGTLFRVTT+GESH KSVGCIVDG PPGL L + DIQ QL RRRPGQSNLTTPR+E 
Sbjct: 1   MSTFGTLFRVTTYGESHCKSVGCIVDGVPPGLPLEDVDIQAQLSRRRPGQSNLTTPRNEA 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V +QSG E  +TLGTPIGLLV N+DQRPHDYSETDLYPRPSHADWTYL KY IKASSG
Sbjct: 61  DAVQLQSGIEHNVTLGTPIGLLVQNKDQRPHDYSETDLYPRPSHADWTYLGKYGIKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGR+SARETIGRVAAGAIAEKYLKL HGVEI+AFVSSV    +P+I    +    ++F +
Sbjct: 121 GGRSSARETIGRVAAGAIAEKYLKLSHGVEIIAFVSSVGKEHIPYIPTDTDEPISKEFRD 180

Query: 181 LLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCF 240
           +++T+ REE+DKD  RCP K  +++M ERI +AKEA DS+GGT+TCVIRN P+GLGEP F
Sbjct: 181 IMSTVTREEIDKDTTRCPHKETAERMTERIIKAKEANDSIGGTVTCVIRNCPIGLGEPVF 240

Query: 241 DKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKN---DRLGTKTNNSGGT 297
           DKLEAK  HAMLSIPATK FEIGSGF+GT + G  HNDP+V      + LGT TN SGG 
Sbjct: 241 DKLEAKLGHAMLSIPATKSFEIGSGFRGTEVPGSAHNDPFVKSTKGLNGLGTTTNWSGGV 300

Query: 298 QGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMA 357
           QGGI+NGE+IYF++ FK PATISQ Q+TA YNG  GVL ARGRHDPCVVPRAVPIVE+MA
Sbjct: 301 QGGISNGEDIYFKIGFKSPATISQAQQTAKYNGDAGVLEARGRHDPCVVPRAVPIVEAMA 360

Query: 358 ALVIMDALMIQQSRKTVASLLPPNPNIPAAMSGVIPKLSETQKQ 401
           ++VIMD L+IQ SR   ASLLPP   +P  M      +SE +K+
Sbjct: 361 SIVIMDQLLIQNSRTAAASLLPPITTLPPTMVLSQSAMSEIKKE 404



>gi|395326387|gb|EJF58797.1| chorismate synthase [Dichomitus squalens LYAD-421 SS1]
          Length = 419

 Score =  574 bits (1479), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 287/420 (68%), Positives = 331/420 (78%), Gaps = 20/420 (4%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTP---- 56
           MSTFG+LFRVTT+GESH  SVG I+DGCPPGL L E D+Q+QL RRRPGQSNLTTP    
Sbjct: 1   MSTFGSLFRVTTYGESHCASVGAIIDGCPPGLPLTEQDVQVQLSRRRPGQSNLTTPNGTT 60

Query: 57  -RDEKDKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSI 115
            RDEKD V +QSG E G+TLGTPIGLLV N+DQRP DYSETDLYPRPSHADWTYL+KY +
Sbjct: 61  QRDEKDLVHLQSGIEHGVTLGTPIGLLVRNEDQRPKDYSETDLYPRPSHADWTYLEKYGV 120

Query: 116 KASSGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPF-------INE 168
           KASSGGGR+SARETIGRVAAGAIAEKYLKL +G+EIVAFVSSV  + +P        +  
Sbjct: 121 KASSGGGRSSARETIGRVAAGAIAEKYLKLAYGIEIVAFVSSVGKVQLPSAISPPSQVPA 180

Query: 169 QDE-----RLFPEDFWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGT 223
           +DE      L PE F ELLNT+ RE+VD    RCP    S++M +RI  AKEA DS+GGT
Sbjct: 181 EDEDTVEDALSPE-FVELLNTVTREQVDAQMTRCPHAETSERMVKRILRAKEANDSIGGT 239

Query: 224 ITCVIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLK 283
           +TCVIRNVP G+GEP FDKLEAK AHAMLSIPATK FEIGSGF+GT + G +HND +V +
Sbjct: 240 VTCVIRNVPSGIGEPVFDKLEAKLAHAMLSIPATKAFEIGSGFRGTQVPGSKHNDAFVQR 299

Query: 284 ND-RLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHD 342
            D R+GT+TN SGG QGGI+NGE++YFR+ FK PATISQEQETA Y+G  G LAARGRHD
Sbjct: 300 PDGRMGTRTNWSGGVQGGISNGEDVYFRIGFKSPATISQEQETAQYDGTPGTLAARGRHD 359

Query: 343 PCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAM-SGVIPKLSETQKQ 401
           PCVVPRAVPIVE+MAALVIMD ++IQ +RKT ++LLPP   +P  M   V P  SE QKQ
Sbjct: 360 PCVVPRAVPIVEAMAALVIMDQVLIQNARKTASALLPPITTLPPTMVKNVKPAASEEQKQ 419



>gi|213407716|ref|XP_002174629.1| chorismate synthase [Schizosaccharomyces japonicus yFS275]
 gi|212002676|gb|EEB08336.1| chorismate synthase [Schizosaccharomyces japonicus yFS275]
          Length = 388

 Score =  572 bits (1473), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 276/385 (71%), Positives = 316/385 (82%), Gaps = 6/385 (1%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FGTLFRV+T+GESH KSVGCIV+GCPPGL L EAD+Q+QL RRRPGQSNLTTPR+EK
Sbjct: 1   MSSFGTLFRVSTYGESHCKSVGCIVEGCPPGLQLTEADVQVQLSRRRPGQSNLTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           DKV IQSGTE G+TLGTPIG+LV N DQRPHDYS+ D +PRPSHAD+TYL+KY +KASSG
Sbjct: 61  DKVQIQSGTEFGVTLGTPIGMLVQNLDQRPHDYSDMDNFPRPSHADYTYLEKYGVKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFIN-----EQDERLFP 175
           GGR+SARETIGRVAAGAIAEKYL   +GVEIVAFVSSV NI+MP  +     E  E    
Sbjct: 121 GGRSSARETIGRVAAGAIAEKYLLEAYGVEIVAFVSSVGNISMPLKHACADVEDPESPIT 180

Query: 176 EDFWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGL 235
            +  E L  + RE+VD   VRCPD +VS KM +RI  A++  DS+GGT+TCVIRNVP+GL
Sbjct: 181 AEVLEFLQNVTREQVDATTVRCPDPSVSQKMADRIARARDNHDSIGGTVTCVIRNVPIGL 240

Query: 236 GEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLK-NDRLGTKTNNS 294
           GEPCFDKLEAK AHAMLSIPATK FEIGSG +G  + G +HND +  K N +LGTKTNNS
Sbjct: 241 GEPCFDKLEAKLAHAMLSIPATKSFEIGSGVEGCKVPGSKHNDSFYRKPNGKLGTKTNNS 300

Query: 295 GGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVE 354
           GG QGGI+NGENIYF V FK PATI +EQ T+ Y+G DGVLAA+GRHDPCVVPRA+PIVE
Sbjct: 301 GGVQGGISNGENIYFTVGFKSPATIGKEQPTSRYDGTDGVLAAKGRHDPCVVPRAIPIVE 360

Query: 355 SMAALVIMDALMIQQSRKTVASLLP 379
           +MAALVIMDA MIQQSR T  SLLP
Sbjct: 361 AMAALVIMDATMIQQSRATARSLLP 385



>gi|336365755|gb|EGN94104.1| hypothetical protein SERLA73DRAFT_188688 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336378356|gb|EGO19514.1| hypothetical protein SERLADRAFT_479040 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 409

 Score =  570 bits (1470), Expect = e-160,   Method: Compositional matrix adjust.
 Identities = 281/403 (69%), Positives = 322/403 (79%), Gaps = 16/403 (3%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MST+G+LFRVTT+GESH  SVG I+DGCPPGL L   DIQ+QL RRRPGQSNLTTPRDEK
Sbjct: 1   MSTYGSLFRVTTYGESHCASVGAIIDGCPPGLVLSPQDIQVQLSRRRPGQSNLTTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V +QSG E G+TLGTPIGLLV N+DQRP DY+ETDLYPRPSHAD+TYL+KY +KASSG
Sbjct: 61  DLVHVQSGIEHGVTLGTPIGLLVKNEDQRPKDYTETDLYPRPSHADYTYLEKYGVKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFI-----------NEQ 169
           GGR+SARETIGRVAAGAIAEKYLKLV+G+EIVAFVSSV  I +P             NE 
Sbjct: 121 GGRSSARETIGRVAAGAIAEKYLKLVYGIEIVAFVSSVGKIHLPAAVAPPSLIPTEGNED 180

Query: 170 DER----LFPEDFWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTIT 225
           D+     L PE F +LL TI REEVDK   RCP    +++M +RI  AK+A DS+GGT+T
Sbjct: 181 DDEAQDALSPE-FRQLLATITREEVDKHPTRCPHPDTAERMTKRIIRAKDAMDSIGGTVT 239

Query: 226 CVIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND 285
           CVIRNVP GLGEP FDK EAK AHAMLSIPATK FE+GSGF+GT + G +HND +V K+ 
Sbjct: 240 CVIRNVPSGLGEPVFDKFEAKLAHAMLSIPATKAFEVGSGFRGTEVPGSKHNDAFVEKDG 299

Query: 286 RLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCV 345
           +LGTKTN SGG QGGITNGE+IYFR+ FK PATISQ QETA Y+G  G LAARGRHDPCV
Sbjct: 300 KLGTKTNWSGGIQGGITNGEDIYFRIGFKSPATISQSQETAQYDGTPGALAARGRHDPCV 359

Query: 346 VPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAM 388
           VPRAVPIVE+MAA+V+MD L+IQ SR+T ASLLPP   +P  M
Sbjct: 360 VPRAVPIVETMAAIVVMDQLLIQNSRRTAASLLPPITTLPPTM 402



>gi|403414732|emb|CCM01432.1| predicted protein [Fibroporia radiculosa]
          Length = 412

 Score =  568 bits (1463), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 277/401 (69%), Positives = 320/401 (79%), Gaps = 14/401 (3%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFGTLFRVTT+GESH  SVG I+DGCPPGL L+  D+Q QL RRRPGQSNLTTPRDEK
Sbjct: 1   MSTFGTLFRVTTYGESHCASVGAIIDGCPPGLPLIAQDVQTQLSRRRPGQSNLTTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V +QSG E GITLGTPIGLLV N+DQRPHDYSETDLYPRPSHADWTYL+KY +KASSG
Sbjct: 61  DTVQLQSGIEHGITLGTPIGLLVRNEDQRPHDYSETDLYPRPSHADWTYLEKYGVKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMP------------FINE 168
           GGR+SARETIGRVAAGAIAEKYLKLV G+EIVAFVSSV  + +P              + 
Sbjct: 121 GGRSSARETIGRVAAGAIAEKYLKLVFGIEIVAFVSSVGKVHLPTNMGSPSQVPDDDDDS 180

Query: 169 QDERLFPEDFWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVI 228
            ++ + PE F  LL T+ RE+VD    RCP+  ++++M +R+  AK+A DS+GGT+TCVI
Sbjct: 181 VEDSISPE-FVSLLRTVTREQVDSHPTRCPNPEIAERMTKRVIRAKDAMDSIGGTVTCVI 239

Query: 229 RNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND-RL 287
           R VP GLGEP FDKLEAK AHAMLSIPATK FEIGSGF+GT + G +HNDP+ +K D  +
Sbjct: 240 RGVPSGLGEPVFDKLEAKLAHAMLSIPATKAFEIGSGFRGTEVPGSKHNDPFFVKADGTM 299

Query: 288 GTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVP 347
           GTKTN SGG QGGITNGE+IYFR+ FK PATISQ QET  Y+G  G LAARGRHDPCVVP
Sbjct: 300 GTKTNWSGGVQGGITNGEDIYFRIGFKSPATISQAQETVQYDGTPGTLAARGRHDPCVVP 359

Query: 348 RAVPIVESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAM 388
           RAVPIVE+MA+LVIMD ++IQ +RKT ASLLPP   +P  M
Sbjct: 360 RAVPIVEAMASLVIMDQMLIQNARKTSASLLPPISTLPPTM 400



>gi|358057398|dbj|GAA96747.1| hypothetical protein E5Q_03418 [Mixia osmundae IAM 14324]
          Length = 432

 Score =  567 bits (1460), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 274/410 (66%), Positives = 320/410 (78%), Gaps = 21/410 (5%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFGTL+RVTT+GESH  SVGCI+DGCPPGL LVE DIQ QL RRRPGQS LTTPRDE 
Sbjct: 1   MSTFGTLYRVTTYGESHCASVGCIIDGCPPGLQLVEQDIQTQLSRRRPGQSALTTPRDEA 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D VAIQSGTE G+TLGTPIGL V N+DQRPHDY+ETDLYPRPSHADWTYL KY IKASSG
Sbjct: 61  DSVAIQSGTEHGVTLGTPIGLRVQNKDQRPHDYTETDLYPRPSHADWTYLLKYGIKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFI-------------- 166
           GGR+SARETIGRVAAGAIAEKYL+   GVEIVAFVSSV  + +P++              
Sbjct: 121 GGRSSARETIGRVAAGAIAEKYLREACGVEIVAFVSSVGKVHIPYLASTSHAASGQTVDL 180

Query: 167 ----NEQD--ERLFPEDFWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSV 220
                E+D  + L  +++ ++L+ + RE+VD++ +RCP    + +M ERI  AK A DS+
Sbjct: 181 IGGGEEEDDADELLTKEYMDMLSKVTREQVDQNNIRCPHPEAAKRMEERIMRAKAANDSI 240

Query: 221 GGTITCVIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPW 280
           GGT+TCVIRN PVGLGEPCFDKLEAK  HAMLSIPATK FEIGSGF+G T+ G +HND +
Sbjct: 241 GGTVTCVIRNSPVGLGEPCFDKLEAKLGHAMLSIPATKAFEIGSGFRGATVAGSKHNDAF 300

Query: 281 VLKND-RLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARG 339
           V + D  LGT TN SGG QGGI+NGENIYFR +FK PATISQEQ+TA Y+G  G LA RG
Sbjct: 301 VRRPDGTLGTLTNKSGGVQGGISNGENIYFRCSFKSPATISQEQKTARYDGEAGSLATRG 360

Query: 340 RHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAMS 389
           RHDPCVVPRA+ IVE+MAALVIMDA +IQ+SR+    +LPP   +PA M+
Sbjct: 361 RHDPCVVPRAIAIVEAMAALVIMDAFLIQKSREAARLMLPPITTLPATMA 410



>gi|505755773|gb|EOQ99966.1| Chorismate synthase [Wallemia ichthyophaga EXF-994]
          Length = 414

 Score =  566 bits (1459), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 274/391 (70%), Positives = 312/391 (79%), Gaps = 3/391 (0%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG+L++VTT+GESH KSVGCI+DG PPGL L + DIQ QL RRRPGQSNLTTPR+E 
Sbjct: 1   MSTFGSLYKVTTYGESHCKSVGCIIDGIPPGLPLEDVDIQAQLSRRRPGQSNLTTPRNEA 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V +QSG E G+TLGTPIGLLV N+DQRPHDY+ETDLYPRPSHADWTYL KY IKASSG
Sbjct: 61  DAVQLQSGIEHGVTLGTPIGLLVQNKDQRPHDYTETDLYPRPSHADWTYLGKYGIKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGR+SARETIGRVAAGA+AEKYLKL H VEIVAFVSSV    +PFI    +    ++F  
Sbjct: 121 GGRSSARETIGRVAAGAVAEKYLKLAHNVEIVAFVSSVGKEHIPFIPTDSDEPISKEFRH 180

Query: 181 LLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCF 240
           +L    RE+VDKD  RCP    + +M ERI +AKEA DS+GGT+TCVIRN PVGLGEP F
Sbjct: 181 ILENTTREDVDKDTTRCPHPETAKRMTERIIKAKEANDSIGGTVTCVIRNCPVGLGEPVF 240

Query: 241 DKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKN---DRLGTKTNNSGGT 297
           DKLEAK  HAMLSIPATK FEIGSGF+GT + G  HNDP+V  N   + LGT TN SGG 
Sbjct: 241 DKLEAKLGHAMLSIPATKSFEIGSGFRGTEVPGSAHNDPFVKSNKGLNGLGTATNWSGGV 300

Query: 298 QGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMA 357
           QGGI+NGE+IYF++ FK PATISQ Q+TA YNG  GVL ARGRHDPCVVPRAVPIVE+MA
Sbjct: 301 QGGISNGEDIYFKMGFKSPATISQAQQTAKYNGEAGVLEARGRHDPCVVPRAVPIVEAMA 360

Query: 358 ALVIMDALMIQQSRKTVASLLPPNPNIPAAM 388
           ++VIMD L+IQ SRK  ASLLPP   +P  M
Sbjct: 361 SIVIMDQLLIQNSRKATASLLPPISTLPPTM 391



>gi|402218875|gb|EJT98950.1| chorismate synthase [Dacryopinax sp. DJM-731 SS1]
          Length = 406

 Score =  566 bits (1458), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 278/409 (67%), Positives = 317/409 (77%), Gaps = 18/409 (4%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFGTLF+VTT+GESHG SVGCIVDGCPPG+ L EAD+Q+QL RRRPGQ+ L TPRDEK
Sbjct: 1   MSTFGTLFKVTTYGESHGLSVGCIVDGCPPGMELAEADVQVQLSRRRPGQTALATPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D VAIQSG E G+TLGTPI +LV NQDQRPHDYSETDLYPRPSHAD+TYL KY +KASSG
Sbjct: 61  DLVAIQSGLEHGVTLGTPISMLVRNQDQRPHDYSETDLYPRPSHADYTYLAKYGVKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFI-------------- 166
           GGR+SARETIGRVAAGAIAEKYL+  +G+EIVAFVSSV  I +P                
Sbjct: 121 GGRSSARETIGRVAAGAIAEKYLRQAYGIEIVAFVSSVGKITIPSTPSPTGISSTAPSVE 180

Query: 167 -NEQDERLFPEDFWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTIT 225
            +  ++ L PE F E+L T+ R +VD    RCP    ++KM  RI  +KEA DS+GGT+T
Sbjct: 181 EDSAEDALSPE-FREILKTVTRAQVDAHPTRCPHPATAEKMTARIMRSKEALDSIGGTVT 239

Query: 226 CVIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND 285
           CVIRNVP GLGEP FDK EAK AHAMLS+PATKGFEIGSGFKGT + G +HND +V    
Sbjct: 240 CVIRNVPSGLGEPVFDKFEAKLAHAMLSVPATKGFEIGSGFKGTEVPGSRHNDKFVQGEG 299

Query: 286 RLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCV 345
           RL T+TN SGG QGGITNGE++YFRV FK PATISQ Q TA Y+G  G LAARGRHDPCV
Sbjct: 300 RLRTETNWSGGIQGGITNGEDVYFRVGFKSPATISQAQSTAQYDGTAGQLAARGRHDPCV 359

Query: 346 VPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAMSGVIPK 394
           VPRAVPIVE+MAALV+MDALMIQ +R    SLLPP   +P  M  V+PK
Sbjct: 360 VPRAVPIVEAMAALVVMDALMIQNARNGAVSLLPPVTTLPKTM--VLPK 406



>gi|242208382|ref|XP_002470042.1| predicted protein [Postia placenta Mad-698-R]
 gi|220730942|gb|EED84792.1| predicted protein [Postia placenta Mad-698-R]
          Length = 410

 Score =  565 bits (1456), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 278/398 (69%), Positives = 314/398 (78%), Gaps = 10/398 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFGTLFRVTT+GESH  SVG IVDGCPPGL L   D+Q QL RRRPGQSNLTTPRDEK
Sbjct: 1   MSTFGTLFRVTTYGESHCASVGAIVDGCPPGLPLEPQDVQTQLSRRRPGQSNLTTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V +QSG E GITLGTPIGLLV N+DQRPHDYSETDLYPRPSHADWTYL+KY +KASSG
Sbjct: 61  DLVQLQSGIEHGITLGTPIGLLVRNEDQRPHDYSETDLYPRPSHADWTYLEKYGVKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMP------FINEQD---E 171
           GGR+SARETIGRVAAGAIAE+YLKLVHG+EIVAFVSSV  + +P        +E D   E
Sbjct: 121 GGRSSARETIGRVAAGAIAERYLKLVHGIEIVAFVSSVGKVHLPSSVGSQASSEDDDSVE 180

Query: 172 RLFPEDFWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNV 231
            +   +F +LL T+ RE+VD    RCP    +++M +RI  AKEA DS+GGT+TCVIR V
Sbjct: 181 DILSSEFVQLLQTVTREQVDSHPTRCPHTETAERMTKRIIRAKEASDSIGGTVTCVIRGV 240

Query: 232 PVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND-RLGTK 290
           P GLGEP FDK EAK AHAMLSIPATK FEIGSGF+GT   G +HND + +K D  +GTK
Sbjct: 241 PAGLGEPVFDKFEAKLAHAMLSIPATKAFEIGSGFRGTEAPGSRHNDAFFVKPDGSMGTK 300

Query: 291 TNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAV 350
           TN SGG QGGITN E+IYFRV FK PATISQ QETA Y+G  G LAARGRHDPCVVPRAV
Sbjct: 301 TNWSGGVQGGITNAEDIYFRVGFKSPATISQAQETAQYDGTPGTLAARGRHDPCVVPRAV 360

Query: 351 PIVESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAM 388
           PIVE+MA+LV+MD L+IQ +RK  ASLLP    +P  M
Sbjct: 361 PIVEAMASLVVMDQLLIQNARKATASLLPAITTLPPTM 398



>gi|472580914|gb|EMS18681.1| chorismate synthase [Rhodosporidium toruloides NP11]
          Length = 410

 Score =  565 bits (1456), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 272/377 (72%), Positives = 310/377 (82%), Gaps = 2/377 (0%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG LFRVTT+GESH  SVG I+DGCPPG+ L + DIQ Q+ RRRPGQSNLTTPR+E 
Sbjct: 1   MSTFGALFRVTTYGESHCASVGAIIDGCPPGMPLTDEDIQPQMTRRRPGQSNLTTPRNEA 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V IQSG E+G+TLGTPIGLLV N+DQRPHDY+ETD YPRPSHADWTYL KY +KASSG
Sbjct: 61  DAVQIQSGVEAGVTLGTPIGLLVRNKDQRPHDYTETDHYPRPSHADWTYLLKYGLKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGR+SARETIGRVAAG IAE+YLKL +GVEIVAFVSSV  + MP  +  D  L  ED+ +
Sbjct: 121 GGRSSARETIGRVAAGTIAERYLKLAYGVEIVAFVSSVGKVHMPE-SSTDSDLLSEDYLK 179

Query: 181 LLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCF 240
           LL+TI RE+VD++ +RCP    +  M ERI  AK   DS+GGT+TCVIR  PVGLGEP F
Sbjct: 180 LLSTITREKVDENTIRCPHAETAQAMEERIMAAKAKNDSIGGTVTCVIRRSPVGLGEPVF 239

Query: 241 DKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND-RLGTKTNNSGGTQG 299
           DKLEAK AHAMLSIPATKGFEIGSGFKGT + G +HND +V K D  LGTKTN SGG QG
Sbjct: 240 DKLEAKLAHAMLSIPATKGFEIGSGFKGTEVPGSEHNDAFVKKADGSLGTKTNRSGGIQG 299

Query: 300 GITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAAL 359
           GITNGE+IYF++AFK PATISQEQ TA Y+G  GVLA RGRHDPCVVPRAVPIVE+MAAL
Sbjct: 300 GITNGEDIYFKIAFKSPATISQEQATAKYDGESGVLATRGRHDPCVVPRAVPIVEAMAAL 359

Query: 360 VIMDALMIQQSRKTVAS 376
           VIMDA++IQ +R+T AS
Sbjct: 360 VIMDAVLIQNARQTAAS 376



>gi|511008076|gb|EPB89348.1| chorismate synthase [Mucor circinelloides f. circinelloides
           1006PhL]
          Length = 397

 Score =  562 bits (1448), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 278/396 (70%), Positives = 316/396 (79%), Gaps = 3/396 (0%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FG LFRVTT+GESH K VG IVDG PPG+ L EADIQ QL RRRPGQ+ LTTPRDEK
Sbjct: 1   MSSFGKLFRVTTYGESHCKGVGAIVDGVPPGMELTEADIQPQLTRRRPGQNKLTTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           DKV I SGTE G+TLGTPIG+ VPN DQRPHDYS+TD+YPRPSHAD+TYLQKY +KASSG
Sbjct: 61  DKVTIMSGTEFGVTLGTPIGIQVPNLDQRPHDYSDTDIYPRPSHADYTYLQKYGLKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPE-DFW 179
           GGRASARETIGRVAAGAIAEKYL+L +GVEIVAF SSV  +AMPFI E +     E +  
Sbjct: 121 GGRASARETIGRVAAGAIAEKYLRLAYGVEIVAFASSVGKVAMPFIRELENADTAEPELI 180

Query: 180 ELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           E +NTI RE+VD D  RCP    ++ M++ I E    +DSVGGT+TCVIR  PVGLGEPC
Sbjct: 181 EFMNTITREDVDADISRCPHPPTAEAMKKVIAEKSHERDSVGGTVTCVIRKCPVGLGEPC 240

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND-RLGTKTNNSGGTQ 298
           FDKLEA  AHAMLSIPATKGFE GSGF GT + GH HNDP+  + D  +GT TNNSGG Q
Sbjct: 241 FDKLEAILAHAMLSIPATKGFEFGSGFNGTKMAGHDHNDPFYQREDGSIGTTTNNSGGVQ 300

Query: 299 GGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAA 358
           GGI+NGENIYFRVAFKP ATISQ+Q TA Y+GV G LAA+GRHDPCVV RAVPIVE+MAA
Sbjct: 301 GGISNGENIYFRVAFKPAATISQDQTTANYDGVTGTLAAKGRHDPCVVSRAVPIVEAMAA 360

Query: 359 LVIMDALMIQQSRKTVASLLPPNPNIPAAMSGVIPK 394
           LVIMDA + Q+SR+T  S L P+ +I  A+ G  PK
Sbjct: 361 LVIMDAALQQESRRTAFSKL-PSIDINHALLGKPPK 395



>gi|449550419|gb|EMD41383.1| hypothetical protein CERSUDRAFT_109982 [Ceriporiopsis subvermispora
           B]
          Length = 411

 Score =  562 bits (1448), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 276/400 (69%), Positives = 315/400 (78%), Gaps = 12/400 (3%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG LFRVTT+GESH  SVG I+DGCPPGL L   D+Q+QL RRRPGQSNLTTPRDEK
Sbjct: 1   MSTFGNLFRVTTYGESHCASVGAIIDGCPPGLPLTAQDVQVQLSRRRPGQSNLTTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V +QSG E GITLGTPIGLLV N+DQRP DYSETDLYPRPSHADWTYL+KY +KASSG
Sbjct: 61  DLVHLQSGIEQGITLGTPIGLLVRNEDQRPKDYSETDLYPRPSHADWTYLEKYGVKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFI--------NEQD-- 170
           GGR+SARETIGRVAAGAIAEKYLKLV+G+EIVAFVSSV  + +P          +E D  
Sbjct: 121 GGRSSARETIGRVAAGAIAEKYLKLVYGIEIVAFVSSVGKVKLPSTVSPPSQASSEDDDA 180

Query: 171 -ERLFPEDFWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIR 229
            E     +F ELL T+ RE+VD    RCP    +++M +RI  AKEA DS+GGT+TCVIR
Sbjct: 181 VEDALSPEFVELLRTVSREQVDSHLTRCPHPETAERMTKRIIRAKEASDSIGGTVTCVIR 240

Query: 230 NVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND-RLG 288
            VP GLGEP FDKLEA   HAMLSIPATK FEIGSGF+GT + G +HND +VL+ D  +G
Sbjct: 241 RVPAGLGEPVFDKLEAALGHAMLSIPATKAFEIGSGFRGTEVPGSKHNDAFVLRADGTVG 300

Query: 289 TKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPR 348
           TKTN SGG QGGI+NGE+IYFRV FK PATISQ Q TA Y+G  G LAARGRHDPCVVPR
Sbjct: 301 TKTNWSGGIQGGISNGEDIYFRVGFKSPATISQAQATAQYDGTPGTLAARGRHDPCVVPR 360

Query: 349 AVPIVESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAM 388
           AVPIVE+MAA+VIMD +++Q +RKT ASLLPP   +P  M
Sbjct: 361 AVPIVEAMAAIVIMDHVLMQNARKTAASLLPPITTLPPTM 400



>gi|409050966|gb|EKM60442.1| hypothetical protein PHACADRAFT_246385 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 407

 Score =  561 bits (1446), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 279/401 (69%), Positives = 315/401 (78%), Gaps = 14/401 (3%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFGTLFRVTT+GESH  SVG I+DGCPPGL L   D+Q QL RRRPGQSNLTTPRDEK
Sbjct: 1   MSTFGTLFRVTTYGESHCASVGAIIDGCPPGLPLDSQDVQTQLSRRRPGQSNLTTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V +QSG E GITLGTPIGLLV N+DQRP DYSETDLYPRPSHADWTYL+KY +KASSG
Sbjct: 61  DLVHLQSGIEHGITLGTPIGLLVKNEDQRPRDYSETDLYPRPSHADWTYLEKYGVKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFI--------NEQD-- 170
           GGR+SARETIGRVAAGAIAEKYLKL HG+EIVAFVSSV  + +P          +E D  
Sbjct: 121 GGRSSARETIGRVAAGAIAEKYLKLTHGIEIVAFVSSVGKVKLPSTVSSPSQASSEDDDI 180

Query: 171 --ERLFPEDFWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVI 228
             + L PE F  LL T+ R +VD    RCP    +++M +RI  AKEA+DS+GGT+TCVI
Sbjct: 181 VEDSLSPE-FVNLLKTVTRAQVDAHLTRCPHPETAERMTKRIIRAKEAQDSIGGTVTCVI 239

Query: 229 RNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND-RL 287
           R VP GLGEP FDKLEAK  HAMLSIPATKGFEIGSGF+GT + G +HNDP+V K D  L
Sbjct: 240 RGVPSGLGEPVFDKLEAKLGHAMLSIPATKGFEIGSGFRGTEVPGSKHNDPFVSKADGSL 299

Query: 288 GTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVP 347
           GT TN SGG QGGI+NGE+IYFRV FK PATISQ QET  Y+G  G LAARGRHDPCVVP
Sbjct: 300 GTSTNWSGGIQGGISNGEDIYFRVGFKSPATISQAQETVQYDGTSGTLAARGRHDPCVVP 359

Query: 348 RAVPIVESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAM 388
           RAVPIVE+MA+LVI+D L+IQ +RKT +SLLP    +P  M
Sbjct: 360 RAVPIVEAMASLVIIDQLLIQNARKTASSLLPTITTLPPTM 400



>gi|321264868|ref|XP_003197151.1| chorismate synthase [Cryptococcus gattii WM276]
 gi|317463629|gb|ADV25364.1| chorismate synthase, putative [Cryptococcus gattii WM276]
          Length = 421

 Score =  561 bits (1446), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 278/406 (68%), Positives = 321/406 (79%), Gaps = 9/406 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FGTL+RV T+GESH KSVGCIVDG PPGL L EADIQ QL RRRPGQS++TT R E 
Sbjct: 1   MSSFGTLYRVHTYGESHCKSVGCIVDGVPPGLQLTEADIQTQLSRRRPGQSDITTARSEF 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V +QSGTE G+TLGTPIGLLV N+DQRPHDY+ETDLYPRPSHAD+TYL KY +KASSG
Sbjct: 61  DTVHVQSGTEHGVTLGTPIGLLVHNKDQRPHDYAETDLYPRPSHADYTYLAKYGVKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGRASARETIGRVAAGAIAEKYLK   GVEIVAFV+SV  +A+PF +E+DE L  E + +
Sbjct: 121 GGRASARETIGRVAAGAIAEKYLKEAFGVEIVAFVASVGKVALPFADEEDEVLGKE-YMD 179

Query: 181 LLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCF 240
           L+ T+ REEVDK+  RCP K  S KM E I  AK   DS+GG++TCVIR  P+GLGEPCF
Sbjct: 180 LVKTVTREEVDKEITRCPHKETSKKMEETIRAAKAKDDSLGGSVTCVIRRCPLGLGEPCF 239

Query: 241 DKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND------RLGTKTNNS 294
           DKLEA  AHAMLSIP+TK FEIGSG +G+T  G  HNDP+V   D      RL T TN S
Sbjct: 240 DKLEAVLAHAMLSIPSTKSFEIGSGLRGSTFPGSVHNDPFVEGVDEKTGGRRLRTVTNWS 299

Query: 295 GGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVE 354
           GG QGGI+NGE+IYFR+ FKPPATI+QEQ TA Y+G +GVLAA+GRHDPCVVPRAVPIVE
Sbjct: 300 GGVQGGISNGEDIYFRIGFKPPATIAQEQSTAKYDGTEGVLAAKGRHDPCVVPRAVPIVE 359

Query: 355 SMAALVIMDALMIQQSRKTVASLLPPNPNIPAAMSGVIPKLSETQK 400
           +MAALVIMD ++ Q +R T ASLLP   ++P  M  V+P  S  QK
Sbjct: 360 TMAALVIMDMVLQQNARLTAASLLPDLTHLPPTM--VLPGKSTFQK 403



>gi|384500260|gb|EIE90751.1| chorismate synthase [Rhizopus delemar RA 99-880]
          Length = 393

 Score =  560 bits (1443), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 280/395 (70%), Positives = 322/395 (81%), Gaps = 5/395 (1%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FG L+RVTT+GESH K VG I+DG PPG+ L EADIQ QL RRRPGQS LTTPRDEK
Sbjct: 1   MSSFGRLYRVTTYGESHCKGVGAIIDGVPPGMELTEADIQPQLTRRRPGQSKLTTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           DKV I SGTE G+TLGTPIG++VPN DQRPHDYSETD+YPRPSHAD+TYLQKY +KASSG
Sbjct: 61  DKVTIMSGTEYGVTLGTPIGIMVPNLDQRPHDYSETDIYPRPSHADYTYLQKYGVKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGRASARETIGRVAAGAIAEKYL+L +GVEIVAF SSV   AMPFINE D    PE   E
Sbjct: 121 GGRASARETIGRVAAGAIAEKYLRLAYGVEIVAFASSVGKAAMPFINELDPT--PEQL-E 177

Query: 181 LLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCF 240
            +NT+ RE+VD D  RCPD   ++ M++ I +  E KDS+GG++TCVIR  P+GLGEPCF
Sbjct: 178 FMNTLTREDVDADISRCPDPATAEAMKQLIAQKSEEKDSIGGSVTCVIRKCPIGLGEPCF 237

Query: 241 DKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND-RLGTKTNNSGGTQG 299
           DKLEA  AHAMLSIPATKGFE GSGFKGT + G QHNDP+ LK D   GT +N+SGG QG
Sbjct: 238 DKLEALLAHAMLSIPATKGFEFGSGFKGTKMSGGQHNDPFYLKEDGTFGTTSNHSGGVQG 297

Query: 300 GITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAAL 359
           GI+NGENIYFRVAFKP ATISQ+Q TA+Y+G+ GVLAARGRHDPCVV RAVPIVESMAAL
Sbjct: 298 GISNGENIYFRVAFKPAATISQDQTTASYDGITGVLAARGRHDPCVVSRAVPIVESMAAL 357

Query: 360 VIMDALMIQQSRKTVASLLPPNPNIPAAMSGVIPK 394
           VIMDA + Q++R+  A+ L P+ +I  A+ G  PK
Sbjct: 358 VIMDAALQQEARQAAAAKL-PSIDIHHALLGKPPK 391



>gi|393247850|gb|EJD55357.1| chorismate synthase [Auricularia delicata TFB-10046 SS5]
          Length = 419

 Score =  560 bits (1442), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 273/400 (68%), Positives = 321/400 (80%), Gaps = 13/400 (3%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFGTLFRVTT+GESH  SVG I+DGCPPG+ L  ADIQ+Q++RRRPGQSNLTTPR+EK
Sbjct: 1   MSTFGTLFRVTTYGESHCASVGAIIDGCPPGMPLEAADIQVQMNRRRPGQSNLTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D + +QSG E G+TLGTPIGL V N+DQRPHDYSETDL+PRPSHAD+TYL+KY +KASSG
Sbjct: 61  DAIQLQSGIEHGVTLGTPIGLYVRNEDQRPHDYSETDLFPRPSHADYTYLEKYGVKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPF-------INEQDER- 172
           GGR+SARETIGRVAAGAIAEKYL++ +G+EIVAFV+SV  I MP         +E+D+  
Sbjct: 121 GGRSSARETIGRVAAGAIAEKYLRMAYGIEIVAFVTSVGKIHMPAAVVQGEPADEEDDNA 180

Query: 173 ---LFPEDFWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIR 229
              L PE F +LL+T+ RE+VD  A RCP    ++KM +RI  A+  KDS+GGT+TCVIR
Sbjct: 181 ADALTPE-FRQLLSTVSREQVDAHATRCPHPETAEKMTKRIVRAQGLKDSIGGTVTCVIR 239

Query: 230 NVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND-RLG 288
           NVP GLGEP FDK EAK AHAMLSIPATK FE+GSGF+GT + G +HND +V + D RLG
Sbjct: 240 NVPSGLGEPVFDKFEAKLAHAMLSIPATKAFEVGSGFRGTEVPGSKHNDAFVRRADGRLG 299

Query: 289 TKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPR 348
           T TN SGG QGGITNGE+IYFRV FK PATISQ QETA Y+G  G LAARGRHDPCVVPR
Sbjct: 300 TATNWSGGIQGGITNGESIYFRVGFKSPATISQAQETARYDGTAGTLAARGRHDPCVVPR 359

Query: 349 AVPIVESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAM 388
           AVPIVE+MAALV++D L+IQ SR+   SLLPP   +P  M
Sbjct: 360 AVPIVEAMAALVVIDQLLIQNSRRAATSLLPPITTLPPTM 399



>gi|393218963|gb|EJD04451.1| chorismate synthase [Fomitiporia mediterranea MF3/22]
          Length = 425

 Score =  559 bits (1441), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 277/401 (69%), Positives = 316/401 (78%), Gaps = 14/401 (3%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFGTLFRVTT+GESH  SVGCIVDGCPPGL L  ADIQ+QL RRRPGQSNLTTPRDEK
Sbjct: 1   MSTFGTLFRVTTYGESHCASVGCIVDGCPPGLQLTAADIQVQLSRRRPGQSNLTTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V +QSG E G+TLGTPIGLLV N+DQRP DYSETDLYPRPSHAD+TYL+KY IKASSG
Sbjct: 61  DLVHVQSGVEHGVTLGTPIGLLVKNEDQRPKDYSETDLYPRPSHADYTYLEKYGIKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFI------------NE 168
           GGR+SARETIGRVAAGAIAE YL+ V+G+EIVAFVSSV  I +P              +E
Sbjct: 121 GGRSSARETIGRVAAGAIAETYLRQVYGIEIVAFVSSVGKITIPSSVDGRAISHDEDNDE 180

Query: 169 QDERLFPEDFWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVI 228
            +E L PE F +LL+T+ R  VD  + RCP    +++M +RI  AKEA DS+GGTITCV+
Sbjct: 181 IEEALTPE-FRQLLSTVTRAAVDAHSTRCPHAETAERMVKRILRAKEAHDSIGGTITCVM 239

Query: 229 RNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND-RL 287
           RNVP GLGEP FDK EA  AHAMLSIPATK FEIGSGF+GT + G +HND +V + D RL
Sbjct: 240 RNVPPGLGEPVFDKFEAALAHAMLSIPATKAFEIGSGFRGTEVPGSRHNDAFVARPDGRL 299

Query: 288 GTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVP 347
           GT+TN SGG QGGITNG+++Y RV FK PATISQ Q TA Y+G  G LAARGRHDPCVVP
Sbjct: 300 GTRTNWSGGVQGGITNGQDVYVRVGFKSPATISQAQSTAQYDGTQGELAARGRHDPCVVP 359

Query: 348 RAVPIVESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAM 388
           RAVPIVE+MAALVIMD L++Q +R   ASLLPP   +P  M
Sbjct: 360 RAVPIVEAMAALVIMDMLLMQNARSQAASLLPPVTTLPPTM 400



>gi|392572045|gb|EIW65217.1| chorismate synthase [Trametes versicolor FP-101664 SS1]
          Length = 409

 Score =  558 bits (1439), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 278/401 (69%), Positives = 315/401 (78%), Gaps = 14/401 (3%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFGTLFRVTT+GESH  SVG I+DGCPPGL LV  D+Q QL RRRPGQSNLTTPRDEK
Sbjct: 1   MSTFGTLFRVTTYGESHCASVGAIIDGCPPGLPLVAQDVQTQLSRRRPGQSNLTTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V +QSG E G+TLGTPIGLLV N+DQRP DYSETDLYPRPSHADWTYL+KY +KASSG
Sbjct: 61  DLVHLQSGIEHGVTLGTPIGLLVRNEDQRPKDYSETDLYPRPSHADWTYLEKYGVKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFI------------NE 168
           GGR+SARETIGRVAAGAIAEKYLKL +G+EIVAFVSSV  + +P              + 
Sbjct: 121 GGRSSARETIGRVAAGAIAEKYLKLAYGIEIVAFVSSVGKVQLPSSVSPPSQVSADDDDT 180

Query: 169 QDERLFPEDFWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVI 228
            ++ L PE F ELL T+ RE VD    RCP    S++M +RI  AKEA DS+GGT+TCVI
Sbjct: 181 VEDALSPE-FVELLKTVTRETVDAQPTRCPHAETSERMVKRIIRAKEANDSIGGTVTCVI 239

Query: 229 RNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND-RL 287
           R VP GLGEP FDKLEAK  HAMLSIPATK FEIGSGF+GT + G +HND +V + D  L
Sbjct: 240 RGVPAGLGEPVFDKLEAKLGHAMLSIPATKAFEIGSGFRGTQVPGSKHNDAFVRRADGSL 299

Query: 288 GTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVP 347
           GT TN SGG QGGI+NGE+IYFR+ FK PATISQEQ+TA Y+G  G LAARGRHDPCVVP
Sbjct: 300 GTTTNWSGGVQGGISNGEDIYFRIGFKSPATISQEQQTAQYDGTPGKLAARGRHDPCVVP 359

Query: 348 RAVPIVESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAM 388
           RAVPIVE+MAALVIMD ++IQ SRK  A+LLPP   +P  M
Sbjct: 360 RAVPIVEAMAALVIMDQVLIQNSRKAAAALLPPITTLPPTM 400



>gi|58270564|ref|XP_572438.1| chorismate synthase [Cryptococcus neoformans var. neoformans JEC21]
 gi|134118044|ref|XP_772403.1| hypothetical protein CNBL2690 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50255016|gb|EAL17756.1| hypothetical protein CNBL2690 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57228696|gb|AAW45131.1| chorismate synthase, putative [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 421

 Score =  558 bits (1439), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 277/406 (68%), Positives = 320/406 (78%), Gaps = 9/406 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FGTL+RV T+GESH KSVGCIVDG PPGL L EADIQ QL RRRPGQS++TT R E 
Sbjct: 1   MSSFGTLYRVHTYGESHCKSVGCIVDGVPPGLQLTEADIQTQLSRRRPGQSDITTARSEF 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V +QSGTE G+TLGTPIGLLV N+DQRPHDY+ETDLYPRPSHAD+TYL KY +KASSG
Sbjct: 61  DTVHVQSGTEHGVTLGTPIGLLVHNKDQRPHDYAETDLYPRPSHADYTYLAKYGVKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGRASARETIGRVAAGAIAEKYLK   GVEIVAFV+SV   A+PF +E+DE +  + + +
Sbjct: 121 GGRASARETIGRVAAGAIAEKYLKEAFGVEIVAFVASVGKTALPFADEEDE-VLGKAYMD 179

Query: 181 LLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCF 240
           L+ T+ REEVDK+  RCP K  S KM E I  AK   DS+GG+ITCVIR  P+GLGEPCF
Sbjct: 180 LVQTVTREEVDKEITRCPHKETSKKMEETIRAAKAKDDSLGGSITCVIRRCPLGLGEPCF 239

Query: 241 DKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND------RLGTKTNNS 294
           DKLEA  AHAMLSIP+TK FEIGSG +G+T  G  HNDP+V   D      RL T TN S
Sbjct: 240 DKLEAVLAHAMLSIPSTKSFEIGSGLRGSTFPGSLHNDPFVEGVDEKTGGRRLRTVTNWS 299

Query: 295 GGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVE 354
           GG QGGI+NGE+IYFR+ FKPPATI+QEQ TA Y+G +GVLAA+GRHDPCVVPRAVPIVE
Sbjct: 300 GGVQGGISNGEDIYFRIGFKPPATIAQEQSTARYDGSEGVLAAKGRHDPCVVPRAVPIVE 359

Query: 355 SMAALVIMDALMIQQSRKTVASLLPPNPNIPAAMSGVIPKLSETQK 400
           +MAALVIMD ++ Q +R T ASLLP   ++P  M  V+P  S  QK
Sbjct: 360 TMAALVIMDMVLQQNARLTAASLLPDLTHLPPTM--VLPGKSTVQK 403



>gi|392596996|gb|EIW86318.1| chorismate synthase [Coniophora puteana RWD-64-598 SS2]
          Length = 408

 Score =  558 bits (1438), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 276/403 (68%), Positives = 314/403 (77%), Gaps = 15/403 (3%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFGTLFRVTT+GESH  SVG IVDGCPPGL L   D+Q+QL RRRPGQSNLTTPR+EK
Sbjct: 1   MSTFGTLFRVTTYGESHCASVGAIVDGCPPGLQLSAEDVQVQLSRRRPGQSNLTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V IQSG E G+TLGTPIGLLV N+DQRPHDYSETDLYPRPSHAD+TYLQKY +KASSG
Sbjct: 61  DAVHIQSGIEHGVTLGTPIGLLVKNEDQRPHDYSETDLYPRPSHADYTYLQKYGVKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFI-------------- 166
           GGR+SARETIGRVAAGAIAE+YLK V+GVEIVAFVSSV  + +P                
Sbjct: 121 GGRSSARETIGRVAAGAIAERYLKEVYGVEIVAFVSSVGKVHLPATVAPPSLIPNDGNED 180

Query: 167 NEQDERLFPEDFWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITC 226
           N++ E     +F +LL TI REEVDK   RCP     ++M +RI  AK+A DS+GGT+TC
Sbjct: 181 NDEAEDALSPEFRQLLATITREEVDKHPTRCPHLETGERMTKRILRAKDASDSIGGTVTC 240

Query: 227 VIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND- 285
           VIRNVP GLGEP FDK EAK  HAMLSIPATK FEIGSGF+GT + G +HND +V K D 
Sbjct: 241 VIRNVPSGLGEPVFDKFEAKLGHAMLSIPATKAFEIGSGFRGTEVPGSRHNDAFVKKEDG 300

Query: 286 RLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCV 345
            LGT TN SGG QGGITNGE+IYFR+ FK PATISQ Q TA Y+G  G LAARGRHDPCV
Sbjct: 301 SLGTATNWSGGVQGGITNGEDIYFRIGFKSPATISQAQATAQYDGTPGELAARGRHDPCV 360

Query: 346 VPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAM 388
           VPRAVPIVE+MAALV+MD L+IQ +R++ A+ LPP   +P  M
Sbjct: 361 VPRAVPIVEAMAALVVMDQLLIQGARRSAAAGLPPVTTLPPTM 403



>gi|426201626|gb|EKV51549.1| hypothetical protein AGABI2DRAFT_189785 [Agaricus bisporus var.
           bisporus H97]
          Length = 402

 Score =  558 bits (1437), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 276/405 (68%), Positives = 323/405 (79%), Gaps = 11/405 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MST+GTLFRVTT+GESH  SVG I+DGCPPGL L + DIQ QL RRRPGQSNLTTPR+EK
Sbjct: 1   MSTYGTLFRVTTYGESHCASVGAIIDGCPPGLELSDTDIQTQLSRRRPGQSNLTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V IQSG E G+TLGTPIGLLV N+D RPHDYSETD YPRPSHAD+TYLQKY IKASSG
Sbjct: 61  DLVHIQSGVEHGVTLGTPIGLLVKNEDHRPHDYSETDFYPRPSHADYTYLQKYGIKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMP-------FINEQDERL 173
           GGR+SARETIGRVAAGAIAE+YLK   G+EIVAFVSSV  I +P         ++  + +
Sbjct: 121 GGRSSARETIGRVAAGAIAERYLKQAFGIEIVAFVSSVGKIQIPQTTTADDDSDDAPDPV 180

Query: 174 FPEDFWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPV 233
            PE F +L++T+ RE+VDK   RCP    +++M +RI  AK+A+DS+GGT+TCVIRNVP 
Sbjct: 181 SPE-FLKLISTVTREDVDKHTTRCPHLETAERMVQRIIRAKDAQDSIGGTVTCVIRNVPG 239

Query: 234 GLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND-RLGTKTN 292
           GLGEP FDK EAK  HAMLSIPATK FEIGSGF+GT + G +HNDP+V++ D  LGTKTN
Sbjct: 240 GLGEPTFDKFEAKLGHAMLSIPATKAFEIGSGFRGTEVPGSKHNDPFVVREDGTLGTKTN 299

Query: 293 NSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPI 352
            SGG QGGITN E+IYFR+AFK PATISQ Q TA Y+G  G LAARGRHDPCVVPRAVPI
Sbjct: 300 WSGGVQGGITNSEDIYFRIAFKSPATISQPQSTAQYDGEPGTLAARGRHDPCVVPRAVPI 359

Query: 353 VESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAMSGVIPKLSE 397
           VE+MAA+V+MD L+IQ +RKT ASLLPP   +P  M  V+P  ++
Sbjct: 360 VEAMAAIVVMDQLLIQNARKTAASLLPPITTLPPTM--VLPPATQ 402



>gi|169844406|ref|XP_001828924.1| chorismate synthase [Coprinopsis cinerea okayama7#130]
 gi|116510036|gb|EAU92931.1| chorismate synthase [Coprinopsis cinerea okayama7#130]
          Length = 417

 Score =  557 bits (1436), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 278/409 (67%), Positives = 316/409 (77%), Gaps = 17/409 (4%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFGTL+RVTT+GESH  SVG I+DGCPPGL L   DIQIQL RRRPGQSNLTTPR+EK
Sbjct: 1   MSTFGTLYRVTTYGESHCASVGAIIDGCPPGLELSAEDIQIQLSRRRPGQSNLTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V +QSG E G+TLGTPI LLV N+DQRPHDYSETDLYPRPSHAD+TYL+KY +KASSG
Sbjct: 61  DLVQLQSGLEHGVTLGTPIALLVKNEDQRPHDYSETDLYPRPSHADYTYLEKYGVKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPF--------------I 166
           GGR+SARETIGRVAAGAIAEKYLK   G+EIVAFVSSV  I +P                
Sbjct: 121 GGRSSARETIGRVAAGAIAEKYLKQAFGIEIVAFVSSVGKIHLPNELSPPSLTRSDTNED 180

Query: 167 NEQDERLFPEDFWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITC 226
           N+  E     +F +LL TI REEVD    RCP    ++KM +RI  AK+A DS+GGT+TC
Sbjct: 181 NDDAEDSVSPEFRQLLKTITREEVDHHPTRCPHPATAEKMTQRIIRAKDASDSIGGTVTC 240

Query: 227 VIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND- 285
           VIRNVP GLGEP FDK EA  AHAMLSIPATK FE+GSGF+GT + G +HNDP+V++ D 
Sbjct: 241 VIRNVPAGLGEPVFDKFEAALAHAMLSIPATKAFEVGSGFRGTEVPGSKHNDPFVVRPDG 300

Query: 286 RLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCV 345
            LGT TN SGG QGGITNGE+IYFR+ FK PATISQ QETA Y+G  G LAARGRHDPCV
Sbjct: 301 TLGTVTNWSGGIQGGITNGEDIYFRIGFKSPATISQPQETARYDGTPGTLAARGRHDPCV 360

Query: 346 VPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAMSGVIPK 394
           VPRAVPIVE+MAALV+MD L+ Q +RKT AS LPP   +P  M  V+PK
Sbjct: 361 VPRAVPIVEAMAALVVMDQLLQQDARKTAASRLPPIKTLPPTM--VMPK 407



>gi|409083322|gb|EKM83679.1| hypothetical protein AGABI1DRAFT_81437 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 402

 Score =  557 bits (1435), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 276/405 (68%), Positives = 323/405 (79%), Gaps = 11/405 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MST+GTLFRVTT+GESH  SVG I+DGCPPGL L + DIQ QL RRRPGQSNLTTPR+EK
Sbjct: 1   MSTYGTLFRVTTYGESHCASVGAIIDGCPPGLELRDTDIQTQLSRRRPGQSNLTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V IQSG E G+TLGTPIGLLV N+D RPHDYSETD YPRPSHAD+TYLQKY IKASSG
Sbjct: 61  DLVHIQSGVEHGVTLGTPIGLLVKNEDHRPHDYSETDFYPRPSHADYTYLQKYGIKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMP-------FINEQDERL 173
           GGR+SARETIGRVAAGAIAE+YLK   G+EIVAFVSSV  I +P         ++  + +
Sbjct: 121 GGRSSARETIGRVAAGAIAERYLKQAFGIEIVAFVSSVGKIQIPQTTTADDDSDDAPDPV 180

Query: 174 FPEDFWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPV 233
            PE F +L++T+ RE+VDK   RCP    +++M +RI  AK+A+DS+GGT+TCVIRNVP 
Sbjct: 181 SPE-FLKLISTVTREDVDKHTTRCPHLETAERMVQRIIRAKDAQDSIGGTVTCVIRNVPG 239

Query: 234 GLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND-RLGTKTN 292
           GLGEP FDK EAK  HAMLSIPATK FEIGSGF+GT + G +HNDP+V++ D  LGTKTN
Sbjct: 240 GLGEPTFDKFEAKLGHAMLSIPATKAFEIGSGFRGTEVPGSKHNDPFVVREDGTLGTKTN 299

Query: 293 NSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPI 352
            SGG QGGITN E+IYFR+AFK PATISQ Q TA Y+G  G LAARGRHDPCVVPRAVPI
Sbjct: 300 WSGGVQGGITNSEDIYFRIAFKSPATISQPQSTAQYDGEPGTLAARGRHDPCVVPRAVPI 359

Query: 353 VESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAMSGVIPKLSE 397
           VE+MAA+V+MD L+IQ +RKT ASLLPP   +P  M  V+P  ++
Sbjct: 360 VEAMAAIVVMDQLLIQNARKTAASLLPPITTLPPTM--VLPPATQ 402



>gi|405124291|gb|AFR99053.1| chorismate synthase [Cryptococcus neoformans var. grubii H99]
          Length = 421

 Score =  556 bits (1434), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 277/406 (68%), Positives = 320/406 (78%), Gaps = 9/406 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FGTL+RV T+GESH KSVGCIVDG PPGL L EADIQ QL RRRPGQS++TT R E 
Sbjct: 1   MSSFGTLYRVHTYGESHCKSVGCIVDGVPPGLQLTEADIQTQLSRRRPGQSDITTARSEF 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V +QSGTE G+TLGTPIGLLV N+DQRPHDY+ETDLYPRPSHAD+TYL KY +KASSG
Sbjct: 61  DTVHVQSGTEHGVTLGTPIGLLVHNKDQRPHDYAETDLYPRPSHADYTYLAKYGVKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGRASARETIGRVAAGAIAEKYLK   GVEIVAFV+SV   A+PF +E+DE +  + + +
Sbjct: 121 GGRASARETIGRVAAGAIAEKYLKEAFGVEIVAFVASVGKTALPFADEEDE-VLGKAYMD 179

Query: 181 LLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCF 240
           L+ TI REEVDK+  RCP K  S KM E I  AK   DS+GG+ITCVIR  P+GLGEPCF
Sbjct: 180 LVKTITREEVDKEITRCPHKETSKKMEETIRAAKAKDDSLGGSITCVIRRCPLGLGEPCF 239

Query: 241 DKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND------RLGTKTNNS 294
           DKLEA  AHAMLSIP+TK FEIGSG +G+T  G  HNDP+V   D      RL T TN S
Sbjct: 240 DKLEAVLAHAMLSIPSTKSFEIGSGLRGSTFPGSLHNDPFVEGVDEKTGGRRLRTVTNWS 299

Query: 295 GGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVE 354
           GG QGGI+NGE+IYFR+ FKPPATI+QEQ TA Y+G +GVLAA+GRHDPCVVPRAVPIVE
Sbjct: 300 GGVQGGISNGEDIYFRIGFKPPATIAQEQPTARYDGSEGVLAAKGRHDPCVVPRAVPIVE 359

Query: 355 SMAALVIMDALMIQQSRKTVASLLPPNPNIPAAMSGVIPKLSETQK 400
           +MAALVIMD ++ Q +R T ASLLP   ++P  M  V+P  +  QK
Sbjct: 360 TMAALVIMDMVLQQNARLTAASLLPDLTHLPPTM--VLPGKNTVQK 403



>gi|63054453|ref|NP_588359.2| chorismate synthase (predicted) [Schizosaccharomyces pombe 972h-]
 gi|12643630|sp|O74413.2|AROC_SCHPO RecName: Full=Chorismate synthase; AltName:
           Full=5-enolpyruvylshikimate-3-phosphate phospholyase
 gi|157310524|emb|CAA20883.2| chorismate synthase (predicted) [Schizosaccharomyces pombe]
          Length = 395

 Score =  556 bits (1433), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 268/392 (68%), Positives = 313/392 (79%), Gaps = 13/392 (3%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FGTLF+VTT+GESH KSVGCIV+GCPPG++L E+D+Q+QL RRRPGQSNLTTPR+EK
Sbjct: 1   MSSFGTLFKVTTYGESHCKSVGCIVEGCPPGMNLTESDVQVQLTRRRPGQSNLTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           DKV IQSGTE G+TLGTPIG+LV NQDQ+PHDYS+ D YPRPSHAD+TYL+KY +KASSG
Sbjct: 61  DKVQIQSGTEFGVTLGTPIGMLVLNQDQKPHDYSDMDNYPRPSHADYTYLEKYGVKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLF-PED-- 177
           GGR+SARETIGRVAAGAIAEKYL   +GVEIVAFVSSV  IA+P        +  PED  
Sbjct: 121 GGRSSARETIGRVAAGAIAEKYLLEAYGVEIVAFVSSVGKIAIPLHETASSAILDPEDDT 180

Query: 178 --------FWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIR 229
                   + + LN I REEVDK  VRCP    + KM ERI  A++  DS+GGT+TCVIR
Sbjct: 181 FESPITAEYLKFLNKITREEVDKTTVRCPHAATAAKMAERITRARDNHDSIGGTVTCVIR 240

Query: 230 NVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RL 287
           NVP GLGEPCFDKLEAK AHAM+SIPATK FEIGSG +G  + G +HND +    D  +L
Sbjct: 241 NVPTGLGEPCFDKLEAKLAHAMMSIPATKSFEIGSGREGCKVAGSKHNDLFYRNADTGKL 300

Query: 288 GTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVP 347
           GT TNNSGG QGGI+NGEN+YF + FK PATI  EQ T+ Y+G DGVLAA+GRHDPCVVP
Sbjct: 301 GTLTNNSGGVQGGISNGENVYFTIGFKSPATIGVEQSTSRYDGSDGVLAAKGRHDPCVVP 360

Query: 348 RAVPIVESMAALVIMDALMIQQSRKTVASLLP 379
           RA+PIVE+MAALV+MDA+MIQQSR    +LLP
Sbjct: 361 RAIPIVEAMAALVVMDAVMIQQSRIASRNLLP 392



>gi|170085343|ref|XP_001873895.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164651447|gb|EDR15687.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 413

 Score =  556 bits (1432), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 273/407 (67%), Positives = 316/407 (77%), Gaps = 16/407 (3%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MST+G+LFRVTT+GESH  SVG +VDGCPPGL L  ADIQ+QL RRRPGQSNLTTPRDEK
Sbjct: 1   MSTYGSLFRVTTYGESHCASVGAVVDGCPPGLQLSAADIQVQLSRRRPGQSNLTTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D + +QSG E G+TLGTPI  LV N+DQRPHDYSETDLYPRPSHAD+TYL+KY IKASSG
Sbjct: 61  DLIHLQSGLEHGVTLGTPIAFLVKNEDQRPHDYSETDLYPRPSHADYTYLEKYGIKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPED--- 177
           GGR+SARET+ RVAAGAIAEKYLKL +G+EIVAFVSSV  I +P        L P     
Sbjct: 121 GGRSSARETVARVAAGAIAEKYLKLAYGIEIVAFVSSVGKIHLP-AALAPPSLTPSSNDD 179

Query: 178 ---------FWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVI 228
                    F +LL TI RE+VD    RCP    +++M +RI  AK A+DS+GGT+TCVI
Sbjct: 180 DEDDALSDDFRQLLATISREQVDSHPTRCPHHETAERMTQRIIRAKNAQDSIGGTVTCVI 239

Query: 229 RNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND-RL 287
           R +P GLGEP FDK EA   HAMLSIPATK FEIGSGF+GT + G +HNDP++ ++D  L
Sbjct: 240 RGIPSGLGEPVFDKFEASLGHAMLSIPATKAFEIGSGFRGTEVPGSKHNDPFIRRSDGSL 299

Query: 288 GTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVP 347
           GT TN SGG QGGITNGE+IYFR+ FK PATISQ QETA Y+G  G LAARGRHDPCVVP
Sbjct: 300 GTATNWSGGVQGGITNGEDIYFRIGFKSPATISQSQETAQYDGTPGSLAARGRHDPCVVP 359

Query: 348 RAVPIVESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAMSGVIPK 394
           RAVPIVE+MAA+V+MD L+IQ SRKT ASLLPP   +PA M  V+P+
Sbjct: 360 RAVPIVEAMAAIVVMDQLLIQNSRKTAASLLPPITTLPATM--VMPR 404



>gi|465792761|emb|CCU98003.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 402

 Score =  555 bits (1431), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 274/392 (69%), Positives = 323/392 (82%), Gaps = 6/392 (1%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FGT +RV+TFGESH K+VGCIVDG PPGL++ EADIQ QL RRRPGQS LTTPRDEK
Sbjct: 1   MSSFGTYYRVSTFGESHCKAVGCIVDGVPPGLAVSEADIQRQLTRRRPGQSALTTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDL--YPRPSHADWTYLQKYSIKAS 118
           DKV I SGTE G+TLGTP+G++V NQDQRPHDY++ +L   PRPSHAD+TYLQKY +KAS
Sbjct: 61  DKVEILSGTERGVTLGTPMGMMVRNQDQRPHDYTDENLDAIPRPSHADYTYLQKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMP-FINEQDERLFPED 177
           SGGGR+SARETIGRVAAGA+AEKYL  V GVEIVAFVSSV  + +P F ++ +E    ++
Sbjct: 121 SGGGRSSARETIGRVAAGALAEKYLGDVLGVEIVAFVSSVGQVQLPAFQSDNEEEPLSQE 180

Query: 178 FWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGE 237
           + +LLNT+ RE+VDK+ +RCP+  V+DKMRER+  AKE  DS+GGT+TCVIR+VP+GLGE
Sbjct: 181 YLDLLNTVTREQVDKENIRCPNPAVADKMRERLMAAKEKSDSIGGTVTCVIRHVPIGLGE 240

Query: 238 PCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND-RLGTKTNNSGG 296
           P FDK EAK AHAMLSIPATKGFEIGSGF+GT + G +HNDP+V K D  LGT TN SGG
Sbjct: 241 PSFDKFEAKLAHAMLSIPATKGFEIGSGFRGTCVPGSKHNDPFVKKADGSLGTSTNWSGG 300

Query: 297 TQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESM 356
            QGGI+NGENIYFRVAFKPPATISQEQ+TA Y+G  GVL  RGRHDPCVVPRAVPIVESM
Sbjct: 301 IQGGISNGENIYFRVAFKPPATISQEQQTARYDGEPGVLENRGRHDPCVVPRAVPIVESM 360

Query: 357 AALVIMDALMIQQSRKTVASLLPPNPNIPAAM 388
           AALV+MD  + Q +R   AS +  NP   AA+
Sbjct: 361 AALVVMDMYLGQCARDKAASGI--NPAAVAAL 390



>gi|443921960|gb|ELU41481.1| chorismate synthase [Rhizoctonia solani AG-1 IA]
          Length = 406

 Score =  555 bits (1431), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 273/400 (68%), Positives = 313/400 (78%), Gaps = 12/400 (3%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT+GESH  SVGCIVDG PPG+ LVEAD+Q QL RRRPGQSNLTTPRDEK
Sbjct: 1   MSTFGRAFRVTTYGESHCPSVGCIVDGVPPGMQLVEADVQTQLTRRRPGQSNLTTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D+V I SG E G+TLGTPI L V NQDQRPHDY+ETD YPRPSHAD+TYL+KY +KASSG
Sbjct: 61  DQVVIHSGVEHGVTLGTPIALQVRNQDQRPHDYTETDFYPRPSHADYTYLEKYGVKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMP------FINEQDERLF 174
           GGR+SARETIGRVAAGAIAEKYLK+  G+EIVAFV+SV  I +P         E ++  F
Sbjct: 121 GGRSSARETIGRVAAGAIAEKYLKIAFGIEIVAFVASVGKIHIPSSTGAAATGESEDPDF 180

Query: 175 PED-----FWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIR 229
            ED     + +LL T+ REEVDK   RCP    S+KM +RI  AKEA+DS+GGT+ CVIR
Sbjct: 181 AEDALSPEYVKLLQTVTREEVDKYTTRCPHPETSEKMTQRILRAKEAQDSIGGTVVCVIR 240

Query: 230 NVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLG 288
           NVP GLGEP FDK EA+ AHAMLSIPATKGFEIGSGFKG  + G +HNDP+V  +  RL 
Sbjct: 241 NVPAGLGEPVFDKFEAELAHAMLSIPATKGFEIGSGFKGCEVPGSRHNDPFVASEGGRLR 300

Query: 289 TKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPR 348
           T TN SGG QGGITNGE+IYFR+ FK PATISQ Q TA YNG  G LAARGRHDPCVVPR
Sbjct: 301 TTTNWSGGIQGGITNGEDIYFRLGFKSPATISQAQSTAQYNGTAGSLAARGRHDPCVVPR 360

Query: 349 AVPIVESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAM 388
           A+PIVE+MAA+V++D L++QQ R T A+LLPP   +P  M
Sbjct: 361 AIPIVEAMAAIVVLDQLLLQQGRNTAANLLPPVTTLPPTM 400



>gi|401881711|gb|EJT46001.1| chorismate synthase [Trichosporon asahii var. asahii CBS 2479]
 gi|406697757|gb|EKD01010.1| chorismate synthase [Trichosporon asahii var. asahii CBS 8904]
          Length = 398

 Score =  555 bits (1430), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 269/391 (68%), Positives = 314/391 (80%), Gaps = 4/391 (1%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FGT +RV T+GESH KSVG I+DG PPGL L   DIQ+QL RRRPGQS++TTPR E 
Sbjct: 1   MSSFGTNYRVHTYGESHCKSVGAIIDGVPPGLKLTNEDIQVQLSRRRPGQSDITTPRSEF 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V IQSGTE G+TLGTPIGLLV N+DQRPHDY+ETDLYPRPSHAD+TYL KY +KASSG
Sbjct: 61  DTVQIQSGTEHGVTLGTPIGLLVQNKDQRPHDYTETDLYPRPSHADYTYLAKYGVKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGRASARETIGRVAAGAIAEKYLK   GV+IVA+VSSV N+++PF    DE +  +++ E
Sbjct: 121 GGRASARETIGRVAAGAIAEKYLKEALGVDIVAYVSSVGNVSLPFAQNDDE-VIGKEYLE 179

Query: 181 LLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCF 240
           LL+T+ RE+VDK+  RCP K  S+KM  +I EAK   DS+GGTITCVIRN P+GLGEPCF
Sbjct: 180 LLSTVTREQVDKEITRCPHKETSEKMEAKIREAKGRNDSLGGTITCVIRNPPLGLGEPCF 239

Query: 241 DKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND---RLGTKTNNSGGT 297
           DKLEA  AHAMLSIP+TKGFEIGSGF+G    G  HNDP+    D   RL T TN SGG 
Sbjct: 240 DKLEAVLAHAMLSIPSTKGFEIGSGFRGAEYPGSVHNDPFEAHPDGGNRLRTTTNWSGGI 299

Query: 298 QGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMA 357
           QGGI+NGE+IYFRVAFKPPATISQEQ TA Y+G  G LA RGRHDPCV+PRA+PIVE+MA
Sbjct: 300 QGGISNGEDIYFRVAFKPPATISQEQSTAQYDGTSGTLATRGRHDPCVLPRAIPIVETMA 359

Query: 358 ALVIMDALMIQQSRKTVASLLPPNPNIPAAM 388
           A+VIMD ++ Q +RK  +SLLPP  ++P  M
Sbjct: 360 AIVIMDMVLQQNARKAASSLLPPVDSLPPTM 390



>gi|353237446|emb|CCA69419.1| probable ARO2-chorismate synthase [Piriformospora indica DSM 11827]
          Length = 425

 Score =  555 bits (1430), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 276/389 (70%), Positives = 312/389 (80%), Gaps = 14/389 (3%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG +FRVTT+GESH  SVG IVDGCPPGL L  +DIQ+QL RRRPGQSNLTTPRDEK
Sbjct: 1   MSTFGRIFRVTTYGESHCASVGAIVDGCPPGLELAASDIQVQLSRRRPGQSNLTTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V +QSG E G+TLGTPIGLLV N+DQRP DYSETDLYPRPSHAD TYL KY +KASSG
Sbjct: 61  DLVQLQSGIEQGVTLGTPIGLLVRNEDQRPKDYSETDLYPRPSHADLTYLLKYGVKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQ----------- 169
           GGRASARETIGRVAAGAIAEKYL+ V+GVEIVAFV+SV  I +P  + Q           
Sbjct: 121 GGRASARETIGRVAAGAIAEKYLRQVYGVEIVAFVTSVGKIHLPTASTQRQTQGEEEDDT 180

Query: 170 -DERLFPEDFWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVI 228
            ++ L PE F +LL+TI REEVDK   RCPD   S++M +RI  AK+A DS+GGT+TCVI
Sbjct: 181 GEDPLSPE-FVKLLSTITREEVDKFPTRCPDGPTSERMTKRIIRAKDAMDSIGGTVTCVI 239

Query: 229 RNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND-RL 287
           RN P GLGEP FDK EA  AHAMLSIPATKGFEIGSGF+GT + G +HNDP++ + D  L
Sbjct: 240 RNSPAGLGEPVFDKFEATLAHAMLSIPATKGFEIGSGFRGTEIPGSKHNDPFMARADGTL 299

Query: 288 GTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVP 347
           GTKTN SGG QGGITNGENIYFRVAFK PATISQ Q TA Y+G  G LAARGRHDPCVVP
Sbjct: 300 GTKTNWSGGIQGGITNGENIYFRVAFKSPATISQAQATAQYDGTSGTLAARGRHDPCVVP 359

Query: 348 RAVPIVESMAALVIMDALMIQQSRKTVAS 376
           RAVPIVE+MAALV+MD L+IQ +R+  A+
Sbjct: 360 RAVPIVEAMAALVLMDQLLIQNARRATAN 388



>gi|471914516|emb|CCO26721.1| chorismate synthase [Rhizoctonia solani AG-1 IB]
          Length = 402

 Score =  555 bits (1430), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 271/396 (68%), Positives = 315/396 (79%), Gaps = 8/396 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG +FRVTT+GESH  SVGCIVDG PPG+ LVEAD+Q QL RRRPGQSNLTTPRDEK
Sbjct: 1   MSTFGRVFRVTTYGESHCPSVGCIVDGVPPGMQLVEADVQTQLTRRRPGQSNLTTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D+V I SG E G+TLGTPI L V NQDQRPHDY+ETD YPRPSHAD+TYL+KY +KASSG
Sbjct: 61  DQVTIHSGVEHGVTLGTPIALQVRNQDQRPHDYTETDFYPRPSHADYTYLEKYGVKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFIN--EQDERLFPED- 177
           GGR+SARETIGRVAAGAIAEKYLK+ +G+EIVAFV+SV  I +P     E ++  + ED 
Sbjct: 121 GGRSSARETIGRVAAGAIAEKYLKIAYGIEIVAFVASVGKIHIPTSTGGESEDPDYAEDA 180

Query: 178 ----FWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPV 233
               + +LL TI REEVDK   RCP    S+KM +RI  AK+A+DS+GGT+ CVIRNVP 
Sbjct: 181 LSPEYIKLLKTITREEVDKYTTRCPHPETSEKMTQRILRAKDAQDSIGGTVVCVIRNVPA 240

Query: 234 GLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV-LKNDRLGTKTN 292
           GLGEP FDK EA+ AHAMLSIPATKGFEIGSGFKG  + G +HNDP+V  +  RL T +N
Sbjct: 241 GLGEPVFDKFEAELAHAMLSIPATKGFEIGSGFKGCEVPGSRHNDPFVATEGGRLRTTSN 300

Query: 293 NSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPI 352
            SGG QGGITNGE+IYFR+ FK PATISQ Q TA YNG  G LAARGRHDPCVVPRA+PI
Sbjct: 301 WSGGIQGGITNGEDIYFRLGFKSPATISQAQSTAQYNGTAGSLAARGRHDPCVVPRAIPI 360

Query: 353 VESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAM 388
           VE+M+A+V++D L++QQ R T ASLLPP   +P  M
Sbjct: 361 VEAMSAIVVLDQLLLQQGRNTAASLLPPVTTLPPTM 396



>gi|328768275|gb|EGF78322.1| hypothetical protein BATDEDRAFT_90818 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 410

 Score =  555 bits (1429), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 267/402 (66%), Positives = 317/402 (78%), Gaps = 8/402 (1%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FG+ FR++TFGESH K+VG IVDGCPPGL L E D+Q  LDRRRPGQS LTTPRDEK
Sbjct: 1   MSSFGSFFRISTFGESHCKAVGVIVDGCPPGLPLSENDVQPLLDRRRPGQSVLTTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D+V I SGTE G TLGTPI ++VPNQDQRPHDY E DLYPRPSHADWTYLQKY +KA+SG
Sbjct: 61  DRVVILSGTEKGFTLGTPIAMMVPNQDQRPHDYGEMDLYPRPSHADWTYLQKYGVKATSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFI-------NEQDERL 173
           GGRASARETIGRVAA A+AEKYLK  HG+E+VAFV+SV  ++M  I       ++    L
Sbjct: 121 GGRASARETIGRVAAAAVAEKYLKSAHGIEVVAFVASVGPVSMVPIESFESVDDKNHWML 180

Query: 174 FPEDFWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPV 233
             + +W+LL  I R++VDK+ VRCP    S KMR+ I + K+A+DS+GG++ CVIRNVP 
Sbjct: 181 KWQSWWDLLKNITRKDVDKNDVRCPSPEFSAKMRDIILQYKDAQDSIGGSVVCVIRNVPA 240

Query: 234 GLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKNDRLGTKTNN 293
           GLGEPCFDKLEA+ AHAMLSIPATK FEIGSGF GT + GH HNDP+V K D LGT TN 
Sbjct: 241 GLGEPCFDKLEAQLAHAMLSIPATKAFEIGSGFSGTNIPGHVHNDPFVKKGDSLGTTTNF 300

Query: 294 SGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIV 353
           SGG QGGI+NGE+IYFRV FKP ATI   QET +Y G  G+LAA+GRHDPCV+PRAVPIV
Sbjct: 301 SGGIQGGISNGEDIYFRVGFKPAATIGISQETTSYEGDTGILAAKGRHDPCVLPRAVPIV 360

Query: 354 ESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAMSGVIPKL 395
           E+MA+LV+MD L+ Q SRK+ AS+L  +  IPA M G+ P +
Sbjct: 361 EAMASLVVMDMLLAQGSRKSAASVLSLS-EIPALMRGIAPAM 401



>gi|164661555|ref|XP_001731900.1| hypothetical protein MGL_1168 [Malassezia globosa CBS 7966]
 gi|159105801|gb|EDP44686.1| hypothetical protein MGL_1168 [Malassezia globosa CBS 7966]
          Length = 404

 Score =  552 bits (1423), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 268/384 (69%), Positives = 316/384 (82%), Gaps = 4/384 (1%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG+ +RV+TFGESH K+VGCIVDG PPGL++ E DIQ QL RRRPGQS+LTTPRDEK
Sbjct: 1   MSTFGSTYRVSTFGESHCKAVGCIVDGIPPGLAVSEQDIQRQLTRRRPGQSSLTTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSET--DLYPRPSHADWTYLQKYSIKAS 118
           DKV I SGTE G+TLGTP+ ++V NQDQRPHDY++   D  PRPSHAD+TYL+KY++KAS
Sbjct: 61  DKVEILSGTEKGVTLGTPVAMMVRNQDQRPHDYTDVKLDAIPRPSHADYTYLEKYNVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMP-FINEQDERLFPED 177
           SGGGR+SARETIGRVAAGA+AEKYL  V G+EIVAFVSSV ++ +  +  + DE     D
Sbjct: 121 SGGGRSSARETIGRVAAGALAEKYLTDVLGIEIVAFVSSVGHVGLSTYDADDDETPLRND 180

Query: 178 FWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGE 237
           + ELLN + R++VD++ VRCPD T ++KMR RI EAKE  DS+GGT+TCVIRNVPVGLGE
Sbjct: 181 YLELLNNVTRDQVDRENVRCPDATTAEKMRARIMEAKEKNDSIGGTVTCVIRNVPVGLGE 240

Query: 238 PCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND-RLGTKTNNSGG 296
           P FDK+EAK AHAMLSIPATKGFEIGSGF+GT + G +HNDP+V K D  LGT TN SGG
Sbjct: 241 PSFDKMEAKLAHAMLSIPATKGFEIGSGFRGTCVPGSKHNDPFVGKPDGSLGTSTNWSGG 300

Query: 297 TQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESM 356
            QGGITNGE+IYFRVAFKPPATISQEQ TA Y+G   VL  RGRHDPCVVPRAVPIVESM
Sbjct: 301 IQGGITNGEHIYFRVAFKPPATISQEQNTARYDGEQAVLENRGRHDPCVVPRAVPIVESM 360

Query: 357 AALVIMDALMIQQSRKTVASLLPP 380
           AA+VIMD  + Q +RK+ A+ + P
Sbjct: 361 AAIVIMDMFLAQSARKSAANKIDP 384



>gi|302673904|ref|XP_003026638.1| hypothetical protein SCHCODRAFT_62010 [Schizophyllum commune H4-8]
 gi|300100321|gb|EFI91735.1| hypothetical protein SCHCODRAFT_62010 [Schizophyllum commune H4-8]
          Length = 406

 Score =  552 bits (1422), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 272/404 (67%), Positives = 320/404 (79%), Gaps = 5/404 (1%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG+L+RVTTFGESH KSVG I+DGCPPG+ L +AD+Q+QL RRRPGQS LTTPR+E 
Sbjct: 1   MSTFGSLYRVTTFGESHCKSVGAIIDGCPPGMRLTDADVQVQLRRRRPGQSALTTPRNEP 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V+IQSGTE GITLGTPIGL+V N D RPHDYSETDLYPRPSHAD+TYL+KY +KASSG
Sbjct: 61  DLVSIQSGTEQGITLGTPIGLMVQNTDHRPHDYSETDLYPRPSHADYTYLEKYDVKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMP-FINEQDERLFPEDFW 179
           GGR+SARETIGRVAAGAIAEKYLK V+G+EIVAFVS V  + +P  +   D+ +  ED+ 
Sbjct: 121 GGRSSARETIGRVAAGAIAEKYLKEVYGIEIVAFVSGVGKVHVPRTMGGDDDEILSEDYM 180

Query: 180 ELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           +LLNT+ REEVDK+ +RCP      +M + I       DS+GGT+TCVIR VP GLGEP 
Sbjct: 181 KLLNTVTREEVDKNTIRCPHAASHKEMTDLITSTAAKADSIGGTVTCVIRGVPSGLGEPV 240

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND-RLGTKTNNSGGTQ 298
           FDK EAK AHAMLSIPATK FEIGSGFKGT   G QHND +  K D +LGT+TN SGG Q
Sbjct: 241 FDKFEAKLAHAMLSIPATKAFEIGSGFKGTEAHGSQHNDAFYAKGDGKLGTRTNWSGGVQ 300

Query: 299 GGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAA 358
           GGITNGENIYFR+ FKPPATISQEQ T+TY GV G LAARGRHDPCVVPRAVPIVE+MAA
Sbjct: 301 GGITNGENIYFRIGFKPPATISQEQATSTYAGVPGTLAARGRHDPCVVPRAVPIVEAMAA 360

Query: 359 LVIMDALMIQQSRKTVASLLPPNPNIPAAM--SGVIPKLSETQK 400
           +V+MD ++IQ++R    + L P  ++P  M  +GV   + E +K
Sbjct: 361 IVVMDMMLIQEARHAARARLAPL-SLPPGMGRAGVDQVIEEVKK 403



>gi|190347159|gb|EDK39382.2| conserved hypothetical protein [Meyerozyma guilliermondii ATCC
           6260]
          Length = 379

 Score =  546 bits (1406), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 264/381 (69%), Positives = 315/381 (82%), Gaps = 9/381 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG +FRVTT+GESH KSVGCIVDGCPPGL L E+DIQ QL RRRPGQS L+TPR+EK
Sbjct: 1   MSTFGKIFRVTTYGESHCKSVGCIVDGCPPGLKLSESDIQPQLSRRRPGQSKLSTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D+V IQSGTE+GITLG+PIG+LV N+D RP+DYSETDLYPRPSHADWTY+QKY  K++SG
Sbjct: 61  DQVHIQSGTENGITLGSPIGMLVLNEDHRPNDYSETDLYPRPSHADWTYIQKYGAKSASG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGR+SARETIGRVAAGAIAEK L L +GVEIVAFVSS+ ++AM      D       F +
Sbjct: 121 GGRSSARETIGRVAAGAIAEKVLSLANGVEIVAFVSSIGSVAM------DRNPLDPTFQK 174

Query: 181 LLNTIRREEVDK-DAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           +L+TI REEVD    +RCPD +V ++M + I + ++A+DS+GG +TCV+RN P+GLGEPC
Sbjct: 175 ILSTITREEVDGVGPIRCPDASVREQMVKEIEKYRDAQDSIGGVVTCVVRNCPIGLGEPC 234

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLK--NDRLGTKTNNSGGT 297
           FDKLEA  AHAMLS+PATKGFEIGSGF GTT+ G +HNDP+V    N RL TKTNNSGGT
Sbjct: 235 FDKLEATLAHAMLSLPATKGFEIGSGFHGTTIPGSKHNDPFVFDELNKRLKTKTNNSGGT 294

Query: 298 QGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMA 357
           QGGI+NGENIYF VAFK  ATISQEQ+T+TY+G  GVLAARGRHDP V PRAVPIVE+M 
Sbjct: 295 QGGISNGENIYFSVAFKSAATISQEQQTSTYDGKSGVLAARGRHDPSVTPRAVPIVEAMT 354

Query: 358 ALVIMDALMIQQSRKTVASLL 378
           ALV++D L+IQ+SR+   S++
Sbjct: 355 ALVLVDQLLIQKSREYGRSIV 375



>gi|146416259|ref|XP_001484099.1| conserved hypothetical protein [Meyerozyma guilliermondii ATCC
           6260]
          Length = 379

 Score =  545 bits (1403), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 264/381 (69%), Positives = 314/381 (82%), Gaps = 9/381 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG +FRVTT+GESH KSVGCIVDGCPPGL L E+DIQ QL RRRPGQS L+TPR+EK
Sbjct: 1   MSTFGKIFRVTTYGESHCKSVGCIVDGCPPGLKLSESDIQPQLSRRRPGQSKLSTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D+V IQSGTE+GITLG+PIG+LV N+D RP+DYSETDLYPRPSHADWTY+QKY  K++SG
Sbjct: 61  DQVHIQSGTENGITLGSPIGMLVLNEDHRPNDYSETDLYPRPSHADWTYIQKYGAKSASG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGR+SARETIGRVAAGAIAEK L L +GVEIVAFVSS+ ++AM      D       F +
Sbjct: 121 GGRSSARETIGRVAAGAIAEKVLSLANGVEIVAFVSSIGSVAM------DRNPLDPTFQK 174

Query: 181 LLNTIRREEVDK-DAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           +L+TI REEVD    +RCPD +V ++M + I + ++A+DS+GG +TCV+RN P+GLGEPC
Sbjct: 175 ILSTITREEVDGVGPIRCPDASVREQMVKEIEKYRDAQDSIGGVVTCVVRNCPIGLGEPC 234

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLK--NDRLGTKTNNSGGT 297
           FDKLEA  AHAMLS+PATKGFEIGSGF GTT+ G +HNDP+V    N RL TKTNNSGGT
Sbjct: 235 FDKLEATLAHAMLSLPATKGFEIGSGFHGTTIPGSKHNDPFVFDELNKRLKTKTNNSGGT 294

Query: 298 QGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMA 357
           QGGI+NGENIYF VAFK  ATISQEQ+T TY+G  GVLAARGRHDP V PRAVPIVE+M 
Sbjct: 295 QGGISNGENIYFSVAFKSAATISQEQQTLTYDGKSGVLAARGRHDPSVTPRAVPIVEAMT 354

Query: 358 ALVIMDALMIQQSRKTVASLL 378
           ALV++D L+IQ+SR+   S++
Sbjct: 355 ALVLVDQLLIQKSREYGRSIV 375



>gi|260947470|ref|XP_002618032.1| conserved hypothetical protein [Clavispora lusitaniae ATCC 42720]
 gi|238847904|gb|EEQ37368.1| conserved hypothetical protein [Clavispora lusitaniae ATCC 42720]
          Length = 376

 Score =  544 bits (1401), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 267/381 (70%), Positives = 313/381 (82%), Gaps = 9/381 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG++FRVTT+GESH KSVGCIVDGCPPGL L EADIQ QL RRRPGQS L+TPR+EK
Sbjct: 1   MSTFGSVFRVTTYGESHCKSVGCIVDGCPPGLELTEADIQPQLSRRRPGQSALSTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D+V IQSGTE G TLG+PIG++V NQD RP DYSETDLYPRPSHADWTY+QKY +K++SG
Sbjct: 61  DQVQIQSGTEHGKTLGSPIGMMVMNQDHRPGDYSETDLYPRPSHADWTYMQKYGVKSASG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGR+SARETIGRVAAGAIAEK LK  + VEIVAFVSS+  ++M   N QD +     F +
Sbjct: 121 GGRSSARETIGRVAAGAIAEKILKKANNVEIVAFVSSIGEVSMDR-NPQDAK-----FQQ 174

Query: 181 LLNTIRREEVDK-DAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           LLNTI REEVD    +RCPD  V ++M + I + ++AKDS+GG +TCVIRN PVGLGEPC
Sbjct: 175 LLNTITREEVDSVGPIRCPDPEVREQMVKVIEKYRDAKDSIGGVVTCVIRNCPVGLGEPC 234

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL--KNDRLGTKTNNSGGT 297
           FDKLEA  AHAM+S+PATKGFE GSGF GT + G +HNDP+    ++ RL TKTNNSGG 
Sbjct: 235 FDKLEATLAHAMMSLPATKGFEFGSGFAGTRIPGSKHNDPFYFSEEDQRLRTKTNNSGGV 294

Query: 298 QGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMA 357
           QGGI+NGENIYF VAFK  ATISQEQET+TY+G DGVLAARGRHDP V PRAVPIVESMA
Sbjct: 295 QGGISNGENIYFSVAFKSAATISQEQETSTYDGKDGVLAARGRHDPSVTPRAVPIVESMA 354

Query: 358 ALVIMDALMIQQSRKTVASLL 378
           ALV++D L+IQ+SR+   S++
Sbjct: 355 ALVLVDQLLIQKSREYGKSIV 375



>gi|296423946|ref|XP_002841513.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295637753|emb|CAZ85704.1| unnamed protein product [Tuber melanosporum]
          Length = 433

 Score =  543 bits (1399), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 269/387 (69%), Positives = 308/387 (79%), Gaps = 8/387 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG+ FRVTT+GESH +SVGCIVDG PPG+ L EADIQ QL RRRPGQS LTTPR+EK
Sbjct: 1   MSTFGSQFRVTTYGESHCRSVGCIVDGVPPGMPLSEADIQTQLSRRRPGQSALTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V IQSGTE G TLGTPIGL+V NQDQRPHDYSE DLYPRPSHAD+TYL KY +KASSG
Sbjct: 61  DNVQIQSGTEFGYTLGTPIGLMVQNQDQRPHDYSEMDLYPRPSHADFTYLMKYGVKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGR+SARETIGRVAAGAIAEKYL L + +EIVAFVSSV  I +P   +         +  
Sbjct: 121 GGRSSARETIGRVAAGAIAEKYLGLAYKIEIVAFVSSVGPIHIPGSLDHTS----PQYIA 176

Query: 181 LLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
            L+ + RE+VD    VRCP    +DKM + I E ++  DS+GGT+TC+I+NVP+GLGEPC
Sbjct: 177 FLSGLTREKVDTFLPVRCPHTESNDKMAKLIAEYRDKSDSIGGTVTCIIKNVPIGLGEPC 236

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLK---NDRLGTKTNNSGG 296
           FDKLEAK AHAMLSIPATKGFE+GSGFKGT + G  HNDP+      N RLGT TNNSGG
Sbjct: 237 FDKLEAKLAHAMLSIPATKGFEVGSGFKGTEMPGSIHNDPFASAPDTNGRLGTTTNNSGG 296

Query: 297 TQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESM 356
            QGGI+NGENIYF+VAFK PATI  +Q T+ Y+G  GVLAA+GRHDPCVVPRAVPIVE+M
Sbjct: 297 IQGGISNGENIYFKVAFKSPATIGIDQPTSKYDGTSGVLAAKGRHDPCVVPRAVPIVEAM 356

Query: 357 AALVIMDALMIQQSRKTVASLLPPNPN 383
           AALVIMDA++IQQ R+T  SLLPP P 
Sbjct: 357 AALVIMDAVLIQQQRETSRSLLPPMPQ 383



>gi|448090895|ref|XP_004197185.1| Piso0_004425 [Millerozyma farinosa CBS 7064]
 gi|448095330|ref|XP_004198216.1| Piso0_004425 [Millerozyma farinosa CBS 7064]
 gi|359378607|emb|CCE84866.1| Piso0_004425 [Millerozyma farinosa CBS 7064]
 gi|359379638|emb|CCE83835.1| Piso0_004425 [Millerozyma farinosa CBS 7064]
          Length = 376

 Score =  542 bits (1397), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 263/381 (69%), Positives = 312/381 (81%), Gaps = 9/381 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG +FRV+T+GESH KSVGCIVDGCPPGL+L E DIQ QL RRRPGQS+++TPR+EK
Sbjct: 1   MSTFGRIFRVSTYGESHCKSVGCIVDGCPPGLNLTEDDIQPQLSRRRPGQSSISTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           DKV IQSGTE+G+TLGTPIG+LV N+D RP DYSETDLYPRPSHADWTY+QKY +KASSG
Sbjct: 61  DKVQIQSGTENGVTLGTPIGMLVLNEDHRPKDYSETDLYPRPSHADWTYMQKYGVKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGR+SARETIGRVAAGAIAEK LK  + VEIVAFVSS+  I M      D     + F E
Sbjct: 121 GGRSSARETIGRVAAGAIAEKVLKKANNVEIVAFVSSIGEIEM------DRNPRSDKFQE 174

Query: 181 LLNTIRREEVDK-DAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           +L T+ +E VD    VRCPD TV D+M + I + +++KDS+GG +TCV+RN P+GLGEPC
Sbjct: 175 ILQTVTKESVDSVGPVRCPDPTVRDEMVKLIEKYRDSKDSIGGVVTCVVRNCPIGLGEPC 234

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL--KNDRLGTKTNNSGGT 297
           FDKLEA  AHAMLS+PATKGFE GSGF GT + G +HNDP++   +N RL T+TNNSGG 
Sbjct: 235 FDKLEANLAHAMLSLPATKGFEFGSGFLGTKIPGSKHNDPFIFDEQNKRLRTRTNNSGGV 294

Query: 298 QGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMA 357
           QGGI+NGENIYF VAFK  ATISQ QETATY+G DGVLAARGRHDP V PRAVPIVE+MA
Sbjct: 295 QGGISNGENIYFSVAFKSAATISQAQETATYDGNDGVLAARGRHDPSVTPRAVPIVEAMA 354

Query: 358 ALVIMDALMIQQSRKTVASLL 378
           ALVI+D L++Q++R+  AS++
Sbjct: 355 ALVIVDNLLLQKAREYGASIV 375



>gi|389742142|gb|EIM83329.1| chorismate synthase [Stereum hirsutum FP-91666 SS1]
          Length = 407

 Score =  541 bits (1395), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 269/405 (66%), Positives = 311/405 (76%), Gaps = 28/405 (6%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFGTLFRVTT+GESH  SVG I+DGCPPGL L   DIQ+QL RRRPGQSNLTTPRDEK
Sbjct: 1   MSTFGTLFRVTTYGESHCASVGAIIDGCPPGLELSAKDIQVQLSRRRPGQSNLTTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V +QSG E GITLGTPIGLLV N+DQRPHDYSETDLYPRPSHAD+TYL+KY +KASSG
Sbjct: 61  DLVHLQSGLEHGITLGTPIGLLVKNEDQRPHDYSETDLYPRPSHADYTYLEKYGVKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFI---------NEQDE 171
           GGR+SARETIGRVAAGAIAE+YL   +G+EIVAFVSSV  I +P           NE   
Sbjct: 121 GGRSSARETIGRVAAGAIAERYLSQAYGIEIVAFVSSVGKIHLPSSVSAPSAQGGNESTS 180

Query: 172 -------------RLFPEDFWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKD 218
                         L PE F +LL ++ R EVD  + RCP +  S++M +RI  AK++ D
Sbjct: 181 ADGEDNDNDDTEDALSPE-FVKLLKSVTRAEVDMFSTRCPHEETSERMIKRIIRAKDSSD 239

Query: 219 SVGGTITCVIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHND 278
           S+GGT+TC+IRN P GLGEP FDK EAK AHAMLSIPATK FEIGSGF+GT + G +HND
Sbjct: 240 SIGGTVTCIIRNAPTGLGEPVFDKFEAKLAHAMLSIPATKAFEIGSGFRGTEVPGSRHND 299

Query: 279 PWVLKND-----RLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDG 333
            +VLK++     +LGTKTN SGG QGGITNGE+IYFR+ FK PATISQ Q TA Y+G  G
Sbjct: 300 AFVLKDEKDGKGKLGTKTNWSGGVQGGITNGEDIYFRIGFKSPATISQAQPTAQYDGTSG 359

Query: 334 VLAARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLL 378
            LAARGRHDPCVVPRAVPIVE+MAALV+MD +M+Q+SRK +   L
Sbjct: 360 SLAARGRHDPCVVPRAVPIVEAMAALVVMDMMMMQESRKAMGGRL 404



>gi|154315776|ref|XP_001557210.1| hypothetical protein BC1G_04460 [Botryotinia fuckeliana B05.10]
          Length = 443

 Score =  535 bits (1379), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 272/413 (65%), Positives = 311/413 (75%), Gaps = 21/413 (5%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  F+VTT+GESH +SVGCIVDG PPG+ L EADIQ Q+ RRRPGQS LTTPRDEK
Sbjct: 1   MSTFGQYFKVTTYGESHCRSVGCIVDGVPPGMELTEADIQPQMTRRRPGQSALTTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           DKV IQSGTE GITLGTPIG++V NQDQRPHDY     DLYPRPSHADWTYL+KY +KAS
Sbjct: 61  DKVEIQSGTEFGITLGTPIGMIVRNQDQRPHDYGNKTMDLYPRPSHADWTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM-PFINEQDERLFPED 177
           SGGGR+SARETIGRVAA AIAEKYL+L HG+EIVAFVSSV +  M P   E         
Sbjct: 121 SGGGRSSARETIGRVAASAIAEKYLRLAHGIEIVAFVSSVGSTHMFPPTAEHPSPSTNPA 180

Query: 178 FWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           F  L+  + RE VD+   VRCPD   S+KM E I E ++ +DS+GGT+TCVIRNVP GLG
Sbjct: 181 FLSLIQDVTRERVDEFVPVRCPDAKASEKMAEIIAEYRDKQDSIGGTVTCVIRNVPSGLG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND----------- 285
           EPCFDK+EA  AHAMLSIPA+KGFEIGSGF G  + G +HNDP++L  +           
Sbjct: 241 EPCFDKMEAMLAHAMLSIPASKGFEIGSGFGGCEVPGSKHNDPFILATEVPPLETGASKN 300

Query: 286 -----RLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGV-DGVLAARG 339
                +L TKTNNS G QGGITNG  IYFRVAFKP ATI Q QETATY+G   G+L A+G
Sbjct: 301 GIPRPKLTTKTNNSAGIQGGITNGAPIYFRVAFKPAATIGQAQETATYDGSGSGILEAKG 360

Query: 340 RHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAMSGVI 392
           RHDPCVVPRAVPIVE+MAAL ++DALM QQ+R+T  SLLPP  NI  A   V+
Sbjct: 361 RHDPCVVPRAVPIVEAMAALTVIDALMAQQARQTSRSLLPPLKNIVPAKYTVV 413



>gi|340975947|gb|EGS23062.1| chorismate synthase-like protein [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 427

 Score =  535 bits (1378), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 275/416 (66%), Positives = 318/416 (76%), Gaps = 31/416 (7%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT+GESH +SVGCIVDGCPPG+ L EADIQ Q++RRRPGQS++TTPR+EK
Sbjct: 1   MSTFGEYFRVTTYGESHCRSVGCIVDGCPPGMELTEADIQPQMNRRRPGQSSITTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE G+TLGTPIG++V N+DQRP DY     D YPRPSHADWTYL+KY +KAS
Sbjct: 61  DRVMIQSGTEFGVTLGTPIGMMVLNEDQRPKDYGNQTMDKYPRPSHADWTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM-PFINEQDERLFPED 177
           SGGGR+SARETIGRVAAGAIAEKYL+L +G+EIVAFVSSV N+ + P   E        +
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLRLAYGIEIVAFVSSVGNVHLFPPTAEHPTPCTNPE 180

Query: 178 FWELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           F +LL TI R+ VD+   VRCP++ VS KM + I   K+  DS+GGT+TCVIRN P GLG
Sbjct: 181 FQKLLQTISRKTVDEYLPVRCPNEEVSRKMEDLIASFKQRSDSIGGTVTCVIRNCPSGLG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND----------- 285
           EPCFDKLEAK AHAMLSIPATKGFEIGSGF G  + G  HNDP+V KND           
Sbjct: 241 EPCFDKLEAKLAHAMLSIPATKGFEIGSGFGGCEIPGSTHNDPFV-KNDSELPEVVAQSG 299

Query: 286 ---------RLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNG-VDGVL 335
                    RL TKTN SGG QGGI+NG  IYFRVAFKPPATI QEQ TATY+G  +G+L
Sbjct: 300 AARGGFPRPRLTTKTNYSGGIQGGISNGAPIYFRVAFKPPATIGQEQLTATYDGEEEGIL 359

Query: 336 AARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPP-----NPNIPA 386
           AA+GRHDPCVVPRAVPIVE+MAALVIMDA++ QQ+R T  SLLPP     N  +PA
Sbjct: 360 AAKGRHDPCVVPRAVPIVEAMAALVIMDAVLAQQARHTAKSLLPPLKQTINSGLPA 415



>gi|254568902|ref|XP_002491561.1| Bifunctional chorismate synthase and flavin reductase [Komagataella
           pastoris GS115]
 gi|238031358|emb|CAY69281.1| Bifunctional chorismate synthase and flavin reductase [Komagataella
           pastoris GS115]
 gi|328351931|emb|CCA38330.1| chorismate synthase [Komagataella pastoris CBS 7435]
          Length = 374

 Score =  535 bits (1378), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 262/379 (69%), Positives = 312/379 (82%), Gaps = 7/379 (1%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FG +FRVTT+GESH KSVGCIVDG PP +SL E DIQ QL RRRPGQS LTTPRDEK
Sbjct: 1   MSSFGQVFRVTTYGESHCKSVGCIVDGVPPNMSLTEEDIQPQLTRRRPGQSKLTTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D+V IQSGTE+G TLGTPIG++V N+DQRP DY ETD+YPRPSHAD+TYLQKY IKASSG
Sbjct: 61  DRVEIQSGTENGKTLGTPIGMIVRNEDQRPKDYKETDVYPRPSHADYTYLQKYGIKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGR+SARETIGRVAAGA+AEK+LK ++ VEIVAFVS+V +++   IN       PE F  
Sbjct: 121 GGRSSARETIGRVAAGAVAEKFLKQLNNVEIVAFVSAVGDVS---INRNPTN--PE-FQN 174

Query: 181 LLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           LL TI RE VD +  +RCP ++V D+M E +   K  +DS+GG +TCVIRN P+GLGEP 
Sbjct: 175 LLQTITRETVDANQPMRCPVESVRDQMAEIVTNFKHKQDSIGGVVTCVIRNCPIGLGEPA 234

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKNDRLGTKTNNSGGTQG 299
           FDKLEA  AHAMLSIPATKGFEIGSGF+GT + G QHNDP+ +++ +  T+TNNSGG QG
Sbjct: 235 FDKLEALLAHAMLSIPATKGFEIGSGFEGTRIPGSQHNDPFYVEDGKFKTRTNNSGGIQG 294

Query: 300 GITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAAL 359
           GI+NGENIYF VAFKPPATISQEQ+TA+Y GVDGVLAA+GRHDP V PRAVPIVE+MAAL
Sbjct: 295 GISNGENIYFSVAFKPPATISQEQQTASYEGVDGVLAAKGRHDPNVTPRAVPIVEAMAAL 354

Query: 360 VIMDALMIQQSRKTVASLL 378
           V+ DA++IQ+SR+   S++
Sbjct: 355 VLADAVLIQKSREFALSVV 373



>gi|347842001|emb|CCD56573.1| similar to chorismate synthase [Botryotinia fuckeliana T4]
 gi|472244289|gb|EMR88907.1| putative chorismate synthase protein [Botryotinia fuckeliana BcDW1]
          Length = 442

 Score =  534 bits (1376), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 272/413 (65%), Positives = 311/413 (75%), Gaps = 21/413 (5%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  F+VTT+GESH +SVGCIVDG PPG+ L EADIQ Q+ RRRPGQS LTTPRDEK
Sbjct: 1   MSTFGQYFKVTTYGESHCRSVGCIVDGVPPGMELTEADIQPQMTRRRPGQSALTTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           DKV IQSGTE GITLGTPIG++V NQDQRPHDY     DLYPRPSHADWTYL+KY +KAS
Sbjct: 61  DKVEIQSGTEFGITLGTPIGMIVRNQDQRPHDYGNKTMDLYPRPSHADWTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM-PFINEQDERLFPED 177
           SGGGR+SARETIGRVAA AIAEKYL+L HG+EIVAFVSSV +  M P   E         
Sbjct: 121 SGGGRSSARETIGRVAASAIAEKYLRLAHGIEIVAFVSSVGSTHMFPPTAEHPSPSTNPA 180

Query: 178 FWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           F  L+  + RE VD+   VRCPD   S+KM E I E ++ +DS+GGT+TCVIRNVP GLG
Sbjct: 181 FLSLIQDVTRERVDEFVPVRCPDAKASEKMAEIIAEYRDKQDSIGGTVTCVIRNVPSGLG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND----------- 285
           EPCFDK+EA  AHAMLSIPA+KGFEIGSGF G  + G +HNDP++L  +           
Sbjct: 241 EPCFDKMEAMLAHAMLSIPASKGFEIGSGFGGCEVPGSKHNDPFILATEVPPLETGASKN 300

Query: 286 -----RLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGV-DGVLAARG 339
                +L TKTNNS G QGGITNG  IYFRVAFKP ATI Q QETATY+G   G+L A+G
Sbjct: 301 GIPRPKLTTKTNNSAGIQGGITNGAPIYFRVAFKPAATIGQAQETATYDGSGSGILEAKG 360

Query: 340 RHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAMSGVI 392
           RHDPCVVPRAVPIVE+MAAL ++DALM QQ+R+T  SLLPP  NI  A   V+
Sbjct: 361 RHDPCVVPRAVPIVEAMAALTVIDALMAQQARQTSRSLLPPLKNIVPAKYTVV 413



>gi|156059748|ref|XP_001595797.1| hypothetical protein SS1G_03887 [Sclerotinia sclerotiorum 1980]
 gi|154701673|gb|EDO01412.1| hypothetical protein SS1G_03887 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 442

 Score =  533 bits (1374), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 274/413 (66%), Positives = 310/413 (75%), Gaps = 21/413 (5%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  F+VTT+GESH +SVGCIVDG PPG+ L EADIQ Q+ RRRPGQS LTTPRDEK
Sbjct: 1   MSTFGQYFKVTTYGESHCRSVGCIVDGVPPGMELTEADIQPQMTRRRPGQSALTTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           DKV IQSGTE GITLGTPIG++V NQDQRPHDY     DLYPRPSHADWTYL+KY +KAS
Sbjct: 61  DKVEIQSGTEFGITLGTPIGMIVRNQDQRPHDYGNKTMDLYPRPSHADWTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM-PFINEQDERLFPED 177
           SGGGR+SARETIGRVAA AIAEKYLKL HG+EIVAFVSSV +  M P   E         
Sbjct: 121 SGGGRSSARETIGRVAASAIAEKYLKLAHGIEIVAFVSSVGSTHMFPPTAEHPSPSTNPA 180

Query: 178 FWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           F  L+  I RE VD+   VRCPD   S+KM E I E ++ +DS+GGT+TCVIRNVP GLG
Sbjct: 181 FLSLIQDITRERVDEFVPVRCPDIKASEKMAEVIAEYRDKQDSIGGTVTCVIRNVPSGLG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND----------- 285
           EPCFDK+EA  AHAMLSIPA+KGFEIGSGF G  + G +HND ++L  +           
Sbjct: 241 EPCFDKMEAMLAHAMLSIPASKGFEIGSGFGGCEVPGSKHNDAFILATEVPPLETGASKN 300

Query: 286 -----RLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVD-GVLAARG 339
                RL TKTNNS G QGGITNG  IYFRVAFKP ATI Q QETATY+G   G+L A+G
Sbjct: 301 GIPRPRLTTKTNNSAGIQGGITNGAPIYFRVAFKPAATIGQPQETATYDGTGAGILEAKG 360

Query: 340 RHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAMSGVI 392
           RHDPCVVPRAVPIVE+MAAL ++DALM QQ+R+T  SLLPP  NI  A   V+
Sbjct: 361 RHDPCVVPRAVPIVEAMAALTVIDALMAQQARQTSRSLLPPLKNIVPAKYTVV 413



>gi|303316654|ref|XP_003068329.1| chorismate synthase, putative [Coccidioides posadasii C735 delta
           SOWgp]
 gi|240108010|gb|EER26184.1| chorismate synthase, putative [Coccidioides posadasii C735 delta
           SOWgp]
 gi|320038133|gb|EFW20069.1| chorismate synthase [Coccidioides posadasii str. Silveira]
          Length = 415

 Score =  533 bits (1373), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 271/425 (63%), Positives = 319/425 (75%), Gaps = 37/425 (8%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT+GESH +SVGCIVDGCPPG+ L E DIQ Q+ RRRPGQS LTTPR+EK
Sbjct: 1   MSTFGEYFRVTTYGESHCRSVGCIVDGCPPGMELTEEDIQPQMTRRRPGQSALTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           DKV IQSGTE GITLGTPIG++V N+DQRP DY     D+YPRPSHAD+TYL+KY +KAS
Sbjct: 61  DKVEIQSGTEFGITLGTPIGMVVRNEDQRPKDYGGKTMDIYPRPSHADFTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPE-- 176
           SGGGR+SARETIGRVAAGAIAEKYL+L HGVEIVAFVSSV N          E LFP   
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLRLSHGVEIVAFVSSVGN----------EHLFPSTP 170

Query: 177 ---------DFWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITC 226
                    +F +L+ TI RE VD    +RCP+   + +M + I + ++ +DS+GGT+TC
Sbjct: 171 ESPSASTNPEFLKLVETIDRERVDSFVPIRCPNTEAAQRMTKIIEDFRDRQDSIGGTVTC 230

Query: 227 VIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND- 285
           VIRNVPVGLGEPCFDKLEAK AHAMLSIPATKGFEIGSGF G  + G  HNDP+V+  + 
Sbjct: 231 VIRNVPVGLGEPCFDKLEAKLAHAMLSIPATKGFEIGSGFAGCEVPGSIHNDPFVVTTEE 290

Query: 286 -----------RLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGV 334
                      RL TKTNNSGG QGGI+NG +IYFRVAFKPPATI Q Q TA+Y   +G+
Sbjct: 291 VKSGNGTTSTKRLTTKTNNSGGIQGGISNGASIYFRVAFKPPATIGQAQTTASYGFEEGI 350

Query: 335 LAARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNP-NIPAAMSGVIP 393
           L A+GRHDPCVVPRAVPIVESMAALVI+DALM Q +R+T  +LLP  P  +P   +G+ P
Sbjct: 351 LEAKGRHDPCVVPRAVPIVESMAALVIIDALMAQNARETAKNLLPRLPKTVPTHPTGIQP 410

Query: 394 KLSET 398
           +  ++
Sbjct: 411 QSQQS 415



>gi|119187965|ref|XP_001244589.1| hypothetical protein CIMG_04030 [Coccidioides immitis RS]
 gi|392871305|gb|EAS33198.2| chorismate synthase [Coccidioides immitis RS]
          Length = 415

 Score =  533 bits (1372), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 271/421 (64%), Positives = 317/421 (75%), Gaps = 37/421 (8%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT+GESH +SVGCIVDGCPPG+ L E DIQ Q+ RRRPGQS LTTPR+EK
Sbjct: 1   MSTFGEYFRVTTYGESHCRSVGCIVDGCPPGMELTEEDIQPQMTRRRPGQSALTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           DKV IQSGTE GITLGTPIG++V N+DQRP DY     D+YPRPSHAD+TYL+KY +KAS
Sbjct: 61  DKVEIQSGTEFGITLGTPIGMVVRNEDQRPKDYGGKTMDIYPRPSHADFTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPE-- 176
           SGGGR+SARETIGRVAAGAIAEKYL+L HGVEIVAFVSSV N          E LFP   
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLRLSHGVEIVAFVSSVGN----------EHLFPSTP 170

Query: 177 ---------DFWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITC 226
                    +F +L+ TI RE VD    +RCP+   + +M + I + ++ +DS+GGT+TC
Sbjct: 171 ESPSASTNPEFLKLVETIDRETVDSFVPIRCPNTEAAQRMTKIIEDFRDRQDSIGGTVTC 230

Query: 227 VIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND- 285
           VIRNVPVGLGEPCFDKLEAK AHAMLSIPATKGFEIGSGF G  + G  HNDP+V+  + 
Sbjct: 231 VIRNVPVGLGEPCFDKLEAKLAHAMLSIPATKGFEIGSGFAGCEVPGSIHNDPFVVTTEE 290

Query: 286 -----------RLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGV 334
                      RL TKTNNSGG QGGI+NG +IYFRVAFKPPATI Q Q TA+Y   +G+
Sbjct: 291 VKSGNGTTSTKRLTTKTNNSGGIQGGISNGASIYFRVAFKPPATIGQAQTTASYGFEEGI 350

Query: 335 LAARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNP-NIPAAMSGVIP 393
           L A+GRHDPCVVPRAVPIVESMAALVI+DALM Q +R+T  +LLP  P  +P   +G+ P
Sbjct: 351 LEAKGRHDPCVVPRAVPIVESMAALVIIDALMAQNARETAKNLLPRLPKTVPTHPTGIQP 410

Query: 394 K 394
           +
Sbjct: 411 Q 411



>gi|345563277|gb|EGX46280.1| hypothetical protein AOL_s00110g104 [Arthrobotrys oligospora ATCC
           24927]
          Length = 412

 Score =  532 bits (1370), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 267/382 (69%), Positives = 303/382 (79%), Gaps = 6/382 (1%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFGTLFRVTT+GESH KSVGCIVDG PPG+ L EADIQ Q+ RRRPGQS L+TPRDEK
Sbjct: 1   MSTFGTLFRVTTYGESHCKSVGCIVDGVPPGMELTEADIQPQMTRRRPGQSALSTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V IQSGTE G+TLGTPIG+LV N+DQRP DYSE D+YPRPSHADWTYLQKY +KA SG
Sbjct: 61  DLVQIQSGTEYGVTLGTPIGMLVRNEDQRPKDYSEMDIYPRPSHADWTYLQKYGVKARSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGR+SARETIGRVAAGAIAEKYL+L H +EIVAFVSSV  I + F  E      P  F  
Sbjct: 121 GGRSSARETIGRVAAGAIAEKYLRLSHNIEIVAFVSSVGPIHL-FDPEATPSSDPA-FQS 178

Query: 181 LLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           LL+TI RE+VD    VRCPD   S KM + I E ++ KDS+GGT+TCVIRNVP GLGEPC
Sbjct: 179 LLSTITREKVDSFLPVRCPDTVASGKMADLIAEYRDKKDSIGGTVTCVIRNVPAGLGEPC 238

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV---LKNDRLGTKTNNSGG 296
           FDK+EAK AHAMLSIPATKGFE+GSGFKGT + G +HND +V    K   L T TN SGG
Sbjct: 239 FDKIEAKLAHAMLSIPATKGFEVGSGFKGTEIPGSKHNDMFVPHPTKPLSLATATNYSGG 298

Query: 297 TQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESM 356
            QGGITNGENIYF+VAFK PATIS  Q+TA+Y G  G L A+GRHDP VVPRA+PIVE+M
Sbjct: 299 IQGGITNGENIYFKVAFKSPATISIAQQTASYTGEPGTLEAKGRHDPSVVPRAIPIVEAM 358

Query: 357 AALVIMDALMIQQSRKTVASLL 378
           AALV+MD ++ QQSR+    +L
Sbjct: 359 AALVVMDMVLQQQSREATREML 380



>gi|367035968|ref|XP_003667266.1| hypothetical protein MYCTH_2312913 [Myceliophthora thermophila ATCC
           42464]
 gi|347014539|gb|AEO62021.1| hypothetical protein MYCTH_2312913 [Myceliophthora thermophila ATCC
           42464]
          Length = 428

 Score =  531 bits (1369), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 268/405 (66%), Positives = 308/405 (76%), Gaps = 25/405 (6%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT+GESH +SVGCIVDGCPPG+ L E DIQ Q+ RRRPGQS +TTPR+EK
Sbjct: 1   MSTFGEYFRVTTYGESHCRSVGCIVDGCPPGMELTEDDIQPQMTRRRPGQSAITTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE G+TLGTPIG++V N+DQRP DY     D+YPRPSHADWTYL+KY +KAS
Sbjct: 61  DRVLIQSGTEFGVTLGTPIGMMVLNEDQRPKDYGNQTMDIYPRPSHADWTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM-PFINEQDERLFPED 177
           SGGGR+SARETIGRVAAGAIAEKYL+L +GVEIVAF SSV N+ + P   E        +
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLRLAYGVEIVAFTSSVGNVHLFPPTAEHPSPSTNPN 180

Query: 178 FWELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           F  LL T+ R+ VD    VRCPD+ VS KM E I E K+ +DS+GGTITCVIRN P GLG
Sbjct: 181 FLALLQTVDRKTVDSFLPVRCPDEAVSRKMEETIAEFKKREDSIGGTITCVIRNAPSGLG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV--------------- 281
           EPCFDKLEAK AHAMLSIPATKGFEIGSGF G  + G  HNDP++               
Sbjct: 241 EPCFDKLEAKLAHAMLSIPATKGFEIGSGFGGCEIPGSTHNDPFIPATNVELPSSVAESG 300

Query: 282 -----LKNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGV-DGVL 335
                    +L TKTN SGG QGGI+NG  IYFRVAFKPPATI Q Q TATY+G+ +GVL
Sbjct: 301 AAKSGFARPKLTTKTNYSGGIQGGISNGAPIYFRVAFKPPATIGQAQTTATYDGLSEGVL 360

Query: 336 AARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPP 380
           AA+GRHDPCVVPRAVPIVE+MAALV+MDA++ QQ+R T  SLLPP
Sbjct: 361 AAKGRHDPCVVPRAVPIVEAMAALVLMDAVLAQQARHTAKSLLPP 405



>gi|500252487|gb|EON96323.1| putative chorismate synthase protein [Togninia minima UCRPA7]
          Length = 425

 Score =  530 bits (1366), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 269/403 (66%), Positives = 308/403 (76%), Gaps = 23/403 (5%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT+GESH +SVGCIVDGCPPG+ L EADIQ Q+ RRRPGQSN+TTPR+EK
Sbjct: 1   MSTFGEYFRVTTYGESHCRSVGCIVDGCPPGMELTEADIQPQMTRRRPGQSNITTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSET--DLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE G+TLGTPIG++V N+DQRP DY     D+YPRPSHADWTYL+KY +KAS
Sbjct: 61  DRVLIQSGTEFGVTLGTPIGMMVMNEDQRPKDYGNATIDMYPRPSHADWTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM-PFINEQDERLFPED 177
           SGGGR+SARETIGRVAAGAIAEKYLKL +GVEI AFV+SV N+ M P   E         
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLKLAYGVEITAFVTSVGNVHMFPPTPEHPSPSTNPA 180

Query: 178 FWELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           F  LL T+ RE VD+   VRCPD+ +S KM + I E K+ +DS+GGT+TCVI+NVP GLG
Sbjct: 181 FLNLLQTVNRETVDQFLPVRCPDEEMSRKMEDCIGEFKKREDSIGGTVTCVIKNVPSGLG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV--------------- 281
           EPCFDKLEA  AHAMLSIPATKGFEIGSGF G  + G  HND ++               
Sbjct: 241 EPCFDKLEAMLAHAMLSIPATKGFEIGSGFGGCEVPGSIHNDAFIRAPEETAGAQQTGAA 300

Query: 282 ---LKNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNG-VDGVLAA 337
              L   RL TKTN SGG QGGI+NG  IYFRV FKPPATI Q Q TATY+G  +GVLAA
Sbjct: 301 RNGLHRPRLTTKTNYSGGIQGGISNGAPIYFRVGFKPPATIGQAQTTATYDGESEGVLAA 360

Query: 338 RGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPP 380
           +GRHDPCVVPRAVPIVE+MAALVIMDA++ QQ+R T  SLLPP
Sbjct: 361 KGRHDPCVVPRAVPIVEAMAALVIMDAVLAQQARHTAKSLLPP 403



>gi|328857342|gb|EGG06459.1| hypothetical protein MELLADRAFT_48454 [Melampsora larici-populina
           98AG31]
          Length = 407

 Score =  530 bits (1365), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 265/404 (65%), Positives = 302/404 (74%), Gaps = 17/404 (4%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFGTLFRV+T GESH   +  IVDG PPGL L E DIQ+QL RRRPGQ+NLTTPR+E 
Sbjct: 1   MSTFGTLFRVSTAGESHCSGITAIVDGVPPGLELNEEDIQVQLSRRRPGQNNLTTPRNES 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V IQSG E G+TLGTPI L VPN+DQRPHDYSETDLYPRPSHADWTYL KY IKASSG
Sbjct: 61  DLVKIQSGVEHGVTLGTPISLFVPNKDQRPHDYSETDLYPRPSHADWTYLLKYGIKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQ----------- 169
           GGR+SARETI RVAAGAIAEK+LKL +G+EIVAFVSSV  +   F  E            
Sbjct: 121 GGRSSARETIARVAAGAIAEKFLKLAYGIEIVAFVSSVGQVH--FTTESLKSQSSNGTPI 178

Query: 170 --DERLFPEDFWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCV 227
             DE     +F E L+T+ R +VDK  VRCP    S  M ERI +AK A DS+GGT+TCV
Sbjct: 179 AADEDWCGHEFTEYLSTVTRADVDKSLVRCPHLPSSALMEERILQAKAASDSIGGTVTCV 238

Query: 228 IRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPW--VLKND 285
           IRN P GLGEPCFDKLEAK AHA++SIPATKGFEIGSGFKG  + G  HND +       
Sbjct: 239 IRNCPTGLGEPCFDKLEAKLAHAIMSIPATKGFEIGSGFKGVEMSGSVHNDMFQKAPSGS 298

Query: 286 RLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCV 345
            L T TN SGG QGGI+NGEN+YFR AFK PATI+Q Q TATY G  GVLAA+GRHDPCV
Sbjct: 299 GLRTVTNRSGGIQGGISNGENVYFRCAFKSPATIAQAQSTATYAGEAGVLAAKGRHDPCV 358

Query: 346 VPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAMS 389
           VPRAV IVE+MAA+V+MDA++ Q +RK++A LLP    +P  M+
Sbjct: 359 VPRAVAIVEAMAAIVMMDAVLQQNARKSLAGLLPTPTKLPKTMT 402



>gi|378729261|gb|EHY55720.1| chorismate synthase [Exophiala dermatitidis NIH/UT8656]
          Length = 417

 Score =  530 bits (1364), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 268/411 (65%), Positives = 316/411 (76%), Gaps = 31/411 (7%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MST+G  FRVTT+GESH +SVGCIVDGCPPG+ L E DIQ Q+ RRRPGQS LTTPR+EK
Sbjct: 1   MSTWGKYFRVTTYGESHCRSVGCIVDGCPPGMHLTEQDIQPQMTRRRPGQSALTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE G+TLGTPIGL+V N+DQRP DY  +  DLYPRPSHAD+TYL+KY +KAS
Sbjct: 61  DRVEIQSGTEFGVTLGTPIGLIVRNEDQRPKDYGGNTMDLYPRPSHADFTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFP--- 175
           SGGGR+SARETIGRVAAGAIAEKYL L HGVEIVAFVSSV +          E LFP   
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLSLAHGVEIVAFVSSVGS----------EHLFPPTA 170

Query: 176 --------EDFWELLNTIRREEVDK-DAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITC 226
                    DF  LL+ I R+EVD    VRCPD    ++M + I + ++A+DS+GGT+TC
Sbjct: 171 QHPSPSTNPDFLALLSKITRKEVDSFIPVRCPDADAMERMTKVIEKFRDAQDSIGGTVTC 230

Query: 227 VIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL---- 282
           VIRN P+GLGEPCFDKLEA+ AHAMLSIPATKGFEIGSGF G  + G  HNDP+V     
Sbjct: 231 VIRNCPIGLGEPCFDKLEAELAHAMLSIPATKGFEIGSGFGGCEVPGSIHNDPFVAAPAD 290

Query: 283 --KNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGR 340
             +  +L TKTNNSGG QGGI+NG++IYFRVAFKPPATI Q Q TATY+  +GVL A+GR
Sbjct: 291 QSQKRKLTTKTNNSGGIQGGISNGQDIYFRVAFKPPATIGQAQHTATYDAEEGVLEAKGR 350

Query: 341 HDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPP-NPNIPAAMSG 390
           HDPCVVPRAVPIVE+M+ALV++DALM Q++R++  SLLPP    +P   SG
Sbjct: 351 HDPCVVPRAVPIVEAMSALVLIDALMAQKARESARSLLPPLKTTLPVKESG 401



>gi|327294489|ref|XP_003231940.1| chorismate synthase [Trichophyton rubrum CBS 118892]
 gi|326465885|gb|EGD91338.1| chorismate synthase [Trichophyton rubrum CBS 118892]
          Length = 407

 Score =  530 bits (1364), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 262/391 (67%), Positives = 311/391 (79%), Gaps = 8/391 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT+GESH +SVGCIVDGCPPG+ L EADIQ Q+ RRRPGQS LTTPR+EK
Sbjct: 1   MSTFGEYFRVTTYGESHCRSVGCIVDGCPPGMELTEADIQPQMTRRRPGQSALTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE GITLGTPIG++V N+DQRP DY  S  D+YPRPSHAD+TYL+KY +KAS
Sbjct: 61  DRVEIQSGTEFGITLGTPIGMVVRNEDQRPKDYGNSTMDMYPRPSHADFTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM-PFINEQDERLFPED 177
           SGGGR+SARETIGRVAAGAIAEKYLKL H VEIV+FVSSV +  + P   E    +   +
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLKLSHNVEIVSFVSSVGHEHLFPPTPEHPSPVTNPE 180

Query: 178 FWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           F +L+ TI R+ VD  A +RCP    + +M + I   ++  DS+GGT+TC+IRNVPVGLG
Sbjct: 181 FLKLIETIDRKTVDSFAPIRCPQSEAAQRMTKLIEHHRDLSDSIGGTVTCIIRNVPVGLG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND----RLGTKTN 292
           EPCFDKLEAK AHAMLSIPATKGFEIGSGF G  + G  HNDP+V++ +    +L TKTN
Sbjct: 241 EPCFDKLEAKLAHAMLSIPATKGFEIGSGFLGCEVPGSTHNDPFVVETNGSGKKLTTKTN 300

Query: 293 NSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPI 352
           NSGG QGGI+NG +IYFRVAFKPPATI Q Q TA+Y+  +GVL A+GRHDPCVVPRAVPI
Sbjct: 301 NSGGIQGGISNGASIYFRVAFKPPATIGQAQTTASYSFEEGVLEAKGRHDPCVVPRAVPI 360

Query: 353 VESMAALVIMDALMIQQSRKTVASLLPPNPN 383
           VE+MAALV++DALM Q +R+   +LLPP P 
Sbjct: 361 VEAMAALVVIDALMAQNAREAAKNLLPPLPQ 391



>gi|240280144|gb|EER43648.1| chorismate synthase [Ajellomyces capsulatus H143]
 gi|325088864|gb|EGC42174.1| chorismate synthase [Ajellomyces capsulatus H88]
          Length = 407

 Score =  530 bits (1364), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 269/406 (66%), Positives = 309/406 (76%), Gaps = 34/406 (8%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT+GESH +SVGCIVDGCPPG++L E DIQ Q+ RRRPGQS LTTPR+EK
Sbjct: 1   MSTFGEYFRVTTYGESHCRSVGCIVDGCPPGMALTEEDIQPQMTRRRPGQSALTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           DKV IQSGTE GITLGTPIG++V N+DQRP DY  S  DLYPRPSHAD+TYL+KY +KAS
Sbjct: 61  DKVEIQSGTEFGITLGTPIGMVVRNEDQRPKDYGGSTMDLYPRPSHADFTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFP--- 175
           SGGGR+SARETIGRVAAGAIAEKYL L H +EIVAFVSSV N          E LFP   
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLNLSHNIEIVAFVSSVGN----------EHLFPPTA 170

Query: 176 --------EDFWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITC 226
                    +F +L+  I R  VD  A VRCP+K  +++M + I   ++  DS+GGT+TC
Sbjct: 171 AHPNPTTNPEFLKLIANIDRPTVDSFAPVRCPEKAAAERMTKVIEHFRDQSDSIGGTVTC 230

Query: 227 VIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND- 285
           VIRNVPVGLGEPCFDKLEAK AHAMLSIPATKGFEIGSGF G  + G  HNDP+V   D 
Sbjct: 231 VIRNVPVGLGEPCFDKLEAKLAHAMLSIPATKGFEIGSGFLGCEIPGSIHNDPFVATADN 290

Query: 286 ---------RLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLA 336
                    RL TKTNNSGG QGGI+NG +IYFRVAFKPPATI Q Q TA+Y+  +GVL 
Sbjct: 291 QNGQTPGQKRLTTKTNNSGGIQGGISNGASIYFRVAFKPPATIGQAQTTASYDFEEGVLE 350

Query: 337 ARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNP 382
           A+GRHDPCVVPRAVPIVESMA+LV++DALM Q +R+   +LLPP P
Sbjct: 351 AKGRHDPCVVPRAVPIVESMASLVVIDALMAQNAREAAKNLLPPLP 396



>gi|225683638|gb|EEH21922.1| chorismate synthase [Paracoccidioides brasiliensis Pb03]
          Length = 405

 Score =  529 bits (1363), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 270/406 (66%), Positives = 309/406 (76%), Gaps = 34/406 (8%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT+GESH +SVGCIVDGCPPG++L EADIQ Q+ RRRPGQS LTTPR+EK
Sbjct: 1   MSTFGEYFRVTTYGESHCRSVGCIVDGCPPGMALTEADIQPQMTRRRPGQSALTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE GITLGTPIG++V N+DQRP DY  S  DLYPRPSHAD+TYL+KY IKAS
Sbjct: 61  DRVEIQSGTEFGITLGTPIGMIVRNEDQRPKDYGGSTMDLYPRPSHADFTYLEKYGIKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFP--- 175
           SGGGR+SARETIGRVAAGAIAEKYL+L H ++IVAFVSSV N          E LFP   
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLRLSHDIDIVAFVSSVGN----------EHLFPPTA 170

Query: 176 --------EDFWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITC 226
                    +F +L+ TI R  VD  A VRCP+ + +++M   I   ++  DS+GGT+TC
Sbjct: 171 AHPNPTTNPEFLKLIETIDRPTVDSFAPVRCPEASAAERMTRVIENFRDQNDSIGGTVTC 230

Query: 227 VIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND- 285
           VIRNVPVGLGEPCFDKLEAK AHAMLSIPATKGFEIGSGF G  + G  HNDP+V   D 
Sbjct: 231 VIRNVPVGLGEPCFDKLEAKLAHAMLSIPATKGFEIGSGFLGCEIPGSVHNDPFVATPDT 290

Query: 286 ---------RLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLA 336
                    RL TKTNNSGG QGGI+NG +IYFRVAFKPPATI Q Q T  Y+  +GVL 
Sbjct: 291 RNGQNPDSKRLTTKTNNSGGIQGGISNGASIYFRVAFKPPATIGQAQTTTKYDFEEGVLE 350

Query: 337 ARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNP 382
           A+GRHDPCVVPRAVPIVE+MAALVI DALM Q +R+T  +LLPP P
Sbjct: 351 AKGRHDPCVVPRAVPIVEAMAALVITDALMAQNARETAKNLLPPLP 396



>gi|154278531|ref|XP_001540079.1| chorismate synthase [Ajellomyces capsulatus NAm1]
 gi|150413664|gb|EDN09047.1| chorismate synthase [Ajellomyces capsulatus NAm1]
          Length = 407

 Score =  529 bits (1362), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 269/406 (66%), Positives = 309/406 (76%), Gaps = 34/406 (8%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT+GESH +SVGCIVDGCPPG++L E DIQ Q+ RRRPGQS LTTPR+EK
Sbjct: 1   MSTFGEYFRVTTYGESHCRSVGCIVDGCPPGMALTEEDIQPQMTRRRPGQSALTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           DKV IQSGTE GITLGTPIG++V N+DQRP DY  S  DLYPRPSHAD+TYL+KY +KAS
Sbjct: 61  DKVEIQSGTEFGITLGTPIGMVVRNEDQRPKDYGGSTMDLYPRPSHADFTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFP--- 175
           SGGGR+SARETIGRVAAGAIAEKYL L H +EIVAFVSSV N          E LFP   
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLNLSHNIEIVAFVSSVGN----------EHLFPPTA 170

Query: 176 --------EDFWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITC 226
                    +F +L+  I R  VD  A VRCP+K  +++M + I   ++  DS+GGT+TC
Sbjct: 171 AHPNPTTNPEFLKLIANIDRPTVDSFAPVRCPEKAAAERMTKVIELFRDQSDSIGGTVTC 230

Query: 227 VIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND- 285
           VIRNVPVGLGEPCFDKLEAK AHAMLSIPATKGFEIGSGF G  + G  HNDP+V   D 
Sbjct: 231 VIRNVPVGLGEPCFDKLEAKLAHAMLSIPATKGFEIGSGFLGCEIPGSIHNDPFVATADN 290

Query: 286 ---------RLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLA 336
                    RL TKTNNSGG QGGI+NG +IYFRVAFKPPATI Q Q TA+Y+  +GVL 
Sbjct: 291 QNGQTPGQKRLTTKTNNSGGIQGGISNGASIYFRVAFKPPATIGQAQTTASYDFEEGVLE 350

Query: 337 ARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNP 382
           A+GRHDPCVVPRAVPIVESMA+LV++DALM Q +R+   +LLPP P
Sbjct: 351 AKGRHDPCVVPRAVPIVESMASLVVIDALMAQNAREAAKNLLPPLP 396



>gi|344303713|gb|EGW33962.1| hypothetical protein SPAPADRAFT_59373 [Spathaspora passalidarum
           NRRL Y-27907]
          Length = 378

 Score =  529 bits (1362), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 259/374 (69%), Positives = 302/374 (80%), Gaps = 9/374 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FGT+F+VTTFGESH  SVGCIV+GCPPGL+L E D+Q QL RRRPGQS L+TPR+EK
Sbjct: 1   MSSFGTIFKVTTFGESHCDSVGCIVEGCPPGLALTEDDVQPQLTRRRPGQSKLSTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D+V I SGTE G TLG+PIG+ V NQD RP DYSETDLYPRPSHADWTY+QKY +K++SG
Sbjct: 61  DQVKIHSGTEHGYTLGSPIGMSVKNQDHRPGDYSETDLYPRPSHADWTYIQKYGVKSASG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGR+SARETIGRVAAGA+AEK L  V+ VEIVAFVSS+ N++M   + QD     E F +
Sbjct: 121 GGRSSARETIGRVAAGAVAEKVLAKVNNVEIVAFVSSIGNVSMNR-DPQD-----ETFQK 174

Query: 181 LLNTIRREEVDK-DAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           +L T+ REEVD    +RCPD+ V ++M + I + ++AKDS+GG +TCV+RN P+GLGEPC
Sbjct: 175 VLQTVTREEVDGVGPIRCPDEGVREEMVKVIEKYRDAKDSIGGVVTCVVRNCPIGLGEPC 234

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDP--WVLKNDRLGTKTNNSGGT 297
           FDKLEAK AHAMLS+PATKGFE GSGF GT + G +HNDP  W     RL TKTNNSGG 
Sbjct: 235 FDKLEAKLAHAMLSLPATKGFEFGSGFAGTQIPGSKHNDPFVWDETKQRLTTKTNNSGGI 294

Query: 298 QGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMA 357
           QGGI+NGENIYF VAFK  ATISQEQETATY G  GVLAARGRHDP V PRAVPIVE+M 
Sbjct: 295 QGGISNGENIYFSVAFKSAATISQEQETATYEGKSGVLAARGRHDPSVTPRAVPIVEAMT 354

Query: 358 ALVIMDALMIQQSR 371
           ALV+ DA MIQQSR
Sbjct: 355 ALVLCDAYMIQQSR 368



>gi|326469813|gb|EGD93822.1| chorismate synthase [Trichophyton tonsurans CBS 112818]
 gi|326479036|gb|EGE03046.1| chorismate synthase [Trichophyton equinum CBS 127.97]
          Length = 410

 Score =  529 bits (1362), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 262/391 (67%), Positives = 311/391 (79%), Gaps = 8/391 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT+GESH +SVGCIVDGCPPG+ L EADIQ Q+ RRRPGQS LTTPR+EK
Sbjct: 1   MSTFGEHFRVTTYGESHCRSVGCIVDGCPPGMELTEADIQPQMTRRRPGQSALTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE GITLGTPIG++V N+DQRP DY  S  D+YPRPSHAD+TYL+KY +KAS
Sbjct: 61  DRVEIQSGTEFGITLGTPIGMVVRNEDQRPKDYGNSTMDMYPRPSHADFTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM-PFINEQDERLFPED 177
           SGGGR+SARETIGRVAAGAIAEKYLKL H VEIV+FVSSV +  + P   E    +   +
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLKLSHNVEIVSFVSSVGHEHLFPPTPEHPSPVTNPE 180

Query: 178 FWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           F +L+ TI R+ VD  A +RCP    + +M + I   ++  DS+GGT+TCVIRNVPVGLG
Sbjct: 181 FLKLIETIDRKTVDSFAPIRCPQAEAAQRMTKLIEHHRDLSDSIGGTVTCVIRNVPVGLG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND----RLGTKTN 292
           EPCFDKLEAK AHAMLSIPATKGFE+GSGF G  + G  HNDP+V++ +    +L TKTN
Sbjct: 241 EPCFDKLEAKLAHAMLSIPATKGFEVGSGFLGCEVPGSTHNDPFVVETNGSGKKLTTKTN 300

Query: 293 NSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPI 352
           NSGG QGGI+NG +IYFRVAFKPPATI Q Q TA+Y+  +GVL A+GRHDPCVVPRAVPI
Sbjct: 301 NSGGIQGGISNGASIYFRVAFKPPATIGQAQTTASYSFEEGVLEAKGRHDPCVVPRAVPI 360

Query: 353 VESMAALVIMDALMIQQSRKTVASLLPPNPN 383
           VE+MAALV++DALM Q +R+   +LLPP P 
Sbjct: 361 VEAMAALVVIDALMAQNAREAAKNLLPPLPQ 391



>gi|390603848|gb|EIN13239.1| chorismate synthase [Punctularia strigosozonata HHB-11173 SS5]
          Length = 413

 Score =  529 bits (1362), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 267/415 (64%), Positives = 317/415 (76%), Gaps = 20/415 (4%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG+ FRVTT+GESH  SVG I+DGCPPGL L + DIQ QL+RRRPGQS LTTPRDEK
Sbjct: 1   MSTFGSHFRVTTYGESHCASVGAIIDGCPPGLLLAQEDIQAQLNRRRPGQSALTTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V +QSG E G+TLGTPI LLV N+DQRPHDYSETDLYPRPSHAD+TYLQKY +KASSG
Sbjct: 61  DLVHLQSGVEHGVTLGTPIALLVKNEDQRPHDYSETDLYPRPSHADYTYLQKYGVKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPE---- 176
           GGR+SARETIGRVAAGAIAEKYLK V+G+EIVAFVSSV  I +P++        P     
Sbjct: 121 GGRSSARETIGRVAAGAIAEKYLKTVYGIEIVAFVSSVGKIHLPYVAAPPSNAVPADNDD 180

Query: 177 -------------DFWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGT 223
                        +F +LLNT+ R +VD+   RCP    +++M +RI  AK+A+DS+GGT
Sbjct: 181 ADHDDDAHDALSPEFVQLLNTVTRADVDRHPTRCPHPETAERMTKRILRAKDAQDSIGGT 240

Query: 224 ITCVIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLK 283
           +TCV+R  P GLGEP FDK EA+ A AMLSIPATKGFE+GSGF+GT + G +HND +V++
Sbjct: 241 VTCVVRRAPAGLGEPVFDKFEAQLARAMLSIPATKGFELGSGFRGTEVPGSRHNDAFVVR 300

Query: 284 ND-RLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHD 342
            D  LGT TN SGG QGGITNGE+IYFRV FK PATI+Q Q TA Y+G  G LAARGRHD
Sbjct: 301 PDGSLGTATNWSGGVQGGITNGEHIYFRVGFKSPATITQAQATAQYDGTPGTLAARGRHD 360

Query: 343 PCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAMSGVIPKLSE 397
           PCVVPRAVPIVE+MA+LV+MDAL+ Q +R   A+ LPP   +P  M  V+PK S+
Sbjct: 361 PCVVPRAVPIVEAMASLVVMDALLAQSARAAAAARLPPVTTLPPTM--VLPKRSQ 413



>gi|501753810|emb|CCG82619.1| Chorismate synthase [Taphrina deformans PYCC 5710]
          Length = 436

 Score =  528 bits (1360), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 261/400 (65%), Positives = 303/400 (75%), Gaps = 15/400 (3%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           S+FGT+F+VTT GESH +SV CIV+GCPPG++L E D+Q QL RRRPGQS+LTTPRDEKD
Sbjct: 6   SSFGTIFKVTTAGESHCRSVSCIVEGCPPGMALTEPDVQTQLSRRRPGQSHLTTPRDEKD 65

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYS--ETDLYPRPSHADWTYLQKYSIKASS 119
           KV I SGTE G+TLGTPI +LV NQDQRPHDYS   TD +PRPSHADWTYLQKY +KASS
Sbjct: 66  KVEIHSGTEFGVTLGTPIMMLVRNQDQRPHDYSANATDAFPRPSHADWTYLQKYGVKASS 125

Query: 120 GGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPED-- 177
           GGGR+SARETIGRVAAGAIAEKYL   +G+EIVAFVSSV  I +P    Q      +D  
Sbjct: 126 GGGRSSARETIGRVAAGAIAEKYLLEAYGIEIVAFVSSVGKIKVPSTGPQSTDELDDDVE 185

Query: 178 ------FWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNV 231
                 + ++LN I R  VD+  VRCP    + KM  RI  AK   DS+GGT+TCVIR+V
Sbjct: 186 SPISVEYLDMLNGITRASVDESLVRCPHPETATKMISRIERAKAKSDSIGGTVTCVIRHV 245

Query: 232 PVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKNDR----- 286
           P+GLGEPCFDK+EAK  HAMLSIP+TK FEIGSGF GT + G +HND +  K D      
Sbjct: 246 PIGLGEPCFDKMEAKLGHAMLSIPSTKSFEIGSGFAGTEVSGSRHNDAFGHKVDHRGETY 305

Query: 287 LGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVV 346
           LGT TNNSGG QGGITNGE+IYFRV FK PATI  EQ TATY+GV G LAA+GRHDPCVV
Sbjct: 306 LGTVTNNSGGVQGGITNGESIYFRVGFKSPATIGMEQSTATYDGVAGKLAAKGRHDPCVV 365

Query: 347 PRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNPNIPA 386
           PRAVPIVE+MAALV++D L++Q +R      LPP  N+ A
Sbjct: 366 PRAVPIVEAMAALVVIDQLLMQLARNESRKGLPPLKNVVA 405



>gi|315056511|ref|XP_003177630.1| chorismate synthase [Arthroderma gypseum CBS 118893]
 gi|311339476|gb|EFQ98678.1| chorismate synthase [Arthroderma gypseum CBS 118893]
          Length = 411

 Score =  528 bits (1360), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 264/391 (67%), Positives = 309/391 (79%), Gaps = 8/391 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT+GESH +SVGCIVDGCPPG+ L EADIQ Q+ RRRPGQS LTTPR+EK
Sbjct: 1   MSTFGEHFRVTTYGESHCRSVGCIVDGCPPGMELTEADIQPQMTRRRPGQSALTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           DKV IQSGTE GITLGTPIG++V N+DQRP DY  S  D+YPRPSHAD+TYL+KY +KAS
Sbjct: 61  DKVEIQSGTEFGITLGTPIGMVVRNEDQRPKDYGNSTMDMYPRPSHADFTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM-PFINEQDERLFPED 177
           SGGGR+SARETIGRVAAGAIAEKYLKL H VEIV+FVSSV +  + P   E        +
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLKLSHDVEIVSFVSSVGHEHLFPPTAEHPSPATNPE 180

Query: 178 FWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           F +L+  I R+ VD  A +RCP    + +M + I   ++  DS+GGT+TCVIRNVPVGLG
Sbjct: 181 FLKLIEKIDRKTVDSFAPIRCPQADAAHRMTKLIEHHRDLSDSIGGTVTCVIRNVPVGLG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND----RLGTKTN 292
           EPCFDKLEAK AHAMLSIPATKGFEIGSGF G  + G  HNDP+V++ +    +L TKTN
Sbjct: 241 EPCFDKLEAKLAHAMLSIPATKGFEIGSGFPGCEIPGSIHNDPFVVETNGNGKKLTTKTN 300

Query: 293 NSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPI 352
           NSGG QGGI+NG +IYFRVAFKPPATI Q Q TATY+  +G+L A+GRHDPCVVPRAVPI
Sbjct: 301 NSGGIQGGISNGASIYFRVAFKPPATIGQAQTTATYSFEEGILEAKGRHDPCVVPRAVPI 360

Query: 353 VESMAALVIMDALMIQQSRKTVASLLPPNPN 383
           VE+MAALVI+DALM Q +R+   +LLPP P 
Sbjct: 361 VEAMAALVIIDALMAQNAREAAKNLLPPLPQ 391



>gi|226292988|gb|EEH48408.1| chorismate synthase [Paracoccidioides brasiliensis Pb18]
          Length = 405

 Score =  528 bits (1360), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 269/406 (66%), Positives = 309/406 (76%), Gaps = 34/406 (8%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT+GESH +SVGCIVDGCPPG++L EADIQ Q+ RRRPGQS LTTPR+EK
Sbjct: 1   MSTFGEYFRVTTYGESHCRSVGCIVDGCPPGMALTEADIQPQMTRRRPGQSALTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE GITLGTPIG++V N+DQRP DY  S  DLYPRPSHAD+TYL+KY IKAS
Sbjct: 61  DRVEIQSGTEFGITLGTPIGMIVRNEDQRPKDYGGSTMDLYPRPSHADFTYLEKYGIKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFP--- 175
           SGGGR+SARETIGRVAAGAIAEKYL+L H ++IVAFVSSV N          E LFP   
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLRLSHDIDIVAFVSSVGN----------EHLFPPTA 170

Query: 176 --------EDFWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITC 226
                    +F +L+ TI R  VD  A VRCP+ + +++M   I   ++  DS+GGT++C
Sbjct: 171 AHPNPTTNPEFLKLIETIDRPTVDSFAPVRCPEASAAERMTRVIENFRDQNDSIGGTVSC 230

Query: 227 VIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND- 285
           VIRNVPVGLGEPCFDKLEAK AHAMLSIPATKGFEIGSGF G  + G  HNDP+V   D 
Sbjct: 231 VIRNVPVGLGEPCFDKLEAKLAHAMLSIPATKGFEIGSGFLGCEIPGSVHNDPFVATPDT 290

Query: 286 ---------RLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLA 336
                    RL TKTNNSGG QGGI+NG +IYFRVAFKPPATI Q Q T  Y+  +GVL 
Sbjct: 291 RNGQNPDSKRLTTKTNNSGGIQGGISNGASIYFRVAFKPPATIGQAQTTTKYDFEEGVLE 350

Query: 337 ARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNP 382
           A+GRHDPCVVPRAVPIVE+MAALVI DALM Q +R+T  +LLPP P
Sbjct: 351 AKGRHDPCVVPRAVPIVEAMAALVITDALMAQNARETAKNLLPPLP 396



>gi|389638094|ref|XP_003716680.1| chorismate synthase, variant [Magnaporthe oryzae 70-15]
 gi|389638096|ref|XP_003716681.1| chorismate synthase [Magnaporthe oryzae 70-15]
 gi|351642499|gb|EHA50361.1| chorismate synthase, variant [Magnaporthe oryzae 70-15]
 gi|351642500|gb|EHA50362.1| chorismate synthase [Magnaporthe oryzae 70-15]
 gi|440465220|gb|ELQ34560.1| chorismate synthase [Magnaporthe oryzae Y34]
 gi|440487643|gb|ELQ67421.1| chorismate synthase [Magnaporthe oryzae P131]
          Length = 424

 Score =  528 bits (1360), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 269/402 (66%), Positives = 306/402 (76%), Gaps = 22/402 (5%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFGT FRVTT+GESH +SVGCIVDGCPPG+ L EADIQ  ++RRRPGQS++TTPR+E+
Sbjct: 1   MSTFGTTFRVTTYGESHCRSVGCIVDGCPPGMQLTEADIQPHMNRRRPGQSDITTPRNEE 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           DKV IQSGTE GITLGTPIG+ V N+DQRP DY  S  D +PRPSHADWTYL+KY +KAS
Sbjct: 61  DKVEIQSGTEFGITLGTPIGMRVMNKDQRPKDYGNSTMDRFPRPSHADWTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSN-IAMPFINEQDERLFPED 177
           SGGGR+SARETIGRVAAGAIAEKYLKL +GVEIVAFVSSV N    P   E        +
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLKLAYGVEIVAFVSSVGNQFLFPPTAEHPTPCTNPE 180

Query: 178 FWELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           F  LL TI R++VD    VRCPD   S KMR+ I   K+  DS+GGT+ CVIRN P GLG
Sbjct: 181 FLSLLQTIDRKQVDSHLPVRCPDAEASAKMRDYIAGFKDRNDSIGGTVHCVIRNAPSGLG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND----------- 285
           EPCFDKLEAK  HAMLSIPATKGFEIGSGF G  L G  HNDP++   +           
Sbjct: 241 EPCFDKLEAKLGHAMLSIPATKGFEIGSGFAGCQLPGSIHNDPFIKAEEAATSAQNGAQH 300

Query: 286 ------RLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNG-VDGVLAAR 338
                 +L TKTN SGG QGGI+NG  IYF VAFKPPATI QEQ+TATY+G  +GVLAA+
Sbjct: 301 FGQSRPKLTTKTNFSGGIQGGISNGAPIYFSVAFKPPATIGQEQKTATYDGDSEGVLAAK 360

Query: 339 GRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPP 380
           GRHDPCVVPRAVPIVE+MAALV+MDA++ QQ+R T  SLLPP
Sbjct: 361 GRHDPCVVPRAVPIVEAMAALVLMDAVLTQQARHTAKSLLPP 402



>gi|485922963|gb|EOD48268.1| putative chorismate synthase protein [Neofusicoccum parvum UCRNP2]
          Length = 414

 Score =  527 bits (1358), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 263/389 (67%), Positives = 305/389 (78%), Gaps = 9/389 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFGT FRVTT+GESH  SVGCIVDGCPPG+ L EADIQ Q+ RRRPGQS +TTPR+EK
Sbjct: 1   MSTFGTHFRVTTYGESHCLSVGCIVDGCPPGMQLTEADIQPQMTRRRPGQSAITTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE G+TLGTPIG+ V N++QRP DY  S  DLYPRPSHADWTYL+KY +KAS
Sbjct: 61  DRVEIQSGTEFGVTLGTPIGMRVMNENQRPKDYGNSTMDLYPRPSHADWTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSN-IAMPFINEQDERLFPED 177
           SGGGR+SARETIGRVAAGAIAEKYL+  +GVEIVAF +S+ N    P   E        D
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLRQAYGVEIVAFTASIGNEFLFPPTPEHPTASTNPD 180

Query: 178 FWELLNTIRREEVDK-DAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           F +LL+ I RE VD    VRCP++  S++M++ +   ++ +DS+GGT++CVIRNVP GLG
Sbjct: 181 FLKLLDGIDRETVDSFIPVRCPNEEASERMKQLVERYRDRQDSIGGTVSCVIRNVPSGLG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV-----LKNDRLGTKT 291
           EPCFDKLEA  AHAMLSIPATKGFEIGSGF G  + G  HNDP+V         RL TKT
Sbjct: 241 EPCFDKLEATLAHAMLSIPATKGFEIGSGFGGCQVPGSVHNDPFVKAPGAAGRPRLTTKT 300

Query: 292 NNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVP 351
           NNSGG QGGITNG +IYF V FKPPATI Q Q+TATY   DGVL A+GRHDPCVVPRAVP
Sbjct: 301 NNSGGIQGGITNGAHIYFNVGFKPPATIGQAQQTATYGEEDGVLEAKGRHDPCVVPRAVP 360

Query: 352 IVESMAALVIMDALMIQQSRKTVASLLPP 380
           IVESMAALV+MDA++ QQ+R+T  SLLPP
Sbjct: 361 IVESMAALVLMDAVLAQQARQTARSLLPP 389



>gi|452984697|gb|EME84454.1| hypothetical protein MYCFIDRAFT_203028 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 415

 Score =  527 bits (1358), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 265/409 (64%), Positives = 311/409 (76%), Gaps = 12/409 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT+GESHGKSVGCIVDG PPGL L E DIQ Q+ RRRPGQS LTTPRDEK
Sbjct: 1   MSTFGQYFRVTTYGESHGKSVGCIVDGVPPGLELTEDDIQPQMTRRRPGQSALTTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE GITLGTPIGL V N+DQRP DY     D+YPRPSHADWTYL+KY +KAS
Sbjct: 61  DRVEIQSGTEKGITLGTPIGLRVMNEDQRPKDYGSKTMDMYPRPSHADWTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVS-NIAMPFINEQDERLFPED 177
           SGGGR+SARETIGRVA+ AIAEKYLK+ HGVEIVA+ +SV      P   E   +    D
Sbjct: 121 SGGGRSSARETIGRVASAAIAEKYLKIAHGVEIVAWTNSVGPEHLFPATREHPTQASNPD 180

Query: 178 FWELLNTIRREEVDK-DAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           F +L++++ RE VD+ + VRCP +  S +M + I E ++ +DS+GGT+TCVIRN P GLG
Sbjct: 181 FLKLIDSVTREYVDRFNPVRCPSEEASRRMGDLIAEYRDKQDSIGGTVTCVIRNTPSGLG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV--------LKNDRLG 288
           EPCFDKLEAK AHAMLSIPATKGFEIGSGF G  + G  HNDP+V            RL 
Sbjct: 241 EPCFDKLEAKLAHAMLSIPATKGFEIGSGFGGCEIPGSVHNDPFVKAPTAQEGRARPRLT 300

Query: 289 TKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPR 348
           TKTNNSGG QGGI+NG ++YF VAFKPPATI Q Q+T TY+  +GVL A+GRHDPCV+PR
Sbjct: 301 TKTNNSGGIQGGISNGAHVYFTVAFKPPATIGQAQQTMTYDEQEGVLEAKGRHDPCVIPR 360

Query: 349 AVPIVESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAMSGVIPKLSE 397
           AVPIVESMAALVIMDAL+ Q +R++  +LLPP  N+   +S     L+E
Sbjct: 361 AVPIVESMAALVIMDALLAQSARQSARALLPPLKNLTIPVSETHNNLTE 409



>gi|116205243|ref|XP_001228432.1| hypothetical protein CHGG_10505 [Chaetomium globosum CBS 148.51]
 gi|88176633|gb|EAQ84101.1| hypothetical protein CHGG_10505 [Chaetomium globosum CBS 148.51]
          Length = 428

 Score =  527 bits (1357), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 263/405 (64%), Positives = 307/405 (75%), Gaps = 25/405 (6%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT+GESH +SVGCIVDGCPPG+ L E DIQ Q+ RRRPGQS +TTPR+EK
Sbjct: 1   MSTFGEYFRVTTYGESHCRSVGCIVDGCPPGMELTEDDIQPQMTRRRPGQSAITTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE G+TLGTPIG++V N+DQRP DY     D+YPRPSHADWTYL+KY +KAS
Sbjct: 61  DRVLIQSGTEFGVTLGTPIGMMVMNEDQRPKDYGNKTMDIYPRPSHADWTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM-PFINEQDERLFPED 177
           SGGGR+SARETIGRVAAG IAEKYL+L +G+EIVAF SSV N+ + P   E         
Sbjct: 121 SGGGRSSARETIGRVAAGTIAEKYLRLAYGIEIVAFTSSVGNVHLFPPTPEHPSPSTNPK 180

Query: 178 FWELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           F  LL TI R+ VD    VRCPD+T++ KM   I + ++ +DS+GGT+TCVIRN P GLG
Sbjct: 181 FLSLLQTIDRKGVDSFLPVRCPDETITKKMEATIADFRDREDSIGGTVTCVIRNAPSGLG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND----------- 285
           EPCFDKLEAK AHAMLSIPATKGFEIGSGF G  + G  HNDP++   D           
Sbjct: 241 EPCFDKLEAKLAHAMLSIPATKGFEIGSGFGGCEVPGSTHNDPFISTADVEVPSSVAESG 300

Query: 286 ---------RLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGV-DGVL 335
                    +L TKTN SGG QGGI+NG  IYFR+AFKPPATI QEQ TATY+G  +GVL
Sbjct: 301 AVKSGVARPKLTTKTNYSGGIQGGISNGAPIYFRIAFKPPATIGQEQRTATYDGASEGVL 360

Query: 336 AARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPP 380
           AA+GRHDPCVVPRAVPIVE+MAALV+MDA++ QQ+R T  SLLPP
Sbjct: 361 AAKGRHDPCVVPRAVPIVEAMAALVLMDAVLAQQARHTAKSLLPP 405



>gi|327356702|gb|EGE85559.1| chorismate synthase [Ajellomyces dermatitidis ATCC 18188]
          Length = 406

 Score =  526 bits (1355), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 264/396 (66%), Positives = 309/396 (78%), Gaps = 15/396 (3%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT+GESH +SVGCIVDGCPPG++L E DIQ Q+ RRRPGQS LTTPR+EK
Sbjct: 1   MSTFGEYFRVTTYGESHCRSVGCIVDGCPPGMALTEDDIQPQMTRRRPGQSALTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE GITLGTPIG++V N+DQRP DY  S  DLYPRPSHAD+TYL+KY +KAS
Sbjct: 61  DRVEIQSGTEFGITLGTPIGMVVRNEDQRPKDYGGSTMDLYPRPSHADFTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM--PFINEQDERLFPE 176
           SGGGR+SARETIGRVAAGAIAEKYLKL H +EIV+FVSSV N  +  P +   +    P 
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLKLSHNIEIVSFVSSVGNEHLFPPTVGHPNPTTNP- 179

Query: 177 DFWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGL 235
           DF +L+ TI R  VD  A +RCP+   + +M + I   ++  DS+GGT+TCVIRNVPVGL
Sbjct: 180 DFLKLIATIDRPTVDSFAPIRCPETAAAARMTKVIEHFRDHNDSIGGTVTCVIRNVPVGL 239

Query: 236 GEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND---------R 286
           GEPCFDKLEAK AHAMLSIPATKGFEIGSGF G  + G  HNDP++  +D         R
Sbjct: 240 GEPCFDKLEAKLAHAMLSIPATKGFEIGSGFLGCEIPGSIHNDPFITTDDQNSQTPGSKR 299

Query: 287 LGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVV 346
           L TKTNNSGG QGGI+NG +IYFRVAFKPPATI Q Q T  Y+  +GVL A+GRHDPCVV
Sbjct: 300 LTTKTNNSGGIQGGISNGASIYFRVAFKPPATIGQAQTTTKYDFEEGVLEAKGRHDPCVV 359

Query: 347 PRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNP 382
           PRAVPIVE+M+ALVI+DALM Q +R+   +LLPP P
Sbjct: 360 PRAVPIVEAMSALVIIDALMAQNAREAAKNLLPPLP 395



>gi|261206328|ref|XP_002627901.1| chorismate synthase [Ajellomyces dermatitidis SLH14081]
 gi|239592960|gb|EEQ75541.1| chorismate synthase [Ajellomyces dermatitidis SLH14081]
 gi|239610864|gb|EEQ87851.1| chorismate synthase [Ajellomyces dermatitidis ER-3]
          Length = 406

 Score =  526 bits (1355), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 264/396 (66%), Positives = 309/396 (78%), Gaps = 15/396 (3%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT+GESH +SVGCIVDGCPPG++L E DIQ Q+ RRRPGQS LTTPR+EK
Sbjct: 1   MSTFGEYFRVTTYGESHCRSVGCIVDGCPPGMALTEDDIQPQMTRRRPGQSALTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE GITLGTPIG++V N+DQRP DY  S  DLYPRPSHAD+TYL+KY +KAS
Sbjct: 61  DRVEIQSGTEFGITLGTPIGMVVRNEDQRPKDYGGSTMDLYPRPSHADFTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM--PFINEQDERLFPE 176
           SGGGR+SARETIGRVAAGAIAEKYLKL H +EIV+FVSSV N  +  P +   +    P 
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLKLSHNIEIVSFVSSVGNEHLFPPTVGHPNPTTNP- 179

Query: 177 DFWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGL 235
           DF +L+ TI R  VD  A +RCP+   + +M + I   ++  DS+GGT+TCVIRNVPVGL
Sbjct: 180 DFLKLIATIDRPTVDSFAPIRCPETAAAARMTKVIEHFRDHNDSIGGTVTCVIRNVPVGL 239

Query: 236 GEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND---------R 286
           GEPCFDKLEAK AHAMLSIPATKGFEIGSGF G  + G  HNDP++  +D         R
Sbjct: 240 GEPCFDKLEAKLAHAMLSIPATKGFEIGSGFLGCEIPGSIHNDPFITTDDQNSQTPGSKR 299

Query: 287 LGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVV 346
           L TKTNNSGG QGGI+NG +IYFRVAFKPPATI Q Q T  Y+  +GVL A+GRHDPCVV
Sbjct: 300 LTTKTNNSGGIQGGISNGASIYFRVAFKPPATIGQAQTTTKYDFEEGVLEAKGRHDPCVV 359

Query: 347 PRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNP 382
           PRAVPIVE+M+ALVI+DALM Q +R+   +LLPP P
Sbjct: 360 PRAVPIVEAMSALVIIDALMAQNAREAAKNLLPPLP 395



>gi|225560577|gb|EEH08858.1| chorismate synthase [Ajellomyces capsulatus G186AR]
          Length = 407

 Score =  526 bits (1354), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 266/397 (67%), Positives = 307/397 (77%), Gaps = 16/397 (4%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT+GESH +SVGCIVDGCPPG++L E DIQ Q+ RRRPGQS LTTPR+EK
Sbjct: 1   MSTFGEYFRVTTYGESHCRSVGCIVDGCPPGMALTEEDIQPQMTRRRPGQSALTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           DKV IQSGTE GITLGTPIG++V N+DQRP DY  S  DLYPRPSHAD+TYL+KY +KAS
Sbjct: 61  DKVEIQSGTEFGITLGTPIGMVVRNEDQRPKDYGGSTMDLYPRPSHADFTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM--PFINEQDERLFPE 176
           SGGGR+SARETIGRVAAGAIAEKYL L H +EIVAFVSSV N  +  P     +    PE
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLNLSHNIEIVAFVSSVGNEHLFPPTATHPNPTTNPE 180

Query: 177 DFWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGL 235
            F +L+  I R  VD  A VRCP+   + +M + I   ++  DS+GGT+TCVIRNVPVGL
Sbjct: 181 -FLKLIANIDRPTVDSFAPVRCPETAAAKRMTKVIEHFRDQSDSIGGTVTCVIRNVPVGL 239

Query: 236 GEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND---------- 285
           GEPCFDKLEAK AHAMLSIPATKGFEIGSGF G  + G  HNDP+V   D          
Sbjct: 240 GEPCFDKLEAKLAHAMLSIPATKGFEIGSGFLGCEIPGSIHNDPFVATADNQNGQTPGQK 299

Query: 286 RLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCV 345
           RL TKTNNSGG QGGI+NG +IYFRVAFKPPATI Q Q TA+Y+  +GVL A+GRHDPCV
Sbjct: 300 RLTTKTNNSGGIQGGISNGASIYFRVAFKPPATIGQAQTTASYDFEEGVLEAKGRHDPCV 359

Query: 346 VPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNP 382
           VPRAVPIVE+MA+LV++DALM Q +R+   +LLPP P
Sbjct: 360 VPRAVPIVEAMASLVVIDALMAQNAREAAKNLLPPLP 396



>gi|448535748|ref|XP_003871008.1| Aro2 chorismate synthase [Candida orthopsilosis Co 90-125]
 gi|380355364|emb|CCG24882.1| Aro2 chorismate synthase [Candida orthopsilosis]
          Length = 377

 Score =  525 bits (1351), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 268/381 (70%), Positives = 309/381 (81%), Gaps = 9/381 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FGTLF+VTT+GESH KSVGCIVDGCPPGL L E DIQ QL RRRPGQS L+TPR+E 
Sbjct: 1   MSSFGTLFKVTTYGESHCKSVGCIVDGCPPGLKLAEDDIQPQLTRRRPGQSKLSTPRNEA 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V IQSGTE+G+TLG+PIG++V N+D RP DYSETDLYPRPSHAD+TY+QKY +K+ SG
Sbjct: 61  DAVEIQSGTENGVTLGSPIGMIVRNKDHRPGDYSETDLYPRPSHADYTYIQKYGLKSGSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGR+SARETIGRVAAGAIAEK L  V+ VEIVAFVSS+  ++M   N QD       F  
Sbjct: 121 GGRSSARETIGRVAAGAIAEKILHEVNNVEIVAFVSSIGEVSMDR-NAQDPT-----FQN 174

Query: 181 LLNTIRREEVDK-DAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           +LNTI RE+VD    VRCPD  V D+M + I + ++AKDS+GG +TCVIRN P+GLGEPC
Sbjct: 175 ILNTITREQVDDVGPVRCPDDGVRDEMVKVIEKYRDAKDSIGGVVTCVIRNCPIGLGEPC 234

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL--KNDRLGTKTNNSGGT 297
           FDKLEAK AHAMLS+PATKGFEIGSGF GT + G +HNDP++   KN+RL TKTNNSGG 
Sbjct: 235 FDKLEAKLAHAMLSLPATKGFEIGSGFLGTQIPGSKHNDPFIHDEKNNRLRTKTNNSGGI 294

Query: 298 QGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMA 357
           QGGI+NGENIYF VAFK  ATISQEQETATY+G  GVLAARGRHDP V PRAVPIVE+MA
Sbjct: 295 QGGISNGENIYFSVAFKSAATISQEQETATYDGKHGVLAARGRHDPSVTPRAVPIVEAMA 354

Query: 358 ALVIMDALMIQQSRKTVASLL 378
           ALV+ D  MIQQ+R   A LL
Sbjct: 355 ALVLCDEFMIQQARSATAGLL 375



>gi|440637547|gb|ELR07466.1| chorismate synthase [Geomyces destructans 20631-21]
          Length = 432

 Score =  525 bits (1351), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 266/401 (66%), Positives = 305/401 (76%), Gaps = 21/401 (5%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  F+VTT+GESH +SVGCIVDGCPPG+ L EADIQ Q+ RRRPGQS LTTPRDEK
Sbjct: 1   MSTFGEYFKVTTYGESHCRSVGCIVDGCPPGMELTEADIQPQMTRRRPGQSALTTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           D+V I SGTE G+TLGTPIG+LV NQDQRP DY  S  DL+PRPSHADWTYL+KY +KAS
Sbjct: 61  DQVEIHSGTEFGVTLGTPIGMLVRNQDQRPKDYGNSTMDLFPRPSHADWTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM-PFINEQDERLFPED 177
           SGGGR+SARETIGRVAAGAIA+KYL+L HG+EI AFVSSV ++ M P   E         
Sbjct: 121 SGGGRSSARETIGRVAAGAIADKYLRLAHGIEITAFVSSVGSVHMFPPTLEHPSPSTNHA 180

Query: 178 FWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           F +LL+TI RE VD    VRCPD    +KM++ I E ++ +DS+GGT+TCVIRNVP GLG
Sbjct: 181 FLKLLDTIDRETVDSFVPVRCPDAAAGEKMKKCIEEFRDRQDSIGGTVTCVIRNVPSGLG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV--------------- 281
           EPCFDK+EA  AHAMLSIPA KGFEIGSGF G  + G  HNDP+V               
Sbjct: 241 EPCFDKMEAMLAHAMLSIPAAKGFEIGSGFGGCEVPGSIHNDPFVKAPVETGPETGASRA 300

Query: 282 -LKNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVD-GVLAARG 339
            +   RL TKTNNSGG QGGITNG  IYFRVAFKP ATI Q Q T TY G + GVL A+G
Sbjct: 301 GVPRPRLTTKTNNSGGIQGGITNGAPIYFRVAFKPAATIGQAQNTVTYAGDEAGVLEAKG 360

Query: 340 RHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPP 380
           RHDPCVVPRAVPIVE+MA+LV++DALM QQ+R+   SLLPP
Sbjct: 361 RHDPCVVPRAVPIVEAMASLVVIDALMAQQARQASRSLLPP 401



>gi|350630819|gb|EHA19191.1| chorismate synthase activity [Aspergillus niger ATCC 1015]
          Length = 401

 Score =  524 bits (1350), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 265/408 (64%), Positives = 309/408 (75%), Gaps = 36/408 (8%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MST+G  FRVTT+GESH +SVGCIVDGCPPG+ L E DIQ Q+ RRRPGQS LTTPR+EK
Sbjct: 1   MSTWGDYFRVTTYGESHCRSVGCIVDGCPPGMELTEDDIQPQMTRRRPGQSALTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE G+TLGTPIG++V N+DQRP DY  S  DLYPRPSHAD TYL+KY +KAS
Sbjct: 61  DRVEIQSGTEFGVTLGTPIGMMVRNEDQRPKDYGNSTMDLYPRPSHADLTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFP--- 175
           SGGGR+SARETIGRVAAGAIAEKYL+L HGVEIVAFVSSV N          E LFP   
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLRLSHGVEIVAFVSSVGN----------EHLFPPTP 170

Query: 176 --------EDFWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITC 226
                    ++  LL TI R  VD+ A  RCP+   + +M + I + ++  DS+GGT+TC
Sbjct: 171 EHPTASTNPEYLNLLKTITRTTVDEFAPTRCPNADAAARMTKVIEQFRDNHDSIGGTVTC 230

Query: 227 VIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKN-- 284
           VIRNVPVGLGEPCFDKLEAK AHAMLSIPATKGFEIGSGF G  + G  HNDP+++ +  
Sbjct: 231 VIRNVPVGLGEPCFDKLEAKLAHAMLSIPATKGFEIGSGFGGCEVPGSIHNDPFIVSDVP 290

Query: 285 ----------DRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGV 334
                      RL TKTNNSGG QGGI+NG +IYFR+AFKPPATI Q Q TATY+  +G+
Sbjct: 291 TQLGPNTTTKQRLTTKTNNSGGIQGGISNGADIYFRIAFKPPATIGQAQNTATYDFGEGI 350

Query: 335 LAARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNP 382
           L A+GRHDPCV PRAVPIVE+M+ALV+MDALM Q SR++  SLLPP P
Sbjct: 351 LEAKGRHDPCVTPRAVPIVEAMSALVVMDALMAQYSRESAKSLLPPLP 398



>gi|320581923|gb|EFW96142.1| Bifunctional chorismate synthase and flavin reductase [Ogataea
           parapolymorpha DL-1]
          Length = 374

 Score =  524 bits (1349), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 255/374 (68%), Positives = 303/374 (81%), Gaps = 7/374 (1%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FGT+F+VTT+GESH +SVGCIVDG PP +SL E DIQ QL RRRPGQS LTTPR+EK
Sbjct: 1   MSSFGTIFKVTTYGESHCRSVGCIVDGVPPNMSLTEDDIQPQLSRRRPGQSKLTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D+V IQSGTE G TLGTPI ++V N+DQRP DY+E D++PRPSHAD+TYL KY +KASSG
Sbjct: 61  DRVEIQSGTEFGKTLGTPIAMVVKNEDQRPKDYTEMDVFPRPSHADFTYLSKYGVKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGR+SARETIGRVAAGAIAEK+LK V+ VEIVAFVS V    +      D  +   +F E
Sbjct: 121 GGRSSARETIGRVAAGAIAEKFLKQVNDVEIVAFVSGVGECQI------DRSVQNPEFME 174

Query: 181 LLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           LL+TI RE VD+   +RCP    +D+M   + + KE  DSVGG +TCVIRNVP+GLGEP 
Sbjct: 175 LLSTITRERVDQSGPIRCPILEKADEMTRLVVDCKERNDSVGGIVTCVIRNVPIGLGEPA 234

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKNDRLGTKTNNSGGTQG 299
           FDKLEA  AHAMLSIPATKGFEIGSGF+GT + G +HNDP+V K  +LGT TNNSGG QG
Sbjct: 235 FDKLEAMLAHAMLSIPATKGFEIGSGFEGTKMRGSEHNDPFVKKGGKLGTATNNSGGIQG 294

Query: 300 GITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAAL 359
           GI+NGENIYF VAFKPPATISQEQ+TA+Y G DGVL +RGRHDP VVPRA+PIVE+MAAL
Sbjct: 295 GISNGENIYFSVAFKPPATISQEQQTASYEGDDGVLKSRGRHDPNVVPRAIPIVEAMAAL 354

Query: 360 VIMDALMIQQSRKT 373
           V+ D+ +IQ+SR++
Sbjct: 355 VLADSYLIQKSRES 368



>gi|50421863|ref|XP_459489.1| DEHA2E03784p [Debaryomyces hansenii CBS767]
 gi|49655157|emb|CAG87707.1| DEHA2E03784p [Debaryomyces hansenii CBS767]
          Length = 377

 Score =  524 bits (1349), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 254/377 (67%), Positives = 305/377 (80%), Gaps = 13/377 (3%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG +FRVTT+GESH KSVGCIVDGCPPGL+L E DIQ QL RRRPGQS L+TPR+EK
Sbjct: 1   MSTFGNIFRVTTYGESHCKSVGCIVDGCPPGLALTEDDIQPQLSRRRPGQSKLSTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D+V IQSGTE+G+TLG+PIG+LV N+D RPHDYSETDLYPRPSHADWTY+QKY +K++SG
Sbjct: 61  DQVHIQSGTENGLTLGSPIGMLVQNEDHRPHDYSETDLYPRPSHADWTYIQKYGVKSTSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPED--F 178
           GGR+SARET+GRVAAGAIAEK L   + VEIVAFVSS+  I M           P+D  F
Sbjct: 121 GGRSSARETVGRVAAGAIAEKILTKANNVEIVAFVSSIGEIEM--------NRSPQDATF 172

Query: 179 WELLNTIRREEVDK-DAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGE 237
             +LNTI REEVD+   +RCPD +V D+M + I + ++ KDS+GG +TCV+RN P+GLGE
Sbjct: 173 QNILNTITREEVDEVGPIRCPDASVRDEMVKVIEKYRDNKDSIGGVVTCVVRNCPIGLGE 232

Query: 238 PCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLK--NDRLGTKTNNSG 295
           PCFDKLEA+ AHAMLS+PATKGFE GSGF GT + G  HNDP++    +++L T TNNSG
Sbjct: 233 PCFDKLEAQLAHAMLSLPATKGFEFGSGFLGTKIPGSVHNDPFISDGTSNKLRTVTNNSG 292

Query: 296 GTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVES 355
           G QGGI+NGENIYF VAFK  ATISQEQ T+TY+G  GVLAARGRHDP V PRAVPIVE+
Sbjct: 293 GIQGGISNGENIYFSVAFKSAATISQEQYTSTYDGEKGVLAARGRHDPSVTPRAVPIVEA 352

Query: 356 MAALVIMDALMIQQSRK 372
           M ALV++D L+ Q++R+
Sbjct: 353 MTALVLVDQLLTQKARE 369



>gi|425769900|gb|EKV08379.1| Chorismate synthase [Penicillium digitatum Pd1]
          Length = 407

 Score =  523 bits (1347), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 263/412 (63%), Positives = 310/412 (75%), Gaps = 28/412 (6%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MST+G  FRVTT+GESH +SVGCIVDGCPPGL L EADIQ Q+ RRRPGQS LTTPRDEK
Sbjct: 1   MSTWGQYFRVTTYGESHCRSVGCIVDGCPPGLELTEADIQPQMTRRRPGQSALTTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE G+TLGTPI ++V N+DQRP DY  S  DLYPRPSHAD+TYL+KY +KAS
Sbjct: 61  DRVEIQSGTEFGVTLGTPIAMVVRNEDQRPKDYGGSTMDLYPRPSHADFTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFP--- 175
           SGGGR+SARETIGRVAAGAIAEK+L L H +EIVAFVSSV N          E LFP   
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKFLSLAHNIEIVAFVSSVGN----------EHLFPPTP 170

Query: 176 --------EDFWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITC 226
                    +F +L+ TI R+ VD  A +RCP+   +++M + I + ++ KDS+GGT+TC
Sbjct: 171 EHPSPSTNPEFLKLIETIDRKTVDSFAPIRCPETAAAERMTKVIEKFRDNKDSIGGTVTC 230

Query: 227 VIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLK--- 283
           VIRNVPVGLGEPCFDKLEAK  HAMLSIPATKGFEIGSGF G  + G  HNDP+++    
Sbjct: 231 VIRNVPVGLGEPCFDKLEAKLGHAMLSIPATKGFEIGSGFGGCEVPGSIHNDPFIVDQTA 290

Query: 284 -NDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHD 342
            + RL TKTNNSGG QGGI+NG +IYFRVAFKP ATI Q Q T TYNG +G+L A+GRHD
Sbjct: 291 GSPRLTTKTNNSGGIQGGISNGASIYFRVAFKPAATIGQAQTTTTYNGEEGILEAKGRHD 350

Query: 343 PCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAMSGVIPK 394
           PCV PRAVPIVE+M++LV+MDALM Q +R+   +LLP  P          PK
Sbjct: 351 PCVTPRAVPIVEAMSSLVVMDALMAQYAREGAKNLLPRKPQTIPTNPATAPK 402



>gi|169769693|ref|XP_001819316.1| bifunctional chorismate synthase/flavin reductase [Aspergillus
           oryzae RIB40]
 gi|83767175|dbj|BAE57314.1| unnamed protein product [Aspergillus oryzae RIB40]
          Length = 412

 Score =  523 bits (1347), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 261/398 (65%), Positives = 309/398 (77%), Gaps = 16/398 (4%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MST+G  F+VTT+GESH +SVGCIVDGCPPG+ L EAD+Q Q+ RRRPGQS LTTPR+EK
Sbjct: 1   MSTWGEYFKVTTYGESHCRSVGCIVDGCPPGMELTEADVQPQMTRRRPGQSALTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE G+TLGTPIG++V N+DQRP DY  S  DLYPRPSHAD+TYL+KY +KAS
Sbjct: 61  DRVEIQSGTEFGVTLGTPIGMIVRNEDQRPKDYGGSTMDLYPRPSHADFTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM-PFINEQDERLFPED 177
           SGGGR+SARETIGRVAAGAIAEKYL+L HGVEIV+FVSSV N  + P   E        +
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLRLSHGVEIVSFVSSVGNEHLFPPTPEHPSPATNPE 180

Query: 178 FWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           F  L+  I RE VD     RCP++  + +M + I + ++ +DS+GGT+TCVIRNVPVGLG
Sbjct: 181 FLNLIENISRETVDSFVPTRCPNQEAAARMTKVIEQFRDNQDSIGGTVTCVIRNVPVGLG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKN------------ 284
           EPCFDKLEAK AHAMLSIPATKGFEIGSGF G  + G  HNDP+V+ +            
Sbjct: 241 EPCFDKLEAKLAHAMLSIPATKGFEIGSGFGGCEVPGSIHNDPFVVSDVETRTGTETTTK 300

Query: 285 DRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPC 344
            RL TKTNNSGG QGGI+NG +IYFRVAFKPPATI Q Q TA+Y   +G L A+GRHDPC
Sbjct: 301 QRLTTKTNNSGGIQGGISNGASIYFRVAFKPPATIGQAQTTASYGLEEGTLEAKGRHDPC 360

Query: 345 VVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNP 382
           VVPRAVPIVE+M+ALVIMDALM Q +R++  +LLPP P
Sbjct: 361 VVPRAVPIVETMSALVIMDALMAQYARESAKNLLPPLP 398



>gi|363750908|ref|XP_003645671.1| hypothetical protein Ecym_3367 [Eremothecium cymbalariae
           DBVPG#7215]
 gi|356889305|gb|AET38854.1| Hypothetical protein Ecym_3367 [Eremothecium cymbalariae
           DBVPG#7215]
          Length = 376

 Score =  522 bits (1345), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 253/381 (66%), Positives = 301/381 (79%), Gaps = 9/381 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FG LFRVTT+GESH KSVGCIV+G PPG+SL E DIQ QL RRRPGQS L+TPR+EK
Sbjct: 1   MSSFGVLFRVTTYGESHCKSVGCIVEGVPPGMSLTEEDIQTQLTRRRPGQSKLSTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D+V IQSGTE   TLGTPIG++V N+DQRPHDY E D YPRPSHAD+TY++KY IKASSG
Sbjct: 61  DRVEIQSGTEFDKTLGTPIGMIVKNEDQRPHDYGEMDQYPRPSHADFTYIEKYGIKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGR+SARETIGRVAAGAIAEK+LKLV  VEIVAFVS +  + M      +   F   F  
Sbjct: 121 GGRSSARETIGRVAAGAIAEKFLKLVSNVEIVAFVSQIGTVKM------NRNPFDPSFQH 174

Query: 181 LLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           +LNTI RE+VD    +RCPD +VS  M + I + +  KDS+GG +TCV+RNVPVGLGEPC
Sbjct: 175 VLNTITREQVDASGPIRCPDPSVSTAMVKEIEKYRGEKDSIGGVVTCVVRNVPVGLGEPC 234

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSGGT 297
           FDKLEA  AHAMLS+PA+KGFEIGSGF G  L G +HNDP+V   +  RL TKTNNSGG 
Sbjct: 235 FDKLEAMLAHAMLSLPASKGFEIGSGFAGVELPGSKHNDPFVFNKEDGRLRTKTNNSGGI 294

Query: 298 QGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMA 357
           QGGI+NGE+IYF V FK  ATISQEQET+TY+G +G+LAA+GRHDP V PRA PIVE+M 
Sbjct: 295 QGGISNGEHIYFSVPFKSAATISQEQETSTYSGTNGILAAKGRHDPSVTPRATPIVEAMT 354

Query: 358 ALVIMDALMIQQSRKTVASLL 378
           ALV+ DA +IQ+SR+   +++
Sbjct: 355 ALVLADAYLIQKSREATRNIV 375



>gi|354548437|emb|CCE45173.1| hypothetical protein CPAR2_701850 [Candida parapsilosis]
          Length = 377

 Score =  522 bits (1345), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 266/381 (69%), Positives = 309/381 (81%), Gaps = 9/381 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FGTLF+VTT+GESH KSVGCIVDGCPPGL L E DIQ QL RRRPGQS L+TPR+E 
Sbjct: 1   MSSFGTLFKVTTYGESHCKSVGCIVDGCPPGLKLTEDDIQPQLTRRRPGQSKLSTPRNEA 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V IQSGTE+G++LG+PIG++V N+D RP DYSETDLYPRPSHAD+TY+QKY +K+ SG
Sbjct: 61  DAVEIQSGTENGVSLGSPIGMIVRNKDHRPGDYSETDLYPRPSHADYTYIQKYGLKSGSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGR+SARETIGRVAAGAIAEK L  V+ VEIVAFVSS+  ++M   N QD       F  
Sbjct: 121 GGRSSARETIGRVAAGAIAEKILYEVNNVEIVAFVSSIGEVSMNR-NAQD-----PTFQN 174

Query: 181 LLNTIRREEVDK-DAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           +LNTI RE+VD    VRCPD  V D+M + I + ++AKDS+GG +TCVIRN P+GLGEPC
Sbjct: 175 ILNTITREQVDNVGPVRCPDDGVRDEMVKVIEKYRDAKDSIGGVVTCVIRNCPIGLGEPC 234

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV--LKNDRLGTKTNNSGGT 297
           FDKLEAK AHAMLS+PATKGFEIGSGF GT + G +HNDP++   +N+RL TKTNNSGG 
Sbjct: 235 FDKLEAKLAHAMLSLPATKGFEIGSGFLGTQIPGSKHNDPFIHDAENNRLRTKTNNSGGI 294

Query: 298 QGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMA 357
           QGGI+NGENIYF VAFK  ATISQEQETATY+G  GVLAARGRHDP V PRAVPIVE+MA
Sbjct: 295 QGGISNGENIYFSVAFKSAATISQEQETATYDGKHGVLAARGRHDPSVTPRAVPIVEAMA 354

Query: 358 ALVIMDALMIQQSRKTVASLL 378
           ALV+ D  MIQQ+R   A LL
Sbjct: 355 ALVLCDEFMIQQARSATAGLL 375



>gi|367055536|ref|XP_003658146.1| hypothetical protein THITE_2124650 [Thielavia terrestris NRRL 8126]
 gi|347005412|gb|AEO71810.1| hypothetical protein THITE_2124650 [Thielavia terrestris NRRL 8126]
          Length = 429

 Score =  521 bits (1343), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 266/405 (65%), Positives = 306/405 (75%), Gaps = 25/405 (6%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT+GESH +SVGCIVDGCPPG+ L E DIQ Q++RRRPGQS +TTPR+EK
Sbjct: 1   MSTFGEYFRVTTYGESHCRSVGCIVDGCPPGMELTEDDIQPQMNRRRPGQSAITTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE GITLGTPIG++V N+DQRP DY     D+YPRPSHADWTYL+KY +KAS
Sbjct: 61  DRVLIQSGTEFGITLGTPIGMMVLNEDQRPKDYGNKTMDIYPRPSHADWTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM-PFINEQDERLFPED 177
           SGGGR+SARETIGRVAAGAIAEKYL+L +G+EIVAF SSV ++ + P   E         
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLRLAYGIEIVAFTSSVGSVHLFPPTPEHPSPSTNPA 180

Query: 178 FWELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           F  LL TI R+ VD    VRCPD+ VS  M + I   K+  DS+GGTITCVIRN P GLG
Sbjct: 181 FLALLQTIDRKMVDSYLPVRCPDEAVSRAMEDCIAGFKKRDDSIGGTITCVIRNAPSGLG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV--------------- 281
           EPCFDKLEAK AHAMLSIPATKGFEIGSGF G  + G  HNDP+V               
Sbjct: 241 EPCFDKLEAKLAHAMLSIPATKGFEIGSGFGGCEIPGSTHNDPFVPAAAVELPSSVAQSG 300

Query: 282 -----LKNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNG-VDGVL 335
                +   +L TKTN SGG QGGI+NG  IYFRVAFKPPATI QEQ TATY+G  +G+L
Sbjct: 301 AVRSGVPRPKLTTKTNYSGGIQGGISNGAPIYFRVAFKPPATIGQEQLTATYDGSSEGIL 360

Query: 336 AARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPP 380
           AA+GRHDPCVVPRAVPIVE+MAALV+MDA++ QQ+R T  SLLPP
Sbjct: 361 AAKGRHDPCVVPRAVPIVEAMAALVLMDAVLAQQARHTAKSLLPP 405



>gi|407928748|gb|EKG21598.1| Chorismate synthase [Macrophomina phaseolina MS6]
          Length = 836

 Score =  520 bits (1340), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 259/389 (66%), Positives = 302/389 (77%), Gaps = 9/389 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFGT FRVTT+GESH  SVGCIVDGCPPG+ L EADIQ Q+ RRRPGQS +TTPR+EK
Sbjct: 423 MSTFGTHFRVTTYGESHCLSVGCIVDGCPPGMQLTEADIQPQMTRRRPGQSAITTPRNEK 482

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE G+TLGTPIG+ V N++QRP DY  S  DLYPRPSHADWTYL+KY +KAS
Sbjct: 483 DRVEIQSGTEFGVTLGTPIGMRVMNENQRPKDYGNSTMDLYPRPSHADWTYLEKYGVKAS 542

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSN-IAMPFINEQDERLFPED 177
           SGGGR+SARETIGRVAAGAIAEKYL+  +GVEIVAF +S+ N    P   E         
Sbjct: 543 SGGGRSSARETIGRVAAGAIAEKYLRQAYGVEIVAFTASIGNEFLFPPTPEHPTASTNPA 602

Query: 178 FWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           F +L++ I RE VD    VRCPD+  +++M+  +   ++ +DS+GGT++CVIRNVP GLG
Sbjct: 603 FLKLIDEIDRETVDSFLPVRCPDEGATERMKRVVENYRDREDSIGGTVSCVIRNVPSGLG 662

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLK-----NDRLGTKT 291
           EPCFDKLEA  AHAMLSIPATKGFEIGSGF G  + G  HNDP++         RL TKT
Sbjct: 663 EPCFDKLEAMLAHAMLSIPATKGFEIGSGFGGCQVPGSIHNDPFIKAPAAEGRPRLTTKT 722

Query: 292 NNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVP 351
           NNSGG QGGITNG +IYF V FKPPATI Q Q+T TY   DGVL A+GRHDPCVVPRAVP
Sbjct: 723 NNSGGIQGGITNGAHIYFNVGFKPPATIGQAQQTVTYGEEDGVLEAKGRHDPCVVPRAVP 782

Query: 352 IVESMAALVIMDALMIQQSRKTVASLLPP 380
           IVESMAALV+MDA++ QQ+R+T  SLLPP
Sbjct: 783 IVESMAALVLMDAVLAQQARQTARSLLPP 811



>gi|50308709|ref|XP_454358.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49643493|emb|CAG99445.1| KLLA0E09065p [Kluyveromyces lactis]
          Length = 376

 Score =  520 bits (1338), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 258/383 (67%), Positives = 302/383 (78%), Gaps = 13/383 (3%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG +FRVTT+GESH KSVGCIVDG PPG+SL E DIQ QL RRRPGQS L+TPR+EK
Sbjct: 1   MSTFGQIFRVTTYGESHCKSVGCIVDGVPPGMSLTEDDIQPQLTRRRPGQSKLSTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D+V IQSGTE G TLGTPIG+LV N+DQRPHDYS+ D YPRPSHAD+TY  KY IKASSG
Sbjct: 61  DRVEIQSGTEFGKTLGTPIGMLVKNEDQRPHDYSDMDNYPRPSHADFTYSSKYGIKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPED--F 178
           GGR+SARETIGRVAAGAIAEK+LK +  VEIVAFV+ +  + M     +D    P+D  F
Sbjct: 121 GGRSSARETIGRVAAGAIAEKFLKQLSNVEIVAFVTQIGAVKM----NRD----PQDPKF 172

Query: 179 WELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGE 237
            ++LNTI RE+VD    +RCPD +V+D M + I   +  KDS+GG +TCVIRN+P GLGE
Sbjct: 173 QQVLNTITREKVDAAGPIRCPDSSVADAMVKEIERYRGEKDSIGGVVTCVIRNLPAGLGE 232

Query: 238 PCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSG 295
           PCFDKLEA  AHAMLSIPA+KGFEIGSGF G  L G +HNDP+    D  RL TKTNNSG
Sbjct: 233 PCFDKLEALLAHAMLSIPASKGFEIGSGFDGVCLPGSKHNDPFYFDEDTGRLRTKTNNSG 292

Query: 296 GTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVES 355
           G QGGI+NGENIYF V FK  ATISQEQ TATY+G  G+LAA+GRHDP V PRA PIVE+
Sbjct: 293 GIQGGISNGENIYFSVPFKSAATISQEQATATYDGKSGILAAKGRHDPSVTPRATPIVEA 352

Query: 356 MAALVIMDALMIQQSRKTVASLL 378
           MAALV+ DA++IQ+SR+   S++
Sbjct: 353 MAALVLADAVLIQKSREAAISIV 375



>gi|406606037|emb|CCH42674.1| Chorismate synthase [Wickerhamomyces ciferrii]
          Length = 378

 Score =  520 bits (1338), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 256/381 (67%), Positives = 303/381 (79%), Gaps = 9/381 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG+ FRVTT+GESH KSVGCIVDG PPGL + EADIQ QL RRRPGQS L+TPR+EK
Sbjct: 1   MSTFGSFFRVTTYGESHCKSVGCIVDGVPPGLDITEADIQPQLTRRRPGQSKLSTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D+V IQSGTE G TLGT IG+LV N+DQRP DYSETDLYPRPSHAD+TYL+KY  KASSG
Sbjct: 61  DRVFIQSGTEYGKTLGTSIGMLVANEDQRPKDYSETDLYPRPSHADFTYLKKYGTKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGR+SARETIGRVAAGAIA+K+L+  +GVEIVAF S +  + M   + QD +     F E
Sbjct: 121 GGRSSARETIGRVAAGAIADKFLEKANGVEIVAFTSQIGQVKMNR-DVQDPK-----FIE 174

Query: 181 LLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           +LNTI R+EVD    VRCPD   + KM E I + +++KDS+GG +TCVIRN P+GLGEP 
Sbjct: 175 ILNTITRDEVDAAGPVRCPDSEAAPKMVEEIEKYRDSKDSIGGVVTCVIRNCPIGLGEPV 234

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSGGT 297
           FDKLEA  AHAMLSIPA+KGFEIGSGF+G  + G +HNDP+ L+ +  R  TKTNNSGG 
Sbjct: 235 FDKLEALLAHAMLSIPASKGFEIGSGFEGVQIPGSKHNDPFYLEEETGRFRTKTNNSGGI 294

Query: 298 QGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMA 357
           QGGI+NGENIYF VAFK  ATISQEQ TA YNG  GVLAA+GRHDP V PRA+PIVE+MA
Sbjct: 295 QGGISNGENIYFSVAFKSAATISQEQPTAQYNGSKGVLAAKGRHDPAVTPRAIPIVEAMA 354

Query: 358 ALVIMDALMIQQSRKTVASLL 378
           ++VI D L++Q+SR+   +L 
Sbjct: 355 SIVIADTLLMQKSREYTQTLF 375



>gi|391863482|gb|EIT72790.1| chorismate synthase [Aspergillus oryzae 3.042]
          Length = 412

 Score =  519 bits (1336), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 260/398 (65%), Positives = 308/398 (77%), Gaps = 16/398 (4%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MST+G  F+VTT+GESH +SVGCIVDGCPPG+ L EAD+Q Q+ RRRPGQS LTTPR+EK
Sbjct: 1   MSTWGEYFKVTTYGESHCRSVGCIVDGCPPGMELTEADVQPQMTRRRPGQSALTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE G+TLGTPIG++V N+DQRP DY  S  DLYPRPSHAD+TYL+KY +KAS
Sbjct: 61  DRVEIQSGTEFGVTLGTPIGMIVRNEDQRPKDYGGSTMDLYPRPSHADFTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM-PFINEQDERLFPED 177
           SGGGR+SARETIGRVAAGAIAEKYL+L HGVEIV+FVSSV N  + P   E        +
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLRLSHGVEIVSFVSSVGNEHLFPPTPEHPSPATNPE 180

Query: 178 FWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           F  L+  I RE VD     RCP++  + +M + I + ++ +DS+GGT+TCVIRNVPVGLG
Sbjct: 181 FLNLIENISRETVDSFVPTRCPNQEAAARMTKVIEQFRDNQDSIGGTVTCVIRNVPVGLG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKN------------ 284
           EPCFDKLEAK A AMLSIPATKGFEIGSGF G  + G  HNDP+V+ +            
Sbjct: 241 EPCFDKLEAKLALAMLSIPATKGFEIGSGFGGCEVPGSIHNDPFVVSDVETRTGTETTTK 300

Query: 285 DRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPC 344
            RL TKTNNSGG QGGI+NG +IYFRVAFKPPATI Q Q TA+Y   +G L A+GRHDPC
Sbjct: 301 QRLTTKTNNSGGIQGGISNGASIYFRVAFKPPATIGQAQTTASYGLEEGTLEAKGRHDPC 360

Query: 345 VVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNP 382
           VVPRAVPIVE+M+ALVIMDALM Q +R++  +LLPP P
Sbjct: 361 VVPRAVPIVETMSALVIMDALMAQYARESAKNLLPPLP 398



>gi|425771422|gb|EKV09865.1| Chorismate synthase [Penicillium digitatum PHI26]
          Length = 407

 Score =  519 bits (1336), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 261/412 (63%), Positives = 308/412 (74%), Gaps = 28/412 (6%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MST+G  FRVTT+GESH +SVGCIVDGCPPGL L EADIQ Q+ RRRPGQS LTTPRDEK
Sbjct: 1   MSTWGQYFRVTTYGESHCRSVGCIVDGCPPGLELTEADIQPQMTRRRPGQSALTTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE G+TLGTPI ++V N+DQRP DY  S  DLYPRPSHAD+TYL+KY +KAS
Sbjct: 61  DRVEIQSGTEFGVTLGTPIAMVVRNEDQRPKDYGGSTMDLYPRPSHADFTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFP--- 175
           SGGGR+  RETIGRVAAGAIAEK+L L H +EIVAFVSSV N          E LFP   
Sbjct: 121 SGGGRSGDRETIGRVAAGAIAEKFLSLAHNIEIVAFVSSVGN----------EHLFPPTP 170

Query: 176 --------EDFWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITC 226
                    +F +L+ TI R+ VD  A +RCP+   +++M + I + ++ KDS+GGT+TC
Sbjct: 171 EHPSPSTNPEFLKLIETIDRKTVDSFAPIRCPETAAAERMTKVIEKFRDNKDSIGGTVTC 230

Query: 227 VIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLK--- 283
           VIRNVPVGLGEPCFDKLEAK  HAMLSIPATKGFEIGSGF G  + G  HNDP+++    
Sbjct: 231 VIRNVPVGLGEPCFDKLEAKLGHAMLSIPATKGFEIGSGFGGCEVPGSIHNDPFIVDQTA 290

Query: 284 -NDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHD 342
            + RL TKTNNSGG QGGI+NG +IYFRVAFKP ATI Q Q T TYNG +G+L A+GRHD
Sbjct: 291 GSPRLTTKTNNSGGIQGGISNGASIYFRVAFKPAATIGQAQTTTTYNGEEGILEAKGRHD 350

Query: 343 PCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAMSGVIPK 394
           PCV PRAVPIVE+M++LV+MDALM Q +R+   +LLP  P          PK
Sbjct: 351 PCVTPRAVPIVEAMSSLVVMDALMAQYAREGAKNLLPRKPQTIPTNPATAPK 402



>gi|258576473|ref|XP_002542418.1| chorismate synthase [Uncinocarpus reesii 1704]
 gi|237902684|gb|EEP77085.1| chorismate synthase [Uncinocarpus reesii 1704]
          Length = 412

 Score =  518 bits (1335), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 262/403 (65%), Positives = 303/403 (75%), Gaps = 34/403 (8%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT+GESH +SVGCIVDGCPPG+ L E DIQ Q+ RRRPGQS LTTPR+EK
Sbjct: 1   MSTFGEYFRVTTYGESHCRSVGCIVDGCPPGMELTEEDIQPQMTRRRPGQSALTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           DKV IQSGTE GITLGTPIG++V N+DQRP DY     D+YPRPSHAD+TYL+KY +KAS
Sbjct: 61  DKVEIQSGTEFGITLGTPIGMVVRNEDQRPKDYGNKTMDMYPRPSHADFTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFP--- 175
           SGGGR+SARETIGRVAAGAIAEKYL+L H VEIV+FVSSV N          E LFP   
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLRLSHNVEIVSFVSSVGN----------EHLFPPTP 170

Query: 176 --------EDFWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITC 226
                    +F +L+ TI R+ VD    +RCP+   + +M + I   ++ +DS+GGT+TC
Sbjct: 171 EYPSASTNPEFLKLIETIDRKTVDSFVPIRCPNTEAAQRMTKLIEHFRDRQDSIGGTVTC 230

Query: 227 VIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLK--- 283
           VIRNVPVGLGEPCFDKLE K AHAMLSIPATKGFEIGSGF G  + G  HNDP+V+    
Sbjct: 231 VIRNVPVGLGEPCFDKLEGKLAHAMLSIPATKGFEIGSGFAGCEVPGSIHNDPFVVATKE 290

Query: 284 -------NDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLA 336
                     L TKTNNSGG QGGI+NG +IYFRVAFKPPATI Q Q TATY   +G L 
Sbjct: 291 ATGGNGTTQHLTTKTNNSGGIQGGISNGASIYFRVAFKPPATIGQAQTTATYAFEEGTLE 350

Query: 337 ARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLP 379
           A+GRHDPCVVPRAVPIVE+MAALVI+DALM Q +R+T  +LLP
Sbjct: 351 AKGRHDPCVVPRAVPIVEAMAALVIVDALMAQNARETAKNLLP 393



>gi|255726854|ref|XP_002548353.1| chorismate synthase [Candida tropicalis MYA-3404]
 gi|240134277|gb|EER33832.1| chorismate synthase [Candida tropicalis MYA-3404]
          Length = 378

 Score =  518 bits (1335), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 262/383 (68%), Positives = 310/383 (80%), Gaps = 13/383 (3%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FGTLF+VTT+GESH KSVGCIVDGCPPGL+L E+DIQ QL RRRPGQS L+TPRDEK
Sbjct: 1   MSSFGTLFKVTTYGESHCKSVGCIVDGCPPGLALTESDIQPQLTRRRPGQSKLSTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V IQSGTE+G+TLG+PIG++V N+D RP DYSETDLYPRPSHADWTY+QKY  K+SSG
Sbjct: 61  DLVEIQSGTENGVTLGSPIGMIVRNKDHRPGDYSETDLYPRPSHADWTYIQKYGTKSSSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPED--F 178
           GGR+SARETIGRVAAGAIAE+ L  V+ VEIVAFVSS+  ++M           P+D  F
Sbjct: 121 GGRSSARETIGRVAAGAIAERILTKVNNVEIVAFVSSIGEVSM--------NRSPQDAEF 172

Query: 179 WELLNTIRREEVDK-DAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGE 237
            ++LNTI REEVD    +RCPD  V D+M + I + ++AKDS+GG +TCV+RN P+G+GE
Sbjct: 173 QKILNTITREEVDGVGPIRCPDARVRDEMVKVIEKYRDAKDSIGGVVTCVVRNCPIGIGE 232

Query: 238 PCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSG 295
           PCFDKLEAK AHAMLS+PATKGFE GSGF+GT + G +HNDP+    +  RL TKTNNSG
Sbjct: 233 PCFDKLEAKLAHAMLSLPATKGFEFGSGFEGTKIPGSKHNDPFYYDENFGRLKTKTNNSG 292

Query: 296 GTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVES 355
           G QGGI+NGENIYF VAFK  ATISQEQET+TY+G +GVLAARGRHDP V PRAVPIVE+
Sbjct: 293 GIQGGISNGENIYFSVAFKSAATISQEQETSTYDGKEGVLAARGRHDPSVTPRAVPIVEA 352

Query: 356 MAALVIMDALMIQQSRKTVASLL 378
           M ALV+ D  MIQQSR +   L+
Sbjct: 353 MTALVLCDEFMIQQSRTSTRLLV 375



>gi|255716646|ref|XP_002554604.1| KLTH0F09218p [Lachancea thermotolerans]
 gi|238935987|emb|CAR24167.1| KLTH0F09218p [Lachancea thermotolerans CBS 6340]
          Length = 376

 Score =  518 bits (1333), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 254/375 (67%), Positives = 299/375 (79%), Gaps = 9/375 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FG  F VTT+GESH KSVGCIVDG PPG+SL E DIQ Q+ RRRPGQS L+TPR+EK
Sbjct: 1   MSSFGRFFTVTTYGESHCKSVGCIVDGVPPGMSLTEDDIQPQMSRRRPGQSKLSTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D+V IQSGTE G TLGTPIG++V N+DQRPHDY+E DLYPRPSHAD+TYL+KY IKASSG
Sbjct: 61  DRVMIQSGTEFGKTLGTPIGMIVMNEDQRPHDYNEMDLYPRPSHADFTYLEKYGIKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGR+SARETIGRVAAGAIAEK+LK +  VEIVAFV+ +  I M      +     ++F  
Sbjct: 121 GGRSSARETIGRVAAGAIAEKFLKQLSNVEIVAFVTQIGAIKM------NRDPLDKNFQH 174

Query: 181 LLNTIRREEVDK-DAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           LLNTI RE+VD    VRCPD +V++ M   I + +  KDS+GG +TCVIRN+PVG+GEPC
Sbjct: 175 LLNTITREKVDSMGPVRCPDSSVAEDMVHEIEKYRGNKDSIGGVVTCVIRNLPVGIGEPC 234

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSGGT 297
           FDKLEA  AHAMLSIPA+KGFEIGSGF+G  + G +HNDP+    +   L TKTNNSGG 
Sbjct: 235 FDKLEAMLAHAMLSIPASKGFEIGSGFEGVAIPGSKHNDPFYFDEETKTLRTKTNNSGGI 294

Query: 298 QGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMA 357
           QGGI+NGENIYF V FK  ATISQEQ TA YNG DGVLAA+GRHDP V PRAVPIVE+MA
Sbjct: 295 QGGISNGENIYFSVPFKSAATISQEQPTAAYNGKDGVLAAKGRHDPSVTPRAVPIVEAMA 354

Query: 358 ALVIMDALMIQQSRK 372
           ALV+ DA++IQ+SR+
Sbjct: 355 ALVLADAVLIQKSRE 369



>gi|410076640|ref|XP_003955902.1| hypothetical protein KAFR_0B04700 [Kazachstania africana CBS 2517]
 gi|372462485|emb|CCF56767.1| hypothetical protein KAFR_0B04700 [Kazachstania africana CBS 2517]
          Length = 376

 Score =  518 bits (1333), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 256/382 (67%), Positives = 299/382 (78%), Gaps = 11/382 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT+GESH KSVGCIVDG PPG++L E DIQ QL RRRPGQS L+TPR EK
Sbjct: 1   MSTFGKFFRVTTYGESHCKSVGCIVDGVPPGMTLTEEDIQPQLTRRRPGQSKLSTPRQEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D+V IQSG E   TLGTPI ++V N+D RP DYSE DLYPRPSHAD+TY +KY IKASSG
Sbjct: 61  DRVEIQSGVEFNKTLGTPIAMIVKNEDHRPKDYSEMDLYPRPSHADFTYSEKYGIKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPE-DFW 179
           GGRASARETIGRVAAG IAEK+LK V  VEIVAFVS +  I M       +R F +  F 
Sbjct: 121 GGRASARETIGRVAAGGIAEKFLKQVSNVEIVAFVSQIGEIKM-------DRTFNDPKFQ 173

Query: 180 ELLNTIRREEVDK-DAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEP 238
            LLNTI RE+VD    +RCPD TV+  M + I + +  KDS+GG +TCV+RN+P GLGEP
Sbjct: 174 HLLNTITREKVDSIGYIRCPDVTVASDMVKEIEKYRGQKDSIGGVVTCVVRNLPTGLGEP 233

Query: 239 CFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSGG 296
           CFDKLEA  AHAMLSIPA+KGFEIGSGF+G ++ G QHNDP+ +  +  RL TKTNNSGG
Sbjct: 234 CFDKLEAMLAHAMLSIPASKGFEIGSGFQGVSIPGSQHNDPFYMDEETGRLRTKTNNSGG 293

Query: 297 TQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESM 356
           TQGGI+NGENIYF V FK  ATISQEQ+TATY+G DG+LAA+GRHDP V PRA+PIVE+M
Sbjct: 294 TQGGISNGENIYFSVPFKSVATISQEQKTATYDGKDGILAAKGRHDPAVTPRAIPIVEAM 353

Query: 357 AALVIMDALMIQQSRKTVASLL 378
            ALV+ DAL+IQ+SR    S++
Sbjct: 354 TALVLADALLIQKSRDFARSVV 375



>gi|212547098|ref|XP_002153702.1| chorismate synthase, putative [Talaromyces marneffei ATCC 18224]
 gi|210064462|gb|EEA18558.1| chorismate synthase, putative [Talaromyces marneffei ATCC 18224]
          Length = 405

 Score =  518 bits (1333), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 265/405 (65%), Positives = 301/405 (74%), Gaps = 32/405 (7%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT+GESH  SVGCIVDGCPPG++L E DIQ Q+ RRRPGQS LTTPRDEK
Sbjct: 1   MSTFGDYFRVTTYGESHCHSVGCIVDGCPPGMALSEGDIQPQMTRRRPGQSALTTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSG E G TLGTPI L+V N+DQRP DY  S  DLYPRPSHAD+TYL+KY +KAS
Sbjct: 61  DRVEIQSGIECGFTLGTPIALIVHNEDQRPKDYGGSTMDLYPRPSHADFTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFP--- 175
           SGGGR+SARETIGRVAAGAIAEKYLKL H +EIVAFVSSV            E LFP   
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLKLAHNIEIVAFVSSVGK----------EDLFPPSP 170

Query: 176 --------EDFWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITC 226
                    +F  L+  I RE+VD+ A VRCPD   S +M E I   ++ KDS+GGT+ C
Sbjct: 171 EYPSYSRNPNFLRLIGAITREKVDEFAPVRCPDTEASQRMTEAIEVFRDKKDSIGGTVMC 230

Query: 227 VIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLK--- 283
           VIRNVP GLGEPCFDKLEAK  HAM+SIPATKGFEIGSGF G  + G  HNDP++     
Sbjct: 231 VIRNVPTGLGEPCFDKLEAKLGHAMMSIPATKGFEIGSGFGGCEVPGSVHNDPFIFTPEV 290

Query: 284 ---ND--RLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAAR 338
              ND  R+ TKTNNSGG QGGI+NG +IYFR+AFKPPATI Q Q T  Y+  +GVL A+
Sbjct: 291 GEINDKKRMTTKTNNSGGIQGGISNGADIYFRIAFKPPATIGQAQTTTKYDFEEGVLEAK 350

Query: 339 GRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNPN 383
           GRHDPCVVPRAVPIVE+M+ALVIMDAL+ Q SR+   SLLP  P 
Sbjct: 351 GRHDPCVVPRAVPIVEAMSALVIMDALLAQNSREASRSLLPKLPK 395



>gi|406863485|gb|EKD16532.1| chorismate synthase [Marssonina brunnea f. sp. 'multigermtubi'
           MB_m1]
          Length = 409

 Score =  518 bits (1333), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 269/410 (65%), Positives = 308/410 (75%), Gaps = 24/410 (5%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  F+VTT+GESH +SVGCIVDG PPG+ L E DIQ Q+ RRRPGQS LTTPR+E 
Sbjct: 1   MSTFGQYFKVTTYGESHCRSVGCIVDGVPPGMVLTEDDIQPQMTRRRPGQSALTTPRNEM 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           D V IQSGTE G+TLGTPI ++V N+DQRP DY  S  DLYPRPSHADWTYL+KY IKAS
Sbjct: 61  DTVEIQSGTEFGVTLGTPIAMIVRNKDQRPKDYGNSTMDLYPRPSHADWTYLEKYGIKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM--PFINEQDERLFPE 176
           SGGGR+SARETIGRVAA AIAEKYLKL HG+EIVAFVSSV N  M  P +        P 
Sbjct: 121 SGGGRSSARETIGRVAASAIAEKYLKLAHGIEIVAFVSSVGNKHMFPPSVEHPTPATNPA 180

Query: 177 DFWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGL 235
            F  L+ +I RE VD+   VRCPD T +  M + I + ++  DS+GGT+TCVIRNVP GL
Sbjct: 181 -FLSLIASITRERVDEFVPVRCPDTTAAKVMEDEIADFRDRDDSIGGTVTCVIRNVPSGL 239

Query: 236 GEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL------------K 283
           GEPCFDK+EA  AHAMLSIPA+KGFE+GSGF G  + G +HNDP+++            K
Sbjct: 240 GEPCFDKMEAMLAHAMLSIPASKGFEVGSGFGGCEVAGSRHNDPFIVAPVVPAMETGASK 299

Query: 284 ND----RLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVD-GVLAAR 338
           N     RL TKTNNSGG QGGITNG  IYFRVAFKPPATI Q Q T TY+G + GVL A+
Sbjct: 300 NGIPRPRLTTKTNNSGGIQGGITNGAPIYFRVAFKPPATIGQAQNTVTYSGDEGGVLEAK 359

Query: 339 GRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPP-NPNIPAA 387
           GRHDPCVVPRAVPIVE+MAALVI+D+LM QQSR+   SLLPP    IPAA
Sbjct: 360 GRHDPCVVPRAVPIVEAMAALVIVDSLMAQQSRQVTRSLLPPLKQTIPAA 409



>gi|344232370|gb|EGV64249.1| chorismate synthase [Candida tenuis ATCC 10573]
 gi|344232371|gb|EGV64250.1| hypothetical protein CANTEDRAFT_113839 [Candida tenuis ATCC 10573]
          Length = 378

 Score =  517 bits (1332), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 251/381 (65%), Positives = 302/381 (79%), Gaps = 9/381 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FGTLF+VTT+GESH KSVGCIV+G PPGL+L E DIQ QL RRRPGQS L+TPR+EK
Sbjct: 1   MSSFGTLFKVTTYGESHCKSVGCIVEGVPPGLALTEEDIQPQLTRRRPGQSKLSTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D+V IQSGTE G TLG+PIG+LV NQDQRPHDY E D++PRPSHAD TY+QKY +K+SSG
Sbjct: 61  DRVMIQSGTEFGKTLGSPIGMLVLNQDQRPHDYGEMDVFPRPSHADLTYIQKYGLKSSSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGRASARETIGRVAAGAIAE  LK ++ VEIVAFVS + N+AM      +       F +
Sbjct: 121 GGRASARETIGRVAAGAIAEHILKKINNVEIVAFVSQIGNVAM------NRDCNDPTFLK 174

Query: 181 LLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           +LNT  ++ +D    +RCPD+ V D+M + I + +++ DS+GG +TCVIRN P+GLGEPC
Sbjct: 175 ILNTATKDSIDATGPIRCPDENVKDEMVKVIEKHRDSNDSIGGVVTCVIRNCPIGLGEPC 234

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSGGT 297
           FDKLEA  AHAMLS+PATKGFEIGSGF+G  + G +HNDP+    +  RL T TNNSGG 
Sbjct: 235 FDKLEALLAHAMLSVPATKGFEIGSGFEGVKVPGSKHNDPFTYDENLKRLRTTTNNSGGI 294

Query: 298 QGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMA 357
           QGGI+NGENIYF VAFK  ATISQEQ T+TY+G DGVLAA+GRHDP V PRAVPIVE+MA
Sbjct: 295 QGGISNGENIYFSVAFKSAATISQEQPTSTYDGKDGVLAAKGRHDPSVTPRAVPIVEAMA 354

Query: 358 ALVIMDALMIQQSRKTVASLL 378
           ALVIMD ++IQ SR +   +L
Sbjct: 355 ALVIMDQVLIQNSRTSTIDML 375



>gi|392575988|gb|EIW69120.1| hypothetical protein TREMEDRAFT_39393 [Tremella mesenterica DSM
           1558]
          Length = 416

 Score =  517 bits (1331), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 250/370 (67%), Positives = 290/370 (78%), Gaps = 6/370 (1%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FG LFRV T+GESH KSVGCIVDG PPGL L E DIQ+QL RRRPGQS++TT R E 
Sbjct: 1   MSSFGKLFRVHTYGESHCKSVGCIVDGVPPGLKLTEEDIQVQLSRRRPGQSDITTARSEF 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V +QSG E G+TLGTPI LLV N+DQRPHDY+ETD YPRPSHAD+TYL KY +KASSG
Sbjct: 61  DTVHLQSGCEHGVTLGTPISLLVLNKDQRPHDYAETDSYPRPSHADYTYLAKYGVKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGRASARETIGRVAAGAIAEKYL   +G+EIVAFV  V  + +PF  E D  +  +++ +
Sbjct: 121 GGRASARETIGRVAAGAIAEKYLLECYGIEIVAFVQRVGKVGIPFA-EDDNEVLGKEYMD 179

Query: 181 LLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCF 240
           L+ +++R++VDK+  RCP K  S KM E I  +K A DS+GG ITCVIRN P GLGEP F
Sbjct: 180 LVKSVKRDQVDKEITRCPHKETSMKMEEAIRTSKAANDSLGGLITCVIRNCPPGLGEPAF 239

Query: 241 DKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKNDRLG-----TKTNNSG 295
           DKLEA  AHAMLSIP+TK FEIGSG +GT   G +HNDPW+   D  G     T TN SG
Sbjct: 240 DKLEAMLAHAMLSIPSTKSFEIGSGLRGTMFHGSEHNDPWIEGVDSKGEKVLRTSTNWSG 299

Query: 296 GTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVES 355
           G QGGI+NGE+IYFRV FKPPATI+QEQ TA Y+G  GVLAA+GRHDPCVVPRAVPIVE+
Sbjct: 300 GVQGGISNGEDIYFRVGFKPPATIAQEQSTARYDGSAGVLAAKGRHDPCVVPRAVPIVET 359

Query: 356 MAALVIMDAL 365
           M+ALVIMD L
Sbjct: 360 MSALVIMDML 369



>gi|241959118|ref|XP_002422278.1| 5-enolpyruvylshikimate-3-phosphate phospholyase, putative;
           bifunctional chorismate synthase and flavin reductase,
           putative; chorismate synthase, putative [Candida
           dubliniensis CD36]
 gi|223645623|emb|CAX40282.1| 5-enolpyruvylshikimate-3-phosphate phospholyase, putative [Candida
           dubliniensis CD36]
          Length = 378

 Score =  517 bits (1331), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 265/386 (68%), Positives = 311/386 (80%), Gaps = 13/386 (3%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FGTLF+VTT+GESH KSVGCIVDGCPPG+SL EADIQ QL RRRPGQS L+TPRDEK
Sbjct: 1   MSSFGTLFKVTTYGESHCKSVGCIVDGCPPGMSLTEADIQPQLTRRRPGQSKLSTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V IQSGTE+G+TLG+PIG++V N+D RP DYSETDLYPRPSHADWTY+QKY  K+SSG
Sbjct: 61  DLVEIQSGTENGLTLGSPIGMIVRNKDHRPGDYSETDLYPRPSHADWTYIQKYGTKSSSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPED--F 178
           GGR+SARETIGRVAAGAIAEK L  V+ VEIVAFVSS+  I+M   N+      P+D  F
Sbjct: 121 GGRSSARETIGRVAAGAIAEKILAKVNNVEIVAFVSSIGEISM---NKS-----PQDAKF 172

Query: 179 WELLNTIRREEVDK-DAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGE 237
            +LLNTI RE+VD    +RCPD+ V ++M + I + ++AKDS+GG +TCVIRN P+GLGE
Sbjct: 173 QQLLNTITREQVDSVGPIRCPDENVREEMVKVIEKYRDAKDSIGGVVTCVIRNCPIGLGE 232

Query: 238 PCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSG 295
           PCFDKLEAK AHAMLS+PATKGFE GSGF+G  + G +HND +    +  RL T+TNNSG
Sbjct: 233 PCFDKLEAKLAHAMLSLPATKGFEFGSGFEGIKIPGSKHNDAFYYDENFGRLRTQTNNSG 292

Query: 296 GTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVES 355
           G QGGI+NGENIYF VAFK  ATISQEQETATY+G  GVLAARGRHDP V PRAVPIVE+
Sbjct: 293 GIQGGISNGENIYFSVAFKSAATISQEQETATYDGKSGVLAARGRHDPSVTPRAVPIVEA 352

Query: 356 MAALVIMDALMIQQSRKTVASLLPPN 381
           M ALV+ D  MIQQ+R +   L+  N
Sbjct: 353 MTALVLCDEYMIQQARTSTRLLVQDN 378



>gi|68492225|ref|XP_710110.1| hypothetical protein CaO19.1986 [Candida albicans SC5314]
 gi|46431237|gb|EAK90838.1| hypothetical protein CaO19.1986 [Candida albicans SC5314]
          Length = 378

 Score =  516 bits (1329), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 264/384 (68%), Positives = 309/384 (80%), Gaps = 9/384 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FGTLF+VTT+GESH KSVGCIVDGCPPG+SL EADIQ QL RRRPGQS L+TPRDEK
Sbjct: 1   MSSFGTLFKVTTYGESHCKSVGCIVDGCPPGMSLTEADIQPQLTRRRPGQSKLSTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V IQSGTE+G+TLG+PIG++V N+D RP DYSETDLYPRPSHADWTY+QKY  K+SSG
Sbjct: 61  DLVEIQSGTENGLTLGSPIGMIVRNKDHRPGDYSETDLYPRPSHADWTYIQKYGTKSSSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGR+SARETIGRVAAGAIAEK L  V+ VEIVAFVS++  I+M   + QD +     F E
Sbjct: 121 GGRSSARETIGRVAAGAIAEKILAKVNNVEIVAFVSAIGEISMS-KSPQDAK-----FQE 174

Query: 181 LLNTIRREEVDK-DAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           LLNTI RE+VD    +RCPD  V ++M + I + ++AKDS+GG +TCVIRN P+GLGEPC
Sbjct: 175 LLNTITREQVDGVGPIRCPDANVREEMVKVIEKYRDAKDSIGGVVTCVIRNCPIGLGEPC 234

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSGGT 297
           FDKLEAK AHAMLS+PATKGFE GSGF+G  + G +HND +    +  RL T+TNNSGG 
Sbjct: 235 FDKLEAKLAHAMLSLPATKGFEFGSGFEGIKIPGSKHNDAFYYDENFGRLRTETNNSGGI 294

Query: 298 QGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMA 357
           QGGI+NGENIYF VAFK  ATISQEQETATY+G  GVLAARGRHDP V PRAVPIVE+M 
Sbjct: 295 QGGISNGENIYFSVAFKSAATISQEQETATYDGKSGVLAARGRHDPSVTPRAVPIVEAMT 354

Query: 358 ALVIMDALMIQQSRKTVASLLPPN 381
           ALV+ D  MIQQ+R +   L+  N
Sbjct: 355 ALVLCDEYMIQQARTSTRLLVQDN 378



>gi|242807349|ref|XP_002484937.1| chorismate synthase, putative [Talaromyces stipitatus ATCC 10500]
 gi|218715562|gb|EED14984.1| chorismate synthase, putative [Talaromyces stipitatus ATCC 10500]
          Length = 405

 Score =  516 bits (1328), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 259/394 (65%), Positives = 298/394 (75%), Gaps = 32/394 (8%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT+GESH +SVGCIVDGCPPG++L E DIQ Q+ RRRPGQS LTTPRDEK
Sbjct: 1   MSTFGDYFRVTTYGESHCRSVGCIVDGCPPGMALSEGDIQPQMTRRRPGQSALTTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE G TLGTPI L+V N+DQRP DY  S  DLYPRPSHAD+TYL+KY +KAS
Sbjct: 61  DRVEIQSGTECGFTLGTPIALIVHNEDQRPKDYGGSTMDLYPRPSHADFTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFP--- 175
           SGGGR+SARETIGRVAAGAIAEKYLKL H +EIVAFVSSV            E LFP   
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLKLAHNIEIVAFVSSVGK----------EELFPPSP 170

Query: 176 --------EDFWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITC 226
                    +F  L+ TI RE+VD+ A VRCPD   S +M + I   ++ KDS+GGT+ C
Sbjct: 171 EYPSYSTNSNFLRLIGTITREKVDEFAPVRCPDTEASKRMTKAIEAFRDKKDSIGGTVMC 230

Query: 227 VIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL---- 282
           VIRNVP GLGEPCFDKLEAK  HAM+SIPATKGFEIGSGF G  + G  HNDP+++    
Sbjct: 231 VIRNVPAGLGEPCFDKLEAKLGHAMMSIPATKGFEIGSGFGGCEVPGSVHNDPFIVTPEV 290

Query: 283 ----KNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAAR 338
                  RL  KTNNSGG QGGI+NG +IYFR+AFKPPATI Q Q T  Y+  +GVL A+
Sbjct: 291 GGISDKKRLTAKTNNSGGIQGGISNGADIYFRIAFKPPATIGQAQTTTKYDFEEGVLEAK 350

Query: 339 GRHDPCVVPRAVPIVESMAALVIMDALMIQQSRK 372
           GRHDPCVVPRAVPIVE+M+ALVIMDAL+ Q+SR+
Sbjct: 351 GRHDPCVVPRAVPIVEAMSALVIMDALLAQKSRE 384



>gi|459372659|gb|EMG50062.1| Chorismate synthase [Candida maltosa Xu316]
          Length = 378

 Score =  515 bits (1327), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 260/383 (67%), Positives = 309/383 (80%), Gaps = 13/383 (3%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FGTLF+VTT+GESH KSVGCIVDGCPPGL+L EADIQ QL RRRPGQS L+TPRDEK
Sbjct: 1   MSSFGTLFKVTTYGESHCKSVGCIVDGCPPGLALTEADIQPQLTRRRPGQSKLSTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V IQSGTE+G+TLG+PIG++V N+D RP DYSETDLYPRPSHADWTY+QKY  K+SSG
Sbjct: 61  DLVEIQSGTENGLTLGSPIGMMVRNKDHRPGDYSETDLYPRPSHADWTYIQKYGTKSSSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPED--F 178
           GGR+SARETIGRVAAGA+AEK L  V+ VEIVAFVSS+  ++M           P+D  F
Sbjct: 121 GGRSSARETIGRVAAGAVAEKILSKVNNVEIVAFVSSIGEVSM--------NRSPQDPEF 172

Query: 179 WELLNTIRREEVDK-DAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGE 237
            ++LN+I REEVD    +RCPD  V ++M + I + ++AKDS+GG +TCV+RN P+GLGE
Sbjct: 173 QKILNSITREEVDGVGPIRCPDANVREEMVKVIEKYRDAKDSIGGVVTCVVRNCPIGLGE 232

Query: 238 PCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSG 295
           PCFDKLEAK AHAMLS+PATKGFE GSGF+GT + G +HNDP+    +  RL TKTNNSG
Sbjct: 233 PCFDKLEAKLAHAMLSLPATKGFEFGSGFEGTKIPGSKHNDPFYYDENFGRLKTKTNNSG 292

Query: 296 GTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVES 355
           G QGGI+NGENIYF VAFK  ATISQEQ T+TY+G DGVLAARGRHDP V PRAVPIVE+
Sbjct: 293 GIQGGISNGENIYFSVAFKSAATISQEQPTSTYDGKDGVLAARGRHDPSVTPRAVPIVEA 352

Query: 356 MAALVIMDALMIQQSRKTVASLL 378
           M ALV+ D  +IQQ+R +   L+
Sbjct: 353 MTALVLCDEFLIQQARNSTRLLV 375



>gi|512206005|gb|EPE34825.1| Chorismate synthase, AroC [Glarea lozoyensis ATCC 20868]
          Length = 417

 Score =  515 bits (1327), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 262/402 (65%), Positives = 302/402 (75%), Gaps = 23/402 (5%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  F+VTT+GESH +SVGCIVDG PPG+ L E DIQ Q+ RRRPGQS LTTPR+E 
Sbjct: 1   MSTFGDFFKVTTYGESHCRSVGCIVDGVPPGMELTEEDIQPQMTRRRPGQSALTTPRNEM 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           D V IQSGTE GITLGTPI ++V N+DQRP DY  S  D+YPRPSHADWTYL+KY +KAS
Sbjct: 61  DTVEIQSGTEFGITLGTPIAMVVRNKDQRPKDYGNSTMDMYPRPSHADWTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM--PFINEQDERLFPE 176
           SGGGR+SARETIGRVAA AIAEKYLKL HG+EIVA+ SSV  I M  P          P 
Sbjct: 121 SGGGRSSARETIGRVAASAIAEKYLKLSHGIEIVAWTSSVGGIHMFPPTATHPTPSTNPA 180

Query: 177 DFWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGL 235
            F  L++TI RE+VD+   VRCPD+  SD+M E I   ++  DS+GGT+TCVIRNVP GL
Sbjct: 181 -FLSLIDTITREKVDEFVPVRCPDQAASDRMAEEIAAFRDKSDSIGGTVTCVIRNVPSGL 239

Query: 236 GEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND---------- 285
           GEPCFDK+EA  AHAMLSIPA+KGFEIGSGF G  + G  HNDP++L  +          
Sbjct: 240 GEPCFDKIEAMLAHAMLSIPASKGFEIGSGFGGCEVPGSIHNDPFILAPEVPPLETGATR 299

Query: 286 ------RLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNG-VDGVLAAR 338
                 RL TKTNNSGG QGGITNG +IYF+V FKPPATI Q Q TATY+G   G L A+
Sbjct: 300 NGIPRPRLTTKTNNSGGIQGGITNGAHIYFKVGFKPPATIGQAQNTATYDGDASGTLEAK 359

Query: 339 GRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPP 380
           GRHDPCVVPRAVPIVE+MAALV++DALM QQSR+   S+LPP
Sbjct: 360 GRHDPCVVPRAVPIVEAMAALVVVDALMAQQSRQVSRSMLPP 401



>gi|67539122|ref|XP_663335.1| hypothetical protein AN5731.2 [Aspergillus nidulans FGSC A4]
 gi|40743634|gb|EAA62824.1| hypothetical protein AN5731.2 [Aspergillus nidulans FGSC A4]
 gi|259484792|tpe|CBF81316.1| TPA: chorismate synthase (Eurofung) [Aspergillus nidulans FGSC A4]
          Length = 410

 Score =  515 bits (1327), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 258/398 (64%), Positives = 305/398 (76%), Gaps = 16/398 (4%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MST+G  FRVTT+GESH +SVGCIVDGCPPG+ L E DIQ Q+ RRRPGQS LTTPR+EK
Sbjct: 1   MSTWGDYFRVTTYGESHCRSVGCIVDGCPPGMELTEDDIQPQMTRRRPGQSALTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE G+TLGTPI ++V N+DQRP DY     D+YPRPSHAD+TYL+KY +KAS
Sbjct: 61  DRVEIQSGTEFGVTLGTPIAMVVRNEDQRPKDYGNKTMDMYPRPSHADFTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM-PFINEQDERLFPED 177
           SGGGR+SARETIGRVAAGAIAEKYL+L HGVEIVAFVSSV N  + P   E        +
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLRLSHGVEIVAFVSSVGNEHLFPPTPEHPSPATNPE 180

Query: 178 FWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           F  L+  I R  VD  A  RCP++  + +M + I   ++  DS+GGT+TCVIRNVPVGLG
Sbjct: 181 FLSLIEKIDRATVDAHAPTRCPNEAAAARMTKVIEHFRDNSDSIGGTVTCVIRNVPVGLG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLK------------N 284
           EPCFDKLEA+ AHAMLSIPATKGFEIGSGF G  + G  HNDP+V               
Sbjct: 241 EPCFDKLEAQLAHAMLSIPATKGFEIGSGFGGCEVPGSIHNDPFVASEVQTQLGSQNTTK 300

Query: 285 DRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPC 344
            RL TKTNNSGG QGGI+NG +IYFRVAFKPPATI Q Q+TATY+  +GVL A+GRHDPC
Sbjct: 301 QRLVTKTNNSGGIQGGISNGASIYFRVAFKPPATIGQAQQTATYDFGEGVLEAKGRHDPC 360

Query: 345 VVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNP 382
           VVPRAVPIVE+M+ALV+MD+L+ Q +R++  +LLPP P
Sbjct: 361 VVPRAVPIVEAMSALVVMDSLLAQYARESAKTLLPPLP 398



>gi|40889605|pdb|1R52|A Chain A, Crystal Structure Of The Bifunctional Chorismate Synthase
           From Saccharomyces Cerevisiae
 gi|40889606|pdb|1R52|B Chain B, Crystal Structure Of The Bifunctional Chorismate Synthase
           From Saccharomyces Cerevisiae
 gi|40889607|pdb|1R52|C Chain C, Crystal Structure Of The Bifunctional Chorismate Synthase
           From Saccharomyces Cerevisiae
 gi|40889608|pdb|1R52|D Chain D, Crystal Structure Of The Bifunctional Chorismate Synthase
           From Saccharomyces Cerevisiae
 gi|40889609|pdb|1R53|A Chain A, Crystal Structure Of The Bifunctional Chorismate Synthase
           From Saccharomyces Cerevisiae
          Length = 382

 Score =  515 bits (1326), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 251/381 (65%), Positives = 302/381 (79%), Gaps = 9/381 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG LFRVTT+GESH KSVGCIVDG PPG+SL EADIQ QL RRRPGQS L+TPRDEK
Sbjct: 1   MSTFGKLFRVTTYGESHCKSVGCIVDGVPPGMSLTEADIQPQLTRRRPGQSKLSTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D+V IQSGTE G TLGTPI +++ N+DQRPHDYS+ D +PRPSHAD+TY +KY IKASSG
Sbjct: 61  DRVEIQSGTEFGKTLGTPIAMMIKNEDQRPHDYSDMDKFPRPSHADFTYSEKYGIKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGRASARETIGRVA+GAIAEK+L     VEIVAFV+ +  I M      +   F  +F  
Sbjct: 121 GGRASARETIGRVASGAIAEKFLAQNSNVEIVAFVTQIGEIKM------NRDSFDPEFQH 174

Query: 181 LLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           LLNTI RE+VD    +RCPD +V+  M + I + +  KDS+GG +TCV+RN+P GLGEPC
Sbjct: 175 LLNTITREKVDSMGPIRCPDASVAGLMVKEIEKYRGNKDSIGGVVTCVVRNLPTGLGEPC 234

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSGGT 297
           FDKLEA  AHAMLSIPA+KGFEIGSGF+G ++ G +HNDP+  + +  RL TKTNNSGG 
Sbjct: 235 FDKLEAMLAHAMLSIPASKGFEIGSGFQGVSVPGSKHNDPFYFEKETNRLRTKTNNSGGV 294

Query: 298 QGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMA 357
           QGGI+NGENIYF V FK  ATISQEQ+TATY+G +G+LAA+GRHDP V PRA+PIVE+M 
Sbjct: 295 QGGISNGENIYFSVPFKSVATISQEQKTATYDGEEGILAAKGRHDPAVTPRAIPIVEAMT 354

Query: 358 ALVIMDALMIQQSRKTVASLL 378
           ALV+ DAL+IQ++R    S++
Sbjct: 355 ALVLADALLIQKARDFSRSVV 375



>gi|6321290|ref|NP_011367.1| bifunctional chorismate synthase/riboflavin reductase [NAD(P)H]
           ARO2 [Saccharomyces cerevisiae S288c]
 gi|114186|sp|P28777.1|AROC_YEAST RecName: Full=Chorismate synthase; AltName:
           Full=5-enolpyruvylshikimate-3-phosphate phospholyase
 gi|3387|emb|CAA42745.1| chorismate synthase [Saccharomyces cerevisiae]
 gi|1322732|emb|CAA96860.1| ARO2 [Saccharomyces cerevisiae]
 gi|1498236|emb|CAA68214.1| ARO2 [Saccharomyces cerevisiae]
 gi|190407094|gb|EDV10361.1| chorismate synthase [Saccharomyces cerevisiae RM11-1a]
 gi|207345435|gb|EDZ72257.1| YGL148Wp-like protein [Saccharomyces cerevisiae AWRI1631]
 gi|256272239|gb|EEU07230.1| Aro2p [Saccharomyces cerevisiae JAY291]
 gi|259146361|emb|CAY79618.1| Aro2p [Saccharomyces cerevisiae EC1118]
 gi|285812062|tpg|DAA07962.1| TPA: bifunctional chorismate synthase/riboflavin reductase
           [NAD(P)H] ARO2 [Saccharomyces cerevisiae S288c]
 gi|323304981|gb|EGA58735.1| Aro2p [Saccharomyces cerevisiae FostersB]
 gi|323309153|gb|EGA62380.1| Aro2p [Saccharomyces cerevisiae FostersO]
 gi|323333639|gb|EGA75032.1| Aro2p [Saccharomyces cerevisiae AWRI796]
 gi|323337557|gb|EGA78802.1| Aro2p [Saccharomyces cerevisiae Vin13]
 gi|323348700|gb|EGA82942.1| Aro2p [Saccharomyces cerevisiae Lalvin QA23]
 gi|323355071|gb|EGA86901.1| Aro2p [Saccharomyces cerevisiae VL3]
 gi|349578082|dbj|GAA23248.1| K7_Aro2p [Saccharomyces cerevisiae Kyokai no. 7]
 gi|392299114|gb|EIW10208.1| Aro2p [Saccharomyces cerevisiae CEN.PK113-7D]
          Length = 376

 Score =  515 bits (1326), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 251/381 (65%), Positives = 302/381 (79%), Gaps = 9/381 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG LFRVTT+GESH KSVGCIVDG PPG+SL EADIQ QL RRRPGQS L+TPRDEK
Sbjct: 1   MSTFGKLFRVTTYGESHCKSVGCIVDGVPPGMSLTEADIQPQLTRRRPGQSKLSTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D+V IQSGTE G TLGTPI +++ N+DQRPHDYS+ D +PRPSHAD+TY +KY IKASSG
Sbjct: 61  DRVEIQSGTEFGKTLGTPIAMMIKNEDQRPHDYSDMDKFPRPSHADFTYSEKYGIKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGRASARETIGRVA+GAIAEK+L     VEIVAFV+ +  I M      +   F  +F  
Sbjct: 121 GGRASARETIGRVASGAIAEKFLAQNSNVEIVAFVTQIGEIKM------NRDSFDPEFQH 174

Query: 181 LLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           LLNTI RE+VD    +RCPD +V+  M + I + +  KDS+GG +TCV+RN+P GLGEPC
Sbjct: 175 LLNTITREKVDSMGPIRCPDASVAGLMVKEIEKYRGNKDSIGGVVTCVVRNLPTGLGEPC 234

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSGGT 297
           FDKLEA  AHAMLSIPA+KGFEIGSGF+G ++ G +HNDP+  + +  RL TKTNNSGG 
Sbjct: 235 FDKLEAMLAHAMLSIPASKGFEIGSGFQGVSVPGSKHNDPFYFEKETNRLRTKTNNSGGV 294

Query: 298 QGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMA 357
           QGGI+NGENIYF V FK  ATISQEQ+TATY+G +G+LAA+GRHDP V PRA+PIVE+M 
Sbjct: 295 QGGISNGENIYFSVPFKSVATISQEQKTATYDGEEGILAAKGRHDPAVTPRAIPIVEAMT 354

Query: 358 ALVIMDALMIQQSRKTVASLL 378
           ALV+ DAL+IQ++R    S++
Sbjct: 355 ALVLADALLIQKARDFSRSVV 375



>gi|68492031|ref|XP_710211.1| hypothetical protein CaO19.3489 [Candida albicans SC5314]
 gi|46431368|gb|EAK90945.1| hypothetical protein CaO19.3489 [Candida albicans SC5314]
          Length = 413

 Score =  515 bits (1326), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 264/386 (68%), Positives = 309/386 (80%), Gaps = 13/386 (3%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FGTLF+VTT+GESH KSVGCIVDGCPPG+SL EADIQ QL RRRPGQS L+TPRDEK
Sbjct: 36  MSSFGTLFKVTTYGESHCKSVGCIVDGCPPGMSLTEADIQPQLTRRRPGQSKLSTPRDEK 95

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V IQSGTE+G+TLG+PIG++V N+D RP DYSETDLYPRPSHADWTY+QKY  K+SSG
Sbjct: 96  DLVEIQSGTENGLTLGSPIGMIVRNKDHRPGDYSETDLYPRPSHADWTYIQKYGTKSSSG 155

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPED--F 178
           GGR+SARETIGRVAAGAIAEK L  V+ VEIVAFVS++  I+M   N+      P+D  F
Sbjct: 156 GGRSSARETIGRVAAGAIAEKILAKVNNVEIVAFVSAIGEISM---NKS-----PQDAKF 207

Query: 179 WELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGE 237
            ELLNTI RE+VD    +RCPD  V ++M + I + ++AKDS+GG +TCVIRN P+GLGE
Sbjct: 208 QELLNTITREQVDGVGPIRCPDANVREEMVKVIEKYRDAKDSIGGVVTCVIRNCPIGLGE 267

Query: 238 PCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSG 295
           PCFDKLEAK AHAMLS+PATKGFE GSGF+G  + G  HND +    +  RL T+T+NSG
Sbjct: 268 PCFDKLEAKLAHAMLSLPATKGFEFGSGFEGIKIPGSNHNDAFYYDENFGRLRTETHNSG 327

Query: 296 GTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVES 355
           G QGGI+NGENIYF VAFK  ATISQEQETATY+G  GVLAARGRHDP V PRAVPIVE+
Sbjct: 328 GIQGGISNGENIYFSVAFKSAATISQEQETATYDGKSGVLAARGRHDPSVTPRAVPIVEA 387

Query: 356 MAALVIMDALMIQQSRKTVASLLPPN 381
           M ALV+ D  MIQQ+R +   L+  N
Sbjct: 388 MTALVLCDEYMIQQARTSTRLLVQDN 413



>gi|358373457|dbj|GAA90055.1| chorismate synthase [Aspergillus kawachii IFO 4308]
          Length = 414

 Score =  514 bits (1325), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 260/402 (64%), Positives = 304/402 (75%), Gaps = 36/402 (8%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MST+G  FRVTT+GESH +SVGCIVDGCPPG+ L E DIQ Q+ RRRPGQS LTTPR+EK
Sbjct: 1   MSTWGDYFRVTTYGESHCRSVGCIVDGCPPGMELTEDDIQPQMTRRRPGQSALTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE G+TLGTPIG++V N+DQRP DY  S  DLYPRPSHAD TYL+KY +KAS
Sbjct: 61  DRVEIQSGTEFGVTLGTPIGMMVRNEDQRPKDYGNSTMDLYPRPSHADLTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFP--- 175
           SGGGR+SARETIGRVAAGAIAEKYL+L HGVEIVAFVSSV N          E LFP   
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLRLSHGVEIVAFVSSVGN----------EHLFPPTP 170

Query: 176 --------EDFWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITC 226
                    ++  LL TI R  VD+ A  RCP+   + +M + I + ++  DS+GGT+TC
Sbjct: 171 EHPTASTNPEYLNLLKTITRTTVDEFAPTRCPNADAAARMTKVIEQFRDNHDSIGGTVTC 230

Query: 227 VIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKN-- 284
           VIRNVPVGLGEPCFDKLEAK AHAMLSIPATKGFEIGSGF G  + G  HNDP+++ +  
Sbjct: 231 VIRNVPVGLGEPCFDKLEAKLAHAMLSIPATKGFEIGSGFGGCEVPGSIHNDPFIVSDVP 290

Query: 285 ----------DRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGV 334
                      RL TKTNNSGG QGGI+NG +IYFR+AFKPPATI Q Q TATY+  +G+
Sbjct: 291 TQLGTNTTTKQRLTTKTNNSGGIQGGISNGADIYFRIAFKPPATIGQAQNTATYDFGEGI 350

Query: 335 LAARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVAS 376
           L A+GRHDPCV PRAVPIVE+M+ALV+MDALM Q SR++  S
Sbjct: 351 LEAKGRHDPCVTPRAVPIVEAMSALVVMDALMAQYSRESAKS 392



>gi|296826856|ref|XP_002851041.1| chorismate synthase [Arthroderma otae CBS 113480]
 gi|238838595|gb|EEQ28257.1| chorismate synthase [Arthroderma otae CBS 113480]
          Length = 413

 Score =  514 bits (1325), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 258/383 (67%), Positives = 304/383 (79%), Gaps = 11/383 (2%)

Query: 1   MSTFGTLFRVTTF---GESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPR 57
           MSTFG  FRVTT+   GESH +SVGCIVDGCPPG+ L EADIQ Q+ RRRPGQS LTTPR
Sbjct: 1   MSTFGEYFRVTTYTSYGESHCRSVGCIVDGCPPGMELTEADIQPQMTRRRPGQSALTTPR 60

Query: 58  DEKDKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSI 115
           +EKDKV IQSGTE GITLGTPIG++V N+DQRP DY  S  D+YPRPSHAD+TYL+KY +
Sbjct: 61  NEKDKVEIQSGTEFGITLGTPIGMVVRNEDQRPKDYGNSTMDMYPRPSHADFTYLEKYGV 120

Query: 116 KASSGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM-PFINEQDERLF 174
           KASSGGGR+SARETIGRVAAGAIAEKYLKL H VEIV+FV+SV +  + P   E    + 
Sbjct: 121 KASSGGGRSSARETIGRVAAGAIAEKYLKLSHNVEIVSFVTSVGHEHLFPPTAEHPSPVT 180

Query: 175 PEDFWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPV 233
             +F +L+ TI R+ VD  A +RCP    + +M + I   ++  DS+GGT+TCVIRNVP+
Sbjct: 181 NPEFLKLIETIDRKTVDSFAPIRCPHADAAQRMTKLIEHHRDLSDSIGGTVTCVIRNVPI 240

Query: 234 GLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND----RLGT 289
           GLGEPCFDKLEAK AHAMLSIPATKGFEIGSGF G  + G  HNDP+V+  +    RL T
Sbjct: 241 GLGEPCFDKLEAKLAHAMLSIPATKGFEIGSGFLGCEIPGSIHNDPFVVDTNGTGKRLTT 300

Query: 290 KTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRA 349
           KTNNSGG QGGI+NG +IYFRVAFKPPATI Q Q TA+Y+  +GVL A+GRHDPCVVPRA
Sbjct: 301 KTNNSGGIQGGISNGASIYFRVAFKPPATIGQAQTTASYSFEEGVLEAKGRHDPCVVPRA 360

Query: 350 VPIVESMAALVIMDALMIQQSRK 372
           VPIVE+M+ALVI+DALM Q +R+
Sbjct: 361 VPIVEAMSALVIIDALMAQNARE 383



>gi|151943663|gb|EDN61973.1| chorismate synthase [Saccharomyces cerevisiae YJM789]
          Length = 376

 Score =  514 bits (1325), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 251/381 (65%), Positives = 301/381 (79%), Gaps = 9/381 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG LFRVTT+GESH KSVGCIVDG PPG+SL EADIQ QL RRRPGQS L+TPRDEK
Sbjct: 1   MSTFGKLFRVTTYGESHCKSVGCIVDGVPPGMSLTEADIQPQLTRRRPGQSKLSTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D+V IQSGTE G TLGTPI +++ N+DQRPHDYS  D +PRPSHAD+TY +KY IKASSG
Sbjct: 61  DRVEIQSGTEFGKTLGTPIAMMIKNEDQRPHDYSNMDKFPRPSHADFTYSEKYGIKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGRASARETIGRVA+GAIAEK+L     VEIVAFV+ +  I M      +   F  +F  
Sbjct: 121 GGRASARETIGRVASGAIAEKFLAQNSNVEIVAFVTQIGEIKM------NRDSFDPEFQH 174

Query: 181 LLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           LLNTI RE+VD    +RCPD +V+  M + I + +  KDS+GG +TCV+RN+P GLGEPC
Sbjct: 175 LLNTITREKVDSMGPIRCPDASVAGLMVKEIEKYRGNKDSIGGVVTCVVRNLPTGLGEPC 234

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSGGT 297
           FDKLEA  AHAMLSIPA+KGFEIGSGF+G ++ G +HNDP+  + +  RL TKTNNSGG 
Sbjct: 235 FDKLEAMLAHAMLSIPASKGFEIGSGFQGVSVPGSKHNDPFYFEKETNRLRTKTNNSGGV 294

Query: 298 QGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMA 357
           QGGI+NGENIYF V FK  ATISQEQ+TATY+G +G+LAA+GRHDP V PRA+PIVE+M 
Sbjct: 295 QGGISNGENIYFSVPFKSVATISQEQKTATYDGEEGILAAKGRHDPAVTPRAIPIVEAMT 354

Query: 358 ALVIMDALMIQQSRKTVASLL 378
           ALV+ DAL+IQ++R    S++
Sbjct: 355 ALVLADALLIQKARDFSRSVV 375



>gi|149238536|ref|XP_001525144.1| chorismate synthase [Lodderomyces elongisporus NRRL YB-4239]
 gi|146450637|gb|EDK44893.1| chorismate synthase [Lodderomyces elongisporus NRRL YB-4239]
          Length = 379

 Score =  514 bits (1324), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 258/383 (67%), Positives = 307/383 (80%), Gaps = 13/383 (3%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FGTLF+VTT+GESH KSVGCIVDGCPPGL L EADIQ QL RRRPGQS L+TPR+E 
Sbjct: 1   MSSFGTLFKVTTYGESHCKSVGCIVDGCPPGLKLSEADIQPQLTRRRPGQSKLSTPRNEA 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V IQSGTE+G+TLG+PIG++V N+D RP DYSETDLYPRPSHAD+TY+QKY +K+ SG
Sbjct: 61  DAVEIQSGTENGVTLGSPIGMMVRNKDHRPGDYSETDLYPRPSHADYTYIQKYGLKSGSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPED--F 178
           GGR+SARETIGRVAAGAIAEK L  V+ VEIVAFVSS+  ++M           P+D  F
Sbjct: 121 GGRSSARETIGRVAAGAIAEKILTAVNNVEIVAFVSSIGEVSM--------NRSPQDPAF 172

Query: 179 WELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGE 237
            ++LNTI REEVD    +RCPD +V D+M + I + ++AKDS+GG +TCVIRN P+GLGE
Sbjct: 173 QKILNTITREEVDGAGPIRCPDASVRDEMVKVIEKYRDAKDSIGGVVTCVIRNCPIGLGE 232

Query: 238 PCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSG 295
           PCFDKLEA  AHAMLS+PATKGFE GSGF+GT + G +HND ++   +  RL TKTNNSG
Sbjct: 233 PCFDKLEATLAHAMLSLPATKGFEFGSGFEGTKIPGSKHNDLFIFDEEKKRLRTKTNNSG 292

Query: 296 GTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVES 355
           G QGGI+NGENIYF VAFK  ATISQEQET TY G  GVLAARGRHDP V PRAVPIVE+
Sbjct: 293 GVQGGISNGENIYFSVAFKSAATISQEQETVTYEGKSGVLAARGRHDPSVTPRAVPIVEA 352

Query: 356 MAALVIMDALMIQQSRKTVASLL 378
           MA++V+ D  +IQQ+R +  S+L
Sbjct: 353 MASIVLCDQYLIQQARNSTRSIL 375



>gi|255938850|ref|XP_002560195.1| Pc14g02010 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211584816|emb|CAP74342.1| Pc14g02010 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 410

 Score =  514 bits (1323), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 258/404 (63%), Positives = 305/404 (75%), Gaps = 31/404 (7%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MST+G  FRVTT+GESH +SVGCIVDGCPPGL + EADIQ Q+ RRRPGQS LTTPRDEK
Sbjct: 1   MSTWGQYFRVTTYGESHCRSVGCIVDGCPPGLEITEADIQPQMTRRRPGQSALTTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE G+TLGTPI ++V N+DQRP DY  S  DLYPRPSHAD+TYL+KY +KAS
Sbjct: 61  DRVEIQSGTEFGVTLGTPIAMVVRNEDQRPKDYGGSTMDLYPRPSHADFTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFP--- 175
           SGGGR+SARETIGRVAAGAIAEK+L L H +EIVAFVSSV N          E LFP   
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKFLSLAHNIEIVAFVSSVGN----------EHLFPPTP 170

Query: 176 --------EDFWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITC 226
                    +F +L+ TI R+ VD  A +RCP+   + +M + I + ++  DS+GGT+TC
Sbjct: 171 EHPSPSTNPEFLKLIETIDRKTVDSFAPIRCPETDAAQRMTKVIEKFRDNHDSIGGTVTC 230

Query: 227 VIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND- 285
           VIRNVPVGLGEPCFDKLEAK  HAMLSIPATKGFEIGSGF G  + G  HNDP++  +  
Sbjct: 231 VIRNVPVGLGEPCFDKLEAKLGHAMLSIPATKGFEIGSGFGGCEVPGSIHNDPFIANSST 290

Query: 286 ------RLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARG 339
                 RL TKTNNSGG QGGI+NG +IYFRVAFKP ATI Q Q T +Y+G +GVL A+G
Sbjct: 291 SEAGGPRLTTKTNNSGGIQGGISNGASIYFRVAFKPAATIGQAQTTTSYDGEEGVLEAKG 350

Query: 340 RHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNPN 383
           RHDPCV PRAVPIVE+M++LV+MDALM Q +R+   +LLP  P 
Sbjct: 351 RHDPCVTPRAVPIVEAMSSLVVMDALMAQYAREGAKNLLPRKPQ 394



>gi|385305904|gb|EIF49847.1| chorismate synthase [Dekkera bruxellensis AWRI1499]
          Length = 374

 Score =  514 bits (1323), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 252/379 (66%), Positives = 297/379 (78%), Gaps = 7/379 (1%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFGTLF+VTT+GESH KSVGCIVDG PP +SL E DIQ QL RRRPGQS L+TPR+EK
Sbjct: 1   MSTFGTLFKVTTYGESHCKSVGCIVDGVPPNMSLTEEDIQPQLSRRRPGQSKLSTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D+V IQSGTE G TLGTPIG+LV N++QRP DYSE   YPRPSHAD+TY++KY IKASSG
Sbjct: 61  DRVYIQSGTEFGKTLGTPIGMLVLNENQRPKDYSEMAKYPRPSHADYTYIEKYGIKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGRASARETIGRVAAGAIAEK+LK  + VEIVAFVS V    +   ++  E      F E
Sbjct: 121 GGRASARETIGRVAAGAIAEKFLKQANNVEIVAFVSGVGECQLDRSSQNPE------FME 174

Query: 181 LLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           LL  I RE VD    +RCP    ++KM + + + K   DS+GG +TCV+RNVP+GLGEP 
Sbjct: 175 LLQNITRETVDAAGPIRCPIPDKAEKMTKIVEDYKAQNDSIGGIVTCVVRNVPIGLGEPA 234

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKNDRLGTKTNNSGGTQG 299
           FDKLEA  AHAMLSIPATKGFEIGSGF GT + G +HNDP+++KN  LGT TNNSGG QG
Sbjct: 235 FDKLEAMLAHAMLSIPATKGFEIGSGFAGTAIPGSKHNDPFIMKNXHLGTTTNNSGGIQG 294

Query: 300 GITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAAL 359
           GI+NGENIYF VAFK PATIS+ Q TATY+G DG L A+GRHDP VVPRAVPIVE+M AL
Sbjct: 295 GISNGENIYFSVAFKSPATISKPQSTATYDGKDGTLEAKGRHDPNVVPRAVPIVEAMTAL 354

Query: 360 VIMDALMIQQSRKTVASLL 378
            + D+ +IQ+SR++  +L+
Sbjct: 355 ALADSYLIQKSRESTFNLV 373



>gi|402081369|gb|EJT76514.1| chorismate synthase [Gaeumannomyces graminis var. tritici
           R3-111a-1]
          Length = 426

 Score =  513 bits (1322), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 263/403 (65%), Positives = 299/403 (74%), Gaps = 24/403 (5%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFGT FRVTT+GESH +SVGCIVDG PPG+ L E DIQ  +DRRRPGQS++TTPR+E 
Sbjct: 1   MSTFGTTFRVTTYGESHCRSVGCIVDGVPPGMQLTEEDIQPHMDRRRPGQSDITTPRNEA 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           DKV IQSGTE G+TLGTPIGL V N+DQRP DY  S  DLYPRPSHADWTYL+KY +KAS
Sbjct: 61  DKVEIQSGTEFGVTLGTPIGLRVLNKDQRPRDYGNSTMDLYPRPSHADWTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSN-IAMPFINEQDERLFPED 177
           SGGGR+SARETIGRVAAGAIA+KYL+L +GVEI AFVSSV      P   E        +
Sbjct: 121 SGGGRSSARETIGRVAAGAIADKYLRLAYGVEITAFVSSVGGAFLFPPTPEHPTPCTNPE 180

Query: 178 FWELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           F  LL T+ R  VD    VRCPD   + +MR+ I + ++ +DS+GGT+ CVIRN P GLG
Sbjct: 181 FLSLLQTVDRAAVDAHLPVRCPDAAAAKRMRDLIADFRDREDSIGGTVHCVIRNAPAGLG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV--------------- 281
           EPCFDKLEA  AHAMLSIPATKGFEIGSGF G  + G  HNDP+V               
Sbjct: 241 EPCFDKLEAMLAHAMLSIPATKGFEIGSGFGGCQIPGSIHNDPFVKAPADEDETAGQQQQ 300

Query: 282 ----LKNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNG-VDGVLA 336
                   +L TKTN SGG QGGITNG  IYF VAFKPPATI QEQ TATY+G  +GVLA
Sbjct: 301 QQFGRTKSKLTTKTNFSGGIQGGITNGAPIYFSVAFKPPATIGQEQRTATYDGESEGVLA 360

Query: 337 ARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLP 379
           A+GRHDPCVVPRAVPIVESMAA+V+MDAL+ QQ+R T  SLLP
Sbjct: 361 AKGRHDPCVVPRAVPIVESMAAIVLMDALLTQQARHTARSLLP 403



>gi|238487986|ref|XP_002375231.1| chorismate synthase [Aspergillus flavus NRRL3357]
 gi|220700110|gb|EED56449.1| chorismate synthase [Aspergillus flavus NRRL3357]
          Length = 425

 Score =  513 bits (1321), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 260/411 (63%), Positives = 309/411 (75%), Gaps = 29/411 (7%)

Query: 1   MSTFGTLFRVTT-------------FGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRR 47
           MST+G  F+VTT             +GESH +SVGCIVDGCPPG+ L EAD+Q Q+ RRR
Sbjct: 1   MSTWGEYFKVTTSGQLNLTCCASSSYGESHCRSVGCIVDGCPPGMELTEADVQPQMTRRR 60

Query: 48  PGQSNLTTPRDEKDKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHA 105
           PGQS LTTPR+EKD+V IQSGTE G+TLGTPIG++V N+DQRP DY  S  DLYPRPSHA
Sbjct: 61  PGQSALTTPRNEKDRVEIQSGTEFGVTLGTPIGMIVRNEDQRPKDYGGSTMDLYPRPSHA 120

Query: 106 DWTYLQKYSIKASSGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM-P 164
           D+TYL+KY +KASSGGGR+SARETIGRVAAGAIAEKYL+L HGVEIV+FVSSV N  + P
Sbjct: 121 DFTYLEKYGVKASSGGGRSSARETIGRVAAGAIAEKYLRLSHGVEIVSFVSSVGNEHLFP 180

Query: 165 FINEQDERLFPEDFWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGT 223
              E        +F  L+  I RE VD     RCP++  + +M + I + ++ +DS+GGT
Sbjct: 181 PTPEHPSPATNPEFLNLIENISRETVDSFVPTRCPNQEAAARMTKVIEQFRDNQDSIGGT 240

Query: 224 ITCVIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLK 283
           +TCVIRNVPVGLGEPCFDKLEAK AHAMLSIPATKGFEIGSGF G  + G  HNDP+V+ 
Sbjct: 241 VTCVIRNVPVGLGEPCFDKLEAKLAHAMLSIPATKGFEIGSGFGGCEVPGSIHNDPFVVS 300

Query: 284 N------------DRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGV 331
           +             RL TKTNNSGG QGGI+NG +IYFRVAFKPPATI Q Q TA+Y   
Sbjct: 301 DVETRTGTETTTKQRLTTKTNNSGGIQGGISNGASIYFRVAFKPPATIGQAQTTASYGLE 360

Query: 332 DGVLAARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNP 382
           +G L A+GRHDPCVVPRAVPIVE+M+ALV+MDALM Q +R++  +LLPP P
Sbjct: 361 EGTLEAKGRHDPCVVPRAVPIVETMSALVMMDALMAQYARESAKNLLPPLP 411



>gi|50550975|ref|XP_502961.1| YALI0D17930p [Yarrowia lipolytica]
 gi|49648829|emb|CAG81153.1| YALI0D17930p [Yarrowia lipolytica CLIB122]
          Length = 375

 Score =  513 bits (1321), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 255/381 (66%), Positives = 297/381 (77%), Gaps = 9/381 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFGTLF+VTT+GESH KSVGCIVDG PPG+ L E+DIQ QL RRRPGQS LTTPR+E+
Sbjct: 1   MSTFGTLFKVTTYGESHCKSVGCIVDGVPPGMDLDESDIQPQLTRRRPGQSALTTPRNER 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D VAIQSGTE G TLGTPI +LV N+DQRPHDYSE D YPRPSHAD+TY +KY IKASSG
Sbjct: 61  DAVAIQSGTEYGKTLGTPIAMLVQNKDQRPHDYSEMDDYPRPSHADYTYQEKYGIKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGR+SARETIGRVAAGAIA+KYL  V+ +EIVAFVS V +++M      D     E +  
Sbjct: 121 GGRSSARETIGRVAAGAIADKYLAAVNDIEIVAFVSQVGDVSM------DRSPRNEQWIS 174

Query: 181 LLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
            L  + RE +D    +RCPD  + +KM + + E +++ DSVGG +TCVIRN PVGLGEPC
Sbjct: 175 TLEGVTREGIDSTGPMRCPDLALGEKMVKIVEEHRDSHDSVGGVVTCVIRNCPVGLGEPC 234

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV--LKNDRLGTKTNNSGGT 297
           FDKLEA  AHAM+SIPATKGFE GSGF G  + G +HND +   + + R  T+TN SGG 
Sbjct: 235 FDKLEATLAHAMMSIPATKGFEFGSGFAGAAMSGSKHNDMFYKDVASGRFRTRTNYSGGV 294

Query: 298 QGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMA 357
           QGGI+NGENIYF +AFKPPATISQEQ TATY G DGVLAA+GRHDP VVPRAVPIVE+MA
Sbjct: 295 QGGISNGENIYFNIAFKPPATISQEQATATYAGKDGVLAAKGRHDPNVVPRAVPIVEAMA 354

Query: 358 ALVIMDALMIQQSRKTVASLL 378
           ALVI DA +IQ+SRK   S  
Sbjct: 355 ALVIADAHLIQESRKGAKSFF 375



>gi|70991188|ref|XP_750443.1| chorismate synthase [Aspergillus fumigatus Af293]
 gi|66848075|gb|EAL88405.1| chorismate synthase [Aspergillus fumigatus Af293]
 gi|159130917|gb|EDP56030.1| chorismate synthase [Aspergillus fumigatus A1163]
          Length = 412

 Score =  513 bits (1320), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 258/395 (65%), Positives = 302/395 (76%), Gaps = 32/395 (8%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MST+G  FRVTT+GESH +SVGCIVDGCPPG+ L E DIQ Q+ RRRPGQS LTTPR+EK
Sbjct: 1   MSTWGEYFRVTTYGESHCRSVGCIVDGCPPGMELTEEDIQPQMTRRRPGQSALTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE GITLGTPIG++V N+DQRP DY  S  DLYPRPSHAD+TYL+KY +KAS
Sbjct: 61  DRVEIQSGTEFGITLGTPIGMMVRNEDQRPKDYGGSTMDLYPRPSHADYTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFP--- 175
           SGGGR+SARETIGRVAAGAIAEKYL+L HGVEIVAFVSSV N          E LFP   
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLRLSHGVEIVAFVSSVGN----------EHLFPPTP 170

Query: 176 --------EDFWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITC 226
                    +F +L+ TI R+ VD     RCP++  + +M + I   ++ +DS+GGT+TC
Sbjct: 171 EHPSPSTNPEFLKLIETIDRKTVDAFVPTRCPNEEAAARMTKVIETFRDNQDSIGGTVTC 230

Query: 227 VIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL---- 282
           VIRNVPVGLGEPCFDKLEAK AHAMLSIPATKGFEIGSGF G  + G  HNDP+ +    
Sbjct: 231 VIRNVPVGLGEPCFDKLEAKLAHAMLSIPATKGFEIGSGFGGCEVPGSIHNDPFTVSEVQ 290

Query: 283 ----KNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAAR 338
                  RL TKTNNSGG QGGI+NG  IYFRVAFKPPATI Q Q TA+Y+  +G+L A+
Sbjct: 291 TRTGSTQRLTTKTNNSGGIQGGISNGAPIYFRVAFKPPATIGQAQTTASYSFEEGILEAK 350

Query: 339 GRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKT 373
           GRHDPCV PRAVPIVE+M+ALV+MDALM Q +R++
Sbjct: 351 GRHDPCVTPRAVPIVEAMSALVVMDALMAQYARES 385



>gi|302307221|ref|NP_983809.2| ADL287Cp [Ashbya gossypii ATCC 10895]
 gi|299788895|gb|AAS51633.2| ADL287Cp [Ashbya gossypii ATCC 10895]
 gi|374107021|gb|AEY95929.1| FADL287Cp [Ashbya gossypii FDAG1]
          Length = 376

 Score =  513 bits (1320), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 250/381 (65%), Positives = 298/381 (78%), Gaps = 9/381 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FG +FRVTT+GESH KSVGCIV+G PPGLSL E DIQ QL RRRPGQS L+TPR+EK
Sbjct: 1   MSSFGQVFRVTTYGESHCKSVGCIVEGVPPGLSLTEEDIQPQLTRRRPGQSKLSTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D+V IQSGTE G TLGTPIG+LV N+DQRPHDY + D +PRPSHAD+TY++KY IKASSG
Sbjct: 61  DRVEIQSGTEFGRTLGTPIGMLVKNEDQRPHDYGDMDDFPRPSHADFTYIEKYGIKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGR+SARETIGRVAAGAIA+K+L+   GVEIVAFVS + ++ M      +   F   F +
Sbjct: 121 GGRSSARETIGRVAAGAIADKFLQQACGVEIVAFVSQIGSVRM------NRDPFDPKFLQ 174

Query: 181 LLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           LLNTI RE+VD    +RCPD +V+  M E I   +  KDS+GG +TCV+RNVP GLGEPC
Sbjct: 175 LLNTITREQVDATGPIRCPDASVAGAMVEEIERHRGDKDSIGGVVTCVVRNVPTGLGEPC 234

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSGGT 297
           FDKLEAK AHAMLSIPA+KGFEIGSGF G  L G +HNDP+    D  RL T+TNNSGG 
Sbjct: 235 FDKLEAKLAHAMLSIPASKGFEIGSGFAGVALPGSKHNDPFFFDEDSNRLRTRTNNSGGV 294

Query: 298 QGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMA 357
           QGGI+NGE+IYF V FK  ATISQ Q TATY G DGVLAA+GRHDP V PRA PIVE+M 
Sbjct: 295 QGGISNGEHIYFSVPFKSAATISQAQATATYAGADGVLAAKGRHDPSVTPRATPIVEAMT 354

Query: 358 ALVIMDALMIQQSRKTVASLL 378
           ALV+ DA ++Q++R+   +++
Sbjct: 355 ALVLADAFLLQKAREAARAIV 375



>gi|238880178|gb|EEQ43816.1| chorismate synthase [Candida albicans WO-1]
          Length = 378

 Score =  513 bits (1320), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 264/386 (68%), Positives = 309/386 (80%), Gaps = 13/386 (3%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FGTLF+VTT+GESH KSVGCIVDGCPPG+SL EADIQ QL RRRPGQS L+TPRDEK
Sbjct: 1   MSSFGTLFKVTTYGESHCKSVGCIVDGCPPGMSLTEADIQPQLTRRRPGQSKLSTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V IQSGTE+G+TLG+PIG++V N+D RP DYSETDLYPRPSHADWTY+QKY  K+SSG
Sbjct: 61  DLVEIQSGTENGLTLGSPIGMIVRNKDHRPGDYSETDLYPRPSHADWTYIQKYGTKSSSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPED--F 178
           GGR+SARETIGRVAAGAIAEK L  V+ VEIVAFVS++  I+M   N+      P+D  F
Sbjct: 121 GGRSSARETIGRVAAGAIAEKILAKVNNVEIVAFVSAIGEISM---NKS-----PQDAKF 172

Query: 179 WELLNTIRREEVDK-DAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGE 237
            ELL TI RE+VD    +RCPD  V ++M + I + ++AKDS+GG +TCVIRN P+GLGE
Sbjct: 173 QELLYTITREQVDGVGPIRCPDANVREEMVKVIEKYRDAKDSIGGVVTCVIRNCPIGLGE 232

Query: 238 PCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSG 295
           PCFDKLEAK AHAMLS+PATKGFE GSGF+G  + G +HND +    +  RL T+TNNSG
Sbjct: 233 PCFDKLEAKLAHAMLSLPATKGFEFGSGFEGIKIPGSKHNDAFYYDENFGRLRTETNNSG 292

Query: 296 GTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVES 355
           G QGGI+NGENIYF VAFK  ATISQEQETATY+G  GVLAARGRHDP V PRAVPIVE+
Sbjct: 293 GIQGGISNGENIYFSVAFKSAATISQEQETATYDGKSGVLAARGRHDPSVTPRAVPIVEA 352

Query: 356 MAALVIMDALMIQQSRKTVASLLPPN 381
           M ALV+ D  MIQQ+R +   L+  N
Sbjct: 353 MTALVLCDEYMIQQARTSTRLLVQDN 378



>gi|212528352|ref|XP_002144333.1| chorismate synthase [Talaromyces marneffei ATCC 18224]
 gi|210073731|gb|EEA27818.1| chorismate synthase [Talaromyces marneffei ATCC 18224]
          Length = 413

 Score =  513 bits (1320), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 259/410 (63%), Positives = 303/410 (73%), Gaps = 38/410 (9%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MST+G  FRVTT+GESH +SVGCIVDGCPPG++L EADIQ Q+ RRRPGQS LTTPR+EK
Sbjct: 1   MSTWGDYFRVTTYGESHCRSVGCIVDGCPPGMALTEADIQPQMTRRRPGQSALTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE G TLGTPI ++V N+DQRP DY  S  DLYPRPSHAD+TYL+KY +KAS
Sbjct: 61  DRVEIQSGTECGYTLGTPIAMVVRNEDQRPKDYGGSTMDLYPRPSHADYTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFP--- 175
           SGGGR+SARETIGRVAAGAIAEKYLKL H VEIV+FVSSV N          E LFP   
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLKLAHNVEIVSFVSSVGN----------EHLFPPSP 170

Query: 176 --------EDFWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITC 226
                    +F +++ TI RE VDK A VRCP+   +++M + I   ++  DS+GGT+ C
Sbjct: 171 EHPSYSTNPEFLKMIETIDRETVDKFAPVRCPNAEAAERMTKVIETFRDNHDSIGGTVMC 230

Query: 227 VIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPW------ 280
           VIRNVP+GLGEP FDKLEAK  HAM+SIPATKGFEIGSGF G  + G  HNDP+      
Sbjct: 231 VIRNVPIGLGEPAFDKLEAKLGHAMMSIPATKGFEIGSGFGGCEVPGSIHNDPFIPAPEV 290

Query: 281 --------VLKNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVD 332
                   +    RL T +NNSGG QGGI+NG  IYFR AFKPPATI Q Q T TY   +
Sbjct: 291 SENKAGAGIANKARLTTSSNNSGGIQGGISNGATIYFRTAFKPPATIGQAQTTTTYTLEE 350

Query: 333 GVLAARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNP 382
           GVL A+GRHDPCVVPRAVPIVE+MAALV+MDAL+ Q++R+   SLLPP P
Sbjct: 351 GVLEAKGRHDPCVVPRAVPIVEAMAALVVMDALLAQKAREAARSLLPPLP 400



>gi|119496395|ref|XP_001264971.1| chorismate synthase [Neosartorya fischeri NRRL 181]
 gi|119413133|gb|EAW23074.1| chorismate synthase [Neosartorya fischeri NRRL 181]
          Length = 412

 Score =  512 bits (1319), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 258/395 (65%), Positives = 301/395 (76%), Gaps = 32/395 (8%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MST+G  FRVTT+GESH +SVGCIVDGCPPG+ L E DIQ Q+ RRRPGQS LTTPR+EK
Sbjct: 1   MSTWGEYFRVTTYGESHCRSVGCIVDGCPPGMELTEEDIQPQMTRRRPGQSALTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE GITLGTPIG++V N+DQRP DY  S  DLYPRPSHAD+TYL+KY +KAS
Sbjct: 61  DRVEIQSGTEFGITLGTPIGMMVRNEDQRPKDYGGSTMDLYPRPSHADYTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFP--- 175
           SGGGR+SARETIGRVAAGAIAEKYL+L HGVEIVAFVSSV N          E LFP   
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLRLSHGVEIVAFVSSVGN----------EHLFPPTP 170

Query: 176 --------EDFWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITC 226
                    +F +L+ TI R+ VD     RCP++  + +M + I   ++ +DS+GGT+TC
Sbjct: 171 EHPSPSTNPEFLKLIETIDRKTVDTFVPTRCPNEEAAARMTKVIETFRDNQDSIGGTVTC 230

Query: 227 VIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL---- 282
           VIRNVPVGLGEPCFDKLEAK AHAMLSIPATKGFEIGSGF G  + G  HNDP+ +    
Sbjct: 231 VIRNVPVGLGEPCFDKLEAKLAHAMLSIPATKGFEIGSGFGGCEVPGSIHNDPFTVSEVQ 290

Query: 283 ----KNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAAR 338
                  RL TKTNNSGG QGGI+NG  IYFRVAFKPPATI Q Q TA+Y   +G+L A+
Sbjct: 291 TRTGSTQRLTTKTNNSGGIQGGISNGAPIYFRVAFKPPATIGQAQTTASYGFEEGILEAK 350

Query: 339 GRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKT 373
           GRHDPCV PRAVPIVE+M+ALV+MDALM Q +R++
Sbjct: 351 GRHDPCVTPRAVPIVEAMSALVVMDALMAQYARES 385



>gi|444316780|ref|XP_004179047.1| hypothetical protein TBLA_0B07100 [Tetrapisispora blattae CBS 6284]
 gi|387512087|emb|CCH59528.1| hypothetical protein TBLA_0B07100 [Tetrapisispora blattae CBS 6284]
          Length = 376

 Score =  512 bits (1318), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 252/375 (67%), Positives = 296/375 (78%), Gaps = 9/375 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFGTLFRVTT+GESH KSVGCIVDG PPGL+L E+DIQ QL RRRPGQS L+TPR+EK
Sbjct: 1   MSTFGTLFRVTTYGESHCKSVGCIVDGVPPGLTLDESDIQPQLTRRRPGQSKLSTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           DKV IQSGTE   TLGTPI ++V N+DQRPHDYSE D YPRPSHAD+TY++KY +KASSG
Sbjct: 61  DKVEIQSGTEFKKTLGTPISMIVKNEDQRPHDYSEMDDYPRPSHADFTYMEKYHLKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGRASARETIGRVAAGAIAEK+L+ +  VEIVAFVS +  + M      D   F ++F  
Sbjct: 121 GGRASARETIGRVAAGAIAEKFLQQISNVEIVAFVSQIGEVKM------DRNPFDKNFHH 174

Query: 181 LLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           LLNTI R++VD    +RCPD   +  M + I + +   DS+GG +TCV+RNVP GLGEPC
Sbjct: 175 LLNTITRDKVDATGPIRCPDIEKAPLMVKEIEKYRGQMDSIGGVVTCVVRNVPTGLGEPC 234

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSGGT 297
           FDKLEA  AHAMLSIPA+KGFEIGSGF G  + G +HNDP+    D  RL T TNNSGG 
Sbjct: 235 FDKLEAMLAHAMLSIPASKGFEIGSGFAGVEIPGSKHNDPFFFDKDSNRLRTVTNNSGGI 294

Query: 298 QGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMA 357
           QGGI+NGENIYF V FK  ATISQEQ TAT++G DGVLAA+GRHDP V PRA+PIVE+M 
Sbjct: 295 QGGISNGENIYFSVPFKSAATISQEQHTATFDGKDGVLAAKGRHDPSVTPRAIPIVEAMT 354

Query: 358 ALVIMDALMIQQSRK 372
           ALV+ DA++IQ+SR+
Sbjct: 355 ALVLADAVLIQKSRE 369



>gi|50286953|ref|XP_445906.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49525212|emb|CAG58825.1| unnamed protein product [Candida glabrata]
          Length = 376

 Score =  511 bits (1317), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 251/375 (66%), Positives = 301/375 (80%), Gaps = 9/375 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG LF+VTT+GESH KSVGCIVDG PPGL+L E DIQ QL RRRPGQS L+TPR+EK
Sbjct: 1   MSTFGRLFKVTTYGESHCKSVGCIVDGVPPGLTLEEKDIQPQLTRRRPGQSALSTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D+V IQSGTE G TLGTPI ++V N+D +P DYSE D YPRPSHAD+TY +KY IKASSG
Sbjct: 61  DRVEIQSGTEFGKTLGTPIAMIVRNEDHKPKDYSEMDNYPRPSHADFTYSEKYGIKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGRASARETIGRVAAGAIAEK+L  V  VEIVAFV+ + +I M      +   F   F +
Sbjct: 121 GGRASARETIGRVAAGAIAEKFLHYVSEVEIVAFVTQIGSIKM------NRDPFDPAFHQ 174

Query: 181 LLNTIRREEVDK-DAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           LLNTI RE+VD    +RCPD +V+D M + I + ++AKDS+GG +TCV+RN+P GLGEPC
Sbjct: 175 LLNTITREQVDSMGPIRCPDASVADLMVKEIEKHRDAKDSIGGVVTCVVRNLPTGLGEPC 234

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSGGT 297
           FDKLEA  AHAMLSIPA+KGFEIGSGF+G ++ G +HNDP+    D  +L TKTNNSGG 
Sbjct: 235 FDKLEALLAHAMLSIPASKGFEIGSGFEGVSVPGSKHNDPFYFDKDSGKLRTKTNNSGGV 294

Query: 298 QGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMA 357
           QGGI+NGENIYF V FK  ATISQEQ+TATY+G +GVLAA+GRHDP V PRA+PIVE+M 
Sbjct: 295 QGGISNGENIYFSVPFKSVATISQEQKTATYDGEEGVLAAKGRHDPAVTPRAIPIVEAMT 354

Query: 358 ALVIMDALMIQQSRK 372
           ALV+ DA++IQ++R+
Sbjct: 355 ALVLADAVLIQKARE 369



>gi|85074621|ref|XP_963243.1| chorismate synthase [Neurospora crassa OR74A]
 gi|30316376|sp|Q12640.2|AROC_NEUCR RecName: Full=Chorismate synthase; AltName:
           Full=5-enolpyruvylshikimate-3-phosphate phospholyase
 gi|11269978|pir||T51020 chorismate synthase/flavin reductase, NADPH-dependent [imported] -
           Neurospora crassa
 gi|9367484|emb|CAB97473.1| chorismate synthase/flavin reductase, NADPH-dependent [Neurospora
           crassa]
 gi|28924915|gb|EAA34007.1| chorismate synthase [Neurospora crassa OR74A]
          Length = 432

 Score =  511 bits (1316), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 264/405 (65%), Positives = 302/405 (74%), Gaps = 25/405 (6%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT+GESH KSVGCIVDG PPG+ L E DIQ Q+ RRRPGQS +TTPRDEK
Sbjct: 1   MSTFGHYFRVTTYGESHCKSVGCIVDGVPPGMELTEDDIQPQMTRRRPGQSAITTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE G+TLGTPIG+LV N+DQRP DY     D+YPRPSHADWTYL+KY +KAS
Sbjct: 61  DRVIIQSGTEFGVTLGTPIGMLVMNEDQRPKDYGNKTMDIYPRPSHADWTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSV-SNIAMPFINEQDERLFPED 177
           SGGGR+SARETIGRVAAGAIAEKYLKL +GVEIVAFVSSV S    P   E        +
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLKLAYGVEIVAFVSSVGSEHLFPPTAEHPSPSTNPE 180

Query: 178 FWELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           F +L+N+I RE VD    VRCPD   + +M + I + ++  DS+GGT+TCVIRNVP GLG
Sbjct: 181 FLKLVNSITRETVDSFLPVRCPDAEANKRMEDLITKFRDNHDSIGGTVTCVIRNVPSGLG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV--------------- 281
           EP FDKLEA  AHAMLSIPATKGFE+GSGF G  + G  HNDP+V               
Sbjct: 241 EPAFDKLEAMLAHAMLSIPATKGFEVGSGFGGCEVPGSIHNDPFVSAENTEIPPSVAASG 300

Query: 282 -----LKNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGV-DGVL 335
                +   +L TKTN SGG QGGI+NG  IYFRV FKP ATI QEQ TATY+G  +GVL
Sbjct: 301 AARNGIPRPKLTTKTNFSGGIQGGISNGAPIYFRVGFKPAATIGQEQTTATYDGTSEGVL 360

Query: 336 AARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPP 380
           AA+GRHDP VVPRAVPIVE+MAALVIMDA++ QQ+R T  SLLPP
Sbjct: 361 AAKGRHDPSVVPRAVPIVEAMAALVIMDAVLAQQARHTAKSLLPP 405



>gi|254576999|ref|XP_002494486.1| ZYRO0A02640p [Zygosaccharomyces rouxii]
 gi|238937375|emb|CAR25553.1| ZYRO0A02640p [Zygosaccharomyces rouxii]
          Length = 376

 Score =  509 bits (1312), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 248/380 (65%), Positives = 297/380 (78%), Gaps = 9/380 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG +FRVTT+GESH +SVGCIVDG PPG+SL + DIQ QL RRRPGQS L+TPR+EK
Sbjct: 1   MSTFGHIFRVTTYGESHCRSVGCIVDGVPPGMSLTDKDIQPQLSRRRPGQSKLSTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           DKV IQ+G E   TLGTPI +L+ N+DQRPHDYS+ D YPRPSHAD+TY++KY +KASSG
Sbjct: 61  DKVEIQAGIEFNKTLGTPIAMLIRNEDQRPHDYSDMDNYPRPSHADYTYMEKYGLKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGRASARETIGRVAAGAIAEK+L  V  VEIV FVS + ++ M      +   F   F  
Sbjct: 121 GGRASARETIGRVAAGAIAEKFLSQVSNVEIVGFVSQIGSVKM------NRDTFDPHFHH 174

Query: 181 LLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           LLNTI RE+VD    +RCPD  ++ +M + I + +  KDS+GG +TCVIRN+P G+GEPC
Sbjct: 175 LLNTITREKVDSAGFIRCPDAAIAAEMVKEIEKYRGQKDSIGGVVTCVIRNLPAGIGEPC 234

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSGGT 297
           FDK+EA  AHAMLSIPA+KGFEIGSGF G +  G QHND +V   +  +L TKTNNSGG 
Sbjct: 235 FDKVEALLAHAMLSIPASKGFEIGSGFSGVSKPGSQHNDLFVFDEETQKLRTKTNNSGGV 294

Query: 298 QGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMA 357
           QGGITNGEN+YF VAFK  ATI+QEQETATY+G  GVLAA+GRHDP V PRA+PIVESMA
Sbjct: 295 QGGITNGENVYFSVAFKSVATIAQEQETATYDGKAGVLAAKGRHDPAVTPRAIPIVESMA 354

Query: 358 ALVIMDALMIQQSRKTVASL 377
           ALV+ D+L+IQ+SR    S+
Sbjct: 355 ALVLADSLLIQKSRDFARSV 374



>gi|336263890|ref|XP_003346724.1| hypothetical protein SMAC_04156 [Sordaria macrospora k-hell]
 gi|380091431|emb|CCC10927.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 432

 Score =  509 bits (1312), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 263/405 (64%), Positives = 302/405 (74%), Gaps = 25/405 (6%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT+GESH KSVGCIVDG PPG+ L E DIQ Q+ RRRPGQS +TTPR+EK
Sbjct: 1   MSTFGQYFRVTTYGESHCKSVGCIVDGVPPGMELTEDDIQPQMTRRRPGQSAITTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE G+TLGTPIG+LV N+DQRP DY     D+YPRPSHADWTYL+KY +KAS
Sbjct: 61  DRVIIQSGTEFGVTLGTPIGMLVMNEDQRPKDYGNKTMDMYPRPSHADWTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSV-SNIAMPFINEQDERLFPED 177
           SGGGR+SARETIGRVAAGAIAEKYLKL +GVEIVAFVSSV S    P   E        +
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLKLAYGVEIVAFVSSVGSEHLFPPTAEHPSPSTNPE 180

Query: 178 FWELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           F +L+N+I RE VD    VRCPD   + +M + I + ++  DS+GGT+TCVIRNVP GLG
Sbjct: 181 FLKLVNSITRETVDSYLPVRCPDAEANKRMEDLITKFRDNHDSIGGTVTCVIRNVPSGLG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV--------------- 281
           EP FDKLEA  AHAMLSIPATKGFE+GSGF G  + G  HNDP+V               
Sbjct: 241 EPAFDKLEALLAHAMLSIPATKGFEVGSGFGGCEVPGSIHNDPFVSAENTENPPSVAASG 300

Query: 282 -----LKNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNG-VDGVL 335
                +   +L TKTN SGG QGGI+NG  IYFRV FKP ATI QEQ TATY+G  +GVL
Sbjct: 301 AARNGIPRPKLTTKTNFSGGIQGGISNGAPIYFRVGFKPAATIGQEQTTATYDGSSEGVL 360

Query: 336 AARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPP 380
           AA+GRHDP VVPRAVPIVE+MAALVIMDA++ QQ+R T  SLLPP
Sbjct: 361 AAKGRHDPSVVPRAVPIVEAMAALVIMDAVLAQQARHTAKSLLPP 405



>gi|513032990|gb|AGO12962.1| AaceriADL287Cp [Saccharomycetaceae sp. 'Ashbya aceri']
          Length = 376

 Score =  509 bits (1311), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 248/381 (65%), Positives = 296/381 (77%), Gaps = 9/381 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FG +FRVTT+GESH +SVGCIV+G PPGLSL E DIQ QL RRRPGQS L+TPR+EK
Sbjct: 1   MSSFGQVFRVTTYGESHCRSVGCIVEGVPPGLSLTEEDIQPQLTRRRPGQSKLSTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D+V IQSGTE G TLGTPIG+LV N+DQRPHDY + D +PRPSHAD+TY++KY IKASSG
Sbjct: 61  DRVEIQSGTEFGRTLGTPIGMLVKNEDQRPHDYGDMDDFPRPSHADFTYIEKYGIKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGR+SARETIGRVAAGAIAEK+L+   GVEIVAFVS + ++ M      +   F   F  
Sbjct: 121 GGRSSARETIGRVAAGAIAEKFLQQACGVEIVAFVSQIGSVRM------NRDPFDPKFLH 174

Query: 181 LLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           LLNTI RE+VD    +RCPD +V+  M E I   +   DS+GG +TCV+RNVP+GLGEPC
Sbjct: 175 LLNTITREQVDATGPIRCPDASVAGAMVEEIERHRGDNDSIGGVVTCVVRNVPIGLGEPC 234

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSGGT 297
           FDKLEAK AHAMLSIPA+KGFEIGSGF G  L G +HNDP+    D  RL T+TNNSGG 
Sbjct: 235 FDKLEAKLAHAMLSIPASKGFEIGSGFAGVALPGSKHNDPFFFDEDANRLRTRTNNSGGV 294

Query: 298 QGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMA 357
           QGGI+NGE+IYF V FK  ATI Q Q TATY G DGVLAA+GRHDP V PRA PIVE+M 
Sbjct: 295 QGGISNGEHIYFSVPFKSAATICQAQATATYAGADGVLAAKGRHDPSVTPRATPIVEAMT 354

Query: 358 ALVIMDALMIQQSRKTVASLL 378
           ALV+ DA ++Q++R+   +++
Sbjct: 355 ALVLADAFLLQKAREAARAIV 375



>gi|336468645|gb|EGO56808.1| NADPH-dependent chorismate synthase/flavin reductase [Neurospora
           tetrasperma FGSC 2508]
 gi|350289077|gb|EGZ70302.1| chorismate synthase/flavin reductase, NADPH-dependent [Neurospora
           tetrasperma FGSC 2509]
          Length = 432

 Score =  509 bits (1311), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 263/405 (64%), Positives = 302/405 (74%), Gaps = 25/405 (6%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT+GESH KSVGCIVDG PPG+ L E DIQ Q+ RRRPGQS +TTPR+EK
Sbjct: 1   MSTFGHYFRVTTYGESHCKSVGCIVDGVPPGMELTEDDIQPQMTRRRPGQSAITTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE G+TLGTPIG+LV N+DQRP DY     D+YPRPSHADWTYL+KY +KAS
Sbjct: 61  DRVIIQSGTEFGVTLGTPIGMLVMNEDQRPKDYGNKTMDIYPRPSHADWTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSV-SNIAMPFINEQDERLFPED 177
           SGGGR+SARETIGRVAAGAIAEKYLKL +GVEIVAFVSSV S    P   E        +
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLKLAYGVEIVAFVSSVGSEHLFPPTAEHPSPSTNPE 180

Query: 178 FWELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           F +L+N+I RE VD    VRCPD   + +M + I + ++  DS+GGT+TCVIRNVP GLG
Sbjct: 181 FLKLVNSITRETVDSFLPVRCPDAEANKRMEDLITKFRDNHDSIGGTVTCVIRNVPSGLG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV--------------- 281
           EP FDKLEA  AHAMLSIPATKGFE+GSGF G  + G  HNDP+V               
Sbjct: 241 EPAFDKLEAMLAHAMLSIPATKGFEVGSGFGGCEVPGSIHNDPFVSAENTEIPPSVAASG 300

Query: 282 -----LKNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGV-DGVL 335
                +   +L TKTN SGG QGGI+NG  IYFRV FKP ATI QEQ TATY+G  +GVL
Sbjct: 301 AARNGIPRPKLTTKTNFSGGIQGGISNGAPIYFRVGFKPAATIGQEQTTATYDGTSEGVL 360

Query: 336 AARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPP 380
           AA+GRHDP VVPRAVPIVE+MAALVIMDA++ QQ+R T  SLLPP
Sbjct: 361 AAKGRHDPSVVPRAVPIVEAMAALVIMDAVLAQQARHTAKSLLPP 405



>gi|512191899|gb|EPE07659.1| chorismate synthase [Ophiostoma piceae UAMH 11346]
          Length = 405

 Score =  509 bits (1311), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 262/404 (64%), Positives = 303/404 (75%), Gaps = 21/404 (5%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  F+VTT+GESH +SVGCIVDGCPPG+SL E DIQ Q+DRRRPGQS++TTPR+E 
Sbjct: 1   MSTFGEYFKVTTYGESHCRSVGCIVDGCPPGMSLTEDDIQPQMDRRRPGQSSITTPRNEA 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE GITLGTPIGL V N+DQRP DY  +  DLYPRPSHADWTYL+KY +KAS
Sbjct: 61  DRVEIQSGTEFGITLGTPIGLRVMNKDQRPKDYGGATIDLYPRPSHADWTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDF 178
           SGGGR+SARETIGRVAAGAIAEKYL+L +G+EIVAFV+SV  I +     +D+    +  
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLRLAYGIEIVAFVTSVGKIHLFPPGTEDDSENDDAR 180

Query: 179 WELLNTIRREEVDK-DAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGE 237
            +LL+TI RE VD    VRCPD   S +M + I   KE +DS+GGT+TCVIRN P+GLGE
Sbjct: 181 NQLLSTISRETVDSFQPVRCPDAAKSAEMAQYIEGFKEREDSIGGTVTCVIRNAPIGLGE 240

Query: 238 PCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLK-------------- 283
           PCFDKLEA  AHAMLSIPATKGFEIGSGF G  + G  HND +V                
Sbjct: 241 PCFDKLEALLAHAMLSIPATKGFEIGSGFAGCEIPGSIHNDAFVANPAAAAGAAELAPGA 300

Query: 284 ---NDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNG-VDGVLAARG 339
                +L TKTN SGG QGGI+NG  IYFRV FKPPATI +EQ TATY+G   GVLAA+G
Sbjct: 301 AAMRSKLTTKTNYSGGVQGGISNGAPIYFRVGFKPPATIGKEQTTATYDGSSSGVLAAKG 360

Query: 340 RHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNPN 383
           RHDPCVVPRAVPIVE+MAALVIMD +M QQ+R      LP  P+
Sbjct: 361 RHDPCVVPRAVPIVEAMAALVIMDTVMAQQARVLSRQFLPKLPS 404



>gi|401625834|gb|EJS43824.1| aro2p [Saccharomyces arboricola H-6]
          Length = 376

 Score =  509 bits (1310), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 250/381 (65%), Positives = 300/381 (78%), Gaps = 9/381 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG LFRVTT+GESH KSVGCIVDG PPG+SL EADIQ QL RRRPGQS L+TPRDEK
Sbjct: 1   MSTFGKLFRVTTYGESHCKSVGCIVDGVPPGMSLTEADIQPQLTRRRPGQSKLSTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D+V IQSGTE G TLGTPI +++ N+DQRPHDYS+ D +PRPSHAD+TY +KY IKASSG
Sbjct: 61  DRVQIQSGTEFGKTLGTPIAMMIMNEDQRPHDYSDMDKFPRPSHADFTYSEKYGIKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGRASARETIGRVA+GAIAEK+L     VEIVAFV+ +  I M      +   F  +F  
Sbjct: 121 GGRASARETIGRVASGAIAEKFLAQNSNVEIVAFVTQIGEIKM------NRDSFDPEFHR 174

Query: 181 LLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           LLNTI RE+VD    +RCPD +V+  M + I + +  KDS+GG +TCV+RN+P GLGEPC
Sbjct: 175 LLNTITREKVDSMGFIRCPDVSVAGLMVKEIEKYRGNKDSIGGVVTCVVRNLPTGLGEPC 234

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSGGT 297
           FDKLEA  AHAMLSIPA+KGFEIGSGF+G ++ G +HND +  + +  RL TKTNNSGG 
Sbjct: 235 FDKLEAMLAHAMLSIPASKGFEIGSGFQGVSVPGSKHNDLFYFEKETNRLRTKTNNSGGV 294

Query: 298 QGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMA 357
           QGGI+NGENIYF V FK  ATISQEQ+T TY+G +GVLAA+GRHDP V PRA+PIVE+M 
Sbjct: 295 QGGISNGENIYFSVPFKSVATISQEQKTVTYDGEEGVLAAKGRHDPAVTPRAIPIVEAMT 354

Query: 358 ALVIMDALMIQQSRKTVASLL 378
           ALV+ DAL+IQ++R    S++
Sbjct: 355 ALVLADALLIQKARDFSRSVV 375



>gi|121702401|ref|XP_001269465.1| chorismate synthase [Aspergillus clavatus NRRL 1]
 gi|119397608|gb|EAW08039.1| chorismate synthase [Aspergillus clavatus NRRL 1]
          Length = 411

 Score =  509 bits (1310), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 255/385 (66%), Positives = 299/385 (77%), Gaps = 12/385 (3%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MST+G  FRVTT+GESH +SVGCIVDGCPPG+ L E DIQ Q+ RRRPGQS LTTPRDEK
Sbjct: 1   MSTWGEHFRVTTYGESHCRSVGCIVDGCPPGMELTEEDIQPQMTRRRPGQSALTTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE G+TLGTPIG++V N+DQRP DY  S  DL+PRPSHAD+TYL+KY +KAS
Sbjct: 61  DRVEIQSGTEFGVTLGTPIGMMVRNEDQRPKDYGGSTMDLFPRPSHADYTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSV-SNIAMPFINEQDERLFPED 177
           SGGGR+SARETIGRVAAGAIAEKYL+L HGVEIVAFVSSV S    P   E        +
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLRLSHGVEIVAFVSSVGSEHLFPPTPEHPSPSTNPE 180

Query: 178 FWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           F +L+ TI R+ VD     RCPD+  + +M + I   ++  DS+GGT+TCVIRNVPVGLG
Sbjct: 181 FLKLVETIDRKTVDAFVPTRCPDEAAAARMTKVIETFRDNHDSIGGTVTCVIRNVPVGLG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLK--------NDRLG 288
           EPCFDKLEAK AHAMLSIPATKGFEIGSGF G  + G  HNDP+++           RL 
Sbjct: 241 EPCFDKLEAKLAHAMLSIPATKGFEIGSGFGGCEVPGSIHNDPFIVSEVAGPSGTTQRLT 300

Query: 289 TKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPR 348
           TKTNNSGG QGGI+NG +IYFRV FKP ATI Q Q TA+Y+  +GVL A+GRHDPCV PR
Sbjct: 301 TKTNNSGGIQGGISNGASIYFRVGFKPAATIGQAQTTASYSFEEGVLEAKGRHDPCVTPR 360

Query: 349 AVPIVESMAALVIMDALMIQQSRKT 373
           AVPIVE+M+ALV+MDALM Q +R++
Sbjct: 361 AVPIVEAMSALVVMDALMAQYARES 385



>gi|449301609|gb|EMC97620.1| hypothetical protein BAUCODRAFT_68287 [Baudoinia compniacensis UAMH
           10762]
          Length = 417

 Score =  508 bits (1307), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 259/406 (63%), Positives = 302/406 (74%), Gaps = 17/406 (4%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRV+T+GESHGKSVGCIVD CPPGL L E DIQ Q+ RRRPGQS LTTPR+EK
Sbjct: 1   MSTFGQYFRVSTYGESHGKSVGCIVDNCPPGLQLTEDDIQPQMTRRRPGQSALTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYS----ETDLYPRPSHADWTYLQKYSIK 116
           DKV IQSGTE G+TLGTPIGL V N+DQRPHDY       D +PRPSHADWTYL+KY +K
Sbjct: 61  DKVEIQSGTEFGVTLGTPIGLRVLNEDQRPHDYGGGGKNIDAFPRPSHADWTYLEKYGVK 120

Query: 117 ASSGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSV-SNIAMPFINEQDERLFP 175
           ASSGGGR+SARETIGRVAAGAIAEKYL++ +GVEIVAF SSV S    P   E       
Sbjct: 121 ASSGGGRSSARETIGRVAAGAIAEKYLRVAYGVEIVAFTSSVGSEFLFPPSREHPTASTN 180

Query: 176 EDFWELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVG 234
             F +L++ + R +VD+   VRCPD TV  +M + I + ++  DS+GG +TCVIR+ P G
Sbjct: 181 PAFLDLIDKVTRTQVDEFLPVRCPDATVCKRMEQVIADFRDRHDSIGGVVTCVIRHCPSG 240

Query: 235 LGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV----------LKN 284
           LGEPCFDKLEA  AHAMLS+PATKGFEIGSGF G  + G  HND +V             
Sbjct: 241 LGEPCFDKLEATLAHAMLSLPATKGFEIGSGFGGCEVPGSIHNDAFVKAPATAAPLGRSK 300

Query: 285 DRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPC 344
            +L TKTNNSGG QGGITNG +IYF VAFKPPATI Q Q+T  Y+G  GVL A+GRHDPC
Sbjct: 301 PKLTTKTNNSGGIQGGITNGAHIYFNVAFKPPATIGQMQDTVGYDGEAGVLEAKGRHDPC 360

Query: 345 VVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNP-NIPAAMS 389
           V+PRAVPIVE+MAALV+MDA++ Q +R+T  SLLP  P  IP + S
Sbjct: 361 VIPRAVPIVEAMAALVVMDAVLAQSARQTARSLLPVLPMTIPVSQS 406



>gi|126139149|ref|XP_001386097.1| Chorismate synthase [Scheffersomyces stipitis CBS 6054]
 gi|126093379|gb|ABN68068.1| Chorismate synthase [Scheffersomyces stipitis CBS 6054]
          Length = 377

 Score =  507 bits (1306), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 257/381 (67%), Positives = 308/381 (80%), Gaps = 9/381 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FGTLFRVTT+GESH KSVGCIVDG PP L L E DIQ QL RRRPGQS L+TPR+EK
Sbjct: 1   MSSFGTLFRVTTYGESHCKSVGCIVDGVPPNLELTEDDIQPQLTRRRPGQSKLSTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D+V IQSGTE+G+TLG+PI ++V N+D RPHDYSETDLYPRPSHADWTY+QKY  K+SSG
Sbjct: 61  DRVEIQSGTENGLTLGSPIAMIVKNEDHRPHDYSETDLYPRPSHADWTYIQKYGTKSSSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGR+SARETIGRVAAGAIAEK L   +GVEIVAFVSS+  ++M   +  D +     F E
Sbjct: 121 GGRSSARETIGRVAAGAIAEKLLSKANGVEIVAFVSSIGPVSMAR-DASDPK-----FHE 174

Query: 181 LLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           LLNT+ RE++D    +RCPD+TV + M + I + ++A+DS+GG +TCV+RN P+GLGEPC
Sbjct: 175 LLNTVTREQIDATGPIRCPDETVREDMVKVIEKYRDAQDSIGGVVTCVVRNCPIGLGEPC 234

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLK--NDRLGTKTNNSGGT 297
           FDKLEAK AHAMLS+PATKGFE GSGF GT + G +HNDP+     + RL T TN SGG 
Sbjct: 235 FDKLEAKLAHAMLSLPATKGFEFGSGFLGTQIPGSKHNDPFYYDELHKRLRTTTNFSGGI 294

Query: 298 QGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMA 357
           QGGI+NGENIYF VAFK  ATISQEQ TATY+G DGVLAARGRHDP V PRAVPIVESM 
Sbjct: 295 QGGISNGENIYFSVAFKSAATISQEQPTATYDGKDGVLAARGRHDPSVTPRAVPIVESMT 354

Query: 358 ALVIMDALMIQQSRKTVASLL 378
           ALV+ D L+IQ++R++ A+++
Sbjct: 355 ALVLADQLLIQKARESGAAIV 375



>gi|365760791|gb|EHN02483.1| Aro2p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 376

 Score =  506 bits (1304), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 247/381 (64%), Positives = 298/381 (78%), Gaps = 9/381 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG LFRVTT+GESH KSVGCIVDG PPG+SL E+DIQ QL RRRPGQS L+TPRDEK
Sbjct: 1   MSTFGKLFRVTTYGESHCKSVGCIVDGVPPGMSLTESDIQPQLTRRRPGQSKLSTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D+V I SGTE G TLGTPI +++ N+DQRPHDYS+ D +PRPSHAD+TY +KY IKASSG
Sbjct: 61  DRVEIHSGTEFGKTLGTPIAMMIRNEDQRPHDYSDMDKFPRPSHADFTYSEKYGIKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGRASARETIGRVA+GAIAEK+L     VEIVAFV+ +  I M      +   F  +F  
Sbjct: 121 GGRASARETIGRVASGAIAEKFLAQNSNVEIVAFVTQIGEIKM------NRDTFDPEFQH 174

Query: 181 LLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           LLNTI RE+VD    +RCPD +V+  M + I + +  KDS+GG +TCV+RN+P GLGEPC
Sbjct: 175 LLNTITREKVDSMGPIRCPDASVAGLMVKEIEKYRGNKDSIGGIVTCVVRNLPTGLGEPC 234

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSGGT 297
           FDKLEA  AHAMLSIPA+KGFEIGSGF+G ++ G +HND +  + +  RL TKTNNSGG 
Sbjct: 235 FDKLEAMLAHAMLSIPASKGFEIGSGFQGVSVPGSKHNDAFYFEKETNRLRTKTNNSGGV 294

Query: 298 QGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMA 357
           QGGI+NGENIYF V FK  ATISQEQ T TY+G +G+LAA+GRHDP V PRA+PIVE+M 
Sbjct: 295 QGGISNGENIYFSVPFKSVATISQEQSTVTYDGEEGILAAKGRHDPAVTPRAIPIVEAMT 354

Query: 358 ALVIMDALMIQQSRKTVASLL 378
           ALV+ DAL+IQ++R    S++
Sbjct: 355 ALVLADALLIQKARDFSRSVV 375



>gi|367016655|ref|XP_003682826.1| hypothetical protein TDEL_0G02480 [Torulaspora delbrueckii]
 gi|359750489|emb|CCE93615.1| hypothetical protein TDEL_0G02480 [Torulaspora delbrueckii]
          Length = 376

 Score =  506 bits (1302), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 250/380 (65%), Positives = 295/380 (77%), Gaps = 9/380 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG +FRVTT+GESH KSVGCIVDG PPG+SL E DIQ QL RRRPGQS L+TPR+EK
Sbjct: 1   MSTFGQIFRVTTYGESHCKSVGCIVDGVPPGMSLTEQDIQPQLSRRRPGQSKLSTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           DKV IQSG E   TLGTPI +L+ N+DQRPHDY++ D YPRPSHAD+TYL+KY++KASSG
Sbjct: 61  DKVEIQSGVEFNKTLGTPIAMLIRNEDQRPHDYNDMDNYPRPSHADFTYLEKYNLKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGRASARETIGRVAAG IAEK+LK V  VEIV FVS + ++ M      D   F   F  
Sbjct: 121 GGRASARETIGRVAAGGIAEKFLKQVSNVEIVGFVSQIGSVKM------DRDPFDPKFHH 174

Query: 181 LLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           LLNTI RE+VD    +RCPD  ++  M + I + +  KDS+GG +TCV+RN+P GLGEPC
Sbjct: 175 LLNTITREKVDSIGFIRCPDVNLAGAMVQEIEKYRGNKDSIGGVVTCVVRNLPTGLGEPC 234

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSGGT 297
           FDKLEA  AHAMLSIPA+KGFEIGSGF+G ++ G +HND +    +  RL TKTN SGG 
Sbjct: 235 FDKLEALLAHAMLSIPASKGFEIGSGFQGVSVPGSKHNDMFYFDEETQRLRTKTNLSGGI 294

Query: 298 QGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMA 357
           QGGI+NGENIYF VAFK  ATISQEQET TY+G  GVLAA+GRHDP V PRA+PIVE+M 
Sbjct: 295 QGGISNGENIYFSVAFKSVATISQEQETCTYDGKPGVLAAKGRHDPAVTPRAIPIVEAMT 354

Query: 358 ALVIMDALMIQQSRKTVASL 377
           ALV+ DAL+IQ+SR    S+
Sbjct: 355 ALVLTDALLIQKSRDFAKSI 374



>gi|380485714|emb|CCF39182.1| chorismate synthase [Colletotrichum higginsianum]
          Length = 408

 Score =  506 bits (1302), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 255/400 (63%), Positives = 305/400 (76%), Gaps = 20/400 (5%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG+ F+VTT+GESHGKSVG IVDG PPG++L EADIQ QL+RRRPGQS++TTPR+EK
Sbjct: 1   MSTFGSYFKVTTYGESHGKSVGVIVDGVPPGMALTEADIQPQLNRRRPGQSSITTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE G+TLGTPIG+LV N+DQRP DY  S  D +PRPSHADWTYL+KY +KAS
Sbjct: 61  DRVVIQSGTEFGVTLGTPIGMLVQNEDQRPKDYGNSTMDRFPRPSHADWTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM-PFINEQDERLFPED 177
           SGGGR+SARETI RVAAGA+AEKYL+  +G EI AF +SV N  + P   E         
Sbjct: 121 SGGGRSSARETIARVAAGALAEKYLREAYGTEITAFTTSVGNCHLFPPTPEHPTPSTXPG 180

Query: 178 FWELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           F  LLNTI R+ VD+   VRCP +  +DKM + I + K+ +DS+GGT+TCVIRN P  LG
Sbjct: 181 FLSLLNTIDRDTVDQYLPVRCPHEETNDKMIDLISDFKKREDSIGGTVTCVIRNPPSALG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV--------------- 281
           EPCFDKLEA+ AHAMLSIPATKGFEIGSGF G  + G QHND ++               
Sbjct: 241 EPCFDKLEAQLAHAMLSIPATKGFEIGSGFGGCEIPGSQHNDAFIKAPEADLAADAQRMG 300

Query: 282 LKNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGV-DGVLAARGR 340
           +   +L TKTN SGG QGGI+NG  IYFRVAFKP ATI Q+Q TATY+G  +GVLAA+GR
Sbjct: 301 IPRSKLTTKTNYSGGIQGGISNGAPIYFRVAFKPAATIGQDQTTATYDGSEEGVLAAKGR 360

Query: 341 HDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPP 380
           HDPCVVPRA+PIVE+MAA+V++DALM Q +R+   SLLPP
Sbjct: 361 HDPCVVPRAIPIVEAMAAIVLLDALMAQHARQVTKSLLPP 400



>gi|366992516|ref|XP_003676023.1| hypothetical protein NCAS_0D00780 [Naumovozyma castellii CBS 4309]
 gi|342301889|emb|CCC69659.1| hypothetical protein NCAS_0D00780 [Naumovozyma castellii CBS 4309]
          Length = 377

 Score =  503 bits (1295), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 249/382 (65%), Positives = 295/382 (77%), Gaps = 10/382 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFGTLFRVTT+GESH KSVGCIVDG PPG+SL E DIQ QL RRRPGQS L+TPR+EK
Sbjct: 1   MSTFGTLFRVTTYGESHCKSVGCIVDGVPPGMSLTEDDIQPQLSRRRPGQSKLSTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE-TDLYPRPSHADWTYLQKYSIKASS 119
           D+V  QSG E G TLGTP+ ++V N+DQRPHDYS+ T+ YPRPSHAD TY++KY I+ASS
Sbjct: 61  DRVEFQSGVEFGKTLGTPLAMIVRNEDQRPHDYSDMTNKYPRPSHADLTYMEKYGIQASS 120

Query: 120 GGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFW 179
           GGGRASARETIGRVAAG IAEK+LK V  VEIVAFV+ +  I M      D   F   F 
Sbjct: 121 GGGRASARETIGRVAAGGIAEKFLKQVSNVEIVAFVTQIGEIKM------DRNTFDPKFQ 174

Query: 180 ELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEP 238
            LL TI RE+VD    +RCPD +V+  M + I + +  +DS+GG +TCV+RN+P GLGEP
Sbjct: 175 HLLQTITREKVDNMGFIRCPDASVAGDMVKEIEKYRGNQDSIGGVVTCVVRNLPTGLGEP 234

Query: 239 CFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSGG 296
           CFDKLEA  AHAMLSIPA+KGFEIGSGF G ++ G +HND +    +  R+ TKTNNSGG
Sbjct: 235 CFDKLEAMLAHAMLSIPASKGFEIGSGFAGVSVPGSKHNDMFYFDEETQRIRTKTNNSGG 294

Query: 297 TQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESM 356
            QGGI+NGENIYF V FK  ATISQEQ T TY+G DGVLAA+GRHDP V PRA+PIVE+M
Sbjct: 295 IQGGISNGENIYFSVPFKSVATISQEQHTCTYDGKDGVLAAKGRHDPAVTPRAIPIVEAM 354

Query: 357 AALVIMDALMIQQSRKTVASLL 378
            ALV+ DAL+IQ+SR    S++
Sbjct: 355 TALVLADALLIQKSRDYSRSIV 376



>gi|482808959|gb|EOA85820.1| hypothetical protein SETTUDRAFT_169596 [Setosphaeria turcica Et28A]
          Length = 413

 Score =  503 bits (1295), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 258/413 (62%), Positives = 303/413 (73%), Gaps = 27/413 (6%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFGT FRVTT+GESH  SVG I+DGCPPG++L EADIQ Q+ RRRPGQS +TTPR+EK
Sbjct: 1   MSTFGTHFRVTTYGESHCLSVGAIIDGCPPGMALTEADIQPQMTRRRPGQSAITTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE GITLGTPIG+ V N++QR  DY     D YPRPSHADWTYL+KY +KAS
Sbjct: 61  DRVEIQSGTEFGITLGTPIGIRVMNENQRKQDYGNQTMDKYPRPSHADWTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSN-IAMPFINEQDERLFPED 177
           SGGGR+SARETIGRVAAGAIAEKYL+   G+EIVAF +S+ N    P   E        +
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLREAFGIEIVAFTNSIGNEFLFPPTAEHPTASTNSE 180

Query: 178 FWELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           + +L++ I RE+VD+   VRCP   VS +M + + + ++A+DS+GGT+TCVIRN P GLG
Sbjct: 181 YLKLIDGITREKVDEYLPVRCPSDEVSRRMEDLVAKYRDAQDSIGGTVTCVIRNCPTGLG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV--------------- 281
           EPCFDKLEAK AHAMLSIPATKGFEIGSGF G  + G  HNDP++               
Sbjct: 241 EPCFDKLEAKLAHAMLSIPATKGFEIGSGFGGAQVPGSIHNDPFIKAPAVPAGENPSAKA 300

Query: 282 -LKNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGR 340
                +L TKTNNSGG QGGITNG  IYF VAFKP ATI Q Q T TY+  DGVL A+GR
Sbjct: 301 FRSKPKLTTKTNNSGGIQGGITNGAPIYFNVAFKPAATIGQAQSTVTYDQEDGVLEAKGR 360

Query: 341 HDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAMSGVIP 393
           HDPCVVPRAVPIVESMAALVIMDA++ QQ+R+   SLLP       A+ GV P
Sbjct: 361 HDPCVVPRAVPIVESMAALVIMDAVLAQQARQGARSLLP-------AIKGVQP 406



>gi|403217363|emb|CCK71857.1| hypothetical protein KNAG_0I00660 [Kazachstania naganishii CBS
           8797]
          Length = 378

 Score =  502 bits (1292), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 246/375 (65%), Positives = 297/375 (79%), Gaps = 10/375 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSL-VEADIQIQLDRRRPGQSNLTTPRDE 59
           MSTFGTLF+VTTFGESH +SVGCIV+G PPG+ L V  D+Q QL RRRPGQS L+TPR+E
Sbjct: 1   MSTFGTLFKVTTFGESHCQSVGCIVEGVPPGMPLRVAEDLQPQLSRRRPGQSKLSTPRNE 60

Query: 60  KDKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASS 119
           +D V +QSG E   TLGTP+ +LV N+D RP+DY  TD YPRPSHAD+TY +KY ++ASS
Sbjct: 61  RDAVIVQSGVEFDTTLGTPLAMLVKNEDHRPNDYKGTDQYPRPSHADFTYAEKYGLQASS 120

Query: 120 GGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFW 179
           GGGRASARETIGRVAAGA+AEK+LKL  GVEIVAFVS + ++AM    ++D   F ++F 
Sbjct: 121 GGGRASARETIGRVAAGAVAEKFLKLASGVEIVAFVSQIGSVAM----QRDP--FDKNFQ 174

Query: 180 ELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEP 238
            LLNTI RE+VD    +RCPD +V+  M + I + +  +DS+GG +TCV+RN P+GLGEP
Sbjct: 175 HLLNTITREKVDSVGFIRCPDTSVAGDMVKEIEKYRGQQDSIGGVVTCVVRNCPIGLGEP 234

Query: 239 CFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSGG 296
           CFDKLEA  AHAMLSIPA+KGFE GSGF G ++ G QHNDP+    +  RL T+TNNSGG
Sbjct: 235 CFDKLEALLAHAMLSIPASKGFEFGSGFAGVSVPGSQHNDPFYFDEEAGRLRTRTNNSGG 294

Query: 297 TQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESM 356
            QGGI+NGENIYF VAFK  ATISQEQ TATY G DGVLA++GRHDP V PRA+PIVESM
Sbjct: 295 IQGGISNGENIYFNVAFKSVATISQEQHTATYEGKDGVLASKGRHDPAVTPRAIPIVESM 354

Query: 357 AALVIMDALMIQQSR 371
           AALV+ D L+IQ+SR
Sbjct: 355 AALVLADQLLIQRSR 369



>gi|396461421|ref|XP_003835322.1| similar to chorismate synthase [Leptosphaeria maculans JN3]
 gi|312211873|emb|CBX91957.1| similar to chorismate synthase [Leptosphaeria maculans JN3]
          Length = 410

 Score =  502 bits (1292), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 252/398 (63%), Positives = 302/398 (75%), Gaps = 18/398 (4%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFGT +RVTT+GESH  SVG I+DGCPPG++L EADIQ Q+ RRRPGQS +TTPR+EK
Sbjct: 1   MSTFGTHYRVTTYGESHCLSVGAIIDGCPPGMALTEADIQPQMTRRRPGQSAITTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE GITLGTPIG+ V N++QR  DY     D YPRPSHADWTYL+KY +KAS
Sbjct: 61  DRVEIQSGTEFGITLGTPIGVRVMNENQRKQDYGNQTMDKYPRPSHADWTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSN-IAMPFINEQDERLFPED 177
           SGGGR+SARETIGRVAAGAIAEKYL+  +G+EIVAF +S+ N    P   E        +
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLREAYGIEIVAFTNSIGNEFLFPPTPEHPTASTNPE 180

Query: 178 FWELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           + +L+++I R +VD+   VRCPD+ V+ +M + I + ++A+DS+GGT+TCVIRN P GLG
Sbjct: 181 YLKLIDSITRNKVDEFLPVRCPDEDVTRRMEDLIAKYRDAQDSIGGTVTCVIRNCPTGLG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV--------------L 282
           EPCFDKLEAK AHAMLSIPATKGFEIGSGF G  L G  HND ++              +
Sbjct: 241 EPCFDKLEAKLAHAMLSIPATKGFEIGSGFGGAQLPGSIHNDAFIKAPAVPAGQNPSSNV 300

Query: 283 KNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHD 342
              RL TKTNNSGG QGGI+NG  IYF VAFKP ATI Q Q T TY+ VDGVL A+GRHD
Sbjct: 301 PRPRLTTKTNNSGGIQGGISNGAPIYFNVAFKPAATIGQAQTTVTYDEVDGVLEAKGRHD 360

Query: 343 PCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPP 380
           PCVVPRAVPIVE MAALVI+DA++ QQ+R+   S+LPP
Sbjct: 361 PCVVPRAVPIVEMMAALVIIDAILAQQARQGARSMLPP 398



>gi|470318503|gb|EMR10156.1| chorismate synthase [Pneumocystis murina B123]
          Length = 395

 Score =  501 bits (1291), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 252/387 (65%), Positives = 306/387 (79%), Gaps = 7/387 (1%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFGTLFRVTT+GESHG+SVGCIVDG PPGL L E DIQIQL RRRPGQ+ LTT R+E+
Sbjct: 1   MSTFGTLFRVTTYGESHGQSVGCIVDGVPPGLFLSEEDIQIQLRRRRPGQNTLTTQRNEQ 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V + SG E GITLGTPIG+++ N+D +P DY E   +PRPSHAD TYLQKY IK+S+G
Sbjct: 61  DLVHLHSGIEDGITLGTPIGMIIYNEDCQPSDYEEIKRFPRPSHADLTYLQKYGIKSSTG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPF-INEQD-----ERLF 174
           GGR+S+RETIGRVAAGAIAEKYL   + +EIVAFVSS+  I M + +N++D     E   
Sbjct: 121 GGRSSSRETIGRVAAGAIAEKYLSETYKIEIVAFVSSIGKIQMEWDMNQEDNEDDIESPI 180

Query: 175 PEDFWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVG 234
            + +   L+T+ RE+VD   VRCP+   S  M  RI  AKE +DS+GGTITCVIRN+P G
Sbjct: 181 SQAYLSFLSTVTREQVDASLVRCPNMVTSAAMIARIERAKENQDSIGGTITCVIRNLPAG 240

Query: 235 LGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLK-NDRLGTKTNN 293
           LGEPCFDKLEAK AHAMLSIP+TKGFE+GSGFKGT + G +HNDP+++  N++L T TNN
Sbjct: 241 LGEPCFDKLEAKLAHAMLSIPSTKGFEVGSGFKGTQVPGSKHNDPYIMDTNNKLRTVTNN 300

Query: 294 SGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIV 353
           SGG QGGI+NGEN++F+VAFK PA+I ++Q T++Y G +G+L  +GRHDP V  RAVPIV
Sbjct: 301 SGGIQGGISNGENVFFKVAFKSPASIGKQQFTSSYEGTNGMLFIKGRHDPNVASRAVPIV 360

Query: 354 ESMAALVIMDALMIQQSRKTVASLLPP 380
           E MAALVIMDALMIQ SR+T  SLLPP
Sbjct: 361 ECMAALVIMDALMIQLSRQTARSLLPP 387



>gi|242766687|ref|XP_002341220.1| chorismate synthase [Talaromyces stipitatus ATCC 10500]
 gi|218724416|gb|EED23833.1| chorismate synthase [Talaromyces stipitatus ATCC 10500]
          Length = 411

 Score =  501 bits (1290), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 254/400 (63%), Positives = 295/400 (73%), Gaps = 38/400 (9%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MST+G  FRVTT+GESH +SVGCIVDGCPPG++L E DIQ Q+ RRRPGQS LTTPR+EK
Sbjct: 1   MSTWGDYFRVTTYGESHCRSVGCIVDGCPPGMALTEDDIQPQMTRRRPGQSALTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE G TLGTPI ++V N+DQRP DY  S  DLYPRPSHAD+TYL+KY +KAS
Sbjct: 61  DRVEIQSGTECGYTLGTPIAMIVRNEDQRPKDYGGSTMDLYPRPSHADYTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFP--- 175
           SGGGR+SARETIGRVAAGAIAEKYLKL H VEIV+FVSSV N          E LFP   
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLKLAHNVEIVSFVSSVGN----------EHLFPPSA 170

Query: 176 --------EDFWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITC 226
                    +F +L+ TI RE VDK A VRCP    S++M + I   ++  DS+GGT+ C
Sbjct: 171 EHPSYSTNPEFLKLIETIDRETVDKFAPVRCPSTEASERMTKVIETFRDNHDSIGGTVMC 230

Query: 227 VIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV----- 281
           VIRNVP+GLGEP FDKLEAK  HAM+SIPATKGFEIGSGF G  + G  HNDP+V     
Sbjct: 231 VIRNVPIGLGEPAFDKLEAKLGHAMMSIPATKGFEIGSGFGGCEVPGSIHNDPFVAAPEV 290

Query: 282 ---------LKNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVD 332
                        RL T +NNSGG QGGI+NG  IYFR AFKPPATI Q Q T TY   +
Sbjct: 291 SENKPGAGIANKSRLTTSSNNSGGIQGGISNGATIYFRTAFKPPATIGQAQTTTTYALEE 350

Query: 333 GVLAARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRK 372
           G+L A+GRHDPCVVPRAVPIVE+MAALV+MDAL+ Q++R+
Sbjct: 351 GILEAKGRHDPCVVPRAVPIVEAMAALVVMDALLAQKARE 390



>gi|189196740|ref|XP_001934708.1| chorismate synthase [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|187980587|gb|EDU47213.1| chorismate synthase [Pyrenophora tritici-repentis Pt-1C-BFP]
          Length = 412

 Score =  501 bits (1290), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 255/413 (61%), Positives = 303/413 (73%), Gaps = 27/413 (6%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFGT FRVTT+GESH  SVG I+DGCPPG++L E+DIQ Q+ RRRPGQS +TTPR+EK
Sbjct: 1   MSTFGTHFRVTTYGESHCLSVGAIIDGCPPGMALTESDIQPQMTRRRPGQSAITTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE GITLGTPIG+ V N++QR  DY     D YPRPSHADWTYL+KY +KAS
Sbjct: 61  DRVEIQSGTEFGITLGTPIGIRVMNENQRKQDYGNQTMDKYPRPSHADWTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSN-IAMPFINEQDERLFPED 177
           SGGGR+SARETIGRVAAGAIAEKYL+  +G+EIVAF +S+ N    P   E        +
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLREAYGIEIVAFTNSIGNEFLFPPTAEHPTASTNPE 180

Query: 178 FWELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           + +L+++I RE+VD+   VRCP   V+ +M + I + ++A DS+GGT+TCVIRN P GLG
Sbjct: 181 YLKLIDSITREKVDEFLPVRCPSDDVTKRMEDLIAKYRDAHDSIGGTVTCVIRNCPTGLG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV--------------- 281
           EPCFDKLEAK  HAMLSIPATKGFEIGSGF G  L G  HND ++               
Sbjct: 241 EPCFDKLEAKLGHAMLSIPATKGFEIGSGFGGAQLPGSIHNDAFIKAPAVPAGENPSAHV 300

Query: 282 -LKNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGR 340
                +L TKTNNSGG QGGITNG  IYF VAFKP ATI Q Q T TY+  DGVL A+GR
Sbjct: 301 YRSKPKLTTKTNNSGGIQGGITNGAPIYFNVAFKPAATIGQAQSTVTYDQEDGVLEAKGR 360

Query: 341 HDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAMSGVIP 393
           HDPCVVPRAVPIVE+MAALVIMDA++ QQ+R+   SLLPP       + GV+P
Sbjct: 361 HDPCVVPRAVPIVETMAALVIMDAVLAQQARQGARSLLPP-------LKGVVP 406



>gi|471571621|gb|EMR70350.1| putative chorismate synthase protein [Eutypa lata UCREL1]
          Length = 413

 Score =  501 bits (1289), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 266/398 (66%), Positives = 305/398 (76%), Gaps = 18/398 (4%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG +FRVTT+GESH +SVGCIVDGCPPG+ L E DIQ Q+ RRRPGQSN+TTPR+EK
Sbjct: 1   MSTFGKVFRVTTYGESHCRSVGCIVDGCPPGMELTEDDIQPQMTRRRPGQSNITTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE G+TLGTPIGL+V N+DQRP DY  S  DLYPRPSHADWTYL+KY +KAS
Sbjct: 61  DRVMIQSGTEFGVTLGTPIGLIVQNEDQRPKDYGNSTMDLYPRPSHADWTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM-PFINEQDERLFPED 177
           SGGGR+SARETIGRVAAGAIAEKYLKL +GVEI AFV+SV  + + P   E        D
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLKLAYGVEITAFVASVGAVHLFPPTAEHPSPSQNPD 180

Query: 178 FWELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           F  L++TI RE VD+   VRCP + VS +M + I   K   DS+GGT+TCVIRN+P GLG
Sbjct: 181 FIRLVDTIDRETVDRFLPVRCPSEAVSRQMADYIAGFKARDDSIGGTVTCVIRNLPSGLG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV-------------LK 283
           EPCFDKLEA+ AHAMLSIPATKGFE GSGF G  + G  HNDP+V             L 
Sbjct: 241 EPCFDKLEAELAHAMLSIPATKGFEFGSGFGGCEVPGSIHNDPFVRAPGGDADAKNHGLP 300

Query: 284 NDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNG-VDGVLAARGRHD 342
             +L TKTNNSGG QGGI+NG  +YFR AFKPPATISQ Q TATY+G  +GVLAA+GRHD
Sbjct: 301 RSKLTTKTNNSGGVQGGISNGAPVYFRTAFKPPATISQAQTTATYDGSSEGVLAAKGRHD 360

Query: 343 PCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPP 380
           PCVVPRAVPIVE+MAALV+MDALM Q +R      LPP
Sbjct: 361 PCVVPRAVPIVEAMAALVVMDALMQQMARHEARRHLPP 398



>gi|451846844|gb|EMD60153.1| hypothetical protein COCSADRAFT_40586 [Bipolaris sorokiniana
           ND90Pr]
          Length = 415

 Score =  500 bits (1288), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 255/413 (61%), Positives = 303/413 (73%), Gaps = 27/413 (6%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFGT FRVTT+GESH  SVG I+DGCPPG++L EAD+Q Q+ RRRPGQS +TTPR+EK
Sbjct: 1   MSTFGTHFRVTTYGESHCLSVGAIIDGCPPGMALTEADMQPQMTRRRPGQSAITTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE GITLGTPIG+ V N++QR  DY     D YPRPSHADWTYL+KY +KAS
Sbjct: 61  DRVEIQSGTEFGITLGTPIGIRVMNENQRKQDYGNQTMDKYPRPSHADWTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSN-IAMPFINEQDERLFPED 177
           SGGGR+SARETIGRVAAGAIAEKYL+  +G+EIVAF +S+ N    P   E        +
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLREAYGIEIVAFTNSIGNEFLFPPTPEHPTASTNPE 180

Query: 178 FWELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           F +L++TI RE+VD+   VRCP   V+ +M + I + ++A+DS+GGT+ CVIRN P GLG
Sbjct: 181 FLKLVDTITREKVDEYLPVRCPSDEVTRRMEDLIAKYRDAQDSIGGTVACVIRNCPTGLG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV--------------- 281
           EPCFDKLEAK  HAMLSIPATKGFEIGSGF G  + G  HNDP++               
Sbjct: 241 EPCFDKLEAKLGHAMLSIPATKGFEIGSGFGGAQVPGSIHNDPFIKAPAVPAGENPSAKV 300

Query: 282 -LKNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGR 340
                +L TKTNNSGG QGGI+NG  IYF VAFKP ATI Q Q T TY+  DGVL A+GR
Sbjct: 301 FRSKPKLTTKTNNSGGIQGGISNGAPIYFNVAFKPAATIGQAQSTVTYDQEDGVLEAKGR 360

Query: 341 HDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAMSGVIP 393
           HDPCVVPRAVPIVESMAALVIMDA++ QQ+R+    LLP       A+ GV+P
Sbjct: 361 HDPCVVPRAVPIVESMAALVIMDAVLAQQARQGARGLLP-------AIKGVLP 406



>gi|452005356|gb|EMD97812.1| hypothetical protein COCHEDRAFT_1165110 [Bipolaris maydis C5]
 gi|477585705|gb|ENI02792.1| hypothetical protein COCC4DRAFT_82875 [Bipolaris maydis ATCC 48331]
          Length = 415

 Score =  499 bits (1286), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 255/413 (61%), Positives = 302/413 (73%), Gaps = 27/413 (6%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFGT FRVTT+GESH  SVG I+DGCPPG++L EADIQ Q+ RRRPGQS +TTPR+EK
Sbjct: 1   MSTFGTHFRVTTYGESHCLSVGAIIDGCPPGMALTEADIQPQMTRRRPGQSAITTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE GITLGTPIG+ V N++QR  DY     D YPRPSHADWTYL+KY +KAS
Sbjct: 61  DRVEIQSGTEFGITLGTPIGIRVMNENQRKQDYGNQTMDKYPRPSHADWTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSN-IAMPFINEQDERLFPED 177
           SGGGR+SARETIGRVAAGAIAEKYL+  +G+EIVAF +S+ N    P   E        +
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLREAYGIEIVAFTNSIGNEFLFPPTPEHPTASTNPE 180

Query: 178 FWELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           F +L++TI RE+VD    VRCP   V+ +M + I + ++A+DS+GGT+ CVIRN P GLG
Sbjct: 181 FLKLVDTITREKVDGYLPVRCPSDEVTRRMEDLIAKYRDAQDSIGGTVACVIRNCPTGLG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV--------------- 281
           EPCFDKLEAK  HAMLSIPATKGFEIGSGF G  + G  HNDP++               
Sbjct: 241 EPCFDKLEAKLGHAMLSIPATKGFEIGSGFGGAQVPGSIHNDPFIKAPAVPAGENPSAKV 300

Query: 282 -LKNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGR 340
                +L TKTNNSGG QGGI+NG  IYF VAFKP ATI Q Q T TY+  DG+L A+GR
Sbjct: 301 FRSKPKLTTKTNNSGGIQGGISNGAPIYFNVAFKPAATIGQAQSTVTYDQEDGILEAKGR 360

Query: 341 HDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAMSGVIP 393
           HDPCVVPRAVPIVESMAALVIMDA++ QQ+R+   SLLP        + GV+P
Sbjct: 361 HDPCVVPRAVPIVESMAALVIMDAVLAQQARQGARSLLP-------VIKGVVP 406



>gi|976375|gb|AAC49056.1| chorismate synthase [Neurospora crassa]
 gi|1583263|prf||2120340A chorismate synthase/flavin reductase
          Length = 432

 Score =  499 bits (1286), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 260/405 (64%), Positives = 299/405 (73%), Gaps = 25/405 (6%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT+GESH KSVGCIVDG PPG+ L E DIQ Q+ RRRPGQS +TTPRDEK
Sbjct: 1   MSTFGHYFRVTTYGESHCKSVGCIVDGVPPGMELTEDDIQPQMTRRRPGQSAITTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE G+TLGTPIG+LV N+DQ P DY     D+YPRPSHADWTYL+KY +KAS
Sbjct: 61  DRVIIQSGTEFGVTLGTPIGMLVMNEDQPPKDYGNKTMDIYPRPSHADWTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSV-SNIAMPFINEQDERLFPED 177
           SGGGR+SARETIGRVAAGAIAEKYLK  +GVEIVAFVSSV S    P   E        +
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLKPRYGVEIVAFVSSVGSEHLFPPTAEHPSPSTNPE 180

Query: 178 FWELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           F +L+N+I RE VD    VRCPD   + +M + I + ++  DS+GGT+TCVIRNVP GLG
Sbjct: 181 FLKLVNSITRETVDSFLPVRCPDAEANKRMEDLITKFRDNHDSIGGTVTCVIRNVPSGLG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV--------------- 281
           EP FDKLEA  AHAMLSIPATKGFE+GSGF G  + G  HNDP+V               
Sbjct: 241 EPAFDKLEAMLAHAMLSIPATKGFEVGSGFGGCEVPGSIHNDPFVSAENTEIPPSVAASG 300

Query: 282 -----LKNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGV-DGVL 335
                +   +L TKTN SGG QGGI+NG  IYFRV FKP ATI QEQ TATY+G  +GVL
Sbjct: 301 AARNGIPRPKLTTKTNFSGGIQGGISNGAPIYFRVGFKPAATIGQEQTTATYDGTSEGVL 360

Query: 336 AARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPP 380
           AA+GRHDP VVPRAVPIVE+MAALVIMDA++  ++R T  SLLPP
Sbjct: 361 AAKGRHDPSVVPRAVPIVEAMAALVIMDAVLAHEARVTAKSLLPP 405



>gi|302914373|ref|XP_003051122.1| hypothetical protein NECHADRAFT_61025 [Nectria haematococca mpVI
           77-13-4]
 gi|256732060|gb|EEU45409.1| hypothetical protein NECHADRAFT_61025 [Nectria haematococca mpVI
           77-13-4]
          Length = 407

 Score =  499 bits (1284), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 254/397 (63%), Positives = 299/397 (75%), Gaps = 25/397 (6%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT GESHGK+V CI++ CPPGLSLVEADIQ QL+RRRPGQS +TTPRDEK
Sbjct: 1   MSTFGNYFRVTTAGESHGKTVSCIIENCPPGLSLVEADIQPQLNRRRPGQSAITTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           D+V I SG E G TLGTPI L VPN+DQRPHDY     DLYPRPSHADWTYL+KY IKAS
Sbjct: 61  DRVTIGSGCEFGRTLGTPILLTVPNEDQRPHDYGSKTIDLYPRPSHADWTYLEKYGIKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM----PFINEQDERLF 174
           SGGGR+SARETI RVAAGA+AEK+L+  +GVEIVAFVSSV NI +    P  +  D    
Sbjct: 121 SGGGRSSARETIARVAAGAVAEKWLREAYGVEIVAFVSSVGNIKLFEDKPTTDSDDIDTL 180

Query: 175 PED--FWELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNV 231
             +  F EL++++ RE+VD+   VRCPD  VS +M +RI E ++  DS GGT+TC+IR  
Sbjct: 181 SSNPKFLELVDSLTREKVDEFLPVRCPDTAVSKRMEDRIAELRDKHDSTGGTVTCIIRGC 240

Query: 232 PVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV---------- 281
           P GLGEPCFDKLEA  AHA++SIPATKGFEIGSGF+G+   G +HNDP+V          
Sbjct: 241 PSGLGEPCFDKLEALLAHAIMSIPATKGFEIGSGFRGSETLGSRHNDPFVSTAAADDATP 300

Query: 282 -----LKNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGV-DGVL 335
                +   RL TKTN+SGG QGGI+NG  I+FRVAFKPPATISQ+Q TA Y+   +GVL
Sbjct: 301 SAGVGIPPSRLQTKTNHSGGIQGGISNGMPIFFRVAFKPPATISQDQTTARYDASGEGVL 360

Query: 336 AARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRK 372
            A+GRHDP V PRAVPIVE+MAAL I DALM Q +R+
Sbjct: 361 TAKGRHDPNVAPRAVPIVEAMAALTIADALMAQHARQ 397



>gi|453080391|gb|EMF08442.1| chorismate synthase [Mycosphaerella populorum SO2202]
          Length = 440

 Score =  498 bits (1283), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 259/424 (61%), Positives = 294/424 (69%), Gaps = 55/424 (12%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT+GESHGKSVGCIVDG PPGL L E DIQ Q+ RRRPGQS LTTPRDEK
Sbjct: 1   MSTFGQYFRVTTYGESHGKSVGCIVDGVPPGLELTEKDIQPQMTRRRPGQSALTTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE-----------------TDLYPRPS 103
           D V IQSGTE GITLGTPIGL V NQDQRP DY +                  D +PRPS
Sbjct: 61  DMVEIQSGTEFGITLGTPIGLRVMNQDQRPKDYGKEGASFNGQQAGTKAQRPMDDFPRPS 120

Query: 104 HADWTYLQKYSIKASSGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM 163
           HADWTYL+KY +KASSGGGR+SARETIGRVAA AIAEKYLK+ +GVEIVAF +SV     
Sbjct: 121 HADWTYLEKYGVKASSGGGRSSARETIGRVAAAAIAEKYLKVAYGVEIVAFTNSVG---- 176

Query: 164 PFINEQDERLFPE-----------DFWELLNTIRREEVDKD-AVRCPDKTVSDKMRERIH 211
                 DE LFP            +F  LL  I RE+VD    VRCP+   + +M + I 
Sbjct: 177 ------DEHLFPSTRTHPSPSTNPEFLNLLEGITREQVDSFLPVRCPNGEAAKRMEDLIA 230

Query: 212 EAKEAKDSVGGTITCVIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTL 271
           E ++  DS+GGT+TCVIRN P GLGEPCFDK+EAK AHAMLSIPATK FEIGSG  G  +
Sbjct: 231 EYRDKHDSIGGTVTCVIRNCPSGLGEPCFDKMEAKLAHAMLSIPATKSFEIGSGLGGCEM 290

Query: 272 FGHQHNDPWVL----------------KNDRLGTKTNNSGGTQGGITNGENIYFRVAFKP 315
            G  HNDP++                    RL TKTNNSGG QGGITNG  I+F V FKP
Sbjct: 291 PGSIHNDPFIKAPAVAPSVSGASQPISSRPRLTTKTNNSGGVQGGITNGMPIFFTVGFKP 350

Query: 316 PATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVA 375
           PATI Q Q+T TY+  +GVL A+GRHDPCV+PRAVPIVE+MAALV+MDALM Q +R++  
Sbjct: 351 PATIGQAQQTTTYDEEEGVLEAKGRHDPCVIPRAVPIVEAMAALVVMDALMAQAARQSTR 410

Query: 376 SLLP 379
           S LP
Sbjct: 411 SRLP 414



>gi|331228895|ref|XP_003327114.1| chorismate synthase [Puccinia graminis f. sp. tritici CRL
           75-36-700-3]
 gi|309306104|gb|EFP82695.1| chorismate synthase [Puccinia graminis f. sp. tritici CRL
           75-36-700-3]
          Length = 389

 Score =  498 bits (1281), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 248/402 (61%), Positives = 291/402 (72%), Gaps = 33/402 (8%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FGT+FRV+T GESH   V  IVDG PPGL L E D+Q QL RRRPGQS+LTTPR+E 
Sbjct: 1   MSSFGTIFRVSTAGESHCSGVTAIVDGVPPGLQLTEDDLQTQLSRRRPGQSDLTTPRNES 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V IQSG E G+TLG+PI L VPN+DQRPHDYSETD YPRPSHADWTYL          
Sbjct: 61  DLVKIQSGVEHGVTLGSPISLFVPNRDQRPHDYSETDFYPRPSHADWTYL---------- 110

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM------PFI-------- 166
                    + RVAAGAIAEK+L+  +GVEIVAFVS V  I +      P          
Sbjct: 111 ---------LTRVAAGAIAEKFLRTAYGVEIVAFVSGVGPIHLSSKSFSPVTVNGSNGTH 161

Query: 167 NEQDERLFPEDFWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITC 226
           +++DE      F + L+ I REEVDK  VRCP +  + +M +RI EAK A DS+GGT+TC
Sbjct: 162 HDEDEDFSGPGFLQFLSDITREEVDKSVVRCPHEATAQRMTQRIMEAKAADDSIGGTVTC 221

Query: 227 VIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKNDR 286
           VI+N P GLGEPCFDKLEAK AHA++SIPATKGFEIGSGFKG  + G +HND +   ++ 
Sbjct: 222 VIKNCPTGLGEPCFDKLEAKLAHAIMSIPATKGFEIGSGFKGVEMAGSKHNDMFTKGDNG 281

Query: 287 LGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVV 346
           L T TN SGG QGGI+NGENIYFR AFK PATI++EQ+TATYNG  GVLAARGRHDPCVV
Sbjct: 282 LSTLTNRSGGIQGGISNGENIYFRCAFKSPATIAKEQQTATYNGESGVLAARGRHDPCVV 341

Query: 347 PRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAM 388
           PRAVPIVESMAALVIMDA+++Q +R + ASLLP    +P  M
Sbjct: 342 PRAVPIVESMAALVIMDAVLLQNARASFASLLPKPTTLPPTM 383



>gi|408393101|gb|EKJ72369.1| hypothetical protein FPSE_07454 [Fusarium pseudograminearum CS3096]
          Length = 395

 Score =  496 bits (1277), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 246/395 (62%), Positives = 291/395 (73%), Gaps = 19/395 (4%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FG  FRVTT GESHGKSV CI+D CPP L L EADIQ QL+RRRPGQS +TTPR+EK
Sbjct: 1   MSSFGQFFRVTTAGESHGKSVSCIIDNCPPNLGLTEADIQPQLNRRRPGQSAITTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           D+V I SGTE G+TLGTPI L VPN+DQRP DY     DLYPRPSHADWTYL+KY  KAS
Sbjct: 61  DRVTIHSGTEDGVTLGTPILLTVPNEDQRPKDYGNKTIDLYPRPSHADWTYLEKYGTKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDF 178
           SGGGR+SARETI RVAAGA+AEK+LK  +G+EIVAFV+SV NI +    + D       F
Sbjct: 121 SGGGRSSARETIARVAAGAVAEKWLKEAYGIEIVAFVTSVGNIKL--FGDSDSMSADPAF 178

Query: 179 WELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGE 237
             L   I R+EVD +  VRCPD      M  RI E ++A DS GGT+TCVIRN P GLGE
Sbjct: 179 LSLAERITRQEVDDNLPVRCPDDAYGRAMEARIAELRDAHDSTGGTVTCVIRNAPSGLGE 238

Query: 238 PCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV-------------LKN 284
           PCFDKL+A  AHAM+SIPA K FE+GSGF+G  + G +HNDP+V             +  
Sbjct: 239 PCFDKLQATLAHAMMSIPAVKAFELGSGFQGAEMTGSKHNDPFVPAPALDAASEKTGIPR 298

Query: 285 DRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGV-DGVLAARGRHDP 343
            +L TKTN+SGG QGGI+NG  I+F+V FKPPATISQ+Q TA Y+G  +G+LAA+GRHDP
Sbjct: 299 SKLQTKTNHSGGIQGGISNGMPIFFKVGFKPPATISQDQTTARYDGQGEGILAAKGRHDP 358

Query: 344 CVVPRAVPIVESMAALVIMDALMIQQSRKTVASLL 378
           CVVPRAVPIVE MAALVI DA+M Q +R+    ++
Sbjct: 359 CVVPRAVPIVEGMAALVIADAIMAQHARQMATDII 393



>gi|330906487|ref|XP_003295495.1| hypothetical protein PTT_01275 [Pyrenophora teres f. teres 0-1]
 gi|311333189|gb|EFQ96413.1| hypothetical protein PTT_01275 [Pyrenophora teres f. teres 0-1]
          Length = 412

 Score =  496 bits (1276), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 253/413 (61%), Positives = 302/413 (73%), Gaps = 27/413 (6%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFGT FRVTT+GESH  SVG I+DGCPPG++L E+DIQ Q+ RRRPGQS +TTPR+EK
Sbjct: 1   MSTFGTHFRVTTYGESHCLSVGAIIDGCPPGMALTESDIQPQMTRRRPGQSAITTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE GITLGTPIG+ V N++QR  DY     D YPRPSHADWTYL+KY +KAS
Sbjct: 61  DRVEIQSGTEFGITLGTPIGIRVMNENQRKQDYGNQTMDKYPRPSHADWTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSN-IAMPFINEQDERLFPED 177
           SGGGR+SARETIGRVAAGAIAEKYL   +G+EIVAF +S+ N    P   E        +
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLCEAYGIEIVAFTNSIGNEFLFPPTAEHPTASTNPE 180

Query: 178 FWELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           + +L+++I RE+VD+   VRCP   V+ +M + + + ++A+DS+GGT+TCVIRN P GLG
Sbjct: 181 YLKLIDSITREKVDEFLPVRCPSDDVTKRMEDLVAKYRDAQDSIGGTVTCVIRNCPTGLG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV--------------- 281
           EPCFDKLEAK  HAMLSIPATKGFEIGSGF G  L G  HND ++               
Sbjct: 241 EPCFDKLEAKLGHAMLSIPATKGFEIGSGFGGAQLPGSIHNDAFIKAPAVPAGENPSAHV 300

Query: 282 -LKNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGR 340
                +L TKTNNSGG QGGITNG  IYF VAFKP ATI Q Q T TY+  DGVL A+GR
Sbjct: 301 YRSKPKLTTKTNNSGGIQGGITNGAPIYFNVAFKPAATIGQAQSTVTYDQEDGVLEAKGR 360

Query: 341 HDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAMSGVIP 393
           HDPCVVPRAVPIVE+MAALVIMDA++ QQ+R+   SLLP        + GV+P
Sbjct: 361 HDPCVVPRAVPIVETMAALVIMDAVLAQQARQGARSLLP-------RLEGVVP 406



>gi|365989846|ref|XP_003671753.1| hypothetical protein NDAI_0H03370 [Naumovozyma dairenensis CBS 421]
 gi|343770526|emb|CCD26510.1| hypothetical protein NDAI_0H03370 [Naumovozyma dairenensis CBS 421]
          Length = 377

 Score =  496 bits (1276), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 245/382 (64%), Positives = 299/382 (78%), Gaps = 10/382 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG LF+VTT+GESH KSVGCIVDG PPG++L EADIQ QL RRRPGQS L+TPR+EK
Sbjct: 1   MSTFGKLFKVTTYGESHCKSVGCIVDGVPPGMTLTEADIQPQLTRRRPGQSKLSTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE-TDLYPRPSHADWTYLQKYSIKASS 119
           DKV IQSG E   TLGTPI +L+ N+DQRP+DY++  + +PRPSHAD+TY +KY I+ASS
Sbjct: 61  DKVEIQSGIEFNKTLGTPIAMLIRNEDQRPNDYNDIMNKFPRPSHADFTYSEKYGIQASS 120

Query: 120 GGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFW 179
           GGGRASARETIGRVAAGAIAEK+LK V  VEIV FV+ +  I M      +   F  +F 
Sbjct: 121 GGGRASARETIGRVAAGAIAEKFLKQVSNVEIVGFVTQIGEIKM------ERNPFDPNFQ 174

Query: 180 ELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEP 238
            +LNTI RE+VD    +RCPD +V+  M + I + +  +DS+GG +TCV+RN+P GLGEP
Sbjct: 175 HVLNTITREKVDSMGPIRCPDASVAGDMVKEIEKYRGNQDSIGGVVTCVVRNLPTGLGEP 234

Query: 239 CFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSGG 296
           CFDKLEA  AHAMLSIPA+KGFEIGSGF G ++ G +HND +    +  RL TKTNNSGG
Sbjct: 235 CFDKLEAMLAHAMLSIPASKGFEIGSGFAGVSVPGSKHNDMFYYDEEQKRLRTKTNNSGG 294

Query: 297 TQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESM 356
            QGGI+NGENIYF V FK  ATISQEQ+TATY+G +GVLAA+GRHDP V PRA+PIVE+M
Sbjct: 295 IQGGISNGENIYFSVPFKSVATISQEQKTATYDGKEGVLAAKGRHDPAVTPRAIPIVEAM 354

Query: 357 AALVIMDALMIQQSRKTVASLL 378
            ALV+ DAL+IQ+SR+   S++
Sbjct: 355 TALVLADALLIQKSREYSRSIV 376



>gi|46109522|ref|XP_381819.1| hypothetical protein FG01643.1 [Fusarium graminearum PH-1]
          Length = 395

 Score =  495 bits (1275), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 245/395 (62%), Positives = 291/395 (73%), Gaps = 19/395 (4%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FG  FRVTT GESHGKSV CI+D CPP L L EADIQ QL+RRRPGQS +TTPR+EK
Sbjct: 1   MSSFGQFFRVTTAGESHGKSVSCIIDNCPPNLGLTEADIQPQLNRRRPGQSAITTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           D+V I SGTE G+TLGTPI L VPN+DQRP DY     DLYPRPSHADWTYL+KY  KAS
Sbjct: 61  DRVTIHSGTEDGVTLGTPILLTVPNEDQRPKDYGNKTIDLYPRPSHADWTYLEKYGTKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDF 178
           SGGGR+SARETI RVAAGA+AEK+LK  +G+EIVAFV+SV NI +    + D       F
Sbjct: 121 SGGGRSSARETIARVAAGAVAEKWLKEAYGIEIVAFVTSVGNIKL--FGDSDSMSADPAF 178

Query: 179 WELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGE 237
             L   I R+EVD +  VRCPD      M  RI E ++A DS GGT+TCVIRN P GLGE
Sbjct: 179 LSLAERITRQEVDDNLPVRCPDDAYGRAMEARIAELRDAHDSTGGTVTCVIRNAPSGLGE 238

Query: 238 PCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV-------------LKN 284
           PCFDKL+A  AHAM+SIPA K FE+GSGF+G  + G +HNDP+V             +  
Sbjct: 239 PCFDKLQATLAHAMMSIPAVKAFELGSGFQGAEMTGSKHNDPFVPAPALDAASEKTGIPR 298

Query: 285 DRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGV-DGVLAARGRHDP 343
            +L TKTN+SGG QGGI+NG  I+F+V FKPPATISQ+Q TA Y+G  +G+L+A+GRHDP
Sbjct: 299 SKLQTKTNHSGGIQGGISNGMPIFFKVGFKPPATISQDQTTARYDGQGEGILSAKGRHDP 358

Query: 344 CVVPRAVPIVESMAALVIMDALMIQQSRKTVASLL 378
           CVVPRAVPIVE MAALVI DA+M Q +R+    ++
Sbjct: 359 CVVPRAVPIVEGMAALVIADAIMAQHARQMATDII 393



>gi|258678618|emb|CAX46413.1| chorismate synthase [Verticillium longisporum]
 gi|346973079|gb|EGY16531.1| chorismate synthase [Verticillium dahliae VdLs.17]
          Length = 408

 Score =  495 bits (1275), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 254/402 (63%), Positives = 294/402 (73%), Gaps = 22/402 (5%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFGT F+VTT+GESHGKSVG IVDG PPGL+L E+DIQ QL RRRPGQS +TTPR+EK
Sbjct: 1   MSTFGTYFKVTTYGESHGKSVGVIVDGVPPGLALDESDIQPQLTRRRPGQSAITTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           D+V IQSGTE G TLGTP+G+LVPN+DQRP DY     D +PRPSHADWTYL KY IKAS
Sbjct: 61  DRVTIQSGTEFGYTLGTPLGMLVPNEDQRPKDYGNKTMDRFPRPSHADWTYLTKYGIKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM-PFINEQDERLFPED 177
           SGGGR+SARETI RVAAGA+AEKYL+  +G EI AF +S+ N+ + P   E         
Sbjct: 121 SGGGRSSARETIARVAAGAVAEKYLREAYGTEITAFTTSIGNVHLFPPTPEHPSPSTNPA 180

Query: 178 FWELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           F  LL TI R  VDK   VRCP    S+ M + I   ++  DS+GGT+TCVI+N P GLG
Sbjct: 181 FLSLLQTIDRATVDKFLPVRCPHTETSEAMNDYIAGFRDRDDSIGGTVTCVIKNPPAGLG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV--------------- 281
           EPCFDKLEA  AHAMLSIPATKGFEIGSGF G  + G  HND ++               
Sbjct: 241 EPCFDKLEALLAHAMLSIPATKGFEIGSGFAGCEVPGSTHNDAFIRAPEDDARAAAETAR 300

Query: 282 --LKNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVD-GVLAAR 338
             +   +L TKTN SGG QGGI+NG  IYFRVAFKP ATI Q+Q TATY+G + GVLAA+
Sbjct: 301 LGIPRSKLTTKTNFSGGIQGGISNGAPIYFRVAFKPAATIGQDQTTATYDGEEGGVLAAK 360

Query: 339 GRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPP 380
           GRHDPCVVPRA+PIVE MAA+VIMDALM Q +R+   SLLPP
Sbjct: 361 GRHDPCVVPRAIPIVEGMAAIVIMDALMAQHARQMTRSLLPP 402



>gi|322695965|gb|EFY87764.1| chorismate synthase [Metarhizium acridum CQMa 102]
          Length = 407

 Score =  494 bits (1272), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 251/397 (63%), Positives = 298/397 (75%), Gaps = 25/397 (6%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT GESHGK+V CI++ CPPGLSLVE+DIQ QL+RRRPGQS +TTPRDEK
Sbjct: 1   MSTFGKYFRVTTAGESHGKTVSCIIENCPPGLSLVESDIQPQLNRRRPGQSAITTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           D+V I SG E G TLGTPI L VPN+DQRPHDY     DLYPRPSHADWTYL+KY  KAS
Sbjct: 61  DRVTIGSGCEFGRTLGTPILLTVPNEDQRPHDYGSKTIDLYPRPSHADWTYLEKYGTKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM----PFINEQDERLF 174
           SGGGR+SARETI RVAAGA+AEK+L+  +GVEIVAFVSSV NI +    P     D    
Sbjct: 121 SGGGRSSARETIARVAAGAVAEKWLREAYGVEIVAFVSSVGNIKLFEDRPITESDDIDSL 180

Query: 175 PED--FWELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNV 231
             +  F EL++++ RE+VD+   VRCPD TV+ +M ++I E ++  DS GGT+TC+IR  
Sbjct: 181 SSNPKFLELIDSLTREKVDEFLPVRCPDTTVAKRMEDKIAELRDQHDSTGGTVTCIIRGC 240

Query: 232 PVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV---------- 281
           P GLGEPCFDKLEA  AHA++SIPATKGFEIGSGF+G  + G +HNDP+V          
Sbjct: 241 PSGLGEPCFDKLEALLAHAIMSIPATKGFEIGSGFRGAEMRGSRHNDPFVPTAAADDATP 300

Query: 282 -----LKNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGV-DGVL 335
                +   RL TKTN+SGG QGGI+NG  I+FRVAFKPPATISQ+Q TA Y+   +GVL
Sbjct: 301 SAGAGIPPSRLQTKTNHSGGIQGGISNGMPIFFRVAFKPPATISQDQTTARYDASGEGVL 360

Query: 336 AARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRK 372
           A +GRHDP V PRAVPIVE+MAAL I DALM Q +R+
Sbjct: 361 ATKGRHDPNVTPRAVPIVEAMAALTIADALMAQHARQ 397



>gi|342886328|gb|EGU86195.1| hypothetical protein FOXB_03274 [Fusarium oxysporum Fo5176]
 gi|477520524|gb|ENH72650.1| Chorismate synthase [Fusarium oxysporum f. sp. cubense race 1]
          Length = 393

 Score =  493 bits (1270), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 244/389 (62%), Positives = 295/389 (75%), Gaps = 19/389 (4%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+ G +FRVTT GESHG+++ CI+DGCPPGL L EADIQ QL+RRRPGQS +TTPR+EK
Sbjct: 1   MSSIGQIFRVTTAGESHGRAISCIIDGCPPGLDLTEADIQPQLNRRRPGQSAITTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           D+V I SGTE+G+TLGTPI L VPN+DQRP DY +   D+YPRPSHADWTYL+KY +KAS
Sbjct: 61  DRVTINSGTENGVTLGTPILLTVPNEDQRPRDYGDKTIDMYPRPSHADWTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDF 178
           SGGGR+SARETI RVAAGA+AEK+LK  + +EIVAFVSSV  I + F + +     P  F
Sbjct: 121 SGGGRSSARETIARVAAGAVAEKWLKEAYNIEIVAFVSSVGTIKL-FADTEAMSTDPA-F 178

Query: 179 WELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGE 237
             L  T+ RE+VD+   VRCPD  +   M  RI E ++  DS GGT+TC+IRNVP GLGE
Sbjct: 179 LSLAETLTREQVDEHLPVRCPDDAIGRAMEARIAELRDEHDSTGGTVTCIIRNVPSGLGE 238

Query: 238 PCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV-------------LKN 284
           PCFDKL+A  AH ++SIPA KGFE GSGF G  + G +HNDP+V             +  
Sbjct: 239 PCFDKLQASLAHGVMSIPAVKGFEYGSGFHGAEMTGSKHNDPFVPAPALDAATQRTGIPR 298

Query: 285 DRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGV-DGVLAARGRHDP 343
            RL TKTN+SGG QGGI+NG  I+FRVAFKPPATISQ+Q TA Y+G  +GVLAA+GRHDP
Sbjct: 299 SRLQTKTNHSGGIQGGISNGMPIFFRVAFKPPATISQDQITALYDGSGEGVLAAKGRHDP 358

Query: 344 CVVPRAVPIVESMAALVIMDALMIQQSRK 372
           CVVPRAVPIVE MAA+++ DALM Q +RK
Sbjct: 359 CVVPRAVPIVEGMAAIMVADALMQQNARK 387



>gi|322709313|gb|EFZ00889.1| chorismate synthase [Metarhizium anisopliae ARSEF 23]
          Length = 407

 Score =  493 bits (1269), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 251/397 (63%), Positives = 300/397 (75%), Gaps = 25/397 (6%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT GESHGK+V CI++ CPPGLSLVE+DIQ QL+RRRPGQS ++TPRDEK
Sbjct: 1   MSTFGKYFRVTTAGESHGKTVSCIIENCPPGLSLVESDIQPQLNRRRPGQSAISTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           D+V I SG E G TLGTPI L VPN+DQRPHDY     DLYPRPSHADWTYL+KY  KAS
Sbjct: 61  DRVTIGSGCEFGRTLGTPILLTVPNEDQRPHDYGSKTIDLYPRPSHADWTYLEKYGTKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM----PFINEQDERLF 174
           SGGGR+SARETI RVAAGA+AEK+L+  +GVEIVAFVSSV NI +    P  +  D    
Sbjct: 121 SGGGRSSARETIARVAAGAVAEKWLREAYGVEIVAFVSSVGNIKLFEDRPITDSDDIDSL 180

Query: 175 PED--FWELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNV 231
             +  F EL++++ RE+VD+   VRCPD TV+ +M ++I E ++  DS GGT+TC+IR  
Sbjct: 181 SSNPKFLELIDSLTREKVDEFLPVRCPDTTVAKRMEDKIAELRDQHDSTGGTVTCIIRGC 240

Query: 232 PVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV---------- 281
           P GLGEPCFDKLEA  AHA++SIPATKGFEIGSGF+G  + G +HNDP+V          
Sbjct: 241 PSGLGEPCFDKLEAHLAHAIMSIPATKGFEIGSGFRGAEMRGSRHNDPFVSTPAANNTTP 300

Query: 282 -----LKNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGV-DGVL 335
                +   RL TKTN+SGG QGGI+NG  IYFRVAFKPPATISQ+Q TA Y+   +G+L
Sbjct: 301 SAGAGIPPSRLQTKTNHSGGIQGGISNGMPIYFRVAFKPPATISQDQTTARYDASGEGIL 360

Query: 336 AARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRK 372
           AA+GRHDP V PRAVPIVE+MAAL I DALM Q +R+
Sbjct: 361 AAKGRHDPNVTPRAVPIVEAMAALTIADALMAQHARQ 397



>gi|475666917|gb|EMT64707.1| Chorismate synthase [Fusarium oxysporum f. sp. cubense race 4]
          Length = 393

 Score =  493 bits (1269), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 244/389 (62%), Positives = 295/389 (75%), Gaps = 19/389 (4%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+ G +FRVTT GESHG+++ CI+DGCPPGL L EADIQ QL+RRRPGQS +TTPR+EK
Sbjct: 1   MSSIGQIFRVTTAGESHGRAISCIIDGCPPGLDLTEADIQPQLNRRRPGQSAITTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           D+V I SGTE+G+TLGTPI L VPN+DQRP DY +   D+YPRPSHADWTYL+KY +KAS
Sbjct: 61  DRVTINSGTENGVTLGTPILLTVPNEDQRPRDYGDKTIDMYPRPSHADWTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDF 178
           SGGGR+SARETI RVAAGA+AEK+LK  + +EIVAFVSSV  I + F + +     P  F
Sbjct: 121 SGGGRSSARETIARVAAGAVAEKWLKEAYNIEIVAFVSSVGTIKL-FADTEAMSTDPA-F 178

Query: 179 WELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGE 237
             L  T+ RE+VD+   VRCPD  +   M  RI E ++  DS GGT+TC+IRNVP GLGE
Sbjct: 179 LSLAETLTREQVDEYLPVRCPDDAIGRAMEARIAELRDQHDSTGGTVTCIIRNVPSGLGE 238

Query: 238 PCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV-------------LKN 284
           PCFDKL+A  AH ++SIPA KGFE GSGF G  + G +HNDP+V             +  
Sbjct: 239 PCFDKLQASLAHGVMSIPAVKGFEYGSGFHGAEMTGSKHNDPFVPAPALDAATQRTGIPR 298

Query: 285 DRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGV-DGVLAARGRHDP 343
            RL TKTN+SGG QGGI+NG  I+FRVAFKPPATISQ+Q TA Y+G  +GVLAA+GRHDP
Sbjct: 299 SRLQTKTNHSGGIQGGISNGMPIFFRVAFKPPATISQDQITALYDGSGEGVLAAKGRHDP 358

Query: 344 CVVPRAVPIVESMAALVIMDALMIQQSRK 372
           CVVPRAVPIVE MAA+++ DALM Q +RK
Sbjct: 359 CVVPRAVPIVEGMAAIMVADALMQQNARK 387



>gi|358387239|gb|EHK24834.1| hypothetical protein TRIVIDRAFT_215686 [Trichoderma virens Gv29-8]
          Length = 407

 Score =  493 bits (1268), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 252/397 (63%), Positives = 300/397 (75%), Gaps = 25/397 (6%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT GESHGK+V CI++ CPPGLSL E+DIQ QL+RRRPGQS ++TPRDEK
Sbjct: 1   MSTFGHYFRVTTAGESHGKTVSCIIENCPPGLSLTESDIQPQLNRRRPGQSAISTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           D+V I SG E G TLGTPI L VPN+DQRPHDY     DLYPRPSHADWTYL+KY IKAS
Sbjct: 61  DRVTIGSGCEFGRTLGTPILLTVPNEDQRPHDYGSKTIDLYPRPSHADWTYLEKYGIKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM----PFINEQDERLF 174
           SGGGR+SARETI RVAAGA+AEK+L+  +GVEIVAFVSSV NI +    P  +  D    
Sbjct: 121 SGGGRSSARETIARVAAGAVAEKWLREAYGVEIVAFVSSVGNIKLFEDRPTTDSDDIDSL 180

Query: 175 PED--FWELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNV 231
             +  F EL++T+ RE+VD+   VRCPD TV+ +M ++I E ++  DS GGT+TC+IR  
Sbjct: 181 SSNPKFLELVDTLTREKVDQFLPVRCPDTTVAKRMEDKIAELRDQHDSTGGTVTCIIRGC 240

Query: 232 PVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV---------- 281
           P GLGEPCFDKLEA  AHA++SIPATKGFEIGSGF+G  + G +HNDP+V          
Sbjct: 241 PSGLGEPCFDKLEALLAHAIMSIPATKGFEIGSGFRGAEMRGSRHNDPFVSIAAADDATP 300

Query: 282 -----LKNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGV-DGVL 335
                +   RL TKTN+SGG QGGI+NG  IYFRVAFKPPATISQ+Q TA Y+   +G+L
Sbjct: 301 SAGAGIPPSRLRTKTNHSGGIQGGISNGMPIYFRVAFKPPATISQDQTTARYDASGEGIL 360

Query: 336 AARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRK 372
           AA+GRHDP V PRAVPIVE+MAAL I DALM Q +R+
Sbjct: 361 AAKGRHDPNVAPRAVPIVEAMAALTIADALMAQHARQ 397



>gi|340514700|gb|EGR44960.1| chorismate synthase [Trichoderma reesei QM6a]
          Length = 407

 Score =  493 bits (1268), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 249/397 (62%), Positives = 300/397 (75%), Gaps = 25/397 (6%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT GESHG++V CI++ CPPGL+L E+DIQ QL+RRRPGQS +TTPRDEK
Sbjct: 1   MSTFGHYFRVTTAGESHGRTVSCIIENCPPGLALDESDIQPQLNRRRPGQSAITTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           D+V I SG E G TLGTPI L VPN+DQRPHDY     DLYPRPSHADWTYL+KY IKAS
Sbjct: 61  DRVTIGSGCEFGRTLGTPILLTVPNEDQRPHDYGSKTIDLYPRPSHADWTYLEKYGIKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM----PFINEQDERLF 174
           SGGGR+SARETI RVAAGA+AEK+L+  +G+EIVAFVSSV NI +    P  +  D    
Sbjct: 121 SGGGRSSARETIARVAAGAVAEKWLREAYGIEIVAFVSSVGNIKLFEDRPVTDGDDVDSL 180

Query: 175 PE--DFWELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNV 231
                F EL++++ RE+VD+   VRCPD  V+ +M ++I E ++  DS+GGT+TC+IR  
Sbjct: 181 SSHPKFLELVDSLTREKVDEFLPVRCPDAAVAKRMEDKIAELRDQHDSIGGTVTCIIRGC 240

Query: 232 PVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV---------- 281
           P GLGEPCFDKLEA  AHAM+SIPATKGFEIGSGF+G  + G +HNDP+V          
Sbjct: 241 PSGLGEPCFDKLEALLAHAMMSIPATKGFEIGSGFRGAEMRGSRHNDPFVSAAAADEATP 300

Query: 282 -----LKNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGV-DGVL 335
                +   RL TKTN+SGG QGGI+NG  I+FR+AFKPPATISQ+Q TA Y+   +GVL
Sbjct: 301 SAGAGIPPSRLQTKTNHSGGIQGGISNGMPIFFRIAFKPPATISQDQTTARYDASGEGVL 360

Query: 336 AARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRK 372
           AA+GRHDP VVPRAVPIVE+MAAL I DALM Q +R+
Sbjct: 361 AAKGRHDPNVVPRAVPIVEAMAALTIADALMAQHARQ 397



>gi|156845616|ref|XP_001645698.1| hypothetical protein Kpol_1043p30 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156116365|gb|EDO17840.1| hypothetical protein Kpol_1043p30 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 376

 Score =  492 bits (1266), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 250/374 (66%), Positives = 293/374 (78%), Gaps = 9/374 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG++FRVTT+GESH KSVGCIVDG PPG+SL E DIQ QL RRRPGQS L+TPR+EK
Sbjct: 1   MSTFGSVFRVTTYGESHCKSVGCIVDGVPPGMSLTEDDIQPQLTRRRPGQSKLSTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D+V IQSGTE G TLGTPI ++V N+DQRPHDYS+ D YPRPSHAD+TYL+KY +KASSG
Sbjct: 61  DRVEIQSGTEFGKTLGTPIAMIVKNEDQRPHDYSDMDNYPRPSHADFTYLEKYGLKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGRASARETIGRVAAGAIAEK+L     VEIVAFV+ +  I M          F  +F +
Sbjct: 121 GGRASARETIGRVAAGAIAEKFLNQYSNVEIVAFVTQIGKIKM------SRDPFDPNFHQ 174

Query: 181 LLNTIRREEVDK-DAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           LL TI RE+VD    +RCPD +V+  M + I   +   DS+GG +TCV+RN+P GLGEPC
Sbjct: 175 LLQTITREKVDSMGPIRCPDASVAGDMVKEIEHYRGLNDSIGGVVTCVVRNLPAGLGEPC 234

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSGGT 297
           FDKLEA  AHAMLSIPA+KGFEIGSGF+G  L G +HNDP+    +  RL TKTNNSGG 
Sbjct: 235 FDKLEALLAHAMLSIPASKGFEIGSGFEGVALPGSEHNDPFYYDEEEKRLRTKTNNSGGI 294

Query: 298 QGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMA 357
           QGGI+NGENIYF V FK  ATI QEQETATY+G  GVLAA+GRHDP V PRA+PIVE+M 
Sbjct: 295 QGGISNGENIYFSVPFKSAATICQEQETATYDGKSGVLAAKGRHDPSVTPRAIPIVEAMT 354

Query: 358 ALVIMDALMIQQSR 371
           ALV+ DAL++Q+SR
Sbjct: 355 ALVLADALLLQKSR 368



>gi|367000413|ref|XP_003684942.1| hypothetical protein TPHA_0C03560 [Tetrapisispora phaffii CBS 4417]
 gi|357523239|emb|CCE62508.1| hypothetical protein TPHA_0C03560 [Tetrapisispora phaffii CBS 4417]
          Length = 376

 Score =  491 bits (1263), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 249/374 (66%), Positives = 296/374 (79%), Gaps = 9/374 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG +FRVTT+GESH KSVGCIVDG PPG+SL E DIQ QL RRRPGQS L+TPR+EK
Sbjct: 1   MSTFGQIFRVTTYGESHCKSVGCIVDGIPPGMSLTEEDIQPQLTRRRPGQSKLSTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           DKV IQSGTE G TLGTP+ ++V N+DQRPHDYS+ D YPRPSHAD+TY++KY++KASSG
Sbjct: 61  DKVEIQSGTEFGKTLGTPLAMIVKNEDQRPHDYSDMDNYPRPSHADYTYMEKYNLKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGRASARETIGRVAAGAIAEK+L+ V  VEIVAFV+ +  I M      +   F + F  
Sbjct: 121 GGRASARETIGRVAAGAIAEKFLQQVSNVEIVAFVTQIGEIKM------NRDPFDKKFQH 174

Query: 181 LLNTIRREEVDK-DAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           LLNTI R +VD    +RCPD +V+  M + I + + A DS+GG +TCVIRNVP GLGEPC
Sbjct: 175 LLNTITRSKVDAVGPIRCPDTSVAGDMVKEIEKYRGANDSIGGVVTCVIRNVPTGLGEPC 234

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSGGT 297
           FDKLEA  AHAMLSIPA+KGFEIGSGF G  + G +HNDP+   ++  +L T TNNSGG 
Sbjct: 235 FDKLEAMLAHAMLSIPASKGFEIGSGFAGVAVPGSKHNDPFYFDDESKKLRTTTNNSGGI 294

Query: 298 QGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMA 357
           QGGI+NGENIYF V FK  ATI QEQETATY G  G+L+A+GRHDP V PRA+PIVE+MA
Sbjct: 295 QGGISNGENIYFSVPFKSAATICQEQETATYEGQTGILSAKGRHDPSVTPRAIPIVEAMA 354

Query: 358 ALVIMDALMIQQSR 371
           ALV+ DAL+IQ++R
Sbjct: 355 ALVLADALLIQKAR 368



>gi|477529024|gb|ENH80795.1| chorismate synthase [Colletotrichum orbiculare MAFF 240422]
          Length = 407

 Score =  490 bits (1261), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 250/398 (62%), Positives = 301/398 (75%), Gaps = 27/398 (6%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT GESHGK+V CI++ CPPGLSLVE+DIQ QL+RRRPGQS +TTPRDEK
Sbjct: 1   MSTFGHYFRVTTAGESHGKTVSCIIENCPPGLSLVESDIQPQLNRRRPGQSAITTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           D+V I SG E G TLGTPI L VPN+DQRPHDY     DLYPRPSHADWTYL+KY  KAS
Sbjct: 61  DRVTIGSGCEFGRTLGTPILLTVPNEDQRPHDYGSKTIDLYPRPSHADWTYLEKYGTKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM---PFINEQDE---- 171
           SGGGR+SARETI RVAAGA+AEK+L+  +GVEIVAFVSSV NI +     I + D+    
Sbjct: 121 SGGGRSSARETIARVAAGAVAEKWLREAYGVEIVAFVSSVGNIKLFEDRLITDSDDIDSL 180

Query: 172 RLFPEDFWELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRN 230
              P+ F E ++++ RE+VD+   VRCPD T++ +M ++I E ++  DS GGT+TC+IR 
Sbjct: 181 SGHPK-FLEFVDSLTREKVDEFLPVRCPDATIAKRMEDKIAELRDQHDSTGGTVTCIIRG 239

Query: 231 VPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV--------- 281
            P GLGEPCFDKLEA  AHA++SIPATKGFEIGSGF+G  + G +HNDP+V         
Sbjct: 240 CPSGLGEPCFDKLEALLAHAIMSIPATKGFEIGSGFRGAEMRGSRHNDPFVSNPVADAAT 299

Query: 282 ------LKNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGV-DGV 334
                 +   RL TKTN+SGG QGGI+NG  I+FRVAFKPPATISQ+Q TA Y+   +G+
Sbjct: 300 PSAGVGIPPSRLRTKTNHSGGIQGGISNGMPIFFRVAFKPPATISQDQTTARYDASGEGI 359

Query: 335 LAARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRK 372
           LAA+GRHDP V PRAVPIVE+MAAL I DALM Q +R+
Sbjct: 360 LAAKGRHDPNVAPRAVPIVEAMAALTIADALMAQHARQ 397



>gi|470308142|ref|XP_004363761.1| chorismate synthase [Capsaspora owczarzaki ATCC 30864]
 gi|320168017|gb|EFW44916.1| chorismate synthase [Capsaspora owczarzaki ATCC 30864]
          Length = 395

 Score =  489 bits (1260), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 259/401 (64%), Positives = 299/401 (74%), Gaps = 18/401 (4%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFGTLFRVTTFGESH   VGCIVDG PP ++L EADIQ QL RRRPGQS LTT RDEK
Sbjct: 1   MSTFGTLFRVTTFGESHCAGVGCIVDGVPPLMALTEADIQPQLSRRRPGQSALTTKRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D V I SGTE G+TLGTPIGL VPN+D RP DY      PRPSHAD+TY  KY  K SSG
Sbjct: 61  DLVRIMSGTEHGVTLGTPIGLTVPNEDMRPGDYGSMSDIPRPSHADYTYQYKYGTKTSSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGRASARETIGRVAAGAIAEK+L+L +GVEIVA+VSS+ +I M            ED   
Sbjct: 121 GGRASARETIGRVAAGAIAEKFLRLRYGVEIVAWVSSIGDIEMK-----------ED--- 166

Query: 181 LLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCF 240
           +++TI RE VD    RCPD  V+D+M   + E + A+DSVGG ++CVIRN PVGLGEPCF
Sbjct: 167 VVDTITRERVDSHPTRCPDAAVADQMTALVQECRNAEDSVGGVVSCVIRNSPVGLGEPCF 226

Query: 241 DKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKNDRLGTKTNNSGGTQGG 300
           DKL+A  AHAM+SIPATKGFEIGSGF+GTT  G  HND +V K DRLGT TNNSGG QGG
Sbjct: 227 DKLQATLAHAMMSIPATKGFEIGSGFRGTTQRGSAHNDMFVRKGDRLGTVTNNSGGVQGG 286

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGE I  RVAFKPPATI +EQ T TY+G   VLAA+GRHDPCVVPRA+PIVE+MAAL 
Sbjct: 287 ISNGEPIVLRVAFKPPATIGKEQATVTYDGTSAVLAAKGRHDPCVVPRAIPIVEAMAALA 346

Query: 361 IMDALMIQQSRKTVASLLPPNPNIPAAMSGVIPKLSETQKQ 401
           + DA ++Q SR   A++LP N   P  +  V+  L+  + Q
Sbjct: 347 LADAALVQLSRH--AAVLPFNALPP--LQNVVTPLNPAKAQ 383



>gi|310792885|gb|EFQ28346.1| chorismate synthase [Glomerella graminicola M1.001]
          Length = 407

 Score =  488 bits (1256), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 249/402 (61%), Positives = 299/402 (74%), Gaps = 35/402 (8%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT GESHGK+V CI++ CPPGLSL E+DIQ QL+RRRPGQS +TTPRDEK
Sbjct: 1   MSTFGHYFRVTTAGESHGKTVSCIIENCPPGLSLDESDIQPQLNRRRPGQSAITTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           D+V I SG E G TLGTPI L VPN+DQRPHDY     DLYPRPSHADWTYL+KY  KAS
Sbjct: 61  DRVTIGSGCEFGRTLGTPILLTVPNEDQRPHDYGSKTIDLYPRPSHADWTYLEKYGTKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPED- 177
           SGGGR+SARETI RVAAGA+AEK+L+  +G+EIVAFVSSV NI +      ++RL  +  
Sbjct: 121 SGGGRSSARETIARVAAGAVAEKWLREAYGIEIVAFVSSVGNIKL-----FEDRLVTDSD 175

Query: 178 ----------FWELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITC 226
                     F E ++T+ RE+VD+   VRCPD TV+ +M ++I E ++  DS GGT+TC
Sbjct: 176 DIDSLSGNPRFLEFVDTLTREKVDEFLPVRCPDATVAKRMEDKIAELRDQHDSTGGTVTC 235

Query: 227 VIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV----- 281
           +IR  P GLGEPCFDKLEA  AHA++SIPATKGFEIGSGF+G  + G +HNDP+V     
Sbjct: 236 IIRGCPPGLGEPCFDKLEALLAHAIMSIPATKGFEIGSGFRGAEMRGSRHNDPFVSATVA 295

Query: 282 ----------LKNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGV 331
                     +   RL TKTN+SGG QGGI+NG  I+FRVAFKPPATISQ+Q TA Y+  
Sbjct: 296 DDATRSASAGIPPSRLQTKTNHSGGIQGGISNGMPIFFRVAFKPPATISQDQTTARYDAS 355

Query: 332 -DGVLAARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRK 372
            +G+LAA+GRHDP V PRAVPIVE+MAAL I DALM Q +R+
Sbjct: 356 GEGILAAKGRHDPNVAPRAVPIVEAMAALTIADALMAQHARQ 397



>gi|398389038|ref|XP_003847980.1| bifunctional chorismate synthase/flavin reductase [Zymoseptoria
           tritici IPO323]
 gi|339467854|gb|EGP82956.1| hypothetical protein MYCGRDRAFT_101785 [Zymoseptoria tritici
           IPO323]
          Length = 420

 Score =  488 bits (1256), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 258/420 (61%), Positives = 303/420 (72%), Gaps = 41/420 (9%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  +RVTT+GESHGKSVGCIVDG PPGL L EADIQ  + RRRPGQS LTTPRDEK
Sbjct: 1   MSTFGQYYRVTTYGESHGKSVGCIVDGVPPGLELTEADIQPSMTRRRPGQSALTTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKAS 118
           D V IQSGTE GITLG+P+ + V NQDQRP DY  S  D+YPRPSHADWTYL+KY +K+S
Sbjct: 61  DMVEIQSGTEHGITLGSPVAMRVMNQDQRPKDYGSSTMDMYPRPSHADWTYLEKYGVKSS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPED- 177
           SGGGR+SARETIGRVAAGAIAEKYL++ HGVEIVAF +SV            E LFP   
Sbjct: 121 SGGGRSSARETIGRVAAGAIAEKYLRVAHGVEIVAFTNSVG----------PEHLFPATK 170

Query: 178 ----------FWELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITC 226
                     F EL++ + R +VDK+  VRCP+     +M + I E ++  DS+GGT+TC
Sbjct: 171 THPSPSTNPAFLELIDKVTRIDVDKNLPVRCPNAEAGKRMEDLIAEYRDKHDSIGGTVTC 230

Query: 227 VIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV----- 281
           VIRN P GLGEPCFDKLEA  AHAMLSIPATKGFEIGSGF G  + G  HNDP+V     
Sbjct: 231 VIRNCPSGLGEPCFDKLEATLAHAMLSIPATKGFEIGSGFGGCEVPGSIHNDPFVKAPVV 290

Query: 282 -----------LKNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNG 330
                          RL T TNNSGG QGGI+NG ++YF VAFKPPATI Q Q+T TY+ 
Sbjct: 291 EPSVSGAEKPIWSRPRLTTATNNSGGIQGGISNGAHVYFTVAFKPPATIGQAQKTVTYDE 350

Query: 331 VDGVLAARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNPN-IPAAMS 389
            +GVL A+GRHDPCV+PRAVPIVESMAALVIMDA++ Q +R++  + LP   N +P +M+
Sbjct: 351 NEGVLEAKGRHDPCVIPRAVPIVESMAALVIMDAVLAQSARQSARACLPVLKNTVPVSMT 410



>gi|399166611|emb|CCE32594.1| probable chorismate synthase/flavin reductase,NADPH-dependent
           [Claviceps purpurea 20.1]
          Length = 396

 Score =  486 bits (1251), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 245/389 (62%), Positives = 290/389 (74%), Gaps = 19/389 (4%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT GESHGKSV CI+D CPPGL L E DIQ QL+RRRPGQS +TTPR+EK
Sbjct: 1   MSTFGHYFRVTTAGESHGKSVSCIIDNCPPGLELSENDIQPQLNRRRPGQSAITTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           DKV I SGTE G TLGTPI L VPN+DQRP DY +   DLYPRPSHADWTYL+KY+IKAS
Sbjct: 61  DKVTIHSGTEFGRTLGTPILLTVPNEDQRPKDYGDKTIDLYPRPSHADWTYLEKYAIKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDF 178
           SGGGR+SARETI RVAAGA+AEK+LK  +GVEI+AFV+SV  I +   ++ D       F
Sbjct: 121 SGGGRSSARETIARVAAGAVAEKWLKDTYGVEIIAFVTSVGRIKL--FSDTDAMSADPAF 178

Query: 179 WELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGE 237
             L +++ R +VD+   VRCPD   + +M + I E ++  DS GGT+TCVIRN P GLGE
Sbjct: 179 LSLADSVTRAQVDEFLPVRCPDAAANKRMEDHIAELRDQHDSTGGTVTCVIRNAPSGLGE 238

Query: 238 PCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV-------------LKN 284
           P FDK+EA   HAM+SIPA KGFEIGSGF G  + G  HND ++             +  
Sbjct: 239 PAFDKMEALLGHAMMSIPAVKGFEIGSGFLGAEMNGSTHNDAFIAAPVLDAAAEKFGIPR 298

Query: 285 DRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGV-DGVLAARGRHDP 343
            RL TKTN+SGG QGGI+NG  I+FRVAFKPPATIS++Q TATY+G  +GVLAA+GRHDP
Sbjct: 299 SRLHTKTNHSGGIQGGISNGMPIFFRVAFKPPATISKDQMTATYDGSGEGVLAAKGRHDP 358

Query: 344 CVVPRAVPIVESMAALVIMDALMIQQSRK 372
           CVVPRAVPIVE MAAL I DA+M Q +R+
Sbjct: 359 CVVPRAVPIVEGMAALAIADAVMAQHARR 387



>gi|346326732|gb|EGX96328.1| chorismate synthase [Cordyceps militaris CM01]
          Length = 399

 Score =  485 bits (1249), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 244/391 (62%), Positives = 295/391 (75%), Gaps = 21/391 (5%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FGT FRVTT GESHGK V CI++ CPPGL+L E DIQ QL RRRPGQS +TTPRDEK
Sbjct: 1   MSSFGTYFRVTTAGESHGKCVSCIIENCPPGLALTEEDIQPQLTRRRPGQSAITTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY-SETDLYPRPSHADWTYLQKYSIKASS 119
           D+V I SGTE G TLGTP+ L +PN+DQRP DY S  + YPRPSHADWTYL+KY IKASS
Sbjct: 61  DRVTIGSGTEFGRTLGTPLLLTIPNEDQRPGDYKSHENSYPRPSHADWTYLEKYGIKASS 120

Query: 120 GGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFW 179
           GGGR+SARETI RVAAGA+AEK+L   +G+EI+AFVSSV  I +   ++ D       F 
Sbjct: 121 GGGRSSARETIARVAAGAVAEKWLCEAYGIEIIAFVSSVGKIKL--FDDMDALSSNLKFL 178

Query: 180 ELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEP 238
            L+NT+ R+EVD+   VRCPD  ++ +M + I E ++  DSVGGT+TC+IR  P GLGEP
Sbjct: 179 TLVNTLTRDEVDEFLPVRCPDTEIAKRMEDLIAELRDQHDSVGGTVTCIIRGCPSGLGEP 238

Query: 239 CFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV----------------L 282
            FDKLEA  AHAM+SIPATKGFEIGSGF+G+ + G +HNDP+V                +
Sbjct: 239 AFDKLEALLAHAMMSIPATKGFEIGSGFRGSEMRGSEHNDPFVSNPLASEATTPGAAVGI 298

Query: 283 KNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGV-DGVLAARGRH 341
              RLGTKTN+SGG QGGI+NG +I+FRV FKPPATI+Q+Q T+ Y+   +GVLA RGRH
Sbjct: 299 PPSRLGTKTNHSGGIQGGISNGASIFFRVGFKPPATIAQDQLTSRYDASGEGVLATRGRH 358

Query: 342 DPCVVPRAVPIVESMAALVIMDALMIQQSRK 372
           DP VVPRAVPIVE+MAAL IMDALM Q +R+
Sbjct: 359 DPNVVPRAVPIVEAMAALTIMDALMAQHARQ 389



>gi|452836660|gb|EME38604.1| hypothetical protein DOTSEDRAFT_75948 [Dothistroma septosporum
           NZE10]
          Length = 421

 Score =  484 bits (1247), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 258/415 (62%), Positives = 301/415 (72%), Gaps = 18/415 (4%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  FRVTT+GESHGKSVGCIVDG PPGL L EADIQ Q+ RRRPGQS LTTPR+EK
Sbjct: 1   MSTFGQYFRVTTYGESHGKSVGCIVDGVPPGLELTEADIQPQMTRRRPGQSALTTPRNEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKAS 118
           DKV IQSGTE GI LGTPI L V N+DQRP DY     D YPRPSHADWTYL+KY +KAS
Sbjct: 61  DKVEIQSGTEFGIALGTPIALRVLNEDQRPKDYGNRTMDQYPRPSHADWTYLEKYGVKAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVS-NIAMPFINEQDERLFPED 177
           SGGGR+SARETIGRVA GAIAEKYLK+ HGVEIVAF +SV      P   E        +
Sbjct: 121 SGGGRSSARETIGRVAGGAIAEKYLKIAHGVEIVAFTNSVGPEHLFPATREHPTPSTNPE 180

Query: 178 FWELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLG 236
           F +L++ I RE+VD    VRCP    + +M + I   ++  DS+GGT+TCVIRN P GLG
Sbjct: 181 FLQLIDKITREDVDSFLPVRCPSVEGTKRMEDLIAHYRDNSDSIGGTVTCVIRNCPSGLG 240

Query: 237 EPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV--------------L 282
           EPCFDKLEA  AHAMLSIPATKGFE GSGF G ++ G  HNDP+V               
Sbjct: 241 EPCFDKLEATLAHAMLSIPATKGFEFGSGFGGCSVPGSTHNDPFVKAEAQPAVGNGAPGT 300

Query: 283 KNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHD 342
           +  RL TKTNNSGG QGGI+NG +IYF VAFKPPATI Q Q TATY+  +G+L A+GRHD
Sbjct: 301 ERPRLTTKTNNSGGIQGGISNGAHIYFTVAFKPPATIGQAQTTATYDETEGILEAKGRHD 360

Query: 343 PCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNPNIPAAMSGVIPKLSE 397
           PCV+PRAVPIVE+MAALVIMDA+  Q +R+++ + LP    +   +S  +  L+E
Sbjct: 361 PCVIPRAVPIVEAMAALVIMDAVAAQSARQSMRARLPTQNKLTIPVSETVNNLTE 415



>gi|400592553|gb|EJP60714.1| chorismate synthase [Beauveria bassiana ARSEF 2860]
          Length = 407

 Score =  483 bits (1244), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 242/391 (61%), Positives = 295/391 (75%), Gaps = 21/391 (5%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FGT FRVTT GESHGK V CI++ CPPGL+L E DIQ QL RRRPGQS +TTPRDEK
Sbjct: 1   MSSFGTYFRVTTAGESHGKCVSCIIENCPPGLALTEEDIQPQLTRRRPGQSAITTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDY-SETDLYPRPSHADWTYLQKYSIKASS 119
           D+V I SGTE G TLGTP+ L +PN+DQRP DY S  + YPRPSHADWTYL+KY IKASS
Sbjct: 61  DRVTIGSGTEFGRTLGTPLLLTIPNEDQRPRDYKSHENSYPRPSHADWTYLEKYGIKASS 120

Query: 120 GGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFW 179
           GGGR+SARETI RVAAGA+AEK+L   +G+EI+AFVSSV  I +   ++ D       F 
Sbjct: 121 GGGRSSARETIARVAAGAVAEKWLCEAYGIEIIAFVSSVGKIKL--FDDMDALSNNVKFL 178

Query: 180 ELLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEP 238
            L+NT+ R++VD+   VRCPD  ++ +M + I E ++  DS+GGT+TC+IR  P GLGEP
Sbjct: 179 TLVNTLTRDKVDEFLPVRCPDTKIAKRMEDLIAELRDQHDSIGGTVTCIIRGCPSGLGEP 238

Query: 239 CFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV----------------L 282
            FDKLEA  AHAM+SIPATKGFEIGSGF+G+ + G +HNDP+V                +
Sbjct: 239 AFDKLEALLAHAMMSIPATKGFEIGSGFRGSEMRGSEHNDPFVSNPPASEATTPGAAVGI 298

Query: 283 KNDRLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGV-DGVLAARGRH 341
              RLGTKTN+SGG QGGI+NG +I+FRV FKPPATI+Q+Q T+ Y+   +GVLA RGRH
Sbjct: 299 PPSRLGTKTNHSGGIQGGISNGASIFFRVGFKPPATIAQDQLTSRYDASGEGVLATRGRH 358

Query: 342 DPCVVPRAVPIVESMAALVIMDALMIQQSRK 372
           DP VVPRAVPIVE+MAAL IMDALM Q +R+
Sbjct: 359 DPNVVPRAVPIVEAMAALTIMDALMAQHARQ 389



>gi|470489457|ref|XP_004344886.1| chorismate synthase [Acanthamoeba castellanii str. Neff]
 gi|440800100|gb|ELR21143.1| chorismate synthase [Acanthamoeba castellanii str. Neff]
 gi|478735534|gb|AGJ52078.1| chorismate synthase [Acanthamoeba castellanii]
 gi|478735536|gb|AGJ52079.1| chorismate synthase [Acanthamoeba castellanii str. Neff]
          Length = 377

 Score =  480 bits (1235), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 250/378 (66%), Positives = 295/378 (78%), Gaps = 20/378 (5%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MS+FG  FRVTTFGESHG  VGCI+DG PP L L EADIQ QL RRRPGQS+LTTPR+E 
Sbjct: 1   MSSFGRAFRVTTFGESHGGGVGCIIDGVPPCLPLTEADIQPQLSRRRPGQSSLTTPRNEA 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D+V IQ+GTE+G TLG+PI L V NQDQRP DYS+    PRPSHAD+TY  KY+IK+SSG
Sbjct: 61  DQVKIQAGTENGYTLGSPISLFVANQDQRPVDYSDMSKIPRPSHADYTYAAKYNIKSSSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGR+SARETIGRV AGA+AEK+LKL +GVEIVA+VSS+        +++ ER       E
Sbjct: 121 GGRSSARETIGRVGAGAVAEKWLKLKYGVEIVAWVSSIG-------DQEIER-------E 166

Query: 181 L-LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           L L+TI RE+VDK  VRCPD+  + KM E I  AK  KDS+GG +TCV RNVP GLGEPC
Sbjct: 167 LDLDTISREDVDKSLVRCPDEAATAKMIEIIEAAKADKDSIGGVVTCVCRNVPTGLGEPC 226

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLK-----NDRLGTKTNNS 294
           FDKLEA  AHAMLSIPATKGFEIGSGF GT + G +HNDP+V+K       RLGT TN+S
Sbjct: 227 FDKLEAMLAHAMLSIPATKGFEIGSGFAGTRMRGSKHNDPFVVKTGADGKKRLGTTTNHS 286

Query: 295 GGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVE 354
           GG QGGITNGE++ F+VAFKPPATISQ Q+T+ Y G + VL A+GRHDPCVVPRA+ IVE
Sbjct: 287 GGIQGGITNGEHVVFKVAFKPPATISQAQKTSEYGGGEAVLEAQGRHDPCVVPRAIAIVE 346

Query: 355 SMAALVIMDALMIQQSRK 372
           +MAALVI DA ++Q +R+
Sbjct: 347 AMAALVIADAALLQLARQ 364



>gi|302665968|ref|XP_003024589.1| hypothetical protein TRV_01244 [Trichophyton verrucosum HKI 0517]
 gi|291188650|gb|EFE43978.1| hypothetical protein TRV_01244 [Trichophyton verrucosum HKI 0517]
          Length = 379

 Score =  476 bits (1226), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 239/359 (66%), Positives = 283/359 (78%), Gaps = 8/359 (2%)

Query: 32  LSLVEADIQIQLDRRRPGQSNLTTPRDEKDKVAIQSGTESGITLGTPIGLLVPNQDQRPH 91
           + L EADIQ Q+ RRRPGQS LTTPR+EKD+V IQSGTE GITLGTPIG++V N+DQRP 
Sbjct: 1   MELTEADIQPQMTRRRPGQSALTTPRNEKDRVEIQSGTEFGITLGTPIGMVVRNEDQRPK 60

Query: 92  DY--SETDLYPRPSHADWTYLQKYSIKASSGGGRASARETIGRVAAGAIAEKYLKLVHGV 149
           DY  S  D+YPRPSHAD+TYL+KY +KASSGGGR+SARETIGRVAAGAIAEKYLKL H V
Sbjct: 61  DYGNSTMDMYPRPSHADFTYLEKYGVKASSGGGRSSARETIGRVAAGAIAEKYLKLSHNV 120

Query: 150 EIVAFVSSVSNIAM-PFINEQDERLFPEDFWELLNTIRREEVDKDA-VRCPDKTVSDKMR 207
           EIV+FVSSV +  + P   E    +   DF +L+ TI R+ VD  A +RCP    + +M 
Sbjct: 121 EIVSFVSSVGHEHLFPPTPEHPSPVTNPDFLKLIETIDRKTVDSFAPIRCPHAEAAQRMT 180

Query: 208 ERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFK 267
           + I   ++  DS+GGT+TCVIRNVPVGLGEPCFDKLEAK AHAMLSIPATKGFEIGSGF 
Sbjct: 181 KLIEHHRDLSDSIGGTVTCVIRNVPVGLGEPCFDKLEAKLAHAMLSIPATKGFEIGSGFL 240

Query: 268 GTTLFGHQHNDPWVLKND----RLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQ 323
           G  + G  HNDP+V++ +    +L TKTNNSGG QGGI+NG +IYFRVAFKPPATI Q Q
Sbjct: 241 GCEVPGSTHNDPFVVETNGSGKKLTTKTNNSGGIQGGISNGASIYFRVAFKPPATIGQAQ 300

Query: 324 ETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNP 382
            TA+YN  +GVL A+GRHDPCVVPRAVPIVE+MAALV++DALM Q +R+   +LLPP P
Sbjct: 301 TTASYNFEEGVLEAKGRHDPCVVPRAVPIVEAMAALVVIDALMAQNAREAAKNLLPPLP 359



>gi|320589232|gb|EFX01694.1| chorismate synthase [Grosmannia clavigera kw1407]
          Length = 395

 Score =  476 bits (1225), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 239/395 (60%), Positives = 290/395 (73%), Gaps = 16/395 (4%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG   RVTT+GESH  SVGCIVD  PPG+ + EA +Q Q+ RRRPGQS++TTPR+E 
Sbjct: 1   MSTFGQFLRVTTYGESHCPSVGCIVDNFPPGVPVSEAVLQPQISRRRPGQSSITTPRNEA 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDL--YPRPSHADWTYLQKYSIKAS 118
           D V+IQSG E G+TLGTPI ++V NQD RP DY    +  YPRPSHAD+TYL+KY ++AS
Sbjct: 61  DLVSIQSGVEGGVTLGTPIAMVVKNQDFRPSDYKGNTMKQYPRPSHADFTYLEKYGVRAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIA-MPFINEQDERLFPED 177
           SGGGR+SARETIGRVAAGA+ E YLKL HG+EIVA+VSSV +I  +P   E        +
Sbjct: 121 SGGGRSSARETIGRVAAGALCEHYLKLAHGIEIVAWVSSVGSIYHIPPTTEYPHTSHNPE 180

Query: 178 FWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGE 237
           F +LL  + RE VDK  VRCPD  V+ KM + I + ++ +DS+GGT+TCVIRN+P GLGE
Sbjct: 181 FLQLLQEVTRETVDKTTVRCPDPEVAAKMEQCITDFRDRQDSIGGTVTCVIRNLPTGLGE 240

Query: 238 PCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND------------ 285
           P F KLEA  AH MLSIPATKGFEIGSGF+GT + G  HND ++   D            
Sbjct: 241 PVFSKLEATLAHGMLSIPATKGFEIGSGFEGTEIPGSAHNDMFIRNPDTGSDSKHGFAKP 300

Query: 286 RLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNG-VDGVLAARGRHDPC 344
           +L T TNNSGG QGGI+NG N++FRVAFKPPATI   QET T+ G  DGVL A+GRHDPC
Sbjct: 301 KLTTSTNNSGGIQGGISNGANVFFRVAFKPPATIGLPQETVTFEGESDGVLEAKGRHDPC 360

Query: 345 VVPRAVPIVESMAALVIMDALMIQQSRKTVASLLP 379
           VVPRAVPIVE+MA++ IMDAL++Q  R+  A   P
Sbjct: 361 VVPRAVPIVEAMASICIMDALLMQGGRRMAAMTSP 395



>gi|302503532|ref|XP_003013726.1| hypothetical protein ARB_00177 [Arthroderma benhamiae CBS 112371]
 gi|291177291|gb|EFE33086.1| hypothetical protein ARB_00177 [Arthroderma benhamiae CBS 112371]
          Length = 379

 Score =  476 bits (1224), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 238/359 (66%), Positives = 283/359 (78%), Gaps = 8/359 (2%)

Query: 32  LSLVEADIQIQLDRRRPGQSNLTTPRDEKDKVAIQSGTESGITLGTPIGLLVPNQDQRPH 91
           + L EADIQ Q+ RRRPGQS LTTPR+EKD+V IQSGTE GITLGTPIG++V N+DQRP 
Sbjct: 1   MELTEADIQPQMTRRRPGQSALTTPRNEKDRVEIQSGTEFGITLGTPIGMVVRNEDQRPK 60

Query: 92  DY--SETDLYPRPSHADWTYLQKYSIKASSGGGRASARETIGRVAAGAIAEKYLKLVHGV 149
           DY  S  D+YPRPSHAD+TYL+KY +KASSGGGR+SARETIGRVAAGAIAEKYLKL H V
Sbjct: 61  DYGNSTMDMYPRPSHADFTYLEKYGVKASSGGGRSSARETIGRVAAGAIAEKYLKLSHNV 120

Query: 150 EIVAFVSSVSNIAM-PFINEQDERLFPEDFWELLNTIRREEVDKDA-VRCPDKTVSDKMR 207
           EIV+FVSSV +  + P   E    +   DF +L+ T+ R+ VD  A +RCP    + +M 
Sbjct: 121 EIVSFVSSVGHEHLFPPTPEHPSPVTNPDFLKLIETVDRKTVDSFAPIRCPHAEAAQRMT 180

Query: 208 ERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFK 267
           + I   ++  DS+GGT+TCVIRNVPVGLGEPCFDKLEAK AHAMLSIPATKGFEIGSGF 
Sbjct: 181 KLIEHHRDLSDSIGGTVTCVIRNVPVGLGEPCFDKLEAKLAHAMLSIPATKGFEIGSGFL 240

Query: 268 GTTLFGHQHNDPWVLKND----RLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQ 323
           G  + G  HNDP+V++ +    +L TKTNNSGG QGGI+NG +IYFRVAFKPPATI Q Q
Sbjct: 241 GCEVPGSTHNDPFVVETNGSGKKLTTKTNNSGGIQGGISNGASIYFRVAFKPPATIGQAQ 300

Query: 324 ETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLPPNP 382
            TA+YN  +GVL A+GRHDPCVVPRAVPIVE+MAALV++DALM Q +R+   +LLPP P
Sbjct: 301 TTASYNFEEGVLEAKGRHDPCVVPRAVPIVEAMAALVVIDALMAQNAREAAKNLLPPLP 359



>gi|320352849|ref|YP_004194188.1| chorismate synthase [Desulfobulbus propionicus DSM 2032]
 gi|505935983|ref|WP_015723442.1| chorismate synthase [Desulfobulbus propionicus]
 gi|320121351|gb|ADW16897.1| chorismate synthase [Desulfobulbus propionicus DSM 2032]
          Length = 364

 Score =  475 bits (1223), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 236/376 (62%), Positives = 281/376 (74%), Gaps = 14/376 (3%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           ST GTL++VTTFGESH K VG IVDGCPPG++L EADIQ QL RRRPGQS+L+TPR E D
Sbjct: 3   STLGTLYKVTTFGESHCKGVGAIVDGCPPGMALTEADIQPQLSRRRPGQSDLSTPRQEAD 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
           +V I SGTE G TLGTPI LLV N+DQRP DY E    PRPSHAD+TY  KY ++ASSGG
Sbjct: 63  QVTIYSGTEFGRTLGTPIMLLVNNKDQRPQDYGEMSRIPRPSHADFTYQMKYGVRASSGG 122

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGAIAEK+L   +G EIVA+VS+V +I  P ++              
Sbjct: 123 GRSSARETIGRVAAGAIAEKWLHETYGTEIVAWVSAVGDIEAPAMD-------------- 168

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
           +  I R +VD   VRCPD   + +M  R+ E   AKDS GG +TCV RNVP+GLGEP FD
Sbjct: 169 VERISRADVDAHLVRCPDAATAARMEARVKEVLAAKDSTGGILTCVCRNVPIGLGEPVFD 228

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKNDRLGTKTNNSGGTQGGI 301
           KLEA+ A AMLS+PATKGF+IGSGF GT + G +HNDP+  K ++LGT+TN SGG QGGI
Sbjct: 229 KLEARLAQAMLSLPATKGFDIGSGFAGTRMRGSEHNDPFTRKGEQLGTRTNYSGGVQGGI 288

Query: 302 TNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALVI 361
           +NGE I FRVAFKP ATI Q QET  ++G    L A+GRHDPCVVPRAVPIVESMAALV+
Sbjct: 289 SNGEPIVFRVAFKPVATIGQAQETVDFDGQPVTLEAKGRHDPCVVPRAVPIVESMAALVL 348

Query: 362 MDALMIQQSRKTVASL 377
           +D  + Q++R TV+ L
Sbjct: 349 IDLALRQRARLTVSPL 364



>gi|494825543|gb|EON62697.1| chorismate synthase [Coniosporium apollinis CBS 100218]
          Length = 424

 Score =  473 bits (1216), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 246/391 (62%), Positives = 283/391 (72%), Gaps = 39/391 (9%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           STFG  F+VTT+GESHG SVG IVDGCPPG+ L EA IQ QL RRRPGQS +TTPRDEKD
Sbjct: 3   STFGEYFKVTTYGESHGLSVGVIVDGCPPGMQLTEAHIQPQLTRRRPGQSAITTPRDEKD 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDY--SETDLYPRPSHADWTYLQKYSIKASS 119
           +V IQSGTE+GITLGTPIGL + N++QRP DY  S  D+YPRP HAD TYL KY +KASS
Sbjct: 63  RVEIQSGTENGITLGTPIGLRIMNENQRPKDYGNSTMDMYPRPGHADLTYLLKYGVKASS 122

Query: 120 GGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFP---- 175
           GGGR+SARETIGRVAAG IAEKYL+   GVEIVAF SS+ N          E LFP    
Sbjct: 123 GGGRSSARETIGRVAAGCIAEKYLEDAFGVEIVAFTSSIGN----------EYLFPPTPT 172

Query: 176 -------EDFWELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCV 227
                   +F  L++TI R +VD    VRCPD  VS +M   + + ++A+DS+GGT+TCV
Sbjct: 173 YPTASTNPEFLSLIDTISRTDVDNHLPVRCPDAEVSKRMEALVAKYRDAQDSIGGTVTCV 232

Query: 228 IRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWV------ 281
           IR+ PVGLGEPCFDKLEA  AHAMLSIPATK FEIGSGF G  + G  HND ++      
Sbjct: 233 IRHCPVGLGEPCFDKLEASLAHAMLSIPATKAFEIGSGFGGCQVPGSIHNDAFIKAPPIP 292

Query: 282 --------LKND-RLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNGVD 332
                    KN  RL TKTNNSGG QGGI+NG +IYF V FK P+TI Q Q+TATY   D
Sbjct: 293 PGPNGEAKAKNKPRLTTKTNNSGGIQGGISNGAHIYFTVGFKSPSTIGQPQQTATYGEED 352

Query: 333 GVLAARGRHDPCVVPRAVPIVESMAALVIMD 363
           GVL A+GRHDPCVVPRA+PIVE+MAALVI D
Sbjct: 353 GVLEAKGRHDPCVVPRAIPIVEAMAALVIQD 383



>gi|295659604|ref|XP_002790360.1| chorismate synthase [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226281812|gb|EEH37378.1| chorismate synthase [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 373

 Score =  471 bits (1212), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 243/374 (64%), Positives = 282/374 (75%), Gaps = 33/374 (8%)

Query: 32  LSLVEADIQIQLDRRRPGQSNLTTPRDEKDKVAIQSGTESGITLGTPIGLLVPNQDQRPH 91
           ++L EADIQ Q+ RRRPGQS LTTPR+EKD+V IQSGTE GITLGTPIG++V N+DQRP 
Sbjct: 1   MALTEADIQPQMTRRRPGQSALTTPRNEKDRVEIQSGTEFGITLGTPIGMIVRNEDQRPK 60

Query: 92  DY--SETDLYPRPSHADWTYLQKYSIKASSGGGRASARETIGRVAAGAIAEKYLKLVHGV 149
           DY  +  DLYPRPSHAD+TYL+KY IKASSGGGR+SARETIGRVAAGAIAEKYL+L H +
Sbjct: 61  DYGGNTMDLYPRPSHADFTYLEKYGIKASSGGGRSSARETIGRVAAGAIAEKYLRLSHDI 120

Query: 150 EIVAFVSSVSNIAMPFINEQDERLFPE----------DFWELLNTIRREEVDKDA-VRCP 198
           +IVAFVSSV N          E LFP           +F +L+ TI R  VD  A VRCP
Sbjct: 121 DIVAFVSSVGN----------EHLFPPTAAHPNSTNPEFLKLIETIDRPTVDFFAPVRCP 170

Query: 199 DKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFDKLEAKFAHAMLSIPATK 258
           + + +++M + I   ++  DS+GGT+TCVIRNVPVGLGEPCFDKLEAK AHAMLSIPATK
Sbjct: 171 EASAAERMTKAIENFRDQNDSIGGTVTCVIRNVPVGLGEPCFDKLEAKLAHAMLSIPATK 230

Query: 259 GFEIGSGFKGTTLFGHQHNDPWVLKND----------RLGTKTNNSGGTQGGITNGENIY 308
           GFEIGSGF G  + G  HNDP+V   D          RL TKTNNSGG QGGI+NG +IY
Sbjct: 231 GFEIGSGFLGCEIPGSVHNDPFVATPDSRNGQNPDSKRLTTKTNNSGGIQGGISNGASIY 290

Query: 309 FRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALVIMDALMIQ 368
           FRVAFKPPATI Q Q T  Y+  +GVL A+GRHDPCVVPRAVPIVE+MAALVI DALM Q
Sbjct: 291 FRVAFKPPATIGQAQTTTKYDFEEGVLEAKGRHDPCVVPRAVPIVEAMAALVITDALMAQ 350

Query: 369 QSRKTVASLLPPNP 382
            +R+T  +LLPP P
Sbjct: 351 NARETAKNLLPPLP 364



>gi|358393948|gb|EHK43349.1| hypothetical protein TRIATDRAFT_301205 [Trichoderma atroviride IMI
           206040]
          Length = 395

 Score =  466 bits (1200), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 237/392 (60%), Positives = 285/392 (72%), Gaps = 17/392 (4%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG   RVTT+GESH  SVGCIVD  PPG+ + E  +Q Q+ RRRPGQS+LTTPR+E 
Sbjct: 1   MSTFGQFLRVTTYGESHCPSVGCIVDNFPPGIPVSEEILQPQISRRRPGQSSLTTPRNEA 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDL--YPRPSHADWTYLQKYSIKAS 118
           D V+IQSG E GI+LGTPI ++V NQD RP DY    +  YPRPSHAD+TYL+KY ++AS
Sbjct: 61  DLVSIQSGVEGGISLGTPIAMVVKNQDFRPSDYKGDTMKQYPRPSHADFTYLEKYGVRAS 120

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIA-MPFINEQDERLFPED 177
           SGGGR+SARETIGRVAAGA+ E YLKL HG+EIVA+VSSV NI  +P   E         
Sbjct: 121 SGGGRSSARETIGRVAAGALCEHYLKLAHGIEIVAWVSSVGNIHHIPPTAEYPTTSHNPK 180

Query: 178 FWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGE 237
           F +L+  + RE VDK  VRCPD  V+ KM + I + ++ +DS+GGT++CVIRNVP GLGE
Sbjct: 181 FLQLIQGVTRETVDKSPVRCPDPEVAAKMEQCIADFRDRQDSIGGTVSCVIRNVPTGLGE 240

Query: 238 PCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND------------ 285
           P F KLEA  AH MLSIPATKGFEIGSGF+GT + G  HND ++   D            
Sbjct: 241 PVFSKLEATLAHGMLSIPATKGFEIGSGFEGTEIPGSAHNDMFISNPDSTALGSNNGFAK 300

Query: 286 -RLGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNG-VDGVLAARGRHDP 343
            +L T TNNSGG QGGITNG  I+FRVAFK PATI   QET T+ G  DG+L A+GRHDP
Sbjct: 301 PKLTTSTNNSGGIQGGITNGAPIFFRVAFKSPATIGLPQETVTFAGESDGLLEAKGRHDP 360

Query: 344 CVVPRAVPIVESMAALVIMDALMIQQSRKTVA 375
           CVVPRAVPIVE+MA++ IMDAL++Q  R+  A
Sbjct: 361 CVVPRAVPIVEAMASICIMDALLLQGGRRMAA 392



>gi|197117215|ref|YP_002137642.1| chorismate synthase [Geobacter bemidjiensis Bem]
 gi|501521320|ref|WP_012529257.1| chorismate synthase [Geobacter bemidjiensis]
 gi|197086575|gb|ACH37846.1| chorismate synthase [Geobacter bemidjiensis Bem]
          Length = 360

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 227/370 (61%), Positives = 278/370 (75%), Gaps = 14/370 (3%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           STFGTLFRV+TFGESH  +VG +VDG P G+ L E+DIQ QLDRRRPGQS L+TPR+EKD
Sbjct: 3   STFGTLFRVSTFGESHCAAVGAVVDGVPAGMQLRESDIQPQLDRRRPGQSELSTPREEKD 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
            V+I SG E G+TLGTPI LLV N+DQRP DY E +  PRPSHAD++Y  KY I+ASSGG
Sbjct: 63  LVSILSGVEKGLTLGTPICLLVHNRDQRPGDYREMEAVPRPSHADYSYQMKYGIRASSGG 122

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGAIAEKYL    G+EIVA+V  V  +    ++              
Sbjct: 123 GRSSARETIGRVAAGAIAEKYLAERFGLEIVAWVDGVGELEGGMVD-------------- 168

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
           L  I RE+VD  AVRCP++  +  M + I   +++KDSVGG + CV RN+P GLGEP FD
Sbjct: 169 LEGITREQVDATAVRCPNREAAAAMMQLIGSVRDSKDSVGGVVRCVCRNLPAGLGEPVFD 228

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKNDRLGTKTNNSGGTQGGI 301
           KL+A  AHAMLS+PA KGFE+GSGF G+ + G  HNDP+V K  RLGT TN SGG QGGI
Sbjct: 229 KLDALLAHAMLSLPAAKGFEVGSGFGGSRMLGSAHNDPFVRKEGRLGTVTNYSGGVQGGI 288

Query: 302 TNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALVI 361
           +NGE ++FRVAFKPPAT+S  Q+TA ++G + +L A+GRHDPC+VPRAVPIVESMAALV+
Sbjct: 289 SNGEPVHFRVAFKPPATVSLPQKTAAFDGTETLLEAKGRHDPCIVPRAVPIVESMAALVL 348

Query: 362 MDALMIQQSR 371
           MD ++ Q+ R
Sbjct: 349 MDLVLRQEYR 358



>gi|490176975|ref|WP_004075605.1| chorismate synthase [Desulfobacter postgatei]
 gi|389403199|gb|EIM65421.1| chorismate synthase [Desulfobacter postgatei 2ac9]
          Length = 370

 Score =  464 bits (1195), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 235/377 (62%), Positives = 269/377 (71%), Gaps = 14/377 (3%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           S+FG LFRV+T+GESH   VG +VDGC PG+SL E DIQ QLDRRRPGQS L+T R E D
Sbjct: 3   SSFGKLFRVSTYGESHCPGVGVVVDGCLPGMSLTEPDIQCQLDRRRPGQSALSTDRQESD 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
           +VAIQSGTE G+TLGTPI L VPN+DQRP DY      PRPSHAD+TY  KY I+ASSGG
Sbjct: 63  RVAIQSGTERGLTLGTPISLFVPNKDQRPGDYKSMADVPRPSHADFTYQSKYGIRASSGG 122

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GRASARETIGRV AGAIAEK LK   G+ IVA+VS V  I  P               E 
Sbjct: 123 GRASARETIGRVCAGAIAEKMLKTALGINIVAWVSQVGQIKAPET-------------EG 169

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
           LN + R  VD   +RCPD   +  M   + +AKE KDS+GG ++CV  NVP GLGEP FD
Sbjct: 170 LN-LTRAMVDTSMIRCPDTDTAKAMEALVLKAKEEKDSIGGVVSCVCTNVPAGLGEPVFD 228

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKNDRLGTKTNNSGGTQGGI 301
           KLEA  AHAMLSIPATKGFEIGSGF G  + G  HNDP+V+K+ RLGT TN SGG QGGI
Sbjct: 229 KLEALLAHAMLSIPATKGFEIGSGFAGAQMRGSVHNDPFVVKDGRLGTTTNFSGGIQGGI 288

Query: 302 TNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALVI 361
           +NGE I FRVAFKPPATI   QET  + G    LAA+GRHDPCV  RAVPIVESMAALV+
Sbjct: 289 SNGEPIMFRVAFKPPATIGLAQETVDFQGRQATLAAKGRHDPCVAARAVPIVESMAALVL 348

Query: 362 MDALMIQQSRKTVASLL 378
            D ++ QQ+R    +L+
Sbjct: 349 ADVMLQQQARLAGMALM 365



>gi|428178292|gb|EKX47168.1| hypothetical protein GUITHDRAFT_159582 [Guillardia theta CCMP2712]
          Length = 431

 Score =  464 bits (1194), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 232/383 (60%), Positives = 284/383 (74%), Gaps = 16/383 (4%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQS---NLTTPR 57
           MS+FGT FRVTTFGESH   VGCIVDG PP + L EAD+Q+QL RRRPGQ+   +++T R
Sbjct: 1   MSSFGTFFRVTTFGESHCAGVGCIVDGVPPRMQLSEADVQVQLSRRRPGQAGAGSISTGR 60

Query: 58  DEKDKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKA 117
           +E+D V I SGTE G TLGTPIG+ V N+D RPHDY E    PRPSHAD+TY  KY  +A
Sbjct: 61  NEEDAVQILSGTEKGFTLGTPIGMFVRNKDMRPHDYGEMSQIPRPSHADFTYQMKYGFRA 120

Query: 118 SSGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPED 177
           +SGGGR+SARETIGRVAAGAIAEK+LK  +GVEIV++VS V +I             P+D
Sbjct: 121 ASGGGRSSARETIGRVAAGAIAEKFLKERYGVEIVSWVSGVGDI-----------FLPDD 169

Query: 178 FWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGE 237
             +L N I RE+VD+  VRCP    ++KM E I  A+  +DSVGG ++CVIRNVP+GLGE
Sbjct: 170 KVDLAN-ISREQVDQHMVRCPCLETAEKMTECIKAARADEDSVGGVVSCVIRNVPIGLGE 228

Query: 238 PCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGG 296
           PCFDKLEA  AHAM+SIPATKGFEIGSGF G  + G QHND + +    ++ T+TN SGG
Sbjct: 229 PCFDKLEAVLAHAMMSIPATKGFEIGSGFAGARMRGSQHNDMFSIDAQGKMVTETNYSGG 288

Query: 297 TQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESM 356
            QGGI+NG  I FR+AFKPPATI + Q TA + G   VL A+GRHDPCVVPRA+PIVE+M
Sbjct: 289 IQGGISNGMPIVFRMAFKPPATIGKAQNTADFTGSSTVLEAKGRHDPCVVPRAIPIVETM 348

Query: 357 AALVIMDALMIQQSRKTVASLLP 379
           AALVI D  ++Q++R + A+ LP
Sbjct: 349 AALVIADMCLMQEARVSSAARLP 371



>gi|224371407|ref|YP_002605571.1| chorismate synthase [Desulfobacterium autotrophicum HRM2]
 gi|506386420|ref|WP_015906139.1| chorismate synthase [Desulfobacterium autotrophicum]
 gi|223694124|gb|ACN17407.1| AroC3 [Desulfobacterium autotrophicum HRM2]
          Length = 362

 Score =  462 bits (1189), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 237/365 (64%), Positives = 275/365 (75%), Gaps = 14/365 (3%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           STFG LFRV+TFGESH K VG IVDGCP G+ L E+DIQ QLDRRRPGQSN+ T R+EKD
Sbjct: 3   STFGKLFRVSTFGESHCKGVGAIVDGCPSGMDLNESDIQTQLDRRRPGQSNVATERNEKD 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
           +V IQSGTE G TLGTPI L VPNQDQRP DY++    PRPSHAD+TY  KY I+ASSGG
Sbjct: 63  QVTIQSGTELGKTLGTPISLFVPNQDQRPGDYADMVDIPRPSHADYTYQMKYGIRASSGG 122

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGR+  GAIAEK+L    GVEIVA+VSSV+++         +   P+     
Sbjct: 123 GRSSARETIGRICGGAIAEKFLLTGPGVEIVAWVSSVADL---------DAKTPD----- 168

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
           L TI R++VD++ +RC D  V+  M + I +AK  KDSVGG ++CV RNVP GLGEP FD
Sbjct: 169 LLTINRKKVDQNIIRCSDPDVAASMEKIIIQAKNEKDSVGGIVSCVCRNVPPGLGEPVFD 228

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKNDRLGTKTNNSGGTQGGI 301
           KLEA  A AMLSIPATKGF+IGSGF G  + G  HNDP+VLK D LGT+TN SGG QGGI
Sbjct: 229 KLEAMLARAMLSIPATKGFDIGSGFAGARMKGSNHNDPFVLKGDLLGTRTNFSGGIQGGI 288

Query: 302 TNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALVI 361
           +NGE I FRVAFKPPATI   Q+T  +NG   VL A+GRHDPCVV RAVPIVESMAALVI
Sbjct: 289 SNGEPIVFRVAFKPPATIGLPQQTVDFNGNPAVLEAKGRHDPCVVARAVPIVESMAALVI 348

Query: 362 MDALM 366
            D L+
Sbjct: 349 ADCLL 353



>gi|161485623|ref|YP_066794.2| chorismate synthase [Desulfotalea psychrophila LSv54]
 gi|499503659|ref|WP_011190299.1| chorismate synthase [Desulfotalea psychrophila]
 gi|67460262|sp|Q6AIP3.2|AROC_DESPS RecName: Full=Chorismate synthase; AltName:
           Full=5-enolpyruvylshikimate-3-phosphate phospholyase
          Length = 362

 Score =  461 bits (1187), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 233/372 (62%), Positives = 276/372 (74%), Gaps = 14/372 (3%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           S+FGTL++V+T+GESH K VG ++DGCPPGL L EADIQ QLDRRRPGQ+ LTT R E D
Sbjct: 3   SSFGTLYKVSTYGESHCKGVGVVIDGCPPGLELSEADIQRQLDRRRPGQNVLTTDRKEAD 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
           +V I SGTE+G TLGTPI L V N+DQRP DY +    PRPSHAD+TY  KY I+ASSGG
Sbjct: 63  QVMILSGTENGKTLGTPIALHVNNRDQRPGDYGDISDLPRPSHADFTYQMKYGIRASSGG 122

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GRASARETIG VAAGA+A K LK  +G+EIVA+V SV  I    IN              
Sbjct: 123 GRASARETIGTVAAGAVAMKVLKKKYGIEIVAWVESVGPIQASGINP------------- 169

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
            +TI REEVDK   RCPD+  + +M + I E KE  DS GG +TC IRN PVGLGEP ++
Sbjct: 170 -DTISREEVDKQISRCPDQITAAEMEKFITELKERGDSTGGIVTCCIRNSPVGLGEPIYE 228

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKNDRLGTKTNNSGGTQGGI 301
           KLEAK A AML+IPA+KGFEIGSGF G+   G +HND ++ K++RLGT TNNSGG QGGI
Sbjct: 229 KLEAKLAQAMLAIPASKGFEIGSGFAGSRQLGSEHNDLFIWKDNRLGTSTNNSGGIQGGI 288

Query: 302 TNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALVI 361
           +NGE I FRVAFKP ATIS  QETAT+ G    + A+GRHDPCVV RA+PIVESMAALV+
Sbjct: 289 SNGEPILFRVAFKPTATISLPQETATFTGKTETMQAKGRHDPCVVSRAIPIVESMAALVL 348

Query: 362 MDALMIQQSRKT 373
           +D  M Q+SRK+
Sbjct: 349 LDMAMRQESRKS 360



>gi|50877947|emb|CAG37787.1| probable chorismate synthase [Desulfotalea psychrophila LSv54]
          Length = 382

 Score =  461 bits (1185), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 233/372 (62%), Positives = 276/372 (74%), Gaps = 14/372 (3%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           S+FGTL++V+T+GESH K VG ++DGCPPGL L EADIQ QLDRRRPGQ+ LTT R E D
Sbjct: 23  SSFGTLYKVSTYGESHCKGVGVVIDGCPPGLELSEADIQRQLDRRRPGQNVLTTDRKEAD 82

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
           +V I SGTE+G TLGTPI L V N+DQRP DY +    PRPSHAD+TY  KY I+ASSGG
Sbjct: 83  QVMILSGTENGKTLGTPIALHVNNRDQRPGDYGDISDLPRPSHADFTYQMKYGIRASSGG 142

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GRASARETIG VAAGA+A K LK  +G+EIVA+V SV  I    IN              
Sbjct: 143 GRASARETIGTVAAGAVAMKVLKKKYGIEIVAWVESVGPIQASGINP------------- 189

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
            +TI REEVDK   RCPD+  + +M + I E KE  DS GG +TC IRN PVGLGEP ++
Sbjct: 190 -DTISREEVDKQISRCPDQITAAEMEKFITELKERGDSTGGIVTCCIRNSPVGLGEPIYE 248

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKNDRLGTKTNNSGGTQGGI 301
           KLEAK A AML+IPA+KGFEIGSGF G+   G +HND ++ K++RLGT TNNSGG QGGI
Sbjct: 249 KLEAKLAQAMLAIPASKGFEIGSGFAGSRQLGSEHNDLFIWKDNRLGTSTNNSGGIQGGI 308

Query: 302 TNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALVI 361
           +NGE I FRVAFKP ATIS  QETAT+ G    + A+GRHDPCVV RA+PIVESMAALV+
Sbjct: 309 SNGEPILFRVAFKPTATISLPQETATFTGKTETMQAKGRHDPCVVSRAIPIVESMAALVL 368

Query: 362 MDALMIQQSRKT 373
           +D  M Q+SRK+
Sbjct: 369 LDMAMRQESRKS 380



>gi|322418253|ref|YP_004197476.1| chorismate synthase [Geobacter sp. M18]
 gi|505925875|ref|WP_015719069.1| chorismate synthase [Geobacter sp. M18]
 gi|320124640|gb|ADW12200.1| chorismate synthase [Geobacter sp. M18]
          Length = 360

 Score =  460 bits (1184), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 225/371 (60%), Positives = 276/371 (74%), Gaps = 14/371 (3%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           S FGTLFRV+TFGESH  +VG IVDG P G+ L +ADIQ QLDRRRPGQS L+TPR+E+D
Sbjct: 3   SVFGTLFRVSTFGESHCPAVGAIVDGTPAGMGLSQADIQPQLDRRRPGQSELSTPREEQD 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
            V+I SG E+G+TLGTPIGL+V N+DQRP DY E    PRPSHAD+TY  KY ++ASSGG
Sbjct: 63  LVSILSGVENGVTLGTPIGLMVHNRDQRPGDYQEMSQIPRPSHADYTYQVKYGVRASSGG 122

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETI RVAAGAIAEK+L   HGVEIVA+V  V  +    ++              
Sbjct: 123 GRSSARETIARVAAGAIAEKFLFERHGVEIVAWVDGVGALDAGAVD-------------- 168

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
           L  I R++VD   VRC +  ++  M + I + +   DS+GGT++CV RN+P GLGEP FD
Sbjct: 169 LAQITRQQVDAHPVRCGNPAMAQAMADLIAQVRSRDDSIGGTVSCVCRNLPAGLGEPVFD 228

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKNDRLGTKTNNSGGTQGGI 301
           KL+A  AHAMLSIPA KGFEIGSGF G+ + G  HNDP+V K  RLGT +N SGG QGGI
Sbjct: 229 KLDALLAHAMLSIPAAKGFEIGSGFSGSRMLGSAHNDPFVDKGGRLGTTSNYSGGVQGGI 288

Query: 302 TNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALVI 361
           +NGE +YFRVAFKPPAT++  Q TA ++G + VL A+GRHDPC+VPRAVP+VESMAALV+
Sbjct: 289 SNGEPVYFRVAFKPPATVALPQRTARFDGSEAVLEAKGRHDPCIVPRAVPVVESMAALVL 348

Query: 362 MDALMIQQSRK 372
           MD L+ Q+ RK
Sbjct: 349 MDLLLRQEYRK 359



>gi|169603826|ref|XP_001795334.1| hypothetical protein SNOG_04921 [Phaeosphaeria nodorum SN15]
 gi|160706462|gb|EAT87312.2| hypothetical protein SNOG_04921 [Phaeosphaeria nodorum SN15]
          Length = 376

 Score =  459 bits (1180), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 235/383 (61%), Positives = 282/383 (73%), Gaps = 25/383 (6%)

Query: 32  LSLVEADIQIQLDRRRPGQSNLTTPRDEKDKVAIQSGTESGITLGTPIGLLVPNQDQRPH 91
           ++L +ADIQ Q+ RRRPGQS +TTPR+EKD+V IQSGTE GITLGTPIGL V N++QR  
Sbjct: 1   MALTDADIQPQMTRRRPGQSAITTPRNEKDRVEIQSGTEFGITLGTPIGLKVMNENQRKQ 60

Query: 92  DYSE--TDLYPRPSHADWTYLQKYSIKASSGGGRASARETIGRVAAGAIAEKYLKLVHGV 149
           DY     D+YPRPSHADWTYL+KY +KASSGGGR+SARETIGRVAAGAIAEKYL+  +G+
Sbjct: 61  DYGNQTMDMYPRPSHADWTYLEKYGVKASSGGGRSSARETIGRVAAGAIAEKYLREAYGI 120

Query: 150 EIVAFVSSVSN-IAMPFINEQDERLFPEDFWELLNTIRREEVDKD-AVRCPDKTVSDKMR 207
           EIV F +S+ N    P   E        ++ +LL+TI R++VD+   VRCPD+ V+ +M 
Sbjct: 121 EIVCFTASIGNEFLFPPTPEHPTATTNPEYLKLLDTITRDKVDEFLPVRCPDEEVTRRME 180

Query: 208 ERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFDKLEAKFAHAMLSIPATKGFEIGSGFK 267
           + I + ++A+DS+GGT+TCVIRN P GLGEPCFDKLEAK AHAMLSIPATKGFEIGSGF 
Sbjct: 181 DLIAKYRDAQDSIGGTVTCVIRNCPTGLGEPCFDKLEAKLAHAMLSIPATKGFEIGSGFG 240

Query: 268 GTTLFGHQHNDPWV--------------LKNDRLGTKTNNSGGTQGGITNGENIYFRVAF 313
           G  L G  HND ++              ++  RL TKTNNSGG QGGITNG  IYF VAF
Sbjct: 241 GAQLPGSVHNDAFIKAPAVPAGENPSANVQRPRLTTKTNNSGGIQGGITNGAPIYFNVAF 300

Query: 314 KPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKT 373
           KPPATI Q Q T TY+  DGVL A+GRHDPCVVPRAVPIVE+MAALVI+DA++ QQ+R  
Sbjct: 301 KPPATIGQAQTTVTYDENDGVLEAKGRHDPCVVPRAVPIVETMAALVIIDAVLAQQARAG 360

Query: 374 VASLLPPNPNIPAAMSGVIPKLS 396
             SLLPP       + GV P  S
Sbjct: 361 ARSLLPP-------LKGVTPARS 376



>gi|253702030|ref|YP_003023219.1| chorismate synthase [Geobacter sp. M21]
 gi|506318874|ref|WP_015838649.1| chorismate synthase [Geobacter sp. M21]
 gi|251776880|gb|ACT19461.1| chorismate synthase [Geobacter sp. M21]
          Length = 360

 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 223/371 (60%), Positives = 275/371 (74%), Gaps = 14/371 (3%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           S+FGTLFRV+TFGESH  +VG +VDG P G+ L E+DIQ QL RRRPGQS L+TPR+EKD
Sbjct: 3   SSFGTLFRVSTFGESHCAAVGAVVDGVPAGMQLRESDIQSQLHRRRPGQSELSTPREEKD 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
            V+I SG E G+TLGTPI L+V N+DQRP DY E +  PRPSHAD++Y  KY I+ASSGG
Sbjct: 63  LVSILSGVELGLTLGTPICLMVHNRDQRPGDYREMEAVPRPSHADYSYQVKYGIRASSGG 122

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGAIAEKYL    G+EIVA+V  V  +    ++              
Sbjct: 123 GRSSARETIGRVAAGAIAEKYLAERFGLEIVAWVDGVGELEGGTVD-------------- 168

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
           L  I RE+VD  AVRCP+   +  M + I   ++ KDSVGG + CV RN+P GLGEP FD
Sbjct: 169 LEAITREQVDATAVRCPNPEAAAAMMQLIGSVRDRKDSVGGVVRCVCRNLPAGLGEPVFD 228

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKNDRLGTKTNNSGGTQGGI 301
           KL+A  AHAMLS+PA KGFE+GSGF G+ + G  HND +V K  RLGT+TN SGG QGGI
Sbjct: 229 KLDALLAHAMLSLPAAKGFEVGSGFVGSRMLGSAHNDLFVQKEGRLGTQTNFSGGVQGGI 288

Query: 302 TNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALVI 361
           +NGE ++FRVAFKPPAT+S  Q+TA ++G + VL A+GRHDPC+VPRAVPIVESM ALV+
Sbjct: 289 SNGEPVHFRVAFKPPATVSLPQKTAAFDGTETVLEAKGRHDPCIVPRAVPIVESMVALVL 348

Query: 362 MDALMIQQSRK 372
           MD ++ Q+ R+
Sbjct: 349 MDLVLRQEYRR 359



>gi|171689694|ref|XP_001909787.1| hypothetical protein [Podospora anserina S mat+]
 gi|170944809|emb|CAP70921.1| unnamed protein product [Podospora anserina S mat+]
          Length = 426

 Score =  454 bits (1168), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 237/403 (58%), Positives = 283/403 (70%), Gaps = 25/403 (6%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           +TFG  F VTT+GESHGKSVGC +   P  L + EAD+Q QL RRRPGQS +TTPRDEKD
Sbjct: 4   NTFGKGFTVTTWGESHGKSVGCTIGNVPAQLRITEADVQPQLTRRRPGQSAITTPRDEKD 63

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSE--TDLYPRPSHADWTYLQKYSIKASS 119
           +V IQSG ++G++LG P+ ++V N+DQRP DY     D+YPRPSHAD+T   KY IK+ S
Sbjct: 64  RVEIQSGVQNGLSLGLPMMMVVKNEDQRPKDYGNKTMDMYPRPSHADFTTQAKYGIKSES 123

Query: 120 GGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAM-PFINEQDERLFPEDF 178
           GGGR+SARETI RVAAGA+AEKY+    G+EIVAF SS+  I + P   E    +    F
Sbjct: 124 GGGRSSARETIARVAAGAVAEKYMMDAFGIEIVAFTSSIGGIDLFPPTPEHPTPVTDPKF 183

Query: 179 WELLNTIRREEVDKD-AVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGE 237
            E L+ I RE VDK   VRCPD+ +SDKM + I E K+  DS+GGT+TCV+RNVPVGLGE
Sbjct: 184 HEFLDNISRETVDKFLPVRCPDQAISDKMVQLITEFKDRNDSIGGTVTCVVRNVPVGLGE 243

Query: 238 PCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKNDR----------- 286
           P FDKLEA  AHAMLSIPATK FEIGSG    T  G  HNDP+V    R           
Sbjct: 244 PAFDKLEAMLAHAMLSIPATKSFEIGSGLTACTTPGSIHNDPFVSTKGREVPPSVAKSGA 303

Query: 287 ---------LGTKTNNSGGTQGGITNGENIYFRVAFKPPATISQEQETATYNG-VDGVLA 336
                    L TKTN SGG QGGITNG  IYF+V FKPPATI Q+Q TATY+G  +GVLA
Sbjct: 304 YLKGFTRPKLTTKTNFSGGIQGGITNGAPIYFKVGFKPPATIGQDQLTATYDGESEGVLA 363

Query: 337 ARGRHDPCVVPRAVPIVESMAALVIMDALMIQQSRKTVASLLP 379
           A+GRHDPCVVPRA+PIVE+MAA+ +MDAL+     KT++  LP
Sbjct: 364 AKGRHDPCVVPRAIPIVEAMAAITVMDALVRHFGPKTLSQYLP 406



>gi|492848994|ref|WP_006002948.1| chorismate synthase [Desulfuromonas acetoxidans]
 gi|95132678|gb|EAT14359.1| Chorismate synthase [Desulfuromonas acetoxidans DSM 684]
          Length = 359

 Score =  451 bits (1161), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 229/370 (61%), Positives = 277/370 (74%), Gaps = 14/370 (3%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           S+FGTLF+VTTFGESH  +VG IVDG PP ++L EADIQ+QLDRRRPGQ+ L T RDE D
Sbjct: 3   SSFGTLFKVTTFGESHCPAVGAIVDGVPPRMTLTEADIQVQLDRRRPGQNKLGTDRDEAD 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
           +V + SG E G TLG+PIGL+V N+DQRP DY      PRPSHAD+TY  KY   ASSGG
Sbjct: 63  QVKLLSGVEFGKTLGSPIGLMVANKDQRPGDYGSMSQIPRPSHADYTYRAKYGTHASSGG 122

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGAIAEK+L   +G+EIV++VSSV  +    ++              
Sbjct: 123 GRSSARETIGRVAAGAIAEKFLLEEYGIEIVSWVSSVGAVDATGVD-------------- 168

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
           + T+ R++VD   VRCPD   +++M   I  A+EAKDSVGG ++CV RNVP G GEP FD
Sbjct: 169 METLTRQQVDGCDVRCPDAVAAEQMTAEILAAREAKDSVGGVLSCVCRNVPAGWGEPAFD 228

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKNDRLGTKTNNSGGTQGGI 301
           +LEA  AHAMLS+PA+KGFEIGSGF G    G  HNDP+V+KN RLGT+TN SGG QGGI
Sbjct: 229 RLEALMAHAMLSLPASKGFEIGSGFAGARQRGSVHNDPFVMKNGRLGTETNRSGGVQGGI 288

Query: 302 TNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALVI 361
           +NGE +YFRVAFKPPATI QEQ+T  ++G   VLAA+GRHDPCVV RAVPIVE+MAALV+
Sbjct: 289 SNGEPVYFRVAFKPPATIGQEQQTVDFDGNPAVLAAKGRHDPCVVARAVPIVETMAALVL 348

Query: 362 MDALMIQQSR 371
            D  +IQ+ R
Sbjct: 349 ADLALIQRMR 358



>gi|167524727|ref|XP_001746699.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163774969|gb|EDQ88595.1| predicted protein [Monosiga brevicollis MX1]
          Length = 431

 Score =  448 bits (1153), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 233/381 (61%), Positives = 277/381 (72%), Gaps = 15/381 (3%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFGT FRVTTFGESH K VG IVDG PP L+L E D+Q QL RRRPGQS LTTPR+E 
Sbjct: 1   MSTFGTYFRVTTFGESHCKGVGAIVDGVPPRLALTEEDVQPQLTRRRPGQSKLTTPRNES 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D+V I SGTE G TLGTPIGL VPNQDQRP DY  T   PRPSHAD+TY+ KY   ASSG
Sbjct: 61  DRVTIMSGTEFGRTLGTPIGLFVPNQDQRPKDYGSTSHAPRPSHADFTYMSKYGTHASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGR+SARETIGRVA GAIAEK+L+   G+EIVA+VS+V +     ++             
Sbjct: 121 GGRSSARETIGRVAGGAIAEKWLREAFGIEIVAWVSAVGSETESDVD------------- 167

Query: 181 LLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
            ++TI RE+VD+   VR       ++    I + K  +DS GG ++CV RNVP G GEPC
Sbjct: 168 -VDTITREQVDEHLPVRSGTAEAVERFSNVIKDCKAKQDSTGGVVSCVCRNVPAGWGEPC 226

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKNDRLGTKTNNSGGTQG 299
           FDKLEAK AHAM+SIPATKGFE+GSGF GT + G  HND +V K D LGT TNNSGG QG
Sbjct: 227 FDKLEAKLAHAMMSIPATKGFEVGSGFSGTRMRGSTHNDLFVKKGDGLGTATNNSGGIQG 286

Query: 300 GITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAAL 359
           GI+NGENI FR+AFKPPATI Q+Q++  + G D V+AA+GRHDPCVVPRA+PIVE+MAAL
Sbjct: 287 GISNGENIVFRIAFKPPATIGQQQQSVNFQGEDDVVAAKGRHDPCVVPRAIPIVEAMAAL 346

Query: 360 VIMDALMIQQSRKTVASLLPP 380
           V+ D  + Q +R++   L  P
Sbjct: 347 VLADLALAQLARRSAGDLATP 367



>gi|365765794|gb|EHN07300.1| Aro2p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 327

 Score =  441 bits (1135), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 218/327 (66%), Positives = 257/327 (78%), Gaps = 9/327 (2%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG LFRVTT+GESH KSVGCIVDG PPG+SL EADIQ QL RRRPGQS L+TPRDEK
Sbjct: 1   MSTFGKLFRVTTYGESHCKSVGCIVDGVPPGMSLTEADIQPQLTRRRPGQSKLSTPRDEK 60

Query: 61  DKVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSG 120
           D+V IQSGTE G TLGTPI +++ N+DQRPHDYS+ D +PRPSHAD+TY +KY IKASSG
Sbjct: 61  DRVEIQSGTEFGKTLGTPIAMMIKNEDQRPHDYSDMDKFPRPSHADFTYSEKYGIKASSG 120

Query: 121 GGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GGRASARETIGRVA+GAIAEK+L     VEIVAFV+ +  I M      +   F  +F  
Sbjct: 121 GGRASARETIGRVASGAIAEKFLAQNSNVEIVAFVTQIGEIKM------NRDSFDPEFQH 174

Query: 181 LLNTIRREEVDKDA-VRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           LLNTI RE+VD    +RCPD +V+  M + I + +  KDS+GG +TCV+RN+P GLGEPC
Sbjct: 175 LLNTITREKVDSMGPIRCPDASVAGLMVKEIEKYRGNKDSIGGVVTCVVRNLPTGLGEPC 234

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSGGT 297
           FDKLEA  AHAMLSIPA+KGFEIGSGF+G ++ G +HNDP+  + +  RL TKTNNSGG 
Sbjct: 235 FDKLEAMLAHAMLSIPASKGFEIGSGFQGVSVPGSKHNDPFYFEKETNRLRTKTNNSGGV 294

Query: 298 QGGITNGENIYFRVAFKPPATISQEQE 324
           QGGI+NGENIYF V FK  ATISQEQ+
Sbjct: 295 QGGISNGENIYFSVPFKSVATISQEQK 321



>gi|449464390|ref|XP_004149912.1| PREDICTED: chorismate synthase, chloroplastic-like [Cucumis
           sativus]
 gi|449505691|ref|XP_004162542.1| PREDICTED: chorismate synthase, chloroplastic-like [Cucumis
           sativus]
          Length = 439

 Score =  427 bits (1098), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 213/384 (55%), Positives = 271/384 (70%), Gaps = 16/384 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           STFG  FRVTT+GESHG  VGC++DGCPP   + EAD+Q++LDRRRPGQS +TTPR E D
Sbjct: 56  STFGNYFRVTTYGESHGGGVGCVIDGCPPRRPISEADLQVELDRRRPGQSRITTPRKETD 115

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SG  +G+T GTPI + VPN DQR HDYSE  +  RPSHAD TY  KY I+A  GG
Sbjct: 116 TCRILSGVTNGVTTGTPIHVFVPNTDQRGHDYSEMSIAYRPSHADATYDMKYGIRAVEGG 175

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGA+A+K LK + G E++A+VS V  + +P      E +   +    
Sbjct: 176 GRSSARETIGRVAAGAVAKKILKELAGTEVLAYVSQVYKVVLP------EGVVDHE---- 225

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
             T+  E+++ + VRCPD   ++KM   I   +   +S+GG +TC+++N P GLG P FD
Sbjct: 226 --TLSMEQIESNIVRCPDPEYAEKMIAAIDAVRVRGESIGGVVTCIVKNCPPGLGSPVFD 283

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQGG 300
           KLEA+FA A+LS+PA+KGFEIGSGF GT L G +HNDP+ L +N R+ T TN SGG QGG
Sbjct: 284 KLEAEFAKAVLSLPASKGFEIGSGFGGTFLTGSEHNDPFYLDENGRIRTVTNRSGGIQGG 343

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGE I  RVAFKP ATI ++Q T T +  +  L ARGRHDPCVVPRAVP+VE+M ALV
Sbjct: 344 ISNGEVISMRVAFKPTATIGKKQNTVTRDKKEVELIARGRHDPCVVPRAVPMVEAMVALV 403

Query: 361 IMDALMIQQSRKTVASLLPPNPNI 384
           +MD LM Q  +    +L P NP++
Sbjct: 404 LMDQLMAQHGQ---CNLFPINPDL 424



>gi|497314860|ref|WP_009629077.1| chorismate synthase [Pseudanabaena biceps]
 gi|443016126|gb|ELS30856.1| chorismate synthase [Pseudanabaena biceps PCC 7429]
          Length = 360

 Score =  426 bits (1095), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 212/369 (57%), Positives = 262/369 (71%), Gaps = 14/369 (3%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           STFG LFRVTTFGESHG  VG IVDGCPP L L EADIQ+ LDRR+PGQS + TPR E D
Sbjct: 3   STFGHLFRVTTFGESHGGGVGAIVDGCPPQLELSEADIQVDLDRRKPGQSKIVTPRREDD 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
           +  I SG   G TLGTPI +LV N+D R  DYSE     RPSHAD TY  KY I+   GG
Sbjct: 63  RAQILSGVFEGKTLGTPITILVQNKDARSQDYSEMAEKFRPSHADATYQAKYGIRNWQGG 122

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGAIA+K LK V GVEI+A+V  V ++ +P I+              
Sbjct: 123 GRSSARETIGRVAAGAIAKKILKQVAGVEIIAYVKQVKDLVVPHIDP------------- 169

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
            NT+  E+V+ + +RCPD  ++ KM + I + +   +SVGG + CV RNVP+GLG+P FD
Sbjct: 170 -NTVTMEQVESNILRCPDPEMAAKMIDFIDKIRREGNSVGGIVECVARNVPIGLGDPVFD 228

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKNDRLGTKTNNSGGTQGGI 301
           KLEA  A A++S+PA+KGFEIGSGF G  L G +HND + ++ DRL T+TNNSGG QGGI
Sbjct: 229 KLEADLAKAVMSLPASKGFEIGSGFDGVCLTGREHNDEFYMEGDRLRTRTNNSGGIQGGI 288

Query: 302 TNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALVI 361
           +NGENI  RVAFKP ATI  EQ+T + +G +  L  RGRHDPCV+PRAVP+VE+M ALV+
Sbjct: 289 SNGENIILRVAFKPTATILLEQKTVSVSGEETTLTGRGRHDPCVLPRAVPMVEAMVALVL 348

Query: 362 MDALMIQQS 370
            D  + Q++
Sbjct: 349 CDRYLTQKT 357



>gi|255577383|ref|XP_002529571.1| Chorismate synthase, chloroplast precursor, putative [Ricinus
           communis]
 gi|223530947|gb|EEF32805.1| Chorismate synthase, chloroplast precursor, putative [Ricinus
           communis]
          Length = 435

 Score =  426 bits (1095), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 210/384 (54%), Positives = 270/384 (70%), Gaps = 16/384 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           STFGT FRVTTFGESHG  VGC +DGCPP + L EAD+Q+ LDRRRPGQS +TTPR E D
Sbjct: 51  STFGTHFRVTTFGESHGGGVGCTIDGCPPRVPLSEADMQVDLDRRRPGQSRITTPRKETD 110

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SG   G+T GTPI + VPN DQR HDYSE  +  RPSHAD TY  KY +++  GG
Sbjct: 111 TCKIYSGVSEGMTTGTPIHVFVPNTDQRGHDYSEMSVAYRPSHADATYDMKYGVRSVQGG 170

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVA+GAIA+K LK   G E++A+VS V  +           + PED  + 
Sbjct: 171 GRSSARETIGRVASGAIAKKILKQFSGTEVLAYVSQVHKV-----------VLPEDMVD- 218

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
             T+  ++++ + VRCPD   ++KM   I + +   DSVGG +TC++RNVP GLG P FD
Sbjct: 219 HETLTLDQIESNIVRCPDPEYAEKMIAAIDKIRVRGDSVGGVVTCIVRNVPRGLGSPVFD 278

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQGG 300
           KLEA+ A A++S+PATKGFE GSGF GT L G +HND + + ++ ++ T+TN SGG QGG
Sbjct: 279 KLEAELAKAVMSLPATKGFEFGSGFAGTFLTGSEHNDEFYMEEHGKIRTRTNRSGGIQGG 338

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGE IY R+AFKP +TI ++Q T T + V+  L ARGRHDPCVVPRAVP+VE+M ALV
Sbjct: 339 ISNGETIYMRIAFKPTSTIGKKQHTVTRDKVETELIARGRHDPCVVPRAVPMVEAMVALV 398

Query: 361 IMDALMIQQSRKTVASLLPPNPNI 384
           ++D LM Q ++     + P NP +
Sbjct: 399 LVDQLMAQYAQ---CYMFPINPEL 419



>gi|76782200|gb|ABA54870.1| putative chorismate synthase [Fagus sylvatica]
          Length = 434

 Score =  423 bits (1088), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 215/384 (55%), Positives = 266/384 (69%), Gaps = 16/384 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           ST G  FRVTTFGESHG  VGCI+DGCPP L L EAD+Q+ LDRRRPGQS +TTPR E D
Sbjct: 50  STHGNYFRVTTFGESHGGGVGCIIDGCPPRLPLSEADMQVDLDRRRPGQSRITTPRKETD 109

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SG   G+T GTPI +LVPN DQR HDYSE  +  RPSHAD TY  KY ++A  GG
Sbjct: 110 TCRILSGVSEGMTTGTPIAVLVPNTDQRGHDYSEMSIAYRPSHADATYDMKYGVRAVQGG 169

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGA+A+K LK + G EI A+VS V  + +           PED  + 
Sbjct: 170 GRSSARETIGRVAAGAVAKKILKSLAGTEIFAYVSQVHKVVL-----------PEDLVDP 218

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
             T+  ++++ + VRCPD   ++KM   I   +   DS+GG +TC++R  P GLG P FD
Sbjct: 219 Y-TLTLDQIESNIVRCPDPEYAEKMIAAIDAVRVRGDSIGGVVTCIVRRCPRGLGSPVFD 277

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQGG 300
           KLEA+ A A +S+PATKGFE GSGF GTTL G +HND +   +N R+ T+TN SGG QGG
Sbjct: 278 KLEAELAKAAMSLPATKGFEFGSGFAGTTLCGSEHNDEFFTDENGRIRTRTNRSGGIQGG 337

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGE I  RVAFKP ATIS++Q+T T    +  L ARGRHDPCVVPRAVP+VE+M ALV
Sbjct: 338 ISNGEVINMRVAFKPTATISRKQQTVTREKKEIELIARGRHDPCVVPRAVPMVEAMVALV 397

Query: 361 IMDALMIQQSRKTVASLLPPNPNI 384
           + D LM Q ++    +L P NP++
Sbjct: 398 LADQLMSQYAQ---CNLFPINPDL 418



>gi|350534912|ref|NP_001234422.1| chorismate synthase 1, chloroplastic precursor [Solanum
           lycopersicum]
 gi|2492952|sp|Q42884.1|AROC1_SOLLC RecName: Full=Chorismate synthase 1, chloroplastic; AltName:
           Full=5-enolpyruvylshikimate-3-phosphate phospholyase 1;
           Flags: Precursor
 gi|410482|emb|CAA79859.1| chorismate synthase 1 [Solanum lycopersicum]
          Length = 440

 Score =  422 bits (1085), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 210/384 (54%), Positives = 270/384 (70%), Gaps = 16/384 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           STFG  FRVTTFGESHG  VGCI+DGCPP L L E+D+Q++LDRRRPGQS +TTPR E D
Sbjct: 57  STFGNYFRVTTFGESHGGGVGCIIDGCPPRLPLSESDMQVELDRRRPGQSRITTPRKETD 116

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SGT  G+T G+PI + VPN DQR +DYSE  L  RPSHAD TY  KY +++  GG
Sbjct: 117 TCKISSGTADGLTTGSPIKVEVPNTDQRGNDYSEMSLAYRPSHADATYDFKYGVRSVQGG 176

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGA+A+K LKL  G E++A+VS V  + +           PED  + 
Sbjct: 177 GRSSARETIGRVAAGAVAKKILKLYSGAEVLAYVSQVHQVVL-----------PEDLIDH 225

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
            N +  E+++ + VRCPD   ++KM   I   +   DSVGG +TC++RN+P GLG P FD
Sbjct: 226 QN-VTLEQIESNIVRCPDPEYAEKMIAAIDAVRVRGDSVGGVVTCIVRNLPRGLGTPVFD 284

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQGG 300
           KLEA+ A A +S+PATKGFE GSGF GT + G +HND + + ++ R+ T+TN SGG QGG
Sbjct: 285 KLEAELAKACMSLPATKGFEFGSGFAGTFMTGSEHNDEFYMDEHGRIRTRTNRSGGIQGG 344

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGE I  R+ FKP +TIS++Q+T T +  +  L ARGRHDPCVVPRAVP+VE+M ALV
Sbjct: 345 ISNGEVINMRIGFKPTSTISRKQQTVTRDKHETELIARGRHDPCVVPRAVPMVEAMVALV 404

Query: 361 IMDALMIQQSRKTVASLLPPNPNI 384
           ++D LM Q S+     + P NP +
Sbjct: 405 LVDQLMAQYSQ---CMMFPINPEL 425



>gi|224109756|ref|XP_002315301.1| chorismate synthase [Populus trichocarpa]
 gi|118487444|gb|ABK95550.1| unknown [Populus trichocarpa]
 gi|222864341|gb|EEF01472.1| chorismate synthase [Populus trichocarpa]
          Length = 437

 Score =  420 bits (1079), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 215/395 (54%), Positives = 268/395 (67%), Gaps = 18/395 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           STFGT FRVTTFGESHG  VGCI+DGCPP + L EAD+Q  LDRRRPGQS +TTPR E D
Sbjct: 53  STFGTNFRVTTFGESHGGGVGCIIDGCPPRIPLSEADMQFDLDRRRPGQSRITTPRKETD 112

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SG   G+T GTPI + VPN DQR  DYSE  +  RPSHAD TY  KY +++  GG
Sbjct: 113 TCKISSGVSEGLTTGTPIHVFVPNTDQRGLDYSEMSVAYRPSHADATYDMKYGVRSVQGG 172

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAG +A+K LKL  G EI+A+VS V  + +P      E +   D   L
Sbjct: 173 GRSSARETIGRVAAGGVAKKILKLYAGTEILAYVSQVHKVVLP------EGVVDHDSLTL 226

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
                 ++++ + VRCPD   ++KM   I   +   DSVGG +TC++RN P GLG P FD
Sbjct: 227 ------DQMESNIVRCPDPEYAEKMIAAIDAVRVKGDSVGGVVTCIVRNAPRGLGSPVFD 280

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQGG 300
           KLEA+ A A +S+PATKGFE GSGF GT L G +HND +   K+ R+ T+TN SGG QGG
Sbjct: 281 KLEAELAKAAMSLPATKGFEFGSGFAGTLLTGSEHNDEFYTDKHGRIRTRTNRSGGIQGG 340

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGE I  R+AFKP +TI ++Q T T +  +  L ARGRHDPCVVPRAVP+VE+M ALV
Sbjct: 341 ISNGEIINMRIAFKPTSTIGKKQHTVTRDKKETDLIARGRHDPCVVPRAVPMVEAMVALV 400

Query: 361 IMDALMIQQSRKTVASLLPPNPNIPAAMSGVIPKL 395
           +MD LM Q S+     LLP N  +   +  ++P+L
Sbjct: 401 LMDQLMAQYSQ---CYLLPINSELQEPL--IMPRL 430



>gi|148906363|gb|ABR16336.1| unknown [Picea sitchensis]
          Length = 442

 Score =  419 bits (1076), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 208/373 (55%), Positives = 267/373 (71%), Gaps = 17/373 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           +TFGTLFRVTTFGESHG  VGC++DGCPP + L EAD+Q++LDRRRPGQS +TTPR E D
Sbjct: 58  NTFGTLFRVTTFGESHGGGVGCVIDGCPPRIPLSEADMQVELDRRRPGQSRITTPRKETD 117

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SG   G T GTPI +LVPN DQR +DYSE  L  RPSHAD TY  KY +++  GG
Sbjct: 118 TCRILSGLSEGQTTGTPIAVLVPNTDQRGNDYSEMSLAYRPSHADATYDFKYGVRSVQGG 177

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMP--FINEQDERLFPEDFW 179
           GR+SARETIGRVAAGA+A+K L+L  G E++A+VS V    +P   +N            
Sbjct: 178 GRSSARETIGRVAAGAVAKKILELKAGTEVLAYVSQVHKEVLPDGIVNH----------- 226

Query: 180 ELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
              +T+ + EV+ + VRCPD   ++KM   I + +   DSVGG +TC++RNVP GLG P 
Sbjct: 227 ---DTLTQAEVESNIVRCPDPVYAEKMIAAIDDVRTKGDSVGGVVTCIVRNVPRGLGAPV 283

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQ 298
           FDKLEA+ A A++S+PATKGFEIGSGF GT + G +HND + + ++  + T+TN SGG Q
Sbjct: 284 FDKLEAELAKALMSLPATKGFEIGSGFAGTLITGSEHNDEFYMDESGDIRTRTNRSGGIQ 343

Query: 299 GGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAA 358
           GGI+NGE I  R+AFKP +TI+++Q T T N  +  L ARGRHDPCVVPRAVP+VE+M A
Sbjct: 344 GGISNGEMIKVRLAFKPTSTITRKQMTVTRNREETELQARGRHDPCVVPRAVPMVEAMVA 403

Query: 359 LVIMDALMIQQSR 371
           LV++D LM Q ++
Sbjct: 404 LVLVDHLMQQYAQ 416



>gi|350534710|ref|NP_001234411.1| chorismate synthase 2, chloroplastic precursor [Solanum
           lycopersicum]
 gi|2492953|sp|Q42885.1|AROC2_SOLLC RecName: Full=Chorismate synthase 2, chloroplastic; AltName:
           Full=5-enolpyruvylshikimate-3-phosphate phospholyase 2;
           Flags: Precursor
 gi|410484|emb|CAA79854.1| chorismate synthase 2 [Solanum lycopersicum]
          Length = 431

 Score =  418 bits (1074), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 210/381 (55%), Positives = 269/381 (70%), Gaps = 16/381 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           +TFG  FRVTTFGESHG  VGCI+DGCPP L L E+D+Q++LDRRRPGQS +TTPR E D
Sbjct: 51  NTFGNYFRVTTFGESHGGGVGCIIDGCPPRLPLSESDMQVELDRRRPGQSRITTPRKETD 110

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SGT  G+T G+PI + VPN DQR +DYSE  L  RPSHAD TY  KY +++  GG
Sbjct: 111 TCKISSGTADGLTTGSPIKVEVPNTDQRGNDYSEMSLAYRPSHADATYDFKYGVRSVQGG 170

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGA+A+K LKL  G EI+A+VS V N+ +           PED  + 
Sbjct: 171 GRSSARETIGRVAAGAVAKKILKLYSGTEILAYVSQVHNVVL-----------PEDLVD- 218

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
              +  E+++ + VRCP+   ++KM   I   +   DSVGG +TC++RNVP GLG P FD
Sbjct: 219 NQIVTLEQIESNIVRCPNPEYAEKMIGAIDYVRVRGDSVGGVVTCIVRNVPRGLGTPVFD 278

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQGG 300
           KLEA+ A A +S+PATKGFE GSGF GT + G +HND + + ++D++ TKTN SGG QGG
Sbjct: 279 KLEAELAKACMSLPATKGFEFGSGFAGTFMTGSEHNDEFFMDEHDQIRTKTNRSGGIQGG 338

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGE I  RVAFKP +TI+++Q T + +  +  L ARGRHDPCVVPRAVP+VE+M ALV
Sbjct: 339 ISNGEIINMRVAFKPTSTIARKQHTVSRDKHETELIARGRHDPCVVPRAVPMVEAMVALV 398

Query: 361 IMDALMIQQSRKTVASLLPPN 381
           ++D LM Q ++     L P N
Sbjct: 399 LVDQLMTQYAQ---CMLFPVN 416



>gi|218192459|gb|EEC74886.1| hypothetical protein OsI_10797 [Oryza sativa Indica Group]
          Length = 438

 Score =  417 bits (1072), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 208/366 (56%), Positives = 259/366 (70%), Gaps = 13/366 (3%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           + FG  F+V T+GESHG  VGC++ GCPP + L EAD+Q++LDRRRPGQS +TTPR E D
Sbjct: 52  NVFGNYFQVATYGESHGGGVGCVISGCPPRIPLTEADMQVELDRRRPGQSRITTPRKETD 111

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SGT  G+T GTPI + VPN DQR  DYSE     RPSHAD TY  KY ++A  GG
Sbjct: 112 TCKILSGTHEGMTTGTPIHVFVPNTDQRGGDYSEMAKAYRPSHADATYDFKYGVRAVQGG 171

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGA+A+K LKL  GVEI+AFVS V  +           + PED  + 
Sbjct: 172 GRSSARETIGRVAAGALAKKILKLKSGVEILAFVSKVHQV-----------VLPEDVVD- 219

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
            +T+  E+++ + VRCPD   + KM + I + +   DS+GG +TC+ RNVP G+G P FD
Sbjct: 220 YDTVTMEQIESNIVRCPDPEYAQKMIDAIDKVRVRGDSIGGVVTCIARNVPRGIGSPVFD 279

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQGG 300
           KLEA+ A AMLS+PA+KGFEIGSGF GT   G +HND + + +   + T+TN SGG QGG
Sbjct: 280 KLEAELAKAMLSLPASKGFEIGSGFAGTDYTGSEHNDEFYMDEAGNVRTRTNRSGGVQGG 339

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGE IYF+VAFKP ATI ++Q T +    D  L ARGRHDPCVVPRAVP+VESMAALV
Sbjct: 340 ISNGEIIYFKVAFKPTATIGKKQHTVSREHEDVELLARGRHDPCVVPRAVPMVESMAALV 399

Query: 361 IMDALM 366
           +MD LM
Sbjct: 400 LMDQLM 405



>gi|123965491|ref|YP_001010572.1| chorismate synthase [Prochlorococcus marinus str. MIT 9515]
 gi|500143574|ref|WP_011819577.1| chorismate synthase [Prochlorococcus marinus]
 gi|166218050|sp|A2BUK4.1|AROC_PROM5 RecName: Full=Chorismate synthase; AltName:
           Full=5-enolpyruvylshikimate-3-phosphate phospholyase
 gi|123199857|gb|ABM71465.1| Chorismate synthase [Prochlorococcus marinus str. MIT 9515]
          Length = 364

 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 207/375 (55%), Positives = 268/375 (71%), Gaps = 17/375 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           S FG +FRV+TFGESHG +VG I+DGCPP L +    IQ +LDRRRPGQS +TTPR E D
Sbjct: 3   SIFGKIFRVSTFGESHGGAVGVILDGCPPKLKINIDLIQNELDRRRPGQSKITTPRKEDD 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
           K+ I SG + GITLGTPI +LV N+DQRP DY+  +   RPSHAD TY  KY I+A SGG
Sbjct: 63  KLEILSGLKEGITLGTPIAMLVRNKDQRPEDYNNLEQVFRPSHADGTYHLKYGIQAGSGG 122

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GRASARETIGRVAAGAIA++ LK +   EI+++V  + +I               D    
Sbjct: 123 GRASARETIGRVAAGAIAKQLLKTLFNTEILSWVKRIHDI---------------DSQVN 167

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
            N +   ++D + VRCPD+ V+ KM +RI E ++  DS GG I C+++NVP GLG P FD
Sbjct: 168 KNKLTLSKIDSNIVRCPDEKVATKMIQRIKELQQEGDSCGGVIECLVKNVPSGLGMPVFD 227

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSGGTQG 299
           KLEA  A A++S+PATKGFEIGSGF GT L G +HND +V  +D  +L TK+NNSGG QG
Sbjct: 228 KLEADLAKALMSLPATKGFEIGSGFLGTYLRGSEHNDSFVESDDINKLKTKSNNSGGIQG 287

Query: 300 GITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAAL 359
           GI+NGENI  ++AFKP ATI +EQ+T   +G + V+ A+GRHDPCV+PRAVP+V+SM AL
Sbjct: 288 GISNGENIEMKIAFKPTATIGKEQKTVNSDGKEIVMKAKGRHDPCVLPRAVPMVDSMVAL 347

Query: 360 VIMDALMIQQSRKTV 374
           V+ D L++ Q++ ++
Sbjct: 348 VLADHLLLHQAQCSI 362



>gi|115451975|ref|NP_001049588.1| Os03g0254800 [Oryza sativa Japonica Group]
 gi|108707229|gb|ABF95024.1| Chorismate synthase 2, chloroplast precursor, putative, expressed
           [Oryza sativa Japonica Group]
 gi|113548059|dbj|BAF11502.1| Os03g0254800 [Oryza sativa Japonica Group]
 gi|215704692|dbj|BAG94320.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|222623703|gb|EEE57835.1| hypothetical protein OsJ_08438 [Oryza sativa Japonica Group]
          Length = 438

 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 208/366 (56%), Positives = 259/366 (70%), Gaps = 13/366 (3%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           + FG  F+V T+GESHG  VGC++ GCPP + L EAD+Q++LDRRRPGQS +TTPR E D
Sbjct: 52  NVFGNYFQVATYGESHGGGVGCVISGCPPRIPLTEADMQVELDRRRPGQSRITTPRKETD 111

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SGT  G+T GTPI + VPN DQR  DYSE     RPSHAD TY  KY ++A  GG
Sbjct: 112 TCKILSGTHEGMTTGTPIHVFVPNTDQRGGDYSEMAKAYRPSHADATYDFKYGVRAVQGG 171

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGA+A+K LKL  GVEI+AFVS V  +           + PED  + 
Sbjct: 172 GRSSARETIGRVAAGALAKKILKLKSGVEILAFVSKVHQV-----------VLPEDAVD- 219

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
            +T+  E+++ + VRCPD   + KM + I + +   DS+GG +TC+ RNVP G+G P FD
Sbjct: 220 YDTVTMEQIESNIVRCPDPEYAQKMIDAIDKVRVRGDSIGGVVTCIARNVPRGIGSPVFD 279

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQGG 300
           KLEA+ A AMLS+PA+KGFEIGSGF GT   G +HND + + +   + T+TN SGG QGG
Sbjct: 280 KLEAELAKAMLSLPASKGFEIGSGFAGTDYTGSEHNDEFYMDEAGNVRTRTNRSGGVQGG 339

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGE IYF+VAFKP ATI ++Q T +    D  L ARGRHDPCVVPRAVP+VESMAALV
Sbjct: 340 ISNGEIIYFKVAFKPTATIGKKQHTVSREHEDVELLARGRHDPCVVPRAVPMVESMAALV 399

Query: 361 IMDALM 366
           +MD LM
Sbjct: 400 LMDQLM 405



>gi|242036289|ref|XP_002465539.1| hypothetical protein SORBIDRAFT_01g040790 [Sorghum bicolor]
 gi|241919393|gb|EER92537.1| hypothetical protein SORBIDRAFT_01g040790 [Sorghum bicolor]
          Length = 440

 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 209/366 (57%), Positives = 258/366 (70%), Gaps = 13/366 (3%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           + FG  F+V T+GESHG  VGC++ GCPP + L EAD+Q++LDRRRPGQS +TTPR E D
Sbjct: 54  NVFGNYFQVATYGESHGGGVGCVISGCPPRIPLSEADMQVELDRRRPGQSRITTPRKETD 113

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SGT  G+T GTPI + VPN DQR  DYSE     RPSHAD TY  KY ++A  GG
Sbjct: 114 TCKILSGTHDGMTTGTPIHVFVPNTDQRGGDYSEMAKAYRPSHADATYDFKYGVRAVQGG 173

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGA+A+K LKL  GVEI+AFVS V  +           + PED  + 
Sbjct: 174 GRSSARETIGRVAAGALAKKILKLKSGVEILAFVSKVHQV-----------VLPEDAVD- 221

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
             T+  E+++ + VRCPD   ++KM   I + +   DS+GG +TC+ RNVP GLG P FD
Sbjct: 222 YETVALEQIESNIVRCPDPEYAEKMIAAIDKVRVRGDSIGGVVTCIARNVPRGLGSPVFD 281

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQGG 300
           KLEA+ A AMLS+PA+KGFEIGSGF GT   G +HND + + +   + T+TN SGG QGG
Sbjct: 282 KLEAELAKAMLSLPASKGFEIGSGFAGTDFTGSEHNDEFYMDEAGNVRTRTNRSGGVQGG 341

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGE IYF+VAFKP ATI ++Q T +    D  L ARGRHDPCVVPRAVP+VESMAALV
Sbjct: 342 ISNGEIIYFKVAFKPTATIGKKQNTVSREHEDVELLARGRHDPCVVPRAVPMVESMAALV 401

Query: 361 IMDALM 366
           +MD LM
Sbjct: 402 LMDQLM 407



>gi|194697622|gb|ACF82895.1| unknown [Zea mays]
 gi|414865879|tpg|DAA44436.1| TPA: chorismate synthase [Zea mays]
          Length = 440

 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 209/366 (57%), Positives = 256/366 (69%), Gaps = 13/366 (3%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           + FG  F+V T+GESHG  VGC++ GCPP + L EAD+Q++LDRRRPGQS +TTPR E D
Sbjct: 54  NVFGNYFQVATYGESHGGGVGCVISGCPPRIPLTEADMQVELDRRRPGQSRITTPRKETD 113

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SGT  G+T GTPI + VPN DQR  DYSE     RPSHAD TY  KY ++A  GG
Sbjct: 114 TCKILSGTHDGMTTGTPIHVFVPNTDQRGGDYSEMSKAYRPSHADATYDFKYGVRAVQGG 173

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGA+A+K LKL  GVEI+AFVS V  +           + PED  + 
Sbjct: 174 GRSSARETIGRVAAGALAKKILKLKSGVEILAFVSKVHQV-----------VLPEDAVD- 221

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
             T+  E ++ + VRCPD   ++KM   I   +   DS+GG +TC+ RNVP GLG P FD
Sbjct: 222 YETVTLEHIESNIVRCPDPEYAEKMIAAIDTVRVRGDSIGGVVTCIARNVPRGLGSPVFD 281

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQGG 300
           KLEA+ A AMLS+PA+KGFEIGSGF GT   G +HND + + +   + T+TN SGG QGG
Sbjct: 282 KLEAELAKAMLSLPASKGFEIGSGFAGTDFTGSEHNDEFYMDEAGNVRTRTNRSGGVQGG 341

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGE IYF+VAFKP ATI ++Q T +    D  L ARGRHDPCVVPRAVP+VESMAALV
Sbjct: 342 ISNGEIIYFKVAFKPTATIGKKQNTVSREHEDVELLARGRHDPCVVPRAVPMVESMAALV 401

Query: 361 IMDALM 366
           +MD LM
Sbjct: 402 LMDQLM 407



>gi|302782684|ref|XP_002973115.1| hypothetical protein SELMODRAFT_173197 [Selaginella moellendorffii]
 gi|300158868|gb|EFJ25489.1| hypothetical protein SELMODRAFT_173197 [Selaginella moellendorffii]
          Length = 455

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 214/384 (55%), Positives = 266/384 (69%), Gaps = 20/384 (5%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           +TFG LFRVTTFGESHG  VGC++DGCPP L+L E D+Q  LDRRRPGQS +TTPR E D
Sbjct: 68  NTFGNLFRVTTFGESHGGGVGCVIDGCPPRLNLTEEDMQEDLDRRRPGQSRITTPRKETD 127

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SG   G+TLGTPI +LVPN DQR  DYSE  L  RPSHAD TY  KY I+A  GG
Sbjct: 128 TCKILSGVAQGMTLGTPIAVLVPNTDQRGGDYSEMALAYRPSHADATYDFKYGIRAVQGG 187

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGAIA+K LK   G E++A+VS V  + +P      E     D   L
Sbjct: 188 GRSSARETIGRVAAGAIAKKLLKQQCGTEVLAYVSRVHQVELP------EGAIDHDNLTL 241

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
                 E+V+ + VRCPD+ +++KM   I   +   DSVGG +TC+ RNVP GLG P FD
Sbjct: 242 ------EQVESNIVRCPDQDMAEKMIAAIDAVRVRGDSVGGVVTCIARNVPRGLGTPVFD 295

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKNDRLG---TKTNNSGGTQ 298
           KLEA+ A A++S+PATKGFEIGSGF+GT + G +HND + +  D +G   T+TN SGG Q
Sbjct: 296 KLEAELAKALMSLPATKGFEIGSGFEGTKMTGSEHNDEFYI--DEIGNVRTRTNRSGGIQ 353

Query: 299 GGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAA 358
           GGI+NGE I  R+AFKP +TI++ Q+T T +  +  L ARGRHDPCVVPRAVP+VE+M A
Sbjct: 354 GGISNGETIVMRIAFKPTSTITKFQKTVTRDRQETELRARGRHDPCVVPRAVPMVEAMVA 413

Query: 359 LVIMDALMIQQSRKTVASLLPPNP 382
           LV+ D L+   ++      LP +P
Sbjct: 414 LVLADQLLQNYAQ---CQFLPLDP 434



>gi|492911878|ref|WP_006042284.1| chorismate synthase [Synechococcus sp. WH 7805]
 gi|88788004|gb|EAR19160.1| chorismate synthase [Synechococcus sp. WH 7805]
          Length = 362

 Score =  416 bits (1069), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 213/371 (57%), Positives = 261/371 (70%), Gaps = 16/371 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           S+FGTLFR++TFGESHG  VG I++GCPP L L    IQ +LDRRRPGQS +TTPR E D
Sbjct: 3   SSFGTLFRISTFGESHGGGVGVILEGCPPRLELDLVAIQAELDRRRPGQSKITTPRKEAD 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
           +V I SG   GITLGTPI ++V N+DQRP DY E ++  RPSHAD TY  KY I+A SGG
Sbjct: 63  QVEILSGVMDGITLGTPIAMVVRNKDQRPQDYKEVEVAFRPSHADATYQAKYGIQARSGG 122

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GRASARETIGRVAAGAIA + L+  HG E+VA+V  + ++      E D           
Sbjct: 123 GRASARETIGRVAAGAIARQILQRSHGTEVVAWVKRIHDLEA----EVDA---------- 168

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
            + + RE V+ + VRCPD T++++M ERI    +  DS GG I CV+R  PVGLG P FD
Sbjct: 169 -SAVTREAVEANIVRCPDATMAERMIERIEAIGQEGDSCGGLIECVVRRPPVGLGMPVFD 227

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND-RLGTKTNNSGGTQGG 300
           KLEA  A A++S+PATKGFEIGSGF GT L G QHND ++  +D RL T +NNSGG QGG
Sbjct: 228 KLEADLAKAVMSLPATKGFEIGSGFAGTLLKGSQHNDAFLPSDDGRLRTASNNSGGIQGG 287

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGE I  RVAFKP ATI +EQ+T    G    LAA+GRHDPCV+PRAVP+VE+M  LV
Sbjct: 288 ISNGEPIVIRVAFKPTATIRKEQQTINDRGEATTLAAKGRHDPCVLPRAVPMVEAMVNLV 347

Query: 361 IMDALMIQQSR 371
           + D L+ QQ +
Sbjct: 348 LADHLLRQQGQ 358



>gi|168009830|ref|XP_001757608.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162691302|gb|EDQ77665.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 466

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 210/382 (54%), Positives = 270/382 (70%), Gaps = 16/382 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           +T+GT+FRVTTFGESHG  VGCI+DGCPP L L E D+QI LDRRRPGQS +TTPR E D
Sbjct: 74  NTYGTVFRVTTFGESHGGGVGCIIDGCPPRLPLSEEDMQIDLDRRRPGQSRITTPRSETD 133

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SG  +G+TLGTPI + VPN DQR  DYSE  +  RPSHAD TY  KY ++A  GG
Sbjct: 134 TCKILSGVGNGLTLGTPIAVTVPNTDQRGGDYSEISVAYRPSHADATYDFKYGVRAIQGG 193

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGA+A+K LK+  G E++A+VS V  + +P      E L   D   L
Sbjct: 194 GRSSARETIGRVAAGAVAKKLLKMKAGTEVLAYVSRVHGVEVP------EGLIDHDSLTL 247

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
                 E+++ + VRCP++  + KM + I   +   DSVGG +TC+ RNVP GLG P FD
Sbjct: 248 ------EQIENNIVRCPNEEHAQKMIDAIDAVRVKGDSVGGVVTCIARNVPKGLGSPVFD 301

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDP-WVLKNDRLGTKTNNSGGTQGG 300
           KLEA+ A A++S+PATKGFEIGSGF G+   G +HND  +V +++ + T+TN SGG QGG
Sbjct: 302 KLEAELAKAVMSLPATKGFEIGSGFAGSLQRGSEHNDEFYVDEHNNVRTRTNRSGGVQGG 361

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGE I  R+AFKP +TI+Q+Q+T T +  +  L ARGRHDPCVVPRAVP+VE+M ALV
Sbjct: 362 ISNGEMIVLRIAFKPTSTITQKQKTVTRDKQETELRARGRHDPCVVPRAVPMVEAMVALV 421

Query: 361 IMDALMIQQSRKTVASLLPPNP 382
           + DAL+   ++     +LP +P
Sbjct: 422 LADALLQHYAQ---CQILPMDP 440



>gi|224100795|ref|XP_002312018.1| chorismate synthase [Populus trichocarpa]
 gi|222851838|gb|EEE89385.1| chorismate synthase [Populus trichocarpa]
          Length = 438

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 212/395 (53%), Positives = 269/395 (68%), Gaps = 18/395 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           STFG  FRVTTFGESHG  VGCI+DGCPP + L E+D+Q  LDRRRPGQS +TTPR E D
Sbjct: 54  STFGNNFRVTTFGESHGGGVGCIIDGCPPRIPLSESDMQFDLDRRRPGQSRITTPRKETD 113

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SG   G T GTPI + VPN DQR  DY+E  +  RPSHAD TY  KY +++  GG
Sbjct: 114 TCKISSGVSEGQTTGTPIHVFVPNTDQRGFDYNEMSVAYRPSHADATYDMKYGVRSVQGG 173

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGA+A+K LKL  G EI+A+VS V  + +P      E +   D   L
Sbjct: 174 GRSSARETIGRVAAGAVAKKILKLYAGTEILAYVSQVHKVVLP------EGVVNHDSLSL 227

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
                 ++++ + VRCPD   ++KM   I   +   DSVGG +TC++RN P GLG P FD
Sbjct: 228 ------DQIESNIVRCPDPEYAEKMIAAIDAVRVKGDSVGGVVTCIVRNAPRGLGSPVFD 281

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQGG 300
           KLEA+ A A +S+PATKGFE GSGF GT L G +HND +   ++ R+ T+TN SGG QGG
Sbjct: 282 KLEAELAKAAMSLPATKGFEFGSGFSGTFLSGSEHNDEFYTDEHGRIRTRTNRSGGIQGG 341

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGE I  R+AFKP +TI ++Q T T +  +  L ARGRHDPCVVPRAVP+VE+M ALV
Sbjct: 342 ISNGEIINLRIAFKPTSTIGRKQHTVTRDKKEIELIARGRHDPCVVPRAVPMVEAMVALV 401

Query: 361 IMDALMIQQSRKTVASLLPPNPNIPAAMSGVIPKL 395
           +MD LM Q S+   + L P NP++   ++  +P+L
Sbjct: 402 LMDQLMAQFSQ---SYLFPINPDLQEPLT--MPRL 431



>gi|488897315|ref|WP_002808417.1| chorismate synthase [Prochlorococcus marinus]
 gi|221538663|gb|EEE41116.1| chorismate synthase [Prochlorococcus marinus str. MIT 9202]
          Length = 365

 Score =  416 bits (1068), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 205/372 (55%), Positives = 267/372 (71%), Gaps = 17/372 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           S+FG +FRV+TFGESHG +VG I+DGCPP L +    IQ +LDRRRPGQS++TTPR+E+D
Sbjct: 3   SSFGKIFRVSTFGESHGGAVGVILDGCPPKLKVDINLIQNELDRRRPGQSDITTPRNEED 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
           K+ I SG + G+TLGTPI +LV N+DQRP DY   D   RPSHAD TY  KY I+ASSGG
Sbjct: 63  KIEILSGIKEGLTLGTPIAMLVRNKDQRPRDYDNLDQVFRPSHADGTYHLKYGIQASSGG 122

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GRASARETIGRVAAGA+A++ LK     EI+++V  + +I      E+            
Sbjct: 123 GRASARETIGRVAAGAVAKQLLKNFCNTEILSWVKRIHDIDSEINKEK------------ 170

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
              I   ++D + VRCPD+ VS +M ERI + K   DS GG I C+++NVP GLG P FD
Sbjct: 171 ---ISLNKIDSNIVRCPDEQVSAEMIERIKQLKRQGDSCGGVIECLVKNVPSGLGMPVFD 227

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSGGTQG 299
           KLEA  A A++S+PATKGFEIGSGF GT L G +HNDP++  +D  +L T +NNSGG QG
Sbjct: 228 KLEADLAKALMSLPATKGFEIGSGFSGTYLKGSEHNDPFIKSDDIRKLRTISNNSGGIQG 287

Query: 300 GITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAAL 359
           GI+NGENI  ++AFKP ATI +EQ+T    G + ++ A+GRHDPCV+PRAVP+V++M AL
Sbjct: 288 GISNGENIEMKIAFKPTATIGKEQKTVNAEGKEVLMKAKGRHDPCVLPRAVPMVDAMVAL 347

Query: 360 VIMDALMIQQSR 371
           V+ D L++ Q++
Sbjct: 348 VLADHLLLNQAQ 359



>gi|182413441|ref|YP_001818507.1| chorismate synthase [Opitutus terrae PB90-1]
 gi|501342809|ref|WP_012374444.1| chorismate synthase [Opitutus terrae]
 gi|238692913|sp|B1ZUM3.1|AROC_OPITP RecName: Full=Chorismate synthase; AltName:
           Full=5-enolpyruvylshikimate-3-phosphate phospholyase
 gi|177840655|gb|ACB74907.1| Chorismate synthase [Opitutus terrae PB90-1]
          Length = 363

 Score =  415 bits (1067), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 209/370 (56%), Positives = 258/370 (69%), Gaps = 15/370 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           ++FG LF VTT+GESHG SVG +VDGCPP L L   +IQ +LDRRRPGQS++ TPR E+D
Sbjct: 3   NSFGKLFTVTTWGESHGASVGVVVDGCPPNLPLSVEEIQTELDRRRPGQSDIVTPRKEED 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
           +V I SG   G T GTP+ ++V N DQRP  Y+E     RPSHAD+TY  K+ I+   GG
Sbjct: 63  RVEILSGLFEGKTTGTPLTMMVRNADQRPEAYAEMREKFRPSHADYTYQAKFGIRDHRGG 122

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGAIA+K L+L  G+EI AFV+ + +I +P +       FP      
Sbjct: 123 GRSSARETIGRVAAGAIAQKILRLAGGIEIRAFVTQIQDICVPALTA-----FPS----- 172

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
                REEV+   +RCP    +  M ERI   +   DSVGG I C +R VP GLGEP FD
Sbjct: 173 -----REEVEATPIRCPHAATAAAMIERIKAVRSQGDSVGGVIECRVRGVPAGLGEPVFD 227

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKNDRLGTKTNNSGGTQGGI 301
           +LEA    AMLS+PATKGFEIGSGF GT L G +HNDP+V+++ R+ T TN+SGG QGGI
Sbjct: 228 RLEADLGKAMLSLPATKGFEIGSGFAGTRLKGSEHNDPFVMRDGRVTTTTNHSGGVQGGI 287

Query: 302 TNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALVI 361
           +NG  I FRVAFKP ATI Q Q+T   +G D  LAARGRHDPCV+PRAVPIVE+M ALV+
Sbjct: 288 SNGAEIVFRVAFKPTATILQPQQTVDVHGADTELAARGRHDPCVLPRAVPIVEAMTALVL 347

Query: 362 MDALMIQQSR 371
           +D  M Q ++
Sbjct: 348 VDHWMRQSAQ 357



>gi|126695584|ref|YP_001090470.1| chorismate synthase [Prochlorococcus marinus str. MIT 9301]
 gi|500188910|ref|WP_011862267.1| chorismate synthase [Prochlorococcus marinus]
 gi|166218047|sp|A3PAU4.1|AROC_PROM0 RecName: Full=Chorismate synthase; AltName:
           Full=5-enolpyruvylshikimate-3-phosphate phospholyase
 gi|126542627|gb|ABO16869.1| Chorismate synthase [Prochlorococcus marinus str. MIT 9301]
          Length = 365

 Score =  414 bits (1065), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 204/372 (54%), Positives = 267/372 (71%), Gaps = 17/372 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           S+FG +FRV+TFGESHG +VG I+DGCPP L +    IQ +LDRRRPGQS++TTPR+E+D
Sbjct: 3   SSFGKIFRVSTFGESHGGAVGVILDGCPPKLKIDINLIQNELDRRRPGQSDITTPRNEED 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
           K+ I SG + G+TLGTPI +LV N+DQRP DY+  +   RPSHAD TY  KY I+ASSGG
Sbjct: 63  KIEILSGIKEGLTLGTPIAMLVRNKDQRPADYNNMEQVFRPSHADGTYHLKYGIQASSGG 122

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GRASARETIGRVAAGA+A++ LK     EI+++V  + +I      E+            
Sbjct: 123 GRASARETIGRVAAGAVAKQLLKTFCNTEILSWVKRIHDIDSDINKEK------------ 170

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
              I  +++D + VRCPD+ VS +M ERI E K   DS GG I C++RNVP GLG P FD
Sbjct: 171 ---ISLKKIDSNIVRCPDEKVSTEMIERIKELKRQGDSCGGVIECLVRNVPSGLGMPVFD 227

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSGGTQG 299
           KLEA  A A++S+PATKGFEIGSGF GT L G +HND ++  +D  +L T +NNSGG QG
Sbjct: 228 KLEADLAKALMSLPATKGFEIGSGFSGTYLKGSEHNDSFIKSDDSSKLRTTSNNSGGIQG 287

Query: 300 GITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAAL 359
           GI+NGENI  ++AFKP ATI +EQ+T    G + ++ A+GRHDPCV+PRAVP+V++M AL
Sbjct: 288 GISNGENIEMKIAFKPTATIGKEQKTVNAEGKEVLMKAKGRHDPCVLPRAVPMVDAMVAL 347

Query: 360 VIMDALMIQQSR 371
           V+ D L++  ++
Sbjct: 348 VLADHLLLNHAQ 359



>gi|302789944|ref|XP_002976740.1| hypothetical protein SELMODRAFT_105551 [Selaginella moellendorffii]
 gi|300155778|gb|EFJ22409.1| hypothetical protein SELMODRAFT_105551 [Selaginella moellendorffii]
          Length = 389

 Score =  414 bits (1063), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 214/384 (55%), Positives = 266/384 (69%), Gaps = 20/384 (5%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           +TFG LFRVTTFGESHG  VGC++DGCPP L+L E D+Q  LDRRRPGQS +TTPR E D
Sbjct: 2   NTFGNLFRVTTFGESHGGGVGCVIDGCPPRLNLTEEDMQEDLDRRRPGQSRITTPRKETD 61

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SG   G+TLGTPI +LVPN DQR  DYSE  L  RPSHAD TY  KY I+A  GG
Sbjct: 62  TCKILSGVAQGMTLGTPIAVLVPNTDQRGGDYSEMALAYRPSHADATYDFKYGIRAVQGG 121

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGAIA+K LK   G E++A+VS V  + +P      E     D   L
Sbjct: 122 GRSSARETIGRVAAGAIAKKLLKQQCGTEVLAYVSRVHQVELP------EGAIDHDNLTL 175

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
                 E+V+ + VRCPD+ +++KM   I   +   DSVGG +TC+ RNVP GLG P FD
Sbjct: 176 ------EQVESNIVRCPDQDMAEKMIAAIDAVRVRGDSVGGVVTCIARNVPRGLGTPVFD 229

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKNDRLG---TKTNNSGGTQ 298
           KLEA+ A A++S+PATKGFEIGSGF+GT + G +HND + +  D +G   T+TN SGG Q
Sbjct: 230 KLEAELAKALMSLPATKGFEIGSGFEGTKMTGSEHNDEFYI--DEIGNVRTRTNRSGGIQ 287

Query: 299 GGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAA 358
           GGI+NGE I  R+AFKP +TI++ Q+T T +  +  L ARGRHDPCVVPRAVP+VE+M A
Sbjct: 288 GGISNGETIVMRIAFKPTSTITKFQKTVTRDRQETELRARGRHDPCVVPRAVPMVEAMVA 347

Query: 359 LVIMDALMIQQSRKTVASLLPPNP 382
           LV+ D L+   ++      LP +P
Sbjct: 348 LVLADQLLQNYAQ---CQFLPLDP 368



>gi|157412583|ref|YP_001483449.1| chorismate synthase [Prochlorococcus marinus str. MIT 9215]
 gi|500851068|ref|WP_012007027.1| chorismate synthase [Prochlorococcus marinus]
 gi|166988262|sp|A8G2N2.1|AROC_PROM2 RecName: Full=Chorismate synthase; AltName:
           Full=5-enolpyruvylshikimate-3-phosphate phospholyase
 gi|157387158|gb|ABV49863.1| Chorismate synthase [Prochlorococcus marinus str. MIT 9215]
          Length = 365

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 203/372 (54%), Positives = 267/372 (71%), Gaps = 17/372 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           S+FG +FRV+TFGESHG +VG I+DGCPP L +    IQ +LDRRRPGQS++TTPR+E+D
Sbjct: 3   SSFGKIFRVSTFGESHGGAVGVILDGCPPKLKVDINMIQNELDRRRPGQSDITTPRNEED 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
           K+ I SG + G+TLGTPI +LV N+DQRP DY   D   RPSHAD TY  KY I+ASSGG
Sbjct: 63  KIEILSGIKEGLTLGTPIAMLVRNKDQRPRDYDNLDQVFRPSHADGTYHLKYGIQASSGG 122

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GRASARETIGRVAAGA+A++ LK     EI+++V  + +I      E+            
Sbjct: 123 GRASARETIGRVAAGAVAKQLLKNFCNTEILSWVKRIHDIDSDINKEK------------ 170

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
              I   ++D + VRCPD+ +S +M ERI + K   DS GG I C+++NVP GLG P FD
Sbjct: 171 ---ISLNKIDSNIVRCPDEKISAEMIERIKQLKRQGDSCGGVIECLVKNVPSGLGMPVFD 227

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSGGTQG 299
           KLEA  A A++S+PATKGFEIGSGF GT L G +HND ++  +D  +L T +NNSGG QG
Sbjct: 228 KLEADLAKALMSLPATKGFEIGSGFSGTYLKGSEHNDAFIKSDDIRKLRTISNNSGGIQG 287

Query: 300 GITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAAL 359
           GI+NGENI  ++AFKP ATI +EQ+T    G + ++ A+GRHDPCV+PRAVP+V++M AL
Sbjct: 288 GISNGENIEMKIAFKPTATIGKEQKTVNAEGKEVLMRAKGRHDPCVLPRAVPMVDAMVAL 347

Query: 360 VIMDALMIQQSR 371
           V++D L++ Q++
Sbjct: 348 VLVDHLLLNQAQ 359



>gi|123967782|ref|YP_001008640.1| chorismate synthase [Prochlorococcus marinus str. AS9601]
 gi|500141714|ref|WP_011817717.1| chorismate synthase [Prochlorococcus marinus]
 gi|166218051|sp|A2BP22.1|AROC_PROMS RecName: Full=Chorismate synthase; AltName:
           Full=5-enolpyruvylshikimate-3-phosphate phospholyase
 gi|123197892|gb|ABM69533.1| Chorismate synthase [Prochlorococcus marinus str. AS9601]
          Length = 365

 Score =  412 bits (1060), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 204/372 (54%), Positives = 265/372 (71%), Gaps = 17/372 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           S+FG +FRV+TFGESHG +VG I+DGCPP L +    IQ +LDRRRPGQS++TTPR+E+D
Sbjct: 3   SSFGKIFRVSTFGESHGGAVGVILDGCPPKLKVDINLIQNELDRRRPGQSDITTPRNEED 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
           K+ I SG + G TLGTPI +LV N+DQRP DY   +   RPSHAD TY  KY I+ASSGG
Sbjct: 63  KIEILSGIKEGFTLGTPIAMLVRNKDQRPGDYDNLEQVFRPSHADGTYHLKYGIQASSGG 122

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GRASARETIGRVAAGA+A++ LK     EI+++V  + +I      E+            
Sbjct: 123 GRASARETIGRVAAGAVAKQLLKTFCNTEILSWVKRIHDIESDINKEK------------ 170

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
              I  +++D + VRCPD+ VS +M ERI E K   DS GG I C++RNVP GLG P FD
Sbjct: 171 ---ISLKQIDSNIVRCPDEKVSTEMIERIKELKRQGDSCGGVIECLVRNVPSGLGMPVFD 227

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSGGTQG 299
           KLEA  A A++S+PATKGFEIGSGF GT L G +HND ++  +D  +L T +NNSGG QG
Sbjct: 228 KLEADLAKALMSLPATKGFEIGSGFSGTYLKGSEHNDAFIKSDDISKLRTTSNNSGGIQG 287

Query: 300 GITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAAL 359
           GI+NGENI  ++AFKP ATI +EQ+T    G + ++ A+GRHDPCV+PRAVP+V++M AL
Sbjct: 288 GISNGENIEMKIAFKPTATIGKEQKTVNAEGKEVLMKAKGRHDPCVLPRAVPMVDAMVAL 347

Query: 360 VIMDALMIQQSR 371
           V+ D L++  ++
Sbjct: 348 VLADHLLLNHAQ 359



>gi|508726731|gb|EOY18628.1| Chorismate synthase / 5-enolpyruvylshikimate-3-phosphate
           phospholyas, putative isoform 1 [Theobroma cacao]
          Length = 448

 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 209/395 (52%), Positives = 265/395 (67%), Gaps = 16/395 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           STFG  FRVTTFGESHG  VGCIVDGCPP + L EAD+Q  LDRRRPGQS +TTPR E D
Sbjct: 64  STFGNYFRVTTFGESHGGGVGCIVDGCPPRIPLSEADLQFDLDRRRPGQSRITTPRKETD 123

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SG   G+T GTPI + VPN DQR HDY+E  +  RPSHAD TY  KY ++A  GG
Sbjct: 124 TCRIYSGVSEGVTTGTPIHVFVPNTDQRGHDYNEMSIAYRPSHADATYDMKYGVRAVKGG 183

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVA GAIA+K L+   G E++A+VS V  + +P            D    
Sbjct: 184 GRSSARETIGRVAPGAIAKKILQQFSGTEVLAYVSQVHQVVLP------------DGSVD 231

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
            +T+  ++V+ + VRCP+   ++KM   I   +   DS+GG +TC++RN P GLG P FD
Sbjct: 232 HDTLTLDQVESNIVRCPNPEYAEKMIAAIDAVRTRGDSIGGVVTCIVRNAPRGLGSPVFD 291

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQGG 300
           KLEA+ A A++S+PATKGFE GSGF GT L G +HND +   ++ ++ T+TN SGG QGG
Sbjct: 292 KLEAELAKAVMSLPATKGFEFGSGFAGTFLTGSEHNDEFFTDEHGKIRTRTNRSGGIQGG 351

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGE +  RVAFKP ATI ++Q T T    +  L ARGRHDPCVVPRAVP+VE+M ALV
Sbjct: 352 ISNGEIMNMRVAFKPTATIGKKQNTVTREKKEIELIARGRHDPCVVPRAVPMVEAMVALV 411

Query: 361 IMDALMIQQSRKTVASLLPPNPNIPAAMSGVIPKL 395
           ++D LM Q ++    +L P NP +   +S   P  
Sbjct: 412 LVDQLMAQYAQ---CNLFPINPELQEPLSLNFPNF 443



>gi|502118474|ref|XP_004496285.1| PREDICTED: chorismate synthase, chloroplastic-like isoform X1
           [Cicer arietinum]
          Length = 435

 Score =  412 bits (1059), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 208/389 (53%), Positives = 269/389 (69%), Gaps = 16/389 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           S++G  FRVTT+GESHG  VGC++DGCPP + L EAD+Q  LDRRRPGQS +TTPR E D
Sbjct: 52  SSYGNHFRVTTYGESHGGGVGCVIDGCPPRIPLSEADMQEDLDRRRPGQSRITTPRKETD 111

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SG   G+T GTPI + VPN DQR +DYSE  L  RPSHAD TY  KY +++  GG
Sbjct: 112 TCKIFSGVSEGLTTGTPIHVFVPNTDQRGNDYSEMSLAYRPSHADATYDMKYGVRSVQGG 171

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVA+GA+A+K LK   G EI+A+VS V  I           + PED  + 
Sbjct: 172 GRSSARETIGRVASGAVAKKILKNFSGTEILAYVSQVHKI-----------ILPEDLID- 219

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
            +T+  ++++ + VRCPD   ++KM   I   +   DSVGG +TC++RN P GLG P FD
Sbjct: 220 NDTLTLDQIESNIVRCPDPEYAEKMISAIDAVRVKGDSVGGVVTCIVRNCPRGLGSPVFD 279

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQGG 300
           KLEA+ A A +S+PATKGF+ GSGF GT L G +HND + L +N  + T+TN SGG QGG
Sbjct: 280 KLEAELAKAAMSLPATKGFQFGSGFAGTFLTGSEHNDEFYLDQNGNMRTRTNRSGGIQGG 339

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGE I  RVAFKP +TI+++Q T T +  +  L ARGRHDPCVVPRAVP+VE+M ALV
Sbjct: 340 ISNGEIINMRVAFKPTSTIARKQLTVTRDKKETELIARGRHDPCVVPRAVPMVEAMVALV 399

Query: 361 IMDALMIQQSRKTVASLLPPNPNIPAAMS 389
           ++D LM Q ++    +L P N ++  +MS
Sbjct: 400 LVDQLMAQYAQ---CNLFPVNFDLQESMS 425



>gi|148238694|ref|YP_001224081.1| chorismate synthase [Synechococcus sp. WH 7803]
 gi|500457779|ref|WP_011932283.1| chorismate synthase [Synechococcus sp. WH 7803]
 gi|166218131|sp|A5GIL9.1|AROC_SYNPW RecName: Full=Chorismate synthase; AltName:
           Full=5-enolpyruvylshikimate-3-phosphate phospholyase
 gi|147847233|emb|CAK22784.1| Chorismate synthase [Synechococcus sp. WH 7803]
          Length = 362

 Score =  411 bits (1057), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 209/371 (56%), Positives = 259/371 (69%), Gaps = 16/371 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           S+FGTLFR++TFGESHG  VG I++GCPP L L    IQ +LDRRRPGQS +TTPR E D
Sbjct: 3   SSFGTLFRISTFGESHGGGVGVILEGCPPRLELDPLAIQAELDRRRPGQSKITTPRKEAD 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
           +V I SG   G+TLGTPI ++V N+DQRP DY E ++  RPSHAD TY  KY I+A SGG
Sbjct: 63  QVEILSGVMDGLTLGTPIAMVVRNKDQRPQDYKEVEVAFRPSHADATYQAKYGIQARSGG 122

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GRASARETIGRVAAGAIA + L+  HG ++VA+V  + ++                    
Sbjct: 123 GRASARETIGRVAAGAIARQMLQRSHGTDVVAWVKRIHDLEAQVDA-------------- 168

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
            +T+ RE VD + VRCPD  ++D+M +RI    +  DS GG I CV+R  PVGLG P FD
Sbjct: 169 -STVTREAVDANIVRCPDAEMADRMIDRIEAIGQDGDSCGGVIECVVRRPPVGLGMPVFD 227

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND-RLGTKTNNSGGTQGG 300
           KLEA  A A++S+PATKGFEIGSGF GT L G +HND ++  +D RL T +NNSGG QGG
Sbjct: 228 KLEADLAKAVMSLPATKGFEIGSGFAGTLLRGSEHNDAFLPSDDGRLRTASNNSGGIQGG 287

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGE I  RVAFKP ATI +EQ+T    G    LAA+GRHDPCV+PRAVP+VE+M  LV
Sbjct: 288 ISNGEPIVIRVAFKPTATIRKEQQTINDRGEATTLAAKGRHDPCVLPRAVPMVEAMVNLV 347

Query: 361 IMDALMIQQSR 371
           + D L+ QQ +
Sbjct: 348 LADHLLRQQGQ 358



>gi|497643721|ref|WP_009957905.1| chorismate synthase [Verrucomicrobium spinosum]
          Length = 361

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 205/371 (55%), Positives = 261/371 (70%), Gaps = 16/371 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           S+FGTLFRV+T+GESHG +VGCIVDGCPP ++L E +IQ++LDRRRPGQS + T R E D
Sbjct: 3   SSFGTLFRVSTYGESHGLAVGCIVDGCPPQVALTETEIQVELDRRRPGQSKIVTQRKEGD 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
           +  I SG  +G TLGTPI ++VPN+DQR   Y E +   RPSHAD+TY  KY ++A +GG
Sbjct: 63  RCQILSGVLNGQTLGTPISIMVPNEDQRSDAYKEMETAYRPSHADFTYDAKYGVRAVAGG 122

Query: 122 GRASARETIGRVAAGAIAEKYLKL-VHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWE 180
           GR+SARETIGRVAAG IA K ++    G E +A+V +V +I      EQ           
Sbjct: 123 GRSSARETIGRVAAGVIARKVVEASCAGYECLAYVKTVRDIEAHPTPEQ----------- 171

Query: 181 LLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCF 240
               I RE ++ + VR  D   ++KM E I E ++  +SVGG + CV+R VP GLGEP F
Sbjct: 172 ----ITRESIESNIVRTADPVAAEKMVELIDEIRKQGNSVGGVVECVVRGVPTGLGEPVF 227

Query: 241 DKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKNDRLGTKTNNSGGTQGG 300
           DKLEA  A AMLS+PATKGFEIGSGF GT L G +HND + ++ +R+ T+TN SGG QGG
Sbjct: 228 DKLEADLAKAMLSLPATKGFEIGSGFAGTLLTGMEHNDEFYMEGERVRTRTNRSGGIQGG 287

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGE I FRVAFKP AT+ +EQ T T +G    L ARGRHDPCV+PRAVPIVE+M  LV
Sbjct: 288 ISNGEEIIFRVAFKPTATLLREQNTVTKDGEAATLKARGRHDPCVLPRAVPIVEAMVHLV 347

Query: 361 IMDALMIQQSR 371
           + D L+ Q+++
Sbjct: 348 LCDHLLRQRAQ 358



>gi|297852508|ref|XP_002894135.1| EMB1144 [Arabidopsis lyrata subsp. lyrata]
 gi|297339977|gb|EFH70394.1| EMB1144 [Arabidopsis lyrata subsp. lyrata]
          Length = 435

 Score =  410 bits (1055), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 207/384 (53%), Positives = 263/384 (68%), Gaps = 16/384 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           S++GT FRV+TFGESHG  VGCI+DGCPP + L E+D+Q  LDRRRPGQS +TTPR E D
Sbjct: 52  SSYGTHFRVSTFGESHGGGVGCIIDGCPPRIPLTESDLQFDLDRRRPGQSRITTPRKETD 111

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SG   G+T GTPI + VPN DQR  DYSE  +  RPSHAD TY  KY +++  GG
Sbjct: 112 TCRISSGVSEGMTTGTPIHVFVPNTDQRGLDYSEMSVAYRPSHADATYDMKYGVRSVQGG 171

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVA GA+A+K LK   G EI+A+VS V ++ +P      E L   D   L
Sbjct: 172 GRSSARETIGRVAPGALAKKILKQFAGTEILAYVSQVHHVVLP------EDLVDHDNLTL 225

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
                 E+++ + VRCP+   ++KM   I   +   +SVGG +TC++RN P GLG P FD
Sbjct: 226 ------EQIENNIVRCPNPEYAEKMIAAIDAVRTKGNSVGGVVTCIVRNAPRGLGTPVFD 279

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQGG 300
           KLEA+ A A +S+PATKGFE GSGF GT L G +HND +   +N R+ T+TN SGG QGG
Sbjct: 280 KLEAELAKACMSLPATKGFEFGSGFAGTFLTGLEHNDEFYTDENGRIRTRTNRSGGIQGG 339

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGE I  RVAFKP +TI ++Q T T + V+  + ARGRHDPCVVPRAVP+VE+M ALV
Sbjct: 340 ISNGEIINMRVAFKPTSTIGRKQNTVTRDKVETEMIARGRHDPCVVPRAVPMVEAMVALV 399

Query: 361 IMDALMIQQSRKTVASLLPPNPNI 384
           ++D LM Q ++     L P NP +
Sbjct: 400 LVDQLMAQYAQ---CHLFPINPEL 420



>gi|33860783|ref|NP_892344.1| chorismate synthase [Prochlorococcus marinus subsp. pastoris str.
           CCMP1986]
 gi|499444399|ref|WP_011131863.1| chorismate synthase [Prochlorococcus marinus]
 gi|67460362|sp|Q7V364.1|AROC_PROMP RecName: Full=Chorismate synthase; AltName:
           Full=5-enolpyruvylshikimate-3-phosphate phospholyase
 gi|33633725|emb|CAE18683.1| Chorismate synthase [Prochlorococcus marinus subsp. pastoris str.
           CCMP1986]
          Length = 364

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 205/375 (54%), Positives = 267/375 (71%), Gaps = 17/375 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           S+FG  FRVTTFGESHG +VG I+DGCPP L +    IQ +LDRRRPGQS +TTPR+E D
Sbjct: 3   SSFGKNFRVTTFGESHGGAVGVILDGCPPKLKINIDLIQNELDRRRPGQSKITTPRNEDD 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
           K+ I SG + GITLGTPI ++V N+DQRP DYS  +   RPSHAD TY  KY I+A SGG
Sbjct: 63  KLEILSGLKEGITLGTPIAMMVRNKDQRPGDYSNLEQVFRPSHADGTYHLKYGIQAGSGG 122

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GRASARETIGRVAAGAIA++ LK +   EI+++V  + +I               D    
Sbjct: 123 GRASARETIGRVAAGAIAKQLLKNLFNTEILSWVKRIHDI---------------DSQVN 167

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
            N +   ++D + VRCPD  V+ KM +RI E ++  DS GG I C+++NVP GLG P FD
Sbjct: 168 KNKLTLSKIDSNIVRCPDDKVAAKMIKRIKELQQDGDSCGGVIECLVKNVPSGLGMPVFD 227

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSGGTQG 299
           KLEA  A A++S+PATKGFEIGSGF GT L G +HND ++  +D  +L T +NNSGG QG
Sbjct: 228 KLEADLAKALMSLPATKGFEIGSGFLGTYLRGSEHNDSFIESDDISKLKTISNNSGGIQG 287

Query: 300 GITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAAL 359
           GI+NGENI  ++AFKP ATI +EQ+T   +G + ++ A+GRHDPCV+PRAVP+V+SM AL
Sbjct: 288 GISNGENIEMKIAFKPTATIGKEQKTVNADGKEVLMKAKGRHDPCVLPRAVPMVDSMVAL 347

Query: 360 VIMDALMIQQSRKTV 374
           V+ D L++ Q++ ++
Sbjct: 348 VLADHLLLHQAQCSI 362



>gi|18402389|ref|NP_564534.1| putative chorismate synthase / 5-enolpyruvylshikimate-3-phosphate
           phospholyase [Arabidopsis thaliana]
 gi|83300489|sp|P57720.2|AROC_ARATH RecName: Full=Chorismate synthase, chloroplastic; AltName:
           Full=5-enolpyruvylshikimate-3-phosphate phospholyase;
           AltName: Full=Protein EMBRYO DEFECTIVE 1144; Flags:
           Precursor
 gi|15982824|gb|AAL09759.1| At1g48850/T24P22_3 [Arabidopsis thaliana]
 gi|53749180|gb|AAU90075.1| At1g48850 [Arabidopsis thaliana]
 gi|110742465|dbj|BAE99151.1| hypothetical protein [Arabidopsis thaliana]
 gi|332194235|gb|AEE32356.1| chorismate synthase [Arabidopsis thaliana]
          Length = 436

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 206/384 (53%), Positives = 263/384 (68%), Gaps = 16/384 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           S++GT FRV+TFGESHG  VGCI+DGCPP + L E+D+Q  LDRRRPGQS +TTPR E D
Sbjct: 53  SSYGTHFRVSTFGESHGGGVGCIIDGCPPRIPLTESDLQFDLDRRRPGQSRITTPRKETD 112

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SG   G+T GTPI + VPN DQR  DYSE  +  RPSHAD TY  KY +++  GG
Sbjct: 113 TCRISSGVSEGMTTGTPIHVFVPNTDQRGLDYSEMSVAYRPSHADATYDMKYGVRSVQGG 172

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVA GA+A+K LK   G EI+A+VS V ++ +P      E L   +   L
Sbjct: 173 GRSSARETIGRVAPGALAKKILKQFAGTEILAYVSQVHHVVLP------EELVDHENLTL 226

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
                 E+++ + VRCP+   ++KM   I   +   +SVGG +TC++RN P GLG P FD
Sbjct: 227 ------EQIENNIVRCPNPEYAEKMIAAIDAVRTKGNSVGGVVTCIVRNAPRGLGTPVFD 280

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQGG 300
           KLEA+ A A +S+PATKGFE GSGF GT L G +HND +   +N R+ T+TN SGG QGG
Sbjct: 281 KLEAELAKACMSLPATKGFEFGSGFAGTFLTGLEHNDEFYTDENGRIRTRTNRSGGIQGG 340

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGE I  RVAFKP +TI ++Q T T + V+  + ARGRHDPCVVPRAVP+VE+M ALV
Sbjct: 341 ISNGEIINMRVAFKPTSTIGRKQNTVTRDKVETEMIARGRHDPCVVPRAVPMVEAMVALV 400

Query: 361 IMDALMIQQSRKTVASLLPPNPNI 384
           ++D LM Q ++     L P NP +
Sbjct: 401 LVDQLMAQYAQ---CHLFPINPEL 421



>gi|482576271|gb|EOA40458.1| hypothetical protein CARUB_v10009182mg [Capsella rubella]
          Length = 435

 Score =  410 bits (1053), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 206/384 (53%), Positives = 262/384 (68%), Gaps = 16/384 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           S++GT FRV+TFGESHG  VGCI+DGCPP + L E+D+Q  LDRRRPGQS +TTPR E D
Sbjct: 52  SSYGTHFRVSTFGESHGGGVGCIIDGCPPRIPLTESDLQFDLDRRRPGQSRITTPRKETD 111

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SG   G+T GTPI + VPN DQR  DYSE  +  RPSHAD TY  KY +++  GG
Sbjct: 112 TCRISSGVSEGMTTGTPIHVFVPNTDQRGLDYSEMSVAYRPSHADATYDMKYGVRSVQGG 171

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVA GA+A+K LK   G EI+A+VS V  +           + PED  + 
Sbjct: 172 GRSSARETIGRVAPGALAKKILKQFAGTEILAYVSQVHQV-----------VLPEDLVDH 220

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
            N +  E+++ + VRCP+   ++KM   I   +   +SVGG +TC++RN P GLG P FD
Sbjct: 221 EN-LTLEQIENNIVRCPNPEYAEKMIAAIDAVRTKGNSVGGVVTCIVRNAPRGLGTPVFD 279

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLK-NDRLGTKTNNSGGTQGG 300
           KLEA+ A A +S+PATKGFE GSGF GT L G +HND +    N R+ T+TN SGG QGG
Sbjct: 280 KLEAELAKACMSLPATKGFEFGSGFAGTFLTGLEHNDEFYTDGNGRIRTRTNRSGGIQGG 339

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGE I  RVAFKP +TI ++Q T T + V+  + ARGRHDPCVVPRAVP+VE+M ALV
Sbjct: 340 ISNGEIINMRVAFKPTSTIGRKQNTVTRDKVETEMIARGRHDPCVVPRAVPMVEAMVALV 399

Query: 361 IMDALMIQQSRKTVASLLPPNPNI 384
           ++D LM Q ++     L P NP +
Sbjct: 400 LVDQLMAQYAQ---CHLFPINPEL 420



>gi|356576217|ref|XP_003556230.1| PREDICTED: chorismate synthase, chloroplastic-like [Glycine max]
          Length = 435

 Score =  408 bits (1049), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 205/384 (53%), Positives = 265/384 (69%), Gaps = 16/384 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           ST+G  FRVTT+GESHG  VGC++DGCPP L L EAD+Q+ LDRRRPGQS +TTPR E D
Sbjct: 52  STYGNHFRVTTYGESHGGGVGCVIDGCPPRLPLSEADMQVDLDRRRPGQSRITTPRKETD 111

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SG   GIT GTPI + VPN DQR HDYSE  +  RPSHAD TY  KY +++  GG
Sbjct: 112 TCKIFSGVSEGITTGTPIHVSVPNTDQRGHDYSEMAVAYRPSHADATYDMKYGVRSVQGG 171

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVA+GA+A+K LK   G EI+A+VS V  I           + PED  + 
Sbjct: 172 GRSSARETIGRVASGAVAKKILKEFSGTEILAYVSQVHKI-----------VLPEDLID- 219

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
            +T+  ++++ + VRCPD   ++KM   I   +   DSVGG +TC++RN P GLG P FD
Sbjct: 220 HDTLTLDQIESNIVRCPDPEYAEKMISAIDAVRVRGDSVGGVVTCIVRNCPRGLGSPVFD 279

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQGG 300
           KLEA+ A A +S+PATKGF+ GSGF GT L G +HND + + ++    T+TN SGG QGG
Sbjct: 280 KLEAELAKAAMSLPATKGFQFGSGFAGTFLTGSEHNDEFYIDEHGNTRTRTNRSGGIQGG 339

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGE I  R+AFKP +TI ++Q+T T +  +    ARGRHDPCVVPRAVP+VE+M ALV
Sbjct: 340 ISNGEIINMRIAFKPTSTIGKKQKTVTRDKKETEFIARGRHDPCVVPRAVPMVEAMVALV 399

Query: 361 IMDALMIQQSRKTVASLLPPNPNI 384
           ++D LM Q ++    +L P N ++
Sbjct: 400 LVDQLMAQYAQ---CNLFPVNSDL 420



>gi|462414471|gb|EMJ19208.1| hypothetical protein PRUPE_ppa005795mg [Prunus persica]
          Length = 443

 Score =  407 bits (1047), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 205/384 (53%), Positives = 263/384 (68%), Gaps = 16/384 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           +T+G  FRVTTFGESHG  VGC++DGCPP + L EAD+Q  LDRRRPGQS +TTPR E D
Sbjct: 56  NTYGNFFRVTTFGESHGGGVGCVIDGCPPRMPLSEADLQGDLDRRRPGQSRITTPRKETD 115

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SG   G+T GTPI +LVPN DQR  DY E  +  RPSHAD TY  KY +++  GG
Sbjct: 116 TCRILSGVHEGVTTGTPILVLVPNTDQRGRDYDEMSIAYRPSHADRTYDLKYGVRSVQGG 175

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGA+A+K LK   G E++A+VS V  + +P   E+    +       
Sbjct: 176 GRSSARETIGRVAAGAVAKKILKAFSGTEVLAYVSQVHKVVLP---EESVNHY------- 225

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
             T+  ++V+ + VRCPD   ++KM   I   +   +S+GG +TC++RN P GLG P FD
Sbjct: 226 --TLALDQVESNIVRCPDTEYAEKMIAAIDAVRVKGESIGGVVTCIVRNCPPGLGSPVFD 283

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQGG 300
           KLEA+FA A+LS+PATKGFE GSGF GT L G +HND + L +  ++ TKTN SGGTQGG
Sbjct: 284 KLEAEFAKAVLSLPATKGFEFGSGFAGTFLTGSEHNDEFYLDEQGKIRTKTNRSGGTQGG 343

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGE I  R+AFKP ATIS++Q T T +  +  L ARGRHDPCVVPRAVP+VE+  AL 
Sbjct: 344 ISNGEIINMRIAFKPTATISKKQNTVTRDKHEIELIARGRHDPCVVPRAVPMVEATIALA 403

Query: 361 IMDALMIQQSRKTVASLLPPNPNI 384
           ++D LM   ++     + P NP +
Sbjct: 404 LVDQLMAHYAQ---CHMFPINPEL 424



>gi|78778612|ref|YP_396724.1| chorismate synthase [Prochlorococcus marinus str. MIT 9312]
 gi|499695058|ref|WP_011375792.1| chorismate synthase [Prochlorococcus marinus]
 gi|119366053|sp|Q31CV7.1|AROC_PROM9 RecName: Full=Chorismate synthase; AltName:
           Full=5-enolpyruvylshikimate-3-phosphate phospholyase
 gi|78712111|gb|ABB49288.1| chorismate synthase [Prochlorococcus marinus str. MIT 9312]
          Length = 365

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 201/372 (54%), Positives = 264/372 (70%), Gaps = 17/372 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           S+FG +FRV+TFGESHG  VG I+DGCPP L +    IQ +LDRRRPGQS++TTPR+E D
Sbjct: 3   SSFGKIFRVSTFGESHGGGVGVILDGCPPKLKIDIKLIQNELDRRRPGQSDITTPRNEDD 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
           K+ I SG + G+TLGTPI +LV N+DQRP DY+  +   RPSHAD TY  KY I+A SGG
Sbjct: 63  KIEILSGIKEGLTLGTPIAMLVRNKDQRPGDYNNLEQVFRPSHADGTYHLKYGIQAGSGG 122

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GRASARETIGRVAAGA+A++ LK +   EI+++V  + +I      E+            
Sbjct: 123 GRASARETIGRVAAGAVAKQLLKNLCNTEILSWVKRIHDIDSDVNKEK------------ 170

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
              I   ++D + VRCPD+ VS +M +RI + K   DS GG I C++RNVP GLG P FD
Sbjct: 171 ---ISLNKIDSNIVRCPDEKVSAEMIDRIKDLKRQGDSCGGVIECLVRNVPSGLGMPVFD 227

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND--RLGTKTNNSGGTQG 299
           KLEA  A A++S+PATKGFEIGSGF GT L G +HND ++  +D  +L T +NNSGG QG
Sbjct: 228 KLEADLAKALMSLPATKGFEIGSGFSGTYLKGSEHNDSFIKSDDISKLRTTSNNSGGIQG 287

Query: 300 GITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAAL 359
           GI+NGENI  ++AFKP ATI +EQ+T    G + ++ A+GRHDPCV+PRAVP+V++M AL
Sbjct: 288 GISNGENIEMKIAFKPTATIGKEQKTVNAEGKEVLMKAKGRHDPCVLPRAVPMVDAMVAL 347

Query: 360 VIMDALMIQQSR 371
           V+ D L++  ++
Sbjct: 348 VLADHLLLNNAQ 359



>gi|225449068|ref|XP_002275232.1| PREDICTED: chorismate synthase, chloroplastic [Vitis vinifera]
 gi|296086029|emb|CBI31470.3| unnamed protein product [Vitis vinifera]
          Length = 436

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 208/399 (52%), Positives = 268/399 (67%), Gaps = 16/399 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           ST+GT FRVTT+GESHG  VGCI+DGCPP L L EAD+QI LDRRRPGQS +TTPR E D
Sbjct: 52  STYGTYFRVTTYGESHGGGVGCIIDGCPPRLPLTEADMQIDLDRRRPGQSRITTPRKETD 111

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SG   G+T G+PI + VPN DQR +DY+E     RPSHAD TY  KY +++  GG
Sbjct: 112 TCRIYSGVAEGMTTGSPIMVNVPNTDQRGNDYTEMSKAYRPSHADATYDFKYGVRSVQGG 171

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGA+A+K LK   G E++A+VS V  + +           PED  + 
Sbjct: 172 GRSSARETIGRVAAGAVAKKILKNFSGTEVLAYVSQVHKVVL-----------PEDLVD- 219

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
             T+  ++++ + VRCPD   ++KM   I   +   DSVGG +TC++RN+P GLG P FD
Sbjct: 220 HETLALDQIESNIVRCPDPEYAEKMIAAIDAVRVRGDSVGGVVTCIVRNIPRGLGSPVFD 279

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQGG 300
           KLEA+ A A LS+PATKGFE GSGF GT + G +HND +    + R+ T+TN SGG QGG
Sbjct: 280 KLEAELAKAALSLPATKGFEFGSGFAGTFMTGSEHNDEFFTDAHGRIRTRTNRSGGIQGG 339

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGE I  R+ FKP +TI ++Q T T +  +  L ARGRHDPCVVPRAVP+VE+  ALV
Sbjct: 340 ISNGEIINIRIGFKPTSTIGKKQHTVTRDKQETELIARGRHDPCVVPRAVPMVEAAVALV 399

Query: 361 IMDALMIQQSRKTVASLLPPNPNIPAAMSGVIPKLSETQ 399
           ++D LM Q ++     L P NP +   +    P+L+ T 
Sbjct: 400 LVDQLMAQYAQ---CELFPINPALQEPLEFRDPELAGTH 435



>gi|384250496|gb|EIE23975.1| chorismate synthase [Coccomyxa subellipsoidea C-169]
          Length = 425

 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 203/379 (53%), Positives = 262/379 (69%), Gaps = 19/379 (5%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           STFG  FRVTTFGESHGK VGC++DG PP L + + +IQ +LDRRRPGQS +TTPR E D
Sbjct: 37  STFGHSFRVTTFGESHGKGVGCVIDGVPPRLPITKEEIQAELDRRRPGQSRITTPRKESD 96

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SG   GITLGTPI ++VPN DQ+  DYSE  +  RPSHAD TY  KY I+A +GG
Sbjct: 97  TCEIYSGVSEGITLGTPICIMVPNTDQKSQDYSEMSVAYRPSHADATYDMKYGIRAVAGG 156

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGAIA+K L+L+ GVE++A+VS V ++     N              
Sbjct: 157 GRSSARETIGRVAAGAIAKKLLRLIAGVEVLAYVSRVRDVTSNVDNA------------- 203

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC-F 240
             T  +E+V+ + VRCPD   +  M   I E +   DS GG +TCVIR+ P GLG P  F
Sbjct: 204 --TFTQEQVEANDVRCPDAEAAKAMYTAIDEVRLRGDSCGGEVTCVIRSCPKGLGSPVFF 261

Query: 241 DKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKNDRLGTKTNNSGGTQGG 300
           DKLEA+   A++S+PA+KG EIGSGF G+ + G +HND + + +  + T+TN SGG QGG
Sbjct: 262 DKLEAELCKALMSLPASKGIEIGSGFSGSRMLGSEHNDEFYMDDGEVRTRTNRSGGIQGG 321

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           ++NGE+I  ++AFKP +TIS++Q T + +G +  L ARGRHDPCVVPRAVP+VE+MAALV
Sbjct: 322 LSNGEDIVAKIAFKPTSTISRKQNTVSRDGEEVELIARGRHDPCVVPRAVPMVEAMAALV 381

Query: 361 IMDALMIQQSRKTVASLLP 379
           I D L+   ++     LLP
Sbjct: 382 IADQLLQHYAQ---CELLP 397



>gi|427725873|ref|YP_007073150.1| chorismate synthase [Leptolyngbya sp. PCC 7376]
 gi|504948932|ref|WP_015136034.1| chorismate synthase [Leptolyngbya sp. PCC 7376]
 gi|427357593|gb|AFY40316.1| chorismate synthase [Leptolyngbya sp. PCC 7376]
          Length = 365

 Score =  406 bits (1043), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 204/377 (54%), Positives = 263/377 (69%), Gaps = 15/377 (3%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           ++FG LFR+TT+GESHG  VG ++DGCPP + + E +IQ++LDRRRPGQS +TTPR+E D
Sbjct: 3   NSFGHLFRITTYGESHGGGVGVVIDGCPPLVEISEEEIQVELDRRRPGQSKITTPRNEAD 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
           +  I SG   G T GTPI +LV N+DQR  DYSE     RPSHAD+TY  KY I+   GG
Sbjct: 63  RCEIMSGVFEGKTTGTPISILVRNKDQRSKDYSEMKQKYRPSHADFTYDSKYGIRNYEGG 122

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGAIA+K L+   GVE++ +V  + +   P I+              
Sbjct: 123 GRSSARETIGRVAAGAIAKKILQQFSGVEVIGYVKRIKDCEAPNIDP------------- 169

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
            +T+  E+V+ + VRCPD   +++M + I E +  K+S+GG + CV RNVP GLG P FD
Sbjct: 170 -STVTIEQVESNIVRCPDAVAAERMIDLIDEIRRDKNSIGGVVECVARNVPKGLGMPVFD 228

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND-RLGTKTNNSGGTQGG 300
           KLEA  A   +S+PA+KGFEIGSGF GT L GH+HND + + N   + TKTN SGG QGG
Sbjct: 229 KLEADLAKGAMSLPASKGFEIGSGFAGTLLTGHEHNDEFTVDNQGEIRTKTNRSGGIQGG 288

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGENI  RVAFKP ATI +EQ+TAT  G + VLAA+GRHDPCV+PRAVP+VE+M ALV
Sbjct: 289 ISNGENIILRVAFKPTATIGKEQQTATREGEETVLAAKGRHDPCVLPRAVPMVEAMVALV 348

Query: 361 IMDALMIQQSRKTVASL 377
           + D L+  Q +    S+
Sbjct: 349 LCDHLLRHQGQCKTLSI 365



>gi|114182|sp|P27793.1|AROC_CORSE RecName: Full=Chorismate synthase, chloroplastic; AltName:
           Full=5-enolpyruvylshikimate-3-phosphate phospholyase;
           Flags: Precursor
 gi|18256|emb|CAA43034.1| chorismate synthase [Capnoides sempervirens]
          Length = 447

 Score =  405 bits (1042), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 203/379 (53%), Positives = 260/379 (68%), Gaps = 13/379 (3%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           S+FG +F+VTT+GESHG  VGC++DGCPP   + EADIQ  LDRRRPGQS +TTPR E D
Sbjct: 61  SSFGKVFQVTTYGESHGGGVGCVIDGCPPRFPISEADIQSDLDRRRPGQSRITTPRKETD 120

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SG   G T G+PI + VPN DQR +DYSE     RPSHAD TY  KY +++  GG
Sbjct: 121 TCKIYSGVADGFTTGSPIHISVPNTDQRGNDYSEMAKAYRPSHADATYDFKYGVRSVQGG 180

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGA+A+K LK   G E++A+VS    + +P      E L   +    
Sbjct: 181 GRSSARETIGRVAAGALAKKILKAYAGTEVLAYVSQAHKVVLP------EGLVDHE---- 230

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
             T+  E+++ + VRCPD   ++KM   I   +   DSVGG +TC++RNVP GLG P FD
Sbjct: 231 --TLSLEQIESNIVRCPDSEYAEKMIAAIDAVRVKGDSVGGVVTCIMRNVPRGLGSPVFD 288

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQGG 300
           KLEA+ A A +S+PATKGFE GSGF GT L G +HND +   +N R+ T+TN SGG QGG
Sbjct: 289 KLEAELAKACMSLPATKGFEFGSGFSGTFLTGSEHNDEFYTDENGRIRTRTNRSGGIQGG 348

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGE I  R+AFKP +TI ++Q T T    +  L ARGRHDPCVVPRAVP+VE+M ALV
Sbjct: 349 ISNGEIINMRIAFKPTSTIGKKQNTVTREREEIELIARGRHDPCVVPRAVPMVEAMVALV 408

Query: 361 IMDALMIQQSRKTVASLLP 379
           ++D LM+Q ++  + S+ P
Sbjct: 409 LLDQLMLQHAQGNLFSINP 427



>gi|493168392|ref|WP_006172327.1| chorismate synthase [Synechococcus sp. WH 5701]
 gi|87283453|gb|EAQ75408.1| chorismate synthase [Synechococcus sp. WH 5701]
          Length = 362

 Score =  405 bits (1041), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 208/371 (56%), Positives = 256/371 (69%), Gaps = 16/371 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           S+FG  FR+ TFGESHG SVG IVDGCPP L+L    IQ +LDRR+PGQS +TTPR E D
Sbjct: 3   SSFGDQFRIQTFGESHGGSVGVIVDGCPPRLALDLEAIQAELDRRKPGQSRITTPRKEDD 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
           +V I SG   G+TLGTPI ++V N+DQRP DYSE  +  RPSHAD TY  KY I+A SGG
Sbjct: 63  RVEILSGLLDGVTLGTPIAMVVRNKDQRPGDYSEMAVAFRPSHADATYQAKYGIQARSGG 122

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GRASARETIGRVAAGAIA++ L   HG E++A+V  +  I        +  + P      
Sbjct: 123 GRASARETIGRVAAGAIAKQLLARAHGTEVIAWVKRIHTI--------EATIDPAG---- 170

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
              +  ++V+ + VRCPD   +++M ERI       DS GG I CV+R  PVGLG P FD
Sbjct: 171 ---VSLDDVEANIVRCPDAACAERMIERIEAIGREGDSCGGVIECVVRRAPVGLGMPVFD 227

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND-RLGTKTNNSGGTQGG 300
           KLEA  A A++S+PATKGFEIGSGF GT   G +HND ++   D  L T TNNSGG QGG
Sbjct: 228 KLEADLAKAVMSLPATKGFEIGSGFAGTLQRGSEHNDAFLATGDGSLRTATNNSGGIQGG 287

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGE I  RVAFKP ATI + Q+T T +G   VL A+GRHDPCV+PRAVP+VE+M ALV
Sbjct: 288 ISNGETIVLRVAFKPTATIRKAQQTVTSSGEATVLEAKGRHDPCVLPRAVPMVEAMVALV 347

Query: 361 IMDALMIQQSR 371
           + D L+ QQ++
Sbjct: 348 LADHLLRQQAQ 358



>gi|470143460|ref|XP_004307393.1| PREDICTED: chorismate synthase, chloroplastic-like [Fragaria vesca
           subsp. vesca]
          Length = 439

 Score =  405 bits (1040), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 209/398 (52%), Positives = 268/398 (67%), Gaps = 18/398 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           STFG  FRVTT+GESHG  VGC++DG PP   L EAD+Q  LDRRRPGQS +TTPR E D
Sbjct: 55  STFGNYFRVTTYGESHGGGVGCVIDGVPPRRPLSEADLQADLDRRRPGQSRITTPRKETD 114

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SG + G+T GTPI + VPN DQR  DY E  +  RPSHAD TY  KY I++  GG
Sbjct: 115 TCKILSGVQGGLTTGTPIHVFVPNTDQRGGDYDEMSIAYRPSHADLTYDMKYGIRSVQGG 174

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGA+A+K LK   G E+ A+VS V  + +           PED  + 
Sbjct: 175 GRSSARETIGRVAAGAVAKKILKGFSGTEVFAYVSQVHKVVL-----------PEDSVDH 223

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
             T+  ++++ + VRCPD   ++KM   I   +   +S+GG +TC++RN P GLG P FD
Sbjct: 224 Y-TLALDQIESNIVRCPDPEYAEKMIAAIDAVRVRGESIGGVVTCIVRNCPRGLGSPVFD 282

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDP-WVLKNDRLGTKTNNSGGTQGG 300
           KLEA+ A A +S+PATKGFE GSGF GT L G +HND  +V +  R+ T+TN SGGTQGG
Sbjct: 283 KLEAELAKACMSLPATKGFEFGSGFAGTFLTGSEHNDEFYVDEQGRVRTRTNRSGGTQGG 342

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGE I  R+AFKP ATI+++Q T T +  +  L ARGRHDPCVVPRAVP+VE+  ALV
Sbjct: 343 ISNGEIINMRIAFKPTATIARKQNTVTRDKKETELIARGRHDPCVVPRAVPMVEAGVALV 402

Query: 361 IMDALMIQQSRKTVASLLPPNPNIPAAMSGV--IPKLS 396
           +MD LM Q ++     L P NP++   ++ V  +P +S
Sbjct: 403 LMDQLMAQYAQ---CHLFPFNPDVQEPLNEVNSLPTMS 437



>gi|357113065|ref|XP_003558325.1| PREDICTED: chorismate synthase 2, chloroplastic-like isoform 1
           [Brachypodium distachyon]
          Length = 440

 Score =  405 bits (1040), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 203/364 (55%), Positives = 253/364 (69%), Gaps = 13/364 (3%)

Query: 4   FGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKDKV 63
           FG  F+V T+GESHG  VGC++ GCPP + L E D+Q  LDRRRPGQS +TTPR E D  
Sbjct: 56  FGDYFQVATYGESHGGGVGCVISGCPPRIPLTEEDMQADLDRRRPGQSRITTPRKETDTC 115

Query: 64  AIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGGGR 123
            I SGT  G+T GTPI + VPN DQR  DY+E     RPSHAD TY  KY +++  GGGR
Sbjct: 116 KILSGTFEGMTTGTPIHVFVPNTDQRGGDYTEMAKAYRPSHADLTYDLKYGVRSVQGGGR 175

Query: 124 ASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWELLN 183
           +SARETIGRVAAGA+A+K LKL  GVEI+AFVS V  +           + PED  +   
Sbjct: 176 SSARETIGRVAAGALAKKILKLKSGVEILAFVSKVHKV-----------VLPEDAVD-YE 223

Query: 184 TIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFDKL 243
           T+  E+++ +  RCP+   + KM + I E +   +S+GG +TC+ RNVP GLG P FDKL
Sbjct: 224 TVTMEQIESNICRCPNPEYAQKMIDAIDEVRLKGNSIGGVVTCIARNVPRGLGSPVFDKL 283

Query: 244 EAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQGGIT 302
           EA  A AMLS+PA+KGFEIGSGF GT L G +HND + + +   + T+TN SGG QGGI+
Sbjct: 284 EALLAKAMLSLPASKGFEIGSGFAGTDLTGSEHNDEFYMDEGGNVRTRTNRSGGVQGGIS 343

Query: 303 NGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALVIM 362
           NGE IYF+VAFKP ATI ++Q T + +  D  L  RGRHDPCVVPRAVP+VE+MAALV+M
Sbjct: 344 NGETIYFKVAFKPTATIGKKQNTVSRDHEDIELMTRGRHDPCVVPRAVPMVETMAALVLM 403

Query: 363 DALM 366
           D LM
Sbjct: 404 DQLM 407



>gi|147770320|emb|CAN73646.1| hypothetical protein VITISV_025571 [Vitis vinifera]
          Length = 436

 Score =  405 bits (1040), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 208/399 (52%), Positives = 267/399 (66%), Gaps = 16/399 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           ST+GT FRVTT+GESHG  VGCI+DGCPP L L EAD+QI LDRRRPGQS +TTPR E D
Sbjct: 52  STYGTYFRVTTYGESHGGGVGCIIDGCPPRLPLTEADMQIDLDRRRPGQSRITTPRKETD 111

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SG   G+T G+PI + VPN DQR +DY+E     RPSHAD TY  KY +++  GG
Sbjct: 112 TCRIYSGVAEGMTTGSPIMVNVPNTDQRGNDYTEMSKAYRPSHADATYDFKYGVRSVQGG 171

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGA+A+K LK     E++A+VS V  + +           PED  + 
Sbjct: 172 GRSSARETIGRVAAGAVAKKILKNFSATEVLAYVSQVHKVVL-----------PEDLVD- 219

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
             T+  ++++ + VRCPD   ++KM   I   +   DSVGG +TC++RNVP GLG P FD
Sbjct: 220 HETLALDQIESNIVRCPDPEYAEKMIAAIDAVRVRGDSVGGVVTCIVRNVPRGLGSPVFD 279

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQGG 300
           KLEA+ A A LS+PATKGFE GSGF GT + G +HND +    + R+ T+TN SGG QGG
Sbjct: 280 KLEAELAKAALSLPATKGFEFGSGFAGTFMTGSEHNDEFFTDAHGRIRTRTNRSGGIQGG 339

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGE I  R+ FKP +TI ++Q T T +  +  L ARGRHDPCVVPRAVP+VE+  ALV
Sbjct: 340 ISNGEIINIRIGFKPTSTIGKKQHTVTRDKQETELIARGRHDPCVVPRAVPMVEAAVALV 399

Query: 361 IMDALMIQQSRKTVASLLPPNPNIPAAMSGVIPKLSETQ 399
           ++D LM Q ++     L P NP +   +    P+L+ T 
Sbjct: 400 LVDQLMAQYAQ---CELFPINPALQEPLEFRDPELAGTH 435



>gi|428773479|ref|YP_007165267.1| chorismate synthase [Cyanobacterium stanieri PCC 7202]
 gi|505035833|ref|WP_015222935.1| chorismate synthase [Cyanobacterium stanieri]
 gi|428687758|gb|AFZ47618.1| chorismate synthase [Cyanobacterium stanieri PCC 7202]
          Length = 365

 Score =  404 bits (1038), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 206/366 (56%), Positives = 260/366 (71%), Gaps = 15/366 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           S FG LFR++TFGESHG  VG ++DGCPP + +   +IQ  L+RR+PGQS +TTPR E D
Sbjct: 3   SIFGELFRISTFGESHGGGVGVVIDGCPPRIEISAEEIQEDLNRRKPGQSKITTPRKESD 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SG   G TLGTPI +LV N+D R  DY E  +  RPSHAD TY  KY I+   GG
Sbjct: 63  LCEIISGVFEGKTLGTPIAILVRNKDARSQDYDEMAVKYRPSHADATYDAKYGIRNWQGG 122

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGAIA+K LK V GVEI+A+V S+ +I    IN+             
Sbjct: 123 GRSSARETIGRVAAGAIAKKILKQVAGVEIIAYVKSIKDIEATNINQ------------- 169

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
            +T+  E+V+ + VRCPD  +++KM + I + ++ KDS+GGT+ CV+RNVP GLGEP FD
Sbjct: 170 -DTVTLEQVESNIVRCPDSAIAEKMIDLIDQIRKEKDSLGGTLECVVRNVPRGLGEPVFD 228

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKNDRL-GTKTNNSGGTQGG 300
           KLEA  A A++S+PATKGFEIGSGF GTTL G QHND + L ++ +  T TN SGG QGG
Sbjct: 229 KLEADLAKAIMSLPATKGFEIGSGFAGTTLTGSQHNDEFYLDDNGIPRTVTNRSGGIQGG 288

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGENI  R AFKP ATI +EQ+T +  G +  LAA+GRHDPCV+PRAVP+VE+M ALV
Sbjct: 289 ISNGENIVLRAAFKPTATIGKEQKTVSKEGEETTLAAKGRHDPCVLPRAVPMVEAMVALV 348

Query: 361 IMDALM 366
           + D L+
Sbjct: 349 LCDHLL 354



>gi|222136859|gb|ACM45079.1| chorismate synthase [Vitis vinifera]
          Length = 436

 Score =  404 bits (1037), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 208/399 (52%), Positives = 267/399 (66%), Gaps = 16/399 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           ST+GT FRVTT+GESHG  VGCI+DGCPP L L EAD+QI LDRRRPGQS +TTPR E D
Sbjct: 52  STYGTYFRVTTYGESHGGGVGCIIDGCPPRLPLTEADMQIDLDRRRPGQSRITTPRKETD 111

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SG   G+T G+PI + VPN DQR +DY+E     RPSHAD TY  KY +++  GG
Sbjct: 112 TCRIYSGVAEGMTTGSPIMVNVPNTDQRGNDYTEMSKAYRPSHADATYDFKYGVRSVQGG 171

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SA ETIGRVAAGA+A+K LK   G E++A+VS V  + +           PED  + 
Sbjct: 172 GRSSAGETIGRVAAGAVAKKILKNFSGTEVLAYVSQVHKVVL-----------PEDLVD- 219

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
             T+  ++++ + VRCPD   ++KM   I   +   DSVGG +TC++RNVP GLG P FD
Sbjct: 220 HETLALDQIESNIVRCPDPEYAEKMIAAIDAVRVRGDSVGGVVTCIVRNVPRGLGSPVFD 279

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQGG 300
           KLEA+ A A LS+PATKGFE GSGF GT + G +HND +    + R+ T+TN SGG QGG
Sbjct: 280 KLEAELAKAALSLPATKGFEFGSGFAGTFMTGSEHNDEFFTDAHGRIRTRTNRSGGIQGG 339

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGE I  R+ FKP +TI ++Q T T +  +  L ARGRHDPCVVPRAVP+VE+  ALV
Sbjct: 340 ISNGEIINIRIGFKPTSTIGKKQHTVTRDKQETELIARGRHDPCVVPRAVPMVEAAVALV 399

Query: 361 IMDALMIQQSRKTVASLLPPNPNIPAAMSGVIPKLSETQ 399
           ++D LM Q ++     L P NP +   +    P+L+ T 
Sbjct: 400 LVDQLMAQYAQ---CELFPINPALQEPLEFRDPELAGTH 435



>gi|12321114|gb|AAG50662.1|AC084242_6 chorismate synthase, putative [Arabidopsis thaliana]
          Length = 435

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 205/384 (53%), Positives = 262/384 (68%), Gaps = 17/384 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           S++GT FRV+TFGESHG  VGCI+DGCPP + L E+D+Q  LDRR PGQS +TTPR E D
Sbjct: 53  SSYGTHFRVSTFGESHGGGVGCIIDGCPPRIPLTESDLQFDLDRR-PGQSRITTPRKETD 111

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SG   G+T GTPI + VPN DQR  DYSE  +  RPSHAD TY  KY +++  GG
Sbjct: 112 TCRISSGVSEGMTTGTPIHVFVPNTDQRGLDYSEMSVAYRPSHADATYDMKYGVRSVQGG 171

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVA GA+A+K LK   G EI+A+VS V ++ +P      E L   +   L
Sbjct: 172 GRSSARETIGRVAPGALAKKILKQFAGTEILAYVSQVHHVVLP------EELVDHENLTL 225

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
                 E+++ + VRCP+   ++KM   I   +   +SVGG +TC++RN P GLG P FD
Sbjct: 226 ------EQIENNIVRCPNPEYAEKMIAAIDAVRTKGNSVGGVVTCIVRNAPRGLGTPVFD 279

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQGG 300
           KLEA+ A A +S+PATKGFE GSGF GT L G +HND +   +N R+ T+TN SGG QGG
Sbjct: 280 KLEAELAKACMSLPATKGFEFGSGFAGTFLTGLEHNDEFYTDENGRIRTRTNRSGGIQGG 339

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGE I  RVAFKP +TI ++Q T T + V+  + ARGRHDPCVVPRAVP+VE+M ALV
Sbjct: 340 ISNGEIINMRVAFKPTSTIGRKQNTVTRDKVETEMIARGRHDPCVVPRAVPMVEAMVALV 399

Query: 361 IMDALMIQQSRKTVASLLPPNPNI 384
           ++D LM Q ++     L P NP +
Sbjct: 400 LVDQLMAQYAQ---CHLFPINPEL 420



>gi|81299023|ref|YP_399231.1| chorismate synthase [Synechococcus elongatus PCC 7942]
 gi|499696763|ref|WP_011377497.1| chorismate synthase [Synechococcus elongatus]
 gi|119366079|sp|Q31RS5.1|AROC_SYNE7 RecName: Full=Chorismate synthase; AltName:
           Full=5-enolpyruvylshikimate-3-phosphate phospholyase
 gi|81167904|gb|ABB56244.1| chorismate synthase [Synechococcus elongatus PCC 7942]
          Length = 362

 Score =  403 bits (1036), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 208/371 (56%), Positives = 264/371 (71%), Gaps = 16/371 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           S+FG LFR++TFGESHG  VG ++DGCPP L + EA+IQ +LDRRRPGQS +TTPR E D
Sbjct: 3   SSFGHLFRISTFGESHGGGVGVVIDGCPPRLEISEAEIQFELDRRRPGQSKITTPRKEAD 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
           +  I SG   G TLGTPI ++V N+DQR  DYSE  +  RPSHAD TY  KY I+A +GG
Sbjct: 63  QCEILSGVVDGKTLGTPIAIVVRNKDQRSQDYSEMQVAYRPSHADATYDAKYGIRAVAGG 122

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGAIA+K L+ + GVEIV +V  + ++        + ++ PE     
Sbjct: 123 GRSSARETIGRVAAGAIAKKLLREIAGVEIVGYVKRIKDL--------EGQIDPE----- 169

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
             T+  E+V+   VRCPD+ ++ +M + I       DS+GG + CV R VP GLGEP FD
Sbjct: 170 --TVTLEQVESTIVRCPDEAIAPQMIDLIEAIGREGDSLGGVVECVARRVPRGLGEPVFD 227

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQGG 300
           KLEA  A A +S+PATKGFEIGSGF GT + G +HND +   +  ++ T+TN SGGTQGG
Sbjct: 228 KLEADLAKACMSLPATKGFEIGSGFAGTEMTGSEHNDAFYTDEQGQIRTRTNRSGGTQGG 287

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGENI  RVAFKP ATI +EQET T +G    LAARGRHDPCV+PRAVP+VE+M ALV
Sbjct: 288 ISNGENIVIRVAFKPTATIRKEQETVTNSGEATTLAARGRHDPCVLPRAVPMVEAMVALV 347

Query: 361 IMDALMIQQSR 371
           + D L+ QQ++
Sbjct: 348 LCDHLLRQQAQ 358



>gi|495372769|ref|WP_008097481.1| chorismate synthase [Verrucomicrobiae bacterium DG1235]
 gi|198256387|gb|EDY80695.1| chorismate synthase [Verrucomicrobiae bacterium DG1235]
          Length = 364

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 210/376 (55%), Positives = 255/376 (67%), Gaps = 16/376 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           + FG LF ++T+GESHG  VG ++DGCPP L L E DIQ +LDRRRPGQS +TTPR E D
Sbjct: 3   NVFGKLFTISTWGESHGGGVGVVIDGCPPNLLLSETDIQPELDRRRPGQSEITTPRKEAD 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
           +V I SG   G T GTPI +LV N+D RP  YSE     RPSHAD+TY  KY  +   GG
Sbjct: 63  QVQILSGVYEGKTTGTPISMLVFNKDARPGAYSEMKEKFRPSHADYTYQTKYGHRNPEGG 122

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGAIA+K LKL   VE +A+VS + +I MP   E             
Sbjct: 123 GRSSARETIGRVAAGAIAKKILKLTSKVETLAYVSRIHDICMPEGAE------------- 169

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
              I  E ++ + VRCPD T ++ M ERI EA+   DSVGG + C IRN+PVGLGEP FD
Sbjct: 170 ---ISEEAIEANIVRCPDATTAEAMVERIKEARSVGDSVGGVVECRIRNLPVGLGEPVFD 226

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKNDRLGTKTNNSGGTQGGI 301
           + EA    AMLS+PATKGFE+GSGF+GT L G +HND +  ++  + T TN SGG QGGI
Sbjct: 227 RFEADLGKAMLSLPATKGFEVGSGFEGTLLKGSEHNDLFENRDGAVRTMTNLSGGVQGGI 286

Query: 302 TNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALVI 361
           TNGE + FRVAFKP ATI QEQ T    G +  L  RGRHDPCVVPRAVPIVE+MA LVI
Sbjct: 287 TNGEEVVFRVAFKPTATILQEQATVDLEGEETTLMGRGRHDPCVVPRAVPIVEAMANLVI 346

Query: 362 MDALMIQQSRKTVASL 377
           +D +M Q ++  + + 
Sbjct: 347 VDHMMRQHAQNRLFTF 362



>gi|493555256|ref|WP_006508791.1| chorismate synthase [Xenococcus sp. PCC 7305]
 gi|442794724|gb|ELS04127.1| chorismate synthase [Xenococcus sp. PCC 7305]
          Length = 362

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 203/376 (53%), Positives = 260/376 (69%), Gaps = 20/376 (5%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           +TFG LFR+TTFGESHG  VG  +DGCPP L + E +IQ+ LDRRRPGQS +TTPR E D
Sbjct: 3   NTFGHLFRITTFGESHGGGVGVTIDGCPPQLEISEEEIQVDLDRRRPGQSKITTPRRETD 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SG   G TLGTPI +LV N+D R  DY E  +  RPSHAD TY  KY  +   GG
Sbjct: 63  TCEIISGVFEGKTLGTPIAILVRNKDARSQDYDEMSVKYRPSHADATYDAKYGFRNWQGG 122

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGAIA+K LK V GVEI+ +V  +                 +D   +
Sbjct: 123 GRSSARETIGRVAAGAIAKKILKQVAGVEIIGYVKRI-----------------KDLEAV 165

Query: 182 LN--TIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           +N  T+  E+V+ + VRCPD   ++KM + I   ++ KDS+GG + CV R+VP GLG+P 
Sbjct: 166 VNPSTVTLEQVESNIVRCPDSDCAEKMIDLIDAIRKEKDSLGGVVECVARSVPRGLGDPV 225

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQ 298
           FDKLEA+ A  ++S+PA+KGFEIGSGF GTT+ G +HND + + +N    T+TN SGG Q
Sbjct: 226 FDKLEAELAKGVMSLPASKGFEIGSGFAGTTMKGSEHNDEFYIDENGETRTRTNRSGGVQ 285

Query: 299 GGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAA 358
           GGI+NGENI  RVAFKP AT+ +EQ+T T +G + VLAA+GRHDPCV+ RAVP+VE+M A
Sbjct: 286 GGISNGENIIIRVAFKPTATVGKEQKTVTKDGQETVLAAKGRHDPCVLSRAVPMVEAMVA 345

Query: 359 LVIMDALMIQQSRKTV 374
           LV+ D L+ Q ++  V
Sbjct: 346 LVLCDRLLCQNAQCKV 361



>gi|194268461|gb|ACF36173.1| chorismate synthase [Hordeum vulgare subsp. vulgare]
 gi|326505106|dbj|BAK02940.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 442

 Score =  403 bits (1035), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 203/364 (55%), Positives = 253/364 (69%), Gaps = 13/364 (3%)

Query: 4   FGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKDKV 63
           FG  F+V T+GESHG  VGC++ GCPP + L E D+Q  LDRRRPGQS +TTPR E D  
Sbjct: 58  FGDYFQVATYGESHGGGVGCVISGCPPRIPLTEEDMQGDLDRRRPGQSRITTPRKETDTC 117

Query: 64  AIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGGGR 123
            I SGT  G+T GTPI + VPN DQR  DY+E     RPSHAD TY  KY +++  GGGR
Sbjct: 118 KILSGTYEGMTTGTPIHVFVPNTDQRGGDYTEMAKAYRPSHADLTYDLKYGVRSVQGGGR 177

Query: 124 ASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWELLN 183
           +SARETIGRVAAGA+A+K LKL  GVEI+AFVS V  +           + PED  +   
Sbjct: 178 SSARETIGRVAAGAVAKKILKLKCGVEILAFVSKVHQV-----------VLPEDAVD-YE 225

Query: 184 TIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFDKL 243
           T+  ++++ +  RCPD   + KM + I + +   +S+GG +TC+ RNVP GLG P FDKL
Sbjct: 226 TLTLDQIESNICRCPDPEYAQKMIDAIDKVRINGNSIGGVVTCIARNVPRGLGSPVFDKL 285

Query: 244 EAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQGGIT 302
           EA  A AMLS+PA+KGFEIGSGF GT L G +HND + + +   + T+TN SGG QGGI+
Sbjct: 286 EALLAKAMLSLPASKGFEIGSGFAGTDLTGSEHNDEFYMDEGGNVRTRTNRSGGVQGGIS 345

Query: 303 NGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALVIM 362
           NGE IYF+VAFKP ATI ++Q T T +  D  L  RGRHDPCVVPRAVP+VE+MAALV+M
Sbjct: 346 NGETIYFKVAFKPTATIGKKQNTVTRDHEDIELLTRGRHDPCVVPRAVPMVETMAALVLM 405

Query: 363 DALM 366
           D LM
Sbjct: 406 DQLM 409



>gi|194477008|ref|YP_002049187.1| chorismate synthase [Paulinella chromatophora]
 gi|111378716|gb|ABH09267.1| chorismate synthase [Paulinella chromatophora]
 gi|171192015|gb|ACB42977.1| chorismate synthase [Paulinella chromatophora]
          Length = 362

 Score =  402 bits (1033), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 204/373 (54%), Positives = 259/373 (69%), Gaps = 20/373 (5%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           ++FG LFRV+TFGESHG+ VG I+DGCPP L+L +  IQ  LDRR+PGQS++TTPR E D
Sbjct: 3   NSFGILFRVSTFGESHGRGVGVIIDGCPPRLNLNQELIQSDLDRRKPGQSSITTPRQETD 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
           +V I SG    ITLGTPI ++V N+DQ+P DY E ++  RPSHAD TY +KY I+A SGG
Sbjct: 63  QVEILSGLLDNITLGTPIAMIVKNKDQKPEDYKEMEIAFRPSHADATYNEKYGIQARSGG 122

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GRASARETIGRVAAG+IA++ L  V+  EI+A+VS +  I                    
Sbjct: 123 GRASARETIGRVAAGSIAKQLLAKVNQTEIIAWVSQIHTIKAD----------------- 165

Query: 182 LNTIR--REEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPC 239
           LN  R   + V+   VRCPDK V+D+M E I       DS GG I C++R  P+GLG P 
Sbjct: 166 LNPCRVTLKSVESSIVRCPDKLVADQMIEHIRSIGSKGDSCGGIIECIVRRPPIGLGAPV 225

Query: 240 FDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND-RLGTKTNNSGGTQ 298
           FDKLEA  A A++S+PAT+GFEIGSGF  T L G +HND ++  +D  L T TNNSGG Q
Sbjct: 226 FDKLEADLAKALMSLPATRGFEIGSGFASTLLKGSEHNDAFIASDDGHLHTITNNSGGIQ 285

Query: 299 GGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAA 358
           GGI+NGENI+ RVAFKP ATI++ Q +    G   +L A+GRHDPCV+PRAVP+VE+M A
Sbjct: 286 GGISNGENIHLRVAFKPTATIAKAQRSIDALGFPKILQAKGRHDPCVLPRAVPMVEAMVA 345

Query: 359 LVIMDALMIQQSR 371
           LV+ D L+ QQ++
Sbjct: 346 LVLADHLLRQQAQ 358



>gi|170078745|ref|YP_001735383.1| chorismate synthase [Synechococcus sp. PCC 7002]
 gi|501264729|ref|WP_012307747.1| chorismate synthase [Synechococcus sp. PCC 7002]
 gi|238689042|sp|B1XIM6.1|AROC_SYNP2 RecName: Full=Chorismate synthase; AltName:
           Full=5-enolpyruvylshikimate-3-phosphate phospholyase
 gi|169886414|gb|ACB00128.1| chorismate synthase [Synechococcus sp. PCC 7002]
          Length = 364

 Score =  402 bits (1033), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 204/371 (54%), Positives = 259/371 (69%), Gaps = 15/371 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           ++FG LFR+TT+GESHG  VG ++DGCPP + + EA+IQ +LDRRRPGQS +TTPR+E D
Sbjct: 3   NSFGHLFRITTYGESHGGGVGVVIDGCPPLVEISEAEIQAELDRRRPGQSRITTPRNEAD 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
           +  I SG   G T GTPI +LV N+DQR  DYSE     RPSHAD+TY  KY I+   GG
Sbjct: 63  RCEIMSGVFDGKTTGTPISILVRNKDQRSKDYSEMKEKYRPSHADFTYDAKYGIRNYEGG 122

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGAIA+K L+ V GVEI+ +V  + +     I+              
Sbjct: 123 GRSSARETIGRVAAGAIAKKILQQVAGVEIIGYVKRIKDCEAVDIDP------------- 169

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
            N +   +V+ + VRCPD   ++KM   I E ++ KDS+GG + CV RNVPVGLG P FD
Sbjct: 170 -NQVTLAQVESNIVRCPDAAAAEKMIALIDEIRKQKDSIGGVVECVARNVPVGLGMPVFD 228

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKND-RLGTKTNNSGGTQGG 300
           KLEA  A   +S+PA+KGFEIGSGF GT L G +HND + + +  ++ TKTN SGG QGG
Sbjct: 229 KLEADLAKGAMSLPASKGFEIGSGFAGTLLTGQEHNDEFTVDDQGQIRTKTNRSGGIQGG 288

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGENI  RVAFKP ATI +EQ+TAT  G +  LAA+GRHDPCV+PRAVP+VE+M ALV
Sbjct: 289 ISNGENIVLRVAFKPTATIGKEQQTATRAGEEATLAAKGRHDPCVLPRAVPMVEAMVALV 348

Query: 361 IMDALMIQQSR 371
           + D L+  Q +
Sbjct: 349 LCDHLLRHQGQ 359



>gi|326508210|dbj|BAJ99372.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 516

 Score =  401 bits (1031), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 203/364 (55%), Positives = 253/364 (69%), Gaps = 13/364 (3%)

Query: 4   FGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKDKV 63
           FG  F+V T+GESHG  VGC++ GCPP + L E D+Q  LDRRRPGQS +TTPR E D  
Sbjct: 132 FGDYFQVATYGESHGGGVGCVISGCPPRIPLTEEDMQGDLDRRRPGQSRITTPRKETDTC 191

Query: 64  AIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGGGR 123
            I SGT  G+T GTPI + VPN DQR  DY+E     RPSHAD TY  KY +++  GGGR
Sbjct: 192 KILSGTYEGMTTGTPIHVFVPNTDQRGGDYTEMAKAYRPSHADLTYDLKYGVRSVQGGGR 251

Query: 124 ASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWELLN 183
           +SARETIGRVAAGA+A+K LKL  GVEI+AFVS V  +           + PED  +   
Sbjct: 252 SSARETIGRVAAGAVAKKILKLKCGVEILAFVSKVHQV-----------VLPEDAVD-YE 299

Query: 184 TIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFDKL 243
           T+  ++++ +  RCPD   + KM + I + +   +S+GG +TC+ RNVP GLG P FDKL
Sbjct: 300 TLTLDQIESNICRCPDPEYAQKMIDAIDKVRINGNSIGGVVTCIARNVPRGLGSPVFDKL 359

Query: 244 EAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQGGIT 302
           EA  A AMLS+PA+KGFEIGSGF GT L G +HND + + +   + T+TN SGG QGGI+
Sbjct: 360 EALLAKAMLSLPASKGFEIGSGFAGTDLTGSEHNDEFYMDEGGNVRTRTNRSGGVQGGIS 419

Query: 303 NGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALVIM 362
           NGE IYF+VAFKP ATI ++Q T T +  D  L  RGRHDPCVVPRAVP+VE+MAALV+M
Sbjct: 420 NGETIYFKVAFKPTATIGKKQNTVTRDHEDIELLTRGRHDPCVVPRAVPMVETMAALVLM 479

Query: 363 DALM 366
           D LM
Sbjct: 480 DQLM 483



>gi|256822856|ref|YP_003146819.1| chorismate synthase [Kangiella koreensis DSM 16069]
 gi|506260882|ref|WP_015780657.1| chorismate synthase [Kangiella koreensis]
 gi|256796395|gb|ACV27051.1| chorismate synthase [Kangiella koreensis DSM 16069]
          Length = 364

 Score =  401 bits (1030), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 200/364 (54%), Positives = 255/364 (70%), Gaps = 15/364 (4%)

Query: 3   TFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKDK 62
           +FGTLFRVT +GESHGK++G +V+GCP GL L E DIQ+ LDRRRPGQS++TT RDE D+
Sbjct: 5   SFGTLFRVTNWGESHGKAIGAVVEGCPAGLKLSEEDIQVFLDRRRPGQSSITTRRDESDQ 64

Query: 63  VAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGGG 122
           V I SG  +G+T GTPI LL+PNQDQR  DYSE     RPSHAD+TY +KY I+  +GGG
Sbjct: 65  VQIMSGVVNGMTTGTPISLLIPNQDQRSKDYSELGSIFRPSHADYTYQKKYGIRDVAGGG 124

Query: 123 RASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWELL 182
           R+SAR T G VAAGAIA K L+   G EIVA+V SV ++ M   +E              
Sbjct: 125 RSSARITAGHVAAGAIARKVLEQALGTEIVAYVKSVQDLTMTLDSE-------------- 170

Query: 183 NTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFDK 242
             +    +++  VRCPD  ++++M  +I +A+++ DS+GG + C I++VPVGLGEP FDK
Sbjct: 171 -AVDASLIEQTPVRCPDLKLAEQMIAKIEQARKSGDSLGGIVECRIKSVPVGLGEPVFDK 229

Query: 243 LEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKNDRLGTKTNNSGGTQGGIT 302
           LEA  A +ML+I A+K FEIGSGF GT L G  HND ++ ++  + T+TNNSGG  GGI+
Sbjct: 230 LEADLAKSMLAINASKAFEIGSGFAGTLLSGTTHNDVFINQDGEVKTRTNNSGGVLGGIS 289

Query: 303 NGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALVIM 362
           NG  I FRVAFKP  TI +EQET    G   V   RGRHDPCV+PRAVPIVE+MAALV+ 
Sbjct: 290 NGMPIVFRVAFKPTPTIIKEQETVNLEGEATVFHGRGRHDPCVLPRAVPIVEAMAALVLC 349

Query: 363 DALM 366
           D  +
Sbjct: 350 DHYL 353



>gi|449015891|dbj|BAM79293.1| chorismate synthase [Cyanidioschyzon merolae strain 10D]
          Length = 444

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 210/398 (52%), Positives = 271/398 (68%), Gaps = 24/398 (6%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           ++FG +FR+TTFGESHG  VG ++DGCPP L L   D+QI+L+RRRPGQS LTTPR+E D
Sbjct: 49  NSFGRIFRITTFGESHGGGVGVVIDGCPPRLPLTIEDVQIELNRRRPGQSRLTTPRNEAD 108

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
           +  I SG   G+T+GTPI ++V N DQR  DY    +  RPSHAD TY  KY I+A +GG
Sbjct: 109 EAEILSGVVDGVTMGTPIAIVVRNTDQRSQDYEAMKVSYRPSHADATYDAKYGIRAVAGG 168

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGAIA+K L+   G +I+A+V SV +I    I+              
Sbjct: 169 GRSSARETIGRVAAGAIAKKILRTYAGTQILAYVKSVKHIEAANIDP------------- 215

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
            N +  E+++ + VRCPD   + +M + I E +   +SVGG + CV RNVP GLG P FD
Sbjct: 216 -NVVSYEQIESNIVRCPDSEAASQMIQLIDEIRRTGNSVGGVVECVARNVPAGLGSPVFD 274

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQGG 300
           KLEA+ A A++S+PA+KGFE+GSGF GT L G +HNDP+ +  N R   + N SGG QGG
Sbjct: 275 KLEAELAKALMSLPASKGFEVGSGFGGTLLTGVEHNDPFYIDSNGRTRARENRSGGIQGG 334

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGENI  RVAFKP +TIS+EQ T T  G   VL A+GRHDPCV+PRAVP+VE+M ALV
Sbjct: 335 ISNGENIVCRVAFKPTSTISREQNTVTRAGEQVVLRAKGRHDPCVLPRAVPMVEAMVALV 394

Query: 361 IMDALMIQQSRKTVASLLP------PNPNIPAAMSGVI 392
           ++D L+ Q ++    SLLP      PNP  P A +G +
Sbjct: 395 LVDHLLQQIAQ---CSLLPIDPSTAPNPLGPPAPAGTV 429



>gi|56751309|ref|YP_172010.1| chorismate synthase [Synechococcus elongatus PCC 6301]
 gi|499562829|ref|WP_011243612.1| chorismate synthase [Synechococcus elongatus]
 gi|67460182|sp|Q5N2I0.1|AROC_SYNP6 RecName: Full=Chorismate synthase; AltName:
           Full=5-enolpyruvylshikimate-3-phosphate phospholyase
 gi|56686268|dbj|BAD79490.1| chorismate synthase [Synechococcus elongatus PCC 6301]
          Length = 362

 Score =  400 bits (1029), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 207/371 (55%), Positives = 263/371 (70%), Gaps = 16/371 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           S+FG LFR++TFGESHG  VG ++DGCPP L + EA+IQ +LDRRRPGQS +TTPR E D
Sbjct: 3   SSFGHLFRISTFGESHGGGVGVVIDGCPPRLEISEAEIQFELDRRRPGQSKITTPRKEAD 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
           +  I SG   G TL TPI ++V N+DQR  DYSE  +  RPSHAD TY  KY I+A +GG
Sbjct: 63  QCEILSGVVDGKTLDTPIAIVVRNKDQRSQDYSEMQVAYRPSHADATYDAKYGIRAVAGG 122

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGAIA+K L+ + GVEIV +V  + ++        + ++ PE     
Sbjct: 123 GRSSARETIGRVAAGAIAKKLLREIAGVEIVGYVKRIKDL--------EGQIDPE----- 169

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
             T+  E+V+   VRCPD+ ++ +M + I       DS+GG + CV R VP GLGEP FD
Sbjct: 170 --TVTLEQVESTIVRCPDEAIAPQMIDLIEAIGREGDSLGGVVECVARRVPRGLGEPVFD 227

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQGG 300
           KLEA  A A +S+PATKGFEIGSGF GT + G +HND +   +  ++ T+TN SGGTQGG
Sbjct: 228 KLEADLAKACMSLPATKGFEIGSGFAGTEMTGSEHNDAFYTDEQGQIRTRTNRSGGTQGG 287

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGENI  RVAFKP ATI +EQET T +G    LAARGRHDPCV+PRAVP+VE+M ALV
Sbjct: 288 ISNGENIVIRVAFKPTATIRKEQETVTNSGEATTLAARGRHDPCVLPRAVPMVEAMVALV 347

Query: 361 IMDALMIQQSR 371
           + D L+ QQ++
Sbjct: 348 LCDHLLRQQAQ 358



>gi|223993785|ref|XP_002286576.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gi|220977891|gb|EED96217.1| predicted protein [Thalassiosira pseudonana CCMP1335]
          Length = 435

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 200/375 (53%), Positives = 262/375 (69%), Gaps = 19/375 (5%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           ++FG LFR++T+GESHG  VG  +DGCPP + +   +IQI LDRRRPGQS +TTPR+E D
Sbjct: 29  NSFGRLFRISTWGESHGGGVGVTLDGCPPRIPITREEIQIDLDRRRPGQSRITTPRNEAD 88

Query: 62  KVAIQSGTE-SGITLGTPIGLLVPNQDQRPHDYSETDLYP--RPSHADWTYLQKYSIKAS 118
            V I SG     ITLGTPIG+LV N+DQR  DY E D+    RPSHAD TY  KY ++A 
Sbjct: 89  AVEILSGLNPEDITLGTPIGMLVRNKDQRSGDYLENDMSVAYRPSHADATYDAKYGVRAI 148

Query: 119 SGGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDF 178
           +GGGR+SARETIGRVAAGA+A K L++ +G+E++A+VS V +I    +N           
Sbjct: 149 AGGGRSSARETIGRVAAGAVARKILRMYNGIEVLAYVSKVQDIEATNVNH---------- 198

Query: 179 WELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEP 238
               +T   EEVD + VRCPD+  +++M ERI E +++ +S+GG +TCV RNVP GLG P
Sbjct: 199 ----DTFTMEEVDANIVRCPDEASAERMLERIDEIRKSGNSIGGVVTCVARNVPAGLGAP 254

Query: 239 CFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKNDRLG--TKTNNSGG 296
            FDKLEA  A A +SIPA KGFE G GF GT L G  HND + +  +     T+TN SGG
Sbjct: 255 VFDKLEADLAKACMSIPAAKGFESGDGFGGTLLTGKDHNDEFYIDEETGATRTRTNRSGG 314

Query: 297 TQGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESM 356
            QGGI+NGEN+   VAFKP +TI+Q Q+T T +G +  L  +GRHDPCV+PRAVP+VE+M
Sbjct: 315 IQGGISNGENVVVHVAFKPTSTIAQSQKTVTRDGQEVELRGKGRHDPCVLPRAVPMVEAM 374

Query: 357 AALVIMDALMIQQSR 371
            AL ++DAL+ Q+++
Sbjct: 375 VALTLVDALLCQKAQ 389



>gi|294054282|ref|YP_003547940.1| chorismate synthase [Coraliomargarita akajimensis DSM 45221]
 gi|502807518|ref|WP_013042494.1| chorismate synthase [Coraliomargarita akajimensis]
 gi|293613615|gb|ADE53770.1| chorismate synthase [Coraliomargarita akajimensis DSM 45221]
          Length = 362

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 211/370 (57%), Positives = 259/370 (70%), Gaps = 16/370 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           ++FGTLFR++T+GESHG  +G +VDGCPP L L   DIQ +LDRRRPGQS++TTPR E D
Sbjct: 3   NSFGTLFRISTWGESHGGGIGVVVDGCPPRLPLSVEDIQFELDRRRPGQSDITTPRKESD 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
             +I SG   G TLGTPIG+ VPN DQRP  Y+E     RPSHAD+TY  K+ I+   GG
Sbjct: 63  TASIVSGVYEGQTLGTPIGIYVPNGDQRPSAYTEMKDKFRPSHADYTYQTKFGIRNHEGG 122

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGAIA+K LKL  G+E+ A+++ V +I               DF  L
Sbjct: 123 GRSSARETIGRVAAGAIAKKILKLAGGIELRAYITRVHDIEAQI----------SDFPSL 172

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
                 E V+ + VRCPD   ++KM ERI E +   DSVGG I C IRN+PVGLG P FD
Sbjct: 173 ------EAVEANPVRCPDPEAAEKMAERIREVRANGDSVGGLIECRIRNLPVGLGVPVFD 226

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKNDRLGTKTNNSGGTQGGI 301
           +LEA  A AMLS+PATKGFE GSGF+G+ L G +HND ++ KN  +GT TN SGG QGGI
Sbjct: 227 RLEADLAKAMLSLPATKGFEFGSGFEGSLLKGSEHNDVFINKNGTVGTATNRSGGVQGGI 286

Query: 302 TNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALVI 361
           +NGE + FRVAFKP AT+ Q Q T   +G +  L  RGRHDPCVVPRAVPIVESMAALV+
Sbjct: 287 SNGEEVVFRVAFKPTATLIQNQATVDKDGNETELMGRGRHDPCVVPRAVPIVESMAALVV 346

Query: 362 MDALMIQQSR 371
           +D  M  +++
Sbjct: 347 VDHWMRHKAQ 356



>gi|302846180|ref|XP_002954627.1| hypothetical protein VOLCADRAFT_82898 [Volvox carteri f.
           nagariensis]
 gi|300260046|gb|EFJ44268.1| hypothetical protein VOLCADRAFT_82898 [Volvox carteri f.
           nagariensis]
          Length = 411

 Score =  400 bits (1028), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 202/366 (55%), Positives = 259/366 (70%), Gaps = 16/366 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           ST+G  FRVTTFGESHGK VG ++DG PP L + E +IQ++LDRR+PGQS +TTPR E D
Sbjct: 33  STYGNNFRVTTFGESHGKGVGGVIDGVPPRLPITEDEIQLELDRRKPGQSIITTPRKEDD 92

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SG   GITLGTPI ++  N+DQ+  DYSE  +  RPSHAD TY  KY I+A +GG
Sbjct: 93  IAEILSGVVDGITLGTPIAIVARNKDQKSQDYSEMAVAYRPSHADATYDFKYGIRAVAGG 152

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGA+A+K LK++   EI+AFVS V +I              E   + 
Sbjct: 153 GRSSARETIGRVAAGAVAKKLLKVIGDTEILAFVSKVRDI--------------ESHVD- 197

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
           L +   E+V+ + VRCPD+  + KM + I+E +   +S GG +TCV+R  P GLG P FD
Sbjct: 198 LASFTLEDVESNIVRCPDQQAATKMIDAINEVRTRGESCGGEVTCVVRRCPKGLGSPVFD 257

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQGG 300
           KLEA+ A AMLS+PATKGFEIGSGF+G  + G +HND + + ++ R+ T+TN SGG QGG
Sbjct: 258 KLEAELAKAMLSLPATKGFEIGSGFRGAAMLGSEHNDEFYMDEHGRVRTRTNRSGGVQGG 317

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           ++NGE+I  RVAFKP +TI  +Q T T +G +  L ARGRHDPCVVPRAVP+VESM ALV
Sbjct: 318 LSNGEDIVIRVAFKPTSTIGIKQRTVTRDGQETELRARGRHDPCVVPRAVPMVESMVALV 377

Query: 361 IMDALM 366
           + D L+
Sbjct: 378 LADQLL 383



>gi|434398668|ref|YP_007132672.1| chorismate synthase [Stanieria cyanosphaera PCC 7437]
 gi|505006272|ref|WP_015193374.1| chorismate synthase [Stanieria cyanosphaera]
 gi|428269765|gb|AFZ35706.1| chorismate synthase [Stanieria cyanosphaera PCC 7437]
          Length = 365

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 206/371 (55%), Positives = 258/371 (69%), Gaps = 16/371 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           +TFG LFR+TTFGESHG  VG ++DGCPP L + EA+IQI LDRR+PGQS +TTPR E D
Sbjct: 3   NTFGHLFRITTFGESHGGGVGVVIDGCPPQLEISEAEIQIDLDRRKPGQSKITTPRKESD 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SG   G TLGTPI +LV N+D R  DY E     RPSHAD TY  KY I+   GG
Sbjct: 63  TCQIISGVFEGKTLGTPIAILVTNKDARSQDYDEMAYKYRPSHADATYDAKYGIRNWQGG 122

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GRASARETIGRVAAGA+A+K L  V GVEIVA+V  + ++     +              
Sbjct: 123 GRASARETIGRVAAGAVAKKILNSVAGVEIVAYVKRIKDLEASVDS-------------- 168

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
            N++  ++V+ + VRCP+   +D+M E I  AK  +DS+GG + CV R+VP GLGEP FD
Sbjct: 169 -NSVTIQQVESNIVRCPNPESADQMIELIERAKRDQDSLGGVVECVARHVPKGLGEPVFD 227

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQGG 300
           KLEA+ A A++S+PATKGFEIGSGF GTT+ G +HND + L +N    T TN SGG QGG
Sbjct: 228 KLEAELAKAIMSLPATKGFEIGSGFAGTTMTGSEHNDQYYLDENGETRTVTNRSGGIQGG 287

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGENI  R AFKP ATI ++Q T T +G + VLAA+GRHDPCV+PRAVP+VE+M ALV
Sbjct: 288 ISNGENIILRAAFKPTATIGKQQRTVTNSGDETVLAAKGRHDPCVLPRAVPMVEAMVALV 347

Query: 361 IMDALMIQQSR 371
           + D  +  Q++
Sbjct: 348 LCDHFLRHQAQ 358



>gi|434398292|ref|YP_007132296.1| chorismate synthase [Stanieria cyanosphaera PCC 7437]
 gi|505005899|ref|WP_015193001.1| chorismate synthase [Stanieria cyanosphaera]
 gi|428269389|gb|AFZ35330.1| chorismate synthase [Stanieria cyanosphaera PCC 7437]
          Length = 363

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 206/371 (55%), Positives = 258/371 (69%), Gaps = 16/371 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           +TFG LFR+TTFGESHG  VG ++DGCPP L + EA+IQI LDRR+PGQS +TTPR E D
Sbjct: 3   NTFGHLFRITTFGESHGGGVGVVIDGCPPQLEISEAEIQIDLDRRKPGQSKITTPRKESD 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SG   G TLGTPI +LV N+D R  DY E     RPSHAD TY  KY I+   GG
Sbjct: 63  TCQIISGVFEGKTLGTPIAILVTNKDARSQDYDEMAYKYRPSHADATYDAKYGIRNWQGG 122

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GRASARETIGRVAAGA+A+K L  V GVEIVA+V  + ++     +              
Sbjct: 123 GRASARETIGRVAAGAVAKKILNSVAGVEIVAYVKRIKDLEASVDS-------------- 168

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
            N++  ++V+ + VRCP+   +D+M E I  AK  +DS+GG + CV R+VP GLGEP FD
Sbjct: 169 -NSVTIQQVESNIVRCPNPESADQMIELIERAKRDQDSLGGVVECVARHVPKGLGEPVFD 227

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQGG 300
           KLEA+ A A++S+PATKGFEIGSGF GTT+ G +HND + L +N    T TN SGG QGG
Sbjct: 228 KLEAELAKAIMSLPATKGFEIGSGFAGTTMTGSEHNDQYYLDENGETRTVTNRSGGIQGG 287

Query: 301 ITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALV 360
           I+NGENI  R AFKP ATI ++Q T T +G + VLAA+GRHDPCV+PRAVP+VE+M ALV
Sbjct: 288 ISNGENIILRAAFKPTATIGKQQRTVTNSGDETVLAAKGRHDPCVLPRAVPMVEAMVALV 347

Query: 361 IMDALMIQQSR 371
           + D  +  Q++
Sbjct: 348 LCDHFLRHQAQ 358



>gi|384247559|gb|EIE21045.1| chorismate synthase [Coccomyxa subellipsoidea C-169]
          Length = 429

 Score =  400 bits (1027), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 200/380 (52%), Positives = 259/380 (68%), Gaps = 18/380 (4%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           STFG  FRVTTFGESHGK VGC++DG PP L + + +IQ +LDRRRPGQS +TTPR E D
Sbjct: 41  STFGHSFRVTTFGESHGKGVGCVIDGVPPRLPITKEEIQEELDRRRPGQSRITTPRKESD 100

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
              I SG   GI+LGTPI ++VPN DQ+  DYSE  +  RPSHAD TY  KY I+A +GG
Sbjct: 101 TCEIYSGVSDGISLGTPICIMVPNTDQKSQDYSEMSVAYRPSHADATYDMKYGIRAVAGG 160

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGAIA+K L++V GVE++A+VS V ++     N              
Sbjct: 161 GRSSARETIGRVAAGAIAKKLLRIVAGVEVLAYVSRVKDVGCTVDN-------------- 206

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
            +T    +++ + VRCPD   +  M   I E +   DS GG +TCV+R  P GLG P FD
Sbjct: 207 -STFTLADIEANKVRCPDAEAAKAMYAAIDEVRVRGDSCGGEVTCVVRACPKGLGAPVFD 265

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKNDRLGTKTNNSGGTQGGI 301
           KLEA+   A +S+PA+KG EIGSGF G+ + G +HND + + +  + T+TN SGG QGG+
Sbjct: 266 KLEAELCKAFMSLPASKGVEIGSGFSGSEMLGSEHNDEFFMDDGVIRTRTNRSGGIQGGL 325

Query: 302 TNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALVI 361
           +NGE+I  ++AFKP +TIS++Q T + NG    L ARGRHDPCVVPRAVP+VE+MAALV+
Sbjct: 326 SNGEDIVAKIAFKPTSTISRKQNTVSRNGEMVELIARGRHDPCVVPRAVPMVEAMAALVL 385

Query: 362 MDALMIQQSRKTVASLLPPN 381
            D L+   ++     LLP N
Sbjct: 386 ADQLLQHYAQ---CELLPRN 402



>gi|218439315|ref|YP_002377644.1| chorismate synthase [Cyanothece sp. PCC 7424]
 gi|506434663|ref|WP_015954380.1| chorismate synthase [Cyanothece sp. PCC 7424]
 gi|226723818|sp|B7KIU0.1|AROC_CYAP7 RecName: Full=Chorismate synthase; AltName:
           Full=5-enolpyruvylshikimate-3-phosphate phospholyase
 gi|218172043|gb|ACK70776.1| Chorismate synthase [Cyanothece sp. PCC 7424]
          Length = 362

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 209/364 (57%), Positives = 255/364 (70%), Gaps = 16/364 (4%)

Query: 4   FGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKDKV 63
           FG LFR+TTFGESHG  VG ++DGCPP + + E +IQ++LDRRRPGQS +TTPR E D  
Sbjct: 5   FGHLFRITTFGESHGGGVGVVIDGCPPRIEISETEIQLELDRRRPGQSKITTPRQESDTC 64

Query: 64  AIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGGGR 123
            I SG   G TLGT I +LV N+D R  DY E  L  RPSHAD TY  KY I+   GGGR
Sbjct: 65  EIISGVFEGKTLGTSIAILVRNKDARSQDYDEMALKYRPSHADATYDAKYGIRNWKGGGR 124

Query: 124 ASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWELLN 183
           +SARETIGRVAAGAIA+K L+ V GVEIVA+V  + ++    IN       PE       
Sbjct: 125 SSARETIGRVAAGAIAKKILQQVAGVEIVAYVKRIKDLE-AIIN-------PE------- 169

Query: 184 TIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFDKL 243
           T+  EEV+ + VRCPD+  + KM + I + +  KDS+GG + CV+RNVP GLGEP FDKL
Sbjct: 170 TVTLEEVESNIVRCPDQDAAQKMIDLIDQTRREKDSIGGVVECVMRNVPKGLGEPVFDKL 229

Query: 244 EAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVL-KNDRLGTKTNNSGGTQGGIT 302
           EA  A  M+S+PATKGFEIGSGF GT L G +HND +   +   + T TN SGG QGGI+
Sbjct: 230 EADLAKGMMSLPATKGFEIGSGFAGTLLTGSEHNDEFYTDEAGNIRTVTNLSGGIQGGIS 289

Query: 303 NGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAALVIM 362
           NGENI  RVAFKP ATI +EQ+T T  G +  LAA+GRHDPCV+PRAVP+VE+MAALV+ 
Sbjct: 290 NGENIIIRVAFKPTATIGKEQQTVTQTGEETTLAAKGRHDPCVLPRAVPMVEAMAALVLC 349

Query: 363 DALM 366
           D L+
Sbjct: 350 DHLL 353



>gi|16330007|ref|NP_440735.1| chorismate synthase [Synechocystis sp. PCC 6803]
 gi|383321750|ref|YP_005382603.1| chorismate synthase [Synechocystis sp. PCC 6803 substr. GT-I]
 gi|383324919|ref|YP_005385772.1| chorismate synthase [Synechocystis sp. PCC 6803 substr. PCC-P]
 gi|383490803|ref|YP_005408479.1| chorismate synthase [Synechocystis sp. PCC 6803 substr. PCC-N]
 gi|384436070|ref|YP_005650794.1| chorismate synthase [Synechocystis sp. PCC 6803]
 gi|451814166|ref|YP_007450618.1| chorismate synthase [Synechocystis sp. PCC 6803]
 gi|499174458|ref|WP_010872045.1| chorismate synthase [Synechocystis sp. PCC 6803]
 gi|728895|sp|P23353.2|AROC_SYNY3 RecName: Full=Chorismate synthase; AltName:
           Full=5-enolpyruvylshikimate-3-phosphate phospholyase
 gi|452798|emb|CAA47855.1| chorismate synthase [Synechocystis sp. PCC 6803]
 gi|1652494|dbj|BAA17415.1| chorismate synthase [Synechocystis sp. PCC 6803]
 gi|339273102|dbj|BAK49589.1| chorismate synthase [Synechocystis sp. PCC 6803]
 gi|359271069|dbj|BAL28588.1| chorismate synthase [Synechocystis sp. PCC 6803 substr. GT-I]
 gi|359274239|dbj|BAL31757.1| chorismate synthase [Synechocystis sp. PCC 6803 substr. PCC-N]
 gi|359277409|dbj|BAL34926.1| chorismate synthase [Synechocystis sp. PCC 6803 substr. PCC-P]
 gi|407957903|dbj|BAM51143.1| chorismate synthase [Bacillus subtilis BEST7613]
 gi|451780135|gb|AGF51104.1| chorismate synthase [Synechocystis sp. PCC 6803]
          Length = 362

 Score =  399 bits (1025), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 212/373 (56%), Positives = 260/373 (69%), Gaps = 20/373 (5%)

Query: 2   STFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEKD 61
           +TFG+LFR+TTFGESHG  VG I+DGCPP L +   +IQ+ LDRRRPGQS +TTPR E D
Sbjct: 3   NTFGSLFRITTFGESHGGGVGVIIDGCPPRLEISPEEIQVDLDRRRPGQSKITTPRKEAD 62

Query: 62  KVAIQSGTESGITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASSGG 121
           +  I SG   G TLGTPI +LV N+D R  DY+E  +  RPSHAD TY  KY I+   GG
Sbjct: 63  QCEILSGVFEGKTLGTPIAILVRNKDARSQDYNEMAVKYRPSHADATYEAKYGIRNWQGG 122

Query: 122 GRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFPEDFWEL 181
           GR+SARETIGRVAAGAIA+K L   +GVEIVA+V S+ +I     +              
Sbjct: 123 GRSSARETIGRVAAGAIAKKILAQFNGVEIVAYVKSIQDIEATVDS-------------- 168

Query: 182 LNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGEPCFD 241
            NT+  E+V+ + VRCPD+  ++KM ERI +    KDS+GG + C IRN P GLGEP FD
Sbjct: 169 -NTVTLEQVESNIVRCPDEECAEKMIERIDQVLRQKDSIGGVVECAIRNAPKGLGEPVFD 227

Query: 242 KLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKNDRLG---TKTNNSGGTQ 298
           KLEA  A AM+S+PATKGFE GSGF GT L G QHND + L  D  G   T+TN SGG Q
Sbjct: 228 KLEADLAKAMMSLPATKGFEFGSGFAGTLLTGSQHNDEYYL--DEAGEWRTRTNRSGGVQ 285

Query: 299 GGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMAA 358
           GGI+NGE I  R+AFKP ATI QEQ+T +  G +  LAA+GRHDPCV+PRAVP+VE+MAA
Sbjct: 286 GGISNGEPIIMRIAFKPTATIGQEQKTVSNIGEETTLAAKGRHDPCVLPRAVPMVEAMAA 345

Query: 359 LVIMDALMIQQSR 371
           LV+ D L+  Q++
Sbjct: 346 LVLCDHLLRFQAQ 358



>gi|145528205|ref|XP_001449902.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124417491|emb|CAK82505.1| unnamed protein product [Paramecium tetraurelia]
          Length = 362

 Score =  399 bits (1024), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 207/374 (55%), Positives = 263/374 (70%), Gaps = 15/374 (4%)

Query: 1   MSTFGTLFRVTTFGESHGKSVGCIVDGCPPGLSLVEADIQIQLDRRRPGQSNLTTPRDEK 60
           MSTFG  +RVTTFGESH K+VGC++DG P    + +  +Q QL+RRRPGQ+ LTT RDEK
Sbjct: 1   MSTFGQKYRVTTFGESHSKAVGCVIDGFPSNFKIDQDALQYQLNRRRPGQTKLTTQRDEK 60

Query: 61  DKVAIQSGTESG-ITLGTPIGLLVPNQDQRPHDYSETDLYPRPSHADWTYLQKYSIKASS 119
           DK  I SG  +  +TLG+PI ++V N+D RP DY + D  PRP HAD+TY  KY I+A S
Sbjct: 61  DKAIIISGLNTQHLTLGSPIMIMVYNEDMRPQDYKQFDDIPRPGHADFTYQMKYEIRAES 120

Query: 120 GGGRASARETIGRVAAGAIAEKYLKLVHGVEIVAFVSSVSNIAMPFINEQDERLFP--ED 177
           GGGR+SARETIGRV  GAIA++YL  ++ V I A+VSSV NI +P   +Q   L P  +D
Sbjct: 121 GGGRSSARETIGRVCGGAIAQQYLSQMN-VSISAWVSSVGNIEIPKEVQQQLILNPPTQD 179

Query: 178 FWELLNTIRREEVDKDAVRCPDKTVSDKMRERIHEAKEAKDSVGGTITCVIRNVPVGLGE 237
             E +N        K   R P +  + +M + I + K  KDS+GGT+TCVI+  P+GLGE
Sbjct: 180 QIEEVNA-------KYQFRNPHQESALEMVKLIEQVKLDKDSIGGTVTCVIKGCPIGLGE 232

Query: 238 PCFDKLEAKFAHAMLSIPATKGFEIGSGFKGTTLFGHQHNDPWVLKNDRLGTKTNNSGGT 297
           PCFDK +A  AHA++SIPATKGFE GSGF+GT   G  HND +  KN  L   TNN+GGT
Sbjct: 233 PCFDKFQAVLAHAIMSIPATKGFEFGSGFEGTKQRGSAHNDRF--KN--LKPITNNAGGT 288

Query: 298 QGGITNGENIYFRVAFKPPATISQEQETATYNGVDGVLAARGRHDPCVVPRAVPIVESMA 357
            GGITNGENIYF+VAFKP +TI  EQET+ + G D +L A GRHDPCVV RAVP+VESMA
Sbjct: 289 LGGITNGENIYFKVAFKPVSTIGLEQETSNFKGEDIILEAHGRHDPCVVSRAVPVVESMA 348

Query: 358 ALVIMDALMIQQSR 371
           A+V++D  ++ + +
Sbjct: 349 AIVVLDLYLLSKQK 362