BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10192_c0_seq1-m.81 5prime_partial 2-982(+) 327 (+)
         (326 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|511009621|gb|EPB90859.1| hypothetical protein HMPREF1544_0227...   273   7e-71   Mucor circinelloides f. circinelloides 1006PhL
gi|470320200|gb|EMR11796.1| hypothetical protein PNEG_00222 [Pne...   271   1e-70   Pneumocystis murina B123
gi|395333041|gb|EJF65419.1| hypothetical protein DICSQDRAFT_1330...   271   3e-70   Dichomitus squalens LYAD-421 SS1
gi|409045165|gb|EKM54646.1| hypothetical protein PHACADRAFT_2586...   268   1e-69   Phanerochaete carnosa HHB-10118-sp
gi|443897479|dbj|GAC74819.1| molecular chaperone [Pseudozyma ant...   267   2e-69   Moesziomyces antarcticus T-34
gi|392569480|gb|EIW62653.1| hypothetical protein TRAVEDRAFT_1128...   266   5e-69   Trametes versicolor FP-101664 SS1
gi|170117305|ref|XP_001889840.1| clc channel [Laccaria bicolor S...   264   2e-68   Laccaria bicolor S238N-H82
gi|71019585|ref|XP_760023.1| hypothetical protein UM03876.1 [Ust...   263   6e-68   
gi|392594011|gb|EIW83336.1| hypothetical protein CONPUDRAFT_5294...   261   2e-67   Coniophora puteana RWD-64-598 SS2
gi|336371403|gb|EGN99742.1| hypothetical protein SERLA73DRAFT_88...   261   2e-67   Serpula lacrymans var. lacrymans S7.3
gi|402222258|gb|EJU02325.1| clc channel [Dacryopinax sp. DJM-731...   260   4e-67   Dacryopinax primogenitus
gi|449546693|gb|EMD37662.1| hypothetical protein CERSUDRAFT_1143...   259   5e-67   Gelatoporia subvermispora B
gi|501303509|dbj|GAC92932.1| hypothetical protein PHSY_000491 [P...   259   9e-67   Pseudozyma hubeiensis SY62
gi|403412008|emb|CCL98708.1| predicted protein [Fibroporia radic...   258   2e-66   Fibroporia radiculosa
gi|388858145|emb|CCF48213.1| related to chloride channel protein...   257   3e-66   Ustilago hordei
gi|393217719|gb|EJD03208.1| clc channel [Fomitiporia mediterrane...   256   8e-66   Fomitiporia mediterranea MF3/22
gi|353238563|emb|CCA70505.1| related to chloride channel protein...   255   1e-65   Serendipita indica DSM 11827
gi|426197564|gb|EKV47491.1| hypothetical protein AGABI2DRAFT_700...   254   2e-65   Agaricus bisporus var. bisporus H97
gi|409080650|gb|EKM81010.1| hypothetical protein AGABI1DRAFT_372...   254   2e-65   Agaricus bisporus var. burnettii JB137-S8
gi|343424957|emb|CBQ68494.1| related to chloride channel protein...   254   2e-65   Sporisorium reilianum SRZ2
gi|390602524|gb|EIN11917.1| hypothetical protein PUNSTDRAFT_6184...   253   4e-65   Punctularia strigosozonata HHB-11173 SS5
gi|299751204|ref|XP_002911604.1| voltage-gated chloride channel ...   253   4e-65   Coprinopsis cinerea okayama7#130
gi|384500420|gb|EIE90911.1| hypothetical protein RO3G_15622 [Rhi...   251   2e-64   Rhizopus delemar RA 99-880
gi|389741902|gb|EIM83090.1| hypothetical protein STEHIDRAFT_6367...   250   3e-64   Stereum hirsutum FP-91666 SS1
gi|302679442|ref|XP_003029403.1| hypothetical protein SCHCODRAFT...   249   6e-64   Schizophyllum commune H4-8
gi|321259349|ref|XP_003194395.1| voltage-gated chloride channel ...   244   3e-62   Cryptococcus gattii WM276
gi|58267620|ref|XP_570966.1| voltage-gated chloride channel [Cry...   242   1e-61   Cryptococcus neoformans var. neoformans JEC21
gi|405120892|gb|AFR95662.1| voltage-gated chloride channel [Cryp...   241   2e-61   
gi|393234764|gb|EJD42324.1| clc channel [Auricularia delicata TF...   241   2e-61   Auricularia subglabra TFB-10046 SS5
gi|392574163|gb|EIW67300.1| hypothetical protein TREMEDRAFT_3402...   239   5e-61   Tremella mesenterica DSM 1558
gi|406700654|gb|EKD03819.1| voltage-gated chloride channel [Tric...   232   9e-59   Trichosporon asahii var. asahii CBS 8904
gi|401882637|gb|EJT46888.1| voltage-gated chloride channel [Tric...   232   9e-59   Trichosporon asahii var. asahii CBS 2479
gi|407928769|gb|EKG21618.1| Chloride channel voltage gated [Macr...   231   3e-58   Macrophomina phaseolina MS6
gi|328770954|gb|EGF80995.1| hypothetical protein BATDEDRAFT_8819...   229   5e-58   Batrachochytrium dendrobatidis JAM81
gi|345569240|gb|EGX52108.1| hypothetical protein AOL_s00043g498 ...   229   7e-58   Arthrobotrys oligospora ATCC 24927
gi|472244943|gb|EMR89544.1| putative voltage gated chloride chan...   228   1e-57   Botrytis cinerea BcDW1
gi|391332631|ref|XP_003740736.1| PREDICTED: H(+)/Cl(-) exchange ...   228   2e-57   Metaseiulus occidentalis
gi|429858500|gb|ELA33316.1| chloride channel protein 3 [Colletot...   226   5e-57   Colletotrichum gloeosporioides Nara gc5
gi|345495146|ref|XP_001603848.2| PREDICTED: H(+)/Cl(-) exchange ...   226   6e-57   Nasonia vitripennis
gi|345495144|ref|XP_003427444.1| PREDICTED: H(+)/Cl(-) exchange ...   226   8e-57   Nasonia vitripennis
gi|452984946|gb|EME84703.1| hypothetical protein MYCFIDRAFT_1351...   226   9e-57   Cercospora fijiensis CIRAD86
gi|67539874|ref|XP_663711.1| hypothetical protein AN6107.2 [Aspe...   226   9e-57   Aspergillus nidulans FGSC A4
gi|29825714|gb|AAO91914.1| CLC channel [Emericella nidulans]          226   9e-57   Aspergillus nidulans
gi|485926509|gb|EOD50757.1| putative voltage-gated chloride chan...   225   1e-56   Neofusicoccum parvum UCRNP2
gi|336264823|ref|XP_003347187.1| hypothetical protein SMAC_08079...   225   2e-56   Sordaria macrospora k-hell
gi|164428859|ref|XP_957245.2| hypothetical protein NCU00121 [Neu...   225   2e-56   
gi|367050938|ref|XP_003655848.1| hypothetical protein THITE_2119...   224   2e-56   Thielavia terrestris NRRL 8126
gi|494827545|gb|EON64495.1| hypothetical protein W97_03727 [Coni...   224   2e-56   Coniosporium apollinis CBS 100218
gi|336469657|gb|EGO57819.1| hypothetical protein NEUTE1DRAFT_817...   224   2e-56   Neurospora tetrasperma FGSC 2508
gi|169783844|ref|XP_001826384.1| voltage-gated chloride channel ...   224   2e-56   Aspergillus oryzae RIB40
gi|242776743|ref|XP_002478893.1| voltage-gated chloride channel ...   224   3e-56   Talaromyces stipitatus ATCC 10500
gi|512190468|gb|EPE06232.1| chloride channel protein 3 [Ophiosto...   223   4e-56   Ophiostoma piceae UAMH 11346
gi|113931518|ref|NP_001039210.1| chloride channel, voltage-sensi...   223   4e-56   Xenopus tropicalis [western clawed frog]
gi|148223531|ref|NP_001080969.1| chloride channel, voltage-sensi...   223   6e-56   Xenopus laevis [clawed frog]
gi|157123916|ref|XP_001653972.1| chloride channel protein 3 [Aed...   223   6e-56   Aedes aegypti
gi|470302333|ref|XP_004347591.1| chloride channel 3 [Capsaspora ...   223   6e-56   
gi|212532855|ref|XP_002146584.1| voltage-gated chloride channel ...   223   7e-56   Talaromyces marneffei ATCC 18224
gi|453082479|gb|EMF10526.1| chloride channel protein 3 [Mycospha...   223   7e-56   Sphaerulina musiva SO2202
gi|122936366|gb|AAI30106.1| Clcn5-A protein [Xenopus laevis]          223   8e-56   Xenopus laevis [clawed frog]
gi|115443394|ref|XP_001218504.1| hypothetical protein ATEG_09882...   223   8e-56   Aspergillus terreus NIH2624
gi|477526550|gb|ENH78417.1| chloride channel protein 3 [Colletot...   223   8e-56   Colletotrichum orbiculare MAFF 240422
gi|440636972|gb|ELR06891.1| hypothetical protein GMDG_02261 [Geo...   222   9e-56   Pseudogymnoascus destructans 20631-21
gi|160420279|ref|NP_001081509.1| chloride channel, voltage-sensi...   222   1e-55   Xenopus laevis [clawed frog]
gi|396480274|ref|XP_003840957.1| hypothetical protein LEMA_P1060...   222   1e-55   Leptosphaeria maculans JN3
gi|430811933|emb|CCJ30639.1| unnamed protein product [Pneumocyst...   222   1e-55   Pneumocystis jirovecii
gi|449269802|gb|EMC80548.1| H(+)/Cl(-) exchange transporter 5, p...   222   1e-55   Columba livia [carrier pigeon]
gi|170037222|ref|XP_001846458.1| chloride channel protein 3 [Cul...   222   1e-55   Culex quinquefasciatus
gi|158294756|ref|XP_001688728.1| AGAP005777-PA [Anopheles gambia...   221   1e-55   Anopheles gambiae str. PEST
gi|472582945|gb|EMS20607.1| voltage-gated chloride channel [Rhod...   221   2e-55   Rhodotorula toruloides NP11
gi|121698423|ref|XP_001267816.1| voltage-gated chloride channel ...   221   2e-55   Aspergillus clavatus NRRL 1
gi|449303008|gb|EMC99016.1| hypothetical protein BAUCODRAFT_1037...   221   2e-55   Baudoinia panamericana UAMH 10762
gi|330926068|ref|XP_003301311.1| hypothetical protein PTT_12780 ...   221   3e-55   Pyrenophora teres f. teres 0-1
gi|71001086|ref|XP_755224.1| voltage-gated chloride channel (Clc...   221   3e-55   Aspergillus fumigatus Af293
gi|169619307|ref|XP_001803066.1| hypothetical protein SNOG_12848...   221   3e-55   Parastagonospora nodorum SN15
gi|240972665|ref|XP_002401153.1| chloride channel, putative [Ixo...   220   3e-55   Ixodes scapularis [blacklegged tick]
gi|302509278|ref|XP_003016599.1| hypothetical protein ARB_04888 ...   220   4e-55   Arthroderma benhamiae CBS 112371
gi|396479619|ref|XP_003840798.1| similar to voltage-gated protei...   220   4e-55   Leptosphaeria maculans JN3
gi|328699860|ref|XP_001947783.2| PREDICTED: H(+)/Cl(-) exchange ...   220   5e-55   
gi|400596235|gb|EJP64011.1| voltage gated chloride channel [Beau...   220   5e-55   Beauveria bassiana ARSEF 2860
gi|513180851|ref|XP_004940780.1| PREDICTED: H(+)/Cl(-) exchange ...   220   5e-55   
gi|513180842|ref|XP_004940778.1| PREDICTED: H(+)/Cl(-) exchange ...   220   5e-55   
gi|395546354|ref|XP_003775053.1| PREDICTED: H(+)/Cl(-) exchange ...   220   5e-55   
gi|513180845|ref|XP_420265.3| PREDICTED: H(+)/Cl(-) exchange tra...   219   6e-55   
gi|189207222|ref|XP_001939945.1| chloride channel protein 3 [Pyr...   219   6e-55   Pyrenophora tritici-repentis Pt-1C-BFP
gi|395546356|ref|XP_003775054.1| PREDICTED: H(+)/Cl(-) exchange ...   219   7e-55   
gi|296423317|ref|XP_002841201.1| hypothetical protein [Tuber mel...   219   7e-55   Tuber melanosporum Mel28
gi|513180854|ref|XP_004940781.1| PREDICTED: H(+)/Cl(-) exchange ...   219   7e-55   
gi|326924401|ref|XP_003208416.1| PREDICTED: H(+)/Cl(-) exchange ...   219   8e-55   
gi|119480729|ref|XP_001260393.1| voltage-gated chloride channel ...   219   8e-55   Aspergillus fischeri NRRL 181
gi|156361254|ref|XP_001625433.1| predicted protein [Nematostella...   219   1e-54   Nematostella vectensis
gi|452843228|gb|EME45163.1| hypothetical protein DOTSEDRAFT_7101...   219   1e-54   Dothistroma septosporum NZE10
gi|341897839|gb|EGT53774.1| hypothetical protein CAEBREN_31647 [...   218   1e-54   Caenorhabditis brenneri
gi|388582076|gb|EIM22382.1| hypothetical protein WALSEDRAFT_3206...   218   2e-54   Wallemia mellicola CBS 633.66
gi|475673036|gb|EMT70159.1| H(+)/Cl(-) exchange transporter 3 [F...   218   2e-54   Fusarium oxysporum f. sp. cubense race 4
gi|477521120|gb|ENH73239.1| H(+)/Cl(-) exchange transporter 3 [F...   218   2e-54   Fusarium oxysporum f. sp. cubense race 1
gi|512203869|gb|EPE32693.1| Clc chloride channel [Glarea lozoyen...   218   2e-54   Glarea lozoyensis ATCC 20868
gi|347442047|emb|CCD34968.1| hypothetical protein BofuT4_P082900...   218   2e-54   Botrytis cinerea T4
gi|399172332|emb|CCE27017.1| related to CLC chloride channel pro...   218   2e-54   Claviceps purpurea 20.1
gi|358369859|dbj|GAA86472.1| voltage-gated chloride channel [Asp...   218   2e-54   Aspergillus kawachii IFO 4308
gi|308509172|ref|XP_003116769.1| CRE-CLH-5 protein [Caenorhabdit...   218   2e-54   Caenorhabditis remanei
gi|483511842|gb|EOB00532.1| Chloride channel protein 5, partial ...   218   2e-54   Anas platyrhynchos [duck]
gi|498986256|ref|XP_004530809.1| PREDICTED: H(+)/Cl(-) exchange ...   218   2e-54   Ceratitis capitata
gi|268532564|ref|XP_002631410.1| C. briggsae CBR-CLH-5 protein [...   218   3e-54   Caenorhabditis briggsae
gi|380471617|emb|CCF47191.1| voltage gated chloride channel [Col...   217   3e-54   Colletotrichum higginsianum
gi|340905339|gb|EGS17707.1| voltage-gated chloride channel-like ...   217   4e-54   Chaetomium thermophilum var. thermophilum DSM 1495
gi|328772574|gb|EGF82612.1| hypothetical protein BATDEDRAFT_3434...   217   4e-54   Batrachochytrium dendrobatidis JAM81
gi|341879113|gb|EGT35048.1| CBN-CLH-5 protein [Caenorhabditis br...   217   4e-54   Caenorhabditis brenneri
gi|302654189|ref|XP_003018904.1| hypothetical protein TRV_07072 ...   216   5e-54   Trichophyton verrucosum HKI 0517
gi|17532615|ref|NP_495940.1| Protein CLH-5 [Caenorhabditis elega...   216   6e-54   Caenorhabditis elegans [roundworm]
gi|116191871|ref|XP_001221748.1| hypothetical protein CHGG_05653...   216   6e-54   Chaetomium globosum CBS 148.51
gi|326469607|gb|EGD93616.1| voltage-gated chloride channel [Tric...   216   7e-54   Trichophyton tonsurans CBS 112818
gi|327303448|ref|XP_003236416.1| voltage gated chloride channel ...   216   8e-54   Trichophyton rubrum CBS 118892
gi|513021584|ref|XP_004872064.1| PREDICTED: H(+)/Cl(-) exchange ...   216   9e-54   Heterocephalus glaber [naked mole rat]
gi|350636876|gb|EHA25234.1| hypothetical protein ASPNIDRAFT_2115...   216   9e-54   Aspergillus niger ATCC 1015
gi|317033366|ref|XP_001395529.2| voltage-gated chloride channel ...   216   1e-53   Aspergillus niger CBS 513.88
gi|451850601|gb|EMD63903.1| hypothetical protein COCSADRAFT_2721...   215   1e-53   Bipolaris sorokiniana ND90Pr
gi|452000640|gb|EMD93101.1| hypothetical protein COCHEDRAFT_1172...   215   1e-53   Bipolaris maydis C5
gi|432110168|gb|ELK33945.1| H(+)/Cl(-) exchange transporter 5 [M...   215   1e-53   Myotis davidii
gi|296812691|ref|XP_002846683.1| chloride channel protein 3 [Art...   215   1e-53   Arthroderma otae CBS 113480
gi|513021590|ref|XP_004872067.1| PREDICTED: H(+)/Cl(-) exchange ...   215   1e-53   Heterocephalus glaber [naked mole rat]
gi|513021588|ref|XP_004872066.1| PREDICTED: H(+)/Cl(-) exchange ...   215   1e-53   Heterocephalus glaber [naked mole rat]
gi|307199100|gb|EFN79810.1| Chloride channel protein 3 [Harpegna...   215   1e-53   Harpegnathos saltator
gi|507969644|ref|XP_004690100.1| PREDICTED: H(+)/Cl(-) exchange ...   215   2e-53   
gi|507969635|ref|XP_004690097.1| PREDICTED: H(+)/Cl(-) exchange ...   215   2e-53   
gi|505755412|gb|EOQ99629.1| H(+)/Cl(-) exchange transporter 5 [W...   215   2e-53   Wallemia ichthyophaga EXF-994
gi|315050608|ref|XP_003174678.1| hypothetical protein MGYG_02209...   215   2e-53   Microsporum gypseum CBS 118893
gi|507969641|ref|XP_004690099.1| PREDICTED: H(+)/Cl(-) exchange ...   215   2e-53   
gi|505793802|ref|XP_004606515.1| PREDICTED: H(+)/Cl(-) exchange ...   215   2e-53   
gi|126723543|ref|NP_001075537.1| H(+)/Cl(-) exchange transporter...   215   2e-53   Oryctolagus cuniculus [European rabbit]
gi|505793795|ref|XP_004606513.1| PREDICTED: H(+)/Cl(-) exchange ...   215   2e-53   
gi|505793806|ref|XP_004606516.1| PREDICTED: H(+)/Cl(-) exchange ...   215   2e-53   Sorex araneus [Eurasian shrew]
gi|451993237|gb|EMD85711.1| hypothetical protein COCHEDRAFT_1228...   214   2e-53   Bipolaris maydis C5
gi|380027901|ref|XP_003697653.1| PREDICTED: H(+)/Cl(-) exchange ...   214   2e-53   
gi|504151264|ref|XP_004587993.1| PREDICTED: H(+)/Cl(-) exchange ...   214   2e-53   
gi|242023116|ref|XP_002431982.1| Chloride channel protein, putat...   214   2e-53   Pediculus humanus corporis [human body lice]
gi|302903816|ref|XP_003048939.1| predicted protein [Nectria haem...   214   2e-53   Nectria haematococca mpVI 77-13-4
gi|328793201|ref|XP_392670.3| PREDICTED: H(+)/Cl(-) exchange tra...   214   2e-53   
gi|449498719|ref|XP_002195118.2| PREDICTED: H(+)/Cl(-) exchange ...   214   2e-53   
gi|405963612|gb|EKC29174.1| H(+)/Cl(-) exchange transporter 3 [C...   214   2e-53   Crassostrea gigas
gi|444521988|gb|ELV13254.1| H(+)/Cl(-) exchange transporter 5 [T...   214   2e-53   Tupaia chinensis
gi|854102|emb|CAA55280.1| chloride channel 3 [Homo sapiens]           214   2e-53   Homo sapiens [man]
gi|332019976|gb|EGI60436.1| H(+)/Cl(-) exchange transporter 3 [A...   214   2e-53   Acromyrmex echinatior
gi|260310527|gb|ACX36518.1| RE11344p [Drosophila melanogaster]        214   2e-53   Drosophila melanogaster
gi|507707999|ref|XP_004646327.1| PREDICTED: H(+)/Cl(-) exchange ...   214   2e-53   Octodon degus
gi|198464545|ref|XP_001353267.2| GA18785 [Drosophila pseudoobscu...   214   2e-53   Drosophila pseudoobscura pseudoobscura
gi|504151266|ref|XP_004587994.1| PREDICTED: H(+)/Cl(-) exchange ...   214   3e-53   Ochotona princeps [southern American pika]
gi|340382150|ref|XP_003389584.1| PREDICTED: H(+)/Cl(-) exchange ...   214   3e-53   
gi|504151261|ref|XP_004587992.1| PREDICTED: H(+)/Cl(-) exchange ...   214   3e-53   Ochotona princeps [southern American pika]
gi|425766652|gb|EKV05255.1| Voltage-gated chloride channel (ClcA...   214   3e-53   Penicillium digitatum Pd1
gi|21744243|gb|AAM76180.1| LD07266p [Drosophila melanogaster]         214   3e-53   Drosophila melanogaster
gi|466068866|ref|XP_004281970.1| PREDICTED: H(+)/Cl(-) exchange ...   214   3e-53   
gi|24665008|ref|NP_648834.1| chloride channel-c, isoform B [Dros...   214   3e-53   Drosophila melanogaster
gi|195160217|ref|XP_002020972.1| GL25087 [Drosophila persimilis]...   214   3e-53   Drosophila persimilis
gi|320545940|ref|NP_730105.3| chloride channel-c, isoform C [Dro...   214   3e-53   Drosophila melanogaster
gi|395854473|ref|XP_003799715.1| PREDICTED: H(+)/Cl(-) exchange ...   214   3e-53   
gi|507707995|ref|XP_004646326.1| PREDICTED: H(+)/Cl(-) exchange ...   214   3e-53   Octodon degus
gi|854103|emb|CAA55281.1| chloride channel 3 [Homo sapiens]           214   3e-53   Homo sapiens [man]
gi|350422945|ref|XP_003493337.1| PREDICTED: H(+)/Cl(-) exchange ...   214   3e-53   Bombus impatiens
gi|507708003|ref|XP_004646328.1| PREDICTED: H(+)/Cl(-) exchange ...   214   3e-53   
gi|426395919|ref|XP_004064206.1| PREDICTED: H(+)/Cl(-) exchange ...   214   3e-53   Gorilla gorilla gorilla [lowland gorilla]
gi|407928894|gb|EKG21737.1| Cystathionine beta-synthase core [Ma...   214   3e-53   Macrophomina phaseolina MS6
gi|449498725|ref|XP_004177289.1| PREDICTED: H(+)/Cl(-) exchange ...   214   3e-53   
gi|511867513|ref|XP_004755169.1| PREDICTED: H(+)/Cl(-) exchange ...   214   3e-53   Mustela putorius furo [black ferret]
gi|345807164|ref|XP_549002.3| PREDICTED: H(+)/Cl(-) exchange tra...   214   3e-53   Canis lupus familiaris [dogs]
gi|478521524|ref|XP_004434971.1| PREDICTED: H(+)/Cl(-) exchange ...   214   3e-53   Ceratotherium simum simum [southern square-lipped rhinoceros]
gi|431907761|gb|ELK11369.1| H(+)/Cl(-) exchange transporter 5 [P...   214   3e-53   Pteropus alecto
gi|488547161|ref|XP_004465089.1| PREDICTED: H(+)/Cl(-) exchange ...   214   3e-53   Dasypus novemcinctus
gi|297493135|ref|XP_002700128.1| PREDICTED: H(+)/Cl(-) exchange ...   214   3e-53   
gi|383858045|ref|XP_003704513.1| PREDICTED: LOW QUALITY PROTEIN:...   214   4e-53   
gi|346321274|gb|EGX90874.1| chloride channel protein 3 [Cordycep...   214   4e-53   Cordyceps militaris CM01
gi|426395917|ref|XP_004064205.1| PREDICTED: H(+)/Cl(-) exchange ...   214   4e-53   Gorilla gorilla gorilla [lowland gorilla]
gi|358419943|ref|XP_869706.4| PREDICTED: H(+)/Cl(-) exchange tra...   214   4e-53   Bos taurus [bovine]
gi|345807166|ref|XP_003435566.1| PREDICTED: H(+)/Cl(-) exchange ...   214   4e-53   Canis lupus familiaris [dogs]
gi|440912737|gb|ELR62278.1| H(+)/Cl(-) exchange transporter 5, p...   214   4e-53   Bos mutus
gi|477582473|gb|ENH99581.1| hypothetical protein COCC4DRAFT_7641...   214   4e-53   Bipolaris maydis ATCC 48331
gi|472354450|ref|XP_004396886.1| PREDICTED: H(+)/Cl(-) exchange ...   214   4e-53   Odobenus rosmarus divergens
gi|398406218|ref|XP_003854575.1| hypothetical protein MYCGRDRAFT...   214   4e-53   Zymoseptoria tritici IPO323
gi|5923861|gb|AAD56388.1|AF182215_1 chloride channel CLC-3 [Oreo...   214   4e-53   Oreochromis mossambicus [Hawaiian perch]
gi|511867519|ref|XP_004755171.1| PREDICTED: H(+)/Cl(-) exchange ...   214   4e-53   
gi|478521522|ref|XP_004434970.1| PREDICTED: H(+)/Cl(-) exchange ...   214   4e-53   
gi|443709820|gb|ELU04325.1| hypothetical protein CAPTEDRAFT_1752...   214   4e-53   Capitella teleta
gi|358419941|ref|XP_003584368.1| PREDICTED: H(+)/Cl(-) exchange ...   214   4e-53   
gi|426257013|ref|XP_004022129.1| PREDICTED: H(+)/Cl(-) exchange ...   213   4e-53   
gi|499040227|ref|XP_004570741.1| PREDICTED: H(+)/Cl(-) exchange ...   213   4e-53   
gi|466068861|ref|XP_004281969.1| PREDICTED: H(+)/Cl(-) exchange ...   213   4e-53   Orcinus orca [Orca]
gi|466068856|ref|XP_004281968.1| PREDICTED: H(+)/Cl(-) exchange ...   213   4e-53   Orcinus orca [Orca]
gi|301764735|ref|XP_002917788.1| PREDICTED: H(+)/Cl(-) exchange ...   213   4e-53   
gi|410988613|ref|XP_004000578.1| PREDICTED: H(+)/Cl(-) exchange ...   213   4e-53   
gi|472354446|ref|XP_004396884.1| PREDICTED: H(+)/Cl(-) exchange ...   213   4e-53   
gi|281353637|gb|EFB29221.1| hypothetical protein PANDA_006151 [A...   213   4e-53   Ailuropoda melanoleuca
gi|511867522|ref|XP_004755172.1| PREDICTED: H(+)/Cl(-) exchange ...   213   4e-53   Mustela putorius furo [black ferret]
gi|488547163|ref|XP_004465090.1| PREDICTED: H(+)/Cl(-) exchange ...   213   4e-53   Dasypus novemcinctus
gi|426257011|ref|XP_004022128.1| PREDICTED: H(+)/Cl(-) exchange ...   213   4e-53   
gi|195378823|ref|XP_002048181.1| GJ13821 [Drosophila virilis] >g...   213   5e-53   
gi|449302739|gb|EMC98747.1| hypothetical protein BAUCODRAFT_6511...   213   5e-53   Baudoinia panamericana UAMH 10762
gi|291190812|ref|NP_001167057.1| H(+)/Cl(-) exchange transporter...   213   5e-53   Salmo salar
gi|485920326|gb|EOD46387.1| putative chloride channel protein 5 ...   213   5e-53   Neofusicoccum parvum UCRNP2
gi|499040239|ref|XP_004570747.1| PREDICTED: H(+)/Cl(-) exchange ...   213   5e-53   Maylandia zebra
gi|511867531|ref|XP_004755175.1| PREDICTED: H(+)/Cl(-) exchange ...   213   5e-53   
gi|426257015|ref|XP_004022130.1| PREDICTED: H(+)/Cl(-) exchange ...   213   5e-53   Ovis aries [domestic sheep]
gi|195126427|ref|XP_002007672.1| GI13072 [Drosophila mojavensis]...   213   5e-53   Drosophila mojavensis
gi|171686950|ref|XP_001908416.1| hypothetical protein [Podospora...   213   5e-53   Podospora anserina S mat+
gi|344313157|ref|NP_001230691.1| H(+)/Cl(-) exchange transporter...   213   6e-53   Mus musculus [mouse]
gi|340727421|ref|XP_003402042.1| PREDICTED: LOW QUALITY PROTEIN:...   213   6e-53   
gi|344240845|gb|EGV96948.1| H(+)/Cl(-) exchange transporter 5 [C...   213   6e-53   Cricetulus griseus [Chinese hamsters]
gi|354487368|ref|XP_003505845.1| PREDICTED: H(+)/Cl(-) exchange ...   213   6e-53   
gi|402079028|gb|EJT74293.1| chloride channel protein 5 [Gaeumann...   213   6e-53   Gaeumannomyces graminis var. tritici R3-111a-1
gi|354487366|ref|XP_003505844.1| PREDICTED: H(+)/Cl(-) exchange ...   213   7e-53   Cricetulus griseus [Chinese hamsters]
gi|358396817|gb|EHK46198.1| hypothetical protein TRIATDRAFT_4009...   213   7e-53   Trichoderma atroviride IMI 206040
gi|74217072|dbj|BAE26635.1| unnamed protein product [Mus musculus]    213   7e-53   Mus musculus [mouse]
gi|47523078|ref|NP_999304.1| H(+)/Cl(-) exchange transporter 5 [...   213   7e-53   Sus scrofa [pigs]
gi|322795873|gb|EFZ18549.1| hypothetical protein SINV_04521 [Sol...   213   8e-53   Solenopsis invicta [imported red fire ant]
gi|148701943|gb|EDL33890.1| mCG3960, isoform CRA_b [Mus musculus]     213   8e-53   Mus musculus [mouse]
gi|261823931|ref|NP_057900.3| H(+)/Cl(-) exchange transporter 5 ...   213   8e-53   Mus musculus [mouse]
gi|334350497|ref|XP_001363734.2| PREDICTED: H(+)/Cl(-) exchange ...   213   8e-53   
gi|1705909|sp|P51796.1|CLCN5_RAT RecName: Full=H(+)/Cl(-) exchan...   213   8e-53   Rattus norvegicus [brown rat]
gi|8393141|ref|NP_058802.1| H(+)/Cl(-) exchange transporter 5 [R...   212   9e-53   Rattus norvegicus [brown rat]
gi|23271431|gb|AAH36347.1| Chloride channel 5 [Mus musculus]          212   9e-53   Mus musculus [mouse]
gi|332255569|ref|XP_003276905.1| PREDICTED: H(+)/Cl(-) exchange ...   212   9e-53   Nomascus leucogenys [White-cheeked Gibbon]
gi|296235492|ref|XP_002762907.1| PREDICTED: H(+)/Cl(-) exchange ...   212   1e-52   Callithrix jacchus [common marmoset]
gi|344292725|ref|XP_003418076.1| PREDICTED: H(+)/Cl(-) exchange ...   212   1e-52   
gi|471378166|ref|XP_004376888.1| PREDICTED: H(+)/Cl(-) exchange ...   212   1e-52   
gi|297303874|ref|XP_001083186.2| PREDICTED: H(+)/Cl(-) exchange ...   212   1e-52   Macaca mulatta [rhesus macaque]
gi|482806061|gb|EOA83134.1| hypothetical protein SETTUDRAFT_1645...   212   1e-52   Setosphaeria turcica Et28A
gi|296235494|ref|XP_002762908.1| PREDICTED: H(+)/Cl(-) exchange ...   212   1e-52   Callithrix jacchus [common marmoset]
gi|109130778|ref|XP_001083430.1| PREDICTED: H(+)/Cl(-) exchange ...   212   1e-52   Macaca mulatta [rhesus macaque]
gi|471378162|ref|XP_004376886.1| PREDICTED: H(+)/Cl(-) exchange ...   212   1e-52   
gi|410056473|ref|XP_003317509.2| PREDICTED: LOW QUALITY PROTEIN:...   212   1e-52   
gi|6467501|gb|AAF13167.1|AF173174_1 CLC chloride channel protein...   212   1e-52   Caenorhabditis elegans [roundworm]
gi|332255573|ref|XP_003276907.1| PREDICTED: H(+)/Cl(-) exchange ...   212   1e-52   Nomascus leucogenys [White-cheeked Gibbon]
gi|330930492|ref|XP_003303055.1| hypothetical protein PTT_15085 ...   212   1e-52   Pyrenophora teres f. teres 0-1
gi|296235496|ref|XP_002762909.1| PREDICTED: H(+)/Cl(-) exchange ...   212   1e-52   
gi|292625629|ref|XP_001920783.2| PREDICTED: H(+)/Cl(-) exchange ...   212   1e-52   Danio rerio [leopard danio]
gi|332255571|ref|XP_003276906.1| PREDICTED: H(+)/Cl(-) exchange ...   212   1e-52   Nomascus leucogenys [White-cheeked Gibbon]
gi|507573060|ref|XP_004670117.1| PREDICTED: H(+)/Cl(-) exchange ...   212   1e-52   Jaculus jaculus
gi|195019841|ref|XP_001985066.1| GH16850 [Drosophila grimshawi] ...   212   1e-52   Drosophila grimshawi
gi|355704805|gb|EHH30730.1| Chloride transporter ClC-5, partial ...   212   1e-52   Macaca mulatta [rhesus macaque]
gi|507573062|ref|XP_004670118.1| PREDICTED: H(+)/Cl(-) exchange ...   212   1e-52   Jaculus jaculus
gi|189217921|ref|NP_001121370.1| H(+)/Cl(-) exchange transporter...   212   1e-52   Homo sapiens [man]
gi|297303879|ref|XP_001083068.2| PREDICTED: H(+)/Cl(-) exchange ...   212   1e-52   
gi|403297565|ref|XP_003939632.1| PREDICTED: H(+)/Cl(-) exchange ...   212   1e-52   Saimiri boliviensis boliviensis
gi|507573064|ref|XP_004670119.1| PREDICTED: H(+)/Cl(-) exchange ...   212   1e-52   Jaculus jaculus
gi|27543516|dbj|BAC54560.1| clcn3e [Homo sapiens]                     211   2e-52   Homo sapiens [man]
gi|4557473|ref|NP_000075.1| H(+)/Cl(-) exchange transporter 5 is...   211   2e-52   Homo sapiens [man]
gi|193786465|dbj|BAG51748.1| unnamed protein product [Homo sapiens]   211   2e-52   Homo sapiens [man]
gi|367026860|ref|XP_003662714.1| hypothetical protein MYCTH_2303...   211   2e-52   Myceliophthora thermophila ATCC 42464
gi|307183977|gb|EFN70548.1| Chloride channel protein 3 [Camponot...   211   2e-52   Camponotus floridanus
gi|158255316|dbj|BAF83629.1| unnamed protein product [Homo sapiens]   211   2e-52   Homo sapiens [man]
gi|403297569|ref|XP_003939634.1| PREDICTED: H(+)/Cl(-) exchange ...   211   2e-52   
gi|512900637|ref|XP_004924939.1| PREDICTED: H(+)/Cl(-) exchange ...   211   2e-52   Bombyx mori [silk moth]
gi|342872310|gb|EGU74691.1| hypothetical protein FOXB_14791 [Fus...   211   2e-52   Fusarium oxysporum Fo5176
gi|119610335|gb|EAW89929.1| chloride channel 5 (nephrolithiasis ...   211   2e-52   Homo sapiens [man]
gi|310793123|gb|EFQ28584.1| voltage gated chloride channel [Glom...   211   2e-52   Colletotrichum graminicola M1.001
gi|452843511|gb|EME45446.1| hypothetical protein DOTSEDRAFT_7124...   211   2e-52   Dothistroma septosporum NZE10
gi|290543412|ref|NP_001166402.1| H(+)/Cl(-) exchange transporter...   211   2e-52   Cavia porcellus [guinea pig]
gi|193787268|dbj|BAG52474.1| unnamed protein product [Homo sapiens]   211   2e-52   Homo sapiens [man]
gi|432920237|ref|XP_004079904.1| PREDICTED: H(+)/Cl(-) exchange ...   211   3e-52   Oryzias latipes [Japanese rice fish]
gi|399166870|emb|CCE32227.1| related to chloride channel protein...   211   3e-52   Claviceps purpurea 20.1
gi|403180714|ref|XP_003890851.1| hypothetical protein PGTG_22819...   210   5e-52   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|395840017|ref|XP_003792866.1| PREDICTED: H(+)/Cl(-) exchange ...   210   5e-52   
gi|117644728|emb|CAL37829.1| hypothetical protein [synthetic con...   210   5e-52   synthetic construct
gi|378731439|gb|EHY57898.1| chloride channel 3, variant [Exophia...   210   5e-52   Exophiala dermatitidis NIH/UT8656
gi|478518630|ref|XP_004433542.1| PREDICTED: H(+)/Cl(-) exchange ...   210   5e-52   Ceratotherium simum simum [southern square-lipped rhinoceros]
gi|55770838|ref|NP_001820.2| H(+)/Cl(-) exchange transporter 3 i...   210   6e-52   Homo sapiens [man]
gi|505830273|ref|XP_004610434.1| PREDICTED: H(+)/Cl(-) exchange ...   209   6e-52   Sorex araneus [Eurasian shrew]
gi|512981965|ref|XP_004852981.1| PREDICTED: H(+)/Cl(-) exchange ...   209   6e-52   Heterocephalus glaber [naked mole rat]
gi|507546491|ref|XP_004657201.1| PREDICTED: H(+)/Cl(-) exchange ...   209   6e-52   Jaculus jaculus
gi|391333211|ref|XP_003741013.1| PREDICTED: H(+)/Cl(-) exchange ...   209   6e-52   Metaseiulus occidentalis
gi|149698084|ref|XP_001499078.1| PREDICTED: H(+)/Cl(-) exchange ...   209   6e-52   Equus caballus [domestic horse]
gi|67969831|dbj|BAE01263.1| unnamed protein product [Macaca fasc...   209   6e-52   Macaca fascicularis [crab eating macaque]
gi|504133023|ref|XP_004579109.1| PREDICTED: H(+)/Cl(-) exchange ...   209   6e-52   Ochotona princeps [southern American pika]
gi|478518634|ref|XP_004433544.1| PREDICTED: H(+)/Cl(-) exchange ...   209   6e-52   
gi|431918334|gb|ELK17561.1| H(+)/Cl(-) exchange transporter 3 [P...   209   6e-52   Pteropus alecto
gi|148298669|ref|NP_445815.2| H(+)/Cl(-) exchange transporter 3 ...   209   6e-52   Rattus norvegicus [brown rat]
gi|344288235|ref|XP_003415856.1| PREDICTED: H(+)/Cl(-) exchange ...   209   6e-52   
gi|451850107|gb|EMD63409.1| hypothetical protein COCSADRAFT_1716...   209   6e-52   Bipolaris sorokiniana ND90Pr
gi|344288231|ref|XP_003415854.1| PREDICTED: H(+)/Cl(-) exchange ...   209   6e-52   Loxodonta africana [African bush elephant]
gi|408394320|gb|EKJ73528.1| hypothetical protein FPSE_06146 [Fus...   209   6e-52   Fusarium pseudograminearum CS3096
gi|338722361|ref|XP_003364528.1| PREDICTED: H(+)/Cl(-) exchange ...   209   6e-52   
gi|511876342|ref|XP_004758161.1| PREDICTED: H(+)/Cl(-) exchange ...   209   6e-52   
gi|388267597|gb|AFK25799.1| chloride channel ClC-3 [Dicentrarchu...   209   7e-52   
gi|46122355|ref|XP_385731.1| hypothetical protein FG05555.1 [Fus...   209   7e-52   
gi|343478299|ref|NP_001230301.1| H(+)/Cl(-) exchange transporter...   209   7e-52   
gi|504133027|ref|XP_004579111.1| PREDICTED: H(+)/Cl(-) exchange ...   209   7e-52   
gi|507546495|ref|XP_004657203.1| PREDICTED: H(+)/Cl(-) exchange ...   209   7e-52   
gi|505830277|ref|XP_004610436.1| PREDICTED: H(+)/Cl(-) exchange ...   209   7e-52   
gi|500260430|gb|EOO03037.1| putative chloride channel protein 3 ...   209   7e-52   
gi|395840015|ref|XP_003792865.1| PREDICTED: H(+)/Cl(-) exchange ...   209   7e-52   
gi|332820723|ref|XP_001154165.2| PREDICTED: H(+)/Cl(-) exchange ...   209   8e-52   
gi|350592365|ref|XP_001926169.4| PREDICTED: H(+)/Cl(-) exchange ...   209   8e-52   
gi|426345959|ref|XP_004040660.1| PREDICTED: H(+)/Cl(-) exchange ...   209   8e-52   
gi|255935553|ref|XP_002558803.1| Pc13g03660 [Penicillium chrysog...   209   8e-52   
gi|504133025|ref|XP_004579110.1| PREDICTED: H(+)/Cl(-) exchange ...   209   8e-52   
gi|332820721|ref|XP_003310636.1| PREDICTED: H(+)/Cl(-) exchange ...   209   8e-52   
gi|512981969|ref|XP_004852983.1| PREDICTED: H(+)/Cl(-) exchange ...   209   8e-52   
gi|426345955|ref|XP_004040658.1| PREDICTED: H(+)/Cl(-) exchange ...   209   8e-52   
gi|332217720|ref|XP_003258007.1| PREDICTED: H(+)/Cl(-) exchange ...   209   8e-52   
gi|296195186|ref|XP_002745269.1| PREDICTED: H(+)/Cl(-) exchange ...   209   8e-52   
gi|189458829|ref|NP_776298.1| H(+)/Cl(-) exchange transporter 3 ...   209   8e-52   
gi|507546493|ref|XP_004657202.1| PREDICTED: H(+)/Cl(-) exchange ...   209   8e-52   
gi|343432569|ref|NP_001230303.1| H(+)/Cl(-) exchange transporter...   209   8e-52   
gi|507684515|ref|XP_004640299.1| PREDICTED: H(+)/Cl(-) exchange ...   209   8e-52   
gi|507684507|ref|XP_004640297.1| PREDICTED: H(+)/Cl(-) exchange ...   209   8e-52   
gi|354473228|ref|XP_003498838.1| PREDICTED: H(+)/Cl(-) exchange ...   209   8e-52   
gi|472345961|ref|XP_004392714.1| PREDICTED: H(+)/Cl(-) exchange ...   209   9e-52   
gi|505830275|ref|XP_004610435.1| PREDICTED: H(+)/Cl(-) exchange ...   209   9e-52   
gi|466052805|ref|XP_004278719.1| PREDICTED: H(+)/Cl(-) exchange ...   209   9e-52   
gi|8134363|sp|Q9R279.1|CLCN3_CAVPO RecName: Full=H(+)/Cl(-) exch...   209   9e-52   
gi|499040229|ref|XP_004570742.1| PREDICTED: H(+)/Cl(-) exchange ...   209   9e-52   
gi|344288229|ref|XP_003415853.1| PREDICTED: H(+)/Cl(-) exchange ...   209   9e-52   
gi|466052794|ref|XP_004278717.1| PREDICTED: H(+)/Cl(-) exchange ...   209   9e-52   
gi|507947222|ref|XP_004682449.1| PREDICTED: H(+)/Cl(-) exchange ...   209   9e-52   
gi|395840492|ref|XP_003793091.1| PREDICTED: H(+)/Cl(-) exchange ...   209   9e-52   
gi|301765609|ref|XP_002918228.1| PREDICTED: H(+)/Cl(-) exchange ...   209   9e-52   
gi|289577069|ref|NP_001166164.1| H(+)/Cl(-) exchange transporter...   209   9e-52   
gi|71043888|ref|NP_001020790.1| H(+)/Cl(-) exchange transporter ...   209   9e-52   
gi|296484982|tpg|DAA27097.1| TPA: chloride channel 3 isoform 2 [...   209   9e-52   
gi|149032290|gb|EDL87196.1| chloride channel 3, isoform CRA_b [R...   209   9e-52   
gi|350592367|ref|XP_003483452.1| PREDICTED: H(+)/Cl(-) exchange ...   209   1e-51   
gi|345307473|ref|XP_003428579.1| PREDICTED: H(+)/Cl(-) exchange ...   209   1e-51   
gi|507546497|ref|XP_004657204.1| PREDICTED: H(+)/Cl(-) exchange ...   209   1e-51   
gi|478518632|ref|XP_004433543.1| PREDICTED: H(+)/Cl(-) exchange ...   209   1e-51   
gi|334331137|ref|XP_003341450.1| PREDICTED: H(+)/Cl(-) exchange ...   209   1e-51   
gi|348520250|ref|XP_003447641.1| PREDICTED: H(+)/Cl(-) exchange ...   209   1e-51   
gi|119619183|gb|EAW98777.1| chloride channel 4, isoform CRA_a [H...   209   1e-51   
gi|6680948|ref|NP_031737.1| H(+)/Cl(-) exchange transporter 3 is...   209   1e-51   
gi|499040233|ref|XP_004570744.1| PREDICTED: H(+)/Cl(-) exchange ...   209   1e-51   
gi|149412019|ref|XP_001506627.1| PREDICTED: H(+)/Cl(-) exchange ...   209   1e-51   
gi|2144040|pir||I58159 protein kinase C-regulated chloride chann...   209   1e-51
gi|499040221|ref|XP_004570738.1| PREDICTED: H(+)/Cl(-) exchange ...   209   1e-51   
gi|41281837|ref|NP_776301.1| H(+)/Cl(-) exchange transporter 3 i...   209   1e-51   
gi|466052789|ref|XP_004278716.1| PREDICTED: H(+)/Cl(-) exchange ...   209   1e-51   
gi|327278010|ref|XP_003223756.1| PREDICTED: H(+)/Cl(-) exchange ...   209   1e-51   
gi|507659602|ref|XP_004635082.1| PREDICTED: H(+)/Cl(-) exchange ...   209   1e-51   
gi|499040225|ref|XP_004570740.1| PREDICTED: H(+)/Cl(-) exchange ...   209   1e-51   
gi|354473230|ref|XP_003498839.1| PREDICTED: H(+)/Cl(-) exchange ...   209   1e-51   
gi|354473232|ref|XP_003498840.1| PREDICTED: H(+)/Cl(-) exchange ...   209   1e-51   
gi|466052799|ref|XP_004278718.1| PREDICTED: H(+)/Cl(-) exchange ...   209   1e-51   
gi|505837335|ref|XP_004612233.1| PREDICTED: H(+)/Cl(-) exchange ...   209   1e-51   
gi|333360842|ref|XP_003339485.1| chloride channel protein 4 [Puc...   208   1e-51   
gi|34783726|gb|AAH57133.1| Chloride channel 3 [Mus musculus]          208   1e-51   
gi|395542411|ref|XP_003773125.1| PREDICTED: H(+)/Cl(-) exchange ...   208   1e-51   
gi|513181967|ref|XP_004940987.1| PREDICTED: H(+)/Cl(-) exchange ...   208   1e-51   
gi|507684511|ref|XP_004640298.1| PREDICTED: H(+)/Cl(-) exchange ...   208   1e-51   
gi|513181972|ref|XP_004940988.1| PREDICTED: H(+)/Cl(-) exchange ...   208   1e-51   
gi|507560075|ref|XP_004663752.1| PREDICTED: H(+)/Cl(-) exchange ...   208   1e-51   
gi|332223789|ref|XP_003261050.1| PREDICTED: H(+)/Cl(-) exchange ...   208   1e-51   
gi|507659614|ref|XP_004635085.1| PREDICTED: H(+)/Cl(-) exchange ...   208   1e-51   
gi|76563948|ref|NP_071534.2| H(+)/Cl(-) exchange transporter 4 [...   208   1e-51   
gi|300795150|ref|NP_001179932.1| H(+)/Cl(-) exchange transporter...   208   2e-51   
gi|355704610|gb|EHH30535.1| Chloride transporter ClC-4 [Macaca m...   208   2e-51   
gi|335305691|ref|XP_001925262.3| PREDICTED: LOW QUALITY PROTEIN:...   208   2e-51   
gi|410988092|ref|XP_004000322.1| PREDICTED: H(+)/Cl(-) exchange ...   208   2e-51   
gi|153252026|ref|NP_001821.2| H(+)/Cl(-) exchange transporter 4 ...   208   2e-51   
gi|507560077|ref|XP_004663753.1| PREDICTED: H(+)/Cl(-) exchange ...   208   2e-51   
gi|431918502|gb|ELK17722.1| H(+)/Cl(-) exchange transporter 4 [P...   208   2e-51   
gi|390479517|ref|XP_002762651.2| PREDICTED: H(+)/Cl(-) exchange ...   208   2e-51   
gi|71051499|gb|AAH36068.1| Chloride channel 4 [Homo sapiens]          208   2e-51   
gi|297709398|ref|XP_002831419.1| PREDICTED: H(+)/Cl(-) exchange ...   208   2e-51   
gi|125821281|ref|XP_685762.2| PREDICTED: H(+)/Cl(-) exchange tra...   208   2e-51   
gi|348554263|ref|XP_003462945.1| PREDICTED: H(+)/Cl(-) exchange ...   208   2e-51   
gi|327278008|ref|XP_003223755.1| PREDICTED: H(+)/Cl(-) exchange ...   208   2e-51   
gi|354493368|ref|XP_003508814.1| PREDICTED: H(+)/Cl(-) exchange ...   208   2e-51   
gi|505837333|ref|XP_004612232.1| PREDICTED: H(+)/Cl(-) exchange ...   208   2e-51   
gi|507659598|ref|XP_004635081.1| PREDICTED: H(+)/Cl(-) exchange ...   208   2e-51   
gi|344253532|gb|EGW09636.1| H(+)/Cl(-) exchange transporter 4 [C...   208   2e-51   
gi|379643013|ref|NP_001243873.1| H(+)/Cl(-) exchange transporter...   208   2e-51   
gi|410929411|ref|XP_003978093.1| PREDICTED: H(+)/Cl(-) exchange ...   208   2e-51   
gi|507618836|ref|XP_004696177.1| PREDICTED: H(+)/Cl(-) exchange ...   208   2e-51   
gi|403172196|ref|XP_003889356.1| hypothetical protein PGTG_21913...   208   2e-51   
gi|513019588|ref|XP_004871090.1| PREDICTED: H(+)/Cl(-) exchange ...   208   2e-51   
gi|507560073|ref|XP_004663751.1| PREDICTED: H(+)/Cl(-) exchange ...   208   2e-51   
gi|478521895|ref|XP_004435154.1| PREDICTED: H(+)/Cl(-) exchange ...   208   2e-51   
gi|507659606|ref|XP_004635083.1| PREDICTED: H(+)/Cl(-) exchange ...   208   2e-51   
gi|169621269|ref|XP_001804045.1| hypothetical protein SNOG_13843...   208   2e-51   
gi|513019582|ref|XP_004871087.1| PREDICTED: H(+)/Cl(-) exchange ...   208   2e-51   
gi|149744231|ref|XP_001488071.1| PREDICTED: H(+)/Cl(-) exchange ...   208   2e-51   
gi|512852567|ref|XP_004887589.1| PREDICTED: LOW QUALITY PROTEIN:...   208   2e-51   
gi|1705907|sp|P51794.1|CLCN4_RAT RecName: Full=H(+)/Cl(-) exchan...   208   2e-51   
gi|507618828|ref|XP_004696175.1| PREDICTED: H(+)/Cl(-) exchange ...   208   2e-51   
gi|47210785|emb|CAF91095.1| unnamed protein product [Tetraodon n...   208   2e-51   
gi|148745607|gb|AAI42584.1| Chloride channel ClC-3-like [Xenopus...   208   2e-51   
gi|354493370|ref|XP_003508815.1| PREDICTED: H(+)/Cl(-) exchange ...   207   2e-51   
gi|320035607|gb|EFW17548.1| voltage-gated chloride channel prote...   207   2e-51   
gi|351701846|gb|EHB04765.1| H(+)/Cl(-) exchange transporter 4 [H...   207   2e-51   
gi|507969042|ref|XP_004689898.1| PREDICTED: H(+)/Cl(-) exchange ...   207   2e-51   
gi|291400135|ref|XP_002716352.1| PREDICTED: chloride channel 3-l...   207   2e-51   
gi|507618832|ref|XP_004696176.1| PREDICTED: H(+)/Cl(-) exchange ...   207   2e-51   
gi|189520977|ref|XP_001923503.1| PREDICTED: H(+)/Cl(-) exchange ...   207   2e-51   
gi|507969039|ref|XP_004689897.1| PREDICTED: H(+)/Cl(-) exchange ...   207   3e-51   
gi|291400137|ref|XP_002716353.1| PREDICTED: chloride channel 3-l...   207   3e-51   
gi|148669009|gb|EDL01088.1| chloride channel 4-2, isoform CRA_b ...   207   3e-51   
gi|471409687|ref|XP_004386416.1| PREDICTED: H(+)/Cl(-) exchange ...   207   3e-51   
gi|395840019|ref|XP_003792867.1| PREDICTED: H(+)/Cl(-) exchange ...   207   3e-51   
gi|345327016|ref|XP_001515028.2| PREDICTED: H(+)/Cl(-) exchange ...   207   3e-51   
gi|472379801|ref|XP_004409307.1| PREDICTED: H(+)/Cl(-) exchange ...   207   3e-51   
gi|512981961|ref|XP_004852979.1| PREDICTED: H(+)/Cl(-) exchange ...   207   3e-51   
gi|444731313|gb|ELW71670.1| H(+)/Cl(-) exchange transporter 3 [T...   207   3e-51   
gi|74006437|ref|XP_848379.1| PREDICTED: H(+)/Cl(-) exchange tran...   207   3e-51   
gi|301758533|ref|XP_002915113.1| PREDICTED: H(+)/Cl(-) exchange ...   207   3e-51   
gi|426345963|ref|XP_004040662.1| PREDICTED: H(+)/Cl(-) exchange ...   207   3e-51   
gi|55770840|ref|NP_776297.2| H(+)/Cl(-) exchange transporter 3 i...   207   3e-51   
gi|70561322|emb|CAJ14974.1| chloride channel 3 [Canis lupus fami...   207   3e-51   
gi|149698082|ref|XP_001499106.1| PREDICTED: H(+)/Cl(-) exchange ...   207   3e-51   
gi|344288615|ref|XP_003416042.1| PREDICTED: H(+)/Cl(-) exchange ...   207   3e-51   
gi|348532955|ref|XP_003453971.1| PREDICTED: H(+)/Cl(-) exchange ...   207   3e-51   
gi|512864765|ref|XP_004890757.1| PREDICTED: LOW QUALITY PROTEIN:...   207   3e-51   
gi|511877812|ref|XP_004758869.1| PREDICTED: H(+)/Cl(-) exchange ...   207   3e-51   
gi|296195182|ref|XP_002745267.1| PREDICTED: H(+)/Cl(-) exchange ...   207   3e-51   
gi|504133018|ref|XP_004579107.1| PREDICTED: H(+)/Cl(-) exchange ...   207   3e-51   
gi|303315189|ref|XP_003067602.1| Voltage gated chloride channel ...   207   3e-51   
gi|149412017|ref|XP_001506740.1| PREDICTED: H(+)/Cl(-) exchange ...   207   3e-51   
gi|472345957|ref|XP_004392712.1| PREDICTED: H(+)/Cl(-) exchange ...   207   3e-51   
gi|346971454|gb|EGY14906.1| chloride channel protein [Verticilli...   207   3e-51   
gi|511876335|ref|XP_004758158.1| PREDICTED: H(+)/Cl(-) exchange ...   207   3e-51   
gi|507947213|ref|XP_004682446.1| PREDICTED: H(+)/Cl(-) exchange ...   207   3e-51   
gi|507546487|ref|XP_004657199.1| PREDICTED: H(+)/Cl(-) exchange ...   207   3e-51   
gi|472379803|ref|XP_004409308.1| PREDICTED: H(+)/Cl(-) exchange ...   207   3e-51   
gi|499046475|ref|XP_004573814.1| PREDICTED: H(+)/Cl(-) exchange ...   207   3e-51   
gi|281341653|gb|EFB17237.1| hypothetical protein PANDA_006629 [A...   207   3e-51   
gi|13542693|gb|AAH05553.1| Clcn4-2 protein [Mus musculus]             207   3e-51   
gi|505830269|ref|XP_004610432.1| PREDICTED: H(+)/Cl(-) exchange ...   207   3e-51   
gi|499046471|ref|XP_004573812.1| PREDICTED: H(+)/Cl(-) exchange ...   207   3e-51   
gi|397502421|ref|XP_003821859.1| PREDICTED: LOW QUALITY PROTEIN:...   207   3e-51   
gi|499046473|ref|XP_004573813.1| PREDICTED: H(+)/Cl(-) exchange ...   207   3e-51   
gi|1587069|prf||2205339A Cl channel                                   207   3e-51
gi|326669130|ref|XP_003198939.1| PREDICTED: H(+)/Cl(-) exchange ...   207   3e-51   
gi|488579997|ref|XP_004475455.1| PREDICTED: H(+)/Cl(-) exchange ...   207   3e-51   
gi|355758046|gb|EHH61408.1| hypothetical protein EGM_19620 [Maca...   207   3e-51   
gi|507546489|ref|XP_004657200.1| PREDICTED: H(+)/Cl(-) exchange ...   207   3e-51   
gi|471409689|ref|XP_004386417.1| PREDICTED: H(+)/Cl(-) exchange ...   207   4e-51   
gi|478518626|ref|XP_004433540.1| PREDICTED: H(+)/Cl(-) exchange ...   207   4e-51   
gi|410956575|ref|XP_003984916.1| PREDICTED: LOW QUALITY PROTEIN:...   207   4e-51   
gi|378734578|gb|EHY61037.1| chloride channel [Exophiala dermatit...   207   4e-51   
gi|511877814|ref|XP_004758870.1| PREDICTED: H(+)/Cl(-) exchange ...   207   4e-51   
gi|110625940|ref|NP_035464.3| H(+)/Cl(-) exchange transporter 4 ...   207   4e-51   
gi|499046477|ref|XP_004573815.1| PREDICTED: H(+)/Cl(-) exchange ...   207   4e-51   
gi|512981967|ref|XP_004852982.1| PREDICTED: H(+)/Cl(-) exchange ...   207   4e-51   
gi|26330924|dbj|BAC29192.1| unnamed protein product [Mus musculus]    207   4e-51   
gi|504133020|ref|XP_004579108.1| PREDICTED: H(+)/Cl(-) exchange ...   207   4e-51   
gi|432118021|gb|ELK37971.1| H(+)/Cl(-) exchange transporter 3 [M...   207   4e-51   
gi|472345959|ref|XP_004392713.1| PREDICTED: H(+)/Cl(-) exchange ...   207   4e-51   
gi|148236831|ref|NP_001083736.1| chloride channel, voltage-sensi...   207   4e-51   
gi|478518628|ref|XP_004433541.1| PREDICTED: H(+)/Cl(-) exchange ...   207   4e-51   
gi|507684499|ref|XP_004640295.1| PREDICTED: H(+)/Cl(-) exchange ...   207   4e-51   
gi|511876340|ref|XP_004758160.1| PREDICTED: H(+)/Cl(-) exchange ...   207   4e-51   
gi|512981963|ref|XP_004852980.1| PREDICTED: H(+)/Cl(-) exchange ...   207   4e-51   
gi|354473234|ref|XP_003498841.1| PREDICTED: H(+)/Cl(-) exchange ...   207   4e-51   
gi|301765607|ref|XP_002918227.1| PREDICTED: H(+)/Cl(-) exchange ...   207   4e-51   
gi|505830271|ref|XP_004610433.1| PREDICTED: H(+)/Cl(-) exchange ...   207   4e-51   
gi|488508003|ref|XP_004446507.1| PREDICTED: H(+)/Cl(-) exchange ...   207   5e-51   
gi|507947216|ref|XP_004682447.1| PREDICTED: H(+)/Cl(-) exchange ...   207   5e-51   
gi|344288233|ref|XP_003415855.1| PREDICTED: H(+)/Cl(-) exchange ...   206   5e-51   
gi|189458826|ref|NP_776299.1| H(+)/Cl(-) exchange transporter 3 ...   206   5e-51   
gi|471414810|ref|XP_004388937.1| PREDICTED: H(+)/Cl(-) exchange ...   206   5e-51   
gi|22023505|gb|AAM89116.1| chloride channel isoform d [Mus muscu...   206   5e-51   
gi|22023507|gb|AAM89118.1| chloride channel isoform f [Mus muscu...   206   5e-51   
gi|189206678|ref|XP_001939673.1| chloride channel protein 3 [Pyr...   206   5e-51   
gi|22023506|gb|AAM89117.1| chloride channel isoform e [Mus muscu...   206   5e-51   
gi|488508001|ref|XP_004446506.1| PREDICTED: H(+)/Cl(-) exchange ...   206   6e-51   
gi|471414808|ref|XP_004388936.1| PREDICTED: H(+)/Cl(-) exchange ...   206   6e-51   
gi|75766715|gb|ABA28317.1| voltage-gated chloride channel ClC-4A...   206   6e-51   
gi|322709336|gb|EFZ00912.1| chloride channel protein 3 [Metarhiz...   206   6e-51   
gi|195442754|ref|XP_002069111.1| GK24160 [Drosophila willistoni]...   206   6e-51   
gi|118089807|ref|XP_420400.2| PREDICTED: H(+)/Cl(-) exchange tra...   206   6e-51   
gi|507684503|ref|XP_004640296.1| PREDICTED: H(+)/Cl(-) exchange ...   206   6e-51   
gi|320588023|gb|EFX00498.1| voltage-gated chloride channel prote...   206   6e-51   
gi|449273059|gb|EMC82678.1| H(+)/Cl(-) exchange transporter 3 [C...   206   6e-51   
gi|119190683|ref|XP_001245948.1| hypothetical protein CIMG_05389...   206   7e-51   
gi|398404852|ref|XP_003853892.1| hypothetical protein MYCGRDRAFT...   206   7e-51   
gi|239606318|gb|EEQ83305.1| CLC channel protein [Ajellomyces der...   206   7e-51   
gi|483514257|gb|EOB01964.1| Chloride channel protein 3, partial ...   206   7e-51   
gi|513181964|ref|XP_004940986.1| PREDICTED: H(+)/Cl(-) exchange ...   206   7e-51   
gi|432920239|ref|XP_004079905.1| PREDICTED: H(+)/Cl(-) exchange ...   206   7e-51   
gi|432848890|ref|XP_004066502.1| PREDICTED: H(+)/Cl(-) exchange ...   206   7e-51   
gi|392868785|gb|EAS34575.2| chloride channel protein 3 [Coccidio...   206   8e-51   
gi|465983584|ref|XP_004265467.1| PREDICTED: H(+)/Cl(-) exchange ...   206   8e-51   
gi|395542413|ref|XP_003773126.1| PREDICTED: H(+)/Cl(-) exchange ...   206   8e-51   
gi|426222425|ref|XP_004005392.1| PREDICTED: H(+)/Cl(-) exchange ...   206   8e-51   
gi|327353109|gb|EGE81966.1| CLC channel protein [Ajellomyces der...   206   8e-51   
gi|213982777|ref|NP_001135560.1| chloride channel, voltage-sensi...   206   8e-51   
gi|432848888|ref|XP_004066501.1| PREDICTED: H(+)/Cl(-) exchange ...   206   9e-51   
gi|395542415|ref|XP_003773127.1| PREDICTED: H(+)/Cl(-) exchange ...   206   9e-51   
gi|929680|emb|CAA90150.1| Clcn4 [Mus musculus]                        206   9e-51   
gi|327268154|ref|XP_003218863.1| PREDICTED: H(+)/Cl(-) exchange ...   206   9e-51   
gi|449483160|ref|XP_004174765.1| PREDICTED: LOW QUALITY PROTEIN:...   206   1e-50   
gi|479159|emb|CAA54417.1| chloride channel [Homo sapiens]             206   1e-50   
gi|327278012|ref|XP_003223757.1| PREDICTED: H(+)/Cl(-) exchange ...   206   1e-50   
gi|513163772|ref|XP_425575.4| PREDICTED: H(+)/Cl(-) exchange tra...   205   1e-50   
gi|507618820|ref|XP_004696173.1| PREDICTED: H(+)/Cl(-) exchange ...   205   1e-50   
gi|126331391|ref|XP_001373330.1| PREDICTED: H(+)/Cl(-) exchange ...   205   1e-50   
gi|483517577|gb|EOB04048.1| Chloride channel protein 4, partial ...   205   1e-50   
gi|500260453|gb|EOO03060.1| putative chloride channel protein 5 ...   205   1e-50   
gi|494827428|gb|EON64378.1| hypothetical protein W97_03609 [Coni...   205   1e-50   
gi|358381105|gb|EHK18781.1| hypothetical protein TRIVIDRAFT_8302...   205   1e-50   
gi|513163775|ref|XP_004938458.1| PREDICTED: H(+)/Cl(-) exchange ...   205   1e-50   
gi|482806554|gb|EOA83627.1| hypothetical protein SETTUDRAFT_1731...   205   1e-50   
gi|470628241|ref|XP_004321033.1| PREDICTED: H(+)/Cl(-) exchange ...   205   1e-50   
gi|471414804|ref|XP_004388934.1| PREDICTED: H(+)/Cl(-) exchange ...   205   1e-50   
gi|326913643|ref|XP_003203145.1| PREDICTED: H(+)/Cl(-) exchange ...   205   2e-50   


>gi|511009621|gb|EPB90859.1| hypothetical protein HMPREF1544_02276 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 901

 Score =  273 bits (697), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 160/379 (42%), Positives = 225/379 (59%), Gaps = 66/379 (17%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC  +   +    YLL  A++ K    VITFG  VP GIF+P+L++GA  GR++G++MQ
Sbjct: 529 GLCARTVAEIPNLLYLLMTAMVIKMSLTVITFGCTVPGGIFLPSLIIGAITGRVIGLIMQ 588

Query: 62  YLTMTYPD-FPIYSTVCNQNI--NGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELT 118
           YLT+TYP+ +P   T C Q+    G+CVIPGVYA+VGAAA LAGVTR+T+SL VIMFELT
Sbjct: 589 YLTLTYPNAWPF--TACAQDFATRGECVIPGVYAIVGAAAGLAGVTRTTISLVVIMFELT 646

Query: 119 GTLTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDL 178
            +LTY LPIM A+M++KW+AD +   GIYDLLI+L  +PYL+++ EY       T T+  
Sbjct: 647 YSLTYALPIMIAVMVAKWIADAMFVEGIYDLLIELKEYPYLEARREY-----VHTMTIMN 701

Query: 179 CQRDLEVIDVNDLNTIGELKNKLKKLSTSGYS-DAGFPIV-DNKILVGYIASTELEHAL- 235
               L  IDVN   TI +LK KLK + + GY+ D GFPI+ D  IL GYIA++E+ H L 
Sbjct: 702 ITEYLSTIDVNAPITISKLKQKLKVIGSMGYAEDGGFPILSDGDILEGYIATSEVSHGLE 761

Query: 236 --------SLAHGSDNLTRCYFKD------------------------------ENVIDK 257
                   S++        CYF                                +NV++ 
Sbjct: 762 QLEKTLGSSMSESELGQVPCYFDRLMNDTATAHHSSANMINQDLKTPVRNLLQIDNVMED 821

Query: 258 SAN--------------FTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVV-DRGQYV 302
             N              F+ Y++ APLTI++NAS+ +++++F KLG RYV V    G+Y+
Sbjct: 822 HHNQLESMISTRQSLNDFSQYIDHAPLTINQNASMTLLMDMFTKLGARYVCVTHSNGRYL 881

Query: 303 GVINKKRLLIYLRQITGKD 321
           G+I+K+RLL YL+++  +D
Sbjct: 882 GIIHKRRLLAYLKELDEED 900



>gi|470320200|gb|EMR11796.1| hypothetical protein PNEG_00222 [Pneumocystis murina B123]
          Length = 855

 Score =  271 bits (694), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 141/317 (44%), Positives = 206/317 (64%), Gaps = 38/317 (11%)

Query: 30  VITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPDFPIYSTVCNQNINGDCVIPG 89
           ++TFG ++PAGIFIP + +GA FGR +G+++Q+   TYP   I+S  C      +C++PG
Sbjct: 543 IVTFGTKIPAGIFIPTMAIGALFGRFVGLIVQFFYYTYPSAYIFSR-CPLGDPNECIVPG 601

Query: 90  VYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMTAIMISKWVADGIIKHGIYDL 149
           VY+MVGAAA+LAGVTR TVSL VIMFELTG+L+YV+P M +I++SKWVAD I   GIYDL
Sbjct: 602 VYSMVGAAATLAGVTRMTVSLAVIMFELTGSLSYVMPFMLSILVSKWVADAIEPQGIYDL 661

Query: 150 LIDLGGHPYLDSKTEYDGAN----------TTFTTTLDLCQRDLEVIDVNDLNTIGELKN 199
           LIDL  +PYLD+K++Y  ++          T + TT+DL          N   +  +L++
Sbjct: 662 LIDLNEYPYLDTKSKYTFSSYLSELLPPPITVYHTTIDL--------SFNSTVSYTKLRD 713

Query: 200 KLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHALSLAHGS---DNLTR--CYFKDENV 254
            LK +   GY D GFPIV NK L+GYIA+ ELEHAL     +   +++ +  CY     V
Sbjct: 714 MLKYVKNEGYIDGGFPIVYNKTLIGYIAAHELEHALDTIKSTVSNEDIEKIGCYLMPFGV 773

Query: 255 IDKS--------------ANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVVDRGQ 300
            D +              A+  +YV++AP++++K A +E+V E+F KLGLRY+ ++D  +
Sbjct: 774 TDSTSSLDTGTSYSLPDPADLRSYVDKAPISLNKEAPMELVFEMFSKLGLRYLCILDGAE 833

Query: 301 YVGVINKKRLLIYLRQI 317
           +VGV++KKR + YL++I
Sbjct: 834 FVGVVHKKRFVRYLKEI 850



>gi|395333041|gb|EJF65419.1| hypothetical protein DICSQDRAFT_133038 [Dichomitus squalens
           LYAD-421 SS1]
          Length = 941

 Score =  271 bits (692), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 156/345 (45%), Positives = 218/345 (63%), Gaps = 32/345 (9%)

Query: 2   GLCD-NSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVM 60
           GLC  N         Y + +ALI K +  ++TFGI+VPAGIFIP L VGAC GR+LGI++
Sbjct: 601 GLCVLNPPTQAVSVIYAIFVALIVKGVLTIVTFGIKVPAGIFIPTLGVGACAGRILGILV 660

Query: 61  QYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGT 120
           Q++  +YPD   ++ VC  ++N  CVIPG+YAMVGAAA+L+GVTR+TVSL VIMFELT T
Sbjct: 661 QWMQFSYPDSAAFA-VCKGDLN--CVIPGLYAMVGAAATLSGVTRTTVSLAVIMFELTDT 717

Query: 121 LTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQ 180
           LTY +P+M A++++K VAD +   GIYDL+I+L   PYLD+K EY       +   D+  
Sbjct: 718 LTYAVPVMLAVLVAKTVADALEPKGIYDLVINLSQLPYLDAKHEYIWGPYQMS---DVTD 774

Query: 181 RDLEVIDVNDLNTIGELKNKLKKLSTSGYSDAGFPIV----DNKILVGYIASTELEHALS 236
           RD+E I ++  NT+  L+++L+KL  SG SD+G PI+    D   +VGYI + ELEHALS
Sbjct: 775 RDVEAIRLDQPNTVKSLRDQLQKLVDSGNSDSGLPILKADDDGLRMVGYIGANELEHALS 834

Query: 237 L-AHGSDNL-------TRCYFKDENVIDKSA------------NFTAYVNQAPLTISKNA 276
           + A   D +          +F   + +   A            +F+ Y++QAPLT+  N+
Sbjct: 835 IVADDPDEVISFHAAGPHGHFPMASSVSSLAETGSNALGLDPYDFSCYMDQAPLTVQDNS 894

Query: 277 SLEIVLELFKKLGLRYVIVVDR-GQYVGVINKKRLLIYLRQITGK 320
            LE+V + F KLG RYV+V D  G Y GVI+KK  L +L ++  K
Sbjct: 895 PLELVQQFFTKLGARYVVVTDSDGHYQGVIDKKTWLAFLDELEHK 939



>gi|409045165|gb|EKM54646.1| hypothetical protein PHACADRAFT_258637 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 937

 Score =  268 bits (686), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 150/327 (45%), Positives = 205/327 (62%), Gaps = 33/327 (10%)

Query: 18  LGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPDFPIYSTVC 77
           +G+A++ K    ++TFGI++PAGIFIP+L VGAC GR++GI++Q+    YP  PI++  C
Sbjct: 614 IGVAMVIKGALTIVTFGIKLPAGIFIPSLGVGACAGRIVGILVQWAHFRYPGSPIFA-AC 672

Query: 78  NQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMTAIMISKWV 137
           N N+N  CV+PG+YAMVGAAASL+GVTR+TVSL VIMFELT TLTYV+P+M A++++K V
Sbjct: 673 NGNLN--CVVPGLYAMVGAAASLSGVTRTTVSLAVIMFELTDTLTYVVPVMLAVLVAKSV 730

Query: 138 ADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDVNDLNTIGEL 197
           AD +   GIYDL+I+L   PYLD K EY  A    +   D+  RD  +I VN  N +  L
Sbjct: 731 ADALEPKGIYDLVIELANLPYLDPKREYSWAGHQIS---DVTDRDAAIIRVNQENNVKSL 787

Query: 198 KNKLKKLSTSGYSDAGFPIV----DNKILVGYIASTELEHALSLAHGSDNLTRCY----- 248
             KL+ L  SG  D+GFPIV        +VGYI   ELEHALS+     N    +     
Sbjct: 788 CGKLQTLVLSGRHDSGFPIVRKDDSGSRMVGYIGVNELEHALSIVADHPNRVIVFHSTTS 847

Query: 249 FKDENVIDKSANFTA-----------------YVNQAPLTISKNASLEIVLELFKKLGLR 291
           ++    +  S + TA                 Y++QAPLT+  N+ LE+V +LF KLG R
Sbjct: 848 YEHPGTMASSFSSTAGDTSPMLGSADPFDLSYYMDQAPLTVQSNSPLELVQQLFTKLGAR 907

Query: 292 YVIVVD-RGQYVGVINKKRLLIYLRQI 317
           Y++V D  G Y GVI+KK  L +L ++
Sbjct: 908 YIVVTDTNGYYEGVIDKKVWLAFLEEV 934



>gi|443897479|dbj|GAC74819.1| molecular chaperone [Pseudozyma antarctica T-34]
          Length = 1362

 Score =  267 bits (683), Expect = 2e-69,   Method: Composition-based stats.
 Identities = 160/376 (42%), Positives = 225/376 (59%), Gaps = 69/376 (18%)

Query: 1    DGLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVM 60
            +GLC +  + +      +  A++ K L  V+TFGI++PAGIFIP L VGACFGRM+G+++
Sbjct: 985  EGLCVSQPSQIKPLILSILFAMVLKGLLTVVTFGIKLPAGIFIPTLAVGACFGRMVGLLV 1044

Query: 61   QYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGT 120
            QY+  T PD   +S  C  + +  C++PGVYAMVGAAA+L+GVTR+TVSL VIMFELTGT
Sbjct: 1045 QYVQWTNPDLGFFSW-CPAS-DSACIVPGVYAMVGAAAALSGVTRTTVSLAVIMFELTGT 1102

Query: 121  LTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEY--DGANTTFTTTLDL 178
            LTY +P+M +I+++K +AD +   GIYDL+I+  G PYLDSKTEY  +G N T     D 
Sbjct: 1103 LTYSVPVMLSILVAKTIADALEHKGIYDLVIEFSGLPYLDSKTEYIWNGVNVT-----DA 1157

Query: 179  CQRDLEVIDVNDLNTIGELKNKLKKLST-SGYSDAGFPIVDNKI---------------- 221
             + ++EVI ++  N++  L +KL +L+  SGY+D GFPIV                    
Sbjct: 1158 METEVEVICLDAFNSLQSLADKLDRLAQGSGYTDGGFPIVSRVATATSSAVPASPLLSAS 1217

Query: 222  -------------------LVGYIASTELEHALSLAHGSD-----NLTRCYFKD------ 251
                               +VGYIA++ELEHAL+ A  +D      +TRC F +      
Sbjct: 1218 LGSLTDAAAPSPGSDSAYQMVGYIAASELEHALTRAVRADAEMRPEVTRCSFNNIPFVRA 1277

Query: 252  ----ENVIDKSANFTA--------YVNQAPLTISKNASLEIVLELFKKLGLRYVIVVD-R 298
                E  +  S  FTA        YV++AP+T+  ++ LE+V + F +LG+RY+IVVD R
Sbjct: 1278 ENEGEANVRDSVLFTASDPLDLSRYVDKAPITVQIHSPLELVHQYFTRLGVRYLIVVDER 1337

Query: 299  GQYVGVINKKRLLIYL 314
            G Y GVI KK  L +L
Sbjct: 1338 GLYRGVIFKKSYLKFL 1353



>gi|392569480|gb|EIW62653.1| hypothetical protein TRAVEDRAFT_112868 [Trametes versicolor
           FP-101664 SS1]
          Length = 917

 Score =  266 bits (681), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 148/326 (45%), Positives = 213/326 (65%), Gaps = 31/326 (9%)

Query: 20  LALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPDFPIYSTVCNQ 79
           +ALI K    ++TFGI+VPAGIFIP L VGAC GR+LGI++Q+   TYP  P + T+C  
Sbjct: 596 IALIVKGALTIVTFGIKVPAGIFIPTLGVGACAGRILGILIQWAQYTYPTSPAF-TMCEG 654

Query: 80  NINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMTAIMISKWVAD 139
           ++  DCVIPG+YAMVGAAA+L+GVTR+TVSL VIMFELT TLTY +P+M +++++K +AD
Sbjct: 655 DL--DCVIPGLYAMVGAAATLSGVTRTTVSLAVIMFELTDTLTYAVPVMLSVLVAKTIAD 712

Query: 140 GIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDVNDLNTIGELKN 199
            +   GIYDL+I+L   PYLD+K +Y   +       D+  RD+EV+ V+  NT+  +++
Sbjct: 713 ALEPKGIYDLVIELSQLPYLDAKHDYVWGSLQIN---DVTDRDVEVLRVDHENTVKSVRD 769

Query: 200 KLKKLSTSGYSDAGFPIV----DNKILVGYIASTELEHALSLA----------------H 239
           +L+ L   G SD+GFPI+    +   +VGYI + ELEHALS+                 H
Sbjct: 770 QLQALVEGGNSDSGFPILRPDGEGTRMVGYIGANELEHALSIVADEPDEIVKFHTNAPHH 829

Query: 240 G---SDNLTRCYFKDENVIDKSA-NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
           G   + +++       NV+     +F+ Y++QAPLT+  N+ LE+V +LF KLG RYV+V
Sbjct: 830 GGPMAGSVSSLAESGMNVVGSDPYDFSCYMDQAPLTVQDNSPLELVQQLFTKLGARYVVV 889

Query: 296 VDR-GQYVGVINKKRLLIYLRQITGK 320
            D  G Y GVI+KK  L +L +++ K
Sbjct: 890 TDTDGHYEGVIDKKTWLAFLDELSHK 915



>gi|170117305|ref|XP_001889840.1| clc channel [Laccaria bicolor S238N-H82]
 gi|164635180|gb|EDQ99491.1| clc channel [Laccaria bicolor S238N-H82]
          Length = 778

 Score =  264 bits (675), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 155/342 (45%), Positives = 213/342 (62%), Gaps = 35/342 (10%)

Query: 2   GLC---DNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGI 58
           GLC     SF   +     + +A++ K    V+TFGI++PAGIFIP L VGAC GR+LGI
Sbjct: 438 GLCVVNPGSFEHAWPVVQAILIAMVVKGALTVVTFGIKLPAGIFIPTLGVGACAGRVLGI 497

Query: 59  VMQYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELT 118
            MQ+L M  PD  I+ + C  ++  DC++PG+YAMVGAAA+L+GVTR+TVSL VIMFELT
Sbjct: 498 GMQWLQMRNPDAQIFRS-CGGDL--DCIVPGLYAMVGAAATLSGVTRTTVSLAVIMFELT 554

Query: 119 GTLTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDL 178
            TLTY +P+M +++++K VAD +   GIYDL+I+L   PYLD K EY   +   +   ++
Sbjct: 555 DTLTYAVPVMLSVLVAKTVADALEPKGIYDLVIELNQLPYLDYKHEYIWGHLQIS---EV 611

Query: 179 CQRDLEVIDVNDLNTIGELKNKLKKLSTSGYSDAGFPIV------DNKILVGYIASTELE 232
             RD+ VI V++ NT+  L  KL  L++SG  D+GFPI+      D   +VGYI + ELE
Sbjct: 612 TSRDVPVIIVDEENTVKNLGRKLLALTSSGADDSGFPILRQDRNDDGLRMVGYIGTNELE 671

Query: 233 HALS-LAHGSDNLTRCYFKDENVIDKSA------------------NFTAYVNQAPLTIS 273
           HALS LA   ++    +  D + +  S+                  NFT Y++QAPLTIS
Sbjct: 672 HALSILADNENDAVHFHVADTHALMSSSILSFAEAQEQTLATADPFNFTPYMDQAPLTIS 731

Query: 274 KNASLEIVLELFKKLGLRYVIVVDR-GQYVGVINKKRLLIYL 314
            N+ LE++ + F KLG RYVIV D  G Y GVI KK  L ++
Sbjct: 732 NNSPLELLHQFFTKLGARYVIVTDTDGLYEGVIEKKTWLAFV 773



>gi|71019585|ref|XP_760023.1| hypothetical protein UM03876.1 [Ustilago maydis 521]
 gi|46099816|gb|EAK85049.1| hypothetical protein UM03876.1 [Ustilago maydis 521]
          Length = 1097

 Score =  263 bits (671), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 163/395 (41%), Positives = 228/395 (57%), Gaps = 81/395 (20%)

Query: 1    DGLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVM 60
            +GLC +  + +      +  A++ K L  +ITFGI++PAGIFIP L VGACFGR++G+++
Sbjct: 708  EGLCVSQPSQIGPLIMAILFAMVLKGLLTIITFGIKLPAGIFIPTLAVGACFGRIVGLLV 767

Query: 61   QYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGT 120
            QY+  T+PD   +   C  + +  C++PGVYAMVGAAA+L+GVTR+TVSL VIMFELTGT
Sbjct: 768  QYVQWTHPDAAFFDW-CPAS-DSVCIVPGVYAMVGAAAALSGVTRTTVSLAVIMFELTGT 825

Query: 121  LTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEY--DGANTTFTTTLDL 178
            LTY +P+M +I+++K +AD +   GIYDL+ID  G PYLDSKTEY  +G N T     D 
Sbjct: 826  LTYSVPVMLSILVAKTIADALEHKGIYDLVIDFSGLPYLDSKTEYIWNGVNVT-----DA 880

Query: 179  CQRDLEVIDVNDLNTIGELKNKLKKLST-SGYSDAGFPIVDNKI---------------- 221
             + ++EVI ++  NT+  L +KL +L++ SGY+D GFPIV   +                
Sbjct: 881  METEVEVISLDAFNTVQSLSDKLDRLASGSGYTDGGFPIVSRVVSPLSPANPPISPGLST 940

Query: 222  -----------------------------LVGYIASTELEHALSLAHGSD-----NLTRC 247
                                         +VGYIA++ELEHAL+ A  SD        RC
Sbjct: 941  SVGSLMPDHSPQMPAHEDEADSASAASHQMVGYIAASELEHALARAVSSDPDLNLQTARC 1000

Query: 248  YFKD----------ENVIDKSANFTA--------YVNQAPLTISKNASLEIVLELFKKLG 289
             FK+          E  +  S  F A        YV++AP+T+  ++ LE+V + F +LG
Sbjct: 1001 SFKNLPFVRAEHEGEAGVRDSVLFIASDPLDLSRYVDKAPITVQIHSPLELVHQYFTRLG 1060

Query: 290  LRYVIVVD-RGQYVGVINKKRLLIYLRQI--TGKD 321
            +RY+IVVD RG Y G I KK  L +L  I   GKD
Sbjct: 1061 VRYLIVVDERGLYRGTIFKKSYLKFLADIERQGKD 1095



>gi|392594011|gb|EIW83336.1| hypothetical protein CONPUDRAFT_52943 [Coniophora puteana
           RWD-64-598 SS2]
          Length = 884

 Score =  261 bits (667), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 145/326 (44%), Positives = 208/326 (63%), Gaps = 31/326 (9%)

Query: 20  LALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPDFPIYSTVCNQ 79
           +A++ K +  ++TFGI++PAGIFIP L VGAC GR+LGI +Q+    YP   +++ VC  
Sbjct: 564 VAMLVKGVLTIVTFGIKLPAGIFIPTLGVGACAGRILGIGVQWAQWRYPTSSVFA-VCRG 622

Query: 80  NINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMTAIMISKWVAD 139
           ++  DCVIPG+YAMVGAAA+L+GVTR+TVSL VIMFELT TLTY +P+M A++++K VAD
Sbjct: 623 DM--DCVIPGLYAMVGAAAALSGVTRTTVSLAVIMFELTDTLTYAVPVMLAVLVAKTVAD 680

Query: 140 GIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDVNDLNTIGELKN 199
            +   GIYDL+IDL   PYL++K EY   N + +   D   RD++VI +   NT+  L++
Sbjct: 681 ALEPKGIYDLVIDLQQLPYLEAKHEYMWNNVSISEVTD---RDVDVIYIERTNTVRSLRD 737

Query: 200 KLKKLSTSGYSDAGFPIV------DNKILVGYIASTELEHALSLA----------HGSD- 242
           +L+ L  SG+ D GFPI+          +VGYI ++ELEHALS+           H S  
Sbjct: 738 QLQMLFESGHDDGGFPILKPTRDGSGTRMVGYIGASELEHALSIVADDADEPVQFHASST 797

Query: 243 -------NLTRCYFKDENVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
                  + +  +F D        +F+ Y++QAPLTI  NA +E++ + F KLG +YV+V
Sbjct: 798 YEHQMAASFSSSFFGDVQAEADLFDFSVYMDQAPLTIQSNAPMELLHQHFAKLGAKYVVV 857

Query: 296 VD-RGQYVGVINKKRLLIYLRQITGK 320
            D  G Y GVI+KK  L +L ++  K
Sbjct: 858 TDVDGDYEGVIDKKTWLAFLSELEEK 883



>gi|336371403|gb|EGN99742.1| hypothetical protein SERLA73DRAFT_88360 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336384159|gb|EGO25307.1| hypothetical protein SERLADRAFT_355634 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 943

 Score =  261 bits (667), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 145/345 (42%), Positives = 220/345 (63%), Gaps = 32/345 (9%)

Query: 2   GLC---DNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGI 58
           GLC     S + ++     + +A++ K    ++TFGI+VPAGIFIP L VGAC GR++GI
Sbjct: 605 GLCVLDPGSLSHLWPVVRAILIAMVVKGALTIVTFGIKVPAGIFIPTLGVGACAGRIVGI 664

Query: 59  VMQYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELT 118
            +Q+L   YP+  ++  VC  ++  DCVIPG+YAMVGAAA+L+GVTR+TVSL VIMFELT
Sbjct: 665 GVQWLQYQYPNSRVFG-VCGGDM--DCVIPGLYAMVGAAAALSGVTRTTVSLAVIMFELT 721

Query: 119 GTLTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDL 178
            TLTY +P+M +++++K VAD +   GIYDL+I+L   PYLD+K EY   N +     D+
Sbjct: 722 DTLTYAVPVMLSVLVAKTVADALEPKGIYDLVIELSQLPYLDAKHEYLWGNLSIN---DV 778

Query: 179 CQRDLEVIDVNDLNTIGELKNKLKKLSTSGYSDAGFPIVDNKI-----LVGYIASTELEH 233
             RD++VI ++  N +  L+++L+ L   G+ D+GFPIV   +     ++GYI ++ELEH
Sbjct: 779 TDRDVDVIHLDRTNNVESLRDQLQNLLNDGHDDSGFPIVKQSVQDGMRMIGYIGASELEH 838

Query: 234 ALSL----AHGSDNLTRCYFKDE------NVIDKSA-------NFTAYVNQAPLTISKNA 276
           AL++    A+   +    Y  ++      +++D ++       +F+ Y++ APLTI  NA
Sbjct: 839 ALTIVAEDANEEVHFNTTYTHEDMAASFSSLVDNASHAGVDPFDFSVYMDDAPLTIQSNA 898

Query: 277 SLEIVLELFKKLGLRYVIVVDR-GQYVGVINKKRLLIYLRQITGK 320
            LE+V + F KLG RYV+V D  G Y G+I+KK  + +L  +  K
Sbjct: 899 PLELVHQFFVKLGARYVVVTDTDGDYEGIIDKKTWVAFLAHLEEK 943



>gi|402222258|gb|EJU02325.1| clc channel [Dacryopinax sp. DJM-731 SS1]
          Length = 816

 Score =  260 bits (664), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 148/342 (43%), Positives = 210/342 (61%), Gaps = 28/342 (8%)

Query: 1   DGLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVM 60
           +GLC      +      +G+ L+ K    +ITFGI+VPAGIFIP L VGACFGR++G+ +
Sbjct: 482 EGLCVREREEVNAVLSAIGVTLLVKGALTIITFGIKVPAGIFIPTLGVGACFGRIVGLAL 541

Query: 61  QYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGT 120
           Q L    PD P++   C Q    DC+IPGVYAMVGAAA+L+GVTR+TVSL VIMFELT +
Sbjct: 542 QTLQAQRPDLPVFG-FCKQG--EDCIIPGVYAMVGAAATLSGVTRTTVSLAVIMFELTDS 598

Query: 121 LTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQ 180
           LTY LP+  A++++K +AD I   GIYDL+IDL   PYLD+K +Y       T   D+  
Sbjct: 599 LTYTLPVSLAVLVAKTIADRIEPKGIYDLVIDLNNLPYLDAKRQYIWGALMVT---DVTN 655

Query: 181 RDLEVIDVNDLNTIGELKNKLKKLSTSGYSDAGFPIV----DNKILVGYIASTELEHALS 236
           R ++VI     NT+  L++KL     +G  D+GFPI+    D + ++GYI + ELEHALS
Sbjct: 656 RKVDVIRTVQDNTVKSLRDKLISAVNAGNGDSGFPILAHAEDGEKMIGYIGANELEHALS 715

Query: 237 LAHGSDNLTRCYFKDENVID----------------KSANFTAYVNQAPLTISKNASLEI 280
           +   + + + C+F      D                   + + Y++QAPLT++ +A LE+
Sbjct: 716 IVAENPDAS-CHFHHTTSHDLLNLSISSLYNTPLPQDLYDLSIYMDQAPLTVAAHAPLEL 774

Query: 281 VLELFKKLGLRYVIVV-DRGQYVGVINKKRLLIYLRQITGKD 321
           V +LF KLG +YV+VV D G Y GVI++K  L +L ++  K+
Sbjct: 775 VQQLFVKLGAKYVVVVNDDGTYQGVIDRKTWLQFLHRLEEKE 816



>gi|449546693|gb|EMD37662.1| hypothetical protein CERSUDRAFT_114309 [Ceriporiopsis subvermispora
           B]
          Length = 932

 Score =  259 bits (663), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 142/326 (43%), Positives = 216/326 (66%), Gaps = 33/326 (10%)

Query: 20  LALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPDFPIYSTVCNQ 79
           +A++ K    +ITFGI++PAGIFIP+L VGAC GR++GI++Q++  ++PD     +V  +
Sbjct: 613 VAMVVKSALTLITFGIKLPAGIFIPSLGVGACAGRIVGILVQWMQYSHPD-----SVMFR 667

Query: 80  NINGD--CVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMTAIMISKWV 137
           + +GD  CVIPG+YAMVGAAA+L+GVTR+TVSL VIMFELT TLTY +P+M +++++K V
Sbjct: 668 SCHGDLTCVIPGLYAMVGAAATLSGVTRTTVSLAVIMFELTDTLTYAVPVMLSVLVAKTV 727

Query: 138 ADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDVNDLNTIGEL 197
           AD +   GIYDL+I+L   PYLD+K +Y       +  +D   RD++VI V+  NT+  L
Sbjct: 728 ADALEPKGIYDLVIELSQLPYLDAKHDYVWGPYQVSDVMD---RDVDVIRVDRENTVKSL 784

Query: 198 KNKLKKLSTSGYSDAGFPIV----DNKILVGYIASTELEHALSLAHGSDNLTRCY----- 248
           +++L+ L  SG+SD+GFPI+    +   + GYI ++ELEHALS+     + T  +     
Sbjct: 785 RDQLQGLIVSGHSDSGFPILRVGDEGMKMTGYIGASELEHALSIVADEADGTVSFHSTTP 844

Query: 249 FKDENVIDKSA-------------NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
           ++D  V+  ++             +F+ Y++QAPLT+  N+ LE+V + F KLG RY++V
Sbjct: 845 YRDSGVLTPTSLAEAGSRRAVDPFDFSCYMDQAPLTVQTNSPLELVQQYFTKLGARYIVV 904

Query: 296 VD-RGQYVGVINKKRLLIYLRQITGK 320
            D  G Y GVI+KK  L +L ++  K
Sbjct: 905 TDVDGYYEGVIDKKTWLAFLGELEEK 930



>gi|501303509|dbj|GAC92932.1| hypothetical protein PHSY_000491 [Pseudozyma hubeiensis SY62]
          Length = 1248

 Score =  259 bits (661), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 164/395 (41%), Positives = 223/395 (56%), Gaps = 81/395 (20%)

Query: 1    DGLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVM 60
            +GLC +  + +      +  A+I K L  +ITFGI++PAGIFIP L VGACFGR++G+++
Sbjct: 859  EGLCVSQPSQIGPLVTAISSAMILKGLLTIITFGIKLPAGIFIPTLAVGACFGRIVGLLV 918

Query: 61   QYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGT 120
            QY+  T+PD   +   C  + +  C++PGVYAMVGAAA+L+GVTR+TVSL VIMFELT T
Sbjct: 919  QYVQWTHPDAAFFG-WCPTS-DSACIVPGVYAMVGAAAALSGVTRTTVSLAVIMFELTDT 976

Query: 121  LTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEY--DGANTTFTTTLDL 178
            LTY +P+M +I+++K +AD +   GIYDL+ID  G PYLDSKTEY  +G N       D 
Sbjct: 977  LTYSVPVMLSILVAKTIADALEHKGIYDLVIDFSGLPYLDSKTEYIWNGVNVA-----DA 1031

Query: 179  CQRDLEVIDVNDLNTIGELKNKLKKLST-SGYSDAGFPIVDNKI---------------- 221
             + ++EVI +   NT+  L  KL +L+  SGY+D GFPIV                    
Sbjct: 1032 METEVEVISLEAFNTVQSLSEKLDRLARGSGYTDGGFPIVSRVATSSQSANPPVSPGLSA 1091

Query: 222  -----------------------------LVGYIASTELEHALSLAHGSD-----NLTRC 247
                                         +VGYIA+ ELEHAL+ A  SD        RC
Sbjct: 1092 SIGSLMPDHSPRLPIHDDFASSTATVAYQMVGYIAANELEHALARAVRSDPDVNLQTARC 1151

Query: 248  YFKD----------ENVIDKSANFTA--------YVNQAPLTISKNASLEIVLELFKKLG 289
             FK+          E  I  S  FTA        YV++AP+T+  ++ LE+V + F +LG
Sbjct: 1152 AFKNLPFVRAEHEGEAGIRDSVLFTASDPFDLSRYVDKAPITVQIHSPLELVHQYFTRLG 1211

Query: 290  LRYVIVVD-RGQYVGVINKKRLLIYLRQI--TGKD 321
            +RY+IVVD RG Y GVI KK  L +L  +   GKD
Sbjct: 1212 VRYLIVVDERGLYRGVIFKKSYLKFLADMEQEGKD 1246



>gi|403412008|emb|CCL98708.1| predicted protein [Fibroporia radiculosa]
          Length = 887

 Score =  258 bits (659), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 145/334 (43%), Positives = 215/334 (64%), Gaps = 39/334 (11%)

Query: 20  LALISKFLTCVITFGIRVPAGIFIPAL--------LVGACFGRMLGIVMQYLTMTYPDFP 71
           +ALI K    +ITFGI++PAGIFIP+L         VGAC GR+LGI++Q++  ++PD P
Sbjct: 558 VALIVKGALTIITFGIKLPAGIFIPSLGGKSLKLAAVGACAGRILGILVQWMQFSHPDSP 617

Query: 72  IYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMTAI 131
           I+++ C  ++  DCV+PG+YAMVGAAA+L+GVTR+TVSL VIMFELT TLTY +P++ ++
Sbjct: 618 IFAS-CKGDL--DCVVPGLYAMVGAAATLSGVTRTTVSLAVIMFELTDTLTYTVPVILSV 674

Query: 132 MISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDVNDL 191
           +++K VAD +   GIYDL+IDL   PYLD+K  +   N       D+  R+++VI +   
Sbjct: 675 LVAKTVADALEPKGIYDLVIDLSELPYLDAKHTHLWGNLQID---DVTDRNVDVIRLEFE 731

Query: 192 NTIGELKNKLKKLSTSGYSDAGFPIV----DNKILVGYIASTELEHALSL---------- 237
           NT+  L+++L+ L  +G+SD GFPI+    + + +VGYI + ELEHALS+          
Sbjct: 732 NTVKTLRDQLQALILAGHSDGGFPILRANGEGQRMVGYIGANELEHALSIVADDADRAIS 791

Query: 238 -------AHGSDNLTRCYFKDENVID---KSANFTAYVNQAPLTISKNASLEIVLELFKK 287
                   HG   +     + E+ +     S +F+ Y++QAP+T+  N+ LE+V + F K
Sbjct: 792 FHSVGPYEHGGPMMASFSSEAESAMQGALDSFDFSPYMDQAPITVQSNSPLELVHQFFIK 851

Query: 288 LGLRYVIVVDR-GQYVGVINKKRLLIYLRQITGK 320
           LG RYV+V+D  G Y GVI+KK  L +L Q+  K
Sbjct: 852 LGARYVVVIDTDGFYEGVIDKKTWLAFLGQLDEK 885



>gi|388858145|emb|CCF48213.1| related to chloride channel protein [Ustilago hordei]
          Length = 1047

 Score =  257 bits (657), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 160/381 (41%), Positives = 222/381 (58%), Gaps = 74/381 (19%)

Query: 1    DGLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVM 60
            +GLC +  + +      +  A++ K L  +ITFGI++PAGIFIP L VGACFGR++G+++
Sbjct: 665  EGLCVSQPSQIGPLVLAILCAMVIKGLLTIITFGIKLPAGIFIPTLAVGACFGRIVGLLV 724

Query: 61   QYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGT 120
            QY   T+P+   +S  C  + +  C++PGVYAMVGAAA+L+GVTR+TVSL VIMFELTGT
Sbjct: 725  QYAQWTHPELRFFSW-CPAS-DSACIVPGVYAMVGAAAALSGVTRTTVSLAVIMFELTGT 782

Query: 121  LTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEY--DGANTTFTTTLDL 178
            LTY +P+M +I+++K +AD +   GIYDL+ID  G PYLDSKTEY  +G N T     D 
Sbjct: 783  LTYSVPVMLSILVAKTIADALEHKGIYDLVIDFSGLPYLDSKTEYIWNGVNVT-----DA 837

Query: 179  CQRDLEVIDVNDLNTIGELKNKLKKLST-SGYSDAGFPIVDNKI---------------- 221
             +  +EVI ++  NTI  L  KL +L+  SGY+D GFPIV                    
Sbjct: 838  METQVEVICLDAYNTIQSLGEKLDRLARGSGYTDGGFPIVSRVTPSPSSAQPGSPPLSAS 897

Query: 222  ------------------------LVGYIASTELEHALSLAHGSD-----NLTRCYFKD- 251
                                    +VGYIA++ELEHAL+ A  +D        RC FK+ 
Sbjct: 898  IGSMADLIQQAPSRGSGSGSDSYQMVGYIAASELEHALARAVRADTDMRPETARCSFKNL 957

Query: 252  ---------ENVIDKSANFTA--------YVNQAPLTISKNASLEIVLELFKKLGLRYVI 294
                     E  +  S  FTA        YV++AP+T+  ++ LE+V + F +LG+RY+I
Sbjct: 958  AFVRAEQEGEAGVRDSVLFTASDPLDLSRYVDKAPITVQVHSPLELVHQYFTRLGVRYLI 1017

Query: 295  VVD-RGQYVGVINKKRLLIYL 314
            VVD +G Y GVI KK  L +L
Sbjct: 1018 VVDEKGLYRGVIFKKSYLKFL 1038



>gi|393217719|gb|EJD03208.1| clc channel [Fomitiporia mediterranea MF3/22]
          Length = 798

 Score =  256 bits (653), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 145/328 (44%), Positives = 205/328 (62%), Gaps = 33/328 (10%)

Query: 18  LGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPDFPIYSTVC 77
           +G+AL+ K    ++TFGI++PAGIFIP L VGACFGR+LGI +QYL   +P+  +++  C
Sbjct: 477 IGIALLVKGALTIVTFGIKLPAGIFIPTLGVGACFGRILGIGIQYLQYKHPNLRMFA-AC 535

Query: 78  NQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMTAIMISKWV 137
             ++  DCV+PG+YAMVGAAA+L+GVTR+TVSL VIMFELT TLTY +P+M A++ +K V
Sbjct: 536 GGDM--DCVVPGLYAMVGAAATLSGVTRTTVSLAVIMFELTDTLTYAVPVMLAVLTAKSV 593

Query: 138 ADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDVNDLNTIGEL 197
           AD +   GIYDL+I+L   PYLD+K EY   N   +   D+  R++ VI ++  NT+  L
Sbjct: 594 ADALEPKGIYDLVIELSQLPYLDAKHEYLWGNRLAS---DMTDRNVGVIRLDGHNTVKNL 650

Query: 198 KNKLKKLSTSGYSDAGFPIVDNKI------LVGYIASTELEHALSLAHGSDNLTRCYFK- 250
           ++KL++   +GY+D+GFPI+   +        GYI   ELEHAL++    D    CYF  
Sbjct: 651 RDKLREALAAGYADSGFPILRPDLQGLGLRTAGYIGFNELEHALAIV-ADDADAICYFNT 709

Query: 251 ------------DENVIDKSA------NFTAYVNQAPLTISKNASLEIVLELFKKLGLRY 292
                       D +  + +A      +FT Y +QAPL I  N   E+V +LF KLG ++
Sbjct: 710 ASEIATRGLTSADSSFTESAAPSNDPLDFTVYTDQAPLMIQTNTPPELVQQLFAKLGAKF 769

Query: 293 VIVVD-RGQYVGVINKKRLLIYLRQITG 319
           VIV D  G Y GVI K   + Y+  + G
Sbjct: 770 VIVTDPNGYYEGVIEKNAWIAYVNDLAG 797



>gi|353238563|emb|CCA70505.1| related to chloride channel protein [Piriformospora indica DSM
           11827]
          Length = 928

 Score =  255 bits (651), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 143/344 (41%), Positives = 214/344 (62%), Gaps = 30/344 (8%)

Query: 1   DGLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVM 60
           +GLC N    +      + +AL+ K    ++TFGI+VPAGIFIP L VGAC GR+LG+ +
Sbjct: 590 EGLCVNDPASVRPVVNAIAVALLVKGALTIVTFGIKVPAGIFIPTLGVGACAGRILGLAV 649

Query: 61  QYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGT 120
           Q+L+  +P+  ++ T   ++    CV+PGVYAMVGAAA+L+GVTR+TVSL VIM ELTGT
Sbjct: 650 QWLSWVHPNMRVFDTCKGKDA---CVVPGVYAMVGAAATLSGVTRTTVSLAVIMMELTGT 706

Query: 121 LTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQ 180
           LTYV+P+M +++++K VAD +   GIYDL+I+L   PYLD K EY        T  D+  
Sbjct: 707 LTYVIPVMLSVLVAKTVADALEPKGIYDLVIELNQLPYLDHKAEYRWG---VLTVADVMD 763

Query: 181 RDLEVIDVNDLNTIGELKNKLKKLSTSGYSDAGFPIVDNK--------ILVGYIASTELE 232
           + +EVI+++  N++  L+ +L ++   G  D GFPIV  +         ++GYI+  ELE
Sbjct: 764 KKVEVINIDKQNSVASLQGQLSRVFGMGTLDGGFPIVTRQESGSARGWKMIGYISHNELE 823

Query: 233 HALSLAHGS-DNLT--------RCYFKDENVIDKSA------NFTAYVNQAPLTISKNAS 277
           HAL++     D+L         R Y    + +  +A      +FT Y++QAPL +  ++ 
Sbjct: 824 HALNIVKDEPDSLVQFHPMAPLREYAPSMSSLHDNAYEPDPLDFTVYMDQAPLLVQAHSP 883

Query: 278 LEIVLELFKKLGLRYVIVVDR-GQYVGVINKKRLLIYLRQITGK 320
           LE+V ++F KLG RYV+V++  G Y GVI+KK  L +L ++  K
Sbjct: 884 LEVVQQMFVKLGARYVVVINSDGLYQGVIDKKGWLQFLTELEEK 927



>gi|426197564|gb|EKV47491.1| hypothetical protein AGABI2DRAFT_70043 [Agaricus bisporus var.
           bisporus H97]
          Length = 813

 Score =  254 bits (650), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 148/328 (45%), Positives = 207/328 (63%), Gaps = 34/328 (10%)

Query: 21  ALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPDF-PIYSTVCNQ 79
           A+I K    ++TFGI++PAGIFIP L VGAC GR++GI +Q++    P F P  +  C +
Sbjct: 493 AMIIKGALTLVTFGIKLPAGIFIPTLGVGACAGRIMGIWIQWMQHQNPGFGP--ARACGE 550

Query: 80  NINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMTAIMISKWVAD 139
           +  GDC+IPG+YAMVGAAA+L+GVTR+TVSL VIMFELT TLTY +P+M A++++K +AD
Sbjct: 551 D--GDCIIPGLYAMVGAAAALSGVTRTTVSLAVIMFELTDTLTYAVPVMLAVLVAKTLAD 608

Query: 140 GIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDVNDLNTIGELKN 199
            +   GIYDL+I+L   PYLD K EY   N   +   D+  RD +VI +++ NT+  L++
Sbjct: 609 ALEPKGIYDLVIELNQLPYLDYKHEYLWGNLQIS---DVTSRDPDVIRLDENNTVRSLRD 665

Query: 200 KLKKLSTSGYSDAGFPIV------DNKILVGYIASTELEHALSLAHGSDNLTRCYFK--- 250
           KL  L TSG  D GFPI+      D   ++GYI ++ELEHAL++    D      F    
Sbjct: 666 KLLCLETSGNDDGGFPILRSEPDGDGLRMIGYIGASELEHALNIVADLDADKEARFHPSY 725

Query: 251 -------------DENVIDKSA---NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVI 294
                        D +V   S+   +F+ Y++QAPLTIS N+ +E++ + F KLG RYVI
Sbjct: 726 SNDLTSSSILSLLDGHVRSGSSDPFDFSIYMDQAPLTISSNSPMELLHQFFVKLGARYVI 785

Query: 295 VVD-RGQYVGVINKKRLLIYLRQITGKD 321
           V D  G Y GVI+KK  L +L  +  K+
Sbjct: 786 VTDIDGLYAGVIDKKTWLAFLSDLEEKN 813



>gi|409080650|gb|EKM81010.1| hypothetical protein AGABI1DRAFT_37258 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 813

 Score =  254 bits (650), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 148/328 (45%), Positives = 207/328 (63%), Gaps = 34/328 (10%)

Query: 21  ALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPDF-PIYSTVCNQ 79
           A+I K    ++TFGI++PAGIFIP L VGAC GR++GI +Q++    P F P  +  C +
Sbjct: 493 AMIIKGALTLVTFGIKLPAGIFIPTLGVGACAGRIMGIWIQWMQHQNPGFGP--ARACGE 550

Query: 80  NINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMTAIMISKWVAD 139
           +  GDC+IPG+YAMVGAAA+L+GVTR+TVSL VIMFELT TLTY +P+M A++++K +AD
Sbjct: 551 D--GDCIIPGLYAMVGAAAALSGVTRTTVSLAVIMFELTDTLTYAVPVMLAVLVAKTLAD 608

Query: 140 GIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDVNDLNTIGELKN 199
            +   GIYDL+I+L   PYLD K EY   N   +   D+  RD +VI +++ NT+  L++
Sbjct: 609 ALEPKGIYDLVIELNQLPYLDYKHEYLWGNLQIS---DVTSRDPDVIRLDENNTVRSLRD 665

Query: 200 KLKKLSTSGYSDAGFPIV------DNKILVGYIASTELEHALSLAHGSDNLTRCYFK--- 250
           KL  L TSG  D GFPI+      D   ++GYI ++ELEHAL++    D      F    
Sbjct: 666 KLLCLETSGNDDGGFPILRSEPDGDGLRMIGYIGASELEHALNIVADLDADKEARFHPSY 725

Query: 251 -------------DENVIDKSA---NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVI 294
                        D +V   S+   +F+ Y++QAPLTIS N+ +E++ + F KLG RYVI
Sbjct: 726 SNDLTSSSILSLLDGHVRSGSSDPFDFSIYMDQAPLTISSNSPMELLHQFFVKLGARYVI 785

Query: 295 VVD-RGQYVGVINKKRLLIYLRQITGKD 321
           V D  G Y GVI+KK  L +L  +  K+
Sbjct: 786 VTDIDGLYAGVIDKKTWLAFLSDLEEKN 813



>gi|343424957|emb|CBQ68494.1| related to chloride channel protein [Sporisorium reilianum SRZ2]
          Length = 1058

 Score =  254 bits (650), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 162/386 (41%), Positives = 224/386 (58%), Gaps = 79/386 (20%)

Query: 1    DGLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVM 60
            +GLC +  + +      +  A++ K L  +ITFGI++PAGIFIP L VGACFGR++G+++
Sbjct: 671  EGLCVSQPSQIGPLVMAILCAMVLKGLLTIITFGIKLPAGIFIPTLAVGACFGRIVGLLV 730

Query: 61   QYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGT 120
            QY   T+P+   +S  C  + +  C++PGVYAMVGAAA+L+GVTR+TVSL VIMFELTGT
Sbjct: 731  QYAQWTHPEAGFFSW-CPAS-DSACIVPGVYAMVGAAAALSGVTRTTVSLAVIMFELTGT 788

Query: 121  LTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEY--DGANTTFTTTLDL 178
            LTY +P+M +I+++K +AD +   GIYDL+ID  G PYLDSKTEY  +G N T     D 
Sbjct: 789  LTYSVPVMLSILVAKTIADALEHKGIYDLVIDFSGLPYLDSKTEYIWNGVNVT-----DA 843

Query: 179  CQRDLEVIDVNDLNTIGELKNKLKKLST-SGYSDAGFPIV-------------------- 217
             + ++EVI ++ +NTI  L  KL  L+  SGY+D GFPIV                    
Sbjct: 844  METEVEVIALSAINTIQSLSEKLDCLARGSGYTDGGFPIVARVETASSSTLPPASPGLSA 903

Query: 218  ---------------DNKI----------LVGYIASTELEHALSLAHGSD-----NLTRC 247
                           D+            +VGYIA++ELEHAL+ A  SD         C
Sbjct: 904  SIGSMTDHIPQFSGIDDAPTPSGAPATYQMVGYIAASELEHALARAVRSDPDLRPEAAHC 963

Query: 248  YFKD----------ENVIDKSANFTA--------YVNQAPLTISKNASLEIVLELFKKLG 289
             FK+          E  +  S  FTA        YV++AP+T+  ++ LE+V + F +LG
Sbjct: 964  SFKNLPFVRAEHEGEAGVRDSVLFTASDPLDLSRYVDKAPITVQVHSPLELVHQYFTRLG 1023

Query: 290  LRYVIVVD-RGQYVGVINKKRLLIYL 314
            +RY+IVVD RG Y GVI KK  L +L
Sbjct: 1024 VRYLIVVDERGLYRGVIFKKSYLKFL 1049



>gi|390602524|gb|EIN11917.1| hypothetical protein PUNSTDRAFT_61841 [Punctularia strigosozonata
           HHB-11173 SS5]
          Length = 938

 Score =  253 bits (647), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 145/330 (43%), Positives = 210/330 (63%), Gaps = 34/330 (10%)

Query: 20  LALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPDFPIYSTVCNQ 79
           +AL+ K    ++TFGI++PAGIFIP L VGAC GR++GI++Q+    YPD  I+   C  
Sbjct: 612 IALLVKGALTIVTFGIKLPAGIFIPTLGVGACAGRIMGILVQWGQWKYPDSGIWFKYCRG 671

Query: 80  NINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMTAIMISKWVAD 139
           ++  DCV+PG+YAMVGAAA+L+GVTR+TVSL VIMFELT TLTY +P+M +++++K VAD
Sbjct: 672 DL--DCVVPGLYAMVGAAAALSGVTRTTVSLAVIMFELTDTLTYAVPVMLSVLVAKTVAD 729

Query: 140 GIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDVNDLNTIGELKN 199
            +   GIYDL+IDL   PYLD K +    +   +   D+  RD+EVI V+  NT+  L +
Sbjct: 730 ALEPKGIYDLVIDLNQLPYLDGKHDPLWGDLQIS---DVVNRDVEVIRVDRENTVKSLCD 786

Query: 200 KLKKLSTSGYSDAGFPIV---DNK-----ILVGYIASTELEHALSL-------------- 237
           +L++L +SG  D+GFPI+   D K      ++GYI ++ELEHALS+              
Sbjct: 787 QLQQLLSSGTDDSGFPILRPDDRKDGGGMRMIGYIGASELEHALSIVADEADSPVSFRVT 846

Query: 238 -AHGSDNLTRCYFKD--ENVIDKSA---NFTAYVNQAPLTISKNASLEIVLELFKKLGLR 291
            AH   ++T        E  I  +    +F+ Y++QAPLT+  NA LE++ E F KLG R
Sbjct: 847 QAHQHGDITSSSISSLAETSIYAAGDPFDFSVYMDQAPLTVQSNAPLELIQEFFVKLGTR 906

Query: 292 YVIVVDR-GQYVGVINKKRLLIYLRQITGK 320
           +V+V D  G Y GVI+KK  L ++ ++  +
Sbjct: 907 HVMVTDTDGCYEGVIDKKTWLHFVTELEER 936



>gi|299751204|ref|XP_002911604.1| voltage-gated chloride channel [Coprinopsis cinerea okayama7#130]
 gi|298409268|gb|EFI28110.1| voltage-gated chloride channel [Coprinopsis cinerea okayama7#130]
          Length = 939

 Score =  253 bits (647), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 149/349 (42%), Positives = 213/349 (61%), Gaps = 38/349 (10%)

Query: 2   GLC---DNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGI 58
           GLC     S+   +     + +A++ K    V+TFGI+VPAGIFIP L VGAC GR++GI
Sbjct: 599 GLCIVSPGSWEHAWPVAKAILIAMMVKGGLTVVTFGIKVPAGIFIPTLGVGACAGRVMGI 658

Query: 59  VMQYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELT 118
            MQYL +  PD  ++++ C+ ++   C++PG+YAMVGAAA+L+GVTR+TVSL VIMFELT
Sbjct: 659 AMQYLQIRNPDARLFAS-CHGDLG--CIVPGLYAMVGAAATLSGVTRTTVSLAVIMFELT 715

Query: 119 GTLTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDL 178
            TLTY +P+M +++++K VAD +   GIYDL+I+L   PYLD K +Y   N   +   D+
Sbjct: 716 DTLTYAVPVMLSVLVAKTVADALEPKGIYDLVIELSELPYLDYKNDYVWGNLQLS---DV 772

Query: 179 CQRDLEVIDVNDLNTIGELKNKLKKLSTSGYSDAGFPIV------DNKILVGYIASTELE 232
             RD+  I +++ NT+  L +KL  L ++G  D GFPI+      D   LVGYI + ELE
Sbjct: 773 ISRDMASIRIDEKNTVQSLSDKLLTLISTGAHDLGFPILRPDGNDDGVRLVGYIGTNELE 832

Query: 233 HALSLAHGSDNLT-RCYFKDENVIDKSA-------------------NFTAYVNQAPLTI 272
           HALS+   +DN T   YF      D ++                   +FT Y++QAPLT+
Sbjct: 833 HALSIV--ADNPTAEVYFGAPYTNDMASSISSFAEPAMPTHSSSDPYDFTPYMDQAPLTL 890

Query: 273 SKNASLEIVLELFKKLGLRYVIVVD-RGQYVGVINKKRLLIYLRQITGK 320
           +  + LE++   F KLG RYV+VVD  G Y G++ KK  L +L +   K
Sbjct: 891 TNQSPLEMLHRFFVKLGARYVVVVDSEGLYEGIVEKKNWLAFLTEFEEK 939



>gi|384500420|gb|EIE90911.1| hypothetical protein RO3G_15622 [Rhizopus delemar RA 99-880]
          Length = 822

 Score =  251 bits (641), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 146/365 (40%), Positives = 219/365 (60%), Gaps = 54/365 (14%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC  +   + +  YLL   L+ K    VITFG  VP GIF+P+L++GA  GR++G++MQ
Sbjct: 455 GLCARTIAEIPQLIYLLATTLVIKAALTVITFGCPVPGGIFLPSLIIGAVTGRIIGLIMQ 514

Query: 62  YLTMTYPD-FPIYSTVCNQNI--NGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELT 118
           YLT++YP  +P   T C ++    G+C+IPGVYA+VG AA LAGVTR+T+SL VIMFELT
Sbjct: 515 YLTVSYPSAWPF--TACAEDFASRGECIIPGVYAIVGGAAGLAGVTRTTISLVVIMFELT 572

Query: 119 GTLTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDL 178
            +LTY LPIM ++M+SKWV+D I   G+YDLLI+L  +PYL++  +Y    +T  T+L  
Sbjct: 573 YSLTYALPIMISVMVSKWVSDAIYLEGVYDLLINLKQYPYLETGRDYVHTTSTTITSLID 632

Query: 179 CQRDLEVIDVNDLNTIGELKNKLKKLSTSGYS-DAGFPIVDNKILVGYIASTELEHAL-- 235
           C   L  ID++   T+  L+ KL  ++  GY+ D GFPI+   +L GYIA++EL H L  
Sbjct: 633 C---LPAIDIDQPVTVEILRKKLSVITALGYAEDGGFPILSGDVLEGYIATSELTHGLDQ 689

Query: 236 -------SLAHGSDNLTRCYFK--------------------------------DENVID 256
                  +++    N   CYF+                                +    D
Sbjct: 690 LEMKLNMTMSQEEINHVPCYFRKLVHGQMTEIGMNRDLKTPVRDLLAIGNPKDMEAMFFD 749

Query: 257 KSA---NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVVDR-GQYVGVINKKRLLI 312
           +S    +F+ Y++ APLT+++N S+ +++++F KLG RYV V    G+++G+I+K+RLL 
Sbjct: 750 ESQAWNDFSHYIDHAPLTVNQNTSMTLLVDVFSKLGARYVGVKHSDGKFMGIIHKRRLLA 809

Query: 313 YLRQI 317
           YL+ +
Sbjct: 810 YLKDL 814



>gi|389741902|gb|EIM83090.1| hypothetical protein STEHIDRAFT_63677 [Stereum hirsutum FP-91666
           SS1]
          Length = 941

 Score =  250 bits (639), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 143/324 (44%), Positives = 215/324 (66%), Gaps = 29/324 (8%)

Query: 20  LALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPDFPIYSTVCNQ 79
           +A++ K +  +ITFGI+VPAGIFIP+L VGAC GR++GI++Q+    +P   ++ + C  
Sbjct: 622 IAMVVKGVLTIITFGIKVPAGIFIPSLGVGACAGRIVGILIQWAQWHWPHARVFRS-CGG 680

Query: 80  NINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMTAIMISKWVAD 139
           ++  DCV+PG+Y+MVGAAASL+GVTR+T+SL VIMFELT +L+YV+P+M +++++K VAD
Sbjct: 681 DL--DCVVPGLYSMVGAAASLSGVTRTTISLAVIMFELTDSLSYVIPVMLSVLVAKTVAD 738

Query: 140 GIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDVNDLNTIGELKN 199
            +   GIYDL+IDL   PYLD+K EY   +       D  +R++EVI V+   T+  L++
Sbjct: 739 ALEPKGIYDLVIDLAQLPYLDAKHEYLWGSLGVN---DAVEREVEVIRVDTPPTVKTLRD 795

Query: 200 KLKKLSTSGYSDAGFPIV----DNKILVGYIASTELEHALSL-AHGSDNL-----TRCY- 248
           +L+ +  SGY+D G PI+        +VGYI ++ELEHALS+ A  +D+      TR + 
Sbjct: 796 QLQIVVASGYADGGLPILYQDDGGSRMVGYIGASELEHALSIVADEADSAVHFTGTRGFR 855

Query: 249 FKD------ENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVVD 297
           F D       + I+  +     +F+ Y++QAPLT+  N+ LE+V + F KLG RYV+V D
Sbjct: 856 FTDLSSSSVSSFINHPSGYDPLDFSVYMDQAPLTVQLNSPLELVHQFFVKLGARYVVVQD 915

Query: 298 RGQYV-GVINKKRLLIYLRQITGK 320
            G Y  GVI+KK  L +L ++  K
Sbjct: 916 SGGYYEGVIDKKAWLAFLGELEHK 939



>gi|302679442|ref|XP_003029403.1| hypothetical protein SCHCODRAFT_58346 [Schizophyllum commune H4-8]
 gi|300103093|gb|EFI94500.1| hypothetical protein SCHCODRAFT_58346 [Schizophyllum commune H4-8]
          Length = 928

 Score =  249 bits (637), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 148/358 (41%), Positives = 208/358 (58%), Gaps = 53/358 (14%)

Query: 2   GLC---DNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGI 58
           GLC     +F  ++     + +A++ K    ++TFGI+VPAGIFIP L VGAC GR+LGI
Sbjct: 585 GLCVVDPGAFAAVWPVARAILVAMVVKGALTIVTFGIKVPAGIFIPTLGVGACAGRVLGI 644

Query: 59  VMQYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELT 118
            MQ+  M  P+  +Y   C  ++  DC+IPG+YAMVGAAA+L+GVTR+TVSL VIMFELT
Sbjct: 645 AMQWHQMQSPEGRLYK-ACGGDL--DCIIPGLYAMVGAAAALSGVTRTTVSLAVIMFELT 701

Query: 119 GTLTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDL 178
            TLTY +P+M A++++K VAD +   GIYDL+ID+   PYLD+K  Y   N       D+
Sbjct: 702 DTLTYAVPVMLAVLVAKTVADALEPKGIYDLVIDVQQLPYLDAKHTYLWGNVQVG---DV 758

Query: 179 CQRDLEVIDVNDLNTIGELKNKLKKLSTSGYSDAGFPI------VDNKILVGYIASTELE 232
            +RD+  I +++  T+  L++ L + S  G  D GFPI      +D   +VGYI + ELE
Sbjct: 759 LRRDVPAIKLDEKQTVESLRDMLVEASVGGDGDGGFPILRRDAEMDGYRMVGYIGANELE 818

Query: 233 HALSL-----------------------------AHGSDNLTRCYFKDENVIDKSANFTA 263
           HAL+L                              HG+   TR Y           +F+ 
Sbjct: 819 HALTLVADNPDSEVQFTQNWVHHSLAASSISSLLEHGAGGATREY--------DPFDFSP 870

Query: 264 YVNQAPLTISKNASLEIVLELFKKLGLRYVIVVDR-GQYVGVINKKRLLIYLRQITGK 320
           Y++QAPL ++ N+ LE+V + F KLG RYV+V D  G Y GVI+KK  L +L ++  K
Sbjct: 871 YMDQAPLLVAFNSPLELVHQFFVKLGARYVVVTDADGLYEGVIDKKTWLAFLSELEEK 928



>gi|321259349|ref|XP_003194395.1| voltage-gated chloride channel [Cryptococcus gattii WM276]
 gi|317460866|gb|ADV22608.1| voltage-gated chloride channel, putative [Cryptococcus gattii WM276]
          Length = 1117

 Score =  244 bits (622), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 146/365 (40%), Positives = 216/365 (59%), Gaps = 57/365 (15%)

Query: 3    LCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQY 62
            LC +  + +    + + +AL+ K    +ITFGI+VPAGIFIP+L VGACFGR++G +M+Y
Sbjct: 754  LCVSQPHELPTVIWEVFMALVIKGCLTIITFGIKVPAGIFIPSLAVGACFGRIVGHMMEY 813

Query: 63   LTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLT 122
            +   +PD  I+S VC    N DCV+PG+YAMVGAAA+LAGVTR+TVSL VIMFELT TL 
Sbjct: 814  IEFVHPDLSIFS-VCK---NTDCVVPGIYAMVGAAATLAGVTRTTVSLAVIMFELTSTLN 869

Query: 123  YVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRD 182
            YV+P+M +++I+K VADG+ + GIYDL+IDL   PYLDSK EY   +   ++  D   R 
Sbjct: 870  YVVPVMLSVLIAKTVADGLERKGIYDLVIDLNQLPYLDSKHEYLWGSRRASSVAD---RS 926

Query: 183  LEVIDVNDLNTIGELKNKLKKLSTSGYSDAGFPIVDNKI--------------------- 221
            +  +  +  +T+  L  KL +L   G  D GFP++  ++                     
Sbjct: 927  VPHLRADKPHTVRSLTGKLLELVRLGMEDTGFPVLAKEVTSAGGPGTNVGLGLDGGIGSG 986

Query: 222  -------LVGYIASTELEHALS-LAHG--------SDNLTRCYFKD---------ENVID 256
                   +VG++   ELEHALS LA           D+ T+   ++         ++ +D
Sbjct: 987  RERSCLRVVGFLGINELEHALSELADEPDAAINLTPDDATQARIRNSALSIFSFADSFVD 1046

Query: 257  KSAN---FTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVVD-RGQYVGVINKKRLLI 312
               N    + Y++QAP+T+  ++ LE+V +LF KLG+R +IVV+ RG + G+I KK  L 
Sbjct: 1047 NGWNPCDLSRYIDQAPITVQIHSPLELVQQLFVKLGVRQIIVVNSRGVFQGIITKKAWLS 1106

Query: 313  YLRQI 317
            +L ++
Sbjct: 1107 FLSEL 1111



>gi|58267620|ref|XP_570966.1| voltage-gated chloride channel [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|134112257|ref|XP_775104.1| hypothetical protein CNBE3780 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50257756|gb|EAL20457.1| hypothetical protein CNBE3780 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57227200|gb|AAW43659.1| voltage-gated chloride channel, putative [Cryptococcus neoformans
           var. neoformans JEC21]
          Length = 897

 Score =  242 bits (617), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 150/365 (41%), Positives = 212/365 (58%), Gaps = 57/365 (15%)

Query: 3   LCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQY 62
           LC N  + +    + + +ALI K    +ITFGI+VPAGIFIP+L VGACFGR++G +M+Y
Sbjct: 534 LCVNHPHELATVIWEVFMALIIKGCLTIITFGIKVPAGIFIPSLAVGACFGRIVGHMMEY 593

Query: 63  LTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLT 122
           +  TYP+  I++ VC      DC++PGVYAMVGAAA+LAGVTR+TVSL VIMFELT TL 
Sbjct: 594 IEFTYPELSIFN-VCKDT---DCIVPGVYAMVGAAATLAGVTRTTVSLAVIMFELTSTLN 649

Query: 123 YVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRD 182
           YV+P+M +I+I+K VADG+ K GIYDL+IDL   PYLDSK EY   +    +  D   R 
Sbjct: 650 YVVPVMLSILIAKTVADGLEKKGIYDLVIDLNQLPYLDSKHEYLWGSRRAYSVAD---RS 706

Query: 183 LEVIDVNDLNTIGELKNKLKKLSTSGYSDAGFPIVDNKI--------------------- 221
           +  +  +  +T+  L  KL +L   G  D GFP++  ++                     
Sbjct: 707 VPHLRADKPHTVRSLTGKLLELVRLGMEDTGFPVLVKEMTSAGGPGTSAGVGLEGGIGSG 766

Query: 222 -------LVGYIASTELEHALS-LAHGSD------------------NLTRCYFKDENV- 254
                  +VG++   ELEHALS LA   D                   ++   F D  V 
Sbjct: 767 RERSCLRVVGFLGINELEHALSELADEPDAAINLIPDDASQARVRSSAMSIFSFADSFVD 826

Query: 255 -IDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVVD-RGQYVGVINKKRLLI 312
            +    + + Y++QAP+T+  ++ LE+V +LF KLG+R VIVV+ RG + G+I KK  L 
Sbjct: 827 NVWNPCDLSRYIDQAPITVQIHSPLELVQQLFVKLGVRQVIVVNSRGVFQGIITKKAWLN 886

Query: 313 YLRQI 317
           +L ++
Sbjct: 887 FLSEL 891



>gi|405120892|gb|AFR95662.1| voltage-gated chloride channel [Cryptococcus neoformans var. grubii
           H99]
          Length = 897

 Score =  241 bits (615), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 147/365 (40%), Positives = 212/365 (58%), Gaps = 57/365 (15%)

Query: 3   LCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQY 62
           LC N  + +    + + +AL+ K    +ITFGI+VPAGIFIP+L VGACFGR++G +M+Y
Sbjct: 534 LCVNYPHELATVIWEVFMALVIKGCLTIITFGIKVPAGIFIPSLAVGACFGRIVGHMMEY 593

Query: 63  LTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLT 122
           +  TYP+  I++ VC      DC++PG+YAMVGAAA+LAGVTR+TVSL VIMFELT TL 
Sbjct: 594 IEFTYPELSIFN-VCKDT---DCIVPGIYAMVGAAATLAGVTRTTVSLAVIMFELTSTLN 649

Query: 123 YVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRD 182
           YV+P+M  ++I+K VADG+ K GIYDL+IDL   PYLDSK EY   +   ++  D   R 
Sbjct: 650 YVVPVMLGVLIAKTVADGLEKKGIYDLVIDLNQLPYLDSKHEYLWGSRRASSVAD---RS 706

Query: 183 LEVIDVNDLNTIGELKNKLKKLSTSGYSDAGFPIVDNKI--------------------- 221
           +  +  +  +T+  L  KL +L   G  D GFP++  ++                     
Sbjct: 707 VPHLRADKPHTVRSLTGKLLELVRLGMEDTGFPVLVKEVTSAGGPSTSASVGLEGGIGSG 766

Query: 222 -------LVGYIASTELEHALS-LAHGSDNLTRCYFKD--ENVIDKSA------------ 259
                  +VG++   ELEHALS LA   D        D  ++ +  SA            
Sbjct: 767 RERSCLRVVGFLGINELEHALSELADEPDAAINLIPDDASQSRVRSSAMSIFSFADSFVD 826

Query: 260 ------NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVVD-RGQYVGVINKKRLLI 312
                 + + Y++QAP+T+  ++ LE+V +LF KLG+R VIVV+ RG + G+I KK  L 
Sbjct: 827 NVWNPYDLSRYIDQAPITVQIHSPLELVQQLFVKLGVRQVIVVNSRGVFQGIITKKAWLN 886

Query: 313 YLRQI 317
           +L ++
Sbjct: 887 FLSEL 891



>gi|393234764|gb|EJD42324.1| clc channel [Auricularia delicata TFB-10046 SS5]
          Length = 808

 Score =  241 bits (615), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 150/349 (42%), Positives = 209/349 (59%), Gaps = 48/349 (13%)

Query: 2   GLCD--NSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIV 59
           GLC     F G  +    +G+AL+ K +  ++TFGI++PAGIFIP L VGAC GR+LG+ 
Sbjct: 477 GLCVPVGDFVGARKVMQSIGVALLVKGVMTIVTFGIKLPAGIFIPTLGVGACCGRILGLA 536

Query: 60  MQYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTG 119
           +Q L                  + D VIPGVYAMVGAAA+L+GVTR+TVSL VIMFELT 
Sbjct: 537 VQSLQWRLG-------------SADEVIPGVYAMVGAAAALSGVTRTTVSLAVIMFELTD 583

Query: 120 TLTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEY-DGANTTFTTTLDL 178
           TLTYV+P+M +++++K VAD +   GIYDL+I L   PYLD+K +Y  GA     +  D+
Sbjct: 584 TLTYVIPVMLSVLVAKTVADALEPKGIYDLVIQLNQLPYLDAKHQYLWGA----MSVADV 639

Query: 179 CQRDLEVIDVNDLNTIGELKNKLKKLSTSGYSDAGFPIVD----NKILVGYIASTELEHA 234
            +R +  I +++ NT+  L +KL+ L   G +D+GFPIV      + +VGYI   ELEHA
Sbjct: 640 TERHVATIRLDEPNTVKYLIDKLQDLVAQGDNDSGFPIVRTDGYRQRMVGYIGVNELEHA 699

Query: 235 LSLAHGSDNLTRCYFK-DEN---------------------VIDKSANFTAYVNQAPLTI 272
           LS+     N   C+F  D N                     V +   +F+ Y++QAPLT+
Sbjct: 700 LSIVADQPNAI-CHFSTDSNGRREDAYSVSSLSTNGFGAAGVKNDPFDFSVYMDQAPLTV 758

Query: 273 SKNASLEIVLELFKKLGLRYVIVVDR-GQYVGVINKKRLLIYLRQITGK 320
             ++ LE+V +LF KLG RY++VVD  G Y GV++KK  L +L +I G 
Sbjct: 759 QTHSPLELVQQLFVKLGARYLVVVDADGFYEGVLDKKGWLTFLNEIEGH 807



>gi|392574163|gb|EIW67300.1| hypothetical protein TREMEDRAFT_34025 [Tremella mesenterica DSM
           1558]
          Length = 923

 Score =  239 bits (611), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 135/343 (39%), Positives = 208/343 (60%), Gaps = 30/343 (8%)

Query: 3   LCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQY 62
           LC    + +      +G AL+ K    +ITFGI++PAGIFIP+L+VGACFGR++G+ +++
Sbjct: 588 LCAQHPHEIASVISTIGFALLIKGALTIITFGIKLPAGIFIPSLVVGACFGRIIGLTLEW 647

Query: 63  LTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLT 122
           L   +PD PI+  VC      DC++PG+YAMVGAAA+LAGVTR+TVSL VI+ ELT +L 
Sbjct: 648 LEFAFPDLPIFG-VCTGT---DCIVPGLYAMVGAAATLAGVTRTTVSLAVIVIELTASLN 703

Query: 123 YVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRD 182
           YV+PIM  ++++K VADG+ K GIYDL+IDL   P+LDSK EY          +D+   +
Sbjct: 704 YVVPIMLGVLVAKTVADGLEKKGIYDLVIDLNQLPFLDSKHEYLWGG---RRAIDVADHE 760

Query: 183 LEVIDVNDLNTIGELKNKLKKLSTSGYSDAGFPIV-----DNKILVGYIASTELEHALSL 237
           +  +  + +N++  L  +L  L  +  +D GFP++     ++  +VG++   ELEHAL  
Sbjct: 761 VPFLRADKVNSVRRLTGQLLALVRTDMADTGFPLLVKENSNSLRIVGFLGMNELEHALRT 820

Query: 238 ---------------AHGSDNLTRCYFKDENVIDK--SANFTAYVNQAPLTISKNASLEI 280
                          A    +    +   E+V D+    + + YV++AP+T+ K++ LE+
Sbjct: 821 LQDEPEAELQLMPNDASRQQSTMSIFSFAESVNDRYDPYDISRYVDRAPITVQKDSPLEL 880

Query: 281 VLELFKKLGLRYVIVVD-RGQYVGVINKKRLLIYLRQITGKDM 322
           V +LF KLG   ++VVD RG + G+I KK  L +L ++  K +
Sbjct: 881 VQQLFVKLGASQLLVVDHRGCFKGMITKKAWLRFLSELEEKSI 923



>gi|406700654|gb|EKD03819.1| voltage-gated chloride channel [Trichosporon asahii var. asahii CBS
            8904]
          Length = 1185

 Score =  232 bits (592), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 138/342 (40%), Positives = 200/342 (58%), Gaps = 39/342 (11%)

Query: 3    LCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQY 62
            LC    N   +  + + +AL+ K    +ITFG+ +PAGIFIP+L++GACFGR++GIVM+ 
Sbjct: 845  LCIGPNNPAGKVIWTVFIALVIKASLTIITFGLALPAGIFIPSLVIGACFGRIVGIVMEL 904

Query: 63   LTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLT 122
            +   YP   ++   C +     CVIPGVYAM+GAAA+LAGVTR+TVSL VIMFELTGTL 
Sbjct: 905  VQHKYPTLGMFEG-CTK-----CVIPGVYAMIGAAATLAGVTRTTVSLAVIMFELTGTLN 958

Query: 123  YVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRD 182
            Y +P+M A++++K VAD + K GIY+L+I+L   PYL  K E        +  +D   R+
Sbjct: 959  YTVPVMLAVLVAKTVADALEKRGIYELVIELKKLPYLSDKEEVLFGGRLVSEVMD---RE 1015

Query: 183  LEVIDVNDLNTIGELKNKLKKLSTSGYSDAGFPIVDNKILV-------------GYIAST 229
               +  +  +T+ EL  +L +L   GY DAGFP++  +  V             G++   
Sbjct: 1016 APTLRADKPHTVRELTGRLLELVRLGYEDAGFPVLVKEAAVDREGRTYPVLRVLGFLGIN 1075

Query: 230  ELEHAL-SLAHGSD---NLTR---------CYFKDENVIDKSAN---FTAYVNQAPLTIS 273
            E+EHAL +LA   D   NLT            F     +D   N    + Y+++AP+T+ 
Sbjct: 1076 EMEHALNALADEPDAVVNLTPDEVMRSSRLSIFSFSESVDGRHNPYDLSQYIDRAPITVQ 1135

Query: 274  KNASLEIVLELFKKLGLRYVIVVD-RGQYVGVINKKRLLIYL 314
             ++ LE+V ELF KLG R ++V D RG Y G + KK+ + YL
Sbjct: 1136 MHSPLELVQELFIKLGSRQILVTDSRGTYRGALYKKQWIAYL 1177



>gi|401882637|gb|EJT46888.1| voltage-gated chloride channel [Trichosporon asahii var. asahii CBS
            2479]
          Length = 1185

 Score =  232 bits (592), Expect = 9e-59,   Method: Composition-based stats.
 Identities = 138/342 (40%), Positives = 200/342 (58%), Gaps = 39/342 (11%)

Query: 3    LCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQY 62
            LC    N   +  + + +AL+ K    +ITFG+ +PAGIFIP+L++GACFGR++GIVM+ 
Sbjct: 845  LCIGPNNPAGKVIWTVFIALVIKASLTIITFGLALPAGIFIPSLVIGACFGRIVGIVMEL 904

Query: 63   LTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLT 122
            +   YP   ++   C +     CVIPGVYAM+GAAA+LAGVTR+TVSL VIMFELTGTL 
Sbjct: 905  VQHKYPTLGMFEG-CTK-----CVIPGVYAMIGAAATLAGVTRTTVSLAVIMFELTGTLN 958

Query: 123  YVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRD 182
            Y +P+M A++++K VAD + K GIY+L+I+L   PYL  K E        +  +D   R+
Sbjct: 959  YTVPVMLAVLVAKTVADALEKRGIYELVIELKKLPYLSDKEEVLFGGRLVSEVMD---RE 1015

Query: 183  LEVIDVNDLNTIGELKNKLKKLSTSGYSDAGFPIVDNKILV-------------GYIAST 229
               +  +  +T+ EL  +L +L   GY DAGFP++  +  V             G++   
Sbjct: 1016 APTLRADKPHTVRELTGRLLELVRLGYEDAGFPVLVKEAAVDREGRTYPVLRVLGFLGIN 1075

Query: 230  ELEHAL-SLAHGSD---NLTR---------CYFKDENVIDKSAN---FTAYVNQAPLTIS 273
            E+EHAL +LA   D   NLT            F     +D   N    + Y+++AP+T+ 
Sbjct: 1076 EMEHALNALADEPDAVVNLTPDEVMRSSRLSIFSFSESVDGRHNPYDLSQYIDRAPITVQ 1135

Query: 274  KNASLEIVLELFKKLGLRYVIVVD-RGQYVGVINKKRLLIYL 314
             ++ LE+V ELF KLG R ++V D RG Y G + KK+ + YL
Sbjct: 1136 MHSPLELVQELFIKLGSRQILVTDSRGTYRGALYKKQWIAYL 1177



>gi|407928769|gb|EKG21618.1| Chloride channel voltage gated [Macrophomina phaseolina MS6]
          Length = 910

 Score =  231 bits (588), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 128/336 (38%), Positives = 201/336 (59%), Gaps = 20/336 (5%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC  +   + E  + L +A + K L  VITFGI+VPAGI++P+++VG   GRM+G ++Q
Sbjct: 582 GLCATN-ERIPEIIWYLFVAFVIKALLTVITFGIKVPAGIYVPSMVVGGLMGRMVGHIVQ 640

Query: 62  YLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTL 121
           YL + Y    ++ T   ++    CV+PGVYAMV A A++ GVTR +V+L VI+FELTG+L
Sbjct: 641 YLALNYSSTGLFGTCHKEDNPESCVVPGVYAMVAAGATMCGVTRLSVTLAVILFELTGSL 700

Query: 122 TYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTL-DLCQ 180
            +VLP    +++SKWVAD I    IYDLL D+  +P+LD+K         FT+ L D+ Q
Sbjct: 701 DHVLPFSLGVLVSKWVADAIEPLSIYDLLTDMNSYPFLDNKFR-----PVFTSQLGDITQ 755

Query: 181 --RDLEVIDVND--LNTIGELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHALS 236
             R+  +ID+ +  L    +L+ +L++L  +G  D G PIV + +LVG I + +LE AL 
Sbjct: 756 PTREERIIDITNSPLVPAKQLRFQLQQLHLNGELDGGLPIVRDGVLVGLIPAPDLEFALD 815

Query: 237 LAHGSDNLTRCYFKDE--------NVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKL 288
                DN T C    E        +      +FT Y++ AP+++   + +++V E F KL
Sbjct: 816 KLDNEDN-TLCLMSPEVGWNSHEDDEESDPTDFTPYIDPAPVSLEYRSPMDLVYECFVKL 874

Query: 289 GLRYVIVVDRGQYVGVINKKRLLIYLRQITGKDMNN 324
           GLRY+ V   G+Y G+++KK  + Y++ +   + ++
Sbjct: 875 GLRYICVTKNGKYAGMVHKKAFVKYMKDVEENEKHH 910



>gi|328770954|gb|EGF80995.1| hypothetical protein BATDEDRAFT_88198 [Batrachochytrium dendrobatidis
            JAM81]
          Length = 1128

 Score =  229 bits (585), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 136/364 (37%), Positives = 211/364 (57%), Gaps = 63/364 (17%)

Query: 3    LCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQY 62
            LC + +  +  + +    AL++K +  + TFGI+VPAG+F+P+++VGAC GR+LG+   Y
Sbjct: 760  LCHSDYPAIMLSLFF---ALVTKLVLMIFTFGIKVPAGLFVPSMVVGACAGRILGVFGLY 816

Query: 63   LTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLT 122
            +   YP   ++S    +    +C+ PG+YAMVGAAA+++GVTR TVSLT+IMFELTG LT
Sbjct: 817  VQAMYPTSWVFSFCQGRE---ECITPGLYAMVGAAAAISGVTRMTVSLTIIMFELTGGLT 873

Query: 123  YVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTE--YDGANTTFTTTLDLCQ 180
            YVLP+M +IM++KWV D      IYD++I   G+PYL+ K     D A     +  D+  
Sbjct: 874  YVLPLMVSIMVAKWVGDAFGSESIYDVIIKRSGYPYLNHKRTLVSDPA-----SARDIMV 928

Query: 181  RDLEVIDVNDLNTIGELKNKLKKL-STSGYSDAGFPIV-DNKILVGYIASTELEHALSLA 238
            R  + + V  +  + +++ KL KL  T    D G P+V DN++L+GYI+ TELEHAL + 
Sbjct: 929  RGGDRLFVGKVYDVEDVETKLAKLEQTYASKDGGLPVVKDNEMLLGYISQTELEHALIMV 988

Query: 239  HGS---------DNLTRCYFKDEN-------VIDKSANF--------------------- 261
              +          NL    F +++       V+ +  +F                     
Sbjct: 989  KNAPQSPQKLVFQNLAIQSFTEQSIDAPTTPVLQQPLDFDMDGSVSQATLAADNANHSDP 1048

Query: 262  -----------TAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVVDRGQYVGVINKKRL 310
                       + +V+Q PL++S+ +S+E+V+ELF KLG+R + VV  G++VG+I+KKRL
Sbjct: 1049 ESGSNATPVDVSQWVDQTPLSVSELSSIELVVELFIKLGVRTLCVVSEGKFVGLIHKKRL 1108

Query: 311  LIYL 314
            LI+L
Sbjct: 1109 LIFL 1112



>gi|345569240|gb|EGX52108.1| hypothetical protein AOL_s00043g498 [Arthrobotrys oligospora ATCC
           24927]
          Length = 864

 Score =  229 bits (584), Expect = 7e-58,   Method: Compositional matrix adjust.
 Identities = 129/318 (40%), Positives = 194/318 (61%), Gaps = 19/318 (5%)

Query: 13  EAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPDFPI 72
           E    LG+AL+ K    +ITFG +VPAG+++P +++G   G M+G+ +QYL +T P   +
Sbjct: 548 ETIKELGVALVVKTFLTIITFGTKVPAGVYVPTMVIGGIIGHMVGLALQYLHLTQPGHFL 607

Query: 73  YSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMTAIM 132
           + + C    +  CV+PGVYA+V A A++ GVTR +V+L VI+FELTG+L YVLP   A+M
Sbjct: 608 FQS-CPTEGHFPCVVPGVYALVTAGAAMCGVTRLSVTLVVILFELTGSLDYVLPFSLAVM 666

Query: 133 ISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDL---EVIDVN 189
           +SKWVAD +    IYDLL DL G+PYLD+K         FT+ L      L    +IDV+
Sbjct: 667 VSKWVADWVEPLSIYDLLTDLNGYPYLDAKMA-----PIFTSELSDIISSLPPQRIIDVS 721

Query: 190 DLNTIG--ELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHALS-LAHGSDNLTR 246
           + + +   EL+ KL  L  SG  D G P++ + ILVG I + +LE+AL  L + + +L  
Sbjct: 722 NSSLVPAVELRRKLHSLQASGELDGGLPLLRDGILVGLIPAPDLEYALDGLKNEATDLCL 781

Query: 247 CYFKD-------ENVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVVDRG 299
              +D       E+      +FT YV+ AP+ +   + +E+V ELF KLGLR++ +   G
Sbjct: 782 METEDGYHDYESEDGTRMLTDFTGYVDPAPIALEIRSPMELVYELFVKLGLRFLCITQEG 841

Query: 300 QYVGVINKKRLLIYLRQI 317
           Q+ G+++KK LL YL+ +
Sbjct: 842 QFAGMVHKKDLLKYLKNL 859



>gi|472244943|gb|EMR89544.1| putative voltage gated chloride channel protein [Botryotinia
           fuckeliana BcDW1]
          Length = 883

 Score =  228 bits (582), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 129/342 (37%), Positives = 203/342 (59%), Gaps = 31/342 (9%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC NS + +F     L +A   K L  +ITFGI+VPAGI++P+++VG   GR++G ++Q
Sbjct: 554 GLCPNSIDEIFPIIGQLTIAFFIKGLLTIITFGIKVPAGIYVPSMVVGGLLGRIVGHLVQ 613

Query: 62  YLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTL 121
           +L +T+P   I+ +         C+ PGVYA++ A +++ GVTR +V+L VI+FELTG+L
Sbjct: 614 WLVLTFPQASIFESCAAHESGTSCITPGVYALIAAGSTMCGVTRLSVTLAVILFELTGSL 673

Query: 122 TYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTL-DLCQ 180
            YVLP   A+++SKW AD +    IYDLL +L  +P+L++K +       FT+ L D+  
Sbjct: 674 DYVLPFSLAVLVSKWTADFMEPLSIYDLLTNLNAYPFLNNKHK-----PIFTSDLADIVP 728

Query: 181 --RDLEVID--VNDLNTIGELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHALS 236
             R   VID  V+ +     L+ KL+ L  +G  D G PI+ + +LVG I + +LE AL 
Sbjct: 729 RVRRERVIDISVSPMIPASSLRQKLELLHQAGEVDGGLPIIRDDVLVGLIPAPDLEFAL- 787

Query: 237 LAHGSDNL-----TRCYF---------KDENVIDKSANFTAYVNQAPLTISKNASLEIVL 282
                DNL     T C           ++E  +D + +FT Y++ AP+ +   + +++V 
Sbjct: 788 -----DNLDNEPGTLCLMATISNYDDSEEEERVDPT-DFTPYIDPAPVALDIRSPMDLVY 841

Query: 283 ELFKKLGLRYVIVVDRGQYVGVINKKRLLIYLRQITGKDMNN 324
           E F KLGLRYV V+  G+Y G+ +KK  + Y+R++  +D +N
Sbjct: 842 ECFVKLGLRYVCVLKDGRYAGLTHKKTFVKYMRELEERDGHN 883



>gi|391332631|ref|XP_003740736.1| PREDICTED: H(+)/Cl(-) exchange transporter 3-like [Metaseiulus
           occidentalis]
          Length = 906

 Score =  228 bits (581), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 129/328 (39%), Positives = 206/328 (62%), Gaps = 20/328 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G+F++ + LG  LI K L  + TFGI+VPAGIFIP+L +GA  GR++G+ M+ L    P 
Sbjct: 586 GVFKSMWNLGFTLIFKMLITIFTFGIKVPAGIFIPSLALGAITGRIVGVGMEQLVYHNPH 645

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+  +C+      C+ PG+YAMVGAAA L GVTR TVSL VIMFELTG++ Y++P+MT
Sbjct: 646 WWIFEGMCSTG--QQCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGSVNYIVPLMT 703

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQR-DLEVIDV 188
           +IM +KWVAD I K GIYD  I+L G+P+LD+K E++  +TT    +   +R +  +I +
Sbjct: 704 SIMAAKWVADAIGKEGIYDAHINLNGYPFLDAKEEFE--HTTIAHDVMRPRRGEGRLICL 761

Query: 189 N-DLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTELEHALSLAHGSD-- 242
             +  T+GE+++ L+  S +GY     P++   DN  LVG++   +L  ALS   G +  
Sbjct: 762 TLEGQTVGEVEDMLRTTSHNGY-----PLIASDDNPCLVGFVLRRDLNIALSSLAGQEVS 816

Query: 243 NLTRCYFKDENVIDKSA----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVVDR 298
           + +R  F   + +  +       +  V+ AP+T++ +  +E V+++F+KLGLR  +V   
Sbjct: 817 SSSRVLFASTSTVAWNEGPPLKLSRIVDLAPITVTDHTPMETVIDMFRKLGLRQTLVTKN 876

Query: 299 GQYVGVINKKRLLIYLRQITGKDMNNTL 326
           G+ +G+I KK +L +++ +  +D  + L
Sbjct: 877 GKILGIITKKDVLRHIKLLANQDPESVL 904



>gi|429858500|gb|ELA33316.1| chloride channel protein 3 [Colletotrichum gloeosporioides Nara
           gc5]
          Length = 855

 Score =  226 bits (577), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 131/342 (38%), Positives = 204/342 (59%), Gaps = 37/342 (10%)

Query: 2   GLCDNS-------FNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGR 54
           GLC  +        +G+F AF      LI  FLT +ITFGI+VPAGI++P+++VG   GR
Sbjct: 528 GLCPTTAEGIPPVLSGLFSAF------LIKGFLT-IITFGIKVPAGIYVPSMVVGGLMGR 580

Query: 55  MLGIVMQYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIM 114
           ++G V+QY+ + YP F ++ T C  +  G C+ PGVY ++ A +++ GVTR +V+L VI+
Sbjct: 581 IVGHVVQYIVLMYPTFGLW-TRCAASPTGSCIQPGVYGLIAAGSTMCGVTRLSVTLAVIL 639

Query: 115 FELTGTLTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTT 174
           FELTG+L YVLP   AI+++KW AD I  + IYDLL ++  +P+LD+K +       FT+
Sbjct: 640 FELTGSLDYVLPFSLAILVAKWTADAIEPNSIYDLLTNMNSYPFLDNKHK-----PIFTS 694

Query: 175 TL-DLCQ--RDLEVIDVNDLNTIG--ELKNKLKKLSTSGYSDAGFPIVDNKILVGYIAST 229
            L D+    R   +IDV+    I    L+ KL+ L  +G  D G PI+ + ILVG I + 
Sbjct: 695 DLADIVPRVRRERIIDVSASPVISAVSLRKKLQTLHRAGELDGGLPIIRDGILVGLIPAP 754

Query: 230 ELEHAL-SLAHGSDNLTRCYFK---------DENVIDKSANFTAYVNQAPLTISKNASLE 279
           +LE AL SL   + ++  C            DE       +FT Y++ AP+ +   + ++
Sbjct: 755 DLEFALDSLDDEASSM--CLMAHIPTIEDSDDEETERDKTDFTPYIDPAPVALDIRSPMD 812

Query: 280 IVLELFKKLGLRYVIVVDRGQYVGVINKKRLLIYLRQITGKD 321
           +V E F KLGLR++ V+  G+Y G+++KK  + Y+R++  K+
Sbjct: 813 LVYECFVKLGLRFICVLKNGRYAGMVHKKSFVKYMRELEEKE 854



>gi|345495146|ref|XP_001603848.2| PREDICTED: H(+)/Cl(-) exchange transporter 3-like isoform 1
           [Nasonia vitripennis]
          Length = 820

 Score =  226 bits (576), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 139/345 (40%), Positives = 206/345 (59%), Gaps = 32/345 (9%)

Query: 1   DGLCD-----NSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRM 55
           D LCD      +FN  +   YLL LA + KF+  + TFG++VP G+FIP+L  GA  GR+
Sbjct: 487 DMLCDYQRNLQTFN--WAPIYLLILAFVFKFIMTIFTFGMKVPCGLFIPSLCFGAITGRI 544

Query: 56  LGIVMQYLTMTYPDFPIYSTVCNQNING-DCVIPGVYAMVGAAASLAGVTRSTVSLTVIM 114
            GI M+ L   YP   ++S  C+   NG DC+ PG+YA+VGAAA L GVTR TVSL VIM
Sbjct: 545 FGIGMEQLAYHYPHIWMFSDECS---NGEDCITPGLYAIVGAAAVLGGVTRMTVSLVVIM 601

Query: 115 FELTGTLTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTT 174
           FELTG + Y++P+M A M SKWV D + K GIYD  I L G+P+LDSK E+   +TT   
Sbjct: 602 FELTGGVRYIVPLMAAAMASKWVGDALGKQGIYDAHIGLNGYPFLDSKDEFQ--HTTLAA 659

Query: 175 TLDLCQRDLEVIDV--NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIAST 229
            +   +R+ E + V   D  T+ +++N LK+   +     GFP++   +++ LVG++   
Sbjct: 660 DVMQPKRN-ETLHVLTQDSMTVEDVENLLKETEHN-----GFPVIVSRESQYLVGFVLRR 713

Query: 230 ELEHALSLA----HGSDNLTRCYFKDENVIDKSAN----FTAYVNQAPLTISKNASLEIV 281
           +L  AL+ A     G +  +   F   N I   A+        ++ AP+TI+    +E V
Sbjct: 714 DLNLALANAKRMLEGINRQSLVVFTSGNNIQTHAHPPLKLKKILDMAPITITDQTPMETV 773

Query: 282 LELFKKLGLRYVIVVDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
           +++F+KLGLR V+V   G+ +GVI KK +L +++Q+  +D N+ L
Sbjct: 774 VDMFRKLGLRQVLVTHNGRLLGVITKKDVLRHVKQLDDEDPNSVL 818



>gi|345495144|ref|XP_003427444.1| PREDICTED: H(+)/Cl(-) exchange transporter 3-like isoform 2
           [Nasonia vitripennis]
          Length = 790

 Score =  226 bits (575), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 139/345 (40%), Positives = 206/345 (59%), Gaps = 32/345 (9%)

Query: 1   DGLCD-----NSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRM 55
           D LCD      +FN  +   YLL LA + KF+  + TFG++VP G+FIP+L  GA  GR+
Sbjct: 457 DMLCDYQRNLQTFN--WAPIYLLILAFVFKFIMTIFTFGMKVPCGLFIPSLCFGAITGRI 514

Query: 56  LGIVMQYLTMTYPDFPIYSTVCNQNING-DCVIPGVYAMVGAAASLAGVTRSTVSLTVIM 114
            GI M+ L   YP   ++S  C+   NG DC+ PG+YA+VGAAA L GVTR TVSL VIM
Sbjct: 515 FGIGMEQLAYHYPHIWMFSDECS---NGEDCITPGLYAIVGAAAVLGGVTRMTVSLVVIM 571

Query: 115 FELTGTLTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTT 174
           FELTG + Y++P+M A M SKWV D + K GIYD  I L G+P+LDSK E+   +TT   
Sbjct: 572 FELTGGVRYIVPLMAAAMASKWVGDALGKQGIYDAHIGLNGYPFLDSKDEFQ--HTTLAA 629

Query: 175 TLDLCQRDLEVIDV--NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIAST 229
            +   +R+ E + V   D  T+ +++N LK+   +     GFP++   +++ LVG++   
Sbjct: 630 DVMQPKRN-ETLHVLTQDSMTVEDVENLLKETEHN-----GFPVIVSRESQYLVGFVLRR 683

Query: 230 ELEHALSLA----HGSDNLTRCYFKDENVIDKSAN----FTAYVNQAPLTISKNASLEIV 281
           +L  AL+ A     G +  +   F   N I   A+        ++ AP+TI+    +E V
Sbjct: 684 DLNLALANAKRMLEGINRQSLVVFTSGNNIQTHAHPPLKLKKILDMAPITITDQTPMETV 743

Query: 282 LELFKKLGLRYVIVVDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
           +++F+KLGLR V+V   G+ +GVI KK +L +++Q+  +D N+ L
Sbjct: 744 VDMFRKLGLRQVLVTHNGRLLGVITKKDVLRHVKQLDDEDPNSVL 788



>gi|452984946|gb|EME84703.1| hypothetical protein MYCFIDRAFT_135140 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 896

 Score =  226 bits (575), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 135/321 (42%), Positives = 192/321 (59%), Gaps = 26/321 (8%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC +        F LL  +LI  F+   ITFG+++PAGI +P++ VGA +GR++G++++
Sbjct: 534 GLCKDGAANTGVIFILLVSSLIG-FVLATITFGLQIPAGILLPSMTVGALYGRVVGLIVE 592

Query: 62  YLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTL 121
                +P F I    C  +I   CV PG YA+VGAA++LAG TR TVS+ VIMFELTG L
Sbjct: 593 VWQKDHPGF-IAFAACEPDI--PCVTPGTYAVVGAASALAGATRMTVSIVVIMFELTGAL 649

Query: 122 TYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEY---DGANTTFTTTLDL 178
           TYVLPIM A+M+SKWV D   K GIY+  I   G+P+LD+K +    D   +   T  D 
Sbjct: 650 TYVLPIMVAVMLSKWVGDAFGKRGIYESWIHFQGYPFLDNKDDTPVPDIPVSQIMTRFD- 708

Query: 179 CQRDLEVIDVNDLNTIGELKNKLKKLSTSGYSDAGFPIVDN---KILVGYIASTELEHAL 235
              DL  I   D +TI  L++ L+      +   GFP+V++    IL+GYI+ TEL++AL
Sbjct: 709 ---DLVCITAAD-HTIESLRDLLRD-----HRFRGFPVVNDTREAILLGYISRTELQYAL 759

Query: 236 SLAHGSDNL----TRCYFKDENVIDKSA--NFTAYVNQAPLTISKNASLEIVLELFKKLG 289
             A          T CYF  + + D +   +   +++Q P+T+  N SL++  E+F+KLG
Sbjct: 760 DSATAPGRALSVSTECYFSHQPLADPTVTLDLRPWMDQTPITMRSNTSLQLTNEMFQKLG 819

Query: 290 LRYVIVVDRGQYVGVINKKRL 310
           LRYVI VDRG   G++ KK L
Sbjct: 820 LRYVIFVDRGALAGLLTKKDL 840



>gi|67539874|ref|XP_663711.1| hypothetical protein AN6107.2 [Aspergillus nidulans FGSC A4]
 gi|40738892|gb|EAA58082.1| hypothetical protein AN6107.2 [Aspergillus nidulans FGSC A4]
 gi|259479703|tpe|CBF70170.1| TPA: CLC channel [Source:UniProtKB/TrEMBL;Acc:Q870M6] [Aspergillus
           nidulans FGSC A4]
          Length = 909

 Score =  226 bits (575), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 123/332 (37%), Positives = 199/332 (59%), Gaps = 24/332 (7%)

Query: 1   DGLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVM 60
           DGLC +   G+ E    L +A + K    ++TFGI+VPAGI++P+++VG   GR++G V 
Sbjct: 584 DGLCPHP-EGIGEVIRALTIAFVIKSFLTIVTFGIKVPAGIYVPSMVVGGLMGRIVGHVT 642

Query: 61  QYLTMTYPDFPIYSTVCNQNINGD-CVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTG 119
           QYL + YP+F ++ + C      + CV PGVYAMV A A++ GVTR +V+L VI+FELTG
Sbjct: 643 QYLALQYPNFFLFGSSCAAGTGMESCVTPGVYAMVAAGATMCGVTRLSVTLAVILFELTG 702

Query: 120 TLTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLC 179
           +L +VLP   A++ +KW AD I  H IYD L ++  +P+LD+K +      +     D+ 
Sbjct: 703 SLDHVLPFSLAVLCAKWTADAIEPHSIYDFLTEMNSYPFLDNKLQ----TVSDAVLGDIV 758

Query: 180 Q--RDLEVIDVND--LNTIGELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHAL 235
           +  R   +ID+ +  L    EL++KL+ L  +G  D+G PI+ + +L+G I + +LE+AL
Sbjct: 759 RPIRRSRLIDITETPLVPARELRSKLQHLLMAGELDSGLPILRDGVLIGLIPAPDLEYAL 818

Query: 236 SLAHGSDNLTRCYFK-----------DENVIDKSANFTAYVNQAPLTISKNASLEIVLEL 284
                 D  T C              DE+ +    +FT Y++ APL +  ++ +++V + 
Sbjct: 819 DNLEDEDR-TSCLMATDTSSVVSDTDDEDTLQ--VDFTKYIDPAPLALDIHSPIDLVYQC 875

Query: 285 FKKLGLRYVIVVDRGQYVGVINKKRLLIYLRQ 316
           F KLGLRY+ V+  GQY G+++KK  + ++++
Sbjct: 876 FVKLGLRYLCVLHDGQYAGLVHKKAFVKFMKE 907



>gi|29825714|gb|AAO91914.1| CLC channel [Emericella nidulans]
          Length = 909

 Score =  226 bits (575), Expect = 9e-57,   Method: Compositional matrix adjust.
 Identities = 123/332 (37%), Positives = 199/332 (59%), Gaps = 24/332 (7%)

Query: 1   DGLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVM 60
           DGLC +   G+ E    L +A + K    ++TFGI+VPAGI++P+++VG   GR++G V 
Sbjct: 584 DGLCPHP-EGIGEVIRALTIAFVIKSFLTIVTFGIKVPAGIYVPSMVVGGLMGRIVGHVT 642

Query: 61  QYLTMTYPDFPIYSTVCNQNINGD-CVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTG 119
           QYL + YP+F ++ + C      + CV PGVYAMV A A++ GVTR +V+L VI+FELTG
Sbjct: 643 QYLALQYPNFFLFGSSCAAGTGMESCVTPGVYAMVAAGATMCGVTRLSVTLAVILFELTG 702

Query: 120 TLTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLC 179
           +L +VLP   A++ +KW AD I  H IYD L ++  +P+LD+K +      +     D+ 
Sbjct: 703 SLDHVLPFSLAVLCAKWTADAIEPHSIYDFLTEMNSYPFLDNKLQ----TVSDAVLGDIV 758

Query: 180 Q--RDLEVIDVND--LNTIGELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHAL 235
           +  R   +ID+ +  L    EL++KL+ L  +G  D+G PI+ + +L+G I + +LE+AL
Sbjct: 759 RPIRRSRLIDITETPLVPARELRSKLQHLLMAGELDSGLPILRDGVLIGLIPAPDLEYAL 818

Query: 236 SLAHGSDNLTRCYFK-----------DENVIDKSANFTAYVNQAPLTISKNASLEIVLEL 284
                 D  T C              DE+ +    +FT Y++ APL +  ++ +++V + 
Sbjct: 819 DNLEDEDR-TSCLMATDTSSVVSDTDDEDTLQ--VDFTKYIDPAPLALDIHSPIDLVYQC 875

Query: 285 FKKLGLRYVIVVDRGQYVGVINKKRLLIYLRQ 316
           F KLGLRY+ V+  GQY G+++KK  + ++++
Sbjct: 876 FVKLGLRYLCVLHDGQYAGLVHKKAFVKFMKE 907



>gi|485926509|gb|EOD50757.1| putative voltage-gated chloride channel protein [Neofusicoccum
           parvum UCRNP2]
          Length = 910

 Score =  225 bits (573), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 129/332 (38%), Positives = 202/332 (60%), Gaps = 24/332 (7%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC  +   + E  + L +A + K L  +ITFGI+VPAGI++P+++VG   GRM+G ++Q
Sbjct: 579 GLCATN-ERIPEIIWYLFVAFVIKALLTIITFGIKVPAGIYVPSMVVGGLMGRMVGHIVQ 637

Query: 62  YLTMTYPDFPIYSTVCNQNINGD-CVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGT 120
           YL + Y    ++ T C+++ N + CV+PGVYAMV A A++ GVTR +V+L VI+FELTG+
Sbjct: 638 YLALNYSSTGLFGT-CHKDDNPEACVVPGVYAMVAAGATMCGVTRLSVTLAVILFELTGS 696

Query: 121 LTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTL-DLC 179
           L +VLP    +++SKWVAD I    IYDLL D+  +P+LD+K         FT+ L D+ 
Sbjct: 697 LDHVLPFSLGVLVSKWVADAIEPLSIYDLLTDMNAYPFLDNKIR-----PVFTSQLGDIT 751

Query: 180 QRDLE--VIDVND--LNTIGELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHAL 235
            R  E   ID+ +  L    +L+ +L+ L  +G  D G PIV + ILVG I + +LE AL
Sbjct: 752 PRVREERFIDITNSPLVPAQQLRYQLQHLHMAGELDGGLPIVRDGILVGLIPAPDLEFAL 811

Query: 236 SLAHGSDNLTRCYFKDE----------NVIDKSANFTAYVNQAPLTISKNASLEIVLELF 285
                 DN T C    E             + + +FT Y++ +P+++   + +++V E F
Sbjct: 812 DKLDNEDN-TLCLMSPEVGWNAREEPEEGEEDNTDFTPYIDPSPVSLEYRSPMDLVYECF 870

Query: 286 KKLGLRYVIVVDRGQYVGVINKKRLLIYLRQI 317
            KLGLRY+ V+  G+Y G+++KK  + Y++++
Sbjct: 871 VKLGLRYICVLRDGRYAGLVHKKAFVKYMKEL 902



>gi|336264823|ref|XP_003347187.1| hypothetical protein SMAC_08079 [Sordaria macrospora k-hell]
 gi|380087880|emb|CCC13958.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 881

 Score =  225 bits (573), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 130/338 (38%), Positives = 210/338 (62%), Gaps = 27/338 (7%)

Query: 2   GLCDNSFNGMFEA-FYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVM 60
           GLC +S   +    ++LL   LI  FLT +ITFGI+VPAGI++P+++VG   GR++G ++
Sbjct: 550 GLCPDSKADIPPILWHLLWAFLIKGFLT-IITFGIKVPAGIYVPSMVVGGLMGRLIGHMV 608

Query: 61  QYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGT 120
           Q+L + +PD  ++S+ CN+  +  C+ PGVY ++ A +++ GVTR +V+L VI+FELTG+
Sbjct: 609 QWLVLAFPDSAMFSS-CNKVSSVSCIQPGVYGLIAAGSTMCGVTRLSVTLAVILFELTGS 667

Query: 121 LTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTL-DLC 179
           L YVLP   AI+++KW AD I    IYDLL ++  +P+L++K +       FT+ L D+ 
Sbjct: 668 LDYVLPFSLAILVAKWTADAIEPLSIYDLLTEMNSYPFLNNKHK-----PIFTSELIDIV 722

Query: 180 Q--RDLEVIDVND--LNTIGELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHAL 235
              R   +ID+++  L     L++KL+ L  +G  D G PIV N+ILVG I + +LE+AL
Sbjct: 723 PRVRRERIIDISNSPLVPATSLRSKLESLHRAGELDGGLPIVRNEILVGLIPAPDLEYAL 782

Query: 236 -SLAHGSDNLTRCYFKDENVIDKS-----------ANFTAYVNQAPLTISKNASLEIVLE 283
            +L   S  L  C   +   ID S            +F+ Y++ AP+ +   + +++V E
Sbjct: 783 DNLPDESTAL--CLMANVPSIDDSDDEEAGGRRDPTDFSPYIDPAPVALDIRSPMDLVYE 840

Query: 284 LFKKLGLRYVIVVDRGQYVGVINKKRLLIYLRQITGKD 321
           LF KLGLRY+ ++  G+Y G+ +KK  + Y+R++  K+
Sbjct: 841 LFVKLGLRYICILRDGKYAGMTHKKTFVKYMRELEEKE 878



>gi|164428859|ref|XP_957245.2| hypothetical protein NCU00121 [Neurospora crassa OR74A]
 gi|157072311|gb|EAA28009.2| hypothetical protein NCU00121 [Neurospora crassa OR74A]
          Length = 915

 Score =  225 bits (573), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 126/337 (37%), Positives = 206/337 (61%), Gaps = 25/337 (7%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC +S   +    + L  A + K L  +ITFGI+VPAGI++P+++VG   GR++G ++Q
Sbjct: 584 GLCPDSKADIPPILWHLLWAFLIKGLLTIITFGIKVPAGIYVPSMVVGGLMGRLIGHMVQ 643

Query: 62  YLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTL 121
           +L + +PD  ++S+ CN+  +  C+ PGVY ++ A +++ GVTR +V+L VI+FELTG+L
Sbjct: 644 WLVLAFPDTAMFSS-CNKVSSVSCIQPGVYGLIAAGSTMCGVTRLSVTLAVILFELTGSL 702

Query: 122 TYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTL-DLCQ 180
            YVLP   AI+++KW AD I    IYDLL ++  +P+L++K +       FT+ L D+  
Sbjct: 703 DYVLPFSLAILVAKWTADAIEPLSIYDLLTEMNSYPFLNNKHK-----PVFTSELIDIVP 757

Query: 181 --RDLEVIDVND--LNTIGELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHAL- 235
             R   +ID+++  L     L++KL+ L  +G  D G PI+ N ILVG I + +LE+AL 
Sbjct: 758 RVRRERIIDISNSPLVPATSLRSKLESLHRAGELDGGLPIIRNDILVGLIPAPDLEYALD 817

Query: 236 SLAHGSDNLTRCYFKDENVIDKS-----------ANFTAYVNQAPLTISKNASLEIVLEL 284
           +L   S  L  C   +   ID S            +FT Y++ AP+ +   + +++V EL
Sbjct: 818 NLPDESTAL--CLMANVPSIDDSDDEEGGGRRDPTDFTPYIDPAPVALDIRSPMDLVYEL 875

Query: 285 FKKLGLRYVIVVDRGQYVGVINKKRLLIYLRQITGKD 321
           F KLGLRY+ ++  G+Y G+ +KK  + Y+R++  ++
Sbjct: 876 FVKLGLRYICILRDGKYAGMTHKKTFVKYMRELEEQE 912



>gi|367050938|ref|XP_003655848.1| hypothetical protein THITE_2119994 [Thielavia terrestris NRRL 8126]
 gi|347003112|gb|AEO69512.1| hypothetical protein THITE_2119994 [Thielavia terrestris NRRL 8126]
          Length = 894

 Score =  224 bits (572), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 128/337 (37%), Positives = 198/337 (58%), Gaps = 29/337 (8%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC      +    Y L  A + K L  +ITFGI+VPAGI++P+++VG   GR++G V+Q
Sbjct: 567 GLCPEEIGDIPPILYNLFTAFLIKGLLTIITFGIKVPAGIYVPSMVVGGLMGRLIGHVVQ 626

Query: 62  YLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTL 121
           ++ M  PD+ I+ T C +  N  C+ PGVY ++ A +++ GVTR +V+L VI+FELTG+L
Sbjct: 627 WVVMATPDWGIWGT-CAKMPNATCIQPGVYGLIAAGSTMCGVTRLSVTLAVILFELTGSL 685

Query: 122 TYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTL-DLCQ 180
            YVLP   AI+++KW AD I    IYDLL ++  +PYL++K +       FT+ L D+  
Sbjct: 686 DYVLPFSLAILVAKWTADAIEPLSIYDLLTEMNSYPYLNNKHK-----PIFTSDLADIVP 740

Query: 181 --RDLEVIDVNDLNTI--GELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHALS 236
             R   +ID+ +   +    L+ KL+ L  +G  D G PIV + ILVG I + +LE+AL 
Sbjct: 741 RVRKERIIDITNSPVVPAPSLRTKLELLHRAGELDGGLPIVRDGILVGLIPAPDLEYAL- 799

Query: 237 LAHGSDNL-----TRCYFKDENVIDKS-------ANFTAYVNQAPLTISKNASLEIVLEL 284
                DNL     + C       ID S        +FT Y++ AP+ +   + +++V E 
Sbjct: 800 -----DNLRDEASSLCLMAPVPSIDDSDDGAPDPTDFTPYIDPAPVALDIRSPMDLVYEC 854

Query: 285 FKKLGLRYVIVVDRGQYVGVINKKRLLIYLRQITGKD 321
           F KLGLRY+ V+  G+Y G+ +KK  + Y+R++  ++
Sbjct: 855 FVKLGLRYICVLRDGRYAGMTHKKTFVKYMREMEKRE 891



>gi|494827545|gb|EON64495.1| hypothetical protein W97_03727 [Coniosporium apollinis CBS 100218]
          Length = 909

 Score =  224 bits (572), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 129/317 (40%), Positives = 194/317 (61%), Gaps = 22/317 (6%)

Query: 17  LLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPDFPIYSTV 76
           +LG+A + K    VITFGI+VPAGI++P+++VG  FGR++G ++QYL + + D  ++ T 
Sbjct: 594 VLGIAFVIKAFLTVITFGIKVPAGIYVPSMVVGGLFGRLVGHIVQYLALHHYDTGLFGT- 652

Query: 77  CNQNINGD-CVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMTAIMISK 135
           CN N   + CV+PGVYAMV A A++ GVTR +V+L VI+FELTG+L +VLP    ++++K
Sbjct: 653 CNANDAPEMCVVPGVYAMVAAGATMCGVTRLSVTLAVILFELTGSLEHVLPFSLGVLVAK 712

Query: 136 WVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTL-DLCQRDLE--VID--VND 190
           W AD I    IYDLL D+  +P+LD+K         FTT L D+ +R  E  VID  V+ 
Sbjct: 713 WTADAIEPLSIYDLLTDMNSYPFLDNKV-----RPVFTTELGDITRRAREERVIDITVSP 767

Query: 191 LNTIGELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHALSLAHGSDN---LTRC 247
           L    EL+ K+  L  +G  D G PIV   ILVG I + +LE AL      D    L   
Sbjct: 768 LVPGRELRQKVDHLHMAGELDGGLPIVREGILVGLIPAPDLEFALDKLENEDKSLCLMST 827

Query: 248 YFKDENVIDKSA-------NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVVDRGQ 300
             +   + D  A       +FT Y++ AP+ +  ++ +++V E F KLGLRY+ V+  G+
Sbjct: 828 QVRWNGLEDPGAGEEPDPTDFTPYIDPAPVALDVHSPMDLVYEAFVKLGLRYLCVLKDGR 887

Query: 301 YVGVINKKRLLIYLRQI 317
           Y G+++KK  + Y++++
Sbjct: 888 YAGLVHKKAFVKYIKEL 904



>gi|336469657|gb|EGO57819.1| hypothetical protein NEUTE1DRAFT_81749 [Neurospora tetrasperma FGSC
           2508]
 gi|350290688|gb|EGZ71902.1| hypothetical protein NEUTE2DRAFT_110974 [Neurospora tetrasperma
           FGSC 2509]
          Length = 912

 Score =  224 bits (572), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 126/337 (37%), Positives = 206/337 (61%), Gaps = 25/337 (7%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC +S   +    + L  A + K L  +ITFGI+VPAGI++P+++VG   GR++G ++Q
Sbjct: 581 GLCPDSKADIPPILWHLLWAFLIKGLLTIITFGIKVPAGIYVPSMVVGGLMGRLIGHMVQ 640

Query: 62  YLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTL 121
           +L + +PD  ++S+ CN+  +  C+ PGVY ++ A +++ GVTR +V+L VI+FELTG+L
Sbjct: 641 WLVLAFPDTAMFSS-CNKVSSVSCIQPGVYGLIAAGSTMCGVTRLSVTLAVILFELTGSL 699

Query: 122 TYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTL-DLCQ 180
            YVLP   AI+++KW AD I    IYDLL ++  +P+L++K +       FT+ L D+  
Sbjct: 700 DYVLPFSLAILVAKWTADAIEPLSIYDLLTEMNSYPFLNNKHK-----PVFTSELIDIVP 754

Query: 181 --RDLEVIDVND--LNTIGELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHAL- 235
             R   +ID+++  L     L++KL+ L  +G  D G PI+ N ILVG I + +LE+AL 
Sbjct: 755 RVRRERIIDISNSPLVPATSLRSKLESLHRAGELDGGLPIIRNDILVGLIPAPDLEYALD 814

Query: 236 SLAHGSDNLTRCYFKDENVIDKS-----------ANFTAYVNQAPLTISKNASLEIVLEL 284
           +L   S  L  C   +   ID S            +FT Y++ AP+ +   + +++V EL
Sbjct: 815 NLPDESTAL--CLMANVPSIDDSDDEEGGGRRDPTDFTPYIDPAPVALDIRSPMDLVYEL 872

Query: 285 FKKLGLRYVIVVDRGQYVGVINKKRLLIYLRQITGKD 321
           F KLGLRY+ ++  G+Y G+ +KK  + Y+R++  ++
Sbjct: 873 FVKLGLRYICILRDGKYAGMTHKKTFVKYMRELEEQE 909



>gi|169783844|ref|XP_001826384.1| voltage-gated chloride channel (ClcA) [Aspergillus oryzae RIB40]
 gi|238493669|ref|XP_002378071.1| voltage-gated chloride channel (ClcA), putative [Aspergillus flavus
           NRRL3357]
 gi|83775128|dbj|BAE65251.1| unnamed protein product [Aspergillus oryzae RIB40]
 gi|220696565|gb|EED52907.1| voltage-gated chloride channel (ClcA), putative [Aspergillus flavus
           NRRL3357]
 gi|391869414|gb|EIT78612.1| Cl- channel CLC-3 [Aspergillus oryzae 3.042]
          Length = 910

 Score =  224 bits (571), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 124/332 (37%), Positives = 199/332 (59%), Gaps = 26/332 (7%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
            LC N  +G+ +    L +A + K L  ++TFGI+VPAGI++P+++VG   GR++G V Q
Sbjct: 586 SLCPNE-DGIVDIIRYLLVAFVIKSLLTIVTFGIKVPAGIYVPSMVVGGLLGRIVGHVAQ 644

Query: 62  YLTMTYPDFPIYSTVCNQNING--DCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTG 119
           Y  + YP FP++ + C   ++G   CV PGVYAM+ A A++ GVTR +V+L VI+FELTG
Sbjct: 645 YFVVKYPSFPLFGSSCPA-VSGMESCVTPGVYAMIAAGATMCGVTRLSVTLAVILFELTG 703

Query: 120 TLTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLC 179
           +L +VLP   AI+ +KW AD I    IYDLL D+  +P+LD+K +      +     DL 
Sbjct: 704 SLAHVLPFSLAILCAKWTADAIEPRSIYDLLTDMNSYPFLDNKIQV----VSDAELGDLV 759

Query: 180 Q--RDLEVIDVNDLNTIG--ELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHAL 235
           +  R   +ID++D   +   EL++KL+ L  +G  D+G PI+ + +L G I + +LE+AL
Sbjct: 760 RPVRKSRIIDISDSPFVPATELRSKLQTLLMAGELDSGLPILRHDVLSGLIPAPDLEYAL 819

Query: 236 SLAHGSDNLTRCYF-----------KDENVIDKSANFTAYVNQAPLTISKNASLEIVLEL 284
                 +N T C              DE  I    +F  Y++ AP+ +  ++ +++V + 
Sbjct: 820 DNLEDEEN-TLCLMTLDTMSVVSDSDDEEAI--RVDFNRYIDPAPIALDIHSPVDLVYQC 876

Query: 285 FKKLGLRYVIVVDRGQYVGVINKKRLLIYLRQ 316
           F KLGLRY+ V+  GQY G+++KK  + ++++
Sbjct: 877 FAKLGLRYLCVLQNGQYAGLVHKKAFVKFMKE 908



>gi|242776743|ref|XP_002478893.1| voltage-gated chloride channel (ClcA), putative [Talaromyces
           stipitatus ATCC 10500]
 gi|218722512|gb|EED21930.1| voltage-gated chloride channel (ClcA), putative [Talaromyces
           stipitatus ATCC 10500]
          Length = 875

 Score =  224 bits (571), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 123/329 (37%), Positives = 191/329 (58%), Gaps = 14/329 (4%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC N    + E    L +A + K L   ITFGI+VPAGI++P+++VG   GR++G + Q
Sbjct: 545 GLCPNEKEDILEVVKYLLVAFVVKSLLTTITFGIKVPAGIYVPSMVVGGLMGRIVGHLTQ 604

Query: 62  YLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTL 121
           Y  ++YPD  ++++         CV PGVYAMV A A++ GVTR +V+L VI FELTG+L
Sbjct: 605 YFVVSYPDLFLFASCPAVPGVESCVTPGVYAMVAAGATMCGVTRLSVTLAVICFELTGSL 664

Query: 122 TYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQR 181
            +VLP   +I+ +KW AD I    IYDLL D+  +P+LD+K  +   + T         R
Sbjct: 665 NHVLPFCISILCAKWTADAIEPRSIYDLLTDMNDYPFLDNKGSHPATDQTLGDLSRSTGR 724

Query: 182 DLEVIDVND--LNTIGELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHALS--- 236
               ID+ D  L    +L+ KL  L  +G  D+G PIV + +LVG IA+T+LE AL    
Sbjct: 725 H-RTIDITDSPLVRAKDLRGKLDYLLMAGELDSGLPIVRDTVLVGMIAATDLEFALDGLE 783

Query: 237 --------LAHGSDNLTRCYFKDENVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKL 288
                   ++    N    Y +D        +FT Y++ +P+ +  ++ L++V + F KL
Sbjct: 784 DEYAEFCIMSPDHQNWPEPYNEDGETNSIVHDFTIYIDPSPVALDVHSPLDLVYQCFVKL 843

Query: 289 GLRYVIVVDRGQYVGVINKKRLLIYLRQI 317
           GLRYV V+  G++ G+++KK+ + ++R++
Sbjct: 844 GLRYVCVLQDGKFQGLVHKKQFVKHMREL 872



>gi|512190468|gb|EPE06232.1| chloride channel protein 3 [Ophiostoma piceae UAMH 11346]
          Length = 916

 Score =  223 bits (569), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 125/321 (38%), Positives = 190/321 (59%), Gaps = 22/321 (6%)

Query: 15  FYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPDFPIYS 74
           F L G  LI   LT V+TFGI+VPAGI++P+++VG   GR++G V+Q+  ++ PD+P++ 
Sbjct: 601 FKLFGACLIKGVLT-VVTFGIKVPAGIYVPSMVVGGLMGRLVGHVVQWTVLSTPDWPVWG 659

Query: 75  TVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMTAIMIS 134
           T C       C+ PGVY ++ A A++ GVTR +V+L VI+FE+TG+L YVLP   AI+++
Sbjct: 660 T-CAAMGEASCIQPGVYGLIAAGATMCGVTRLSVTLAVILFEITGSLDYVLPFSLAILVA 718

Query: 135 KWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTL-DLCQ--RDLEVIDVNDL 191
           KW AD I    IYDLL ++  +P+L++K +       FT+ L D+    R   +ID++  
Sbjct: 719 KWTADAIEPLSIYDLLTEMNSYPFLNNKHK-----PVFTSDLADIVPRVRRSRIIDISSS 773

Query: 192 NTIGE--LKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHALSLAHGSDNLTRCYF 249
             +    L+ KL+ L  +G  D G PIV N ILVG I + +LE AL       N + C  
Sbjct: 774 PQVKATVLRQKLEGLHRAGELDGGLPIVRNDILVGLIPAPDLEFALDNLRDEAN-SMCLM 832

Query: 250 KDENVIDKS---------ANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVVDRGQ 300
                ID S          NFT Y++ AP+ +   + +++V E F KLGLRY+ V+  G+
Sbjct: 833 ASVPSIDDSDDELRDTDPTNFTPYIDPAPVALDIRSPMDLVYECFVKLGLRYICVLRDGR 892

Query: 301 YVGVINKKRLLIYLRQITGKD 321
           Y G+ +KK  + Y+R +  +D
Sbjct: 893 YAGMAHKKTFVKYVRDLEARD 913



>gi|113931518|ref|NP_001039210.1| chloride channel, voltage-sensitive 5 [Xenopus (Silurana)
           tropicalis]
 gi|89268902|emb|CAJ83644.1| chloride channel 5 (nephrolithiasis 2, X-linked, Dent disease)
           [Xenopus (Silurana) tropicalis]
          Length = 808

 Score =  223 bits (569), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 126/332 (37%), Positives = 200/332 (60%), Gaps = 23/332 (6%)

Query: 9   NGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYP 68
           NG++ A + L LALI K +  + TFG++VP+G+FIP++ VGA  GR+LG+ M+ L+  + 
Sbjct: 484 NGVYTAMWQLSLALIFKAVITIFTFGMKVPSGLFIPSMAVGAIMGRLLGVAMEQLSFYHH 543

Query: 69  DFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIM 128
           D+ I+   CNQ    DC+ PG+YAMVGAAA L G TR TVSL VIMFELTG L Y++P+M
Sbjct: 544 DWLIFRGWCNQG--ADCITPGLYAMVGAAACLGGATRMTVSLVVIMFELTGGLEYIVPLM 601

Query: 129 TAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV 188
            A M SKWVAD + +  IYD  I L G+P+L++K E+  ++ T    +   +R+  ++ V
Sbjct: 602 AAAMTSKWVADALGRESIYDAHIHLNGYPFLEAKEEF--SHKTLAMDVMRPRRNDPILTV 659

Query: 189 --NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAH 239
              D  T+ +++  + + + S     GFPIV   +++ LVG++   +L    E A     
Sbjct: 660 ITQDSMTVEDIEAIINETTYS-----GFPIVISRESQRLVGFVLRRDLIISVESARKKQE 714

Query: 240 GSDNLTRCYFKDE-----NVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVI 294
           G  + ++ YF +           S    A ++ +P TI+    +EIV+++F+KLGLR  +
Sbjct: 715 GIVSTSQIYFTEHTPPQPPTAPPSLKLRAIMDLSPFTITDQTPMEIVVDIFRKLGLRQCL 774

Query: 295 VVDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
           V   G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 775 VTHNGRLLGIITKKDVLKHIAQMANQDPDSIL 806



>gi|148223531|ref|NP_001080969.1| chloride channel, voltage-sensitive 5 [Xenopus laevis]
 gi|4580765|gb|AAD24497.1|AF063904_1 chloride channel ClC-5 [Xenopus laevis]
 gi|163916588|gb|AAI57729.1| Chloride channel 5 [Xenopus laevis]
 gi|213623742|gb|AAI70161.1| Chloride channel 5 [Xenopus laevis]
 gi|213625243|gb|AAI70157.1| Chloride channel 5 [Xenopus laevis]
          Length = 808

 Score =  223 bits (568), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 128/332 (38%), Positives = 200/332 (60%), Gaps = 23/332 (6%)

Query: 9   NGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYP 68
           NG++ A + L LALI K +  + TFGI+VP+G+FIP++ VGA  GR+LG+ M+ L+  + 
Sbjct: 484 NGVYTAMWQLSLALIFKAVITIFTFGIKVPSGLFIPSMAVGAIMGRLLGVAMEQLSFYHH 543

Query: 69  DFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIM 128
           D+ I+   CNQ    DC+ PG+YAMVGAAA L G TR TVSL VIMFELTG L Y++P+M
Sbjct: 544 DWLIFRGWCNQG--ADCITPGLYAMVGAAACLGGATRMTVSLVVIMFELTGGLEYIVPLM 601

Query: 129 TAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV 188
            A M SKWVAD + +  IYD  I L G+P+L++K E+  ++ T    +   +R+  ++  
Sbjct: 602 AAAMTSKWVADALGRGSIYDAHIHLNGYPFLEAKEEF--SHKTLAMDVMRPRRNDPILTA 659

Query: 189 --NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAH 239
              D  T+ +++     +S + YS  GFPIV   +++ L+G++   +L    E A     
Sbjct: 660 ITQDSMTVEDIE---AIISETTYS--GFPIVVSRESQRLMGFVLRRDLIISIESARKKQE 714

Query: 240 GSDNLTRCYFKDE-----NVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVI 294
           G  + +R YF +           S    A ++ +P TI+    +EIV+++F+KLGLR  +
Sbjct: 715 GIVSTSRIYFTEHTPTQPTTAPPSLKLRAIMDLSPFTITDQTPMEIVVDIFRKLGLRQCL 774

Query: 295 VVDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
           V   G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 775 VTHNGRLLGIITKKDVLKHIAQMANQDPDSIL 806



>gi|157123916|ref|XP_001653972.1| chloride channel protein 3 [Aedes aegypti]
 gi|108882874|gb|EAT47099.1| AAEL001752-PB [Aedes aegypti]
          Length = 877

 Score =  223 bits (568), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 130/330 (39%), Positives = 198/330 (60%), Gaps = 23/330 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G+++A +LL LAL+ K +  + TFG++VP G+FIP+L +GA  GR++GI M+ L   YP 
Sbjct: 556 GVYKAIWLLTLALMMKLIMTIFTFGMKVPCGLFIPSLALGAIMGRIVGIGMEQLAYHYPK 615

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
             I+S  C+     DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG + Y++P+M 
Sbjct: 616 IWIFSGECSTG--DDCITPGLYAMVGAAAVLGGVTRMTVSLVVIMFELTGGVRYIVPLMA 673

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRD--LEVID 187
           A M SKWV D + + GIYD  I L G+P+LDSK E+   +TT    +   +R+  L VI 
Sbjct: 674 AAMASKWVGDALGRQGIYDAHIALNGYPFLDSKDEFQ--HTTLAADVMQPKRNETLSVI- 730

Query: 188 VNDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTELEHALSLAH----G 240
             D  T+ +++  LK+   +GY     P+V   +N+ LVG++   +L  A++ A     G
Sbjct: 731 TQDSMTVDDIETLLKETEHNGY-----PVVVSKENQYLVGFVLRRDLNLAIANARRMIDG 785

Query: 241 SDNLTRCYFKD----ENVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVV 296
               +   F      +N+          ++ AP+T++    +E V+++F+KLGLR  +V 
Sbjct: 786 IAGQSLVIFTSAQPVQNLGPSPLKLKKILDMAPITVTDQTPMETVVDMFRKLGLRQTLVT 845

Query: 297 DRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
             G+ +GVI KK +L +++Q+  +D N  L
Sbjct: 846 HNGRLLGVITKKDVLRHVKQMDNEDPNTVL 875



>gi|470302333|ref|XP_004347591.1| chloride channel 3 [Capsaspora owczarzaki ATCC 30864]
 gi|320169983|gb|EFW46882.1| chloride channel 3 [Capsaspora owczarzaki ATCC 30864]
          Length = 933

 Score =  223 bits (568), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 132/336 (39%), Positives = 196/336 (58%), Gaps = 24/336 (7%)

Query: 3   LCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQY 62
           +C++   G  E   LL L+   + +  V TFG+++PAG+F+P++ +GAC GR+LGI MQ 
Sbjct: 608 VCNDDLIG--ETIGLLFLSAAFRMIITVFTFGLKLPAGLFVPSMAIGACTGRILGIAMQQ 665

Query: 63  LTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLT 122
           +    PD  ++   C       C+IPG+YAMVGAAA L GVTR TVSL VIMFELTG L+
Sbjct: 666 IVNANPD--LFELSCGAKPE-SCIIPGLYAMVGAAAVLGGVTRMTVSLVVIMFELTGGLS 722

Query: 123 YVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRD 182
           YVLP MTA+++SKWV D   + GIYD  I L G+P+LD+K E+   +TT    +   Q+ 
Sbjct: 723 YVLPFMTAVLVSKWVGDAFSREGIYDRHIRLNGYPFLDNKEEFR--HTTLACDVMYPQKG 780

Query: 183 LEVIDVNDL--NTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTELEHALSL 237
              + V  +  NT+G+L+  L++         GFP+V   +   + GY+A +EL+ AL  
Sbjct: 781 DSPLCVLPVFGNTVGQLERLLEETVYQ-----GFPVVFTTETMHVAGYVARSELKIALEK 835

Query: 238 A---HGSDNLTRCYFKDENVIDKSA----NFTAYVNQAPLTISKNASLEIVLELFKKLGL 290
           A   H     T C F        +     +    ++ +P+ I+++ + E+ LELF+KLGL
Sbjct: 836 ARKHHDVTEFTTCSFSHRTAASGNTSEMISLRHCLDASPIQIAEHTTTEMTLELFRKLGL 895

Query: 291 RYVIVVDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
           RY +V   GQ VG+I KK LL ++  +  +D  + L
Sbjct: 896 RYALVCSYGQLVGIITKKDLLKHMAILQHRDPGSIL 931



>gi|212532855|ref|XP_002146584.1| voltage-gated chloride channel (ClcA), putative [Talaromyces
           marneffei ATCC 18224]
 gi|210071948|gb|EEA26037.1| voltage-gated chloride channel (ClcA), putative [Talaromyces
           marneffei ATCC 18224]
          Length = 872

 Score =  223 bits (567), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 122/328 (37%), Positives = 190/328 (57%), Gaps = 12/328 (3%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC N  + +      L +A + K L   ITFGI+VPAGI++P+++VG   GR++G + Q
Sbjct: 542 GLCPNEKDDILPVVKYLLVAFVVKSLLTTITFGIKVPAGIYVPSMVVGGLMGRIVGHLTQ 601

Query: 62  YLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTL 121
           Y   TYPDF ++++         CV PGVYAMV A A++ GVTR +V+L VI FELTG+L
Sbjct: 602 YFVATYPDFFLFASCPAVPGVESCVTPGVYAMVAAGATMCGVTRLSVTLAVICFELTGSL 661

Query: 122 TYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQR 181
            +VLP   AI+ +KW AD I    IYDLL D+  +P+LD+K  +   + T         R
Sbjct: 662 NHVLPFCIAILCAKWTADAIEPRSIYDLLTDMNNYPFLDNKGSHPATDQTLGDLSRSTGR 721

Query: 182 DLEV-IDVNDLNTIGELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHALS---- 236
              + I  + L    +L+ KL  L  +G  D+G PIV + +LVG IA T+LE AL     
Sbjct: 722 HRTINISNSPLVRAKDLRGKLDYLLMAGELDSGLPIVRDTVLVGMIAVTDLEFALDGLDD 781

Query: 237 -------LAHGSDNLTRCYFKDENVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLG 289
                  ++    N     ++D +      +FT Y++ +P+ +  ++ L++V + F KLG
Sbjct: 782 EYAEFCIMSPDHRNWPEPNYEDGDTNGAVHDFTIYIDPSPVALDVHSPLDLVYQCFVKLG 841

Query: 290 LRYVIVVDRGQYVGVINKKRLLIYLRQI 317
           LRYV V+  G++ G+++KK+ + ++R++
Sbjct: 842 LRYVCVLQDGKFQGLVHKKQFVKHMREL 869



>gi|453082479|gb|EMF10526.1| chloride channel protein 3 [Mycosphaerella populorum SO2202]
          Length = 895

 Score =  223 bits (567), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 136/324 (41%), Positives = 195/324 (60%), Gaps = 29/324 (8%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC +        F LL  ALI  FL   +TFG+++PAGI +P++ VGA +GR++G++++
Sbjct: 524 GLCKSGVANTGNIFILLTSALIG-FLLATMTFGLQIPAGILLPSMGVGALYGRVIGLIVE 582

Query: 62  YLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTL 121
                +P+F  +++ C  +I   CV PG YA+VGAA++LAG TR TVS+ VIMFELTG L
Sbjct: 583 VWQGEHPNFIAFAS-CEPDI--PCVTPGTYAVVGAASALAGATRMTVSIVVIMFELTGAL 639

Query: 122 TYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEY---DGANTTFTTTLDL 178
           TYVLPIM A+M+SKWVAD   K GIY+  I   G+P+LD+K +    D       T  D 
Sbjct: 640 TYVLPIMIAVMLSKWVADAFGKKGIYESWIHFQGYPFLDNKDDTPVPDVPVAQIMTRFD- 698

Query: 179 CQRDLEVIDVNDLNTIGELKNKLKKLSTSGYSDAGFPIV-----DNKILVGYIASTELEH 233
              DL  I     +TI  L+  L++     +   GFP+V     D+ IL+GYI+  EL  
Sbjct: 699 ---DLVCIPATG-HTIETLQELLQE-----HRFRGFPVVSDAREDDAILLGYISRAELHF 749

Query: 234 ALSLA--HGSDNL---TRCYFKDENVIDKSA--NFTAYVNQAPLTISKNASLEIVLELFK 286
           AL  A    S NL   T C+F  + + D +   +   +++Q P+T+  N+SL++  E+F+
Sbjct: 750 ALESATSQTSRNLPDSTECFFTHQPLADPTITLDLRPWMDQTPITLRSNSSLQLTNEMFQ 809

Query: 287 KLGLRYVIVVDRGQYVGVINKKRL 310
           KLGLRY+I VDRG   G++ KK L
Sbjct: 810 KLGLRYIIFVDRGSLKGLLTKKDL 833



>gi|122936366|gb|AAI30106.1| Clcn5-A protein [Xenopus laevis]
          Length = 764

 Score =  223 bits (567), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 128/332 (38%), Positives = 200/332 (60%), Gaps = 23/332 (6%)

Query: 9   NGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYP 68
           NG++ A + L LALI K +  + TFGI+VP+G+FIP++ VGA  GR+LG+ M+ L+  + 
Sbjct: 440 NGVYTAMWQLSLALIFKAVITIFTFGIKVPSGLFIPSMAVGAIMGRLLGVAMEQLSFYHH 499

Query: 69  DFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIM 128
           D+ I+   CNQ    DC+ PG+YAMVGAAA L G TR TVSL VIMFELTG L Y++P+M
Sbjct: 500 DWLIFRGWCNQG--ADCITPGLYAMVGAAACLGGATRMTVSLVVIMFELTGGLEYIVPLM 557

Query: 129 TAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV 188
            A M SKWVAD + +  IYD  I L G+P+L++K E+  ++ T    +   +R+  ++  
Sbjct: 558 AAAMTSKWVADALGRGSIYDAHIHLNGYPFLEAKEEF--SHKTLAMDVMRPRRNDPILTA 615

Query: 189 --NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAH 239
              D  T+ +++     +S + YS  GFPIV   +++ L+G++   +L    E A     
Sbjct: 616 ITQDSMTVEDIE---AIISETTYS--GFPIVVSRESQRLMGFVLRRDLIISIESARKKQE 670

Query: 240 GSDNLTRCYFKDE-----NVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVI 294
           G  + +R YF +           S    A ++ +P TI+    +EIV+++F+KLGLR  +
Sbjct: 671 GIVSTSRIYFTEHTPTQPTTAPPSLKLRAIMDLSPFTITDQTPMEIVVDIFRKLGLRQCL 730

Query: 295 VVDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
           V   G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 731 VTHNGRLLGIITKKDVLKHIAQMANQDPDSIL 762



>gi|115443394|ref|XP_001218504.1| hypothetical protein ATEG_09882 [Aspergillus terreus NIH2624]
 gi|114188373|gb|EAU30073.1| hypothetical protein ATEG_09882 [Aspergillus terreus NIH2624]
          Length = 911

 Score =  223 bits (567), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 125/328 (38%), Positives = 197/328 (60%), Gaps = 17/328 (5%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC +  +G+ E    L +A + K L  V+TFGI+VPAGI++P+++VG   GR++G   Q
Sbjct: 586 GLCPDE-DGIGEIIRYLLIAFVIKSLLTVVTFGIKVPAGIYVPSMVVGGLLGRIIGHAAQ 644

Query: 62  YLTMTYPDFPIYSTVCNQNING--DCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTG 119
           YL + YP FP++ + C   ++G   CV PGVYAMV A A++ GVTR +V+L VI+FELTG
Sbjct: 645 YLVVKYPTFPLFGSSCPA-VSGMESCVTPGVYAMVAAGATMCGVTRLSVTLAVILFELTG 703

Query: 120 TLTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLC 179
           +L +VLP   AI+ +KW AD I    IYDLL D+  +P+LD+  +   A+      +   
Sbjct: 704 SLDHVLPFSLAILCAKWTADAIEPRSIYDLLTDMNSYPFLDNNIQI--ASDAELGDIVRP 761

Query: 180 QRDLEVIDVNDLNTI--GELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHALSL 237
            R   +ID+++   +   EL++KL+ L  +G  D+G PI+ + IL G I + +LE+AL  
Sbjct: 762 VRKSRIIDISESPFVPASELRSKLQNLLMAGELDSGLPILRHNILTGLIPAPDLEYALDN 821

Query: 238 AHGSDN-LTRCYFKDENVIDKSA--------NFTAYVNQAPLTISKNASLEIVLELFKKL 288
               DN L         VI  S         +F  Y++ AP+ +  ++ +++V + F KL
Sbjct: 822 LEDEDNSLCLMALDTSMVISDSEDLPGPDRVDFGRYIDPAPIALDIHSPIDLVYQCFTKL 881

Query: 289 GLRYVIVVDRGQYVGVINKKRLLIYLRQ 316
           GLRY+ V+  G+Y G+++KK  + +++Q
Sbjct: 882 GLRYLCVLQNGEYAGLVHKKAFVKFVKQ 909



>gi|477526550|gb|ENH78417.1| chloride channel protein 3 [Colletotrichum orbiculare MAFF 240422]
          Length = 874

 Score =  223 bits (567), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 128/335 (38%), Positives = 195/335 (58%), Gaps = 24/335 (7%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC      +      L  A + K    +ITFGI+VPAGI++P+++VG   GR++G V+Q
Sbjct: 547 GLCPTVIEDIPPVLLSLFWAFLIKGFLTIITFGIKVPAGIYVPSMVVGGLMGRLVGHVVQ 606

Query: 62  YLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTL 121
           Y+ ++YP   I+ T C     G C+ PGVY ++ A +++ GVTR +V+L VI+FELTG+L
Sbjct: 607 YIVLSYPTSGIFGT-CAAKATGSCIQPGVYGLIAAGSTMCGVTRLSVTLAVILFELTGSL 665

Query: 122 TYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTL-DLCQ 180
            YVLP   AI+++KW AD I  + IYDLL ++  +P+LD+K +       FT+ L DL  
Sbjct: 666 DYVLPFSLAILVAKWTADAIEPNSIYDLLTNMNSYPFLDNKHK-----PIFTSDLADLVP 720

Query: 181 --RDLEVIDVNDLNTIG--ELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHALS 236
             R   VIDV+    +    L+NKL+ L  +G  D G PIV + ILVG I + +LE AL 
Sbjct: 721 RVRRERVIDVSASPVVSAVSLRNKLQALHRAGEIDGGLPIVRDGILVGLIPAPDLEFALD 780

Query: 237 LAHGSDNLTR--CYFKDENVI--------DKSANFTAYVNQAPLTISKNASLEIVLELFK 286
              G D+ T   C       I            +FT +++ AP+ +   + +++V E + 
Sbjct: 781 ---GLDDETSSMCLMAHIPSIEDSDEEDERDKTDFTPFIDPAPIALDIKSPMDLVYECYV 837

Query: 287 KLGLRYVIVVDRGQYVGVINKKRLLIYLRQITGKD 321
           KLGLRYV V+  G+Y G+++KK  + Y+R++  K+
Sbjct: 838 KLGLRYVCVLKNGRYAGMVHKKSFVKYMRELEEKE 872



>gi|440636972|gb|ELR06891.1| hypothetical protein GMDG_02261 [Geomyces destructans 20631-21]
          Length = 880

 Score =  222 bits (566), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 121/328 (36%), Positives = 200/328 (60%), Gaps = 18/328 (5%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC  S   +      L +A + K    +ITFGI+VPAGI++P+++VG   GR+ G ++Q
Sbjct: 554 GLCPESMGDIDSILKQLSIAFVIKSFLTIITFGIKVPAGIYVPSMVVGGLLGRIAGHLVQ 613

Query: 62  YLTMTYPDFPIYSTVCNQNING-DCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGT 120
            L + +P   I+   C  + NG  C+ PGVYA++GA A++ GVTR +V+L VI+FELTG+
Sbjct: 614 RLVLQFPHAAIFEQ-CASHPNGTSCITPGVYALIGAGATMCGVTRLSVTLAVILFELTGS 672

Query: 121 LTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTL-DLC 179
           L YVLP   +I+++KW AD + +  IYDLL ++  +P+L++KT+       FT+ L D+ 
Sbjct: 673 LDYVLPFSLSILVAKWTADAVERLSIYDLLTNMNSYPFLNNKTK-----PVFTSDLADIT 727

Query: 180 Q--RDLEVIDVND--LNTIGELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHAL 235
              R   VID++   L +   L+ K++ L  +G  D G PI+   +LVG I +  LE AL
Sbjct: 728 PRVRRERVIDISSSPLMSAKSLREKIRILHEAGELDGGLPIIRQDVLVGLIPAPGLEFAL 787

Query: 236 -SLAHGSDNL-----TRCYFKDENVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLG 289
            SL +  ++L      + +  DE+      +FT+Y++ AP+ +   + +++V E F KLG
Sbjct: 788 DSLPNEENDLCLMAAVKSFDDDEDETADPTDFTSYIDPAPVALDIRSEMDLVYECFVKLG 847

Query: 290 LRYVIVVDRGQYVGVINKKRLLIYLRQI 317
           LRY+ ++  G+Y G++++K  + Y+R++
Sbjct: 848 LRYICILRDGRYAGMLHRKVFVKYVREL 875



>gi|160420279|ref|NP_001081509.1| chloride channel, voltage-sensitive 4 [Xenopus laevis]
 gi|2155011|emb|CAA71071.1| chloride channel ClC-5 [Xenopus laevis]
          Length = 808

 Score =  222 bits (565), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 127/332 (38%), Positives = 201/332 (60%), Gaps = 23/332 (6%)

Query: 9   NGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYP 68
           NG++ A + L LALI K +  + TFGI+VP+G+FIP++ VGA  GR+LG+ M+ L+  + 
Sbjct: 484 NGVYTAMWQLSLALIFKAVITIFTFGIKVPSGLFIPSMAVGAIMGRLLGVAMEQLSFYHH 543

Query: 69  DFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIM 128
           D+ I+   CNQ    DC+ PG+YAMVGAAA L G TR TVSL VIMFE+TG L Y++P+M
Sbjct: 544 DWLIFRGWCNQG--ADCITPGLYAMVGAAACLGGATRMTVSLVVIMFEITGGLEYIVPLM 601

Query: 129 TAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV 188
           +A M SKWVAD + +  IYD  I L G+P+L++K E+  ++ T    +   +R+  ++  
Sbjct: 602 SAAMTSKWVADALGRGSIYDAHIHLNGYPFLEAKGEF--SHKTLAMDVMRPRRNDPILTA 659

Query: 189 --NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAH 239
              D  T+ +++     +S + YS  GFPIV   +++ L+G++   +L    E A     
Sbjct: 660 ITQDSMTVEDIE---AIISETTYS--GFPIVVSRESQRLMGFVLRRDLIISIESARKKQE 714

Query: 240 GSDNLTRCYFKDE-----NVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVI 294
           G  + +R YF +           S    A ++ +P TI+    +EIV+++F+KLGLR  +
Sbjct: 715 GIVSTSRIYFTEHTPTQPTTAPPSLKLRAIMDLSPFTITDQTPMEIVVDIFRKLGLRQCL 774

Query: 295 VVDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
           V   G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 775 VTHNGRLLGIITKKDVLKHIAQMANQDPDSIL 806



>gi|396480274|ref|XP_003840957.1| hypothetical protein LEMA_P106090.1 [Leptosphaeria maculans JN3]
 gi|312217530|emb|CBX97478.1| hypothetical protein LEMA_P106090.1 [Leptosphaeria maculans JN3]
          Length = 1524

 Score =  222 bits (565), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 125/304 (41%), Positives = 185/304 (60%), Gaps = 21/304 (6%)

Query: 32   TFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPDFPIYSTVCNQNINGDCVIPGVY 91
            TFG+R+PAGI +P++ +G  FGR +G+ +Q     +P+  ++S+ C  +I   CV PG Y
Sbjct: 1138 TFGLRIPAGIILPSMAIGGLFGRAVGLSVQVCQQAWPNLFVFSS-CEPDIA--CVTPGTY 1194

Query: 92   AMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMTAIMISKWVADGIIKHGIYDLLI 151
            A+VGAA++LAG TR TVS+ VIMFELTG LTYVLPIM A+MISKW+ D I   GIY+  I
Sbjct: 1195 AIVGAASALAGTTRMTVSIVVIMFELTGALTYVLPIMIAVMISKWIGDAISPRGIYESWI 1254

Query: 152  DLGGHPYLDSKTEYDGANTTFTTTLDLCQR--DLEVIDVNDLNTIGELKNKLKKLSTSGY 209
               G+PYLD++ + DG++    +   +  R  DL  I     +TI  L+N L     S +
Sbjct: 1255 HFNGYPYLDNRDD-DGSSIPDVSAAHVMTRLEDLTTITATG-HTIASLRNML-----SQH 1307

Query: 210  SDAGFPIVDNK---ILVGYIASTELEHALSLA-HGSDNL---TRCYFKDENVIDK--SAN 260
               GFP++DN    +L+GYI+ TEL +AL  A     NL   T  YF  + + D   S +
Sbjct: 1308 RFRGFPVIDNSRDALLLGYISRTELSYALHAALSPPRNLSTDTEAYFAHQPLSDPTTSLD 1367

Query: 261  FTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVVDRGQYVGVINKKRLLIYLRQITGK 320
               +++Q P+T++  AS ++ + +F+KLGLRYV+  +RG   G++ KK +   L  + G+
Sbjct: 1368 LRPWMDQTPITLNAKASFQLTVSMFQKLGLRYVVFTERGMLRGLLTKKDVWYVLNGMEGE 1427

Query: 321  DMNN 324
            D   
Sbjct: 1428 DREE 1431



>gi|430811933|emb|CCJ30639.1| unnamed protein product [Pneumocystis jirovecii]
          Length = 852

 Score =  222 bits (565), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 133/320 (41%), Positives = 191/320 (59%), Gaps = 41/320 (12%)

Query: 30  VITFGIRVPAGI---FIPALLVGACFGRMLGIVMQYLTM-TYPDFPIYSTVCNQNINGDC 85
           ++TFG ++PAG+   F    LV         I    L   TYP+  I++  C  +   +C
Sbjct: 537 IVTFGAKIPAGLEYSFQQWQLVLYLEDFFKSIKYYELKFSTYPNAYIFAG-CPPSDPNEC 595

Query: 86  VIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMTAIMISKWVADGIIKHG 145
           ++PGVY+MVGAAA+LAGVTR TVSL VIMFELTG+L+YV+P M +I++SKWVAD +   G
Sbjct: 596 IVPGVYSMVGAAATLAGVTRMTVSLAVIMFELTGSLSYVMPFMLSILVSKWVADALEPQG 655

Query: 146 IYDLLIDLGGHPYLDSKTEYDGAN----------TTFTTTLDLCQRDLEVIDVNDLNTIG 195
           IYDLLIDL  +PYLD+K++Y  ++          T + TT+DL  R   +          
Sbjct: 656 IYDLLIDLNEYPYLDTKSKYTFSSCLSELLPPPITVYHTTIDLSFRSTVLYT-------- 707

Query: 196 ELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHAL----SLAHGSDNLT-RCYFK 250
           +L++ L+ +    Y D GFPIV NK LVGYIA+ ELEHAL    S+    D  +  C   
Sbjct: 708 QLRDMLEYIKKEEYIDGGFPIVFNKTLVGYIAAHELEHALDTIKSVFSKEDQKSIECKLM 767

Query: 251 DENVIDKSANF-------------TAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVVD 297
              + D  ++F              + V+ AP+++SKNA +E+V ELF KLGLRY+ ++D
Sbjct: 768 PFGITDSISSFDPESYSLLDPTDLRSCVDNAPISLSKNAPMELVYELFSKLGLRYLCILD 827

Query: 298 RGQYVGVINKKRLLIYLRQI 317
              ++GV++KKR + YL++I
Sbjct: 828 GADFIGVVHKKRFVRYLKEI 847



>gi|449269802|gb|EMC80548.1| H(+)/Cl(-) exchange transporter 5, partial [Columba livia]
          Length = 810

 Score =  222 bits (565), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 125/331 (37%), Positives = 202/331 (61%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L LALI K    + TFG++VP+G+FIP++ VGA  GR+LG+ ++ L   + D
Sbjct: 487 GVYTAMWQLALALIMKVFITIFTFGMKVPSGLFIPSMAVGAIAGRLLGVAVEQLAYYHHD 546

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           +PI+S  C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 547 WPIFSGWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 604

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD I + GIYD  I L G+P+L++K E+  ++ T    +   +R+   + V 
Sbjct: 605 AAMTSKWVADAIGREGIYDAHIRLNGYPFLEAKEEF--SHKTLAMDVMRPRRNDPPLTVI 662

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ ++++ + + + SGY     P+V   +++ LVG++   +L    E+A     G
Sbjct: 663 TQDSMTVEDVESIINETTYSGY-----PVVVSRESQRLVGFVLRRDLIISIENARKKQDG 717

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF D +     +        + ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 718 IVSTSIIYFTDHSPPLPPSSPSMLKLRSILDLSPFTVTDQTPMEIVVDIFRKLGLRQCLV 777

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 778 THNGKLLGIITKKDVLKHIAQLANQDPDSIL 808



>gi|170037222|ref|XP_001846458.1| chloride channel protein 3 [Culex quinquefasciatus]
 gi|167880292|gb|EDS43675.1| chloride channel protein 3 [Culex quinquefasciatus]
          Length = 1047

 Score =  222 bits (565), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 130/330 (39%), Positives = 197/330 (59%), Gaps = 23/330 (6%)

Query: 10   GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
            G+++A +LL LAL  K +  + TFG++VP G+FIP+L +GA  GR++GI M+ L   YP 
Sbjct: 726  GVYKAIWLLTLALAMKLVMTIFTFGMKVPCGLFIPSLALGAIMGRIVGIGMEQLAYHYPK 785

Query: 70   FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
              I+S  C+     DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG + Y++P+M 
Sbjct: 786  IWIFSGECSTG--DDCITPGLYAMVGAAAVLGGVTRMTVSLVVIMFELTGGVRYIVPLMA 843

Query: 130  AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRD--LEVID 187
            A M SKWV D + + GIYD  I L G+P+LDSK E+   +TT    +   +R+  L VI 
Sbjct: 844  AAMASKWVGDALGRQGIYDAHIALNGYPFLDSKDEFQ--HTTLAADVMQPKRNETLSVI- 900

Query: 188  VNDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTELEHALSLAH----G 240
              D  T+ +++  LK+   +GY     P+V   +N+ LVG++   +L  A++ A     G
Sbjct: 901  TQDSMTVDDIETLLKETEHNGY-----PVVVSKENQYLVGFVLRRDLNLAIANARRLIDG 955

Query: 241  SDNLTRCYFKD----ENVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVV 296
                +   F      +N+          ++ AP+T++    +E V+++F+KLGLR  +V 
Sbjct: 956  IAGQSPVIFTSAQPVQNLGPSPLKLKKILDMAPITVTDQTPMETVVDMFRKLGLRQTLVT 1015

Query: 297  DRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +GVI KK +L +++Q+  +D N  L
Sbjct: 1016 HNGRLLGVITKKDVLRHVKQMDNEDPNTVL 1045



>gi|158294756|ref|XP_001688728.1| AGAP005777-PA [Anopheles gambiae str. PEST]
 gi|158294758|ref|XP_315792.4| AGAP005777-PB [Anopheles gambiae str. PEST]
 gi|157015713|gb|EDO63734.1| AGAP005777-PA [Anopheles gambiae str. PEST]
 gi|157015714|gb|EAA11899.4| AGAP005777-PB [Anopheles gambiae str. PEST]
          Length = 917

 Score =  221 bits (564), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 131/330 (39%), Positives = 197/330 (59%), Gaps = 23/330 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G+++A +LL LAL  K +  + TFG++VP G+FIP+L +GA  GR++GI M+ L   YP 
Sbjct: 596 GVYKAVWLLILALAMKLIMTIFTFGMKVPCGLFIPSLALGAITGRIVGIAMEQLAYNYPK 655

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
             I+S  C+     DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG + Y++P+M 
Sbjct: 656 IWIFSGECSTG--DDCITPGLYAMVGAAAVLGGVTRMTVSLVVIMFELTGGVRYIVPLMA 713

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRD--LEVID 187
           A M SKWV D + + GIYD  I L G+P+LDSK E+   +TT    +   +R+  L VI 
Sbjct: 714 AAMASKWVGDALGRQGIYDAHIALNGYPFLDSKDEFQ--HTTLAADVMQPKRNETLAVI- 770

Query: 188 VNDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTELEHALSLAH----G 240
             D  T+ +++  LK+   +GY     P+V   +N+ LVG++   +L  AL+ A     G
Sbjct: 771 TQDSMTVDDIETLLKETEHNGY-----PVVVSKENQYLVGFVLRRDLNLALANARRIIDG 825

Query: 241 SDNLTRCYFKD----ENVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVV 296
               +   F      +N+          ++ AP+T++    +E V+++F+KLGLR  +V 
Sbjct: 826 ITGQSLVIFTSAQPVQNLGPSPLKLKKILDMAPITVTDQTPMETVVDMFRKLGLRQTLVT 885

Query: 297 DRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
             G+ +GVI KK +L +++Q+  +D N  L
Sbjct: 886 HNGRLLGVITKKDVLRHVKQMDNEDPNTVL 915



>gi|472582945|gb|EMS20607.1| voltage-gated chloride channel [Rhodosporidium toruloides NP11]
          Length = 1010

 Score =  221 bits (563), Expect = 2e-55,   Method: Composition-based stats.
 Identities = 144/359 (40%), Positives = 202/359 (56%), Gaps = 40/359 (11%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC  S + +      LG AL  K     ITFG+++PAGIFIP L VGA  GR+ G+ ++
Sbjct: 627 GLCVTSPSQVGPLVLSLGAALFLKAALTTITFGLKLPAGIFIPTLAVGALAGRIAGLAVE 686

Query: 62  YLTMTYPDFPIYSTVCNQNINGD------CVIPGVYAMVGAAASLAGVTRSTVSLTVIMF 115
            L   YP   ++        +G       CV+PGV+AM+GAAA+LAGVTR+TVSL VI+F
Sbjct: 687 VLHAKYPRSFVFEACRMDGESGPLPFGQACVLPGVWAMIGAAAALAGVTRTTVSLAVIVF 746

Query: 116 ELTGTLTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTT 175
           ELTGTLTY +P M A++++K VAD I    IYDL+I++   PYLD+K EY       +T 
Sbjct: 747 ELTGTLTYSVPTMLAVLLAKTVADSIEPRSIYDLVIEVADLPYLDAKAEY----VHDSTP 802

Query: 176 LDLCQRDLEVIDVNDLNTIGELKNKLKKLSTSGYSDAGFPIV-----DNKILVGYIASTE 230
            D+       I ++  NT+  L ++L  L  SG S +GFP++      +  + GYI S E
Sbjct: 803 HDILDASAPTISLDTDNTVSSLYSQLAALYASGTS-SGFPLIATDDAGSPRMFGYIGSKE 861

Query: 231 LEHALSLA--HGSDNLTRCYFKDENVIDK--SANFTA-------------------YVNQ 267
           LEH LSLA   G  + T C F+      +  +A  +A                     +Q
Sbjct: 862 LEHGLSLARPQGLPHSTTCTFRVAQAARRGLAAEMSAAATPGLGGGAESETFDLSWLTDQ 921

Query: 268 APLTISKNASLEIVLELFKKLGLRYVIVVD-RGQYVGVINKKRLLIYLRQITGKDMNNT 325
           APLT+S  + +E++ E+F KLG RYV+V+D RG Y+G I K R L+YLR +  ++   T
Sbjct: 922 APLTVSARSPMELIHEMFVKLGSRYVVVIDERGCYLGPIEKNRYLLYLRWLEKRNHEKT 980



>gi|121698423|ref|XP_001267816.1| voltage-gated chloride channel (ClcA), putative [Aspergillus
           clavatus NRRL 1]
 gi|119395958|gb|EAW06390.1| voltage-gated chloride channel (ClcA), putative [Aspergillus
           clavatus NRRL 1]
          Length = 912

 Score =  221 bits (563), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 119/327 (36%), Positives = 205/327 (62%), Gaps = 16/327 (4%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC    +G+ E    L +A + K L  V+TFG++VPAGI++P+++VG   GR++G V+Q
Sbjct: 588 GLCPTE-DGIGEIIRYLLVAFVIKSLLTVVTFGLKVPAGIYVPSMVVGGLMGRIVGHVVQ 646

Query: 62  YLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTL 121
           YL + +P+F ++ST    +    CV+PGVYAMV A A++ GVTR +V+L VI+FELTG+L
Sbjct: 647 YLVLKFPNFFLFSTCPASSGTESCVVPGVYAMVAAGATMCGVTRLSVTLAVILFELTGSL 706

Query: 122 TYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQR 181
            +VLP   A++ +KW AD +    IYDLL D+  +P+LD+K +   ++      +   +R
Sbjct: 707 NHVLPFSLAVLCAKWTADALEPRSIYDLLTDMNSYPFLDNKIQLL-SDAELGDIVRPIRR 765

Query: 182 DLEVIDVNDLNTIG--ELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHALSLAH 239
              +ID+++ + +   EL++KL+ L  +G  D+G PI+ + IL G I + +LE+AL    
Sbjct: 766 S-RIIDISESSLVPATELRSKLQHLLMAGELDSGLPILRDDILCGIIPAPDLEYALDTIE 824

Query: 240 GSDNLTRCYFKDEN---VIDKS-------ANFTAYVNQAPLTISKNASLEIVLELFKKLG 289
             ++ T C    ++   V+D+         +F  +++ AP+++  ++ +++V + F KLG
Sbjct: 825 DEEH-TVCLMSMDSSSAVLDQDYDHGIIWVDFRRFIDPAPISLDIHSPVDLVYQCFAKLG 883

Query: 290 LRYVIVVDRGQYVGVINKKRLLIYLRQ 316
           +RY+ V+  GQY G+++KK  + Y++Q
Sbjct: 884 VRYLCVLRDGQYAGLVHKKAFVKYVKQ 910



>gi|449303008|gb|EMC99016.1| hypothetical protein BAUCODRAFT_103703 [Baudoinia compniacensis
           UAMH 10762]
          Length = 888

 Score =  221 bits (563), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 126/323 (39%), Positives = 190/323 (58%), Gaps = 19/323 (5%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC          F LL  ALI  FL   +TFG+++PAGI +P++ VGA +GR++G++++
Sbjct: 529 GLCKAGIANTGVIFILLISALIG-FLLATVTFGLQIPAGILLPSMAVGALYGRVIGLIVE 587

Query: 62  YLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTL 121
                +P+F  + + C  +I   CV PG YA++GAA++LAG TR TVS+ VIMFELTG L
Sbjct: 588 VWQREHPNFIAFRS-CEPDI--PCVTPGTYAVIGAASALAGATRMTVSIVVIMFELTGAL 644

Query: 122 TYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQR 181
           TYVLPIM A+M+SKWV D   K GIY+  I   G+P+LD+K      + T    + + Q 
Sbjct: 645 TYVLPIMIAVMLSKWVGDAFGKRGIYESWIHFNGYPFLDNK------DDTPVPDVPVSQI 698

Query: 182 DLEVIDVNDLNTIGELKNKLKKLSTSGYSDAGFPIVD---NKILVGYIASTELEHALSLA 238
                D+  +   G     L++L    +   GFP+++     +L+GYI+ TEL  AL  A
Sbjct: 699 MTRYDDLVCITATGHTTTSLREL-LGEHRFRGFPVINELRESVLLGYISRTELTFALETA 757

Query: 239 HGSDNL---TRCYFKDENVIDKSA--NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYV 293
             S  +   T CYF+ + + D +   +   +++Q P+T+S  +S  +V ++F+KLGLRY+
Sbjct: 758 STSRAMPSTTECYFQHQPLADPTVTLDLRPWMDQTPITLSSRSSFGLVKDMFEKLGLRYI 817

Query: 294 IVVDRGQYVGVINKKRLLIYLRQ 316
           I  DRG   G++ KK L   L +
Sbjct: 818 IFTDRGSLTGLLTKKDLWYVLNE 840



>gi|330926068|ref|XP_003301311.1| hypothetical protein PTT_12780 [Pyrenophora teres f. teres 0-1]
 gi|311324067|gb|EFQ90582.1| hypothetical protein PTT_12780 [Pyrenophora teres f. teres 0-1]
          Length = 923

 Score =  221 bits (562), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 125/340 (36%), Positives = 196/340 (57%), Gaps = 26/340 (7%)

Query: 1   DGLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVM 60
           DGLC  +   + E   +L  A I K    V+TFGI+VPAGI++P+++VG   GR +G  +
Sbjct: 585 DGLCP-TIEHIPEVLKVLFFAFIIKASLTVVTFGIKVPAGIYVPSMVVGGLAGRFIGHTV 643

Query: 61  QYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGT 120
           QY+   Y    ++S        G CV+PGVYA+V A A++ GVTR +++L VI+FELTG+
Sbjct: 644 QYIAFRYSHLGLFSECSPDGPPGSCVVPGVYALVAAGATMTGVTRLSITLAVILFELTGS 703

Query: 121 LTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLD--- 177
           L +VLP    I++SKWVAD I    IYDLL D+  +P+LD+K         FT+ L+   
Sbjct: 704 LDHVLPFSLGILVSKWVADAIEPLSIYDLLTDMNSYPFLDNKV-----RPIFTSELNDIT 758

Query: 178 LCQRDLEVIDVNDLNTIG--ELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHAL 235
             +R   +ID+++   I   EL+ K + L  +G  D G  IV + ILVG I + +LE AL
Sbjct: 759 TGRRKDHIIDISEDALIPAVELRAKQRNLQMAGELDGGLAIVKHGILVGLIPAPDLEFAL 818

Query: 236 SLAHGSDNLTRC--------------YFKDENVIDKSANFTAYVNQAPLTISKNASLEIV 281
                 DN T C              + ++E      ++FT Y++ AP+ +  ++ +++V
Sbjct: 819 DKLENEDN-TLCLMSPRVDWAAGREPHDEEEPEAYDPSDFTPYIDPAPVALDVHSPMDLV 877

Query: 282 LELFKKLGLRYVIVVDRGQYVGVINKKRLLIYLRQITGKD 321
            E F KLGLRY+ V+  G+Y G+++KK  + Y++++  ++
Sbjct: 878 YECFVKLGLRYICVLRDGKYAGLVHKKTFVKYVKELEHQE 917



>gi|71001086|ref|XP_755224.1| voltage-gated chloride channel (ClcA) [Aspergillus fumigatus Af293]
 gi|66852862|gb|EAL93186.1| voltage-gated chloride channel (ClcA), putative [Aspergillus
           fumigatus Af293]
 gi|159129311|gb|EDP54425.1| voltage-gated chloride channel (ClcA), putative [Aspergillus
           fumigatus A1163]
          Length = 911

 Score =  221 bits (562), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 123/327 (37%), Positives = 200/327 (61%), Gaps = 16/327 (4%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC    +G+ E    L +A + K L  V+TFGI+VPAGI++P+++VG   GR++G V+Q
Sbjct: 587 GLCPTE-DGIGEIISDLLVAFVIKSLLTVVTFGIKVPAGIYVPSMVVGGLMGRIVGHVVQ 645

Query: 62  YLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTL 121
           +L + +P+F ++ST    +    CV+PGVYAMV A A++ GVTR +V+L VI+FELTG+L
Sbjct: 646 FLVVKFPNFFLFSTCPVYSGMESCVVPGVYAMVAAGATMCGVTRLSVTLAVILFELTGSL 705

Query: 122 TYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQR 181
            +VLP   A++ +KW AD I    IYDLL D+  +P+LD+K +    +        +  R
Sbjct: 706 DHVLPFSLAVLCAKWTADAIEPRSIYDLLTDMNSYPFLDNKIQLLSDDELGDIVRPV--R 763

Query: 182 DLEVIDVNDLNTIG--ELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHALSLAH 239
              VID+++   +   EL++KL+ L  +G  D+G PI+ N IL G I + +LE+AL    
Sbjct: 764 KSRVIDISESPFVPATELRSKLQHLLMAGELDSGLPILRNDILCGIIPAPDLEYALDTIE 823

Query: 240 GSDNLTRCYFKDEN---VIDKS-------ANFTAYVNQAPLTISKNASLEIVLELFKKLG 289
             ++ T C    +    V+D          +F  Y++ AP+++  ++ +++V + F KLG
Sbjct: 824 DEEH-TMCLMSMDTASAVVDSEDSNGNSWVDFRRYIDPAPISLDIHSPIDLVYQCFAKLG 882

Query: 290 LRYVIVVDRGQYVGVINKKRLLIYLRQ 316
           LRY+ V+  GQY G+++KK  + Y+++
Sbjct: 883 LRYLCVLRDGQYAGLVHKKAFVKYVKE 909



>gi|169619307|ref|XP_001803066.1| hypothetical protein SNOG_12848 [Phaeosphaeria nodorum SN15]
 gi|111058528|gb|EAT79648.1| hypothetical protein SNOG_12848 [Phaeosphaeria nodorum SN15]
          Length = 925

 Score =  221 bits (562), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 123/343 (35%), Positives = 199/343 (58%), Gaps = 26/343 (7%)

Query: 1   DGLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVM 60
           DGLC  +   +      L +A + K    V+TFGI+VPAGI++P+++VG   GR +G  +
Sbjct: 588 DGLCP-TVEHIPSVLKTLFIAFVIKAFLTVVTFGIKVPAGIYVPSMVVGGLAGRFIGHTV 646

Query: 61  QYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGT 120
           Q + + Y    ++S        G CV+PGVYA+V A A++ GVTR T++L VI+FELTG+
Sbjct: 647 QLVALKYSHLGLFSECKPDGAPGACVVPGVYALVAAGATMTGVTRLTITLAVILFELTGS 706

Query: 121 LTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTL-DLC 179
           L +VLP    I+++KW AD I    IYDLL D+  +P+LD+K         FT+ L D+ 
Sbjct: 707 LDHVLPFSLGILVAKWTADAIEPLSIYDLLTDMNSYPFLDNK-----VRPIFTSELGDIT 761

Query: 180 Q--RDLEVIDVNDLNTI--GELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHAL 235
              R   VID++D + I   EL+ K + L  SG  D G PI+ + +LVG I + +LE AL
Sbjct: 762 PRVRKDRVIDISDESLIPASELREKQQALQMSGQLDGGIPIIKHGVLVGLIPAPDLEFAL 821

Query: 236 SLAHGSDNLTRC--------------YFKDENVIDKSANFTAYVNQAPLTISKNASLEIV 281
                 +N T C              + ++  ++   ++FT Y++ AP+++  ++ +++V
Sbjct: 822 DKLDNEEN-TLCLMSTQVDWAAGREPHGEESQILYDPSDFTPYIDPAPVSLDVHSPMDLV 880

Query: 282 LELFKKLGLRYVIVVDRGQYVGVINKKRLLIYLRQITGKDMNN 324
            E F KLGLRY+ V+  G+Y G+++KK  + Y++++  K+  +
Sbjct: 881 YECFVKLGLRYICVLRDGKYAGMVHKKSFVKYMKELEIKEKKH 923



>gi|240972665|ref|XP_002401153.1| chloride channel, putative [Ixodes scapularis]
 gi|215490978|gb|EEC00619.1| chloride channel, putative [Ixodes scapularis]
          Length = 764

 Score =  220 bits (561), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 128/330 (38%), Positives = 192/330 (58%), Gaps = 22/330 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ + + L LAL+ K L  + TFGI+VPAGIFIP++  GA  GRM+GI ++ L   YP 
Sbjct: 442 GVYTSLWQLSLALVFKLLITIFTFGIKVPAGIFIPSMAFGAIMGRMIGIAVEQLAYQYPT 501

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
             ++   CN   N  CV PG+YAMVGAAA L GVTR TVSL VIMFELTG++ Y+ P+M 
Sbjct: 502 LWVFQGACNTGEN--CVTPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGSVRYIEPLMA 559

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVID-- 187
           A+M SKWV D + K GIYD  I L G+P+LDSK E+  A+TT    +   +R    +   
Sbjct: 560 AVMASKWVGDALGKEGIYDAHIHLNGYPFLDSKEEF--AHTTLAADVMQPRRGEGPLCYI 617

Query: 188 VNDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTELEHALSLAHGSD-- 242
             D  T+ EL+  LK    +     GFP++   +++ LVG++   +L  AL+ A  S   
Sbjct: 618 TQDSMTVEELECLLKTTDHN-----GFPVIVSTESQYLVGFVLRKDLSLALANARKSQVG 672

Query: 243 --NLTRCYFKDENVIDKSA----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVV 296
               +R  F  +     +          ++ AP+T++    +E V+++F+KLGLR  +V 
Sbjct: 673 VVGSSRALFVSQVATPWTGPPPVTLRRILDLAPITVTDQTPMETVIDMFRKLGLRQTLVT 732

Query: 297 DRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
             G+ +G+I KK +L +++ +  +D  + L
Sbjct: 733 HNGKILGIITKKDVLRHIKLLANEDPESVL 762



>gi|302509278|ref|XP_003016599.1| hypothetical protein ARB_04888 [Arthroderma benhamiae CBS 112371]
 gi|291180169|gb|EFE35954.1| hypothetical protein ARB_04888 [Arthroderma benhamiae CBS 112371]
          Length = 898

 Score =  220 bits (561), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 119/310 (38%), Positives = 192/310 (61%), Gaps = 12/310 (3%)

Query: 16  YLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPDFPIYST 75
           YLL   +I  FLT  ITFGI+VPAGI++P+++VG   GR++G V QY  + YP+F ++  
Sbjct: 583 YLLVAFIIKSFLT-TITFGIKVPAGIYVPSMVVGGLMGRIVGHVAQYFVVHYPNFFLFGQ 641

Query: 76  VCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMTAIMISK 135
             +  +   CV PGVYA++ A +++ GVTR +++L VI+FELTG+L +VLP   AI+ +K
Sbjct: 642 CPSTKLAESCVNPGVYALIAAGSTMCGVTRLSLTLVVILFELTGSLDHVLPFSLAILCAK 701

Query: 136 WVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDVND--LNT 193
           WV++ +    IYDLL D+  +P+LD+K  +  AN      +   +R+  VID++   L +
Sbjct: 702 WVSNAVEPLSIYDLLTDMNSYPFLDNKL-HPIANIELGDIVPRVRRN-RVIDISSSPLVS 759

Query: 194 IGELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHALSLAHGSDNLTRC------ 247
             EL+ KL KL  +G  D G PI++N ILVG I + ELE+AL      +  T C      
Sbjct: 760 ATELREKLDKLLMAGELDGGLPILNNNILVGLIPAPELEYALDKLPSEEQDTMCLMSMQS 819

Query: 248 -YFKDENVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVVDRGQYVGVIN 306
            Y  +       A+FT +++ +P+++  ++ + +V + F KLGLRY+ V+  GQY G+++
Sbjct: 820 SYLGEGENDTNVADFTPFIDPSPVSLDIHSPINLVYQCFVKLGLRYMCVLRDGQYAGLVH 879

Query: 307 KKRLLIYLRQ 316
           KK  + ++++
Sbjct: 880 KKSFVKFMKE 889



>gi|396479619|ref|XP_003840798.1| similar to voltage-gated protein/chloride channel [Leptosphaeria
           maculans JN3]
 gi|312217371|emb|CBX97319.1| similar to voltage-gated protein/chloride channel [Leptosphaeria
           maculans JN3]
          Length = 918

 Score =  220 bits (561), Expect = 4e-55,   Method: Compositional matrix adjust.
 Identities = 123/340 (36%), Positives = 197/340 (57%), Gaps = 26/340 (7%)

Query: 1   DGLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVM 60
           DGLC      + +   +L +A + K    +ITFG++VPAGI++P+++VG   GR +G  +
Sbjct: 580 DGLCPTR-EHIPDVLKVLFVAFLIKASLTIITFGLKVPAGIYVPSMVVGGLAGRFIGHSV 638

Query: 61  QYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGT 120
           Q   + Y    ++         G CV+PGVYA+V A A++ GVTR T++L VI+FELTG+
Sbjct: 639 QLFALRYSHLGVFGECVPSGPPGSCVVPGVYALVAAGATMTGVTRLTITLAVILFELTGS 698

Query: 121 LTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTL-DLC 179
           L +VLP    I+++KWVAD I    IYDLL D+  +P+LD+K         FT+ L D+ 
Sbjct: 699 LDHVLPFSLGILVAKWVADAIEPLSIYDLLTDMNSYPFLDNKV-----RPIFTSELGDIT 753

Query: 180 Q--RDLEVIDVNDLNTI--GELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHAL 235
              R  ++IDV++ + I   EL+ K ++L  SG  D G PIV N +LVG I + +LE AL
Sbjct: 754 PRVRPDKIIDVSEESLIPAPELREKQQRLQMSGELDGGLPIVKNGVLVGLIPAPDLEFAL 813

Query: 236 SLAHGSDNLTRC--------------YFKDENVIDKSANFTAYVNQAPLTISKNASLEIV 281
                 DN T C              + ++E      ++FT Y++ AP+ +  ++ +++V
Sbjct: 814 DKLENEDN-TLCLMSPQEDWAAGREQHGEEEQASYDPSDFTPYIDPAPVALDVHSPMDLV 872

Query: 282 LELFKKLGLRYVIVVDRGQYVGVINKKRLLIYLRQITGKD 321
            E F KLGLRY+ V+  G++ G+++KK  + Y++++   +
Sbjct: 873 YECFVKLGLRYICVLRDGKFAGLVHKKSFVKYIKELEQHE 912



>gi|328699860|ref|XP_001947783.2| PREDICTED: H(+)/Cl(-) exchange transporter 3-like [Acyrthosiphon
           pisum]
          Length = 763

 Score =  220 bits (560), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 130/344 (37%), Positives = 197/344 (57%), Gaps = 26/344 (7%)

Query: 1   DGLCDNSFN-------GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFG 53
           DGLCD + +       G++ A  LL +A + K +T + TFGI+VP G+FIP+L +G   G
Sbjct: 426 DGLCDYTNDKANVAGPGVYTAMLLLSMAFVLKLVTTIFTFGIKVPCGLFIPSLAMGGITG 485

Query: 54  RMLGIVMQYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVI 113
           R++GI+MQ L   +P    +   C       C+ PG+YAMVGAAA L GVTR TVSL VI
Sbjct: 486 RIVGILMQQLAAKHPHLWFFDNSCGLPGQEGCITPGLYAMVGAAAVLGGVTRMTVSLVVI 545

Query: 114 MFELTGTLTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFT 173
           MFELTG + Y++P+M A+M SKWV D + K G+YD  I L G+P+LDSK   D  +T   
Sbjct: 546 MFELTGGVRYIVPLMAAVMASKWVGDALGKEGMYDAHIQLNGYPFLDSKE--DIVHTALA 603

Query: 174 TTLDLCQRDLEVIDVNDLNTIGELKNKLK--KLSTSGYSDAGFPIV---DNKILVGYIAS 228
             +   +R        +LN + +    L+  ++        GFP+V   +++ LVGY+  
Sbjct: 604 ADVMQPRR------AENLNVLTQSSMSLEDTEILLKDTEHNGFPVVVSRESQYLVGYVLR 657

Query: 229 TELEHALSLAHGS-DNL---TRCYFKD--ENVIDKSANFTAYVNQAPLTISKNASLEIVL 282
            +L+ AL  A  + D L   +   F D  + V+         ++ AP+TI+    +E V+
Sbjct: 658 RDLQLALENAKRTIDGLLPESLVLFTDITQQVMPPPLKLKKILDMAPITITDQTPMETVV 717

Query: 283 ELFKKLGLRYVIVVDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
           ++F+KLGLR  +V   G+ +GVI KK +L Y++Q+  +D ++ L
Sbjct: 718 DMFRKLGLRQTLVTHNGRLLGVITKKDILRYIKQVDNEDPSSVL 761



>gi|400596235|gb|EJP64011.1| voltage gated chloride channel [Beauveria bassiana ARSEF 2860]
          Length = 869

 Score =  220 bits (560), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 125/325 (38%), Positives = 192/325 (59%), Gaps = 15/325 (4%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC NS + +      L +A + K    VITFGI+VPAGI+IP+++VG   GRM+G ++Q
Sbjct: 544 GLCPNSVDDIPGILKTLVVAFLIKGFLTVITFGIKVPAGIYIPSMVVGGLMGRMVGHLVQ 603

Query: 62  YLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTL 121
           +L +  PD+ I+   C    +G C+ PGVY ++ A A++ GVTR +V+L VI+FELTG+L
Sbjct: 604 WLVLAAPDWRIWGN-CATEADGTCIQPGVYGLIAAGATMCGVTRLSVTLAVILFELTGSL 662

Query: 122 TYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTE--YDGANTTFTTTLDLC 179
            YVLP    I+++KW AD I  + IYDLL  +  +P+LD+K +  + G      T     
Sbjct: 663 DYVLPFSLTILVAKWTADAIEPNSIYDLLTSMNAYPFLDNKHKPVFTGDLADIITRF--- 719

Query: 180 QRDLEVIDVNDLNTIG--ELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHAL-S 236
            R   VID+ +   +   +L++KL+ L  +G  D G PI+ + ILVG I + +LE AL  
Sbjct: 720 -RRERVIDITNSPLVAATKLRSKLEILHRAGELDGGLPILRHDILVGLIPAPDLEFALDQ 778

Query: 237 LAHGSDNLT---RCYFKDENVID--KSANFTAYVNQAPLTISKNASLEIVLELFKKLGLR 291
           L   + +L    R    DE+  D     +FT Y++ AP+ +   +  ++V E F KLGLR
Sbjct: 779 LEEEATSLCLMDRVPSMDEDEDDTVDPTDFTPYIDPAPVALDLRSPTDLVYECFVKLGLR 838

Query: 292 YVIVVDRGQYVGVINKKRLLIYLRQ 316
           Y+     G+Y G+I+KK  + ++R+
Sbjct: 839 YICATKDGRYAGMIHKKTFVKHMRE 863



>gi|513180851|ref|XP_004940780.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform X11 [Gallus
           gallus]
          Length = 785

 Score =  220 bits (560), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 125/331 (37%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L LALI K    + TFG++VP+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 462 GVYTAMWQLALALIMKVFITIFTFGMKVPSGLFIPSMAVGAIAGRLLGVAMEQLAFYHHD 521

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+S  C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 522 WIIFSGWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 579

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD I + GIYD  I L G+P+L++K E+  ++ T    +   +R+   + V 
Sbjct: 580 AAMTSKWVADAIGREGIYDAHIRLNGYPFLEAKEEF--SHKTLAMDVMRPRRNDPPLTVI 637

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + SGY     P+V   +++ LVG++   +L    E+A     G
Sbjct: 638 TQDSMTVEDIETIINETTYSGY-----PVVVSRESQRLVGFVLRRDLIISIENARKKQDG 692

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF D +     +        + ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 693 IVSTSIIYFTDHSPPLPPSSPSMLKLRSILDLSPFTVTDQTPMEIVVDIFRKLGLRQCLV 752

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 753 THNGKLLGIITKKDVLKHIAQLANQDPDSIL 783



>gi|513180842|ref|XP_004940778.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform X9 [Gallus
           gallus]
          Length = 826

 Score =  220 bits (560), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 125/331 (37%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L LALI K    + TFG++VP+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 503 GVYTAMWQLALALIMKVFITIFTFGMKVPSGLFIPSMAVGAIAGRLLGVAMEQLAFYHHD 562

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+S  C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 563 WIIFSGWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 620

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD I + GIYD  I L G+P+L++K E+  ++ T    +   +R+   + V 
Sbjct: 621 AAMTSKWVADAIGREGIYDAHIRLNGYPFLEAKEEF--SHKTLAMDVMRPRRNDPPLTVI 678

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + SGY     P+V   +++ LVG++   +L    E+A     G
Sbjct: 679 TQDSMTVEDIETIINETTYSGY-----PVVVSRESQRLVGFVLRRDLIISIENARKKQDG 733

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF D +     +        + ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 734 IVSTSIIYFTDHSPPLPPSSPSMLKLRSILDLSPFTVTDQTPMEIVVDIFRKLGLRQCLV 793

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 794 THNGKLLGIITKKDVLKHIAQLANQDPDSIL 824



>gi|395546354|ref|XP_003775053.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 1 [Sarcophilus
           harrisii]
          Length = 814

 Score =  220 bits (560), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 127/334 (38%), Positives = 199/334 (59%), Gaps = 27/334 (8%)

Query: 9   NGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYP 68
            G++ A + L LAL+ K L  + TFGI+VP+G+FIP++ VGA  GR+LG+ M+ L   + 
Sbjct: 490 KGVYTAVWQLSLALVMKILITIFTFGIKVPSGLFIPSMAVGAIAGRLLGVGMEQLAFYHH 549

Query: 69  DFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIM 128
           D+PI+S  C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M
Sbjct: 550 DWPIFSGWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLM 607

Query: 129 TAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLE---- 184
            A M SKWVAD I + GIYD  I L G+P+L++K E+    T  T  +D+ +        
Sbjct: 608 AAAMTSKWVADAIGREGIYDAHIRLNGYPFLEAKEEF----THKTLAMDVMRPRRSDPTL 663

Query: 185 VIDVNDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSL 237
           ++   D  T+ +++  + + + SGY     P+V   +++ LVG++   +L    E+A   
Sbjct: 664 MVLTQDSMTVEDVETLISETTYSGY-----PVVVSRESQRLVGFVLRRDLIISIENARKK 718

Query: 238 AHGSDNLTRCYFKD-----ENVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRY 292
             G  + +  +F D           S      ++ +P T++    +EIV+++F+KLGLR 
Sbjct: 719 QDGIVSTSIIHFTDHSPPLPPHAPPSLKLRNILDLSPFTVTDQTPMEIVVDIFRKLGLRQ 778

Query: 293 VIVVDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
            +V   G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 779 CLVTHNGRLLGIITKKDVLKHIAQMANQDPDSIL 812



>gi|513180845|ref|XP_420265.3| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform X8 [Gallus
           gallus]
 gi|513180848|ref|XP_004940779.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform X10 [Gallus
           gallus]
          Length = 805

 Score =  219 bits (559), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 125/331 (37%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L LALI K    + TFG++VP+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 482 GVYTAMWQLALALIMKVFITIFTFGMKVPSGLFIPSMAVGAIAGRLLGVAMEQLAFYHHD 541

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+S  C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 542 WIIFSGWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 599

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD I + GIYD  I L G+P+L++K E+  ++ T    +   +R+   + V 
Sbjct: 600 AAMTSKWVADAIGREGIYDAHIRLNGYPFLEAKEEF--SHKTLAMDVMRPRRNDPPLTVI 657

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + SGY     P+V   +++ LVG++   +L    E+A     G
Sbjct: 658 TQDSMTVEDIETIINETTYSGY-----PVVVSRESQRLVGFVLRRDLIISIENARKKQDG 712

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF D +     +        + ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 713 IVSTSIIYFTDHSPPLPPSSPSMLKLRSILDLSPFTVTDQTPMEIVVDIFRKLGLRQCLV 772

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 773 THNGKLLGIITKKDVLKHIAQLANQDPDSIL 803



>gi|189207222|ref|XP_001939945.1| chloride channel protein 3 [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|187976038|gb|EDU42664.1| chloride channel protein 3 [Pyrenophora tritici-repentis Pt-1C-BFP]
          Length = 923

 Score =  219 bits (559), Expect = 6e-55,   Method: Compositional matrix adjust.
 Identities = 124/340 (36%), Positives = 196/340 (57%), Gaps = 26/340 (7%)

Query: 1   DGLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVM 60
           DGLC  +   + E   +L  A I K    V+TFGI+VPAGI++P+++VG   GR +G  +
Sbjct: 585 DGLCP-TIEHIPEVLKVLFFAFIIKASLTVVTFGIKVPAGIYVPSMVVGGLAGRFIGHTV 643

Query: 61  QYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGT 120
           QY+   +    ++S        G CV+PGVYA+V A A++ GVTR +++L VI+FELTG+
Sbjct: 644 QYIAFRFSHLGLFSECSPDGPPGSCVVPGVYALVAAGATMTGVTRLSITLAVILFELTGS 703

Query: 121 LTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLD--- 177
           L +VLP    I++SKWVAD I    IYDLL D+  +P+LD+K         FT+ L+   
Sbjct: 704 LDHVLPFSLGILVSKWVADAIEPLSIYDLLTDMNSYPFLDNKV-----RPIFTSELNDIT 758

Query: 178 LCQRDLEVIDVNDLNTIG--ELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHAL 235
             +R   +ID+++   I   EL+ K + L  +G  D G  IV + ILVG I + +LE AL
Sbjct: 759 TGRRKDHIIDISEDALIPAVELRAKQRNLQMAGELDGGLAIVKHGILVGLIPAPDLEFAL 818

Query: 236 SLAHGSDNLTRC--------------YFKDENVIDKSANFTAYVNQAPLTISKNASLEIV 281
                 DN T C              + ++E      ++FT Y++ AP+ +  ++ +++V
Sbjct: 819 DKLENEDN-TLCLMSPRVDWAAGREPHDEEEPEAYDPSDFTPYIDPAPVALDVHSPMDLV 877

Query: 282 LELFKKLGLRYVIVVDRGQYVGVINKKRLLIYLRQITGKD 321
            E F KLGLRY+ V+  G+Y G+++KK  + Y++++  ++
Sbjct: 878 YECFVKLGLRYICVLRDGKYAGLVHKKTFVKYVKELEHQE 917



>gi|395546356|ref|XP_003775054.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 2 [Sarcophilus
           harrisii]
          Length = 810

 Score =  219 bits (559), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 127/334 (38%), Positives = 199/334 (59%), Gaps = 27/334 (8%)

Query: 9   NGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYP 68
            G++ A + L LAL+ K L  + TFGI+VP+G+FIP++ VGA  GR+LG+ M+ L   + 
Sbjct: 486 KGVYTAVWQLSLALVMKILITIFTFGIKVPSGLFIPSMAVGAIAGRLLGVGMEQLAFYHH 545

Query: 69  DFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIM 128
           D+PI+S  C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M
Sbjct: 546 DWPIFSGWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLM 603

Query: 129 TAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLE---- 184
            A M SKWVAD I + GIYD  I L G+P+L++K E+    T  T  +D+ +        
Sbjct: 604 AAAMTSKWVADAIGREGIYDAHIRLNGYPFLEAKEEF----THKTLAMDVMRPRRSDPTL 659

Query: 185 VIDVNDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSL 237
           ++   D  T+ +++  + + + SGY     P+V   +++ LVG++   +L    E+A   
Sbjct: 660 MVLTQDSMTVEDVETLISETTYSGY-----PVVVSRESQRLVGFVLRRDLIISIENARKK 714

Query: 238 AHGSDNLTRCYFKD-----ENVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRY 292
             G  + +  +F D           S      ++ +P T++    +EIV+++F+KLGLR 
Sbjct: 715 QDGIVSTSIIHFTDHSPPLPPHAPPSLKLRNILDLSPFTVTDQTPMEIVVDIFRKLGLRQ 774

Query: 293 VIVVDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
            +V   G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 775 CLVTHNGRLLGIITKKDVLKHIAQMANQDPDSIL 808



>gi|296423317|ref|XP_002841201.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295637436|emb|CAZ85392.1| unnamed protein product [Tuber melanosporum]
          Length = 864

 Score =  219 bits (559), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 123/332 (37%), Positives = 190/332 (57%), Gaps = 21/332 (6%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC           YLL +AL  K +  V+TFG +VPAG+++P +++G   G ++G+ ++
Sbjct: 534 GLCPKPDEIPSTILYLL-VALAIKSVLTVVTFGTKVPAGVYVPTMVIGGIMGHVVGLAVE 592

Query: 62  YLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTL 121
           Y    +P  P++++      +  CV PGVYA+V A A + GVTR +V+L +I+FE+TG+L
Sbjct: 593 YAVYKFPHSPMFASCPVGGASSACVTPGVYALVCAGAVMCGVTRLSVTLAIILFEMTGSL 652

Query: 122 TYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTL-DLCQ 180
            +VLP   A+++SKW AD I    IYDLL  L  +PYLD+K         F++ L D+  
Sbjct: 653 DHVLPFSLAVLVSKWTADAIEPLSIYDLLTALNSYPYLDTKM-----RPVFSSQLSDITP 707

Query: 181 RDL--EVIDVNDLNTI--GELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHALS 236
           R     VID+ D   +   EL+ KL+ L   G  D G PIV N ILVG I + +LE AL 
Sbjct: 708 RPRPERVIDITDSVYVPADELREKLQMLQAVGELDGGLPIVRNDILVGLIPAPDLEFALD 767

Query: 237 LAHGSDNLTRCYFK----------DENVIDKSANFTAYVNQAPLTISKNASLEIVLELFK 286
               S+    C  +          D++ +     F+ Y++ AP+ + +++ +E+V E F 
Sbjct: 768 NLQSSEQDELCCMEPKGEWWDGGSDDDSMRDPTYFSQYIDPAPVALERHSPMELVYECFA 827

Query: 287 KLGLRYVIVVDRGQYVGVINKKRLLIYLRQIT 318
           KLGLRY+ V+  GQ+ GV++KK  + YL ++T
Sbjct: 828 KLGLRYMCVLRDGQFAGVVHKKTFVKYLMEVT 859



>gi|513180854|ref|XP_004940781.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform X12 [Gallus
           gallus]
          Length = 752

 Score =  219 bits (558), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 125/331 (37%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L LALI K    + TFG++VP+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 429 GVYTAMWQLALALIMKVFITIFTFGMKVPSGLFIPSMAVGAIAGRLLGVAMEQLAFYHHD 488

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+S  C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 489 WIIFSGWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 546

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD I + GIYD  I L G+P+L++K E+  ++ T    +   +R+   + V 
Sbjct: 547 AAMTSKWVADAIGREGIYDAHIRLNGYPFLEAKEEF--SHKTLAMDVMRPRRNDPPLTVI 604

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + SGY     P+V   +++ LVG++   +L    E+A     G
Sbjct: 605 TQDSMTVEDIETIINETTYSGY-----PVVVSRESQRLVGFVLRRDLIISIENARKKQDG 659

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF D +     +        + ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 660 IVSTSIIYFTDHSPPLPPSSPSMLKLRSILDLSPFTVTDQTPMEIVVDIFRKLGLRQCLV 719

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 720 THNGKLLGIITKKDVLKHIAQLANQDPDSIL 750



>gi|326924401|ref|XP_003208416.1| PREDICTED: H(+)/Cl(-) exchange transporter 5-like [Meleagris
           gallopavo]
          Length = 886

 Score =  219 bits (558), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 125/331 (37%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L LALI K    + TFG++VP+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 563 GVYTAMWQLALALIMKVFITIFTFGMKVPSGLFIPSMAVGAIAGRLLGVAMEQLAFYHHD 622

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+S  C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 623 WIIFSGWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 680

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD I + GIYD  I L G+P+L++K E+  ++ T    +   +R+   + V 
Sbjct: 681 AAMTSKWVADAIGREGIYDAHIRLNGYPFLEAKEEF--SHKTLAMDVMRPRRNDPPLTVI 738

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + SGY     P+V   +++ LVG++   +L    E+A     G
Sbjct: 739 TQDSMTVEDIETIINETTYSGY-----PVVVSRESQRLVGFVLRRDLIISIENARKKQDG 793

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF D +     +        + ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 794 IVSTSIIYFTDHSPPLPPSSPSMLKLRSILDLSPFTVTDQTPMEIVVDIFRKLGLRQCLV 853

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 854 THNGKLLGIITKKDVLKHIAQLANQDPDSIL 884



>gi|119480729|ref|XP_001260393.1| voltage-gated chloride channel (ClcA), putative [Neosartorya
           fischeri NRRL 181]
 gi|119408547|gb|EAW18496.1| voltage-gated chloride channel (ClcA), putative [Neosartorya
           fischeri NRRL 181]
          Length = 911

 Score =  219 bits (558), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 122/327 (37%), Positives = 199/327 (60%), Gaps = 16/327 (4%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC    +G+      L +A + K L  V+TFGI+VPAGI++P+++VG   GR++G V+Q
Sbjct: 587 GLCPTE-DGIGAIISDLLVAFVIKSLLTVVTFGIKVPAGIYVPSMVVGGLMGRIVGHVVQ 645

Query: 62  YLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTL 121
           +L + +P+F ++ST    +    CV+PGVYAMV A A++ GVTR +V+L VI+FELTG+L
Sbjct: 646 FLVVKFPNFFLFSTCPVYSGMESCVVPGVYAMVAAGATMCGVTRLSVTLAVILFELTGSL 705

Query: 122 TYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQR 181
            +VLP   A++ +KW AD I    IYDLL D+  +P+LD+K +    +        +  R
Sbjct: 706 DHVLPFSLAVLCAKWTADAIEPRSIYDLLTDMNSYPFLDNKIQVLSEDELGDIVRPV--R 763

Query: 182 DLEVIDVNDLNTIG--ELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHALSLAH 239
              VID+++   +   EL++KL+ L  +G  D+G PI+ N IL G I + +LE+AL    
Sbjct: 764 KSRVIDISESPFVPATELRSKLQHLLMAGELDSGLPILRNDILCGIIPAPDLEYALDTIE 823

Query: 240 GSDNLTRCYFKDEN---VIDKS-------ANFTAYVNQAPLTISKNASLEIVLELFKKLG 289
             ++ T C    +    V+D          +F  Y++ AP+++  ++ +++V + F KLG
Sbjct: 824 DEEH-TMCLMSMDTASAVVDSEDSNGNSWVDFRRYIDPAPISLDIHSPIDLVYQCFAKLG 882

Query: 290 LRYVIVVDRGQYVGVINKKRLLIYLRQ 316
           LRY+ V+  GQY G+++KK  + Y+++
Sbjct: 883 LRYLCVLRDGQYAGLVHKKAFVKYVKE 909



>gi|156361254|ref|XP_001625433.1| predicted protein [Nematostella vectensis]
 gi|156212267|gb|EDO33333.1| predicted protein [Nematostella vectensis]
          Length = 746

 Score =  219 bits (557), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 124/332 (37%), Positives = 204/332 (61%), Gaps = 23/332 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G+ +A + L LA + K +  V TFGI+VPAG+FIP++ +GAC GR++GI ++ L ++ P+
Sbjct: 421 GVLKAVWQLLLAALFKLIITVFTFGIKVPAGLFIPSMAIGACIGRIIGIGVEQLAVSNPE 480

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + ++S+ C  +I+ +CV PG+YAMVGAAA L GVT+ TVSL VIMFELTG LTY++P+M 
Sbjct: 481 WLVFSSSCGNSIS-NCVTPGLYAMVGAAAVLGGVTKMTVSLVVIMFELTGGLTYIVPLMV 539

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVID-- 187
           AIM SKWV D  IK GIYD  I L G+P+LD+K E+   +TT  + +   ++    +   
Sbjct: 540 AIMTSKWVGDAFIKEGIYDGHIHLNGYPFLDNKEEF--THTTQASDVMRPRKHDPALSCI 597

Query: 188 VNDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTELEHALSLAHGSD-- 242
             D  T+G+L+  L +         GFP++   +++ LVG++   +L+ AL  A   +  
Sbjct: 598 TQDEFTVGDLEQLLDETEFK-----GFPVIVDKESQRLVGFVLRRDLKIALRHARIRNEE 652

Query: 243 --NLTRCYFKDENVIDKSANFTA------YVNQAPLTISKNASLEIVLELFKKLGLRYVI 294
             + ++ YF +++    +    A       ++ +P+ I+    +E V+ELF+++GLR  +
Sbjct: 653 IVSASKVYFTEQSTRYATPGQAAPLTLRHILDMSPIQITDATPMETVVELFRRVGLRQTL 712

Query: 295 VVDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
           V   G+ +G+I KK +L ++  +  +D  + L
Sbjct: 713 VTHNGRLLGIITKKDVLRHIATLANQDPESIL 744



>gi|452843228|gb|EME45163.1| hypothetical protein DOTSEDRAFT_71014 [Dothistroma septosporum
           NZE10]
          Length = 895

 Score =  219 bits (557), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 125/324 (38%), Positives = 193/324 (59%), Gaps = 20/324 (6%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC +        F LL  + I   LT V TFG+++PAGI +P++ VGA +GR++G+VM+
Sbjct: 538 GLCKSGVANTGVIFILLISSAIGFVLTSV-TFGLQIPAGILLPSMTVGALYGRVVGLVME 596

Query: 62  YLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTL 121
                +P + I    C  ++   CV PG YA++GAA++LAG TR TVS+ VIMFELTG L
Sbjct: 597 VWVQNHPTW-IAFAACEPDV--PCVTPGTYAVIGAASALAGATRMTVSIVVIMFELTGAL 653

Query: 122 TYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQR 181
           TYVLPIM A+M++KWVAD   K GIY+  I   G+P+LD+K +   A+   +      + 
Sbjct: 654 TYVLPIMVAVMLAKWVADAFGKRGIYESWIHFQGYPFLDNKDDTPVADVPISQI--FTRF 711

Query: 182 DLEVIDVNDLNTIGELKNKLKKLSTSGYSDAGFPIVDN---KILVGYIASTELEHALSLA 238
           D  V      +TI  L+  L +     +   GFP++++    +L+GYI+ TEL++AL  A
Sbjct: 712 DDLVCFTASGHTIDSLRELLHE-----HQFRGFPVINDARESVLLGYISRTELQYALDSA 766

Query: 239 HGSDN----LTRCYFKDENVIDKSA--NFTAYVNQAPLTISKNASLEIVLELFKKLGLRY 292
             +      +T C+F+   + D +   +   +++Q P+T+S  +SL++  E+F+KLGLRY
Sbjct: 767 TSTGRSLPAITECFFQHRPLADPTVTLDLRPWMDQTPITLSSRSSLQLTNEMFQKLGLRY 826

Query: 293 VIVVDRGQYVGVINKKRLLIYLRQ 316
           ++  DRG   G++ KK L   L +
Sbjct: 827 IVFTDRGMLSGLLTKKDLWYILNE 850



>gi|341897839|gb|EGT53774.1| hypothetical protein CAEBREN_31647 [Caenorhabditis brenneri]
          Length = 602

 Score =  218 bits (556), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 133/339 (39%), Positives = 193/339 (56%), Gaps = 27/339 (7%)

Query: 1   DGLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVM 60
           D LCD +   +  AF  L  ALI KF+  + TFGI+VP G+F+P++ +GA  GR+LGI +
Sbjct: 262 DSLCDQN-KALSIAFGQLLWALIFKFIITIFTFGIKVPCGLFVPSIGMGAIAGRILGITV 320

Query: 61  QYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGT 120
             +       P +S      I  DCV+PG+YAMVGAAA L GVTR TVSL VIMFELTG+
Sbjct: 321 DQIFRAVQATPGHSEYFTCQIGKDCVMPGLYAMVGAAAVLGGVTRMTVSLVVIMFELTGS 380

Query: 121 LTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQ 180
           L +++P M A M SKW+ DGI K GIY+  I+L G+P+LDSK EY  +            
Sbjct: 381 LEFIVPTMVATMFSKWIGDGISKMGIYEAHIELNGYPFLDSKGEYPYSTVASQVMRPSIH 440

Query: 181 RDLEVIDVNDLNTIGELKNKLKKLSTSGYSDA------------GFPIV---DNKILVGY 225
           R  +V D   ++ + ELKN+L  ++ SG S              GFP+V   ++  LVG+
Sbjct: 441 R--QVADEMSMSDLRELKNELSVITESGMSLGDLESLLRQTDFNGFPVVVSQNSMHLVGF 498

Query: 226 IASTELEHALSLAHGSDNL----TRCYFKD---ENVIDKSA--NFTAYVNQAPLTISKNA 276
           I   ++  AL  A  +       +  YF D   ++V    A       ++ AP+T++   
Sbjct: 499 ITRRDILLALHTARKTQPYVVTNSIAYFSDGVPDSVPGGPAPLRLRKILDMAPMTVTDQT 558

Query: 277 SLEIVLELFKKLGLRYVIVVDRGQYVGVINKKRLLIYLR 315
            +E V+++F+KLGLR V+V   G+ +G+I KK +L ++R
Sbjct: 559 PMETVIDMFRKLGLRQVLVTKNGKVLGIITKKDILQFMR 597



>gi|388582076|gb|EIM22382.1| hypothetical protein WALSEDRAFT_32065 [Wallemia sebi CBS 633.66]
          Length = 985

 Score =  218 bits (556), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 134/354 (37%), Positives = 201/354 (56%), Gaps = 45/354 (12%)

Query: 3   LCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQY 62
           LC       +     L LA+  K +  VITFG+++PAGIF+P L VGACFGRM+G+V++Y
Sbjct: 637 LCAREGQAPWGIIKTLSLAIGIKSVLTVITFGMKLPAGIFVPTLAVGACFGRMVGLVIEY 696

Query: 63  LTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLT 122
            ++  PD  ++    +Q+    C++  +YA++GAA++L+GVTR T+SL VI+ ELTGTL 
Sbjct: 697 WSIVQPDSALFGQCKSQS---KCMLSAIYALIGAASALSGVTRMTISLVVIVCELTGTLN 753

Query: 123 YVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRD 182
           YV+P M +I+ISK +AD I   GIYDL+ID+   P+LD+K EY        + LD+  + 
Sbjct: 754 YVVPTMLSILISKTLADTIEHKGIYDLIIDMNKLPFLDAKHEYRFGK---DSVLDVATKK 810

Query: 183 LEVIDVNDLNTIGELKNKLKKLSTSGYSDAGFP-IVDNK---ILVGYIASTELEHAL-SL 237
           + VI ++  +++  L +KL  L   G SD+GFP I+D++    LVGYIA+ ELEHAL SL
Sbjct: 811 IPVIRIDQEHSVCTLLDKLDSLVMRGLSDSGFPLIIDDEGIIRLVGYIAANELEHALDSL 870

Query: 238 AHGSDNLTR---------------------------CYFK------DENVIDKSANFTAY 264
           +H      R                             FK      D  +     + +AY
Sbjct: 871 SHNPSARVRFTPFDTLQNSILTQSTNNSNSNSRSRLTLFKRFSGVHDAPLSANPYDLSAY 930

Query: 265 VNQAPLTISKNASLEIVLELFKKLGLRYVIVVDR-GQYVGVINKKRLLIYLRQI 317
            + +P+ +   A + +V + F KLG R V VVD  G + GV+ +KR + YL+ +
Sbjct: 931 CDLSPVVVRPEAPMALVHDNFSKLGARQVFVVDSIGGFQGVVYRKRWIDYLKSL 984



>gi|475673036|gb|EMT70159.1| H(+)/Cl(-) exchange transporter 3 [Fusarium oxysporum f. sp.
           cubense race 4]
          Length = 864

 Score =  218 bits (556), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 125/327 (38%), Positives = 195/327 (59%), Gaps = 20/327 (6%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
            LC  + + +    + L +AL+ K    VITFGI+VPAGI++P+++VG   GR++G ++Q
Sbjct: 541 ALCPGAIDEIPPILFELFVALLIKGFLTVITFGIKVPAGIYVPSMVVGGLMGRIVGHMVQ 600

Query: 62  YLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTL 121
           +  +  PD+ I+   C  + +G C+ PGVY ++ A A++ GVTR +V+L VI+FELTG+L
Sbjct: 601 WAVLRVPDWAIWGD-CAFSRDGSCIQPGVYGLIAAGATMCGVTRLSVTLAVILFELTGSL 659

Query: 122 TYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTL-DLCQ 180
            YVLP   AI++SKW AD I  + IYDLL  +  +P+LD+K +       FT  L D+  
Sbjct: 660 DYVLPFSLAILVSKWTADAIEPNSIYDLLTSMNSYPFLDNKHK-----PIFTEDLADIVP 714

Query: 181 --RDLEVIDVNDLNTIG--ELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHAL- 235
             R   +ID+ +   +    L+ KL+ L  +G  D G PIV + ILVG I + +L +AL 
Sbjct: 715 RIRKERIIDITNSPVVPATSLRIKLELLHRAGELDGGLPIVRHGILVGLIPAPDLGYALD 774

Query: 236 SLAHGSDNLTRCYFKDENVIDK------SANFTAYVNQAPLTISKNASLEIVLELFKKLG 289
            L   + NL  C       ID+        +FT Y++ AP+ +   + +++V ELF KLG
Sbjct: 775 QLEDEATNL--CLMDHVPSIDEDEGEHDPTDFTPYIDPAPVALDIRSPMDLVYELFAKLG 832

Query: 290 LRYVIVVDRGQYVGVINKKRLLIYLRQ 316
           LRY+ V+  G+Y G+ +KK  + Y+R+
Sbjct: 833 LRYICVLKDGKYAGMTHKKTFVRYMRE 859



>gi|477521120|gb|ENH73239.1| H(+)/Cl(-) exchange transporter 3 [Fusarium oxysporum f. sp.
           cubense race 1]
          Length = 864

 Score =  218 bits (555), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 125/327 (38%), Positives = 195/327 (59%), Gaps = 20/327 (6%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
            LC  + + +    + L +AL+ K    VITFGI+VPAGI++P+++VG   GR++G ++Q
Sbjct: 541 ALCPGAIDEIPPILFELFVALLIKGFLTVITFGIKVPAGIYVPSMVVGGLMGRIVGHMVQ 600

Query: 62  YLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTL 121
           +  +  PD+ I+   C  + +G C+ PGVY ++ A A++ GVTR +V+L VI+FELTG+L
Sbjct: 601 WAVLRVPDWAIWGD-CAFSRDGSCIQPGVYGLIAAGATMCGVTRLSVTLAVILFELTGSL 659

Query: 122 TYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTL-DLCQ 180
            YVLP   AI++SKW AD I  + IYDLL  +  +P+LD+K +       FT  L D+  
Sbjct: 660 DYVLPFSLAILVSKWTADAIEPNSIYDLLTSMNSYPFLDNKHK-----PIFTEDLADIVP 714

Query: 181 --RDLEVIDVNDLNTIG--ELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHAL- 235
             R   +ID+ +   +    L+ KL+ L  +G  D G PIV + ILVG I + +L +AL 
Sbjct: 715 RIRKERIIDITNSPVVPATSLRIKLELLHRAGELDGGLPIVRHGILVGLIPAPDLGYALD 774

Query: 236 SLAHGSDNLTRCYFKDENVIDK------SANFTAYVNQAPLTISKNASLEIVLELFKKLG 289
            L   + NL  C       ID+        +FT Y++ AP+ +   + +++V ELF KLG
Sbjct: 775 QLEDEATNL--CLMDHVPSIDEDEGEHDPTDFTPYIDPAPVALDIRSPMDLVYELFAKLG 832

Query: 290 LRYVIVVDRGQYVGVINKKRLLIYLRQ 316
           LRY+ V+  G+Y G+ +KK  + Y+R+
Sbjct: 833 LRYICVLKDGKYAGMTHKKTFVRYMRE 859



>gi|512203869|gb|EPE32693.1| Clc chloride channel [Glarea lozoyensis ATCC 20868]
          Length = 868

 Score =  218 bits (555), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 121/334 (36%), Positives = 193/334 (57%), Gaps = 18/334 (5%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC    + +F     L +A   K    VITFGI+VPAGI++P+++VG   GR+ G ++Q
Sbjct: 541 GLCPKDLDDIFPIIRSLAVAFFIKAFLTVITFGIKVPAGIYVPSMVVGGLVGRIFGHLLQ 600

Query: 62  YLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTL 121
           +  + +P  P++           C+ PGVYA+V A +++ GVTR +++L VI+FELTG+L
Sbjct: 601 WTVLRFPTNPVWGNCAAHADGTSCITPGVYALVAAGSTMCGVTRLSITLAVILFELTGSL 660

Query: 122 TYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLC-- 179
            Y+LP   A++++KW AD I    IYDLL +L  +P+L++K +       FT+TL     
Sbjct: 661 DYILPFSLAVLVAKWTADWIEPLSIYDLLTNLNSYPFLNNKHK-----PMFTSTLAEIVP 715

Query: 180 -QRDLEVIDVND--LNTIGELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHALS 236
             R   VID++   L     L+NKL+ L  +G  D G  IV +++LVG I + ELE AL 
Sbjct: 716 RVRRERVIDISSSPLVPASSLRNKLEILHKAGEVDGGLAIVRDEVLVGLIPAPELEFALD 775

Query: 237 LAHGSDNLTRC-------YFKDENVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLG 289
                +  T C       +   ++  D   +FT +++ +PLT+  +A +++V E + KLG
Sbjct: 776 -GLPDEPGTLCLMVKVTSFDDSDDEGDDPTDFTKHIDPSPLTLDIHAPMDLVYECYVKLG 834

Query: 290 LRYVIVVDRGQYVGVINKKRLLIYLRQITGKDMN 323
           LRY+ V   G++ GV +KK  + Y+R++  KD +
Sbjct: 835 LRYICVTREGRFAGVTHKKTFVKYIREMEEKDEH 868



>gi|347442047|emb|CCD34968.1| hypothetical protein BofuT4_P082900.1 [Botryotinia fuckeliana T4]
          Length = 590

 Score =  218 bits (555), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 129/360 (35%), Positives = 204/360 (56%), Gaps = 49/360 (13%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC NS + +F     L +A   K L  +ITFGI+VPAGI++P+++VG   GR++G ++Q
Sbjct: 243 GLCPNSIDEIFPIIGQLTIAFFIKGLLTIITFGIKVPAGIYVPSMVVGGLLGRIVGHLVQ 302

Query: 62  YLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTL 121
           +L +T+P   I+ +         C+ PGVYA++ A +++ GVTR +V+L VI+FELTG+L
Sbjct: 303 WLVLTFPQASIFESCAAHESGTSCITPGVYALIAAGSTMCGVTRLSVTLAVILFELTGSL 362

Query: 122 TYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTL-DLCQ 180
            YVLP   A+++SKW AD +    IYDLL +L  +P+L++K +       FT+ L D+  
Sbjct: 363 DYVLPFSLAVLVSKWTADFMEPLSIYDLLTNLNAYPFLNNKHK-----PIFTSDLADIVP 417

Query: 181 --RDLEVID--VNDLNTIGELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHALS 236
             R   VID  V+ +     L+ KL+ L  +G  D G PI+ + +LVG I + +LE AL 
Sbjct: 418 RVRRERVIDISVSPMIPASSLRQKLELLHQAGEVDGGLPIIRDDVLVGLIPAPDLEFAL- 476

Query: 237 LAHGSDNL-----TRCYF---------KDENVIDKSANFTAYVNQAPLTISKNASLEIVL 282
                DNL     T C           ++E  +D + +FT Y++ AP+ +   + +++V 
Sbjct: 477 -----DNLDNEPGTLCLMATISNYDDSEEEERVDPT-DFTPYIDPAPVALDIRSPMDLVY 530

Query: 283 ELFKKLGLRYVIVVDRGQYVGVI------------------NKKRLLIYLRQITGKDMNN 324
           E F KLGLRYV V+  G+Y G++                  +KK  + Y+R++  +D +N
Sbjct: 531 ECFVKLGLRYVCVLKDGRYAGLVIYPTSTHLPCKRPDHLQTHKKTFVKYMRELEERDGHN 590



>gi|399172332|emb|CCE27017.1| related to CLC chloride channel protein [Claviceps purpurea 20.1]
          Length = 870

 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 122/328 (37%), Positives = 192/328 (58%), Gaps = 19/328 (5%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC  S N +      L +A + K    VITFGI+VPAGI+IP+++VG   GR++G ++Q
Sbjct: 545 GLCPGSVNDIPSILLTLIVAFLIKGFLTVITFGIKVPAGIYIPSMVVGGLLGRIIGHLVQ 604

Query: 62  YLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTL 121
           +  +  PD+ I+   C    +G C+ PGVYA + A A++ GVTR +V+L VI+FELTG+L
Sbjct: 605 WFVLAVPDWAIFGN-CATAADGSCIQPGVYAFIAAGATMCGVTRLSVTLAVILFELTGSL 663

Query: 122 TYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTL-DLCQ 180
            YVLP    I+++KW AD I  + +Y+LL ++  +P+LD+K +       FT+ L D+  
Sbjct: 664 DYVLPFSLTILVAKWTADAIEPNSVYELLTNMNAYPFLDNKHK-----PVFTSDLADIVP 718

Query: 181 RDL--EVIDV--NDLNTIGELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHALS 236
           R     VID+  + L     L++KL+ L  +G  D G PIV N ILVG I + +LE AL 
Sbjct: 719 RTRRERVIDISTSPLVPASSLRSKLELLHRAGELDGGLPIVRNDILVGLIPAPDLEFALD 778

Query: 237 LAHGSDNLTRCYFKD-------ENVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLG 289
               ++    C  +        +       +FT Y++ AP+++   + +++V E F KLG
Sbjct: 779 QLQ-NEQTDLCLMEKVPSIDDDDIEDVDPTDFTPYIDPAPVSLDIRSPMDLVYECFVKLG 837

Query: 290 LRYVIVVDRGQYVGVINKKRLLIYLRQI 317
           LRY+     G++ G+I+KK  + Y+R++
Sbjct: 838 LRYICASQNGRFRGMIHKKTFVKYMREL 865



>gi|358369859|dbj|GAA86472.1| voltage-gated chloride channel [Aspergillus kawachii IFO 4308]
          Length = 912

 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 123/329 (37%), Positives = 194/329 (58%), Gaps = 19/329 (5%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC     G+ E    L +A + K L  V+TFGI+VP GI++P+++VG   GR++G   Q
Sbjct: 587 GLCPPE-EGIGEIIRYLLVAFVIKSLLTVVTFGIKVPCGIYVPSMVVGGLLGRIVGHAAQ 645

Query: 62  YLTMTYPDFPIYSTVCNQNINGD-CVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGT 120
           YL +TYP   ++ + C      + CV PGVYAMV A A++ GVTR +V+L VI+FELTG+
Sbjct: 646 YLVLTYPTSFLFGSSCPATAGMESCVTPGVYAMVAAGATMCGVTRLSVTLAVILFELTGS 705

Query: 121 LTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQ 180
           L +VLP   A++ +KW AD I    IYD+L D+  +P+LDSK +     T+     DL +
Sbjct: 706 LDHVLPFSVAVLCAKWTADAIEPRSIYDMLTDMNSYPFLDSKHQ----PTSDAQLGDLVR 761

Query: 181 --RDLEVIDVNDLNTIG--ELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHAL- 235
             R   +ID++  + +   EL++KL+ L  +G  D G PI+ + +L G I + ELE+AL 
Sbjct: 762 PVRSSRIIDISGSSFVPARELRSKLQNLLMAGELDGGLPILRHGVLTGLIPAPELEYALD 821

Query: 236 SLAHGSDNLTRCYFKDENVIDKSA--------NFTAYVNQAPLTISKNASLEIVLELFKK 287
           +LA   + L        + +  S         +F  Y++ +PL +  ++ +++V + F K
Sbjct: 822 NLADEENTLCLMSLDGSSAVSDSEDEAETGRVDFGQYIDPSPLALDIHSPIDLVYQCFAK 881

Query: 288 LGLRYVIVVDRGQYVGVINKKRLLIYLRQ 316
           LGLRY+ V   GQY G+++KK  + Y+++
Sbjct: 882 LGLRYLCVSHDGQYAGLVHKKAFVKYMKE 910



>gi|308509172|ref|XP_003116769.1| CRE-CLH-5 protein [Caenorhabditis remanei]
 gi|308241683|gb|EFO85635.1| CRE-CLH-5 protein [Caenorhabditis remanei]
          Length = 812

 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 132/339 (38%), Positives = 195/339 (57%), Gaps = 27/339 (7%)

Query: 1   DGLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVM 60
           D LCD +   +  AF  L  ALI KF+  + TFGI+VP G+F+P++ +GA  GR+LGI +
Sbjct: 472 DSLCDQN-KALSIAFGQLLWALIFKFIITIFTFGIKVPCGLFVPSIGMGAIAGRILGITV 530

Query: 61  QYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGT 120
             +  +    P +S      I  DCV+PG+YAMVGAAA L GVTR TVSL VIMFELTG+
Sbjct: 531 DQIFRSVQATPGHSEYFTCQIGKDCVMPGLYAMVGAAAVLGGVTRMTVSLVVIMFELTGS 590

Query: 121 LTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQ 180
           L +++P M A M SKW+ DGI K GIY+  I+L G+P+LDSK EY  +            
Sbjct: 591 LEFIVPTMVATMFSKWIGDGISKMGIYEAHIELNGYPFLDSKGEYPYSTVASQVMRPSIH 650

Query: 181 RDLEVIDVNDLNTIGELKNKLKKLSTSGYSDA------------GFPIV---DNKILVGY 225
           R  +V D   ++ + ELKN+L  ++ SG +              GFP+V   ++  LVG+
Sbjct: 651 R--QVADELSMSDLRELKNELSVITESGMTLGDLEGLLRQTDFNGFPVVVSHNSMHLVGF 708

Query: 226 IASTELEHALSLAHGSDNL----TRCYFKD---ENVIDKSA--NFTAYVNQAPLTISKNA 276
           I   ++  AL  A  +       +  YF D   ++V    A       ++ AP+T++   
Sbjct: 709 ITRRDILLALHTARKTQPYVVTNSIAYFSDAVPDSVPGAPAPLRLRKILDMAPMTVTDQT 768

Query: 277 SLEIVLELFKKLGLRYVIVVDRGQYVGVINKKRLLIYLR 315
            +E V+++F+KLGLR+V+V   G+ +G+I KK +L ++R
Sbjct: 769 PMETVIDMFRKLGLRHVLVTKNGKVLGIITKKDILQFMR 807



>gi|483511842|gb|EOB00532.1| Chloride channel protein 5, partial [Anas platyrhynchos]
          Length = 813

 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 123/331 (37%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L LAL+ K    + TFG++VP+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 490 GVYTAMWQLALALVMKVFITIFTFGMKVPSGLFIPSMAVGAIAGRLLGVAMEQLAFYHHD 549

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+S  C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 550 WVIFSGWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 607

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKW+AD I + GIYD  I L G+P+L++K E+  ++ T    +   +R+   + V 
Sbjct: 608 AAMTSKWMADAIGREGIYDAHIRLNGYPFLEAKEEF--SHKTLAMDVMRPRRNDPPLTVI 665

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + SGY     P+V   +++ LVG++   +L    E+A     G
Sbjct: 666 TQDSMTVEDVETIINETTYSGY-----PVVVSRESQRLVGFVLRRDLIISIENARKKQDG 720

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF D +     +        + ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 721 IVSTSIIYFTDHSPPLPPSFPSMLKLRSILDLSPFTVTDQTPMEIVVDIFRKLGLRQCLV 780

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 781 THNGKLLGIITKKDVLKHIAQLANQDPDSIL 811



>gi|498986256|ref|XP_004530809.1| PREDICTED: H(+)/Cl(-) exchange transporter 3-like isoform X1
           [Ceratitis capitata]
 gi|498986260|ref|XP_004530810.1| PREDICTED: H(+)/Cl(-) exchange transporter 3-like isoform X2
           [Ceratitis capitata]
          Length = 883

 Score =  218 bits (554), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 129/331 (38%), Positives = 201/331 (60%), Gaps = 25/331 (7%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A  LL LA + K    V TFG++VPAG+FIP+LL+G+  GR++GI ++    +YP+
Sbjct: 562 GVYHAIILLLLAFVFKLALAVFTFGMKVPAGLFIPSLLLGSIMGRIVGIGVERFAYSYPN 621

Query: 70  FPIYSTVCNQNINGDCVI-PGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIM 128
             +++  C   +NG  +I PG+YAMVGAAA+L GVTR TVSL VIMFELTG + Y++P+M
Sbjct: 622 IWLFTGEC---VNGKNLITPGLYAMVGAAATLGGVTRMTVSLVVIMFELTGGVGYIVPLM 678

Query: 129 TAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV 188
            A M SKWV D + + GIYD  I L G+P+LDSK E+  A+TT    +   +R+ E ++V
Sbjct: 679 AAAMASKWVGDALGRQGIYDAHIALNGYPFLDSKEEF--AHTTLAADVMQPKRN-ETLNV 735

Query: 189 --NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAH 239
              D  T+ +++  LK+   +GY     P+V   +N+ LVG++   +L    E+A  L  
Sbjct: 736 ITQDSMTVDDIETLLKETEHNGY-----PVVVSKENQYLVGFVLRRDLNLAIENAKRLIE 790

Query: 240 GSDNLTRCYFKD----ENVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
           G    +   F      +N+          ++ AP+T++    +E V+++F+KLGLR  +V
Sbjct: 791 GITGASIVLFTSAAPIQNLGPPPLKLKKILDMAPITVTDQTPMETVVDMFRKLGLRQTLV 850

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +GVI KK +L +++Q+  +D N  L
Sbjct: 851 THNGRLLGVITKKDVLRHVKQMDNEDPNTVL 881



>gi|268532564|ref|XP_002631410.1| C. briggsae CBR-CLH-5 protein [Caenorhabditis briggsae]
          Length = 797

 Score =  218 bits (554), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 132/339 (38%), Positives = 194/339 (57%), Gaps = 27/339 (7%)

Query: 1   DGLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVM 60
           D LCD +   +  AF  L  ALI KF+  + TFGI+VP G+F+P++ +GA  GR+LGI +
Sbjct: 457 DSLCDQN-KALSIAFGQLLWALIFKFIITIFTFGIKVPCGLFVPSIGMGAIAGRILGITV 515

Query: 61  QYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGT 120
             +       P +S      I  DCV+PG+YAMVGAAA L GVTR TVSL VIMFELTG+
Sbjct: 516 DQIFRAVQATPGHSEYFTCQIGKDCVMPGLYAMVGAAAVLGGVTRMTVSLVVIMFELTGS 575

Query: 121 LTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQ 180
           L +++P M A M SKW+ DGI K GIY+  I+L G+P+LDSK EY  +            
Sbjct: 576 LEFIVPTMVATMFSKWIGDGISKMGIYEAHIELNGYPFLDSKGEYPYSTVASQVMRPSIH 635

Query: 181 RDLEVIDVNDLNTIGELKNKLKKLSTSGYSDA------------GFPIV---DNKILVGY 225
           R  +V D   ++ + ELKN+L  ++ SG +              GFP+V   ++  LVG+
Sbjct: 636 R--QVADEMSMSDLRELKNELSVITESGMTLGDLESLLRQTDFNGFPVVVSQNSMHLVGF 693

Query: 226 IASTELEHALSLAHGSDNL----TRCYFKD---ENVIDKSA--NFTAYVNQAPLTISKNA 276
           I   ++  AL  A  +       +  YF D   ++V    A       ++ AP+T++   
Sbjct: 694 ITRRDILLALHTARKTQPYVVTNSIAYFSDGVPDSVPGGPAPLRLRKILDMAPMTVTDQT 753

Query: 277 SLEIVLELFKKLGLRYVIVVDRGQYVGVINKKRLLIYLR 315
            +E V+++F+KLGLR+V+V   G+ +G+I KK +L ++R
Sbjct: 754 PMETVIDMFRKLGLRHVLVTKNGKVLGIITKKDILQFMR 792



>gi|380471617|emb|CCF47191.1| voltage gated chloride channel [Colletotrichum higginsianum]
          Length = 873

 Score =  217 bits (553), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 121/336 (36%), Positives = 195/336 (58%), Gaps = 26/336 (7%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC  + + +      L  A + K    +ITFGI+VPAGI++P+++VG   GR++G V+Q
Sbjct: 546 GLCPTAMDDIPPVLLSLFTAFLIKGFLTIITFGIKVPAGIYVPSMVVGGLMGRLVGHVVQ 605

Query: 62  YLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTL 121
           Y+ + YP F ++   C     G C+ PGVY ++ A +++ GVTR +V+L VI+FELTG+L
Sbjct: 606 YMVLLYPGFGLWGA-CASKETGSCIQPGVYGLIAAGSTMCGVTRLSVTLAVILFELTGSL 664

Query: 122 TYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTL-DLCQ 180
            YVLP   +I+++KW AD I  + IYDLL ++  +P+LD+K +       FT+ L D+  
Sbjct: 665 DYVLPFSLSILVAKWTADAIEPNSIYDLLTNMNSYPFLDNKHK-----PIFTSDLADIVP 719

Query: 181 --RDLEVIDVNDLNTIG--ELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHALS 236
             R    ID++    +    L+ KL+ L  +G  D G PI+ + ILVG I + +LE AL 
Sbjct: 720 RVRRERTIDISASPAVSAVSLRTKLQTLHRAGEIDGGLPIIRDGILVGLIPAPDLEFALD 779

Query: 237 -----------LAHGSDNLTRCYFKDENVIDKSANFTAYVNQAPLTISKNASLEIVLELF 285
                      +AH    +T     D+       +FT Y++ AP+ +   + +++V E F
Sbjct: 780 NLDDEASSMCLMAH----VTSIEDSDDEEEVDKTDFTPYIDPAPVALDIRSPMDLVYECF 835

Query: 286 KKLGLRYVIVVDRGQYVGVINKKRLLIYLRQITGKD 321
            KLGLR+V V+  G+Y G+++KK  + Y+R++  K+
Sbjct: 836 VKLGLRFVCVLKNGRYAGMVHKKSFVRYMRELEEKE 871



>gi|340905339|gb|EGS17707.1| voltage-gated chloride channel-like protein [Chaetomium
           thermophilum var. thermophilum DSM 1495]
          Length = 898

 Score =  217 bits (552), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 119/311 (38%), Positives = 191/311 (61%), Gaps = 19/311 (6%)

Query: 25  KFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPDFPIYSTVCNQNINGD 84
           K L  +ITFGI+VPAGI++P+++VG   GR  G V+Q++ M  P+F ++ T C + + G 
Sbjct: 593 KGLLTIITFGIKVPAGIYVPSMVVGGLMGRFCGHVVQWVVMATPNFGLWGT-CGR-MPGT 650

Query: 85  CVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMTAIMISKWVADGIIKH 144
           C+ PGVY ++ A +++ GVTR +V+L VI+FELTG+L YVLP   AI+++KW AD I   
Sbjct: 651 CIQPGVYGLIAAGSTMCGVTRLSVTLAVILFELTGSLDYVLPFSLAILVAKWTADFIEPL 710

Query: 145 GIYDLLIDLGGHPYLDSKTEYDGANTTFTTTL-DLCQRDL---EVIDVND--LNTIGELK 198
            IYDLL ++  +PYL++K +       FT+ L D+  R +    +ID+ +  L     L+
Sbjct: 711 SIYDLLTEMNSYPYLNNKHK-----PIFTSELADIIPRTIRPHRIIDITNSPLVAAPTLR 765

Query: 199 NKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHALSLAHGSDN------LTRCYFKDE 252
           +KL+ L  +G  D G PIV + ILVG I + +LE+AL      +N        +   +D+
Sbjct: 766 HKLELLHRAGELDGGLPIVRDGILVGLIPAPDLEYALDQLPDEENSLCLMAPVQSIEEDD 825

Query: 253 NVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVVDRGQYVGVINKKRLLI 312
              +   +FT Y++ AP+ +   + +++V E F KLGLRY+ VV  G+Y G+ +KK  + 
Sbjct: 826 EAGEDPTDFTPYIDPAPVALDIRSPMDLVYECFAKLGLRYICVVRDGRYAGMCHKKTFVK 885

Query: 313 YLRQITGKDMN 323
           Y+R++  K+ +
Sbjct: 886 YMREVEEKERH 896



>gi|328772574|gb|EGF82612.1| hypothetical protein BATDEDRAFT_34343 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 862

 Score =  217 bits (552), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 128/308 (41%), Positives = 181/308 (58%), Gaps = 29/308 (9%)

Query: 30  VITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPDFPIYSTVCNQNINGDCVIPG 89
           VITFG+R+PAGIF+P++ +GA  GR LGI +Q      PD  I+++    +   +CV PG
Sbjct: 563 VITFGMRIPAGIFLPSMAIGAYVGRALGIAVQSWQRIMPDLWIFTSCKRASAGAECVTPG 622

Query: 90  VYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTY-----------VLPIMTAIMISKWVA 138
            YAMVGAAASLAGVTR +VSLTVIMFELTG L+Y           VLPIM   +++KWV+
Sbjct: 623 TYAMVGAAASLAGVTRMSVSLTVIMFELTGALSYGRVHFILTHIVVLPIMITALVAKWVS 682

Query: 139 DGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDVNDLNTIGELK 198
           D   KHGIY+ LI L G+P+L+   EY   +TT    L     D+E I     +T+G L+
Sbjct: 683 DIYGKHGIYECLITLNGYPFLNPNEEY--THTTSAANLMTRLEDIETISATG-HTMGSLE 739

Query: 199 NKLKKLSTSGYSDAGFPIVDNK--ILVGYIASTELEHALSLAHGSDNL---TRCYFKDEN 253
             L           GFP+V  +  + +GYI   EL+ A+  A    ++   +   F D  
Sbjct: 740 ELLASTKVK-----GFPVVKPQGSLTIGYIGRAELQFAIEKAKAESDVVGNSLGIFTDML 794

Query: 254 VIDKS---ANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVVDRGQYVGVINKKRL 310
            +D S    +F  +V+  P+ I     +++++ELFKK+GLRYV+V   GQ +G+I KK +
Sbjct: 795 ALDDSLPAIDFRQWVDYTPVKIHPKFPIDMLVELFKKMGLRYVLVTRNGQLLGIITKKDI 854

Query: 311 L--IYLRQ 316
           L  I+LR+
Sbjct: 855 LRDIHLRE 862



>gi|341879113|gb|EGT35048.1| CBN-CLH-5 protein [Caenorhabditis brenneri]
          Length = 797

 Score =  217 bits (552), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 133/339 (39%), Positives = 193/339 (56%), Gaps = 27/339 (7%)

Query: 1   DGLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVM 60
           D LCD +   +  AF  L  ALI KF+  + TFGI+VP G+F+P++ +GA  GR+LGI +
Sbjct: 457 DSLCDQN-KALSIAFGQLLWALIFKFIITIFTFGIKVPCGLFVPSIGMGAIAGRILGITV 515

Query: 61  QYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGT 120
             +       P +S      I  DCV+PG+YAMVGAAA L GVTR TVSL VIMFELTG+
Sbjct: 516 DQIFRAVQATPGHSEYFTCQIGKDCVMPGLYAMVGAAAVLGGVTRMTVSLVVIMFELTGS 575

Query: 121 LTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQ 180
           L +++P M A M SKW+ DGI K GIY+  I+L G+P+LDSK EY  +            
Sbjct: 576 LEFIVPTMVATMFSKWIGDGISKMGIYEAHIELNGYPFLDSKGEYPYSTVASQVMRPSIH 635

Query: 181 RDLEVIDVNDLNTIGELKNKLKKLSTSGYSDA------------GFPIV---DNKILVGY 225
           R  +V D   ++ + ELKN+L  ++ SG S              GFP+V   ++  LVG+
Sbjct: 636 R--QVADEMSMSDLRELKNELSVITESGMSLGDLESLLRQTDFNGFPVVVSQNSMHLVGF 693

Query: 226 IASTELEHALSLAHGSDNL----TRCYFKD---ENVIDKSA--NFTAYVNQAPLTISKNA 276
           I   ++  AL  A  +       +  YF D   ++V    A       ++ AP+T++   
Sbjct: 694 ITRRDILLALHTARKTQPYVVTNSIAYFSDGVPDSVPGGPAPLRLRKILDMAPMTVTDQT 753

Query: 277 SLEIVLELFKKLGLRYVIVVDRGQYVGVINKKRLLIYLR 315
            +E V+++F+KLGLR V+V   G+ +G+I KK +L ++R
Sbjct: 754 PMETVIDMFRKLGLRQVLVTKNGKVLGIITKKDILQFMR 792



>gi|302654189|ref|XP_003018904.1| hypothetical protein TRV_07072 [Trichophyton verrucosum HKI 0517]
 gi|291182590|gb|EFE38259.1| hypothetical protein TRV_07072 [Trichophyton verrucosum HKI 0517]
          Length = 898

 Score =  216 bits (551), Expect = 5e-54,   Method: Compositional matrix adjust.
 Identities = 117/310 (37%), Positives = 191/310 (61%), Gaps = 12/310 (3%)

Query: 16  YLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPDFPIYST 75
           YLL   +I  FLT  ITFGI+VPAGI++P+++VG   GR++G V QY  + YP+F ++  
Sbjct: 583 YLLVAFIIKSFLT-TITFGIKVPAGIYVPSMVVGGLMGRIVGHVAQYFVVHYPNFFLFGQ 641

Query: 76  VCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMTAIMISK 135
             +  +   CV PGVYA++ A +++ GVTR +++L VI+FELTG+L +VLP   AI+ +K
Sbjct: 642 CPSTKLAESCVNPGVYALIAAGSTMCGVTRLSLTLVVILFELTGSLDHVLPFSLAILCAK 701

Query: 136 WVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDVND--LNT 193
           WV++ +    IYDLL D+  +P+LD+K  +  AN      +   +++  VID++   L +
Sbjct: 702 WVSNAVEPLSIYDLLTDMNSYPFLDNKL-HPIANIELGDIVPRVRKN-RVIDISSSPLVS 759

Query: 194 IGELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHALSLAHGSDNLTRC------ 247
             EL+ KL KL  +G  D G PI++  ILVG I + ELE+AL      +  T C      
Sbjct: 760 ATELREKLDKLLMAGELDGGLPILNKNILVGLIPAPELEYALDKLPSEEQDTMCLMSMQS 819

Query: 248 -YFKDENVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVVDRGQYVGVIN 306
            Y  +       A+FT +++ +P+++  ++ + +V + F KLGLRY+ V+  GQY G+++
Sbjct: 820 SYLGEGENDTNVADFTPFIDPSPVSLDIHSPINLVYQCFVKLGLRYMCVLRDGQYAGLVH 879

Query: 307 KKRLLIYLRQ 316
           KK  + ++++
Sbjct: 880 KKSFVKFMKE 889



>gi|17532615|ref|NP_495940.1| Protein CLH-5 [Caenorhabditis elegans]
 gi|6464026|dbj|BAA86959.1| clc chloride channel homologue [Caenorhabditis elegans]
 gi|14530332|emb|CAA92728.2| Protein CLH-5 [Caenorhabditis elegans]
          Length = 797

 Score =  216 bits (551), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 133/340 (39%), Positives = 193/340 (56%), Gaps = 29/340 (8%)

Query: 1   DGLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVM 60
           D LCD +   +  AF  L  ALI KF+  + TFGI+VP G+F+P++ +GA  GR+LGI +
Sbjct: 457 DSLCDQN-KALSIAFGQLLWALIFKFVITIFTFGIKVPCGLFVPSIGMGAIAGRILGITV 515

Query: 61  QYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGT 120
             +       P +S      I  DCV+PG+YAMVGAAA L GVTR TVSL VIMFELTG+
Sbjct: 516 DQIFRAVQATPGHSDYFTCQIGKDCVMPGLYAMVGAAAVLGGVTRMTVSLVVIMFELTGS 575

Query: 121 LTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQ 180
           L +++P M A M SKW+ DGI K GIY+  I+L G+P+LDSK EY  +            
Sbjct: 576 LEFIVPTMVATMFSKWIGDGISKMGIYEAHIELNGYPFLDSKGEYPYSTVASQVMRPSIH 635

Query: 181 RDLEVIDVNDLNTIGELKNKLKKLSTSGYSDA------------GFPIV---DNKILVGY 225
           R  +V D   ++ + ELKN+L  ++ SG +              GFP+V   ++  LVG+
Sbjct: 636 R--QVADEMSMSDLRELKNELSVITESGMTLGDLESLLRQTDFNGFPVVVSQNSMHLVGF 693

Query: 226 IASTELEHALSLAHGSDNL----TRCYFKDENVIDKSANFTA------YVNQAPLTISKN 275
           I   ++  AL  A  +       +  YF D  V D      A       ++ AP+T++  
Sbjct: 694 ITRRDILLALHTARKTQPYVVTNSIAYFSD-GVPDAMPGGPAPLRLRKILDMAPMTVTDQ 752

Query: 276 ASLEIVLELFKKLGLRYVIVVDRGQYVGVINKKRLLIYLR 315
             +E V+++F+KLGLR+V+V   G+ +G+I KK +L ++R
Sbjct: 753 TPMETVIDMFRKLGLRHVLVTKNGKVLGIITKKDILQFMR 792



>gi|116191871|ref|XP_001221748.1| hypothetical protein CHGG_05653 [Chaetomium globosum CBS 148.51]
 gi|88181566|gb|EAQ89034.1| hypothetical protein CHGG_05653 [Chaetomium globosum CBS 148.51]
          Length = 781

 Score =  216 bits (550), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 128/338 (37%), Positives = 198/338 (58%), Gaps = 31/338 (9%)

Query: 2   GLCDNSFNGMFEAFY-LLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVM 60
           GLC      +      LL   LI  FLT +ITFGI++PAGI++P+++VG   GR++G V+
Sbjct: 454 GLCPEEIGDIPPILLNLLTAFLIKGFLT-IITFGIKLPAGIYVPSMVVGGLMGRLVGHVV 512

Query: 61  QYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGT 120
           Q++ M  PD+ ++ T C +  N  C+ PGVY ++ A +++ GVTR +V+L VI+FELTG+
Sbjct: 513 QWVVMATPDWGVWGT-CAKMPNATCIQPGVYGLIAAGSTMCGVTRLSVTLAVILFELTGS 571

Query: 121 LTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTL-DLC 179
           L YVLP   AI+++KW AD I    IYDLL ++  +PYL++K +       FT+ L D+ 
Sbjct: 572 LDYVLPFSLAILVAKWTADAIEPLSIYDLLTEMNSYPYLNNKHK-----PIFTSDLADIV 626

Query: 180 Q--RDLEVIDVNDLNTIG--ELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHAL 235
              R   +ID+     +    L+ KL+ L  +G  D G PIV + ILVG I + +LE+AL
Sbjct: 627 PRVRKERIIDITTSPVVPALSLRAKLELLHKAGELDGGLPIVRDGILVGLIPAPDLEYAL 686

Query: 236 SLAHGSDNL-----TRCYFKDENVIDKS-------ANFTAYVNQAPLTISKNASLEIVLE 283
                 DNL     + C       ID S        +FT +++ AP+ +   + +++V E
Sbjct: 687 ------DNLRDEPSSLCLMAPVPSIDDSDDGLPDPTDFTPFIDPAPVALDIRSPMDLVYE 740

Query: 284 LFKKLGLRYVIVVDRGQYVGVINKKRLLIYLRQITGKD 321
            F KLGLRY+ V+  G+Y G+ +KK  + Y+R++  K+
Sbjct: 741 CFVKLGLRYICVLRDGRYAGMTHKKTFVKYMRELEEKE 778



>gi|326469607|gb|EGD93616.1| voltage-gated chloride channel [Trichophyton tonsurans CBS 112818]
 gi|326478866|gb|EGE02876.1| voltage-gated chloride channel protein [Trichophyton equinum CBS
           127.97]
          Length = 915

 Score =  216 bits (550), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 119/314 (37%), Positives = 192/314 (61%), Gaps = 20/314 (6%)

Query: 16  YLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPDFPIYST 75
           YLL   +I  FLT  ITFGI+VPAGI++P+++VG   GR++G V QY  + YP+F ++  
Sbjct: 600 YLLVAFIIKSFLT-TITFGIKVPAGIYVPSMVVGGLMGRIVGHVAQYFVVHYPNFFLFGQ 658

Query: 76  VCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMTAIMISK 135
             +  +   CV PGVYA++ A +++ GVTR +++L VI+FELTG+L +VLP   AI+ +K
Sbjct: 659 CPSTKLAESCVNPGVYALIAAGSTMCGVTRLSLTLVVILFELTGSLDHVLPFSLAILCAK 718

Query: 136 WVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDVND--LNT 193
           WV++ +    IYDLL D+  +P+LD+K  +  AN      +   +++  VID+++  L +
Sbjct: 719 WVSNAVEPLSIYDLLTDMNSYPFLDNKL-HPIANIELGDIVPRVRKN-RVIDISNSPLVS 776

Query: 194 IGELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHALSLAHGSDNLTRCYFK--- 250
             EL+ KL KL  +G  D G PI++  ILVG I + ELE+AL      +  T C      
Sbjct: 777 ATELREKLDKLLMAGELDGGLPILNKNILVGLIPAPELEYALDKLPSEEQDTMCLMSMQS 836

Query: 251 --------DENVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVVDRGQYV 302
                   D NV D    FT +++ +P+++  ++ + +V + F KLGLRY+ V+  GQY 
Sbjct: 837 SYLGEGENDMNVTD----FTPFIDPSPVSLDIHSPINLVYQCFVKLGLRYMCVLRDGQYA 892

Query: 303 GVINKKRLLIYLRQ 316
           G+++KK  + ++++
Sbjct: 893 GLVHKKSFVKFMKE 906



>gi|327303448|ref|XP_003236416.1| voltage gated chloride channel [Trichophyton rubrum CBS 118892]
 gi|326461758|gb|EGD87211.1| voltage gated chloride channel [Trichophyton rubrum CBS 118892]
          Length = 916

 Score =  216 bits (550), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 117/310 (37%), Positives = 191/310 (61%), Gaps = 12/310 (3%)

Query: 16  YLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPDFPIYST 75
           YLL   +I  FLT  ITFGI+VPAGI++P+++VG   GR++G V QY  + YP+F ++  
Sbjct: 601 YLLVAFIIKSFLT-TITFGIKVPAGIYVPSMVVGGLMGRIVGHVAQYFVVHYPNFFLFGQ 659

Query: 76  VCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMTAIMISK 135
             +  +   CV PGVYA++ A +++ GVTR +++L VI+FELTG+L +VLP   AI+ +K
Sbjct: 660 CPSTKLAESCVNPGVYALIAAGSTMCGVTRLSLTLVVILFELTGSLDHVLPFSLAILCAK 719

Query: 136 WVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDVND--LNT 193
           WV++ +    IYDLL D+  +P+LD+K  +  AN      +   +++  VID++   L +
Sbjct: 720 WVSNAVEPLSIYDLLTDMNSYPFLDNKL-HPIANIELGDIVPRVRKN-RVIDISSSPLVS 777

Query: 194 IGELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHALSLAHGSDNLTRC------ 247
             EL+ KL KL  +G  D G PI++  ILVG I + ELE+AL      +  T C      
Sbjct: 778 AMELREKLDKLLMAGELDGGLPILNKNILVGLIPAPELEYALDKLPSEEQDTMCLMSMQS 837

Query: 248 -YFKDENVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVVDRGQYVGVIN 306
            Y  +       A+FT +++ +P+++  ++ + +V + F KLGLRY+ V+  GQY G+++
Sbjct: 838 PYLGEGENDTNVADFTPFIDPSPVSLDIHSPINLVYQCFVKLGLRYMCVLRDGQYAGLVH 897

Query: 307 KKRLLIYLRQ 316
           KK  + ++++
Sbjct: 898 KKSFVKFMKE 907



>gi|513021584|ref|XP_004872064.1| PREDICTED: H(+)/Cl(-) exchange transporter 5-like isoform X1
           [Heterocephalus glaber]
 gi|513021586|ref|XP_004872065.1| PREDICTED: H(+)/Cl(-) exchange transporter 5-like isoform X2
           [Heterocephalus glaber]
          Length = 816

 Score =  216 bits (549), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 122/331 (36%), Positives = 201/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L LALI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 493 GVYSAMWQLALALILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 552

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 553 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 610

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 611 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 668

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 669 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 723

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 724 VVSTSIIYFTEHSPPVPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 783

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 784 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 814



>gi|350636876|gb|EHA25234.1| hypothetical protein ASPNIDRAFT_211598 [Aspergillus niger ATCC
           1015]
          Length = 913

 Score =  216 bits (549), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 122/329 (37%), Positives = 193/329 (58%), Gaps = 19/329 (5%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC     G+ E    L +A + K L  V+TFGI+VP GI++P+++VG   GR++G   Q
Sbjct: 588 GLCPPE-EGIGEIIRYLLVAFVIKSLLTVVTFGIKVPCGIYVPSMVVGGLLGRIVGHAAQ 646

Query: 62  YLTMTYPDFPIYSTVCNQNINGD-CVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGT 120
           YL + YP   ++ + C      + CV PGVYAMV A A++ GVTR +V+L VI+FELTG+
Sbjct: 647 YLVLKYPTSFLFGSSCPATAGMESCVTPGVYAMVAAGATMCGVTRLSVTLAVILFELTGS 706

Query: 121 LTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQ 180
           L +VLP   A++ +KW AD I    IYD+L D+  +P+LDSK +     T+     DL +
Sbjct: 707 LDHVLPFSVAVLCAKWTADAIEPRSIYDMLTDMNSYPFLDSKHQ----PTSDAQLGDLVR 762

Query: 181 --RDLEVIDVNDLNTIG--ELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHAL- 235
             R   +ID++  + +   EL++KL+ L  +G  D G PI+ + +L G I + ELE+AL 
Sbjct: 763 PVRSSRIIDISGSSFVPARELRSKLQNLLMAGELDGGLPILRHGVLTGLIPAPELEYALD 822

Query: 236 SLAHGSDNLTRCYFKDENVIDKSA--------NFTAYVNQAPLTISKNASLEIVLELFKK 287
           +LA   + L        + +  S         +F  Y++ +PL +  ++ +++V + F K
Sbjct: 823 NLADEENTLCLMSLDGSSAVSDSEDEAETGRVDFGQYIDPSPLALDIHSPIDLVYQCFAK 882

Query: 288 LGLRYVIVVDRGQYVGVINKKRLLIYLRQ 316
           LGLRY+ V   GQY G+++KK  + Y+++
Sbjct: 883 LGLRYLCVSHDGQYAGLVHKKAFVKYMKE 911



>gi|317033366|ref|XP_001395529.2| voltage-gated chloride channel (ClcA) [Aspergillus niger CBS
           513.88]
          Length = 913

 Score =  216 bits (549), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 122/329 (37%), Positives = 193/329 (58%), Gaps = 19/329 (5%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC     G+ E    L +A + K L  V+TFGI+VP GI++P+++VG   GR++G   Q
Sbjct: 588 GLCPPE-EGIGEIIRYLLVAFVIKSLLTVVTFGIKVPCGIYVPSMVVGGLLGRIVGHAAQ 646

Query: 62  YLTMTYPDFPIYSTVCNQNINGD-CVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGT 120
           YL + YP   ++ + C      + CV PGVYAMV A A++ GVTR +V+L VI+FELTG+
Sbjct: 647 YLVLKYPTSFLFGSSCPATAGMESCVTPGVYAMVAAGATMCGVTRLSVTLAVILFELTGS 706

Query: 121 LTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQ 180
           L +VLP   A++ +KW AD I    IYD+L D+  +P+LDSK +     T+     DL +
Sbjct: 707 LDHVLPFSVAVLCAKWTADAIEPRSIYDMLTDMNSYPFLDSKHQ----PTSDAQLGDLVR 762

Query: 181 --RDLEVIDVNDLNTIG--ELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHAL- 235
             R   +ID++  + +   EL++KL+ L  +G  D G PI+ + +L G I + ELE+AL 
Sbjct: 763 PVRSSRIIDISGSSFVPARELRSKLQNLLMAGELDGGLPILRHGVLTGLIPAPELEYALD 822

Query: 236 SLAHGSDNLTRCYFKDENVIDKSA--------NFTAYVNQAPLTISKNASLEIVLELFKK 287
           +LA   + L        + +  S         +F  Y++ +PL +  ++ +++V + F K
Sbjct: 823 NLADEENTLCLMSLDGSSAVSDSEDEAETGRVDFGQYIDPSPLALDIHSPIDLVYQCFAK 882

Query: 288 LGLRYVIVVDRGQYVGVINKKRLLIYLRQ 316
           LGLRY+ V   GQY G+++KK  + Y+++
Sbjct: 883 LGLRYLCVSHDGQYAGLVHKKAFVKYMKE 911



>gi|451850601|gb|EMD63903.1| hypothetical protein COCSADRAFT_27210 [Bipolaris sorokiniana
           ND90Pr]
          Length = 923

 Score =  215 bits (548), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 124/343 (36%), Positives = 198/343 (57%), Gaps = 26/343 (7%)

Query: 1   DGLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVM 60
           DGLC  +   +     LL +A + K    V+TFGI+VPAGI++P+++VG   GR +G  +
Sbjct: 585 DGLCP-TVEHIPGVLKLLFIAFLIKASLTVVTFGIKVPAGIYVPSMVVGGLAGRFIGHTV 643

Query: 61  QYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGT 120
           Q + + +    I+S        G CV+PGVYA+V A A++ GVTR +++L VI+FELTG+
Sbjct: 644 QLVALRFSHLGIFSECSPDGPPGSCVVPGVYALVAAGATMTGVTRLSITLAVILFELTGS 703

Query: 121 LTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTL-DLC 179
           L +VLP    I++SKWVAD I    IYDLL D+  +P+LD+K         FT+ L D+ 
Sbjct: 704 LDHVLPFSLGILVSKWVADAIEPLSIYDLLTDMNSYPFLDNKV-----RPIFTSELGDIT 758

Query: 180 --QRDLEVIDVNDLNTIG--ELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHAL 235
              ++  VID+++ + I   EL+ K + L  +G  D G  IV N ILVG I + +LE AL
Sbjct: 759 PGSKNDHVIDISEDSLIPAVELRAKQRALQMAGELDGGLSIVKNGILVGLIPAPDLEFAL 818

Query: 236 SLAHGSDNLTRC--------------YFKDENVIDKSANFTAYVNQAPLTISKNASLEIV 281
                 +N T C              + ++E      ++FT Y++ AP+ +  ++ +++V
Sbjct: 819 DKLENEEN-TLCLMSPRVDWAAGREHHDEEEQEAYDPSDFTPYIDPAPVALDVHSPMDLV 877

Query: 282 LELFKKLGLRYVIVVDRGQYVGVINKKRLLIYLRQITGKDMNN 324
            E F KLGLRY+ V+  G+Y G+++KK  + Y++++  ++   
Sbjct: 878 YECFVKLGLRYICVLRDGKYAGLVHKKTFVKYVKELEEREKKQ 920



>gi|452000640|gb|EMD93101.1| hypothetical protein COCHEDRAFT_1172960 [Bipolaris maydis C5]
 gi|477583204|gb|ENI00305.1| hypothetical protein COCC4DRAFT_75906 [Bipolaris maydis ATCC 48331]
          Length = 923

 Score =  215 bits (548), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 123/343 (35%), Positives = 198/343 (57%), Gaps = 26/343 (7%)

Query: 1   DGLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVM 60
           DGLC  +   +     LL +A + K    V+TFGI+VPAGI++P+++VG   GR +G  +
Sbjct: 585 DGLCP-TVEHIPGVLKLLFIAFLIKATLTVVTFGIKVPAGIYVPSMVVGGLAGRFIGHTV 643

Query: 61  QYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGT 120
           Q + + +    I+S        G CV+PGVYA+V A A++ GVTR +++L VI+FELTG+
Sbjct: 644 QLVALRFSHLGIFSECSPDGPPGSCVVPGVYALVAAGATMTGVTRLSITLAVILFELTGS 703

Query: 121 LTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTL-DLC 179
           L +VLP    I++SKWVAD I    IYDLL D+  +P+LD+K         FT+ L D+ 
Sbjct: 704 LDHVLPFSLGILVSKWVADAIEPLSIYDLLTDMNSYPFLDNKV-----RPIFTSELGDIT 758

Query: 180 --QRDLEVIDVNDLNTIG--ELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHAL 235
              ++  VID+++ + I   EL+ K + L  +G  D G  +V N ILVG I + +LE AL
Sbjct: 759 PGSKNDHVIDISEDSLIPAVELRAKQRALQMAGELDGGLSVVKNGILVGLIPAPDLEFAL 818

Query: 236 SLAHGSDNLTRC--------------YFKDENVIDKSANFTAYVNQAPLTISKNASLEIV 281
                 +N T C              + ++E      ++FT Y++ AP+ +  ++ +++V
Sbjct: 819 DKLENEEN-TLCLMSPRVDWAAGREPHDEEEQEAYDPSDFTPYIDPAPVALDVHSPMDLV 877

Query: 282 LELFKKLGLRYVIVVDRGQYVGVINKKRLLIYLRQITGKDMNN 324
            E F KLGLRY+ V+  G+Y G+++KK  + Y++++  ++   
Sbjct: 878 YECFVKLGLRYICVLRDGKYAGLVHKKTFVKYVKELEEREKKQ 920



>gi|432110168|gb|ELK33945.1| H(+)/Cl(-) exchange transporter 5 [Myotis davidii]
          Length = 809

 Score =  215 bits (548), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 201/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L LALI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ +   + D
Sbjct: 486 GVYSAMWQLALALIMKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQMAYYHHD 545

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 546 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 603

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 604 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 661

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 662 TQDSMTVEDVETVISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 716

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 717 VVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 776

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 777 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 807



>gi|296812691|ref|XP_002846683.1| chloride channel protein 3 [Arthroderma otae CBS 113480]
 gi|238841939|gb|EEQ31601.1| chloride channel protein 3 [Arthroderma otae CBS 113480]
          Length = 906

 Score =  215 bits (547), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 118/310 (38%), Positives = 192/310 (61%), Gaps = 12/310 (3%)

Query: 16  YLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPDFPIYST 75
           YLL   +I  FLT  ITFGI+VPAGI++P+++VG   GR++G V QY  + YP+F ++  
Sbjct: 591 YLLIAFIIKSFLT-TITFGIKVPAGIYVPSMVVGGLMGRIVGHVAQYFVVHYPNFFLFGQ 649

Query: 76  VCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMTAIMISK 135
             +  I   CV PGVYA++ A +++ GVTR +++L VI+FELTG+L +VLP   AI+ +K
Sbjct: 650 CPSTKIAESCVNPGVYALIAAGSTMCGVTRLSLTLVVILFELTGSLDHVLPFSLAILCAK 709

Query: 136 WVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDVND--LNT 193
           WV++ +    IYDLL D+  +P+LD+K  +  AN      +   +R+  VID+++  L +
Sbjct: 710 WVSNAVEPLSIYDLLTDMNSYPFLDNKL-HPIANIELGDIVPRVRRN-RVIDISNSPLVS 767

Query: 194 IGELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHAL-SLAHGSDNLTRCYFKDE 252
             EL+ KL  L  +G  D G PI+   ILVG I + ELE+AL  L    D +     +  
Sbjct: 768 ATELREKLDILLMAGELDGGLPILKKNILVGLIPAPELEYALDKLPSEQDTMCLMSMQSS 827

Query: 253 NVIDKS------ANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVVDRGQYVGVIN 306
            + ++       A+FT Y++ +P+++  ++ + +V + F KLGLRY+ V+  GQY G+++
Sbjct: 828 YLTERENDEMDVADFTQYIDPSPVSLDIHSPINLVYQCFVKLGLRYMCVLRDGQYAGLVH 887

Query: 307 KKRLLIYLRQ 316
           KK  + ++++
Sbjct: 888 KKSFVKFMKE 897



>gi|513021590|ref|XP_004872067.1| PREDICTED: H(+)/Cl(-) exchange transporter 5-like isoform X4
           [Heterocephalus glaber]
          Length = 746

 Score =  215 bits (547), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 122/331 (36%), Positives = 201/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L LALI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 423 GVYSAMWQLALALILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 482

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 483 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 540

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 541 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 598

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 599 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 653

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 654 VVSTSIIYFTEHSPPVPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 713

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 714 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 744



>gi|513021588|ref|XP_004872066.1| PREDICTED: H(+)/Cl(-) exchange transporter 5-like isoform X3
           [Heterocephalus glaber]
          Length = 784

 Score =  215 bits (547), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 122/331 (36%), Positives = 201/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L LALI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 461 GVYSAMWQLALALILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 520

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 521 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 578

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 579 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 636

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 637 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 691

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 692 VVSTSIIYFTEHSPPVPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 751

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 752 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 782



>gi|307199100|gb|EFN79810.1| Chloride channel protein 3 [Harpegnathos saltator]
          Length = 833

 Score =  215 bits (547), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 132/330 (40%), Positives = 204/330 (61%), Gaps = 23/330 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G+++A +LL LALI K +  + TFG++VP G+FIP+L +GA  GR++GI M+ L   YP 
Sbjct: 512 GVYKAIWLLVLALILKLIMTIFTFGMKVPCGLFIPSLCLGAIMGRIVGIGMEQLAYNYPH 571

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
             ++S  C+  +  DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG + Y++P+M 
Sbjct: 572 IWMFSEECSTGV--DCITPGLYAMVGAAAVLGGVTRMTVSLVVIMFELTGGVRYIVPLMA 629

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWV D + K GIYD  I L G+P+LDSK E+   +TT    +   +R+ E + V 
Sbjct: 630 AAMASKWVGDALGKQGIYDAHIGLNGYPFLDSKDEFQ--HTTLAADVMQPKRN-EALHVL 686

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTELEHALSLAHGS-DN 243
             D  T+ +++N LK+   +     GFP++   +++ LVG++   +L  A++ A    + 
Sbjct: 687 TQDSMTVEDVENLLKETEHN-----GFPVIVSKESQYLVGFVLRRDLNLAIANAKRMIEE 741

Query: 244 LTR---CYFKDENVIDKSA----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVV 296
           +TR     F + N I   +         ++ AP+TI+    +E V+++F+KLGLR  +V 
Sbjct: 742 ITRQSLVIFTNGNNIQSHSPPPLKLKKILDMAPITITDQTPMETVVDMFRKLGLRQTLVT 801

Query: 297 DRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
             G+ +GVI KK +L +++Q+  +D N+ L
Sbjct: 802 HNGRLLGVITKKDVLRHVKQLDNEDPNSVL 831



>gi|507969644|ref|XP_004690100.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform X4 [Condylura
           cristata]
          Length = 718

 Score =  215 bits (547), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 122/330 (36%), Positives = 200/330 (60%), Gaps = 22/330 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 396 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 455

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 456 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 513

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRD-LEVIDV 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+ L  +  
Sbjct: 514 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNALLTVLT 571

Query: 189 NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHGS 241
            D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G 
Sbjct: 572 QDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGV 626

Query: 242 DNLTRCYFKDENVIDKSANFTAY-----VNQAPLTISKNASLEIVLELFKKLGLRYVIVV 296
            + +  YF + +         A      ++ +P T++    +EIV+++F+KLGLR  +V 
Sbjct: 627 VSTSIIYFTEHSPPMPPYTPPALKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLVT 686

Query: 297 DRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
             G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 687 HNGRLLGIITKKDVLKHIAQMANQDPDSIL 716



>gi|507969635|ref|XP_004690097.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform X1 [Condylura
           cristata]
 gi|507969638|ref|XP_004690098.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform X2 [Condylura
           cristata]
          Length = 745

 Score =  215 bits (547), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 122/330 (36%), Positives = 200/330 (60%), Gaps = 22/330 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 423 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 482

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 483 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 540

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRD-LEVIDV 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+ L  +  
Sbjct: 541 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNALLTVLT 598

Query: 189 NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHGS 241
            D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G 
Sbjct: 599 QDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGV 653

Query: 242 DNLTRCYFKDENVIDKSANFTAY-----VNQAPLTISKNASLEIVLELFKKLGLRYVIVV 296
            + +  YF + +         A      ++ +P T++    +EIV+++F+KLGLR  +V 
Sbjct: 654 VSTSIIYFTEHSPPMPPYTPPALKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLVT 713

Query: 297 DRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
             G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 714 HNGRLLGIITKKDVLKHIAQMANQDPDSIL 743



>gi|505755412|gb|EOQ99629.1| H(+)/Cl(-) exchange transporter 5 [Wallemia ichthyophaga EXF-994]
          Length = 2310

 Score =  215 bits (547), Expect = 2e-53,   Method: Composition-based stats.
 Identities = 132/331 (39%), Positives = 190/331 (57%), Gaps = 42/331 (12%)

Query: 3    LCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQY 62
            LC       +     + LA+I K +  V+TFG+++PAGIFIP L VGACFGRM+G+V++Y
Sbjct: 1887 LCAKEGQAPWSILKTISLAMIIKGVLTVVTFGMKLPAGIFIPTLAVGACFGRMVGLVVEY 1946

Query: 63   LTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLT 122
             +   PD  I++    Q     C++  +YA++GAA++L+GVTR T+SL VI+ ELTGTL 
Sbjct: 1947 WSKVMPDLAIFNQCVGQE---KCMLTAIYALIGAASALSGVTRMTISLVVIVCELTGTLN 2003

Query: 123  YVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRD 182
            Y +P M +I+I+K +AD I + GIYD LID+   PYLD+K EY     + T   D+  + 
Sbjct: 2004 YAVPSMLSILIAKTLADTIEQKGIYDQLIDMNRLPYLDAKHEYKFGKDSVT---DVATKK 2060

Query: 183  LEVIDVNDLNTIGELKNKLKKLSTSGYSDAGFPIV--DNKI--LVGYIASTELEHAL-SL 237
            + VI ++  +++  L +KL  L   G SD+GFP++  D  +  LVGYIA+ ELEHAL SL
Sbjct: 2061 IPVIRIDVEHSVCTLLDKLDTLVLKGLSDSGFPLIIEDEGVVRLVGYIAANELEHALDSL 2120

Query: 238  AHG--------------SDNLTRCYFKDEN-----------VIDK---SAN---FTAYVN 266
            +H               +  LT+   K  N           V D    SAN    +AY +
Sbjct: 2121 SHNPTAGVRFAQFDTLQNSILTQSTSKSNNNRNPPKRFSTVVCDGAPLSANPYDLSAYCD 2180

Query: 267  QAPLTISKNASLEIVLELFKKLGLRYVIVVD 297
             +PL +   A + +V + F KLG R V VVD
Sbjct: 2181 LSPLVVRPEAPMALVHDNFSKLGARQVFVVD 2211



>gi|315050608|ref|XP_003174678.1| hypothetical protein MGYG_02209 [Arthroderma gypseum CBS 118893]
 gi|311339993|gb|EFQ99195.1| hypothetical protein MGYG_02209 [Arthroderma gypseum CBS 118893]
          Length = 919

 Score =  215 bits (547), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 121/325 (37%), Positives = 200/325 (61%), Gaps = 13/325 (4%)

Query: 1   DGLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVM 60
           +GLC    +      YL+   +I  FLT  ITFGI+VPAGI++P+++VG   GR++G V 
Sbjct: 590 NGLCPKREDIPDVIKYLVVAFIIKSFLT-TITFGIKVPAGIYVPSMVVGGLMGRIVGHVA 648

Query: 61  QYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGT 120
           QY  + YP+F ++    +  +   CV PGVYA++ A +++ GVTR +++L VI+FELTG+
Sbjct: 649 QYFVVHYPNFFLFGQCPSTKLAESCVNPGVYALIAAGSTMCGVTRLSLTLVVILFELTGS 708

Query: 121 LTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQ 180
           L +VLP   AI+ +KWV++ +    IYDLL D+  +P+LD+K  +  AN      +   +
Sbjct: 709 LDHVLPFSLAILCAKWVSNAVEPLSIYDLLTDMNSYPFLDNKL-HPIANIELGDIVPRVR 767

Query: 181 RDLEVIDVND--LNTIGELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHALSLA 238
           R+  VID+++  L    EL+ KL KL  +G  D G PI++  ILVG I + ELE+AL   
Sbjct: 768 RN-RVIDISNSPLVRATELREKLDKLLMAGELDGGLPILNKNILVGLIPAPELEYALDKL 826

Query: 239 HGSDN------LTRCYFKD-ENVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLR 291
              ++      +   Y  D EN +D + +FT +++ +P+++  ++ + +V + F KLGLR
Sbjct: 827 DSEEDTMCLMSMQSSYLGDGENDMDVT-DFTPFIDPSPVSLDIHSPINLVYQCFVKLGLR 885

Query: 292 YVIVVDRGQYVGVINKKRLLIYLRQ 316
           Y+ V+  GQY G+++KK  + ++++
Sbjct: 886 YMCVLRDGQYAGLVHKKSFVKFMKE 910



>gi|507969641|ref|XP_004690099.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform X3 [Condylura
           cristata]
          Length = 808

 Score =  215 bits (547), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 125/336 (37%), Positives = 200/336 (59%), Gaps = 34/336 (10%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 486 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 545

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 546 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 603

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDL------ 183
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+       
Sbjct: 604 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNALLTVLT 661

Query: 184 -EVIDVNDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHAL 235
            + + V D+ TI         +S + YS  GFP+V   +++ LVG++   +L    E+A 
Sbjct: 662 QDSMTVEDVETI---------ISETTYS--GFPVVVSRESQRLVGFVLRRDLIISIENAR 710

Query: 236 SLAHGSDNLTRCYFKDENVIDKSANFTAY-----VNQAPLTISKNASLEIVLELFKKLGL 290
               G  + +  YF + +         A      ++ +P T++    +EIV+++F+KLGL
Sbjct: 711 KKQDGVVSTSIIYFTEHSPPMPPYTPPALKLRNILDLSPFTVTDLTPMEIVVDIFRKLGL 770

Query: 291 RYVIVVDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
           R  +V   G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 771 RQCLVTHNGRLLGIITKKDVLKHIAQMANQDPDSIL 806



>gi|505793802|ref|XP_004606515.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform X3 [Sorex
           araneus]
          Length = 786

 Score =  215 bits (547), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 128/354 (36%), Positives = 207/354 (58%), Gaps = 39/354 (11%)

Query: 3   LCD--NSFN--------------GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPAL 46
           LCD  NSFN              G++ A + L L LI K +  + TFG+++P+G+FIP++
Sbjct: 440 LCDYENSFNTSKAGELPDRPAGVGVYNAMWQLALTLILKIVITIFTFGMKIPSGLFIPSM 499

Query: 47  LVGACFGRMLGIVMQYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRS 106
            VGA  GR+LG+ M+ L   + D+ I+++ C+Q    DC+ PG+YAMVGAAA L GVTR 
Sbjct: 500 AVGAIAGRLLGVGMEQLAYYHHDWAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRM 557

Query: 107 TVSLTVIMFELTGTLTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYD 166
           TVSL VIMFELTG L Y++P+M A M SKWVAD + + GIYD  I L G+P+L++K E+ 
Sbjct: 558 TVSLVVIMFELTGGLEYIVPLMAAAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF- 616

Query: 167 GANTTFTTTLDLCQRDLEVIDV--NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKI 221
            A+ T    +   +R+  ++ V   D  T+ +++  + + + S     GFP+V   +++ 
Sbjct: 617 -AHKTLAMDVMKPRRNDPLLTVITQDSMTVEDVETIISETTYS-----GFPVVVSRESQR 670

Query: 222 LVGYIASTEL----EHALSLAHGSDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTI 272
           LVG++   +L    E+A     G  + +  YF + +                ++ +P T+
Sbjct: 671 LVGFVLRRDLIISIENARKKQDGVVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTV 730

Query: 273 SKNASLEIVLELFKKLGLRYVIVVDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
           +    +EIV+++F+KLGLR  +V   G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 731 TDLTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDVLKHIAQMANQDPDSIL 784



>gi|126723543|ref|NP_001075537.1| H(+)/Cl(-) exchange transporter 5 [Oryctolagus cuniculus]
 gi|75056437|sp|Q9TTU3.1|CLCN5_RABIT RecName: Full=H(+)/Cl(-) exchange transporter 5; AltName:
           Full=Chloride channel protein 5; Short=ClC-5; AltName:
           Full=Chloride transporter ClC-5
 gi|6224928|gb|AAF06018.1|AF195523_1 chloride channel CLC-5 [Oryctolagus cuniculus]
          Length = 746

 Score =  215 bits (547), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 122/331 (36%), Positives = 201/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L LALI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 423 GVYNAMWQLALALILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 482

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 483 WTIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 540

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 541 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 598

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 599 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 653

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 654 VVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 713

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 714 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 744



>gi|505793795|ref|XP_004606513.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform X1 [Sorex
           araneus]
 gi|505793799|ref|XP_004606514.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform X2 [Sorex
           araneus]
          Length = 747

 Score =  215 bits (547), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 128/354 (36%), Positives = 207/354 (58%), Gaps = 39/354 (11%)

Query: 3   LCD--NSFN--------------GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPAL 46
           LCD  NSFN              G++ A + L L LI K +  + TFG+++P+G+FIP++
Sbjct: 401 LCDYENSFNTSKAGELPDRPAGVGVYNAMWQLALTLILKIVITIFTFGMKIPSGLFIPSM 460

Query: 47  LVGACFGRMLGIVMQYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRS 106
            VGA  GR+LG+ M+ L   + D+ I+++ C+Q    DC+ PG+YAMVGAAA L GVTR 
Sbjct: 461 AVGAIAGRLLGVGMEQLAYYHHDWAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRM 518

Query: 107 TVSLTVIMFELTGTLTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYD 166
           TVSL VIMFELTG L Y++P+M A M SKWVAD + + GIYD  I L G+P+L++K E+ 
Sbjct: 519 TVSLVVIMFELTGGLEYIVPLMAAAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF- 577

Query: 167 GANTTFTTTLDLCQRDLEVIDV--NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKI 221
            A+ T    +   +R+  ++ V   D  T+ +++  + + + S     GFP+V   +++ 
Sbjct: 578 -AHKTLAMDVMKPRRNDPLLTVITQDSMTVEDVETIISETTYS-----GFPVVVSRESQR 631

Query: 222 LVGYIASTEL----EHALSLAHGSDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTI 272
           LVG++   +L    E+A     G  + +  YF + +                ++ +P T+
Sbjct: 632 LVGFVLRRDLIISIENARKKQDGVVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTV 691

Query: 273 SKNASLEIVLELFKKLGLRYVIVVDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
           +    +EIV+++F+KLGLR  +V   G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 692 TDLTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDVLKHIAQMANQDPDSIL 745



>gi|505793806|ref|XP_004606516.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform X4 [Sorex
           araneus]
          Length = 720

 Score =  215 bits (547), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 128/354 (36%), Positives = 207/354 (58%), Gaps = 39/354 (11%)

Query: 3   LCD--NSFN--------------GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPAL 46
           LCD  NSFN              G++ A + L L LI K +  + TFG+++P+G+FIP++
Sbjct: 374 LCDYENSFNTSKAGELPDRPAGVGVYNAMWQLALTLILKIVITIFTFGMKIPSGLFIPSM 433

Query: 47  LVGACFGRMLGIVMQYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRS 106
            VGA  GR+LG+ M+ L   + D+ I+++ C+Q    DC+ PG+YAMVGAAA L GVTR 
Sbjct: 434 AVGAIAGRLLGVGMEQLAYYHHDWAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRM 491

Query: 107 TVSLTVIMFELTGTLTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYD 166
           TVSL VIMFELTG L Y++P+M A M SKWVAD + + GIYD  I L G+P+L++K E+ 
Sbjct: 492 TVSLVVIMFELTGGLEYIVPLMAAAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF- 550

Query: 167 GANTTFTTTLDLCQRDLEVIDV--NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKI 221
            A+ T    +   +R+  ++ V   D  T+ +++  + + + S     GFP+V   +++ 
Sbjct: 551 -AHKTLAMDVMKPRRNDPLLTVITQDSMTVEDVETIISETTYS-----GFPVVVSRESQR 604

Query: 222 LVGYIASTEL----EHALSLAHGSDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTI 272
           LVG++   +L    E+A     G  + +  YF + +                ++ +P T+
Sbjct: 605 LVGFVLRRDLIISIENARKKQDGVVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTV 664

Query: 273 SKNASLEIVLELFKKLGLRYVIVVDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
           +    +EIV+++F+KLGLR  +V   G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 665 TDLTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDVLKHIAQMANQDPDSIL 718



>gi|451993237|gb|EMD85711.1| hypothetical protein COCHEDRAFT_1228750 [Bipolaris maydis C5]
          Length = 878

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 122/306 (39%), Positives = 189/306 (61%), Gaps = 24/306 (7%)

Query: 17  LLGLALISKFLTCVI---TFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPDFPIY 73
           ++ L L+S  L  ++   TFG+++PAGI +P++ +G  FGR +G+ MQ +   +P    +
Sbjct: 531 VIALLLVSSGLGIILAGFTFGLQIPAGIILPSMAIGGLFGRAVGLSMQVVQAAWPSLFFF 590

Query: 74  STVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMTAIMI 133
           S+ C  ++   CV PG YA++GAA++LAG TR TVS+ VIMFELTG LTYVLPIM A+MI
Sbjct: 591 SS-CEPDV--PCVTPGTYAIIGAASALAGTTRMTVSIVVIMFELTGALTYVLPIMIAVMI 647

Query: 134 SKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQR--DLEVIDVNDL 191
           SKW+ D I   GIY+  I   G+P+LD++ + +G++    +   +  R  DL  I     
Sbjct: 648 SKWIGDAISPRGIYESWIHFKGYPFLDNRDD-NGSSIPDVSASHVMTRTEDLTAITATG- 705

Query: 192 NTIGELKNKLKKLSTSGYSDAGFPIVDNK---ILVGYIASTELEHALSLA-HGSDNL--- 244
           +TIG L++ L +     +   GFP++DN    +L+GYI+ TEL++AL  A     NL   
Sbjct: 706 HTIGSLRDLLSQ-----HRFRGFPVIDNSRDALLLGYISRTELQYALQTALTPPRNLAPE 760

Query: 245 TRCYFKDENVIDK--SANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVVDRGQYV 302
           T  YF  + + D   S +   +++Q P+T++  AS ++ + +F+KLGLRYV+  DRG   
Sbjct: 761 TEAYFAHQPLSDPTTSLDLRPWMDQTPMTLNAKASFQLTVSMFQKLGLRYVLFTDRGTLK 820

Query: 303 GVINKK 308
           G++ KK
Sbjct: 821 GLLTKK 826



>gi|380027901|ref|XP_003697653.1| PREDICTED: H(+)/Cl(-) exchange transporter 3-like [Apis florea]
          Length = 853

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 132/330 (40%), Positives = 204/330 (61%), Gaps = 23/330 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G+++A +LL LALI K +  + TFG++VP G+FIP+L +GA  GR++GI M+ L   YP 
Sbjct: 532 GVYKAIWLLVLALILKLVMTIFTFGMKVPCGLFIPSLCLGAIMGRIVGIGMEQLAYNYPH 591

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
             I+S  C+  +  DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG + Y++P+M 
Sbjct: 592 IWIFSEACSTGV--DCITPGLYAMVGAAAVLGGVTRMTVSLVVIMFELTGGVRYIVPLMA 649

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWV D + K GIYD  I L G+P+LDSK E+   +TT    +   +R+ E + V 
Sbjct: 650 AAMASKWVGDALGKQGIYDAHIGLNGYPFLDSKDEFQ--HTTLAADVMQPRRN-EALHVL 706

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTELEHALSLAHG-SDN 243
             D  T+ +++N LK+   +     GFP++   +++ LVG++   +L  A++ A   ++ 
Sbjct: 707 TQDSMTVEDVENLLKETEHN-----GFPVIVSKESQYLVGFVLRRDLNLAIANAKRMTEE 761

Query: 244 LTR---CYFKDENVIDKSA----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVV 296
           +T      F + N I   +         ++ AP+TI+    +E V+++F+KLGLR  +V 
Sbjct: 762 ITGQSLVLFTNGNNIQNHSPPPLKLKKILDMAPITITDQTPMETVVDMFRKLGLRQTLVT 821

Query: 297 DRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
             G+ +GVI KK +L +++Q+  +D N+ L
Sbjct: 822 HNGRLLGVITKKDVLRHVKQLDNEDPNSVL 851



>gi|504151264|ref|XP_004587993.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform X2 [Ochotona
           princeps]
          Length = 809

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 122/331 (36%), Positives = 201/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L LALI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 486 GVYSAMWQLALALILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 545

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 546 WTIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 603

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 604 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 661

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 662 TQDSLTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 716

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 717 VVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 776

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 777 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 807



>gi|242023116|ref|XP_002431982.1| Chloride channel protein, putative [Pediculus humanus corporis]
 gi|212517333|gb|EEB19244.1| Chloride channel protein, putative [Pediculus humanus corporis]
          Length = 750

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 135/354 (38%), Positives = 201/354 (56%), Gaps = 39/354 (11%)

Query: 1   DGLCDNSFN---------------GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPA 45
           D LCD + N               G+++A  LL LAL+ K +  V TFG++VP G+FIP+
Sbjct: 406 DNLCDYNRNFTDVNSAIEIAAAGPGVYKAVRLLSLALVFKLVATVFTFGMKVPCGLFIPS 465

Query: 46  LLVGACFGRMLGIVMQYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTR 105
           L +GA  GR++GI ++ L   YP    +S  C+     DC+ PG+YAMVGAAA L GVTR
Sbjct: 466 LCLGAIMGRIVGIFVEQLAYNYPYIWPFSGECSTG--DDCITPGLYAMVGAAAVLGGVTR 523

Query: 106 STVSLTVIMFELTGTLTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEY 165
            TVSL VIMFELTG + Y++P+M A M SKWV D + K G+YD  I L G+P+LDSK E 
Sbjct: 524 MTVSLVVIMFELTGGVRYIVPLMVAAMASKWVGDALGKQGVYDAHICLNGYPFLDSKEEM 583

Query: 166 DGANTTFTTTLDLCQRDLEVIDV--NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNK 220
             A+T      D+ Q   E + V   D  T+ ++++ LK+   +     GFP+V   +++
Sbjct: 584 --AHTALAA--DVMQPKSEPLTVLTQDSMTVDDVESILKETEHN-----GFPVVVSKESQ 634

Query: 221 ILVGYIASTELEHALSLA----HGSDNLTRCYFKD----ENVIDKSANFTAYVNQAPLTI 272
            LVG++   +L  A+S A     G    +   F      + +          ++ AP+TI
Sbjct: 635 YLVGFVLRRDLLLAISNAKRTLEGISGQSLVVFNTIPAGQTLGPAPLKLKRILDMAPITI 694

Query: 273 SKNASLEIVLELFKKLGLRYVIVVDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
           +    +E V+++F+KLGLR  +V   G+ +GVI KK +L Y++Q+  +D N+ L
Sbjct: 695 TDQTPMETVIDMFRKLGLRQTLVTHNGRLLGVITKKDVLRYIKQLDNEDPNSVL 748



>gi|302903816|ref|XP_003048939.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256729873|gb|EEU43226.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 862

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 127/327 (38%), Positives = 195/327 (59%), Gaps = 22/327 (6%)

Query: 3   LCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQY 62
           LC  S + +      L +AL+ K    VITFGI+VPAGI++P+++VG   GR++G V+Q+
Sbjct: 542 LCPKSIDDIPPILLHLFVALLIKGFLTVITFGIKVPAGIYVPSMVVGGLMGRIVGHVVQW 601

Query: 63  LTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLT 122
             +  PD+ ++   C  + +G C+ PGVY ++ A A++ GVTR +V+L VI+FELTG+L 
Sbjct: 602 SVLRVPDWGVWGN-CAFSQDGSCIQPGVYGLIAAGATMCGVTRLSVTLAVILFELTGSLD 660

Query: 123 YVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTL-DLCQ- 180
           YVLP   AI+++KW AD I  + IYDLL  +  +P+LD+K +       FT  L D+   
Sbjct: 661 YVLPFSLAILVAKWTADAIEPNSIYDLLTSMNSYPFLDNKHK-----PIFTEDLADIVPR 715

Query: 181 -RDLEVIDVND--LNTIGELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHAL-S 236
            R   +ID+ +  L     L+ KL+ L  +G  D G PIV + ILVG I   +L +AL  
Sbjct: 716 IRRERLIDITNSPLVPATSLRVKLELLHRAGELDGGLPIVRHGILVGLIPVPDLGYALDQ 775

Query: 237 LAHGSDNLTRCYF-------KDENVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLG 289
           L   S +L  C         +D  V D + +FT Y++ AP+ +   + +++V ELF KLG
Sbjct: 776 LVEESTDL--CLMDRIPSIDEDTGVFDPT-DFTPYIDPAPVALDIKSPMDLVYELFSKLG 832

Query: 290 LRYVIVVDRGQYVGVINKKRLLIYLRQ 316
           LRY+ V+  G+Y G+ +KK  + Y+R+
Sbjct: 833 LRYICVLKDGKYAGMTHKKTFVRYMRE 859



>gi|328793201|ref|XP_392670.3| PREDICTED: H(+)/Cl(-) exchange transporter 3-like isoform 1 [Apis
           mellifera]
          Length = 865

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 132/330 (40%), Positives = 204/330 (61%), Gaps = 23/330 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G+++A +LL LALI K +  + TFG++VP G+FIP+L +GA  GR++GI M+ L   YP 
Sbjct: 544 GVYKAIWLLVLALILKLVMTIFTFGMKVPCGLFIPSLCLGAIMGRIVGIGMEQLAYNYPH 603

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
             I+S  C+  +  DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG + Y++P+M 
Sbjct: 604 IWIFSEACSTGV--DCITPGLYAMVGAAAVLGGVTRMTVSLVVIMFELTGGVRYIVPLMA 661

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWV D + K GIYD  I L G+P+LDSK E+   +TT    +   +R+ E + V 
Sbjct: 662 AAMASKWVGDALGKQGIYDAHIGLNGYPFLDSKDEFQ--HTTLAADVMQPKRN-EALHVL 718

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTELEHALSLAHG-SDN 243
             D  T+ +++N LK+   +     GFP++   +++ LVG++   +L  A++ A   ++ 
Sbjct: 719 TQDSMTVEDVENLLKETEHN-----GFPVIVSKESQYLVGFVLRRDLNLAIANAKRMTEE 773

Query: 244 LTR---CYFKDENVIDKSA----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVV 296
           +T      F + N I   +         ++ AP+TI+    +E V+++F+KLGLR  +V 
Sbjct: 774 ITGQSLVLFTNGNNIQNHSPPPLKLKKILDMAPITITDQTPMETVVDMFRKLGLRQTLVT 833

Query: 297 DRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
             G+ +GVI KK +L +++Q+  +D N+ L
Sbjct: 834 HNGRLLGVITKKDVLRHVKQLDNEDPNSVL 863



>gi|449498719|ref|XP_002195118.2| PREDICTED: H(+)/Cl(-) exchange transporter 5-like isoform 1
           [Taeniopygia guttata]
          Length = 895

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 129/339 (38%), Positives = 198/339 (58%), Gaps = 39/339 (11%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L LALI K    + TFG++VP+G+FIP++ VGA  GR+LG+ ++ L   + D
Sbjct: 572 GVYTAMWQLALALIMKVFITIFTFGMKVPSGLFIPSMAVGAIAGRLLGVAVEQLAFYHHD 631

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           +PI+S  C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 632 WPIFSGWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 689

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQ-----RDLE 184
           A M SKWVAD I + GIYD  I L G+P+L++K E+       T  +D+ +       L 
Sbjct: 690 AAMTSKWVADAIGREGIYDAHIRLNGYPFLEAKEEFSHK----TRAMDVMRPRKNDPPLT 745

Query: 185 VI-----DVNDLNTIGELKNKLKKLSTSGYSDAGFPIVDNKI---LVGYIASTEL----E 232
           VI      V D+ TI         +S++ YS  G+P+V ++    LVG++   +L    E
Sbjct: 746 VITQDSMSVEDVETI---------VSSTTYS--GYPVVVSRTSQRLVGFVLRRDLIISIE 794

Query: 233 HALSLAHGSDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKK 287
           +A     G  + +   F D       +        + ++ +P T++    +EIV+++F+K
Sbjct: 795 NARKKQDGIVSTSVICFTDYCPPLPPSSPSVLKLRSILDLSPFTVTDETPMEIVVDIFRK 854

Query: 288 LGLRYVIVVDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
           LGLR  +V   G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 855 LGLRQCLVTHNGKLLGIITKKDVLKHIAQMANQDPDSIL 893



>gi|405963612|gb|EKC29174.1| H(+)/Cl(-) exchange transporter 3 [Crassostrea gigas]
          Length = 867

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 132/341 (38%), Positives = 198/341 (58%), Gaps = 33/341 (9%)

Query: 9   NGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYP 68
           +G+++A ++L LAL+ K +  V TFGI++P G+FIP++ VGA  GRM+GI ++ + +   
Sbjct: 535 DGVYKALWMLALALVFKGIITVFTFGIKIPCGLFIPSMAVGAIMGRMIGIGVEQIVVANH 594

Query: 69  DFPIYSTVCNQNINGDCVI-PGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPI 127
           D P +  +C       C I PG+YAMVGAAA+L GVTR TVSL VIMFELTG L Y++P+
Sbjct: 595 DNPFFENMCESK--QFCRITPGLYAMVGAAAALGGVTRMTVSLVVIMFELTGGLQYIVPL 652

Query: 128 MTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQR------ 181
           M A M SKWV D + K GIYD  I L G+PYLDSK E+             C R      
Sbjct: 653 MVASMTSKWVGDALGKEGIYDAHILLNGYPYLDSKEEFTHTTLASDVMRPRCARYGSAVR 712

Query: 182 ---DLEVIDVNDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTELEHAL 235
               L VI   D  T+ E+ + LK  S +     GFP++   +++ LVG++   +L  AL
Sbjct: 713 NDPPLSVI-TQDSMTVEEVDHVLKSTSHN-----GFPVIVSRESQYLVGFVLRRDLNLAL 766

Query: 236 SLA-HGSDNL---TRCYFKDENVIDKSANFTA------YVNQAPLTISKNASLEIVLELF 285
           S A    D +   +  YF   N + ++ N  A       ++ AP+TI+    +E+V+E+F
Sbjct: 767 SNALKNQDGIVYNSIVYFT--NHVTENPNGPAPLKLRKIIDMAPVTITDQTPMEMVVEMF 824

Query: 286 KKLGLRYVIVVDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
           +KLGLR  +V  +G+ +G++ KK +L ++  +  +D  + L
Sbjct: 825 RKLGLRQTLVTHKGRLLGILTKKDVLRHIAHLENQDPESIL 865



>gi|444521988|gb|ELV13254.1| H(+)/Cl(-) exchange transporter 5 [Tupaia chinensis]
          Length = 686

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 122/331 (36%), Positives = 201/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L+LI K +  + TFG++VP+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 363 GVYSAMWQLALSLILKIVITIFTFGMKVPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 422

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 423 WTIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 480

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 481 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 538

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 539 TQDSMTVEDIETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 593

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 594 VVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 653

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 654 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 684



>gi|854102|emb|CAA55280.1| chloride channel 3 [Homo sapiens]
          Length = 820

 Score =  214 bits (546), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 119/326 (36%), Positives = 192/326 (58%), Gaps = 21/326 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L LALI K +  V TFGI+VP+G+FIP++ +GA  GR++GI ++ L   + D
Sbjct: 495 GVYSAIWQLCLALIFKIIMTVFTFGIKVPSGLFIPSMAIGAIAGRIVGIAVEQLAYYHHD 554

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+   C   +  DC+ PG+YAMVGAAA L GVTR TVSL VI+FELTG L Y++P+M 
Sbjct: 555 WFIFKEWCE--VGADCITPGLYAMVGAAACLGGVTRMTVSLVVIVFELTGGLEYIVPLMA 612

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A+M SKWV D   + GIY+  I L G+P+LD+K E++  +TT    +   +R+   + V 
Sbjct: 613 AVMTSKWVGDAFGREGIYEAHIRLNGYPFLDAKEEFEFTHTTLAADVMRPRRNDPPLAVL 672

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++N + + S +     GFP++   +++ LVG+    +L    E A     G
Sbjct: 673 TQDNMTVDDIENMINETSYN-----GFPVIMSKESQRLVGFALRRDLTIAIESARKKQEG 727

Query: 241 SDNLTRCYFKDENV-----IDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
               +R  F            +     + ++ +P T++ +  +EIV+++F+KLGLR  +V
Sbjct: 728 IVGSSRVCFAQHTPSLPAESPRPLKLRSILDMSPFTVTDHTPMEIVVDIFRKLGLRQCLV 787

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKD 321
              G+ +G+I KK +L ++ Q   +D
Sbjct: 788 THNGRLLGIITKKDILRHMAQTANQD 813



>gi|332019976|gb|EGI60436.1| H(+)/Cl(-) exchange transporter 3 [Acromyrmex echinatior]
          Length = 832

 Score =  214 bits (545), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 131/330 (39%), Positives = 205/330 (62%), Gaps = 23/330 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G+++A +LL LALI K +  + TFG++VP G+FIP+L +GA  GR++GI M+ L   YP 
Sbjct: 511 GVYKAIWLLVLALILKLIMTIFTFGMKVPCGLFIPSLCLGAIMGRIVGIGMEQLAYNYPH 570

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
             ++S  C+  +  DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG + Y++P+M 
Sbjct: 571 IWMFSEECSMGV--DCITPGLYAMVGAAAVLGGVTRMTVSLVVIMFELTGGVRYIVPLMA 628

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWV D + K GIYD  I L G+P+LDSK E+   +TT    +   +R+ E + V 
Sbjct: 629 AAMASKWVGDALGKQGIYDAHIGLNGYPFLDSKDEFQ--HTTLAADVMQPKRN-EALHVL 685

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTELEHALSLAHGS-DN 243
             D  T+ +++N LK+   +     GFP++   +++ LVG++   +L  A++ A    ++
Sbjct: 686 TQDSMTVEDVENLLKETEHN-----GFPVIVSKESQYLVGFVLRRDLNLAIANAKRMIED 740

Query: 244 LTR---CYFKDENVIDKSA----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVV 296
           ++R     F + N I   +         ++ AP+TI+    +E V+++F+KLGLR  +V 
Sbjct: 741 ISRQSLVIFTNGNNIQSHSPPPLKLKKILDMAPITITDQTPMETVVDMFRKLGLRQTLVT 800

Query: 297 DRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
             G+ +GVI KK +L +++Q+  +D N+ L
Sbjct: 801 HNGRLLGVITKKDVLRHVKQLDNEDPNSVL 830



>gi|260310527|gb|ACX36518.1| RE11344p [Drosophila melanogaster]
          Length = 893

 Score =  214 bits (545), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 124/330 (37%), Positives = 199/330 (60%), Gaps = 24/330 (7%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ + +LL L  I K    + TFG++VPAG+FIP+LL+GA  GR++GI ++    +YP+
Sbjct: 573 GVYSSIWLLMLTFILKLALTIFTFGMKVPAGLFIPSLLLGAIMGRIVGIGVEQFAYSYPN 632

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
              ++  C    + + + PG+YA+VGAAA L GVTR TVSL VIMFELTG + Y++P+M 
Sbjct: 633 IWFFTGEC---ADSNLITPGLYAVVGAAAVLGGVTRMTVSLVVIMFELTGGVRYIVPLMA 689

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWV D + + GIYD  I L G+P+LDSK E+  A+TT    +   +R+ E ++V 
Sbjct: 690 AAMASKWVGDALGRQGIYDAHIALNGYPFLDSKEEF--AHTTLAADVMQPKRN-ETLNVI 746

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTELE----HALSLAHG 240
             D  T+ +++N LK+   +GY     P+V   +N+ LVG++   +L     +A  L  G
Sbjct: 747 TQDSMTVDDVENLLKETEHNGY-----PVVVSRENQYLVGFVLRRDLNLAIGNAKRLIEG 801

Query: 241 SDNLTRCYFKD----ENVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVV 296
             + +   F      +N+  +       ++ AP+T++    +E V+++F+KLGLR  +V 
Sbjct: 802 ISSSSIVLFTSSQPIQNLGPQPLKLKKILDMAPITVTDQTPMETVVDMFRKLGLRQTLVT 861

Query: 297 DRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
             G+ +GVI KK +L +++Q+  +D N  L
Sbjct: 862 HNGRLLGVITKKDVLRHVKQMDNEDPNTVL 891



>gi|507707999|ref|XP_004646327.1| PREDICTED: H(+)/Cl(-) exchange transporter 5-like isoform X2
           [Octodon degus]
          Length = 809

 Score =  214 bits (545), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 486 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYNHHD 545

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 546 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 603

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 604 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 661

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 662 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 716

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 717 VVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 776

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 777 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 807



>gi|198464545|ref|XP_001353267.2| GA18785 [Drosophila pseudoobscura pseudoobscura]
 gi|198149766|gb|EAL30770.2| GA18785 [Drosophila pseudoobscura pseudoobscura]
          Length = 891

 Score =  214 bits (545), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 124/330 (37%), Positives = 199/330 (60%), Gaps = 24/330 (7%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ + +LL L  I K    + TFG++VPAG+FIP+LL+GA  GR++GI ++    +YP+
Sbjct: 571 GVYSSIWLLMLTFILKLALTIFTFGMKVPAGLFIPSLLLGAIMGRIVGIGVEQFAYSYPN 630

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
              ++  C    + + + PG+YA+VGAAA L GVTR TVSL VIMFELTG + Y++P+M 
Sbjct: 631 IWFFTGEC---ADSNLITPGLYAVVGAAAVLGGVTRMTVSLVVIMFELTGGVRYIVPLMA 687

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWV D + + GIYD  I L G+P+LDSK E+  A+TT    +   +R+ E ++V 
Sbjct: 688 AAMASKWVGDALGRQGIYDAHIALNGYPFLDSKEEF--AHTTLAADVMQPKRN-ETLNVI 744

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTELE----HALSLAHG 240
             D  T+ +++N LK+   +GY     P+V   +N+ LVG++   +L     +A  L  G
Sbjct: 745 TQDSMTVDDVENLLKETEHNGY-----PVVVSRENQYLVGFVLRRDLNLAIGNAKRLIEG 799

Query: 241 SDNLTRCYFKD----ENVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVV 296
             + +   F      +N+  +       ++ AP+T++    +E V+++F+KLGLR  +V 
Sbjct: 800 ISSSSIVLFTSTTPTQNLGPQPLKLKKILDMAPITVTDQTPMETVVDMFRKLGLRQTLVT 859

Query: 297 DRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
             G+ +GVI KK +L +++Q+  +D N  L
Sbjct: 860 HNGRLLGVITKKDVLRHVKQMDNEDPNTVL 889



>gi|504151266|ref|XP_004587994.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform X3 [Ochotona
           princeps]
          Length = 719

 Score =  214 bits (545), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 122/331 (36%), Positives = 201/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L LALI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 396 GVYSAMWQLALALILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 455

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 456 WTIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 513

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 514 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 571

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 572 TQDSLTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 626

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 627 VVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 686

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 687 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 717



>gi|340382150|ref|XP_003389584.1| PREDICTED: H(+)/Cl(-) exchange transporter 3-like [Amphimedon
           queenslandica]
          Length = 810

 Score =  214 bits (545), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 129/332 (38%), Positives = 198/332 (59%), Gaps = 31/332 (9%)

Query: 11  MFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPDF 70
           ++EA  LL LA+++K +  + TFG++VPAG+FIP++ VGAC GR++GI M+ +   Y D 
Sbjct: 484 VYEAMLLLSLAMVAKAILTIFTFGMKVPAGLFIPSMFVGACVGRVIGIGMEQIAFIYKDS 543

Query: 71  PIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMTA 130
             +   C+ +    CV PG+YAM+GAAA+L GVTR TVSL VIMFELTG L+Y++PIM A
Sbjct: 544 WFFKLFCSPH--EACVTPGLYAMIGAAAALGGVTRMTVSLVVIMFELTGGLSYIVPIMVA 601

Query: 131 IMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRD--LEVIDV 188
           +MISKWV D I+K GIYD  I L G P+LDSK ++   +T     +     D  LE ID+
Sbjct: 602 VMISKWVGDAIVKDGIYDGHIHLNGFPFLDSKEDFI-HDTLVCDVMKPQPGDAPLETIDL 660

Query: 189 NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTELEHALSL--AHGSDN 243
           +   TI  L+  +++ +  GY     P +   + ++L G++   ++  +L L  A   ++
Sbjct: 661 STC-TISSLRKLVRESNYFGY-----PCLLSNETQLLEGFLTRKDIMTSLELIDARKDED 714

Query: 244 LT---RCYFKD------ENVIDK---SANFTAYVNQAPLTISKNASLEIVLELFKKLGLR 291
           +T   R +F D      E V+D    S N    ++ AP+ +S    ++ V+ELF K+GLR
Sbjct: 715 VTEESRVFFLDKSHRLQEAVVDSDVPSVNIRGTIDPAPIQVSDQTPMKTVVELFGKMGLR 774

Query: 292 YVIVVDRGQYVGVINKKRLLIYLRQITGKDMN 323
              V   G+ +G++ KK +   LR ++  + N
Sbjct: 775 QAFVSRNGRLLGIVTKKDM---LRHVSSMEKN 803



>gi|504151261|ref|XP_004587992.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform X1 [Ochotona
           princeps]
          Length = 746

 Score =  214 bits (545), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 122/331 (36%), Positives = 201/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L LALI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 423 GVYSAMWQLALALILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 482

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 483 WTIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 540

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 541 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 598

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 599 TQDSLTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 653

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 654 VVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 713

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 714 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 744



>gi|425766652|gb|EKV05255.1| Voltage-gated chloride channel (ClcA), putative [Penicillium
           digitatum Pd1]
 gi|425775303|gb|EKV13581.1| Voltage-gated chloride channel (ClcA), putative [Penicillium
           digitatum PHI26]
          Length = 908

 Score =  214 bits (545), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 120/328 (36%), Positives = 195/328 (59%), Gaps = 18/328 (5%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC  + +G+ E  + L +A + K    +ITFGI+VPAGI++P+++VG   GR++G ++Q
Sbjct: 583 GLCPRT-DGILEIVHYLLVAFVIKSFLTIITFGIKVPAGIYVPSMVVGGLMGRIVGHLIQ 641

Query: 62  YLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTL 121
           Y  + +P F ++ +    +    CV PGVYA+V A A++ GVTR +V+L VI+FELTG+L
Sbjct: 642 YWALRHPTFFLFDSCSAISGVESCVTPGVYALVAAGATMCGVTRLSVTLPVILFELTGSL 701

Query: 122 TYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQ- 180
            +VLP   +++ +KW AD I    IYDLL D+  +P+LDSK +     TT     DL + 
Sbjct: 702 NHVLPFSLSVLCAKWTADAIEPRSIYDLLTDMNSYPFLDSKLQ----PTTDAELGDLVRP 757

Query: 181 -RDLEVIDV--NDLNTIGELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHALSL 237
            R   +ID+  +   T   L+ KL+ L  +G  D G PI+ + +L G + + ELE AL  
Sbjct: 758 VRKNRIIDISGSPFVTATALRLKLEDLLIAGELDGGLPILRDGVLAGLLPAPELEFALDN 817

Query: 238 AHGSDNLTRCYFK--------DENVID-KSANFTAYVNQAPLTISKNASLEIVLELFKKL 288
               +  T C           D +V D +  +F+ Y++ AP+ +  ++S+++V + F KL
Sbjct: 818 LGDEEENTICLMTTDTSVAVYDSDVEDAEQVDFSRYIDPAPIALDVHSSIDLVYQCFVKL 877

Query: 289 GLRYVIVVDRGQYVGVINKKRLLIYLRQ 316
           GLRY+ V   G+Y G+++KK  + ++R+
Sbjct: 878 GLRYLCVTQDGKYAGLVHKKAFVKFMRE 905



>gi|21744243|gb|AAM76180.1| LD07266p [Drosophila melanogaster]
          Length = 882

 Score =  214 bits (545), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 124/330 (37%), Positives = 199/330 (60%), Gaps = 24/330 (7%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ + +LL L  I K    + TFG++VPAG+FIP+LL+GA  GR++GI ++    +YP+
Sbjct: 562 GVYSSIWLLMLTFILKLALTIFTFGMKVPAGLFIPSLLLGAIMGRIVGIGVEQFAYSYPN 621

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
              ++  C    + + + PG+YA+VGAAA L GVTR TVSL VIMFELTG + Y++P+M 
Sbjct: 622 IWFFTGEC---ADSNLITPGLYAVVGAAAVLGGVTRMTVSLVVIMFELTGGVRYIVPLMA 678

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWV D + + GIYD  I L G+P+LDSK E+  A+TT    +   +R+ E ++V 
Sbjct: 679 AAMASKWVGDALGRQGIYDAHIALNGYPFLDSKEEF--AHTTLAADVMQPKRN-ETLNVI 735

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTELE----HALSLAHG 240
             D  T+ +++N LK+   +GY     P+V   +N+ LVG++   +L     +A  L  G
Sbjct: 736 TQDSMTVDDVENLLKETEHNGY-----PVVVSRENQYLVGFVLRRDLNLAIGNAKRLIEG 790

Query: 241 SDNLTRCYFKD----ENVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVV 296
             + +   F      +N+  +       ++ AP+T++    +E V+++F+KLGLR  +V 
Sbjct: 791 ISSSSIVLFTSSQPIQNLGPQPLKLKKILDMAPITVTDQTPMETVVDMFRKLGLRQTLVT 850

Query: 297 DRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
             G+ +GVI KK +L +++Q+  +D N  L
Sbjct: 851 HNGRLLGVITKKDVLRHVKQMDNEDPNTVL 880



>gi|466068866|ref|XP_004281970.1| PREDICTED: H(+)/Cl(-) exchange transporter 5-like isoform 3
           [Orcinus orca]
          Length = 809

 Score =  214 bits (545), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 486 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 545

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 546 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 603

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 604 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 661

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 662 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 716

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 717 VVSTSVIYFTEHSPPVPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 776

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 777 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 807



>gi|24665008|ref|NP_648834.1| chloride channel-c, isoform B [Drosophila melanogaster]
 gi|23093368|gb|AAN11761.1| chloride channel-c, isoform B [Drosophila melanogaster]
          Length = 822

 Score =  214 bits (545), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 124/330 (37%), Positives = 199/330 (60%), Gaps = 24/330 (7%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ + +LL L  I K    + TFG++VPAG+FIP+LL+GA  GR++GI ++    +YP+
Sbjct: 502 GVYSSIWLLMLTFILKLALTIFTFGMKVPAGLFIPSLLLGAIMGRIVGIGVEQFAYSYPN 561

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
              ++  C    + + + PG+YA+VGAAA L GVTR TVSL VIMFELTG + Y++P+M 
Sbjct: 562 IWFFTGECA---DSNLITPGLYAVVGAAAVLGGVTRMTVSLVVIMFELTGGVRYIVPLMA 618

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWV D + + GIYD  I L G+P+LDSK E+  A+TT    +   +R+ E ++V 
Sbjct: 619 AAMASKWVGDALGRQGIYDAHIALNGYPFLDSKEEF--AHTTLAADVMQPKRN-ETLNVI 675

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTELE----HALSLAHG 240
             D  T+ +++N LK+   +GY     P+V   +N+ LVG++   +L     +A  L  G
Sbjct: 676 TQDSMTVDDVENLLKETEHNGY-----PVVVSRENQYLVGFVLRRDLNLAIGNAKRLIEG 730

Query: 241 SDNLTRCYFKD----ENVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVV 296
             + +   F      +N+  +       ++ AP+T++    +E V+++F+KLGLR  +V 
Sbjct: 731 ISSSSIVLFTSSQPIQNLGPQPLKLKKILDMAPITVTDQTPMETVVDMFRKLGLRQTLVT 790

Query: 297 DRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
             G+ +GVI KK +L +++Q+  +D N  L
Sbjct: 791 HNGRLLGVITKKDVLRHVKQMDNEDPNTVL 820



>gi|195160217|ref|XP_002020972.1| GL25087 [Drosophila persimilis]
 gi|194118085|gb|EDW40128.1| GL25087 [Drosophila persimilis]
          Length = 891

 Score =  214 bits (545), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 124/330 (37%), Positives = 199/330 (60%), Gaps = 24/330 (7%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ + +LL L  I K    + TFG++VPAG+FIP+LL+GA  GR++GI ++    +YP+
Sbjct: 571 GVYSSIWLLMLTFILKLALTIFTFGMKVPAGLFIPSLLLGAIMGRIVGIGVEQFAYSYPN 630

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
              ++  C    + + + PG+YA+VGAAA L GVTR TVSL VIMFELTG + Y++P+M 
Sbjct: 631 IWFFTGEC---ADSNLITPGLYAVVGAAAVLGGVTRMTVSLVVIMFELTGGVRYIVPLMA 687

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWV D + + GIYD  I L G+P+LDSK E+  A+TT    +   +R+ E ++V 
Sbjct: 688 AAMASKWVGDALGRQGIYDAHIALNGYPFLDSKEEF--AHTTLAADVMQPKRN-ETLNVI 744

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTELE----HALSLAHG 240
             D  T+ +++N LK+   +GY     P+V   +N+ LVG++   +L     +A  L  G
Sbjct: 745 TQDSMTVDDVENLLKETEHNGY-----PVVVSRENQYLVGFVLRRDLNLAIGNAKRLIEG 799

Query: 241 SDNLTRCYFKD----ENVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVV 296
             + +   F      +N+  +       ++ AP+T++    +E V+++F+KLGLR  +V 
Sbjct: 800 ISSSSIVLFTSTTPTQNLGPQPLKLKKILDMAPITVTDQTPMETVVDMFRKLGLRQTLVT 859

Query: 297 DRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
             G+ +GVI KK +L +++Q+  +D N  L
Sbjct: 860 HNGRLLGVITKKDVLRHVKQMDNEDPNTVL 889



>gi|320545940|ref|NP_730105.3| chloride channel-c, isoform C [Drosophila melanogaster]
 gi|442632693|ref|NP_001261922.1| chloride channel-c, isoform D [Drosophila melanogaster]
 gi|318069221|gb|AAF49542.4| chloride channel-c, isoform C [Drosophila melanogaster]
 gi|378548256|gb|AFC17502.1| FI18633p1 [Drosophila melanogaster]
 gi|440215869|gb|AGB94615.1| chloride channel-c, isoform D [Drosophila melanogaster]
          Length = 893

 Score =  214 bits (545), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 124/330 (37%), Positives = 199/330 (60%), Gaps = 24/330 (7%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ + +LL L  I K    + TFG++VPAG+FIP+LL+GA  GR++GI ++    +YP+
Sbjct: 573 GVYSSIWLLMLTFILKLALTIFTFGMKVPAGLFIPSLLLGAIMGRIVGIGVEQFAYSYPN 632

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
              ++  C    + + + PG+YA+VGAAA L GVTR TVSL VIMFELTG + Y++P+M 
Sbjct: 633 IWFFTGEC---ADSNLITPGLYAVVGAAAVLGGVTRMTVSLVVIMFELTGGVRYIVPLMA 689

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWV D + + GIYD  I L G+P+LDSK E+  A+TT    +   +R+ E ++V 
Sbjct: 690 AAMASKWVGDALGRQGIYDAHIALNGYPFLDSKEEF--AHTTLAADVMQPKRN-ETLNVI 746

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTELE----HALSLAHG 240
             D  T+ +++N LK+   +GY     P+V   +N+ LVG++   +L     +A  L  G
Sbjct: 747 TQDSMTVDDVENLLKETEHNGY-----PVVVSRENQYLVGFVLRRDLNLAIGNAKRLIEG 801

Query: 241 SDNLTRCYFKD----ENVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVV 296
             + +   F      +N+  +       ++ AP+T++    +E V+++F+KLGLR  +V 
Sbjct: 802 ISSSSIVLFTSSQPIQNLGPQPLKLKKILDMAPITVTDQTPMETVVDMFRKLGLRQTLVT 861

Query: 297 DRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
             G+ +GVI KK +L +++Q+  +D N  L
Sbjct: 862 HNGRLLGVITKKDVLRHVKQMDNEDPNTVL 891



>gi|395854473|ref|XP_003799715.1| PREDICTED: H(+)/Cl(-) exchange transporter 5-like [Otolemur
           garnettii]
          Length = 816

 Score =  214 bits (545), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 121/332 (36%), Positives = 200/332 (60%), Gaps = 23/332 (6%)

Query: 9   NGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYP 68
            G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + 
Sbjct: 492 RGVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHH 551

Query: 69  DFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIM 128
           D+ I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M
Sbjct: 552 DWAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLM 609

Query: 129 TAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV 188
            A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V
Sbjct: 610 AAAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTV 667

Query: 189 --NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAH 239
              D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     
Sbjct: 668 LTQDSMTVEDIETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQD 722

Query: 240 GSDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVI 294
           G  + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +
Sbjct: 723 GVVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCL 782

Query: 295 VVDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
           V   G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 783 VTHNGRLLGIITKKDVLKHIAQMANQDPDSIL 814



>gi|507707995|ref|XP_004646326.1| PREDICTED: H(+)/Cl(-) exchange transporter 5-like isoform X1
           [Octodon degus]
          Length = 746

 Score =  214 bits (545), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 423 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYNHHD 482

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 483 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 540

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 541 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 598

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 599 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 653

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 654 VVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 713

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 714 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 744



>gi|854103|emb|CAA55281.1| chloride channel 3 [Homo sapiens]
          Length = 762

 Score =  214 bits (545), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 119/326 (36%), Positives = 192/326 (58%), Gaps = 21/326 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L LALI K +  V TFGI+VP+G+FIP++ +GA  GR++GI ++ L   + D
Sbjct: 437 GVYSAIWQLCLALIFKIIMTVFTFGIKVPSGLFIPSMAIGAIAGRIVGIAVEQLAYYHHD 496

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+   C   +  DC+ PG+YAMVGAAA L GVTR TVSL VI+FELTG L Y++P+M 
Sbjct: 497 WFIFKEWCE--VGADCITPGLYAMVGAAACLGGVTRMTVSLVVIVFELTGGLEYIVPLMA 554

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A+M SKWV D   + GIY+  I L G+P+LD+K E++  +TT    +   +R+   + V 
Sbjct: 555 AVMTSKWVGDAFGREGIYEAHIRLNGYPFLDAKEEFEFTHTTLAADVMRPRRNDPPLAVL 614

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++N + + S +     GFP++   +++ LVG+    +L    E A     G
Sbjct: 615 TQDNMTVDDIENMINETSYN-----GFPVIMSKESQRLVGFALRRDLTIAIESARKKQEG 669

Query: 241 SDNLTRCYFKDENV-----IDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
               +R  F            +     + ++ +P T++ +  +EIV+++F+KLGLR  +V
Sbjct: 670 IVGSSRVCFAQHTPSLPAESPRPLKLRSILDMSPFTVTDHTPMEIVVDIFRKLGLRQCLV 729

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKD 321
              G+ +G+I KK +L ++ Q   +D
Sbjct: 730 THNGRLLGIITKKDILRHMAQTANQD 755



>gi|350422945|ref|XP_003493337.1| PREDICTED: H(+)/Cl(-) exchange transporter 3-like [Bombus
           impatiens]
          Length = 836

 Score =  214 bits (545), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 132/330 (40%), Positives = 204/330 (61%), Gaps = 23/330 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G+++A +LL LALI K +  + TFG++VP G+FIP+L +GA  GR++GI M+ L   YP 
Sbjct: 515 GVYKAIWLLVLALILKLVMTIFTFGMKVPCGLFIPSLCLGAIMGRIVGIGMEQLAYNYPH 574

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
             I+S  C+  +  DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG + Y++P+M 
Sbjct: 575 IWIFSEACSTGV--DCITPGLYAMVGAAAVLGGVTRMTVSLVVIMFELTGGVRYIVPLMA 632

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWV D + K GIYD  I L G+P+LDSK E+   +TT    +   +R+ E + V 
Sbjct: 633 AAMASKWVGDALGKQGIYDAHIGLNGYPFLDSKDEFQ--HTTLAADVMQPKRN-EALHVL 689

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTELEHALSLAHG-SDN 243
             D  T+ +++N LK+   +     GFP++   +++ LVG++   +L  A++ A   ++ 
Sbjct: 690 TQDSMTVEDVENLLKETEHN-----GFPVIVSKESQYLVGFVLRRDLNLAIANAKRMTEE 744

Query: 244 LTR---CYFKDENVIDKSA----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVV 296
           +T      F + N I   +         ++ AP+TI+    +E V+++F+KLGLR  +V 
Sbjct: 745 ITGQSLVIFTNGNNIQTHSPPPLKLKKILDMAPITITDQTPMETVVDMFRKLGLRQTLVT 804

Query: 297 DRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
             G+ +GVI KK +L +++Q+  +D N+ L
Sbjct: 805 HNGRLLGVITKKDVLRHVKQLDNEDPNSVL 834



>gi|507708003|ref|XP_004646328.1| PREDICTED: H(+)/Cl(-) exchange transporter 5-like isoform X3
           [Octodon degus]
          Length = 659

 Score =  214 bits (544), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 123/331 (37%), Positives = 201/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 336 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYNHHD 395

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 396 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 453

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 454 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 511

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++     +S + YS  GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 512 TQDSMTVEDVET---IISETTYS--GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 566

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 567 VVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 626

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 627 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 657



>gi|426395919|ref|XP_004064206.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 2 [Gorilla
           gorilla gorilla]
          Length = 746

 Score =  214 bits (544), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 120/331 (36%), Positives = 202/331 (61%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + +
Sbjct: 423 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHQE 482

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + ++++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 483 WTVFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 540

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 541 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 598

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++N + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 599 TQDSMTVEDVENIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 653

Query: 241 SDNLTRCYFKDEN-----VIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +         +      ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 654 VVSTSIIYFTEHSPPLPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 713

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 714 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 744



>gi|407928894|gb|EKG21737.1| Cystathionine beta-synthase core [Macrophomina phaseolina MS6]
          Length = 899

 Score =  214 bits (544), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 129/325 (39%), Positives = 198/325 (60%), Gaps = 24/325 (7%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC  +     E   LL ++ +   +   I+FG+ +PAGI +P++ +GA +GR +G++++
Sbjct: 537 GLC-KAGKANTEVISLLVVSAVLGVVLAAISFGLLIPAGILLPSMAIGALYGRAVGLIVR 595

Query: 62  YLTMTYPD-FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGT 120
            + M++ + FP   T C  +I   CV PG YA++GAA+++ G TR TVS+ VIMFELTG 
Sbjct: 596 VMHMSHKNKFPF--TACEPDI--PCVTPGTYAIIGAASAIGGATRMTVSIVVIMFELTGA 651

Query: 121 LTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQ 180
           LTYVLPIM A+MISKWV D I   GIY+  I   G+P+LD++ + DG++        +  
Sbjct: 652 LTYVLPIMIAVMISKWVGDAISPRGIYEAWIHFNGYPFLDNRDD-DGSSVPDVPASQVMT 710

Query: 181 R--DLEVIDVNDLNTIGELKNKLKKLSTSGYSDAGFPIVDNK---ILVGYIASTELEHAL 235
           R  DL VI     +TI  L+N L     S +S  GFP++DN    +L+GYI+ TEL +AL
Sbjct: 711 RIEDLVVITATG-HTIQSLRNLL-----SQHSFRGFPVIDNPREALLLGYISRTELAYAL 764

Query: 236 SLAHGSD-NL---TRCYFKDENVIDK--SANFTAYVNQAPLTISKNASLEIVLELFKKLG 289
           S+A  S  NL   T  +F  + + D   S +   +++Q P+T++   SL++ + +F KLG
Sbjct: 765 SVAISSPRNLSVDTEAFFAHQPLSDPTTSLDLRPWMDQTPITLNAQTSLQLTVNMFSKLG 824

Query: 290 LRYVIVVDRGQYVGVINKKRLLIYL 314
           LRYV+ V++G   G++ KK +   L
Sbjct: 825 LRYVVFVEKGCLRGLLTKKDVWFVL 849



>gi|449498725|ref|XP_004177289.1| PREDICTED: H(+)/Cl(-) exchange transporter 5-like isoform 2
           [Taeniopygia guttata]
          Length = 805

 Score =  214 bits (544), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 129/339 (38%), Positives = 198/339 (58%), Gaps = 39/339 (11%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L LALI K    + TFG++VP+G+FIP++ VGA  GR+LG+ ++ L   + D
Sbjct: 482 GVYTAMWQLALALIMKVFITIFTFGMKVPSGLFIPSMAVGAIAGRLLGVAVEQLAFYHHD 541

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           +PI+S  C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 542 WPIFSGWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 599

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQ-----RDLE 184
           A M SKWVAD I + GIYD  I L G+P+L++K E+       T  +D+ +       L 
Sbjct: 600 AAMTSKWVADAIGREGIYDAHIRLNGYPFLEAKEEFSHK----TRAMDVMRPRKNDPPLT 655

Query: 185 VI-----DVNDLNTIGELKNKLKKLSTSGYSDAGFPIVDNKI---LVGYIASTEL----E 232
           VI      V D+ TI         +S++ YS  G+P+V ++    LVG++   +L    E
Sbjct: 656 VITQDSMSVEDVETI---------VSSTTYS--GYPVVVSRTSQRLVGFVLRRDLIISIE 704

Query: 233 HALSLAHGSDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKK 287
           +A     G  + +   F D       +        + ++ +P T++    +EIV+++F+K
Sbjct: 705 NARKKQDGIVSTSVICFTDYCPPLPPSSPSVLKLRSILDLSPFTVTDETPMEIVVDIFRK 764

Query: 288 LGLRYVIVVDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
           LGLR  +V   G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 765 LGLRQCLVTHNGKLLGIITKKDVLKHIAQMANQDPDSIL 803



>gi|511867513|ref|XP_004755169.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform X1 [Mustela
           putorius furo]
 gi|511867516|ref|XP_004755170.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform X2 [Mustela
           putorius furo]
 gi|512000369|ref|XP_004817721.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform X1 [Mustela
           putorius furo]
 gi|512000371|ref|XP_004817722.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform X2 [Mustela
           putorius furo]
          Length = 816

 Score =  214 bits (544), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 493 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 552

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 553 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 610

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 611 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 668

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 669 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 723

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 724 VVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 783

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 784 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 814



>gi|345807164|ref|XP_549002.3| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 2 [Canis lupus
           familiaris]
          Length = 809

 Score =  214 bits (544), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 486 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 545

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 546 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 603

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 604 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 661

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 662 TQDSMTVEDVETVISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 716

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 717 VVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 776

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 777 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 807



>gi|478521524|ref|XP_004434971.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 2
           [Ceratotherium simum simum]
          Length = 747

 Score =  214 bits (544), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 201/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 424 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 483

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 484 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 541

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 542 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 599

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ ++++ + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 600 TQDSMTVEDVESIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 654

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 655 VVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 714

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 715 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 745



>gi|431907761|gb|ELK11369.1| H(+)/Cl(-) exchange transporter 5 [Pteropus alecto]
          Length = 822

 Score =  214 bits (544), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 120/331 (36%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L L+ K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 499 GVYSAMWQLALTLVMKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 558

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 559 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 616

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 617 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 674

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 675 TQDSMTVEDVETVISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 729

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 730 VVSTSVIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 789

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 790 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 820



>gi|488547161|ref|XP_004465089.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 1 [Dasypus
           novemcinctus]
          Length = 816

 Score =  214 bits (544), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 493 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIVGRLLGVGMEQLAYYHHD 552

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 553 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 610

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 611 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 668

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 669 TQDSMTVEDVETIINETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 723

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 724 VVSTSIIYFTEHSPPVPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 783

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 784 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 814



>gi|297493135|ref|XP_002700128.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 1 [Bos taurus]
 gi|296470761|tpg|DAA12876.1| TPA: chloride channel 5 [Bos taurus]
          Length = 809

 Score =  214 bits (544), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 486 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 545

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 546 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 603

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 604 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 661

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 662 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 716

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 717 VVSTSVIYFTEHSPPVPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 776

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 777 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 807



>gi|383858045|ref|XP_003704513.1| PREDICTED: LOW QUALITY PROTEIN: H(+)/Cl(-) exchange transporter
           3-like [Megachile rotundata]
          Length = 870

 Score =  214 bits (544), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 132/330 (40%), Positives = 204/330 (61%), Gaps = 23/330 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G+++A +LL LALI K +  + TFG++VP G+FIP+L +GA  GR++GI M+ L   YP 
Sbjct: 549 GVYKAIWLLVLALILKLVMTIFTFGMKVPCGLFIPSLCLGAIMGRIVGIGMEQLAYNYPH 608

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
             ++S  C+  +  DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG + Y++P+M 
Sbjct: 609 IWMFSEECSTGV--DCITPGLYAMVGAAAVLGGVTRMTVSLVVIMFELTGGVRYIVPLMA 666

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWV D + K GIYD  I L G+P+LDSK E+   +TT    +   +R+ E + V 
Sbjct: 667 AAMASKWVGDALGKQGIYDAHIGLNGYPFLDSKDEFQ--HTTLAADVMQPKRN-EALHVL 723

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTELEHALSLAHG-SDN 243
             D  T+ +++N LK+   +     GFP++   +++ LVG++   +L  A++ A   +D 
Sbjct: 724 TQDSMTVEDVENLLKETEHN-----GFPVIVSKESQYLVGFVLRRDLNLAIANAKRMTDE 778

Query: 244 LTR---CYFKDENVIDKSA----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVV 296
           +T      F + N I   +         ++ AP+TI+    +E V+++F+KLGLR  +V 
Sbjct: 779 ITGQSLVIFTNGNNIQSHSPPPLKLKKILDMAPITITDQTPMETVVDMFRKLGLRQTLVT 838

Query: 297 DRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
             G+ +GVI KK +L +++Q+  +D N+ L
Sbjct: 839 HNGRLLGVITKKDVLRHVKQLDNEDPNSVL 868



>gi|346321274|gb|EGX90874.1| chloride channel protein 3 [Cordyceps militaris CM01]
          Length = 870

 Score =  214 bits (544), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 119/326 (36%), Positives = 189/326 (57%), Gaps = 17/326 (5%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC +S + +     +L +A + K    VITFGI+VPAGI+IP+++VG   GRM+G ++Q
Sbjct: 545 GLCPDSIDDIPGILKMLVVAFLIKGFLTVITFGIKVPAGIYIPSMVVGGLMGRMVGHLIQ 604

Query: 62  YLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTL 121
           +L +  P + ++   C    +G CV PGVY ++ A A++ GVTR +V+L VI+FELTG+L
Sbjct: 605 WLVLAAPSWALWGN-CATAADGTCVQPGVYGLIAAGATMCGVTRLSVTLAVILFELTGSL 663

Query: 122 TYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTE--YDGANTTFTTTLDLC 179
            YVLP    I+++KW AD I  + IYDLL  +  +P+LD+K +  + G      T     
Sbjct: 664 DYVLPFSLTILVAKWTADAIEPNSIYDLLTSMNAYPFLDNKHKPIFTGDLADIITRF--- 720

Query: 180 QRDLEVIDVNDLNTIG--ELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHALSL 237
            R   +ID+ +   +   +L+ KL+ L  +G  D G PI+ + ILVG I + +LE AL  
Sbjct: 721 -RRERIIDITNSPLVAATKLRLKLEILHRAGELDGGLPILRHDILVGLIPAPDLEFALDQ 779

Query: 238 AHGSDNLTRCYF-------KDENVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGL 290
               +  + C         +DE  +    +FT Y++ AP+ +   +  ++V E F KLGL
Sbjct: 780 LE-DETTSLCLMDRVPSIDEDEGDMVDPTDFTPYIDPAPVALDLRSPTDLVYECFVKLGL 838

Query: 291 RYVIVVDRGQYVGVINKKRLLIYLRQ 316
           RY+     G+Y G+I+KK  + ++R+
Sbjct: 839 RYICATKDGRYAGMIHKKTFVRHMRE 864



>gi|426395917|ref|XP_004064205.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 1 [Gorilla
           gorilla gorilla]
          Length = 766

 Score =  214 bits (544), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 120/331 (36%), Positives = 202/331 (61%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + +
Sbjct: 443 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHQE 502

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + ++++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 503 WTVFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 560

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 561 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 618

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++N + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 619 TQDSMTVEDVENIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 673

Query: 241 SDNLTRCYFKDEN-----VIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +         +      ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 674 VVSTSIIYFTEHSPPLPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 733

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 734 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 764



>gi|358419943|ref|XP_869706.4| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 2 [Bos taurus]
 gi|359081910|ref|XP_003588215.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 3 [Bos taurus]
          Length = 747

 Score =  214 bits (544), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 424 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 483

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 484 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 541

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 542 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 599

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 600 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 654

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 655 VVSTSVIYFTEHSPPVPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 714

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 715 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 745



>gi|345807166|ref|XP_003435566.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 1 [Canis lupus
           familiaris]
          Length = 747

 Score =  214 bits (544), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 424 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 483

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 484 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 541

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 542 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 599

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 600 TQDSMTVEDVETVISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 654

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 655 VVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 714

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 715 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 745



>gi|440912737|gb|ELR62278.1| H(+)/Cl(-) exchange transporter 5, partial [Bos grunniens mutus]
          Length = 811

 Score =  214 bits (544), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 488 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 547

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 548 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 605

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 606 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 663

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 664 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 718

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 719 VVSTSVIYFTEHSPPVPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 778

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 779 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 809



>gi|477582473|gb|ENH99581.1| hypothetical protein COCC4DRAFT_76413 [Bipolaris maydis ATCC 48331]
          Length = 1241

 Score =  214 bits (544), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 123/306 (40%), Positives = 189/306 (61%), Gaps = 24/306 (7%)

Query: 17   LLGLALISKFLTCVI---TFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPDFPIY 73
            ++ L L+S  L  ++   TFG+++PAGI +P++ +G  FGR +G+ MQ +   +P    +
Sbjct: 894  VIALLLVSSGLGIILAGFTFGLQIPAGIILPSMAIGGLFGRAVGLSMQVVQAAWPSLFFF 953

Query: 74   STVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMTAIMI 133
            S+ C  ++   CV PG YA++GAA++LAG TR TVS+ VIMFELTG LTYVLPIM A+MI
Sbjct: 954  SS-CEPDV--PCVTPGTYAIIGAASALAGTTRMTVSIVVIMFELTGALTYVLPIMIAVMI 1010

Query: 134  SKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQR--DLEVIDVNDL 191
            SKW+ D I   GIY+  I   G+P+LD++ + +G++    +   +  R  DL  I     
Sbjct: 1011 SKWIGDAISPRGIYESWIHFKGYPFLDNRDD-NGSSIPDVSASHVMTRTEDLTAITATG- 1068

Query: 192  NTIGELKNKLKKLSTSGYSDAGFPIVDNK---ILVGYIASTELEHALSLA-HGSDNL--- 244
            +TIG L++ L     S +   GFP++DN    +L+GYI+ TEL++AL  A     NL   
Sbjct: 1069 HTIGSLRDLL-----SQHRFRGFPVIDNSRDALLLGYISRTELQYALQTALTPPRNLAPE 1123

Query: 245  TRCYFKDENVIDK--SANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVVDRGQYV 302
            T  YF  + + D   S +   +++Q P+T++  AS ++ + +F+KLGLRYV+  DRG   
Sbjct: 1124 TEAYFAHQPLSDPTTSLDLRPWMDQTPMTLNAKASFQLTVSMFQKLGLRYVLFTDRGTLK 1183

Query: 303  GVINKK 308
            G++ KK
Sbjct: 1184 GLLTKK 1189



>gi|472354450|ref|XP_004396886.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 3 [Odobenus
           rosmarus divergens]
          Length = 809

 Score =  214 bits (544), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 486 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 545

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 546 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 603

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 604 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 661

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 662 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 716

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 717 VVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 776

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 777 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 807



>gi|398406218|ref|XP_003854575.1| hypothetical protein MYCGRDRAFT_20761, partial [Zymoseptoria
           tritici IPO323]
 gi|339474458|gb|EGP89551.1| hypothetical protein MYCGRDRAFT_20761 [Zymoseptoria tritici IPO323]
          Length = 791

 Score =  214 bits (544), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 122/314 (38%), Positives = 190/314 (60%), Gaps = 16/314 (5%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC +          LL  A++  FL   +TFG+++PAGI +P++ VGA +GR++G++++
Sbjct: 484 GLCKSGVANTGVILVLLVSAVLG-FLLATVTFGLQIPAGILLPSMAVGALYGRVVGLIVE 542

Query: 62  YLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTL 121
                +P+F  + T C  ++   CV PG YA+VGAA++LAG TR TVS+ VIMFELTG L
Sbjct: 543 VWQREHPNFSAF-TSCEPDV--PCVTPGTYAVVGAASALAGATRMTVSIIVIMFELTGAL 599

Query: 122 TYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQR 181
           TYVLPIM A+M+SKWV D   K GIY+  I    +P+LD+K +    +   +  +   + 
Sbjct: 600 TYVLPIMIAVMLSKWVGDAFGKAGIYESWIHFQQYPFLDNKDDSPVPDIPVSEVMTRAE- 658

Query: 182 DLEVIDVNDLNTIGELKNKLKKLSTSGYSDAGFPIVDNK--ILVGYIASTELEHAL-SLA 238
           DL  I   D +TI  L++ L++     +   GFP+V      L+GYI+ TEL  AL S +
Sbjct: 659 DLVCITATD-HTIDSLRDLLRE-----HPYRGFPVVTTAEVTLLGYISRTELTFALDSSS 712

Query: 239 HGSDNLTRCYFKDENVIDKSA--NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVV 296
                 T+C+F+ E   D +   +   +++Q P+T++  +SL +  E+F+KLGLR+V+  
Sbjct: 713 RSLPGSTQCFFQHEAFADPTTTLDLRPWMDQTPITLNSRSSLMLTNEMFQKLGLRFVVFA 772

Query: 297 DRGQYVGVINKKRL 310
           D+G+  G++ KK L
Sbjct: 773 DQGRLAGLVTKKDL 786



>gi|5923861|gb|AAD56388.1|AF182215_1 chloride channel CLC-3 [Oreochromis mossambicus]
          Length = 759

 Score =  214 bits (544), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 120/332 (36%), Positives = 198/332 (59%), Gaps = 25/332 (7%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L LALI K +  + TFG++VP+G+FIP++ +GA  GR++GI M+ L   + D
Sbjct: 436 GVYSAMWQLCLALIFKIIMTIFTFGLKVPSGLFIPSMAIGAIAGRIVGIAMEQLAYYHHD 495

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + ++   C   +  DC+ PG+YAMVGAAA L GVTR TVSL +I+FELTG L Y++P+M 
Sbjct: 496 WFLFKEWCE--VGADCITPGLYAMVGAAACLGGVTRMTVSLVIIVFELTGGLEYIVPLMA 553

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRD---LEVI 186
           A+M SKWV D   + GIY+  I L G+P+LDSK E+   +TT    +   +R+   L V+
Sbjct: 554 AVMTSKWVGDAFGREGIYEAHIRLNGYPFLDSKEEF--THTTLAREVMRPRRNDPPLAVL 611

Query: 187 DVNDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTE----LEHALSLAH 239
             +DL T+ EL+  + + S +     GFP++   +++ LVG+    +    +E+A     
Sbjct: 612 TQDDL-TVEELQGIINETSYN-----GFPVIVSKESQRLVGFALRRDITIAIENARRKQE 665

Query: 240 GSDNLTRCYFKDENVI-----DKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVI 294
           G    +R YF            +     + ++ +P T++ +  +EIV+++F+KLGLR  +
Sbjct: 666 GIVLNSRVYFTQHAPTLPADSPRPLKLRSILDMSPFTVTDHTPMEIVVDIFRKLGLRQCL 725

Query: 295 VVDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
           V   G+ +G+I KK +L ++ Q+  +D  + +
Sbjct: 726 VTHNGRLLGIITKKDILRHMAQMANQDPESIM 757



>gi|511867519|ref|XP_004755171.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform X3 [Mustela
           putorius furo]
 gi|512000373|ref|XP_004817723.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform X3 [Mustela
           putorius furo]
          Length = 766

 Score =  214 bits (544), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 443 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 502

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 503 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 560

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 561 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 618

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 619 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 673

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 674 VVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 733

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 734 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 764



>gi|478521522|ref|XP_004434970.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 1
           [Ceratotherium simum simum]
          Length = 766

 Score =  214 bits (544), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 201/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 443 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 502

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 503 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 560

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 561 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 618

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ ++++ + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 619 TQDSMTVEDVESIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 673

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 674 VVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 733

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 734 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 764



>gi|443709820|gb|ELU04325.1| hypothetical protein CAPTEDRAFT_175229 [Capitella teleta]
          Length = 766

 Score =  214 bits (544), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 126/332 (37%), Positives = 196/332 (59%), Gaps = 24/332 (7%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G+  A + L LALI K +  + TFGI+VPAG+FIP++  GA  GRM+G+ M+ L   + D
Sbjct: 442 GVVAAMWQLALALIFKMVITIFTFGIKVPAGLFIPSMAAGAIAGRMIGVGMEQLAFYHQD 501

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
             I+  +CN+     CV PG+YAMVGAAA+L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 502 HHIFKEMCNEG--HTCVTPGLYAMVGAAAALGGVTRMTVSLVVIMFELTGGLQYIVPLMA 559

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A+M +KWV D   + GIYD  I L G+P+LDSK E+   +TT    +   +R+   + V 
Sbjct: 560 AVMTAKWVGDAFGREGIYDGHILLNGYPFLDSKEEF--THTTIAADVMRPRRNDPPLCVV 617

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTELEHALSLAH----G 240
             D  T+ +++  L+    +     GFP+V   +++ LVG++   +L  A+  A     G
Sbjct: 618 TQDTYTVDDIEMVLRDTDHN-----GFPVVVSHESQYLVGFVLRRDLSIAVGNARKNQDG 672

Query: 241 SDNLTRCYFKDENVID------KSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVI 294
             + +  YF +   ++      +       ++ AP+TI+    +E V+E+F+KLGLR  +
Sbjct: 673 VVSNSVVYFSNHVPVNTVVGGPEPLKLRRILDMAPITITDQTPMETVVEMFRKLGLRQTL 732

Query: 295 VVDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
           V   G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 733 VTHNGRLLGIITKKDVLRHVAQMKNQDPDSIL 764



>gi|358419941|ref|XP_003584368.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 [Bos taurus]
 gi|359081908|ref|XP_003588214.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 2 [Bos taurus]
          Length = 766

 Score =  214 bits (544), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 443 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 502

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 503 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 560

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 561 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 618

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 619 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 673

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 674 VVSTSVIYFTEHSPPVPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 733

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 734 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 764



>gi|426257013|ref|XP_004022129.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 2 [Ovis aries]
          Length = 767

 Score =  213 bits (543), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 444 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 503

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 504 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 561

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 562 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 619

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 620 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 674

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 675 VVSTSIIYFTEHSPPVPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 734

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 735 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 765



>gi|499040227|ref|XP_004570741.1| PREDICTED: H(+)/Cl(-) exchange transporter 3-like isoform X4
           [Maylandia zebra]
          Length = 818

 Score =  213 bits (543), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 120/332 (36%), Positives = 198/332 (59%), Gaps = 25/332 (7%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L LALI K +  + TFG++VP+G+FIP++ +GA  GR++GI M+ L   + D
Sbjct: 495 GVYSAMWQLCLALIFKIIMTIFTFGLKVPSGLFIPSMAIGAIAGRIVGIAMEQLAYYHHD 554

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + ++   C   +  DC+ PG+YAMVGAAA L GVTR TVSL +I+FELTG L Y++P+M 
Sbjct: 555 WFLFKEWCE--VGADCITPGLYAMVGAAACLGGVTRMTVSLVIIVFELTGGLEYIVPLMA 612

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRD---LEVI 186
           A+M SKWV D   + GIY+  I L G+P+LDSK E+   +TT    +   +R+   L V+
Sbjct: 613 AVMTSKWVGDAFGREGIYEAHIRLNGYPFLDSKEEF--THTTLAREVMRPRRNDPPLAVL 670

Query: 187 DVNDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTE----LEHALSLAH 239
             +DL T+ EL+  + + S +     GFP++   +++ LVG+    +    +E+A     
Sbjct: 671 TQDDL-TVEELQGIINETSYN-----GFPVIVSKESQRLVGFALRRDITIAIENARRKQE 724

Query: 240 GSDNLTRCYFKDENVI-----DKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVI 294
           G    +R YF            +     + ++ +P T++ +  +EIV+++F+KLGLR  +
Sbjct: 725 GIVLNSRVYFTQHAPTLPADSPRPLKLRSILDMSPFTVTDHTPMEIVVDIFRKLGLRQCL 784

Query: 295 VVDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
           V   G+ +G+I KK +L ++ Q+  +D  + +
Sbjct: 785 VTHNGRLLGIITKKDILRHMAQMANQDPESIM 816



>gi|466068861|ref|XP_004281969.1| PREDICTED: H(+)/Cl(-) exchange transporter 5-like isoform 2
           [Orcinus orca]
          Length = 747

 Score =  213 bits (543), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 424 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 483

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 484 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 541

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 542 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 599

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 600 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 654

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 655 VVSTSVIYFTEHSPPVPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 714

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 715 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 745



>gi|466068856|ref|XP_004281968.1| PREDICTED: H(+)/Cl(-) exchange transporter 5-like isoform 1
           [Orcinus orca]
          Length = 766

 Score =  213 bits (543), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 443 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 502

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 503 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 560

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 561 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 618

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 619 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 673

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 674 VVSTSVIYFTEHSPPVPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 733

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 734 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 764



>gi|301764735|ref|XP_002917788.1| PREDICTED: H(+)/Cl(-) exchange transporter 5-like [Ailuropoda
           melanoleuca]
          Length = 809

 Score =  213 bits (543), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 486 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 545

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 546 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 603

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 604 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 661

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 662 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 716

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 717 VVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 776

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 777 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 807



>gi|410988613|ref|XP_004000578.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 [Felis catus]
          Length = 809

 Score =  213 bits (543), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 486 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 545

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 546 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 603

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 604 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 661

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 662 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 716

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 717 VVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 776

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 777 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 807



>gi|472354446|ref|XP_004396884.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 1 [Odobenus
           rosmarus divergens]
 gi|472354448|ref|XP_004396885.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 2 [Odobenus
           rosmarus divergens]
          Length = 747

 Score =  213 bits (543), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 424 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 483

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 484 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 541

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 542 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 599

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 600 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 654

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 655 VVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 714

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 715 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 745



>gi|281353637|gb|EFB29221.1| hypothetical protein PANDA_006151 [Ailuropoda melanoleuca]
          Length = 746

 Score =  213 bits (543), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 423 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 482

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 483 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 540

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 541 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 598

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 599 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 653

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 654 VVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 713

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 714 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 744



>gi|511867522|ref|XP_004755172.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform X4 [Mustela
           putorius furo]
 gi|511867525|ref|XP_004755173.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform X5 [Mustela
           putorius furo]
 gi|511867528|ref|XP_004755174.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform X6 [Mustela
           putorius furo]
 gi|512000375|ref|XP_004817724.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform X4 [Mustela
           putorius furo]
 gi|512000377|ref|XP_004817725.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform X5 [Mustela
           putorius furo]
 gi|512000379|ref|XP_004817726.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform X6 [Mustela
           putorius furo]
          Length = 747

 Score =  213 bits (543), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 424 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 483

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 484 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 541

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 542 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 599

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 600 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 654

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 655 VVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 714

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 715 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 745



>gi|488547163|ref|XP_004465090.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 2 [Dasypus
           novemcinctus]
          Length = 747

 Score =  213 bits (543), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 424 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIVGRLLGVGMEQLAYYHHD 483

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 484 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 541

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 542 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 599

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 600 TQDSMTVEDVETIINETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 654

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 655 VVSTSIIYFTEHSPPVPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 714

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 715 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 745



>gi|426257011|ref|XP_004022128.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 1 [Ovis aries]
          Length = 809

 Score =  213 bits (543), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 486 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 545

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 546 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 603

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 604 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 661

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 662 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 716

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 717 VVSTSIIYFTEHSPPVPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 776

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 777 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 807



>gi|195378823|ref|XP_002048181.1| GJ13821 [Drosophila virilis]
 gi|194155339|gb|EDW70523.1| GJ13821 [Drosophila virilis]
          Length = 877

 Score =  213 bits (543), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 124/330 (37%), Positives = 199/330 (60%), Gaps = 24/330 (7%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ + +LL L  I K    + TFGI+VP+G+FIP+LL+GA  GR++GI ++    +YP+
Sbjct: 557 GVYRSIWLLVLTFILKLALTIFTFGIKVPSGLFIPSLLLGAIMGRIVGIGVEQFAYSYPN 616

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
              ++  C    + + + PG+YA+VGAAA L GVTR TVSL VIMFELTG + Y++P+M 
Sbjct: 617 IWFFTGEC---ADSNLITPGLYAVVGAAAVLGGVTRMTVSLVVIMFELTGGVRYIVPLMA 673

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWV D + + GIYD  I L G+P+LDSK E+  A+TT    +   +R+ E ++V 
Sbjct: 674 AAMASKWVGDALGRQGIYDAHIALNGYPFLDSKEEF--AHTTLAADVMQPKRN-ETLNVI 730

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTELE----HALSLAHG 240
             D  T+ +++N LK+   +GY     P+V   +N+ LVG++   +L     +A  L  G
Sbjct: 731 TQDSMTVDDVENLLKETEHNGY-----PVVVSRENQYLVGFVLRRDLNLAIGNAKRLIEG 785

Query: 241 SDNLTRCYFKD----ENVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVV 296
            ++ +   F      +N+          ++ AP+T++    +E V+++F+KLGLR  +V 
Sbjct: 786 INSNSIVLFTSTTPTQNLGPSPLKLKKILDMAPITVTDQTPMETVVDMFRKLGLRQTLVT 845

Query: 297 DRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
             G+ +GVI KK +L +++Q+  +D N  L
Sbjct: 846 HNGRLLGVITKKDVLRHVKQMDNEDPNTVL 875



>gi|449302739|gb|EMC98747.1| hypothetical protein BAUCODRAFT_65114 [Baudoinia compniacensis UAMH
           10762]
          Length = 879

 Score =  213 bits (543), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 124/361 (34%), Positives = 204/361 (56%), Gaps = 46/361 (12%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC    + +    + L +A + K    V+TFG++VPAGI++P++++G   GR++G  +Q
Sbjct: 524 GLCPTQ-DRIPSIIWYLCVAFVIKAALTVVTFGVKVPAGIYVPSMVIGGLLGRIIGHCVQ 582

Query: 62  YLTMTYPDFPIYSTVCNQNINGD-CVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGT 120
           YLT+ YPDF +++  C  + N + CV+PGVYA+V A A++ GVTR +V+L VI+FELTG+
Sbjct: 583 YLTLRYPDFGLFAG-CPADGNPEGCVVPGVYALVAAGATMCGVTRLSVTLAVILFELTGS 641

Query: 121 LTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTL---- 176
           L +VLP    ++I+KW AD +    IYDLL D+  +PYLD+K     A   FT+ L    
Sbjct: 642 LEHVLPFSLGVLIAKWTADALEPLSIYDLLTDMNAYPYLDAK-----ARPVFTSELGDIT 696

Query: 177 DLCQRDLEV-IDVNDLNTIGELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHAL 235
           D  +R+  V I  + L    +L+ KL+ L  +G  D G P++ + ILVG I + +LE+AL
Sbjct: 697 DPPRRNRFVDITTSPLVPATQLRMKLQYLHMAGELDGGLPVLRDGILVGMIPAPDLEYAL 756

Query: 236 SLAHGSDNL-----TRCYFKDENVIDKSA----------------------------NFT 262
                 DN       R   +D+    +S+                            +FT
Sbjct: 757 DRLESDDNKLCLMSPRDSPQDQWSGQESSVAESRHDPFGPDGASDRQHAPADEHDLTDFT 816

Query: 263 AYVNQAPLTISKNASLEIVLELFKKLGLRYVIVVDRGQYVGVINKKRLLIYLRQITGKDM 322
            +++ AP+ +   + +++V E F KLGLRY+ V+  G+Y G+++KK+ + ++++   K+ 
Sbjct: 817 PFIDPAPVALDITSPMDLVFECFVKLGLRYICVLREGKYAGMVHKKQFVRFVKEEHEKER 876

Query: 323 N 323
            
Sbjct: 877 K 877



>gi|291190812|ref|NP_001167057.1| H(+)/Cl(-) exchange transporter 3 [Salmo salar]
 gi|223647900|gb|ACN10708.1| Chloride channel protein 3 [Salmo salar]
          Length = 796

 Score =  213 bits (543), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 121/332 (36%), Positives = 198/332 (59%), Gaps = 25/332 (7%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L LALI K +  + TFG++VPAG+FIP++ +GA  GR++GI ++ L   + D
Sbjct: 473 GVYAAIWQLCLALIFKIIMTIFTFGLKVPAGLFIPSMAIGAIAGRIVGIAVEQLAYYHHD 532

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + ++   C   +  DC+ PG+YAMVGAAA L GVTR TVSL VI+FELTG L Y++P+M 
Sbjct: 533 WLVFREWCE--VGTDCITPGLYAMVGAAACLGGVTRMTVSLVVIVFELTGGLEYIVPLMA 590

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRD---LEVI 186
           A+M SKWV D   + GIY+  I L G+P+LD+K E+   +TT    +   +R    L V+
Sbjct: 591 AVMTSKWVGDAFGREGIYESHIRLNGYPFLDAKEEF--THTTLAREVMRPRRSDPPLAVL 648

Query: 187 DVNDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTE----LEHALSLAH 239
             +DL T+ EL+  + + S +     GFP++   +++ LVG+    +    +E+A     
Sbjct: 649 TQDDL-TVEELQGIINETSYN-----GFPVIVSKESQRLVGFALRRDITIAIENARRKQE 702

Query: 240 GSDNLTRCYFKDENVI-----DKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVI 294
           G    +R YF            +     + ++ +P T++ +  +EIV+++F+KLGLR  +
Sbjct: 703 GILLTSRVYFTQHAPTLPADSPRPLKLRSILDMSPFTVTDHTPMEIVVDIFRKLGLRQCL 762

Query: 295 VVDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
           V   G+ +G+I KK +L ++ Q+  +D +N +
Sbjct: 763 VTHNGRLLGIITKKDILRHMAQMANQDPDNIM 794



>gi|485920326|gb|EOD46387.1| putative chloride channel protein 5 protein [Neofusicoccum parvum
           UCRNP2]
          Length = 869

 Score =  213 bits (542), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 129/325 (39%), Positives = 198/325 (60%), Gaps = 24/325 (7%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC  +     E   LL ++ +   L   ++FG+ +PAGI +P++ +GA +GR +G++++
Sbjct: 509 GLC-KAGKANTEVITLLIVSAVLGVLLAAVSFGLLIPAGILLPSMAIGALYGRAVGLIVR 567

Query: 62  YLTMTYPD-FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGT 120
            + M++ + FP   T C  +I   CV PG YA++GAA+++ G TR TVS+ VIMFELTG 
Sbjct: 568 VMHMSHKNKFPF--TACEPDI--PCVTPGTYAIIGAASAIGGATRMTVSIVVIMFELTGA 623

Query: 121 LTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQ 180
           LTYVLPIM A+MISKWV D I   GIY+  I   G+P+LD++ + DG++        +  
Sbjct: 624 LTYVLPIMIAVMISKWVGDAISPRGIYEAWIHFNGYPFLDNRDD-DGSSVPDVPASQVMT 682

Query: 181 R--DLEVIDVNDLNTIGELKNKLKKLSTSGYSDAGFPIVDNK---ILVGYIASTELEHAL 235
           R  DL VI     +TI  L++ L     S +S  GFPI+DN    +L+GYI+ TEL +AL
Sbjct: 683 RIEDLVVITATG-HTIQSLRSLL-----SQHSFRGFPIIDNPRDALLLGYISRTELAYAL 736

Query: 236 SLAHGSD-NLT---RCYFKDENVIDK--SANFTAYVNQAPLTISKNASLEIVLELFKKLG 289
           S+A  S  NL+     YF  + + D   S +   +++Q P+T++  ASL++ + +F KLG
Sbjct: 737 SVAISSPRNLSVDAEAYFAHQPLSDPTTSLDLRPWMDQTPITLNAKASLQLTVNMFSKLG 796

Query: 290 LRYVIVVDRGQYVGVINKKRLLIYL 314
           LRYV+  ++G   G++ KK +   L
Sbjct: 797 LRYVVFTEKGCLRGLLTKKDVWFVL 821



>gi|499040239|ref|XP_004570747.1| PREDICTED: H(+)/Cl(-) exchange transporter 3-like isoform X10
           [Maylandia zebra]
          Length = 793

 Score =  213 bits (542), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 120/332 (36%), Positives = 198/332 (59%), Gaps = 25/332 (7%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L LALI K +  + TFG++VP+G+FIP++ +GA  GR++GI M+ L   + D
Sbjct: 470 GVYSAMWQLCLALIFKIIMTIFTFGLKVPSGLFIPSMAIGAIAGRIVGIAMEQLAYYHHD 529

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + ++   C   +  DC+ PG+YAMVGAAA L GVTR TVSL +I+FELTG L Y++P+M 
Sbjct: 530 WFLFKEWCE--VGADCITPGLYAMVGAAACLGGVTRMTVSLVIIVFELTGGLEYIVPLMA 587

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRD---LEVI 186
           A+M SKWV D   + GIY+  I L G+P+LDSK E+   +TT    +   +R+   L V+
Sbjct: 588 AVMTSKWVGDAFGREGIYEAHIRLNGYPFLDSKEEF--THTTLAREVMRPRRNDPPLAVL 645

Query: 187 DVNDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTE----LEHALSLAH 239
             +DL T+ EL+  + + S +     GFP++   +++ LVG+    +    +E+A     
Sbjct: 646 TQDDL-TVEELQGIINETSYN-----GFPVIVSKESQRLVGFALRRDITIAIENARRKQE 699

Query: 240 GSDNLTRCYFKDENVI-----DKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVI 294
           G    +R YF            +     + ++ +P T++ +  +EIV+++F+KLGLR  +
Sbjct: 700 GIVLNSRVYFTQHAPTLPADSPRPLKLRSILDMSPFTVTDHTPMEIVVDIFRKLGLRQCL 759

Query: 295 VVDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
           V   G+ +G+I KK +L ++ Q+  +D  + +
Sbjct: 760 VTHNGRLLGIITKKDILRHMAQMANQDPESIM 791



>gi|511867531|ref|XP_004755175.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform X7 [Mustela
           putorius furo]
 gi|512000381|ref|XP_004817727.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform X7 [Mustela
           putorius furo]
          Length = 698

 Score =  213 bits (542), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 127/354 (35%), Positives = 206/354 (58%), Gaps = 39/354 (11%)

Query: 3   LCD--NSFN--------------GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPAL 46
           LCD  N FN              G++ A + L L LI K +  + TFG+++P+G+FIP++
Sbjct: 352 LCDYENRFNTSKGGELPDRPAGVGVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSM 411

Query: 47  LVGACFGRMLGIVMQYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRS 106
            VGA  GR+LG+ M+ L   + D+ I+++ C+Q    DC+ PG+YAMVGAAA L GVTR 
Sbjct: 412 AVGAIAGRLLGVGMEQLAYYHHDWAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRM 469

Query: 107 TVSLTVIMFELTGTLTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYD 166
           TVSL VIMFELTG L Y++P+M A M SKWVAD + + GIYD  I L G+P+L++K E+ 
Sbjct: 470 TVSLVVIMFELTGGLEYIVPLMAAAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF- 528

Query: 167 GANTTFTTTLDLCQRDLEVIDV--NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKI 221
            A+ T    +   +R+  ++ V   D  T+ +++  + + + S     GFP+V   +++ 
Sbjct: 529 -AHKTLAMDVMKPRRNDPLLTVLTQDSMTVEDVETIISETTYS-----GFPVVVSRESQR 582

Query: 222 LVGYIASTEL----EHALSLAHGSDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTI 272
           LVG++   +L    E+A     G  + +  YF + +                ++ +P T+
Sbjct: 583 LVGFVLRRDLIISIENARKKQDGVVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTV 642

Query: 273 SKNASLEIVLELFKKLGLRYVIVVDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
           +    +EIV+++F+KLGLR  +V   G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 643 TDLTPMEIVVDIFRKLGLRQCLVTHNGRLLGIITKKDVLKHIAQMANQDPDSIL 696



>gi|426257015|ref|XP_004022130.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 3 [Ovis aries]
          Length = 746

 Score =  213 bits (542), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 423 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 482

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 483 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 540

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 541 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 598

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 599 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 653

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 654 VVSTSIIYFTEHSPPVPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 713

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 714 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 744



>gi|195126427|ref|XP_002007672.1| GI13072 [Drosophila mojavensis]
 gi|193919281|gb|EDW18148.1| GI13072 [Drosophila mojavensis]
          Length = 880

 Score =  213 bits (542), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 123/330 (37%), Positives = 199/330 (60%), Gaps = 24/330 (7%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ + +LL L  + K    + TFGI+VP+G+FIP+LL+GA  GR++GI ++    +YP+
Sbjct: 560 GVYRSIWLLVLTFVLKLALTIFTFGIKVPSGLFIPSLLLGAIMGRIVGIGVEQFAYSYPN 619

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
              ++  C    + + + PG+YA+VGAAA L GVTR TVSL VIMFELTG + Y++P+M 
Sbjct: 620 IWFFTGEC---ADSNLITPGLYAVVGAAAVLGGVTRMTVSLVVIMFELTGGVRYIVPLMA 676

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWV D + + GIYD  I L G+P+LDSK E+  A+TT    +   +R+ E ++V 
Sbjct: 677 AAMASKWVGDALGRQGIYDAHIALNGYPFLDSKEEF--AHTTLAADVMQPKRN-ETLNVI 733

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTELE----HALSLAHG 240
             D  T+ +++N LK+   +GY     P+V   +N+ LVG++   +L     +A  L  G
Sbjct: 734 TQDSMTVEDVENLLKETEHNGY-----PVVVSRENQYLVGFVLRRDLNLAIGNAKRLVEG 788

Query: 241 SDNLTRCYFKD----ENVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVV 296
            ++ +   F      +N+          ++ AP+T++    +E V+++F+KLGLR  +V 
Sbjct: 789 INSNSIVLFTSTTPTQNLGPPPLKLKKILDMAPITVTDQTPMETVVDMFRKLGLRQTLVT 848

Query: 297 DRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
             G+ +GVI KK +L +++Q+  +D N  L
Sbjct: 849 HNGRLLGVITKKDVLRHVKQMDNEDPNTVL 878



>gi|171686950|ref|XP_001908416.1| hypothetical protein [Podospora anserina S mat+]
 gi|170943436|emb|CAP69089.1| unnamed protein product [Podospora anserina S mat+]
          Length = 863

 Score =  213 bits (542), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 124/322 (38%), Positives = 194/322 (60%), Gaps = 31/322 (9%)

Query: 17  LLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPDFPIYSTV 76
           LL   LI  FLT +ITFGI+VPAGI++P+++VG   GR +G V+Q+  M   ++P++ T 
Sbjct: 553 LLTAFLIKGFLT-IITFGIKVPAGIYVPSMVVGGLMGRTIGHVVQWWVMATREWPVWGT- 610

Query: 77  CNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMTAIMISKW 136
           C+   +  C+ PGVY ++ A +++ GVTR +V+L VI+FELTG+L YVLP   AI+++KW
Sbjct: 611 CSAT-SATCIQPGVYGLIAAGSTMCGVTRLSVTLAVILFELTGSLDYVLPFSLAILVAKW 669

Query: 137 VADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTL-DLCQ--RDLEVIDVNDLNT 193
           VAD I    IYDLL ++  +P+L++K +       FT+ L D+    R   +ID++    
Sbjct: 670 VADAIEPLSIYDLLTEMNSYPFLNNKHK-----PVFTSELADIVPRVRKERIIDISTSPV 724

Query: 194 IG--ELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHALSLAHGSDNL-----TR 246
           +    L+ KL+ L  +G  D G PIV + ILVG I + +LE+AL      DNL     + 
Sbjct: 725 VPAMSLRTKLELLHRAGELDGGLPIVRHGILVGLIPAPDLEYAL------DNLQDEGSSL 778

Query: 247 CYFKDENVIDKS-------ANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVVDRG 299
           C       ID S        +FT Y++ AP+ +   + +++V E F KLGLRY+ ++  G
Sbjct: 779 CLMASVPTIDDSDDGMPDPTDFTPYIDPAPVALDIRSPMDLVYECFVKLGLRYICILRDG 838

Query: 300 QYVGVINKKRLLIYLRQITGKD 321
           +Y G+ +KK  + Y+R++  K+
Sbjct: 839 KYAGMTHKKTFVKYMRELEEKE 860



>gi|344313157|ref|NP_001230691.1| H(+)/Cl(-) exchange transporter 5 isoform 2 [Mus musculus]
          Length = 816

 Score =  213 bits (542), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 493 GIYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 552

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 553 WGIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 610

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 611 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 668

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 669 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 723

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 724 VVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 783

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 784 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 814



>gi|340727421|ref|XP_003402042.1| PREDICTED: LOW QUALITY PROTEIN: H(+)/Cl(-) exchange transporter
           3-like [Bombus terrestris]
          Length = 871

 Score =  213 bits (542), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 132/330 (40%), Positives = 204/330 (61%), Gaps = 23/330 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G+++A +LL LALI K +  + TFG++VP G+FIP+L +GA  GR++GI M+ L   YP 
Sbjct: 550 GVYKAIWLLVLALILKLVMTIFTFGMKVPCGLFIPSLCLGAIMGRIVGIGMEQLAYNYPH 609

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
             I+S  C+  +  DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG + Y++P+M 
Sbjct: 610 IWIFSEACSTGV--DCITPGLYAMVGAAAVLGGVTRMTVSLVVIMFELTGGVRYIVPLMA 667

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWV D + K GIYD  I L G+P+LDSK E+   +TT    +   +R+ E + V 
Sbjct: 668 AAMASKWVGDALGKQGIYDAHIGLNGYPFLDSKDEFQ--HTTLAADVMQPKRN-EALHVL 724

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTELEHALSLAHG-SDN 243
             D  T+ +++N LK+   +     GFP++   +++ LVG++   +L  A++ A   ++ 
Sbjct: 725 TQDSMTVEDVENLLKETEHN-----GFPVIVSKESQYLVGFVLRRDLNLAIANAKRMTEE 779

Query: 244 LTR---CYFKDENVIDKSA----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVV 296
           +T      F + N I   +         ++ AP+TI+    +E V+++F+KLGLR  +V 
Sbjct: 780 ITGQSLVIFTNGNNIQIHSPPPLKLKKILDMAPITITDQTPMETVVDMFRKLGLRQTLVT 839

Query: 297 DRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
             G+ +GVI KK +L +++Q+  +D N+ L
Sbjct: 840 HNGRLLGVITKKDVLRHVKQLDNEDPNSVL 869



>gi|344240845|gb|EGV96948.1| H(+)/Cl(-) exchange transporter 5 [Cricetulus griseus]
          Length = 809

 Score =  213 bits (542), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 121/332 (36%), Positives = 200/332 (60%), Gaps = 23/332 (6%)

Query: 9   NGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYP 68
            G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + 
Sbjct: 485 KGVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHH 544

Query: 69  DFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIM 128
           D+ I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M
Sbjct: 545 DWGIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLM 602

Query: 129 TAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV 188
            A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V
Sbjct: 603 AAAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTV 660

Query: 189 --NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAH 239
              D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     
Sbjct: 661 LTQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQD 715

Query: 240 GSDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVI 294
           G  + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +
Sbjct: 716 GVVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCL 775

Query: 295 VVDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
           V   G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 776 VTHNGRLLGIITKKDVLKHIAQMANQDPDSIL 807



>gi|354487368|ref|XP_003505845.1| PREDICTED: H(+)/Cl(-) exchange transporter 5-like isoform 2
           [Cricetulus griseus]
          Length = 746

 Score =  213 bits (542), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 121/332 (36%), Positives = 200/332 (60%), Gaps = 23/332 (6%)

Query: 9   NGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYP 68
            G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + 
Sbjct: 422 KGVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHH 481

Query: 69  DFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIM 128
           D+ I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M
Sbjct: 482 DWGIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLM 539

Query: 129 TAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV 188
            A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V
Sbjct: 540 AAAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTV 597

Query: 189 --NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAH 239
              D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     
Sbjct: 598 LTQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQD 652

Query: 240 GSDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVI 294
           G  + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +
Sbjct: 653 GVVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCL 712

Query: 295 VVDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
           V   G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 713 VTHNGRLLGIITKKDVLKHIAQMANQDPDSIL 744



>gi|402079028|gb|EJT74293.1| chloride channel protein 5 [Gaeumannomyces graminis var. tritici
           R3-111a-1]
          Length = 886

 Score =  213 bits (542), Expect = 6e-53,   Method: Compositional matrix adjust.
 Identities = 121/302 (40%), Positives = 176/302 (58%), Gaps = 21/302 (6%)

Query: 17  LLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPDFPIYSTV 76
           LL  A +  F+   ITFG+++PAGI +P++ +GA  GR +GI+M+     +P+F  + + 
Sbjct: 534 LLIFAAMLGFMLSAITFGLQIPAGIILPSMAIGALTGRAVGIIMETWQHNHPNFLPFQS- 592

Query: 77  CNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMTAIMISKW 136
           C  +I   C+ PG YA+VGAAA+LAGVTR TVS+ VIMFELTG LTYVLPIM A+M+SKW
Sbjct: 593 CEPDI--PCITPGTYAIVGAAATLAGVTRMTVSIVVIMFELTGALTYVLPIMVAVMLSKW 650

Query: 137 VADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDVNDLNTIGE 196
           V D   + GIY+  I    +PY+D+  E      TF   +   Q    + D+  L   G 
Sbjct: 651 VGDAFSRRGIYESWIHFNEYPYIDNSEE------TFIPDIPASQIMTRIEDLVVLTAAGH 704

Query: 197 LKNKLKK-LSTSGYSDAGFPIVDNK---ILVGYIASTELEHALSLAHGSDNL----TRCY 248
               L++ L T  Y   GFP+V +    IL+GYI+  EL + L  + G        T  +
Sbjct: 705 TIGSLQRILDTHPYR--GFPVVSDPRDAILLGYISRAELAYNLHTSTGPPRSLPAETEAF 762

Query: 249 FKDENVIDKSA--NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVVDRGQYVGVIN 306
           F  + + D  A  +   +++Q PLT+S  +SL + +  F+KLGLRY++  DRG   G++ 
Sbjct: 763 FSHQPMADPRATLDLRPWMDQTPLTLSSRSSLHLAVSYFQKLGLRYILFSDRGALQGLLT 822

Query: 307 KK 308
           KK
Sbjct: 823 KK 824



>gi|354487366|ref|XP_003505844.1| PREDICTED: H(+)/Cl(-) exchange transporter 5-like isoform 1
           [Cricetulus griseus]
          Length = 816

 Score =  213 bits (542), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 121/332 (36%), Positives = 200/332 (60%), Gaps = 23/332 (6%)

Query: 9   NGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYP 68
            G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + 
Sbjct: 492 KGVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHH 551

Query: 69  DFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIM 128
           D+ I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M
Sbjct: 552 DWGIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLM 609

Query: 129 TAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV 188
            A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V
Sbjct: 610 AAAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTV 667

Query: 189 --NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAH 239
              D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     
Sbjct: 668 LTQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQD 722

Query: 240 GSDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVI 294
           G  + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +
Sbjct: 723 GVVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCL 782

Query: 295 VVDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
           V   G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 783 VTHNGRLLGIITKKDVLKHIAQMANQDPDSIL 814



>gi|358396817|gb|EHK46198.1| hypothetical protein TRIATDRAFT_40094 [Trichoderma atroviride IMI
           206040]
          Length = 860

 Score =  213 bits (541), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 116/332 (34%), Positives = 198/332 (59%), Gaps = 18/332 (5%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC  S + +      L LA + K    VI FGI+VPAGI+IP+++VG   GR++G + Q
Sbjct: 532 GLCPRSMDDIPSILSTLILAFLIKGFLTVIAFGIKVPAGIYIPSMVVGGLMGRIVGHLAQ 591

Query: 62  YLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTL 121
           +L +  P++ ++   C    +G C+ PGVY ++ A A++ GVTR +V+L VI+FELTG+L
Sbjct: 592 WLVLATPEWSVWGG-CATAADGTCIQPGVYGLIAAGATMCGVTRLSVTLAVILFELTGSL 650

Query: 122 TYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTL-DLCQ 180
            YVLP   +I+++KW AD I    IYDLL ++  +P+L++K +       F+  L DL +
Sbjct: 651 DYVLPFSLSILVAKWTADAIEPCSIYDLLTNMNAYPFLNNKDK-----PIFSGDLSDLVR 705

Query: 181 --RDLEVIDVNDLNTI--GELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHALS 236
             R   +ID+ +  ++    L+++L+ L   G  D G PI+ + +LVG I + +L++AL 
Sbjct: 706 RYRRERIIDITNSPSVPASSLRSQLEILHLHGELDGGLPILRDNVLVGLIPAPDLQYALD 765

Query: 237 L------AHGSDNLTRCYFKDENVI-DKSANFTAYVNQAPLTISKNASLEIVLELFKKLG 289
                  +H   +  + + +D++++     +FT Y++ AP+ +   + +++  E F KLG
Sbjct: 766 QLQDEGSSHCLMDQVQSFDEDDDIVGPDPTDFTQYIDPAPVALDIRSPIDLAWECFVKLG 825

Query: 290 LRYVIVVDRGQYVGVINKKRLLIYLRQITGKD 321
           LRY+ V+  G+Y G+I+KK  + Y R++  K 
Sbjct: 826 LRYICVLRDGKYAGMIHKKTFVKYTRELEDKQ 857



>gi|74217072|dbj|BAE26635.1| unnamed protein product [Mus musculus]
          Length = 746

 Score =  213 bits (541), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 423 GIYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 482

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 483 WGIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 540

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 541 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 598

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 599 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 653

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 654 VVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 713

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 714 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 744



>gi|47523078|ref|NP_999304.1| H(+)/Cl(-) exchange transporter 5 [Sus scrofa]
 gi|75056096|sp|Q9GKE7.1|CLCN5_PIG RecName: Full=H(+)/Cl(-) exchange transporter 5; AltName:
           Full=Chloride channel protein 5; Short=ClC-5; AltName:
           Full=Chloride transporter ClC-5
 gi|11078590|gb|AAG29104.1|AF274055_1 outwardly rectifying chloride channel [Sus scrofa]
          Length = 746

 Score =  213 bits (541), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 124/337 (36%), Positives = 199/337 (59%), Gaps = 35/337 (10%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 423 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 482

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 483 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 540

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRD------- 182
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+       
Sbjct: 541 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPSLTVL 598

Query: 183 -LEVIDVNDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHA 234
             + + V D+ TI         +S + YS  GFP+V   +++ LVG++   +L    E+A
Sbjct: 599 TQDSMTVEDVETI---------ISETTYS--GFPVVVSRESQRLVGFVLRRDLIISIENA 647

Query: 235 LSLAHGSDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLG 289
                G  + +  YF + +                ++ +P T++    +EIV+++F+KLG
Sbjct: 648 RKKQDGVVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLG 707

Query: 290 LRYVIVVDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
           LR  +V   G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 708 LRQCLVTHNGRLLGIITKKDVLKHIAQMANQDPDSIL 744



>gi|322795873|gb|EFZ18549.1| hypothetical protein SINV_04521 [Solenopsis invicta]
          Length = 317

 Score =  213 bits (541), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 122/310 (39%), Positives = 191/310 (61%), Gaps = 23/310 (7%)

Query: 30  VITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPDFPIYSTVCNQNINGDCVIPG 89
           + TFG++VP G+FIP+L +GA  GR++GI M+ L   YP   ++S  C+  +  DC+ PG
Sbjct: 16  IFTFGMKVPCGLFIPSLCLGAIMGRIVGIGMEQLAYNYPHIWMFSEECSMGV--DCITPG 73

Query: 90  VYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMTAIMISKWVADGIIKHGIYDL 149
           +YAMVGAAA L GVTR TVSL VIMFELTG + Y++P+M A M SKWV D + K GIYD 
Sbjct: 74  LYAMVGAAAVLGGVTRMTVSLVVIMFELTGGVRYIVPLMAAAMASKWVGDALGKQGIYDA 133

Query: 150 LIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV--NDLNTIGELKNKLKKLSTS 207
            I L G+P+LDSK E+   +TT    +   +R+ E + V   D  T+ +++N LK+   +
Sbjct: 134 HIGLNGYPFLDSKDEFQ--HTTLAADVMQPKRN-EALHVLTQDSMTVEDVENLLKETEHN 190

Query: 208 GYSDAGFPIV---DNKILVGYIASTELEHALSLAHGS-DNLTR---CYFKDENVIDKSA- 259
                GFP++   +++ LVG++   +L  A++ A    ++++R     F + N I   + 
Sbjct: 191 -----GFPVIVSKESQYLVGFVLRRDLNLAIANAKRMIEDISRQSLVIFTNGNNIQSHSP 245

Query: 260 ---NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVVDRGQYVGVINKKRLLIYLRQ 316
                   ++ AP+TI+    +E V+++F+KLGLR  +V   G+ +GVI KK +L +++Q
Sbjct: 246 PPLKLKKILDMAPITITDQTPMETVVDMFRKLGLRQTLVTHNGRLLGVITKKDVLRHVKQ 305

Query: 317 ITGKDMNNTL 326
           +  +D N+ L
Sbjct: 306 LDNEDPNSVL 315



>gi|148701943|gb|EDL33890.1| mCG3960, isoform CRA_b [Mus musculus]
          Length = 677

 Score =  213 bits (541), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 354 GIYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 413

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 414 WGIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 471

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 472 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 529

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 530 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 584

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 585 VVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 644

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 645 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 675



>gi|261823931|ref|NP_057900.3| H(+)/Cl(-) exchange transporter 5 isoform 1 [Mus musculus]
 gi|13124106|sp|Q9WVD4.1|CLCN5_MOUSE RecName: Full=H(+)/Cl(-) exchange transporter 5; AltName:
           Full=Chloride channel protein 5; Short=ClC-5; AltName:
           Full=Chloride transporter ClC-5
 gi|4731365|gb|AAD28473.1| chloride channel 5 [Mus musculus]
          Length = 746

 Score =  213 bits (541), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 423 GIYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 482

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 483 WGIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 540

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 541 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 598

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 599 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 653

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 654 VVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 713

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 714 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 744



>gi|334350497|ref|XP_001363734.2| PREDICTED: H(+)/Cl(-) exchange transporter 5-like isoform 2
           [Monodelphis domestica]
          Length = 809

 Score =  213 bits (541), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 123/333 (36%), Positives = 197/333 (59%), Gaps = 27/333 (8%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L LAL+ K L  + TFG++VP+G+FIP++ VGA  GR+LG+ ++ L   + D
Sbjct: 486 GVYTAMWQLSLALVMKILITIFTFGMKVPSGLFIPSMAVGAIAGRLLGVGVEQLAFYHHD 545

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           +PI+   C+     DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 546 WPIFRGWCSPG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 603

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLE----V 185
           A M SKWVAD I + GIYD  I L G+P+L++K E+    T  T  +D+ +        +
Sbjct: 604 AAMTSKWVADAIGREGIYDAHIRLNGYPFLEAKEEF----THKTLAMDVMRPRRSDPTLM 659

Query: 186 IDVNDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLA 238
           +   D  T+ +++  + + + SGY     P+V   +++ LVG++   +L    E+A    
Sbjct: 660 VLTQDSMTVEDVETLISETTYSGY-----PVVVSRESQRLVGFVLRRDLIISIENARKKQ 714

Query: 239 HGSDNLTRCYFKD-----ENVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYV 293
            G  + +  +F D           S      ++ +P T++    +EIV+++F+KLGLR  
Sbjct: 715 DGIVSTSIIHFTDHSPPLPPHAPPSLKLRNILDLSPFTVTDQTPMEIVVDIFRKLGLRQC 774

Query: 294 IVVDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
           +V   G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 775 LVTHNGRLLGIITKKDVLKHIAQMANQDPDSIL 807



>gi|1705909|sp|P51796.1|CLCN5_RAT RecName: Full=H(+)/Cl(-) exchange transporter 5; AltName:
           Full=Chloride channel protein 5; Short=ClC-5; AltName:
           Full=Chloride transporter ClC-5
 gi|1122330|emb|CAA91216.1| CLC-5 chloride channel protein [Rattus norvegicus]
 gi|149028475|gb|EDL83860.1| chloride channel 5 [Rattus norvegicus]
          Length = 746

 Score =  213 bits (541), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 199/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 423 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 482

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 483 WGIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 540

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 541 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 598

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 599 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 653

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 654 VVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 713

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D  + L
Sbjct: 714 THNGRLLGIITKKDVLKHIAQMANQDPESIL 744



>gi|8393141|ref|NP_058802.1| H(+)/Cl(-) exchange transporter 5 [Rattus norvegicus]
 gi|1549231|dbj|BAA09091.1| chloride channel (ClC-5) [Rattus norvegicus]
          Length = 746

 Score =  212 bits (540), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 199/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 423 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 482

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 483 WGIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 540

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 541 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 598

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 599 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 653

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 654 VVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 713

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D  + L
Sbjct: 714 THNGRLLGIITKKDVLKHIAQMANQDPESIL 744



>gi|23271431|gb|AAH36347.1| Chloride channel 5 [Mus musculus]
          Length = 746

 Score =  212 bits (540), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 423 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 482

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 483 WGIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 540

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 541 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 598

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 599 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 653

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 654 VVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 713

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 714 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 744



>gi|332255569|ref|XP_003276905.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 1 [Nomascus
           leucogenys]
          Length = 816

 Score =  212 bits (540), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 120/331 (36%), Positives = 201/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  V TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + +
Sbjct: 493 GVYSAMWQLALTLILKIVITVFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHQE 552

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + ++++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 553 WTVFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 610

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 611 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 668

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 669 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 723

Query: 241 SDNLTRCYFKDEN-----VIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +         +      ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 724 VVSTSIIYFTEHSPPLPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 783

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 784 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 814



>gi|296235492|ref|XP_002762907.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 1 [Callithrix
           jacchus]
          Length = 816

 Score =  212 bits (540), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 120/331 (36%), Positives = 201/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + +
Sbjct: 493 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHQE 552

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 553 WTIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 610

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 611 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 668

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 669 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 723

Query: 241 SDNLTRCYFKDEN-----VIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +         +      ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 724 VVSTSIIYFTEHSPPLPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 783

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 784 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 814



>gi|344292725|ref|XP_003418076.1| PREDICTED: H(+)/Cl(-) exchange transporter 5-like [Loxodonta
           africana]
          Length = 809

 Score =  212 bits (540), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 199/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  V TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 486 GVYSALWQLALTLILKIVITVFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 545

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 546 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 603

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++   
Sbjct: 604 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTAL 661

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 662 TQDSMTVEDVETIINETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 716

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 717 IVSTSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 776

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 777 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 807



>gi|471378166|ref|XP_004376888.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 3 [Trichechus
           manatus latirostris]
          Length = 786

 Score =  212 bits (540), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 120/331 (36%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 463 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 522

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 523 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 580

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 581 AAMTSKWVADALGREGIYDAHIHLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 638

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  ++ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 639 TQDSMSVEDVETIINETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 693

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 694 IVSTSIIYFTEHSPPVPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 753

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 754 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 784



>gi|297303874|ref|XP_001083186.2| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 4 [Macaca
           mulatta]
 gi|297303876|ref|XP_001083302.2| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 5 [Macaca
           mulatta]
 gi|402910168|ref|XP_003917761.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 1 [Papio
           anubis]
 gi|355757364|gb|EHH60889.1| Chloride transporter ClC-5 [Macaca fascicularis]
          Length = 816

 Score =  212 bits (540), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 120/331 (36%), Positives = 201/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + +
Sbjct: 493 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHQE 552

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 553 WTIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 610

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 611 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 668

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 669 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 723

Query: 241 SDNLTRCYFKDEN-----VIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +         +      ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 724 VVSTSIIYFTEHSPPLPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 783

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 784 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 814



>gi|482806061|gb|EOA83134.1| hypothetical protein SETTUDRAFT_164591 [Setosphaeria turcica Et28A]
          Length = 924

 Score =  212 bits (540), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 124/342 (36%), Positives = 195/342 (57%), Gaps = 30/342 (8%)

Query: 1   DGLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVM 60
           DGLC  +   +     LL  A + K    V+TFGI+VPAGI++P+++VG   GR +G  +
Sbjct: 586 DGLCP-TLEHIPGVLRLLFFAFVIKAGLTVVTFGIKVPAGIYVPSMVVGGLAGRFIGHTV 644

Query: 61  QYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGT 120
           Q + + +    I+S        G CV+PGVYA+V A A++ GVTR +++L VI+FELTG+
Sbjct: 645 QLVALRFSHLGIFSECSPDGPPGSCVVPGVYALVAAGATMTGVTRLSITLAVILFELTGS 704

Query: 121 LTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTL-DL- 178
           L +V+P    I+++KWVAD I    IYDLL D+  +P+LD+K         FT+ L D+ 
Sbjct: 705 LDHVMPFSLGILVAKWVADAIEPLSIYDLLTDMNSYPFLDNKV-----RPIFTSELGDIT 759

Query: 179 -CQRDLEVIDVNDLNTIG--ELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHAL 235
              RD  VID+++ + I   EL+ K + L  +G  D G  IV N  LVG I + +LE AL
Sbjct: 760 PATRDDHVIDISEDSLIPAVELRAKQRALQMAGELDGGLSIVKNGTLVGLIPAPDLEFAL 819

Query: 236 SLAHGSDNLTRCYFKDENVIDKSA----------------NFTAYVNQAPLTISKNASLE 279
                 +N T C       +D +A                +FT Y++ AP+ +  ++ ++
Sbjct: 820 DKLENEEN-TLCLMSPR--VDWAAGREPHDEEEEEAYDPSDFTPYIDPAPVALDVHSPMD 876

Query: 280 IVLELFKKLGLRYVIVVDRGQYVGVINKKRLLIYLRQITGKD 321
           +V E F KLGLRY+ V+  G+Y G+++KK  + Y++++  ++
Sbjct: 877 LVYECFVKLGLRYICVLRDGKYAGLVHKKTFVKYVKELEEQE 918



>gi|296235494|ref|XP_002762908.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 2 [Callithrix
           jacchus]
          Length = 746

 Score =  212 bits (540), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 120/331 (36%), Positives = 201/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + +
Sbjct: 423 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHQE 482

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 483 WTIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 540

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 541 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 598

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 599 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 653

Query: 241 SDNLTRCYFKDEN-----VIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +         +      ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 654 VVSTSIIYFTEHSPPLPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 713

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 714 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 744



>gi|109130778|ref|XP_001083430.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 6 [Macaca
           mulatta]
 gi|402910170|ref|XP_003917762.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 2 [Papio
           anubis]
          Length = 746

 Score =  212 bits (540), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 120/331 (36%), Positives = 201/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + +
Sbjct: 423 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHQE 482

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 483 WTIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 540

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 541 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 598

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 599 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 653

Query: 241 SDNLTRCYFKDEN-----VIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +         +      ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 654 VVSTSIIYFTEHSPPLPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 713

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 714 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 744



>gi|471378162|ref|XP_004376886.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 1 [Trichechus
           manatus latirostris]
 gi|471378164|ref|XP_004376887.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 2 [Trichechus
           manatus latirostris]
          Length = 747

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 120/331 (36%), Positives = 200/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 424 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 483

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 484 WAIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 541

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 542 AAMTSKWVADALGREGIYDAHIHLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 599

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  ++ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 600 TQDSMSVEDVETIINETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 654

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 655 IVSTSIIYFTEHSPPVPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 714

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 715 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 745



>gi|410056473|ref|XP_003317509.2| PREDICTED: LOW QUALITY PROTEIN: H(+)/Cl(-) exchange transporter 5
           [Pan troglodytes]
          Length = 883

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 119/331 (35%), Positives = 201/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + +
Sbjct: 509 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHQE 568

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + ++++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 569 WTVFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 626

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 627 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 684

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 685 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 739

Query: 241 SDNLTRCYFKDEN-----VIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +         +      ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 740 VVSTSIIYFTEHSPPLPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 799

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 800 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 830



>gi|6467501|gb|AAF13167.1|AF173174_1 CLC chloride channel protein [Caenorhabditis elegans]
          Length = 796

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 133/340 (39%), Positives = 193/340 (56%), Gaps = 30/340 (8%)

Query: 1   DGLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVM 60
           D LCD +   +  AF  L  ALI KF+  + TFGI+VP G+F+P++ +GA  GR+LGI +
Sbjct: 457 DSLCDQN-KALSIAFGQLLWALIFKFVITIFTFGIKVPCGLFVPSIGMGAIAGRILGITV 515

Query: 61  QYLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGT 120
             +       P +S      I  DCV+PG+YAMVGAAA L GVTR TVSL VIMFELTG+
Sbjct: 516 DQIFRAVQATPGHSDYFTCQIGKDCVMPGLYAMVGAAAVLGGVTRMTVSLVVIMFELTGS 575

Query: 121 LTYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQ 180
           L +++P M A M SKW+ DGI K GIY+  I+L G+P+LDSK EY  +            
Sbjct: 576 LEFIVPTMVATMFSKWIGDGISKMGIYEAHIELNGYPFLDSKGEYPYSTVASQVMRPSIH 635

Query: 181 RDLEVIDVNDLNTIGELKNKLKKLSTSGYSDA------------GFPIV---DNKILVGY 225
           R  +V D   ++ + ELKN+L  ++ SG +              GFP+V   ++  LVG+
Sbjct: 636 R--QVADEMSMSDLRELKNELSVITESGMTLGDLESLLRQTDFNGFPVVVSQNSMHLVGF 693

Query: 226 IASTELEHALSLAHGSDNL----TRCYFKDENVIDKSANFTA------YVNQAPLTISKN 275
           I   ++  AL  A  +       +  YF D  V D      A       ++ AP+T++  
Sbjct: 694 I-RRDILLALHTARKTQPYVVTNSIAYFSD-GVPDAMPGGPAPLRLRKILDMAPMTVTDQ 751

Query: 276 ASLEIVLELFKKLGLRYVIVVDRGQYVGVINKKRLLIYLR 315
             +E V+++F+KLGLR+V+V   G+ +G+I KK +L ++R
Sbjct: 752 TPMETVIDMFRKLGLRHVLVTKNGKVLGIITKKDILQFMR 791



>gi|332255573|ref|XP_003276907.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 3 [Nomascus
           leucogenys]
          Length = 746

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 120/331 (36%), Positives = 201/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  V TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + +
Sbjct: 423 GVYSAMWQLALTLILKIVITVFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHQE 482

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + ++++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 483 WTVFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 540

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 541 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 598

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 599 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 653

Query: 241 SDNLTRCYFKDEN-----VIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +         +      ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 654 VVSTSIIYFTEHSPPLPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 713

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 714 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 744



>gi|330930492|ref|XP_003303055.1| hypothetical protein PTT_15085 [Pyrenophora teres f. teres 0-1]
 gi|311321229|gb|EFQ88852.1| hypothetical protein PTT_15085 [Pyrenophora teres f. teres 0-1]
          Length = 883

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 125/305 (40%), Positives = 185/305 (60%), Gaps = 22/305 (7%)

Query: 17  LLGLALISKFLTCVI---TFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPDFPIY 73
           ++ L LIS  L  ++   TFG+++PAGI +P++ +G  FGR +G+ MQ +   +P   ++
Sbjct: 529 VIALLLISAALGVILASFTFGLQIPAGIILPSMAIGGLFGRAVGLTMQVIQGAWPTLFVF 588

Query: 74  STVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMTAIMI 133
            + C  ++   CV PG YA+VGAAA+LAG TR TVS+ VIMFELTG LTYVLPIM A+MI
Sbjct: 589 KS-CEPDVT--CVTPGTYAIVGAAAALAGTTRMTVSIVVIMFELTGALTYVLPIMIAVMI 645

Query: 134 SKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQ-RDLEVIDVNDLN 192
           SKW+ D I   GIY+  I   G+P+LD++ E  GA    + +  + +  DL  I     +
Sbjct: 646 SKWIGDAIAPRGIYESWIQFKGYPFLDNRDEDGGAIPDVSASHVMTRIEDLTAITATG-H 704

Query: 193 TIGELKNKLKKLSTSGYSDAGFPIVDNK---ILVGYIASTELEHALSLAHGSDN----LT 245
           TIG L+  L     S Y   GFP++DN    +L+GYI+ TEL++AL  A          T
Sbjct: 705 TIGSLRQML-----SQYRFRGFPVIDNSRDALLLGYISRTELQYALQTAVTPPRDLAAET 759

Query: 246 RCYFKDENVIDK--SANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVVDRGQYVG 303
             YF  + + D   S +   +++Q P+T++  AS ++ + +F+KLGLRYV+  DRG   G
Sbjct: 760 EAYFAHQPLSDPTTSLDLRPWMDQTPITLNARASFQLTVSMFQKLGLRYVLFTDRGMLKG 819

Query: 304 VINKK 308
           ++ KK
Sbjct: 820 LLTKK 824



>gi|296235496|ref|XP_002762909.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 3 [Callithrix
           jacchus]
          Length = 769

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 120/331 (36%), Positives = 201/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + +
Sbjct: 446 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHQE 505

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 506 WTIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 563

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 564 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 621

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 622 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 676

Query: 241 SDNLTRCYFKDEN-----VIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +         +      ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 677 VVSTSIIYFTEHSPPLPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 736

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 737 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 767



>gi|292625629|ref|XP_001920783.2| PREDICTED: H(+)/Cl(-) exchange transporter 5-like [Danio rerio]
          Length = 811

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 121/331 (36%), Positives = 200/331 (60%), Gaps = 25/331 (7%)

Query: 11  MFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPDF 70
           ++ A + L LALI K L  V+TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D+
Sbjct: 489 VYTAMWQLSLALIFKMLITVVTFGMKLPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHDW 548

Query: 71  PIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMTA 130
            I+   C+     DC+ PG+YAMVGA A L GVTR TVSL VIMFELTG L Y++P+M A
Sbjct: 549 VIFRGWCSPG--ADCITPGLYAMVGATACLGGVTRMTVSLVVIMFELTGGLEYIVPLMAA 606

Query: 131 IMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRD---LEVID 187
            M SKWVAD + + GIY+  I L G+P+L+SK E+  ++ T    +   +R    L VI 
Sbjct: 607 TMTSKWVADALGREGIYEAHIRLNGYPFLESKEEF--SHKTLAMDVMRPRRSDPPLSVIT 664

Query: 188 VNDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
            + +N + E+++ + + S S     GFP+V   +++ LVG++   +L    ++A     G
Sbjct: 665 QDGMN-VEEVESLIAETSYS-----GFPVVVSHESQRLVGFVQRRDLVISIDNARQRQEG 718

Query: 241 SDNLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +R +F +                  ++ +P T++ + +++IV+++F+KLGLR  +V
Sbjct: 719 VVSASRIFFTEYTPPQPPNSPPPLKLRGIMDLSPFTVTDHTAMDIVVDIFRKLGLRQCLV 778

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 779 THNGRLLGIITKKDILKHMAQMANRDPDSIL 809



>gi|332255571|ref|XP_003276906.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 2 [Nomascus
           leucogenys]
          Length = 766

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 120/331 (36%), Positives = 201/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  V TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + +
Sbjct: 443 GVYSAMWQLALTLILKIVITVFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHQE 502

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + ++++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 503 WTVFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 560

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 561 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 618

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 619 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 673

Query: 241 SDNLTRCYFKDEN-----VIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +         +      ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 674 VVSTSIIYFTEHSPPLPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 733

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 734 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 764



>gi|507573060|ref|XP_004670117.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform X1 [Jaculus
           jaculus]
          Length = 816

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 118/329 (35%), Positives = 192/329 (58%), Gaps = 19/329 (5%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 493 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 552

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 553 WGIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 610

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDVN 189
           A M SKWVAD + + GIYD  I L G+P+L++K E+                 L  +   
Sbjct: 611 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEFSHKTLAMDVMKPRRNDPLLTVLTQ 670

Query: 190 DLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHGSD 242
           D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G  
Sbjct: 671 DSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGVV 725

Query: 243 NLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVVD 297
           + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V  
Sbjct: 726 STSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLVTH 785

Query: 298 RGQYVGVINKKRLLIYLRQITGKDMNNTL 326
            G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 786 NGRLLGIITKKDVLKHIAQMANQDPDSIL 814



>gi|195019841|ref|XP_001985066.1| GH16850 [Drosophila grimshawi]
 gi|193898548|gb|EDV97414.1| GH16850 [Drosophila grimshawi]
          Length = 884

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 123/330 (37%), Positives = 199/330 (60%), Gaps = 24/330 (7%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ + +LL +  I K    + TFGI+VP+G+FIP+LL+GA  GR++GI ++    +YP+
Sbjct: 564 GVYRSIWLLVVTFILKLALTIFTFGIKVPSGLFIPSLLLGAIMGRIVGIGVEQFAYSYPN 623

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
              ++  C    + + + PG+YA+VGAAA L GVTR TVSL VIMFELTG + Y++P+M 
Sbjct: 624 IWFFTGEC---ADSNLITPGLYAVVGAAAVLGGVTRMTVSLVVIMFELTGGVRYIVPLMA 680

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWV D + + GIYD  I L G+P+LDSK E+  A+TT    +   +R+ E ++V 
Sbjct: 681 AAMASKWVGDALGRQGIYDAHIALNGYPFLDSKEEF--AHTTLAADVMQPKRN-ETLNVI 737

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTELE----HALSLAHG 240
             D  T+ +++N LK+   +GY     P+V   +N+ LVG++   +L     +A  L  G
Sbjct: 738 TQDSMTVDDVENMLKETEHNGY-----PVVVSRENQYLVGFVLRRDLNLAIGNAKRLIDG 792

Query: 241 SDNLTRCYFKD----ENVIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVV 296
            ++ +   F      +N+          ++ AP+T++    +E V+++F+KLGLR  +V 
Sbjct: 793 INSNSIVLFTSTTPTQNLGPPPLKLKKILDMAPITVTDQTPMETVVDMFRKLGLRQTLVT 852

Query: 297 DRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
             G+ +GVI KK +L +++Q+  +D N  L
Sbjct: 853 HNGRLLGVITKKDVLRHVKQMDNEDPNTVL 882



>gi|355704805|gb|EHH30730.1| Chloride transporter ClC-5, partial [Macaca mulatta]
          Length = 762

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 120/331 (36%), Positives = 201/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + +
Sbjct: 439 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHQE 498

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 499 WTIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 556

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 557 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 614

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 615 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 669

Query: 241 SDNLTRCYFKDEN-----VIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +         +      ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 670 VVSTSIIYFTEHSPPLPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 729

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 730 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 760



>gi|507573062|ref|XP_004670118.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform X2 [Jaculus
           jaculus]
          Length = 746

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 118/329 (35%), Positives = 192/329 (58%), Gaps = 19/329 (5%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 423 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 482

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 483 WGIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 540

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDVN 189
           A M SKWVAD + + GIYD  I L G+P+L++K E+                 L  +   
Sbjct: 541 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEFSHKTLAMDVMKPRRNDPLLTVLTQ 600

Query: 190 DLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHGSD 242
           D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G  
Sbjct: 601 DSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGVV 655

Query: 243 NLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVVD 297
           + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V  
Sbjct: 656 STSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLVTH 715

Query: 298 RGQYVGVINKKRLLIYLRQITGKDMNNTL 326
            G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 716 NGRLLGIITKKDVLKHIAQMANQDPDSIL 744



>gi|189217921|ref|NP_001121370.1| H(+)/Cl(-) exchange transporter 5 isoform a [Homo sapiens]
 gi|189217923|ref|NP_001121371.1| H(+)/Cl(-) exchange transporter 5 isoform a [Homo sapiens]
 gi|397468686|ref|XP_003806005.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 1 [Pan
           paniscus]
 gi|397468688|ref|XP_003806006.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 2 [Pan
           paniscus]
          Length = 816

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 119/331 (35%), Positives = 201/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + +
Sbjct: 493 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHQE 552

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + ++++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 553 WTVFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 610

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 611 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 668

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 669 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 723

Query: 241 SDNLTRCYFKDEN-----VIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +         +      ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 724 VVSTSIIYFTEHSPPLPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 783

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 784 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 814



>gi|297303879|ref|XP_001083068.2| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 3 [Macaca
           mulatta]
 gi|402910172|ref|XP_003917763.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 3 [Papio
           anubis]
          Length = 766

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 120/331 (36%), Positives = 201/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + +
Sbjct: 443 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHQE 502

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 503 WTIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 560

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 561 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 618

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 619 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 673

Query: 241 SDNLTRCYFKDEN-----VIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +         +      ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 674 VVSTSIIYFTEHSPPLPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 733

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 734 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 764



>gi|403297565|ref|XP_003939632.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 1 [Saimiri
           boliviensis boliviensis]
 gi|403297567|ref|XP_003939633.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 2 [Saimiri
           boliviensis boliviensis]
          Length = 816

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 119/331 (35%), Positives = 201/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + +
Sbjct: 493 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHQE 552

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + ++++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 553 WTVFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 610

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 611 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 668

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 669 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 723

Query: 241 SDNLTRCYFKDEN-----VIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +         +      ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 724 VVSTSIIYFTEHSPPLPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 783

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 784 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 814



>gi|507573064|ref|XP_004670119.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform X3 [Jaculus
           jaculus]
          Length = 719

 Score =  212 bits (539), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 118/329 (35%), Positives = 192/329 (58%), Gaps = 19/329 (5%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + D
Sbjct: 396 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHHD 455

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 456 WGIFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 513

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDVN 189
           A M SKWVAD + + GIYD  I L G+P+L++K E+                 L  +   
Sbjct: 514 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEFSHKTLAMDVMKPRRNDPLLTVLTQ 573

Query: 190 DLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHGSD 242
           D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G  
Sbjct: 574 DSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDGVV 628

Query: 243 NLTRCYFKDENVIDKSA-----NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVVD 297
           + +  YF + +                ++ +P T++    +EIV+++F+KLGLR  +V  
Sbjct: 629 STSIIYFTEHSPPMPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLVTH 688

Query: 298 RGQYVGVINKKRLLIYLRQITGKDMNNTL 326
            G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 689 NGRLLGIITKKDVLKHIAQMANQDPDSIL 717



>gi|27543516|dbj|BAC54560.1| clcn3e [Homo sapiens]
          Length = 810

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 119/322 (36%), Positives = 190/322 (59%), Gaps = 21/322 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L LALI K +  V TFGI+VP+G+FIP++ +GA  GR++GI ++ L   + D
Sbjct: 437 GVYSAIWQLCLALIFKIIMTVFTFGIKVPSGLFIPSMAIGAIAGRIVGIAVEQLAYYHHD 496

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + I+   C   +  DC+ PG+YAMVGAAA L GVTR TVSL VI+FELTG L Y++P+M 
Sbjct: 497 WFIFKEWCE--VGADCITPGLYAMVGAAACLGGVTRMTVSLVVIVFELTGGLEYIVPLMA 554

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A+M SKWV D   + GIY+  I L G+P+LD+K E++  +TT    +   +R+   + V 
Sbjct: 555 AVMTSKWVGDAFGREGIYEAHIRLNGYPFLDAKEEFEFTHTTLAADVMRPRRNDPPLAVL 614

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++N + + S +     GFP++   +++ LVG+    +L    E A     G
Sbjct: 615 TQDNMTVDDIENMINETSYN-----GFPVIMSKESQRLVGFALRRDLTIAIESARKKQEG 669

Query: 241 SDNLTRCYFKDENV-----IDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
               +R  F            +     + ++ +P T++ +  +EIV+++F+KLGLR  +V
Sbjct: 670 IVGSSRVCFAQHTPSLPAESPRPLKLRSILDMSPFTVTDHTPMEIVVDIFRKLGLRQCLV 729

Query: 296 VDRGQYVGVINKKRLLIYLRQI 317
              G  +G+I KK +L +L Q+
Sbjct: 730 THNGIVLGIITKKNILEHLEQL 751



>gi|4557473|ref|NP_000075.1| H(+)/Cl(-) exchange transporter 5 isoform b [Homo sapiens]
 gi|197099522|ref|NP_001127343.1| H(+)/Cl(-) exchange transporter 5 [Pongo abelii]
 gi|397468690|ref|XP_003806007.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 3 [Pan
           paniscus]
 gi|1705908|sp|P51795.1|CLCN5_HUMAN RecName: Full=H(+)/Cl(-) exchange transporter 5; AltName:
           Full=Chloride channel protein 5; Short=ClC-5; AltName:
           Full=Chloride transporter ClC-5
 gi|75055074|sp|Q5RBK4.1|CLCN5_PONAB RecName: Full=H(+)/Cl(-) exchange transporter 5; AltName:
           Full=Chloride channel protein 5; Short=ClC-5; AltName:
           Full=Chloride transporter ClC-5
 gi|1171562|emb|CAA63000.1| voltage-gated chloride ion channel [Homo sapiens]
 gi|55728218|emb|CAH90856.1| hypothetical protein [Pongo abelii]
 gi|120659868|gb|AAI30430.1| CLCN5 protein [Homo sapiens]
 gi|120660212|gb|AAI30432.1| CLCN5 protein [Homo sapiens]
 gi|313883828|gb|ADR83400.1| chloride channel 5 (CLCN5), transcript variant 3 [synthetic
           construct]
          Length = 746

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 119/331 (35%), Positives = 201/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + +
Sbjct: 423 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHQE 482

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + ++++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 483 WTVFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 540

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 541 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 598

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 599 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 653

Query: 241 SDNLTRCYFKDEN-----VIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +         +      ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 654 VVSTSIIYFTEHSPPLPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 713

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 714 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 744



>gi|193786465|dbj|BAG51748.1| unnamed protein product [Homo sapiens]
          Length = 816

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 119/331 (35%), Positives = 201/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + +
Sbjct: 493 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHQE 552

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + ++++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 553 WTVFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 610

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 611 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 668

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 669 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 723

Query: 241 SDNLTRCYFKDEN-----VIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +         +      ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 724 VVSTSIIYFTEHSPPLPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 783

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 784 THNGRLLGIITKKDVLKHVAQMANQDPDSIL 814



>gi|367026860|ref|XP_003662714.1| hypothetical protein MYCTH_2303682 [Myceliophthora thermophila ATCC
           42464]
 gi|347009983|gb|AEO57469.1| hypothetical protein MYCTH_2303682 [Myceliophthora thermophila ATCC
           42464]
          Length = 901

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 121/337 (35%), Positives = 195/337 (57%), Gaps = 29/337 (8%)

Query: 2   GLCDNSFNGMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQ 61
           GLC      +      L  A + K +  +ITFGI++PAGI++P+++VG   GR++G V+Q
Sbjct: 574 GLCPEEIGDIPPILMNLFSAFLIKGVLTIITFGIKLPAGIYVPSMVVGGLMGRLVGHVVQ 633

Query: 62  YLTMTYPDFPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTL 121
           ++ M  PD+ I+ T C +  N  C+ PGVY ++ A +++ GVTR +V+L VI+FELTG+L
Sbjct: 634 WVVMATPDWSIWGT-CAKMPNATCIQPGVYGLIAAGSTMCGVTRLSVTLAVILFELTGSL 692

Query: 122 TYVLPIMTAIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTL-DLCQ 180
            YVLP   AI+++KW AD I    IYDLL ++  +P+L++K +       FT+ L D+  
Sbjct: 693 DYVLPFSLAILVAKWTADAIEPLSIYDLLTNMNSYPFLNNKHK-----PIFTSDLADIVP 747

Query: 181 --RDLEVIDVNDLNTI--GELKNKLKKLSTSGYSDAGFPIVDNKILVGYIASTELEHALS 236
             R   +ID+ +   +    L+ KL+ L  +G  D G PI+ + +LVG I + +LE+AL 
Sbjct: 748 RVRKERIIDITNSPVVPAPSLRAKLELLHKAGELDGGLPIIRDGVLVGLIPAPDLEYAL- 806

Query: 237 LAHGSDNL-----TRCYFKDENVI-------DKSANFTAYVNQAPLTISKNASLEIVLEL 284
                DNL     + C       I           +FT Y++ AP+ +   + +++V E 
Sbjct: 807 -----DNLRDEASSLCLMAPVPRIDDSDDGSPDPTDFTPYIDPAPVALDIRSPMDLVYEC 861

Query: 285 FKKLGLRYVIVVDRGQYVGVINKKRLLIYLRQITGKD 321
           F KLGLRY+ V+  G+Y G+ +KK  + Y+R++  K+
Sbjct: 862 FVKLGLRYICVLRDGKYAGMTHKKTFVKYMRELEEKE 898



>gi|307183977|gb|EFN70548.1| Chloride channel protein 3 [Camponotus floridanus]
          Length = 831

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 122/310 (39%), Positives = 191/310 (61%), Gaps = 23/310 (7%)

Query: 30  VITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPDFPIYSTVCNQNINGDCVIPG 89
           + TFG++VP G+FIP+L +GA  GR++GI M+ L   YP   ++S  C+  +  DC+ PG
Sbjct: 530 IFTFGMKVPCGLFIPSLCLGAIMGRIVGIGMEQLAYNYPHIWMFSEECSMGV--DCITPG 587

Query: 90  VYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMTAIMISKWVADGIIKHGIYDL 149
           +YAMVGAAA L GVTR TVSL VIMFELTG + Y++P+M A M SKWV D + K GIYD 
Sbjct: 588 LYAMVGAAAVLGGVTRMTVSLVVIMFELTGGVRYIVPLMAAAMASKWVGDALGKQGIYDA 647

Query: 150 LIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV--NDLNTIGELKNKLKKLSTS 207
            I L G+P+LDSK E+   +TT    +   +R+ E + V   D  T+ +++N LK+   +
Sbjct: 648 HIGLNGYPFLDSKDEFQ--HTTLAADVMQPKRN-EALHVLTQDSMTVEDVENLLKETEHN 704

Query: 208 GYSDAGFPIV---DNKILVGYIASTELEHALSLAHGS-DNLTR---CYFKDENVIDKSA- 259
                GFP++   +++ LVG++   +L  A++ A    ++++R     F + N I   + 
Sbjct: 705 -----GFPVIVSKESQYLVGFVLRRDLNLAIANAKRMIEDISRQSLVIFTNGNNIQSHSP 759

Query: 260 ---NFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIVVDRGQYVGVINKKRLLIYLRQ 316
                   ++ AP+TI+    +E V+++F+KLGLR  +V   G+ +GVI KK +L +++Q
Sbjct: 760 PPLKLKKILDMAPITITDQTPMETVVDMFRKLGLRQTLVTHNGRLLGVITKKDVLRHVKQ 819

Query: 317 ITGKDMNNTL 326
           +  +D N+ L
Sbjct: 820 LDNEDPNSVL 829



>gi|158255316|dbj|BAF83629.1| unnamed protein product [Homo sapiens]
          Length = 746

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 119/331 (35%), Positives = 201/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + +
Sbjct: 423 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHQE 482

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + ++++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 483 WTVFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 540

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 541 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 598

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 599 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 653

Query: 241 SDNLTRCYFKDEN-----VIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +         +      ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 654 VVSTSIIYFTEHSPPLPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 713

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 714 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 744



>gi|403297569|ref|XP_003939634.1| PREDICTED: H(+)/Cl(-) exchange transporter 5 isoform 3 [Saimiri
           boliviensis boliviensis]
          Length = 746

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 119/331 (35%), Positives = 201/331 (60%), Gaps = 23/331 (6%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A + L L LI K +  + TFG+++P+G+FIP++ VGA  GR+LG+ M+ L   + +
Sbjct: 423 GVYSAMWQLALTLILKIVITIFTFGMKIPSGLFIPSMAVGAIAGRLLGVGMEQLAYYHQE 482

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
           + ++++ C+Q    DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG L Y++P+M 
Sbjct: 483 WTVFNSWCSQG--ADCITPGLYAMVGAAACLGGVTRMTVSLVVIMFELTGGLEYIVPLMA 540

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRDLEVIDV- 188
           A M SKWVAD + + GIYD  I L G+P+L++K E+  A+ T    +   +R+  ++ V 
Sbjct: 541 AAMTSKWVADALGREGIYDAHIRLNGYPFLEAKEEF--AHKTLAMDVMKPRRNDPLLTVL 598

Query: 189 -NDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTEL----EHALSLAHG 240
             D  T+ +++  + + + S     GFP+V   +++ LVG++   +L    E+A     G
Sbjct: 599 TQDSMTVEDVETIISETTYS-----GFPVVVSRESQRLVGFVLRRDLIISIENARKKQDG 653

Query: 241 SDNLTRCYFKDEN-----VIDKSANFTAYVNQAPLTISKNASLEIVLELFKKLGLRYVIV 295
             + +  YF + +         +      ++ +P T++    +EIV+++F+KLGLR  +V
Sbjct: 654 VVSTSIIYFTEHSPPLPPYTPPTLKLRNILDLSPFTVTDLTPMEIVVDIFRKLGLRQCLV 713

Query: 296 VDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
              G+ +G+I KK +L ++ Q+  +D ++ L
Sbjct: 714 THNGRLLGIITKKDVLKHIAQMANQDPDSIL 744



>gi|512900637|ref|XP_004924939.1| PREDICTED: H(+)/Cl(-) exchange transporter 3-like [Bombyx mori]
          Length = 827

 Score =  211 bits (538), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 125/334 (37%), Positives = 200/334 (59%), Gaps = 31/334 (9%)

Query: 10  GMFEAFYLLGLALISKFLTCVITFGIRVPAGIFIPALLVGACFGRMLGIVMQYLTMTYPD 69
           G++ A +LL LAL+ K +  + TFGI+VP G+FIP+L +GA  GR++GI ++ +  TYP 
Sbjct: 506 GVYRAIWLLVLALVFKLVVTIFTFGIKVPCGLFIPSLALGAIAGRIVGIGVEQMAYTYPK 565

Query: 70  FPIYSTVCNQNINGDCVIPGVYAMVGAAASLAGVTRSTVSLTVIMFELTGTLTYVLPIMT 129
             ++S  C+     DC+ PG+YAMVGAAA L GVTR TVSL VIMFELTG + Y++P+M 
Sbjct: 566 IWLFSGECSTG--DDCITPGLYAMVGAAAVLGGVTRMTVSLVVIMFELTGGVRYIVPLMA 623

Query: 130 AIMISKWVADGIIKHGIYDLLIDLGGHPYLDSKTEYDGANTTFTTTLDLCQRD--LEVID 187
           A M SKWV D + + GIYD  I L G+P+LDSK E+   +T+    +   +R+  L VI 
Sbjct: 624 AAMASKWVGDALGRQGIYDAHIALNGYPFLDSKDEFQ--HTSLAADVMQPKRNETLSVI- 680

Query: 188 VNDLNTIGELKNKLKKLSTSGYSDAGFPIV---DNKILVGYIASTELEHALSLAHGSDNL 244
             D  T+ +++  LK+   +GY     P+V   +++ LVG++    L   L+LA  +   
Sbjct: 681 TQDSMTVDDVETLLKETEHNGY-----PVVVSKESQYLVGFV----LRRDLNLAIANARR 731

Query: 245 TRCYFKDENVIDKSAN------------FTAYVNQAPLTISKNASLEIVLELFKKLGLRY 292
           T      ++V+  + N             +  ++ AP+T++    +E V+++F+KLGLR 
Sbjct: 732 TIEGITGQSVVIFAGNVAPPPGPPPYLQLSRILDMAPITVTDQTPMETVVDMFRKLGLRQ 791

Query: 293 VIVVDRGQYVGVINKKRLLIYLRQITGKDMNNTL 326
            +V   G+ +GVI KK +L +++ +  +D ++ +
Sbjct: 792 TLVTHNGRLLGVITKKDVLRHVKHMDNEDPSSVM 825