BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10197_c0_seq1-m.82 5prime_partial 2-1564(+) 521 (+)
         (520 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|162135180|gb|ABX82699.1| malic enzyme [Umbelopsis isabellina]      608   e-171   Umbelopsis isabellina
gi|511005084|gb|EPB86434.1| hypothetical protein HMPREF1544_0679...   606   e-171   Mucor circinelloides f. circinelloides 1006PhL
gi|384488567|gb|EIE80747.1| hypothetical protein RO3G_05452 [Rhi...   587   e-165   Rhizopus delemar RA 99-880
gi|120564457|gb|ABM30154.1| malic enzyme protein 2 [Mortierella ...   586   e-165   Mortierella alpina
gi|384494191|gb|EIE84682.1| hypothetical protein RO3G_09392 [Rhi...   584   e-164   Rhizopus delemar RA 99-880
gi|511009818|gb|EPB91051.1| hypothetical protein HMPREF1544_0212...   580   e-163   Mucor circinelloides f. circinelloides 1006PhL
gi|121495966|gb|ABM45933.1| malic enzyme [Mucor circinelloides]       560   e-157   Mucor circinelloides
gi|511011356|gb|EPB92567.1| hypothetical protein HMPREF1544_0058...   531   e-148   Mucor circinelloides f. circinelloides 1006PhL
gi|347832297|emb|CCD47994.1| hypothetical protein BofuT4_P113040...   466   e-129   Botrytis cinerea T4
gi|154302961|ref|XP_001551889.1| hypothetical protein BC1G_09224...   466   e-129   Botrytis cinerea B05.10
gi|472245557|gb|EMR90126.1| putative nadp-dependent malic enzyme...   465   e-128   Botrytis cinerea BcDW1
gi|367025765|ref|XP_003662167.1| hypothetical protein MYCTH_2302...   464   e-128   Myceliophthora thermophila ATCC 42464
gi|367038781|ref|XP_003649771.1| hypothetical protein THITE_2108...   461   e-127   Thielavia terrestris NRRL 8126
gi|345568542|gb|EGX51435.1| hypothetical protein AOL_s00054g134 ...   459   e-127   Arthrobotrys oligospora ATCC 24927
gi|302663795|ref|XP_003023535.1| malate dehydrogenase, putative ...   458   e-126   Trichophyton verrucosum HKI 0517
gi|326471119|gb|EGD95128.1| NADP-dependent malic enzyme MaeA [Tr...   458   e-126   Trichophyton tonsurans CBS 112818
gi|302509976|ref|XP_003016948.1| malate dehydrogenase, putative ...   458   e-126   Arthroderma benhamiae CBS 112371
gi|327302642|ref|XP_003236013.1| NAD-dependent malic enzyme [Tri...   457   e-126   Trichophyton rubrum CBS 118892
gi|340914859|gb|EGS18200.1| malic enzyme-like protein [Chaetomiu...   456   e-126   Chaetomium thermophilum var. thermophilum DSM 1495
gi|116197989|ref|XP_001224806.1| hypothetical protein CHGG_07150...   456   e-125   Chaetomium globosum CBS 148.51
gi|315040924|ref|XP_003169839.1| NAD-dependent malic enzyme [Art...   454   e-125   Microsporum gypseum CBS 118893
gi|346974189|gb|EGY17641.1| NADP-dependent malic enzyme [Vertici...   454   e-125   Verticillium dahliae VdLs.17
gi|171693999|ref|XP_001911924.1| hypothetical protein [Podospora...   454   e-125   Podospora anserina S mat+
gi|296813573|ref|XP_002847124.1| malic enzyme [Arthroderma otae ...   453   e-125   Arthroderma otae CBS 113480
gi|336274679|ref|XP_003352093.1| hypothetical protein SMAC_02528...   453   e-125   Sordaria macrospora k-hell
gi|296414462|ref|XP_002836919.1| hypothetical protein [Tuber mel...   452   e-124   Tuber melanosporum Mel28
gi|453084827|gb|EMF12871.1| NADP-dependent malic enzyme [Mycosph...   452   e-124   Sphaerulina musiva SO2202
gi|310794313|gb|EFQ29774.1| malic enzyme [Glomerella graminicola...   451   e-124   Colletotrichum graminicola M1.001
gi|164426796|ref|XP_960731.2| hypothetical protein NCU03651 [Neu...   451   e-124   
gi|512187180|gb|EPE02962.1| malic enzyme [Ophiostoma piceae UAMH...   451   e-124   Ophiostoma piceae UAMH 11346
gi|16944467|emb|CAC18164.2| related to malate dehydrogenase (oxa...   450   e-124   Neurospora crassa
gi|336473113|gb|EGO61273.1| hypothetical protein NEUTE1DRAFT_771...   449   e-124   Neurospora tetrasperma FGSC 2508
gi|471562229|gb|EMR63785.1| putative nadp-dependent malic enzyme...   449   e-124   Eutypa lata UCREL1
gi|350293635|gb|EGZ74720.1| hypothetical protein NEUTE2DRAFT_823...   449   e-124   Neurospora tetrasperma FGSC 2509
gi|477530946|gb|ENH82671.1| nadp-dependent malic enzyme [Colleto...   449   e-124   Colletotrichum orbiculare MAFF 240422
gi|501309949|dbj|GAC98752.1| hypothetical protein PHSY_006346 [P...   448   e-123   Pseudozyma hubeiensis SY62
gi|119192994|ref|XP_001247103.1| NAD-dependent malic enzyme [Coc...   448   e-123   
gi|500258497|gb|EOO01409.1| putative nadp-dependent malic enzyme...   447   e-123   Phaeoacremonium minimum UCRPA7
gi|392863662|gb|EAS35573.2| NAD-dependent malic enzyme [Coccidio...   447   e-123   
gi|340522298|gb|EGR52531.1| malate dehydrogenase [Trichoderma re...   447   e-123   Trichoderma reesei QM6a
gi|512205311|gb|EPE34133.1| NAD(P)-binding Rossmann-fold contain...   447   e-123   Glarea lozoyensis ATCC 20868
gi|303312421|ref|XP_003066222.1| Malic enzyme, NAD binding domai...   447   e-123   Coccidioides posadasii C735 delta SOWgp
gi|402085634|gb|EJT80532.1| NADP-dependent malic enzyme [Gaeuman...   446   e-123   Gaeumannomyces graminis var. tritici R3-111a-1
gi|400600978|gb|EJP68646.1| malic enzyme [Beauveria bassiana ARS...   446   e-123   Beauveria bassiana ARSEF 2860
gi|443895078|dbj|GAC72424.1| NADP+-dependent malic enzyme [Pseud...   444   e-122   Moesziomyces antarcticus T-34
gi|429861963|gb|ELA36626.1| nadp-dependent malic enzyme [Colleto...   444   e-122   Colletotrichum gloeosporioides Nara gc5
gi|452840162|gb|EME42100.1| hypothetical protein DOTSEDRAFT_4566...   444   e-122   Dothistroma septosporum NZE10
gi|71011147|ref|XP_758454.1| hypothetical protein UM02307.1 [Ust...   444   e-122   
gi|71000960|ref|XP_755161.1| NADP-dependent malic enzyme MaeA [A...   442   e-121   Aspergillus fumigatus Af293
gi|388854604|emb|CCF51761.1| related to NADP-dependent malic enz...   442   e-121   Ustilago hordei
gi|159129255|gb|EDP54369.1| NADP-dependent malic enzyme MaeA [As...   442   e-121   Aspergillus fumigatus A1163
gi|449299577|gb|EMC95590.1| hypothetical protein BAUCODRAFT_7183...   442   e-121   Baudoinia panamericana UAMH 10762
gi|358389717|gb|EHK27309.1| hypothetical protein TRIVIDRAFT_1406...   441   e-121   Trichoderma virens Gv29-8
gi|67539996|ref|XP_663772.1| hypothetical protein AN6168.2 [Aspe...   441   e-121   Aspergillus nidulans FGSC A4
gi|482807862|gb|EOA84795.1| hypothetical protein SETTUDRAFT_8967...   441   e-121   Setosphaeria turcica Et28A
gi|358401365|gb|EHK50671.1| hypothetical protein TRIATDRAFT_1873...   441   e-121   Trichoderma atroviride IMI 206040
gi|425766411|gb|EKV05023.1| Malic enzyme [Penicillium digitatum ...   441   e-121   Penicillium digitatum Pd1
gi|295660242|ref|XP_002790678.1| malic enzyme [Paracoccidioides ...   440   e-121   Paracoccidioides lutzii Pb01
gi|485923371|gb|EOD48553.1| putative nadp-dependent malic enzyme...   440   e-121   Neofusicoccum parvum UCRNP2
gi|121698222|ref|XP_001267753.1| malic enzyme [Aspergillus clava...   440   e-121   Aspergillus clavatus NRRL 1
gi|238493799|ref|XP_002378136.1| NADP-dependent malic enzyme Mae...   439   e-120   Aspergillus flavus NRRL3357
gi|358369780|dbj|GAA86393.1| malic enzyme [Aspergillus kawachii ...   439   e-120   Aspergillus kawachii IFO 4308
gi|452981088|gb|EME80848.1| hypothetical protein MYCFIDRAFT_1404...   439   e-120   Cercospora fijiensis CIRAD86
gi|119480619|ref|XP_001260338.1| malic enzyme [Neosartorya fisch...   439   e-120   Aspergillus fischeri NRRL 181
gi|343427509|emb|CBQ71036.1| related to NADP-dependent malic enz...   439   e-120   Sporisorium reilianum SRZ2
gi|350636788|gb|EHA25146.1| hypothetical protein ASPNIDRAFT_2116...   438   e-120   Aspergillus niger ATCC 1015
gi|325088515|gb|EGC41825.1| NADP-dependent malic enzyme MaeA [Aj...   438   e-120   Histoplasma capsulatum H88
gi|317028775|ref|XP_001390670.2| NADP-dependent malic enzyme Mae...   438   e-120   Aspergillus niger CBS 513.88
gi|452004771|gb|EMD97227.1| hypothetical protein COCHEDRAFT_1209...   438   e-120   Bipolaris maydis C5
gi|226293734|gb|EEH49154.1| malic enzyme [Paracoccidioides brasi...   437   e-120   
gi|255935719|ref|XP_002558886.1| Pc13g04510 [Penicillium chrysog...   437   e-120   Penicillium rubens Wisconsin 54-1255
gi|134075120|emb|CAK39130.1| unnamed protein product [Aspergillu...   437   e-120   Aspergillus niger
gi|154274203|ref|XP_001537953.1| hypothetical protein HCAG_07375...   437   e-120   Histoplasma capsulatum NAm1
gi|440639467|gb|ELR09386.1| hypothetical protein GMDG_03950 [Geo...   437   e-120   Pseudogymnoascus destructans 20631-21
gi|115442968|ref|XP_001218291.1| hypothetical protein ATEG_09669...   436   e-120   Aspergillus terreus NIH2624
gi|317157399|ref|XP_001826448.2| NADP-dependent malic enzyme Mae...   436   e-120   Aspergillus oryzae RIB40
gi|83775192|dbj|BAE65315.1| unnamed protein product [Aspergillus...   436   e-120   Aspergillus oryzae RIB40
gi|451853341|gb|EMD66635.1| hypothetical protein COCSADRAFT_8545...   436   e-120   Bipolaris sorokiniana ND90Pr
gi|225678895|gb|EEH17179.1| NAD-dependent malic enzyme [Paracocc...   436   e-119   
gi|322703511|gb|EFY95119.1| putative malate dehydrogenase (NADP+...   436   e-119   
gi|408397500|gb|EKJ76642.1| hypothetical protein FPSE_03192 [Fus...   435   e-119   Fusarium pseudograminearum CS3096
gi|398396982|ref|XP_003851949.1| hypothetical protein MYCGRDRAFT...   434   e-119   Zymoseptoria tritici IPO323
gi|327353020|gb|EGE81877.1| malic enzyme [Ajellomyces dermatitid...   434   e-119   Blastomyces dermatitidis ATCC 18188
gi|346319932|gb|EGX89533.1| NAD-binding malic dehydrase [Cordyce...   434   e-119   Cordyceps militaris CM01
gi|46125627|ref|XP_387367.1| hypothetical protein FG07191.1 [Fus...   434   e-119   
gi|512204403|gb|EPE33226.1| Aminoacid dehydrogenase-like, N-term...   433   e-119   Glarea lozoyensis ATCC 20868
gi|261190208|ref|XP_002621514.1| NADP-dependent malic enzyme Mae...   433   e-119   Blastomyces gilchristii SLH14081
gi|302909249|ref|XP_003050031.1| predicted protein [Nectria haem...   433   e-119   Nectria haematococca mpVI 77-13-4
gi|326497939|dbj|BAJ94832.1| predicted protein [Hordeum vulgare ...   432   e-118   Hordeum vulgare subsp. vulgare [barley]
gi|389634985|ref|XP_003715145.1| NADP-dependent malic enzyme [Ma...   432   e-118   Magnaporthe oryzae 70-15
gi|322693713|gb|EFY85564.1| putative malate dehydrogenase (NADP+...   431   e-118   Metarhizium acridum CQMa 102
gi|409048128|gb|EKM57606.1| hypothetical protein PHACADRAFT_1158...   431   e-118   Phanerochaete carnosa HHB-10118-sp
gi|440482326|gb|ELQ62826.1| NADP-dependent malic enzyme [Magnapo...   431   e-118   Magnaporthe oryzae P131
gi|225559440|gb|EEH07723.1| NADP-dependent malic enzyme MaeA [Aj...   430   e-118   Histoplasma capsulatum G186AR
gi|212532737|ref|XP_002146525.1| NADP-dependent malic enzyme Mae...   430   e-118   Talaromyces marneffei ATCC 18224
gi|242776288|ref|XP_002478815.1| NADP-dependent malic enzyme Mae...   429   e-118   Talaromyces stipitatus ATCC 10500
gi|189191676|ref|XP_001932177.1| NADP-dependent malic enzyme [Py...   429   e-117   Pyrenophora tritici-repentis Pt-1C-BFP
gi|406861833|gb|EKD14886.1| NADP-dependent malic enzyme MaeA [Ma...   428   e-117   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|396500411|ref|XP_003845712.1| similar to malic enzyme [Leptos...   428   e-117   Leptosphaeria maculans JN3
gi|353235795|emb|CCA67802.1| related to NADP-dependent malic enz...   428   e-117   Serendipita indica DSM 11827
gi|342875995|gb|EGU77660.1| hypothetical protein FOXB_11835 [Fus...   427   e-117   Fusarium oxysporum Fo5176
gi|465792336|emb|CCU97444.1| unnamed protein product [Malassezia...   427   e-117   Malassezia sympodialis ATCC 42132
gi|399171461|emb|CCE27651.1| related to malate dehydrogenase (ox...   426   e-116   Claviceps purpurea 20.1
gi|330913003|ref|XP_003296149.1| hypothetical protein PTT_05114 ...   426   e-116   Pyrenophora teres f. teres 0-1
gi|472238488|gb|EMR83353.1| putative nadp-dependent malic enzyme...   425   e-116   Botrytis cinerea BcDW1
gi|347838424|emb|CCD52996.1| hypothetical protein BofuT4_P139200...   425   e-116   Botrytis cinerea T4
gi|304366186|gb|ADM26561.1| malic enzyme [Cunninghamella echinul...   422   e-115   Cunninghamella echinulata
gi|409076993|gb|EKM77361.1| hypothetical protein AGABI1DRAFT_115...   422   e-115   Agaricus bisporus var. burnettii JB137-S8
gi|320592797|gb|EFX05206.1| NADP-dependent malic enzyme [Grosman...   421   e-115   Grosmannia clavigera kw1407
gi|426195337|gb|EKV45267.1| hypothetical protein AGABI2DRAFT_194...   420   e-115   Agaricus bisporus var. bisporus H97
gi|392589134|gb|EIW78465.1| malic enzyme [Coniophora puteana RWD...   420   e-115   Coniophora puteana RWD-64-598 SS2
gi|361128581|gb|EHL00513.1| putative NADP-dependent malic enzyme...   418   e-114   Glarea lozoyensis 74030
gi|392561660|gb|EIW54841.1| malic enzyme [Trametes versicolor FP...   417   e-114   Trametes versicolor FP-101664 SS1
gi|156048192|ref|XP_001590063.1| hypothetical protein SS1G_08827...   416   e-113   Sclerotinia sclerotiorum 1980 UF-70
gi|302676053|ref|XP_003027710.1| hypothetical protein SCHCODRAFT...   415   e-113   Schizophyllum commune H4-8
gi|299742234|ref|XP_001832332.2| malate dehydrogenase [Coprinops...   415   e-113   Coprinopsis cinerea okayama7#130
gi|389751270|gb|EIM92343.1| malic enzyme [Stereum hirsutum FP-91...   414   e-113   Stereum hirsutum FP-91666 SS1
gi|395326905|gb|EJF59309.1| malic enzyme [Dichomitus squalens LY...   414   e-113   Dichomitus squalens LYAD-421 SS1
gi|164658389|ref|XP_001730320.1| hypothetical protein MGL_2702 [...   413   e-113   Malassezia globosa CBS 7966
gi|393213749|gb|EJC99244.1| hypothetical protein FOMMEDRAFT_1428...   411   e-112   Fomitiporia mediterranea MF3/22
gi|358058521|dbj|GAA95484.1| hypothetical protein E5Q_02138 [Mix...   410   e-112   Mixia osmundae IAM 14324
gi|403157826|ref|XP_003890783.1| malate dehydrogenase (oxaloacet...   410   e-112   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|403157828|ref|XP_003307217.2| malate dehydrogenase (oxaloacet...   410   e-112   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|393237840|gb|EJD45380.1| malic enzyme [Auricularia delicata T...   408   e-111   Auricularia subglabra TFB-10046 SS5
gi|336375547|gb|EGO03883.1| hypothetical protein SERLA73DRAFT_16...   407   e-111   Serpula lacrymans var. lacrymans S7.3
gi|378733260|gb|EHY59719.1| malate dehydrogenase (oxaloacetate-d...   407   e-111   Exophiala dermatitidis NIH/UT8656
gi|328859767|gb|EGG08875.1| hypothetical protein MELLADRAFT_4769...   406   e-110   Melampsora larici-populina 98AG31
gi|389740476|gb|EIM81667.1| malate dehydrogenase [Stereum hirsut...   405   e-110   Stereum hirsutum FP-91666 SS1
gi|494826857|gb|EON63884.1| hypothetical protein W97_03112 [Coni...   405   e-110   Coniosporium apollinis CBS 100218
gi|326498765|dbj|BAK02368.1| predicted protein [Hordeum vulgare ...   399   e-108   Hordeum vulgare subsp. vulgare [barley]
gi|407924764|gb|EKG17792.1| Malic oxidoreductase [Macrophomina p...   399   e-108   Macrophomina phaseolina MS6
gi|390598910|gb|EIN08307.1| malate dehydrogenase [Punctularia st...   398   e-108   Punctularia strigosozonata HHB-11173 SS5
gi|380478945|emb|CCF43308.1| malic enzyme [Colletotrichum higgin...   397   e-108   Colletotrichum higginsianum
gi|170100006|ref|XP_001881221.1| predicted protein [Laccaria bic...   396   e-108   Laccaria bicolor S238N-H82
gi|345569909|gb|EGX52735.1| hypothetical protein AOL_s00007g518 ...   396   e-108   Arthrobotrys oligospora ATCC 24927
gi|449544664|gb|EMD35637.1| hypothetical protein CERSUDRAFT_8557...   396   e-108   Gelatoporia subvermispora B
gi|470243022|ref|XP_004355233.1| NADP-dependent malate dehydroge...   395   e-107   Dictyostelium fasciculatum
gi|336363747|gb|EGN92120.1| hypothetical protein SERLA73DRAFT_17...   392   e-106   Serpula lacrymans var. lacrymans S7.3
gi|330789939|ref|XP_003283056.1| malic enzyme [Dictyostelium pur...   391   e-106   Dictyostelium purpureum
gi|170089365|ref|XP_001875905.1| predicted protein [Laccaria bic...   390   e-106   Laccaria bicolor S238N-H82
gi|299743333|ref|XP_001835695.2| malate dehydrogenase [Coprinops...   390   e-106   Coprinopsis cinerea okayama7#130
gi|342185670|emb|CCC95155.1| unnamed protein product [Trypanosom...   389   e-105   Trypanosoma congolense IL3000
gi|66823513|ref|XP_645111.1| NADP-dependent malate dehydrogenase...   387   e-105   Dictyostelium discoideum AX4
gi|290977620|ref|XP_002671535.1| predicted protein [Naegleria gr...   379   e-102   Naegleria gruberi strain NEG-M
gi|281209464|gb|EFA83632.1| NADP-dependent malate dehydrogenase ...   378   e-102   Polysphondylium pallidum PN500
gi|392591609|gb|EIW80936.1| malate dehydrogenase [Coniophora put...   377   e-102   Coniophora puteana RWD-64-598 SS2
gi|472582305|gb|EMS19997.1| malic enzyme [Rhodosporidium toruloi...   376   e-102   Rhodotorula toruloides NP11
gi|409079038|gb|EKM79400.1| hypothetical protein AGABI1DRAFT_120...   375   e-101   Agaricus bisporus var. burnettii JB137-S8
gi|340058718|emb|CCC53078.1| putative malic enzyme [Trypanosoma ...   372   e-100   Trypanosoma vivax Y486
gi|407425453|gb|EKF39432.1| malic enzyme, putative [Trypanosoma ...   371   e-100   Trypanosoma cruzi marinkellei
gi|505755190|gb|EOQ99414.1| NADP-dependent malic enzyme [Wallemi...   370   e-100   Wallemia ichthyophaga EXF-994
gi|340058719|emb|CCC53079.1| putative malic enzyme [Trypanosoma ...   369   e-100   Trypanosoma vivax Y486
gi|71662504|ref|XP_818258.1| malic enzyme [Trypanosoma cruzi str...   369   1e-99   Trypanosoma cruzi strain CL Brener
gi|407425452|gb|EKF39431.1| malic enzyme, putative [Trypanosoma ...   369   2e-99   Trypanosoma cruzi marinkellei
gi|71651465|ref|XP_814410.1| malic enzyme [Trypanosoma cruzi str...   368   2e-99   Trypanosoma cruzi strain CL Brener
gi|71651463|ref|XP_814409.1| malic enzyme [Trypanosoma cruzi str...   368   3e-99   Trypanosoma cruzi strain CL Brener
gi|407860360|gb|EKG07369.1| malic enzyme, putative [Trypanosoma ...   368   3e-99   Trypanosoma cruzi
gi|407860363|gb|EKG07371.1| malic enzyme, putative [Trypanosoma ...   367   4e-99   Trypanosoma cruzi
gi|71755409|ref|XP_828619.1| malic enzyme [Trypanosoma brucei br...   367   4e-99   Trypanosoma brucei brucei TREU927
gi|261334502|emb|CBH17496.1| malic enzyme, putative [Trypanosoma...   366   9e-99   Trypanosoma brucei gambiense DAL972
gi|388583791|gb|EIM24092.1| hypothetical protein WALSEDRAFT_5908...   366   1e-98   Wallemia mellicola CBS 633.66
gi|342319135|gb|EGU11086.1| Malic enzyme [Rhodotorula glutinis A...   365   1e-98   Rhodotorula toruloides ATCC 204091
gi|71662506|ref|XP_818259.1| malic enzyme [Trypanosoma cruzi str...   365   2e-98   Trypanosoma cruzi strain CL Brener
gi|154296927|ref|XP_001548892.1| hypothetical protein BC1G_12552...   365   2e-98   Botrytis cinerea B05.10
gi|71755411|ref|XP_828620.1| malic enzyme [Trypanosoma brucei br...   365   2e-98   Trypanosoma brucei brucei TREU927
gi|258574269|ref|XP_002541316.1| hypothetical protein UREG_00830...   364   4e-98   Uncinocarpus reesii 1704
gi|390950814|ref|YP_006414573.1| malic enzyme [Thiocystis violas...   364   4e-98   
gi|392574404|gb|EIW67540.1| hypothetical protein TREMEDRAFT_4511...   364   4e-98   Tremella mesenterica DSM 1558
gi|146087792|ref|XP_001465906.1| malic enzyme [Leishmania infant...   364   4e-98   Leishmania infantum JPCM5
gi|261334503|emb|CBH17497.1| malic enzyme, putative [Trypanosoma...   362   1e-97   Trypanosoma brucei gambiense DAL972
gi|401422804|ref|XP_003875889.1| malic enzyme [Leishmania mexica...   362   1e-97   Leishmania mexicana MHOM/GT/2001/U1103
gi|342185669|emb|CCC95154.1| unnamed protein product [Trypanosom...   361   2e-97   Trypanosoma congolense IL3000
gi|510034073|gb|AGN32876.1| malic enzyme [Trypanosoma rangeli]        360   4e-97   Trypanosoma rangeli
gi|294933125|ref|XP_002780610.1| malic enzyme, putative [Perkins...   359   1e-96   Perkinsus marinus ATCC 50983
gi|224001756|ref|XP_002290550.1| NAD dependent malic enzyme [Tha...   358   2e-96   Thalassiosira pseudonana CCMP1335
gi|405123849|gb|AFR98612.1| malate dehydrogenase [Cryptococcus n...   358   2e-96   Cryptococcus neoformans var. grubii H99
gi|148257076|ref|YP_001241661.1| malate dehydrogenase [Bradyrhiz...   356   1e-95   
gi|94469707|gb|ABF20307.1| cytosolic NADP-malic enzyme [Leishman...   355   1e-95   Leishmania gerbilli
gi|58262262|ref|XP_568541.1| malate dehydrogenase (oxaloacetate-...   355   2e-95   Cryptococcus neoformans var. neoformans JEC21
gi|428186275|gb|EKX55125.1| hypothetical protein GUITHDRAFT_9131...   355   2e-95   Guillardia theta CCMP2712
gi|406698215|gb|EKD01456.1| malate dehydrogenase (oxaloacetate-d...   354   3e-95   Trichosporon asahii var. asahii CBS 8904
gi|146342172|ref|YP_001207220.1| malate dehydrogenase [Bradyrhiz...   354   3e-95   
gi|496323022|ref|WP_009032200.1| Malate dehydrogenase (oxaloacet...   354   4e-95   
gi|218778465|ref|YP_002429783.1| malate dehydrogenase [Desulfati...   354   5e-95   
gi|389601387|ref|XP_001565344.2| malic enzyme [Leishmania brazil...   353   6e-95   Leishmania braziliensis MHOM/BR/75/M2904
gi|493658371|ref|WP_006609767.1| Malate dehydrogenase (oxaloacet...   353   9e-95   
gi|94469677|gb|ABF20292.1| cytosolic NADP-malic enzyme [Leishman...   353   1e-94   Leishmania infantum
gi|384216662|ref|YP_005607828.1| malic enzyme [Bradyrhizobium ja...   353   1e-94   
gi|494887240|ref|WP_007613287.1| malic enzyme [Bradyrhizobium sp...   352   1e-94   Bradyrhizobium sp. WSM471
gi|398015961|ref|XP_003861169.1| malic enzyme, putative [Leishma...   352   1e-94   Leishmania donovani
gi|94469655|gb|ABF20281.1| cytosolic NADP-malic enzyme [Leishman...   352   1e-94   Leishmania donovani
gi|495406871|ref|WP_008131570.1| malic enzyme [Bradyrhizobium sp...   352   2e-94   Bradyrhizobium sp. YR681
gi|146087796|ref|XP_001465907.1| putative malic enzyme [Leishman...   352   2e-94   Leishmania infantum JPCM5
gi|94469639|gb|ABF20273.1| cytosolic NADP-malic enzyme [Leishman...   352   2e-94   Leishmania infantum
gi|189308561|gb|ACD87082.1| cytosolic NADP-malic enzyme [Leishma...   352   2e-94   Leishmania infantum
gi|494874947|ref|WP_007601042.1| malic enzyme [Bradyrhizobium sp...   351   2e-94   Bradyrhizobium sp. WSM1253
gi|401422806|ref|XP_003875890.1| putative malic enzyme [Leishman...   351   2e-94   Leishmania mexicana MHOM/GT/2001/U1103
gi|496139218|ref|WP_008863725.1| malic enzyme, NAD binding domai...   351   3e-94   Parasutterella excrementihominis
gi|94469661|gb|ABF20284.1| cytosolic NADP-malic enzyme [Leishman...   351   3e-94   Leishmania donovani
gi|321265534|ref|XP_003197483.1| malate dehydrogenase (oxaloacet...   351   4e-94   Cryptococcus gattii WM276
gi|496087450|ref|WP_008811957.1| NADP-dependent malic enzyme [Bu...   350   4e-94   
gi|94469679|gb|ABF20293.1| cytosolic NADP-malic enzyme [Leishman...   350   4e-94   Leishmania infantum
gi|459288815|ref|YP_007511972.1| malate dehydrogenase [Bradyrhiz...   350   6e-94   
gi|294874240|ref|XP_002766872.1| malic enzyme, putative [Perkins...   350   7e-94   Perkinsus marinus ATCC 50983
gi|470530455|ref|XP_004368256.1| NAD-dependent malic enzyme, put...   350   9e-94   Acanthamoeba castellanii str. Neff
gi|27381580|ref|NP_773109.1| malate dehydrogenase [Bradyrhizobiu...   348   2e-93   Bradyrhizobium diazoefficiens USDA 110
gi|496260439|ref|WP_008973824.1| Malate dehydrogenase (oxaloacet...   348   2e-93   Bradyrhizobium sp. STM 3843
gi|94469709|gb|ABF20308.1| cytosolic NADP-malic enzyme [Leishman...   348   3e-93   Leishmania tropica
gi|27357017|gb|AAN86690.1| malic enzyme [Mastigamoeba balamuthi]      348   3e-93   Mastigamoeba balamuthi
gi|383770127|ref|YP_005449190.1| malate dehydrogenase [Bradyrhiz...   347   4e-93   
gi|389601389|ref|XP_001565345.2| putative malic enzyme [Leishman...   347   6e-93   Leishmania braziliensis MHOM/BR/75/M2904
gi|308912542|gb|ADO51080.1| malic enzyme [Leishmania tropica] >g...   346   1e-92   Leishmania tropica
gi|157870083|ref|XP_001683592.1| putative malic enzyme [Leishman...   345   1e-92   Leishmania major strain Friedlin
gi|428185540|gb|EKX54392.1| hypothetical protein GUITHDRAFT_1499...   345   1e-92   Guillardia theta CCMP2712
gi|308912544|gb|ADO51081.1| malic enzyme [Leishmania tropica] >g...   345   2e-92   Leishmania tropica
gi|491576226|ref|WP_005433803.1| hypothetical protein [Sutterell...   344   3e-92   Sutterella wadsworthensis
gi|325190506|emb|CCA25004.1| NADdependent malic enzyme putative ...   344   4e-92   Albugo laibachii Nc14
gi|348676932|gb|EGZ16749.1| hypothetical protein PHYSODRAFT_3144...   342   1e-91   Phytophthora sojae
gi|294874440|ref|XP_002766957.1| malic enzyme, putative [Perkins...   342   2e-91   Perkinsus marinus ATCC 50983
gi|507924891|ref|XP_004673712.1| PREDICTED: NADP-dependent malic...   342   2e-91   
gi|291232321|ref|XP_002736106.1| PREDICTED: cytosolic malic enzy...   341   3e-91   
gi|507924889|ref|XP_004673711.1| PREDICTED: NADP-dependent malic...   341   4e-91   Condylura cristata
gi|348578045|ref|XP_003474794.1| PREDICTED: NADP-dependent malic...   340   6e-91   
gi|493797922|ref|WP_006745900.1| malic protein NAD-binding [Thio...   340   7e-91   
gi|145353063|ref|XP_001420849.1| predicted protein [Ostreococcus...   340   8e-91   Ostreococcus lucimarinus CCE9901
gi|498953102|ref|XP_004523448.1| PREDICTED: NADP-dependent malic...   340   9e-91   
gi|498953096|ref|XP_004523447.1| PREDICTED: NADP-dependent malic...   339   1e-90   Ceratitis capitata
gi|498953090|ref|XP_004523446.1| PREDICTED: NADP-dependent malic...   339   1e-90   Ceratitis capitata
gi|219112277|ref|XP_002177890.1| predicted protein [Phaeodactylu...   339   1e-90   Phaeodactylum tricornutum CCAP 1055/1
gi|391330340|ref|XP_003739621.1| PREDICTED: NADP-dependent malic...   339   1e-90   Metaseiulus occidentalis
gi|395857964|ref|XP_003801349.1| PREDICTED: NADP-dependent malic...   338   2e-90   Otolemur garnettii
gi|428175693|gb|EKX44581.1| hypothetical protein GUITHDRAFT_1529...   338   2e-90   Guillardia theta CCMP2712
gi|507553465|ref|XP_004660523.1| PREDICTED: NADP-dependent malic...   338   3e-90   
gi|482556049|gb|EOA20241.1| hypothetical protein CARUB_v10000542...   338   3e-90   Capsella rubella
gi|495818567|ref|WP_008543146.1| malic enzyme, NAD binding domai...   337   5e-90   Sutterella parvirubra
gi|505829771|ref|XP_004610185.1| PREDICTED: NADP-dependent malic...   337   6e-90   Sorex araneus [Eurasian shrew]
gi|344264125|ref|XP_003404144.1| PREDICTED: NADP-dependent malic...   337   8e-90   Loxodonta africana [African bush elephant]
gi|507619502|ref|XP_004696342.1| PREDICTED: NADP-dependent malic...   337   8e-90   Echinops telfairi [lesser hedgehog tenrec]
gi|195108739|ref|XP_001998950.1| GI24244 [Drosophila mojavensis]...   336   8e-90   Drosophila mojavensis
gi|478495574|ref|XP_004422129.1| PREDICTED: NADP-dependent malic...   336   9e-90   
gi|15029730|gb|AAH11081.1| Me1 protein [Mus musculus] >gi|518738...   336   9e-90   Mus musculus [mouse]
gi|242089803|ref|XP_002440734.1| hypothetical protein SORBIDRAFT...   336   1e-89   Sorghum bicolor [broomcorn]
gi|148694555|gb|EDL26502.1| malic enzyme, supernatant, isoform C...   336   1e-89   Mus musculus [mouse]
gi|332218371|ref|XP_003258331.1| PREDICTED: NADP-dependent malic...   336   1e-89   Nomascus leucogenys [White-cheeked Gibbon]
gi|162139827|ref|NP_032641.2| NADP-dependent malic enzyme isofor...   336   1e-89   Mus musculus [mouse]
gi|307107318|gb|EFN55561.1| hypothetical protein CHLNCDRAFT_3545...   336   1e-89   Chlorella variabilis
gi|312147392|ref|NP_001185862.1| NADP-dependent malic enzyme iso...   336   1e-89   Mus musculus [mouse]
gi|478495572|ref|XP_004422128.1| PREDICTED: NADP-dependent malic...   335   1e-89   Ceratotherium simum simum [southern square-lipped rhinoceros]
gi|403261214|ref|XP_003923020.1| PREDICTED: NADP-dependent malic...   335   2e-89   Saimiri boliviensis boliviensis
gi|308810214|ref|XP_003082416.1| OJ1457_D07.117 gene product (IS...   335   2e-89   Ostreococcus tauri
gi|426195944|gb|EKV45873.1| hypothetical protein AGABI2DRAFT_186...   335   2e-89   Agaricus bisporus var. bisporus H97
gi|332218369|ref|XP_003258330.1| PREDICTED: NADP-dependent malic...   335   2e-89   Nomascus leucogenys [White-cheeked Gibbon]
gi|354466477|ref|XP_003495700.1| PREDICTED: NADP-dependent malic...   335   3e-89   Cricetulus griseus [Chinese hamsters]
gi|355561869|gb|EHH18501.1| hypothetical protein EGK_15118 [Maca...   335   3e-89   Macaca mulatta [rhesus macaque]
gi|449271454|gb|EMC81815.1| NADP-dependent malic enzyme, mitocho...   335   3e-89   Columba livia [carrier pigeon]
gi|149018984|gb|EDL77625.1| malic enzyme 1 [Rattus norvegicus]        334   4e-89   Rattus norvegicus [brown rat]
gi|220901386|gb|ACL82855.1| malic enzyme 1 [Bos taurus]               334   4e-89   Bos taurus [bovine]
gi|266504|sp|P13697.2|MAOX_RAT RecName: Full=NADP-dependent mali...   334   5e-89   Rattus norvegicus [brown rat]
gi|430762529|ref|YP_007218386.1| NAD-dependent malic enzyme [Thi...   334   5e-89   
gi|158341689|ref|NP_036732.2| NADP-dependent malic enzyme [Rattu...   334   5e-89   Rattus norvegicus [brown rat]
gi|205294|gb|AAA41563.1| malic enzyme [Rattus norvegicus]             333   6e-89   Rattus norvegicus [brown rat]
gi|507633007|ref|XP_004628315.1| PREDICTED: NADP-dependent malic...   333   6e-89   Octodon degus
gi|332824450|ref|XP_003311414.1| PREDICTED: NADP-dependent malic...   333   7e-89   
gi|449466139|ref|XP_004150784.1| PREDICTED: NADP-dependent malic...   333   7e-89   Cucumis sativus [cucumbers]
gi|397490919|ref|XP_003816431.1| PREDICTED: NADP-dependent malic...   333   7e-89   
gi|15239517|ref|NP_197960.1| NADP-dependent malic enzyme 3 [Arab...   333   7e-89   Arabidopsis thaliana [mouse-ear cress]
gi|397490917|ref|XP_003816430.1| PREDICTED: NADP-dependent malic...   333   7e-89   Pan paniscus [bonobo]
gi|338710829|ref|XP_001499853.2| PREDICTED: NADP-dependent malic...   333   9e-89   
gi|332824448|ref|XP_518610.3| PREDICTED: NADP-dependent malic en...   333   9e-89   Pan troglodytes
gi|226510109|ref|NP_001150965.1| NADP-dependent malic enzyme [Ze...   333   9e-89   Zea mays [maize]
gi|1465733|gb|AAC50613.1| cytosolic NADP(+)-dependent malic enzy...   333   1e-88   Homo sapiens [man]
gi|199021|gb|AAA39489.1| malic enzyme [Mus musculus] >gi|199763|...   333   1e-88   Mus musculus [mouse]
gi|194901632|ref|XP_001980356.1| GG17100 [Drosophila erecta] >gi...   333   1e-88   Drosophila erecta
gi|126310544|ref|XP_001375769.1| PREDICTED: NADP-dependent malic...   332   1e-88   
gi|302828106|ref|XP_002945620.1| hypothetical protein VOLCADRAFT...   332   1e-88   Volvox carteri f. nagariensis
gi|482570455|gb|EOA34643.1| hypothetical protein CARUB_v10022207...   332   1e-88   Capsella rubella
gi|512997518|ref|XP_004860328.1| PREDICTED: NADP-dependent malic...   332   1e-88   Heterocephalus glaber [naked mole rat]
gi|291396542|ref|XP_002714598.1| PREDICTED: cytosolic malic enzy...   332   1e-88   Oryctolagus cuniculus [European rabbit]
gi|194380430|dbj|BAG63982.1| unnamed protein product [Homo sapiens]   332   1e-88   Homo sapiens [man]
gi|498938773|ref|XP_004541703.1| PREDICTED: NADP-dependent malic...   332   2e-88   
gi|84579257|dbj|BAE73062.1| hypothetical protein [Macaca fascicu...   332   2e-88   
gi|221325670|ref|NP_001138325.1| NADP-dependent malic enzyme [Bo...   332   2e-88   
gi|499051913|ref|XP_004576454.1| PREDICTED: NADP-dependent malic...   332   2e-88   
gi|90020308|ref|YP_526135.1| malate dehydrogenase [Saccharophagu...   332   2e-88   
gi|296484257|tpg|DAA26372.1| TPA: cytosolic malic enzyme 1 [Bos ...   332   2e-88   
gi|256595612|gb|ACV04456.1| malic enzyme 1 [Capra hircus]             332   2e-88   
gi|4505143|ref|NP_002386.1| NADP-dependent malic enzyme [Homo sa...   332   2e-88   
gi|350535679|ref|NP_001233951.1| cytosolic NADP-malic enzyme [So...   332   2e-88   
gi|471409055|ref|XP_004386106.1| PREDICTED: NADP-dependent malic...   332   2e-88   
gi|91093507|ref|XP_969226.1| PREDICTED: similar to malate dehydr...   332   2e-88   
gi|145581577|pdb|2AW5|A Chain A, Crystal Structure Of A Human Ma...   332   2e-88   
gi|348531020|ref|XP_003453008.1| PREDICTED: NADP-dependent malic...   332   2e-88   
gi|152926124|gb|ABS32241.1| NADP-malic enzyme [Flaveria palmeri]      332   2e-88   
gi|348676929|gb|EGZ16746.1| hypothetical protein PHYSODRAFT_5596...   331   3e-88   
gi|158260589|dbj|BAF82472.1| unnamed protein product [Homo sapiens]   331   3e-88   
gi|226227795|ref|YP_002761901.1| malic enzyme [Gemmatimonas aura...   331   3e-88   
gi|547886|sp|P36444.1|MAOC_FLAPR RecName: Full=NADP-dependent ma...   331   3e-88   
gi|465978487|gb|EMP35026.1| NADP-dependent malic enzyme [Cheloni...   331   3e-88   
gi|471409053|ref|XP_004386105.1| PREDICTED: NADP-dependent malic...   331   4e-88   
gi|301095009|ref|XP_002896607.1| NADP-dependent malic enzyme [Ph...   331   4e-88   
gi|75699588|gb|ABA19497.1| cytosolic malic enzyme [Drosophila si...   330   4e-88   
gi|224043678|ref|XP_002188511.1| PREDICTED: NADP-dependent malic...   330   4e-88   
gi|460379793|ref|XP_004235645.1| PREDICTED: NADP-dependent malic...   330   5e-88   
gi|24646386|ref|NP_524880.2| malic enzyme, isoform B [Drosophila...   330   5e-88   
gi|495804549|ref|WP_008529128.1| NAD-dependent malic enzyme [gam...   330   5e-88   
gi|413949354|gb|AFW82003.1| hypothetical protein ZEAMMB73_408175...   330   5e-88   
gi|46850202|gb|AAT02534.1| NADP-dependent malic enzyme 2 [Hydril...   330   5e-88   
gi|497196400|ref|WP_009510662.1| malic protein NAD-binding [Opit...   330   5e-88   
gi|24646388|ref|NP_731739.1| malic enzyme, isoform A [Drosophila...   330   6e-88   
gi|1335389|gb|AAB01380.1| NADP-dependent malic enzyme [Homo sapi...   330   6e-88   
gi|356556489|ref|XP_003546557.1| PREDICTED: NADP-dependent malic...   330   6e-88   
gi|410959594|ref|XP_003986390.1| PREDICTED: NADP-dependent malic...   330   6e-88   
gi|378342915|gb|AFB81571.1| malic enzyme [Drosophila melanogaste...   330   6e-88   
gi|301105531|ref|XP_002901849.1| NAD-dependent malic enzyme, put...   330   7e-88   
gi|195446325|ref|XP_002070728.1| GK10867 [Drosophila willistoni]...   330   7e-88   
gi|157783890|gb|ABV72704.1| non-C4 NADP-dependent malic enzyme, ...   330   8e-88   
gi|115495175|ref|NP_001069345.1| NADP-dependent malic enzyme, mi...   330   8e-88   
gi|7248648|gb|AAF43602.1|AF187999_1 malic enzyme [Drosophila mel...   330   8e-88   
gi|7248646|gb|AAF43601.1|AF187998_1 malic enzyme [Drosophila mel...   330   9e-88   
gi|297839957|ref|XP_002887860.1| NADP-malic enzyme 4 [Arabidopsi...   330   9e-88   
gi|255549832|ref|XP_002515967.1| malic enzyme, putative [Ricinus...   330   9e-88   
gi|460412492|ref|XP_004251632.1| PREDICTED: NADP-dependent malic...   330   9e-88   
gi|397564787|gb|EJK44344.1| hypothetical protein THAOC_37124 [Th...   330   9e-88   
gi|326492730|dbj|BAJ90221.1| predicted protein [Hordeum vulgare ...   330   9e-88   
gi|512689136|ref|WP_016475167.1| hypothetical protein [Sutterell...   330   9e-88   
gi|307175341|gb|EFN65360.1| NADP-dependent malic enzyme [Campono...   329   1e-87   
gi|472377188|ref|XP_004408025.1| PREDICTED: NADP-dependent malic...   329   1e-87   
gi|395737453|ref|XP_002817152.2| PREDICTED: LOW QUALITY PROTEIN:...   329   1e-87   
gi|8118507|gb|AAF73006.1|AF262997_1 NADP-dependent malic protein...   329   1e-87   
gi|442618752|ref|NP_001262509.1| malic enzyme, isoform C [Drosop...   329   1e-87   
gi|472377186|ref|XP_004408024.1| PREDICTED: NADP-dependent malic...   329   1e-87   
gi|345482391|ref|XP_003424587.1| PREDICTED: NADP-dependent malic...   329   1e-87   
gi|356550498|ref|XP_003543623.1| PREDICTED: NADP-dependent malic...   329   1e-87   
gi|207028179|ref|NP_001128692.1| NADP-dependent malic enzyme [Ov...   329   1e-87   
gi|301779712|ref|XP_002925274.1| PREDICTED: NADP-dependent malic...   329   1e-87   
gi|281351761|gb|EFB27345.1| hypothetical protein PANDA_014734 [A...   329   1e-87   
gi|195500593|ref|XP_002097438.1| GE24490 [Drosophila yakuba] >gi...   329   1e-87   
gi|462413134|gb|EMJ18183.1| hypothetical protein PRUPE_ppa002714...   329   1e-87   
gi|494602987|ref|WP_007361239.1| malic enzyme [Opitutaceae bacte...   329   1e-87   
gi|345778157|ref|XP_532217.3| PREDICTED: NADP-dependent malic en...   329   1e-87   
gi|195571335|ref|XP_002103659.1| Men [Drosophila simulans] >gi|1...   329   1e-87   
gi|511908459|ref|XP_004773664.1| PREDICTED: NADP-dependent malic...   329   1e-87   
gi|462413133|gb|EMJ18182.1| hypothetical protein PRUPE_ppa002714...   329   1e-87   
gi|156537832|ref|XP_001608277.1| PREDICTED: NADP-dependent malic...   329   2e-87   
gi|512682537|ref|WP_016474733.1| hypothetical protein [Sutterell...   329   2e-87   
gi|15219980|ref|NP_178093.1| NADP-malic enzyme 4 [Arabidopsis th...   329   2e-87   
gi|378342895|gb|AFB81561.1| malic enzyme [Drosophila melanogaster]    329   2e-87   
gi|357125918|ref|XP_003564636.1| PREDICTED: NADP-dependent malic...   329   2e-87   
gi|378342901|gb|AFB81564.1| malic enzyme [Drosophila melanogaster]    329   2e-87   
gi|426251477|ref|XP_004019448.1| PREDICTED: NADP-dependent malic...   328   2e-87   
gi|502081150|ref|XP_004486781.1| PREDICTED: NADP-dependent malic...   328   2e-87   
gi|62898395|dbj|BAD97137.1| cytosolic malic enzyme 1 variant [Ho...   328   2e-87   
gi|7248650|gb|AAF43603.1|AF188000_1 malic enzyme [Drosophila mel...   328   2e-87   
gi|348532059|ref|XP_003453524.1| PREDICTED: NADP-dependent malic...   328   2e-87   
gi|512000123|ref|XP_004817605.1| PREDICTED: NADP-dependent malic...   328   2e-87   
gi|378342945|gb|AFB81586.1| malic enzyme [Drosophila melanogaster]    328   2e-87   
gi|320354099|ref|YP_004195438.1| malic protein NAD-binding prote...   328   3e-87   
gi|311244403|ref|XP_001924368.2| PREDICTED: NADP-dependent malic...   328   3e-87   
gi|328778238|ref|XP_395280.4| PREDICTED: NADP-dependent malic en...   328   3e-87   
gi|298710532|emb|CBJ25596.1| malate dehydrogenase [Ectocarpus si...   327   4e-87   
gi|338970403|gb|AEJ33773.1| putative NADP-dependent malic enzyme...   327   5e-87   
gi|378342877|gb|AFB81552.1| malic enzyme [Drosophila melanogaster]    327   5e-87   
gi|339235395|ref|XP_003379252.1| malate oxidoreductase [Trichine...   327   5e-87   
gi|157111212|ref|XP_001651437.1| malic enzyme [Aedes aegypti] >g...   327   5e-87   
gi|148694554|gb|EDL26501.1| malic enzyme, supernatant, isoform C...   327   6e-87   
gi|325181483|emb|CCA15917.1| NADPdependent malic enzyme putative...   327   6e-87   
gi|13096987|gb|AAH03287.1| Me1 protein [Mus musculus]                 327   7e-87   
gi|222139360|gb|ACM45704.1| NADP-malic enzyme [Echinochloa crus-...   327   7e-87   
gi|195395186|ref|XP_002056217.1| GJ10817 [Drosophila virilis] >g...   327   7e-87   
gi|117959825|gb|ABK59872.1| ME2 [Tigriopus californicus]              327   8e-87   
gi|410896574|ref|XP_003961774.1| PREDICTED: NADP-dependent malic...   327   8e-87   
gi|390177875|ref|XP_003736507.1| GA10087, isoform B [Drosophila ...   326   8e-87   
gi|498938769|ref|XP_004541702.1| PREDICTED: NADP-dependent malic...   326   8e-87   
gi|384249711|gb|EIE23192.1| RNB-domain-containing protein [Cocco...   326   9e-87   
gi|513166353|ref|XP_004938943.1| PREDICTED: NADP-dependent malic...   326   1e-86   
gi|195037521|ref|XP_001990209.1| GH19210 [Drosophila grimshawi] ...   326   1e-86   
gi|466010464|ref|XP_004270128.1| PREDICTED: NADP-dependent malic...   326   1e-86   
gi|195329436|ref|XP_002031417.1| GM25984 [Drosophila sechellia] ...   326   1e-86   
gi|225445108|ref|XP_002283751.1| PREDICTED: NADP-dependent malic...   326   1e-86   
gi|30678679|ref|NP_191966.2| NAD-dependent malic enzyme 2 [Arabi...   326   1e-86   
gi|303271001|ref|XP_003054862.1| NADP-me with chloroplast precur...   326   1e-86   
gi|198451817|ref|XP_001358521.2| GA10087, isoform A [Drosophila ...   326   1e-86   
gi|410922850|ref|XP_003974895.1| PREDICTED: NAD-dependent malic ...   326   1e-86   
gi|6382043|gb|AAC13636.2| F6N23.16 gene product [Arabidopsis tha...   325   1e-86   
gi|7267396|emb|CAB80866.1| putative malate oxidoreductase [Arabi...   325   1e-86   
gi|413945042|gb|AFW77691.1| malic enzyme [Zea mays]                   325   1e-86   
gi|115462465|ref|NP_001054832.1| Os05g0186300 [Oryza sativa Japo...   325   1e-86   
gi|466010459|ref|XP_004270127.1| PREDICTED: NADP-dependent malic...   325   1e-86   
gi|413945041|gb|AFW77690.1| malic enzyme [Zea mays]                   325   1e-86   
gi|488526980|ref|XP_004455312.1| PREDICTED: LOW QUALITY PROTEIN:...   325   1e-86   
gi|443728093|gb|ELU14567.1| hypothetical protein CAPTEDRAFT_2269...   325   2e-86   
gi|496202687|ref|WP_008922524.1| Malate dehydrogenase (oxaloacet...   325   2e-86   
gi|297807205|ref|XP_002871486.1| NADP-malic enzyme 2 [Arabidopsi...   325   2e-86   
gi|17537199|ref|NP_496968.1| Protein MEN-1 [Caenorhabditis elega...   325   2e-86   
gi|513166341|ref|XP_003640618.2| PREDICTED: NADP-dependent malic...   325   2e-86   
gi|413945039|gb|AFW77688.1| malic enzyme [Zea mays]                   325   2e-86   
gi|513166350|ref|XP_004938942.1| PREDICTED: NADP-dependent malic...   325   2e-86   
gi|290972108|ref|XP_002668802.1| predicted protein [Naegleria gr...   325   2e-86   
gi|94469192|gb|ABF18445.1| malic enzyme [Aedes aegypti]               325   2e-86   
gi|326914540|ref|XP_003203583.1| PREDICTED: NADP-dependent malic...   325   2e-86   
gi|242051767|ref|XP_002455029.1| hypothetical protein SORBIDRAFT...   325   2e-86   
gi|117959869|gb|ABK59894.1| ME2 [Tigriopus californicus]              325   2e-86   
gi|223647696|gb|ACN10606.1| NADP-dependent malic enzyme, mitocho...   325   2e-86   
gi|1708924|sp|P51615.1|MAOX_VITVI RecName: Full=NADP-dependent m...   325   2e-86   
gi|117959867|gb|ABK59893.1| ME2 [Tigriopus californicus] >gi|117...   325   2e-86   
gi|15239146|ref|NP_196728.1| NADP-dependent malic enzyme 2 [Arab...   325   2e-86   
gi|332019833|gb|EGI60294.1| NADP-dependent malic enzyme [Acromyr...   325   3e-86   
gi|50418515|gb|AAH78317.1| Malic enzyme 2, NAD(+)-dependent, mit...   325   3e-86   
gi|2497785|sp|Q29558.1|MAOX_PIG RecName: Full=NADP-dependent mal...   325   3e-86   
gi|483502367|gb|EOA95543.1| NADP-dependent malic enzyme, mitocho...   325   3e-86   
gi|162957175|gb|ABY25986.1| NADP-dependent malic enzyme 1 [Triti...   325   3e-86   
gi|152926126|gb|ABS32242.1| NADP-malic enzyme [Flaveria floridana]    325   3e-86   
gi|18460985|gb|AAK91502.1| NADP-dependent malic enzyme [Zea mays]     325   3e-86   
gi|395318401|gb|AFN54300.1| malic enzyme, partial [Tigriopus cal...   325   3e-86   
gi|194743202|ref|XP_001954089.1| GF18099 [Drosophila ananassae] ...   324   3e-86   
gi|117959819|gb|ABK59869.1| ME2 [Tigriopus californicus] >gi|117...   324   4e-86   
gi|50897495|gb|AAO67523.2| mitochondrial malic enzyme 2 [Xenopus...   324   4e-86   
gi|117959795|gb|ABK59857.1| ME2 [Tigriopus californicus] >gi|117...   324   4e-86   
gi|126327750|ref|XP_001376728.1| PREDICTED: NADP-dependent malic...   324   4e-86   
gi|395318409|gb|AFN54304.1| malic enzyme, partial [Tigriopus cal...   324   4e-86   
gi|15077107|gb|AAK83073.1|AF288920_1 putative cytosolic NADP-mal...   324   4e-86   
gi|354489393|ref|XP_003506847.1| PREDICTED: NAD-dependent malic ...   324   4e-86   
gi|91093505|ref|XP_969151.1| PREDICTED: similar to malic enzyme ...   324   4e-86   
gi|125524727|gb|EAY72841.1| hypothetical protein OsI_00711 [Oryz...   324   4e-86   
gi|224054400|ref|XP_002298241.1| predicted protein [Populus tric...   324   4e-86   
gi|152926128|gb|ABS32243.1| NADP-malic enzyme [Flaveria trinervia]    324   4e-86   
gi|237681177|ref|NP_001003627.2| NAD-dependent malic enzyme, mit...   324   4e-86   
gi|431838181|gb|ELK00113.1| NADP-dependent malic enzyme [Pteropu...   324   4e-86   
gi|57791240|gb|AAW56450.1| chloroplast NADP-dependent malic enzy...   324   4e-86   
gi|115434998|ref|NP_001042257.1| Os01g0188400 [Oryza sativa Japo...   324   4e-86   
gi|395318417|gb|AFN54308.1| malic enzyme, partial [Tigriopus cal...   324   4e-86   
gi|118486015|gb|ABK94851.1| unknown [Populus trichocarpa]             324   5e-86   
gi|117959801|gb|ABK59860.1| ME2 [Tigriopus californicus]              324   5e-86   
gi|508782530|gb|EOY29786.1| NADP-malic enzyme 4 [Theobroma cacao]     324   5e-86   
gi|171854655|dbj|BAG16517.1| putative NADP-dependent malic enzym...   323   5e-86   
gi|414875927|tpg|DAA53058.1| TPA: NADP malic enzyme3 [Zea mays]       323   6e-86   
gi|242051769|ref|XP_002455030.1| hypothetical protein SORBIDRAFT...   323   6e-86   
gi|221316701|ref|NP_001100846.2| NAD-dependent malic enzyme, mit...   323   6e-86   
gi|117959813|gb|ABK59866.1| ME2 [Tigriopus californicus]              323   6e-86   
gi|194688810|gb|ACF78489.1| unknown [Zea mays] >gi|223948349|gb|...   323   6e-86   
gi|449435772|ref|XP_004135668.1| PREDICTED: NADP-dependent malic...   323   7e-86   
gi|505845423|ref|XP_004616193.1| PREDICTED: NAD-dependent malic ...   323   7e-86   
gi|147899340|ref|NP_001082582.1| malic enzyme 2 [Xenopus laevis]...   323   7e-86   
gi|357136385|ref|XP_003569785.1| PREDICTED: NADP-dependent malic...   323   8e-86   
gi|395318407|gb|AFN54303.1| malic enzyme, partial [Tigriopus cal...   323   8e-86   
gi|73987737|ref|XP_848770.1| PREDICTED: NADP-dependent malic enz...   323   8e-86   
gi|482558870|gb|EOA23062.1| hypothetical protein CARUB_v10003832...   323   9e-86   
gi|320449082|gb|ADW27478.1| NADP-dependent malic enzyme [Zea mays]    323   9e-86   
gi|356528914|ref|XP_003533042.1| PREDICTED: NADP-dependent malic...   323   9e-86   
gi|213625751|gb|AAI71259.1| mitochondrial malic enzyme 2 [Xenopu...   323   9e-86   
gi|118487388|gb|ABK95522.1| unknown [Populus trichocarpa]             323   1e-85   
gi|350405161|ref|XP_003487345.1| PREDICTED: NADP-dependent malic...   323   1e-85   
gi|390176211|gb|AFL65183.1| plastid NADP-malic enzyme [Sorghum b...   323   1e-85   
gi|338726972|ref|XP_001493140.2| PREDICTED: NADP-dependent malic...   323   1e-85   
gi|415315|dbj|BAA03949.1| NADP-dependent malic enzyme [Oryza sat...   323   1e-85   
gi|323456245|gb|EGB12112.1| hypothetical protein AURANDRAFT_5866...   323   1e-85   
gi|224142207|ref|XP_002324450.1| predicted protein [Populus tric...   323   1e-85   
gi|395521075|ref|XP_003764646.1| PREDICTED: NADP-dependent malic...   322   1e-85   
gi|380024737|ref|XP_003696148.1| PREDICTED: LOW QUALITY PROTEIN:...   322   1e-85   
gi|1561774|gb|AAB08874.1| malate dehydrogenase [Vitis vinifera]       322   1e-85   
gi|404313448|gb|AFR54473.1| cytosolic NADP-malic protein [Prunus...   322   1e-85   
gi|37147841|gb|AAQ88396.1| non-photosynthetic NADP-malic enzyme ...   322   1e-85   
gi|149409770|ref|XP_001509137.1| PREDICTED: NAD-dependent malic ...   322   1e-85   
gi|488542170|ref|XP_004462666.1| PREDICTED: NADP-dependent malic...   322   1e-85   
gi|15077109|gb|AAK83074.1|AF288921_1 putative cytosolic NADP-mal...   322   1e-85   
gi|30575690|gb|AAP33011.1| NADP-malic enzyme [Zea mays]               322   1e-85   
gi|332210999|ref|XP_003254598.1| PREDICTED: NADP-dependent malic...   322   2e-85   
gi|488542168|ref|XP_004462665.1| PREDICTED: NADP-dependent malic...   322   2e-85   
gi|255071005|ref|XP_002507584.1| NAD dependent malate dehydrogen...   322   2e-85   
gi|118480585|gb|ABI98681.2| cytosolic NADP-malic enzyme [Nicotia...   322   2e-85   
gi|395318411|gb|AFN54305.1| malic enzyme, partial [Tigriopus cal...   322   2e-85   
gi|170052885|ref|XP_001862425.1| malic enzyme [Culex quinquefasc...   322   2e-85   
gi|395510669|ref|XP_003759595.1| PREDICTED: NAD-dependent malic ...   322   2e-85   
gi|162459265|ref|NP_001105313.1| NADP-dependent malic enzyme, ch...   322   2e-85   
gi|225442481|ref|XP_002283814.1| PREDICTED: NADP-dependent malic...   322   2e-85   
gi|46850204|gb|AAT02535.1| NADP-dependent malic enzyme 3 [Hydril...   322   2e-85   
gi|350535591|ref|NP_001234458.1| NADP-dependent malic enzyme, ch...   322   2e-85   
gi|508786102|gb|EOY33358.1| NADP-malic enzyme 4 isoform 1 [Theob...   322   2e-85   
gi|46850200|gb|AAT02533.1| NADP-dependent malic enzyme 1 [Hydril...   322   2e-85   
gi|471407996|ref|XP_004385583.1| PREDICTED: NADP-dependent malic...   322   2e-85   
gi|224070971|ref|XP_002303310.1| predicted protein [Populus tric...   322   2e-85   
gi|340726184|ref|XP_003401441.1| PREDICTED: NADP-dependent malic...   322   2e-85   
gi|115420|sp|P12628.1|MAOX_PHAVU RecName: Full=NADP-dependent ma...   322   3e-85   
gi|114639684|ref|XP_508682.2| PREDICTED: NADP-dependent malic en...   321   3e-85   
gi|395318403|gb|AFN54301.1| malic enzyme, partial [Tigriopus cal...   321   3e-85   
gi|466019484|ref|XP_004271915.1| PREDICTED: NADP-dependent malic...   321   3e-85   
gi|357507187|ref|XP_003623882.1| Malic enzyme [Medicago truncatu...   321   3e-85   
gi|334323530|ref|XP_001379418.2| PREDICTED: NADP-dependent malic...   321   3e-85   
gi|449515454|ref|XP_004164764.1| PREDICTED: NADP-dependent malic...   321   3e-85   
gi|227286|prf||1701292A NADP dependent malic enzyme                   321   3e-85
gi|346716344|ref|NP_001231187.1| NADP-dependent malic enzyme, mi...   321   3e-85   
gi|340726186|ref|XP_003401442.1| PREDICTED: NADP-dependent malic...   321   3e-85   
gi|449461331|ref|XP_004148395.1| PREDICTED: NADP-dependent malic...   321   3e-85   
gi|57899542|dbj|BAD87056.1| putative NADP-dependent malic protei...   321   4e-85   
gi|511955490|ref|XP_004796072.1| PREDICTED: NADP-dependent malic...   321   4e-85   
gi|125527668|gb|EAY75782.1| hypothetical protein OsI_03698 [Oryz...   321   4e-85   
gi|498969980|ref|XP_004547288.1| PREDICTED: NAD-dependent malic ...   321   4e-85   
gi|397526231|ref|XP_003833038.1| PREDICTED: LOW QUALITY PROTEIN:...   321   4e-85   
gi|119595544|gb|EAW75138.1| malic enzyme 3, NADP(+)-dependent, m...   321   4e-85   
gi|218188979|gb|EEC71406.1| hypothetical protein OsI_03572 [Oryz...   321   4e-85   


>gi|162135180|gb|ABX82699.1| malic enzyme [Umbelopsis isabellina]
          Length = 588

 Score =  608 bits (1567), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 300/520 (57%), Positives = 370/520 (71%), Gaps = 16/520 (3%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N+ LFY+IV  ELEE+ P+IYTPTVG AC+E+S+I PFLAPPG PDGLYL+  DLPN+ +
Sbjct: 81  NIRLFYKIVCDELEELAPVIYTPTVGHACVEWSNIYPFLAPPGTPDGLYLTQADLPNIKE 140

Query: 61  IIKTYRPYPYD-DTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRT 119
           +I+TY+P+P D    +P+IAVI+DGSRILGLGDLGVNGMGIP+GKLQLYVA AGIDPRRT
Sbjct: 141 LIRTYQPFPTDPHPFSPEIAVISDGSRILGLGDLGVNGMGIPIGKLQLYVAGAGIDPRRT 200

Query: 120 LPITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSS 179
           LPI LDLGTNNEK L+D+FYLG+R+KR +DD FY  VD V+ +L   +PELL+QFED+SS
Sbjct: 201 LPIMLDLGTNNEKFLEDDFYLGVRNKRPNDDVFYDAVDQVLSALYSEFPELLVQFEDWSS 260

Query: 180 EHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLV--EKDVHPTKHRLLFFXXXXX 237
           EHAF LL KY+  TFCFNDDIQGTGAV+LSG +NA K+V  E  V    HR++FF     
Sbjct: 261 EHAFGLLEKYQHKTFCFNDDIQGTGAVILSGLMNAYKVVANEDKVAAKDHRIVFFGAGSA 320

Query: 238 XXXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQ 297
                KQ+ ++F +EHG +EEEA+++ ++VD+KGL+T DRGD LA+HK YF+RDDN+G Q
Sbjct: 321 GIGVAKQIKDYFIIEHGFTEEEARKVFYIVDSKGLITNDRGDRLAEHKKYFSRDDNNGQQ 380

Query: 298 FKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDA 357
           FK L ++I YVKPT LIGLSS    F E I+ RMAELNK PI+FPLSNP   AECTF  A
Sbjct: 381 FKDLLDIINYVKPTTLIGLSSQPQTFTEPILRRMAELNKQPIVFPLSNPSTQAECTFAQA 440

Query: 358 MKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
           M+ TDNRV+FASGTAFP YT+ ETG  K PGQGNN YIFPGLGLGA +AKP  ITD  +Y
Sbjct: 441 MEFTDNRVLFASGTAFPTYTITETGAVKIPGQGNNFYIFPGLGLGASIAKPAHITDNMVY 500

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP + RIR +S              GLAR+ QI  +V   
Sbjct: 501 QSAAALADCLTPEEKAERRLYPNLKRIRQISAEVAAAVCIEAVKEGLARNPQIETVV--- 557

Query: 478 IEVLKTRKGKEWDNLVKFVQENMWDPDSEKFFNTEELLSK 517
                    K+ D L+K+V E MW P+S+  +  E+ +SK
Sbjct: 558 ---------KDRDQLIKYVMERMWTPESDG-YGAEKSISK 587



>gi|511005084|gb|EPB86434.1| hypothetical protein HMPREF1544_06796 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 607

 Score =  606 bits (1562), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 291/506 (57%), Positives = 358/506 (70%), Gaps = 15/506 (2%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFY+IVI ELEE+ P+IYTPTVGTACLEYS I PFLA PG+PDGLYL+  +LP L Q
Sbjct: 102 NVRLFYKIVIDELEELAPVIYTPTVGTACLEYSTIYPFLAAPGVPDGLYLTKAELPELCQ 161

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
            I+ YRP    +   P+IAVI+DGSRILGLGDLG NG+GIP+GKLQLYVA AGIDPRRTL
Sbjct: 162 TIRNYRPTD-TEGFEPEIAVISDGSRILGLGDLGTNGIGIPIGKLQLYVAGAGIDPRRTL 220

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LDLGTNNEK L DEFY+GLR KR +D++FY  VD V+ +L  VYP LLIQFED+SSE
Sbjct: 221 PIILDLGTNNEKLLNDEFYIGLRQKRPNDEEFYQTVDTVLTALHTVYPNLLIQFEDWSSE 280

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKD--VHPTKHRLLFFXXXXXX 238
           HAF LL KY+    CFNDDIQGTGAV+LSG INA++ VEK+  V P  HR++F+      
Sbjct: 281 HAFGLLEKYQNQMLCFNDDIQGTGAVILSGVINAIRKVEKENQVSPRDHRIVFYGAGSAA 340

Query: 239 XXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQF 298
               +Q+  +F++EH M+EEEAK + W+VD+KGLVT  RGD LA+HKVY+AR DN+G Q+
Sbjct: 341 IGVARQIQSYFQIEHNMTEEEAKHVFWIVDSKGLVTTTRGDKLAQHKVYYARGDNEGQQY 400

Query: 299 KTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAM 358
           K L +++ YVKPTALIGLSST G FN +++ R+A LN+ PI+FPLSNP   AECTFE AM
Sbjct: 401 KELIDIVNYVKPTALIGLSSTTGAFNTQVLERLASLNEQPIVFPLSNPATQAECTFEQAM 460

Query: 359 KGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYI 418
           + T+N+VIFASGTAFP YT+  TG+ KYPGQGNNMYIFPGLGLGA+LAKPK I+D+ IY 
Sbjct: 461 EATNNKVIFASGTAFPAYTIKSTGEVKYPGQGNNMYIFPGLGLGAVLAKPKHISDRMIYE 520

Query: 419 XXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDI 478
                              YP + RIR VS               LA  + ++       
Sbjct: 521 ASKALADSLTEEEISKGWLYPSLKRIRSVSAIVAAAVCQETLNENLATSQAMMTQC---- 576

Query: 479 EVLKTRKGKEWDNLVKFVQENMWDPD 504
                   K  ++++ +V  +MW PD
Sbjct: 577 --------KSHEDILDYVSAHMWSPD 594



>gi|384488567|gb|EIE80747.1| hypothetical protein RO3G_05452 [Rhizopus delemar RA 99-880]
          Length = 569

 Score =  587 bits (1513), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 288/505 (57%), Positives = 357/505 (70%), Gaps = 20/505 (3%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFY++V+  L+E  P+IYTPTVGTAC+EYS+I PFLA PG+PDGLY++ + +  L Q
Sbjct: 75  NTPLFYKLVMDNLQEFAPIIYTPTVGTACIEYSNIYPFLAAPGVPDGLYINSDRMSELEQ 134

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
            I+ Y+P P     +P+IAVITDGSRILGLGDLG NG+GI +GKLQLYVA AGIDPRRTL
Sbjct: 135 TIRNYQPVP---DFSPEIAVITDGSRILGLGDLGSNGIGISIGKLQLYVAVAGIDPRRTL 191

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LDLGTNNEK L+DEFYLGLR  R  DDQFYS VD V+++L  VYP+LLIQFED+SSE
Sbjct: 192 PIVLDLGTNNEKLLQDEFYLGLRQHRPADDQFYSIVDKVLQTLHAVYPKLLIQFEDWSSE 251

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKD--VHPTKHRLLFFXXXXXX 238
           HAF LL KY++   CFNDDIQGTGAV+LSG INA++ V+K+  + P +HR+LF+      
Sbjct: 252 HAFGLLEKYQDKLLCFNDDIQGTGAVILSGVINAIRRVQKETGLDPREHRILFYGAGSAA 311

Query: 239 XXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQF 298
               +Q+ ++F+ E GM+EEEAK++ W+VD+KGLVTLDRGD LA+HK YFAR+DN+G Q+
Sbjct: 312 IGVGRQIQQYFETELGMTEEEAKKVFWIVDSKGLVTLDRGDRLAQHKTYFARNDNEGQQY 371

Query: 299 KTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAM 358
           K L ++I YVKPTALIGLSST G F+ K + R+AELN  P+IFPLSNP   AECTF +AM
Sbjct: 372 KDLMDIINYVKPTALIGLSSTTGAFHRKALERLAELNPLPVIFPLSNPATQAECTFAEAM 431

Query: 359 KGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYI 418
           + T NRVIFASGTAFP YT P TG+T  PGQGNNMYIFPGLGLGA+LA+PK I+ K IY 
Sbjct: 432 EATKNRVIFASGTAFPNYTTP-TGETHVPGQGNNMYIFPGLGLGAVLAQPKQISSKMIYS 490

Query: 419 XXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDI 478
                              YP ++RIR VS               L +D+ I  M +   
Sbjct: 491 ASKALADALTTEELDQHWLYPSLTRIREVSREVAVAVIEESIREDLCQDETIKTMSRQ-- 548

Query: 479 EVLKTRKGKEWDNLVKFVQENMWDP 503
                       +L+  V + MW P
Sbjct: 549 ------------SLLDHVSKQMWHP 561



>gi|120564457|gb|ABM30154.1| malic enzyme protein 2 [Mortierella alpina]
          Length = 669

 Score =  586 bits (1511), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 302/504 (59%), Positives = 360/504 (71%), Gaps = 12/504 (2%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFY +V  +LEE  PLIYTPTVGTAC  YS I PFLAPPG PDGL+LS+NDLPNLTQ
Sbjct: 164 NVRLFYGLVGDQLEETLPLIYTPTVGTACQNYSSIYPFLAPPGQPDGLFLSINDLPNLTQ 223

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           II+ Y+P+P D +LTPQIAVITDGSRILGLGDLGV GMGIPVGKLQLYVA AGIDPRRTL
Sbjct: 224 IIQNYKPFPQDPSLTPQIAVITDGSRILGLGDLGVGGMGIPVGKLQLYVAGAGIDPRRTL 283

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PITLDLGTNNE  LKDEFYLGLR KR  DD+F+ FVDAV+++L  +YP+LLIQFEDFSSE
Sbjct: 284 PITLDLGTNNEDKLKDEFYLGLREKRAGDDKFFPFVDAVIEALTSLYPKLLIQFEDFSSE 343

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           HAF LL KY+   FCFNDDIQGTGAV+L+GF+NA+ L    +    H++LFF        
Sbjct: 344 HAFQLLDKYQPKKFCFNDDIQGTGAVILAGFMNAINLA--GIPAKDHKILFFGAGSAAVC 401

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL  +F  +HGM+E+EA+ +VWLVD+KGLVTLDRGD LA+HK+YFAR DN G+Q+ +
Sbjct: 402 VAKQLAAYFVNDHGMTEDEAREMVWLVDSKGLVTLDRGDKLAEHKLYFARKDNAGSQYPS 461

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           +  VIE+V+PTAL GLSS  G F+E ++  MA LN+ PI+FPLSNP   AEC+FE AM  
Sbjct: 462 IASVIEHVRPTALFGLSSQSGAFSEDVLKSMATLNQRPIVFPLSNPAYQAECSFEQAMIH 521

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           T  +VIFASGTAFP+YT P TG    PGQGNNMYIFPGLGLG ILA+P+ I+D+ IY   
Sbjct: 522 TKGKVIFASGTAFPKYTDPNTGLISAPGQGNNMYIFPGLGLGGILAQPETISDRLIYSAA 581

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YPV+ RIR VS              G A +++ I++V      
Sbjct: 582 RACANALTVEERSQGLLYPVLPRIRQVSAEVAAAVVTEAVAEGTATNEEAIKLV------ 635

Query: 481 LKTRKGKEWDNLVKFVQENMWDPD 504
               K  +   L+ FV  NMW  D
Sbjct: 636 ----KSHDKAALLNFVNSNMWTTD 655



>gi|384494191|gb|EIE84682.1| hypothetical protein RO3G_09392 [Rhizopus delemar RA 99-880]
          Length = 550

 Score =  584 bits (1505), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 287/510 (56%), Positives = 356/510 (69%), Gaps = 27/510 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFY+IV+ ELEE+ P+IYTPTVGTACLEYS I PFLA PG+PDGL+L+ +DLP LT+
Sbjct: 53  NVRLFYKIVMDELEELAPIIYTPTVGTACLEYSTIYPFLAAPGVPDGLFLTKSDLPTLTE 112

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
            IK Y+       L PQIAVI+DGSRILGLGDLG NGMGIP+GKLQLYVA AGIDPRRTL
Sbjct: 113 TIKNYQ-----SQLEPQIAVISDGSRILGLGDLGSNGMGIPIGKLQLYVACAGIDPRRTL 167

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LDLGTNNEK L DEFY+GL  KR DD++FY  VD V+++L+ VYP +L+QFED+SSE
Sbjct: 168 PILLDLGTNNEKLLNDEFYIGLSQKRPDDEEFYETVDKVVQALVTVYPNILVQFEDWSSE 227

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLV--EKDVHPTKHRLLFFXXXXXX 238
           HAF LL +Y+    CFNDDIQGTGAV+LSG INA++ V  E  V P  HR+LF+      
Sbjct: 228 HAFGLLERYKSKILCFNDDIQGTGAVILSGIINAIRKVQNEDSVPPKDHRILFYGAGSAA 287

Query: 239 XXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQF 298
                Q+ ++F+ EH + EEEAK+L W+VD+KGLVT  RGD LA+HK+Y+AR+D +G ++
Sbjct: 288 IGVAHQIQDYFQFEHKIPEEEAKKLFWIVDSKGLVTKTRGDKLAEHKIYYARED-EGKEY 346

Query: 299 KTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAM 358
           + L ++++YVKPT LIGLSST G FN++++NRM++LN+ PIIFPLSNP   AECTFE AM
Sbjct: 347 RELIDIVDYVKPTILIGLSSTPGAFNKQVLNRMSQLNQQPIIFPLSNPATQAECTFEQAM 406

Query: 359 KGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYI 418
             T+NRVIFASGTAFP YT+P T + KYPGQGNNMYIFPGLGLGAIL++P  ITD+ IY 
Sbjct: 407 IETENRVIFASGTAFPAYTIPSTNQVKYPGQGNNMYIFPGLGLGAILSRPNHITDRMIYA 466

Query: 419 XXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDI 478
                              YP + RIR VS               LA   ++        
Sbjct: 467 TAKALADSLTTEEINQGWLYPSLKRIRDVSATIAIAVYKEAVDANLASLPKV-------- 518

Query: 479 EVLKTRKGKEWDNLVKFVQENMWDPDSEKF 508
                      DN+  +V  NMW P  + +
Sbjct: 519 -----------DNIKDYVISNMWSPIDDHY 537



>gi|511009818|gb|EPB91051.1| hypothetical protein HMPREF1544_02120 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 587

 Score =  580 bits (1496), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 284/510 (55%), Positives = 350/510 (68%), Gaps = 18/510 (3%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFY+I++ +L+E  P+IYTPTVGTAC+EYS+I PFLA PG+PDGLY+   DL NL  
Sbjct: 87  NTRLFYKIIMDDLQEFAPVIYTPTVGTACVEYSNIYPFLAGPGVPDGLYIDSTDLKNLKD 146

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
            I  Y+P P     +P+IAVITDGSRILGLGDLG NG+GI +GKLQLYVA AGIDPRRTL
Sbjct: 147 TIANYKPVP---NFSPEIAVITDGSRILGLGDLGSNGIGISIGKLQLYVAGAGIDPRRTL 203

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LDLGTNNEK   D+FYLGLR  R DDD+FY+ VD V+ ++  VYP LLIQFED+SSE
Sbjct: 204 PIVLDLGTNNEKLRNDDFYLGLRKPRPDDDEFYATVDTVLSTIHDVYPNLLIQFEDWSSE 263

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLV--EKDVHPTKHRLLFFXXXXXX 238
           HAF LL KY++   CFNDDIQGTGAV+LSG INA++ V  E  V P  HR++F+      
Sbjct: 264 HAFGLLEKYQDKLVCFNDDIQGTGAVILSGVINAIRKVQNENGVLPKDHRIVFYGAGSAA 323

Query: 239 XXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQF 298
               +Q+ E+F+ E GM+EEEA+R+ W+VD+KGLVT++RGD LA+HKVYFARDDN   Q+
Sbjct: 324 IGVARQIQEYFQAEFGMTEEEARRVFWIVDSKGLVTMNRGDRLAQHKVYFARDDNQDQQY 383

Query: 299 KTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAM 358
           K L +++ YVKPTALIGLSST   FN +++NR+A +NK PI+FPLSNP   AECTF +AM
Sbjct: 384 KELIDIVNYVKPTALIGLSSTPNAFNTQVLNRLAAINKQPIVFPLSNPATQAECTFAEAM 443

Query: 359 KGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYI 418
           + T+NRVIFASGTAFP YTV  TG+ + PGQGNNMYIFPGLG   +LAKP +I+D  IY 
Sbjct: 444 EATENRVIFASGTAFPSYTVQSTGEVRIPGQGNNMYIFPGLGFAGVLAKPTMISDGMIYS 503

Query: 419 XXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDI 478
                              YP + RIR VS              GL + +Q         
Sbjct: 504 ASKALADSLTSEELSQGWLYPSLIRIRQVSAIVAAAVIEQSIKEGLCQREQ--------- 554

Query: 479 EVLKTRKGKEWDNLVKFVQENMWDPDSEKF 508
             LK    KE   L+ +V   MW P  E +
Sbjct: 555 -ELKPLSHKE---LLDYVTSEMWTPTQEGY 580



>gi|121495966|gb|ABM45933.1| malic enzyme [Mucor circinelloides]
          Length = 620

 Score =  560 bits (1442), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 279/508 (54%), Positives = 346/508 (68%), Gaps = 20/508 (3%)

Query: 1   NVSLFYRIVIGELE--EITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNL 58
           NV LFY+IVI ELE  ++ P+IYTPTVGTACLEYS I PFLA PG+PDGLYL+  +LP L
Sbjct: 116 NVRLFYKIVIDELETVQLAPVIYTPTVGTACLEYSTIYPFLAAPGVPDGLYLTKAELPEL 175

Query: 59  TQIIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRR 118
            Q I+ YRP    +   P+IAVI+DGSRILGLGDLG NGMGIP+GKLQLYVA AGIDPRR
Sbjct: 176 CQTIRNYRPTD-TEGFEPEIAVISDGSRILGLGDLGTNGMGIPMGKLQLYVAGAGIDPRR 234

Query: 119 TLPITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFS 178
           TLPI LDLGTNNEK L DEFY+GLR KR +D++FY  VD V+ +L  VYP LLIQFED+S
Sbjct: 235 TLPIILDLGTNNEKLLNDEFYIGLRQKRPNDEEFYQTVDTVLTALHTVYPNLLIQFEDWS 294

Query: 179 SEHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKD--VHPTKHRLLFFXXXX 236
           SEHAF LL KY+    CFNDDIQGTGAV+LSG INA++ VEK+  V P  HR++F+    
Sbjct: 295 SEHAFGLLEKYQNQMLCFNDDIQGTGAVILSGVINAIRKVEKENQVSPRDHRIVFYGAGS 354

Query: 237 XXXXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGN 296
                 +Q+  +F++EH M+EEEAK + W+VD+KGLVT  RGD LA+HKVY+AR DN+G 
Sbjct: 355 AAIGVARQIQSYFQIEHNMTEEEAKHVFWIVDSKGLVTTTRGDKLAQHKVYYARGDNEGQ 414

Query: 297 QFKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFED 356
           Q+K L +++ Y    +LIGLSST G FN +++ R+A LN+ PI+FPLSNP   AECTFE 
Sbjct: 415 QYKELIDIVNY-NLYSLIGLSSTTGAFNTQVLERLASLNEQPIVFPLSNPATQAECTFEQ 473

Query: 357 AMKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQI 416
           AM+ T+N+VIFASGTAFP YT+  TG+   PGQGNNMYIFPGLGLGA LA P    D+ I
Sbjct: 474 AMEATNNKVIFASGTAFPAYTIKSTGEVNTPGQGNNMYIFPGLGLGACLANPAHF-DRMI 532

Query: 417 YIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQN 476
           Y                    YP ++  R VS               LA  + ++     
Sbjct: 533 YEASKALADSLTEEEISKAWLYPSLN-YRSVSAIVAAAVCQETLNENLATSQAMMTQC-- 589

Query: 477 DIEVLKTRKGKEWDNLVKFVQENMWDPD 504
                     K  ++++ +V  +MW PD
Sbjct: 590 ----------KSHEDILDYVSAHMWSPD 607



>gi|511011356|gb|EPB92567.1| hypothetical protein HMPREF1544_00580 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 612

 Score =  531 bits (1367), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 269/508 (52%), Positives = 354/508 (69%), Gaps = 19/508 (3%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFY+++   +EE  P+IYTPTVG AC  YS I PFL PPG PDGLYL+L DLP+L +
Sbjct: 122 NTRLFYKLINDHIEEFAPIIYTPTVGEACQRYSDIYPFLTPPGTPDGLYLTLKDLPHLDE 181

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           II  Y+    +   TP I V+TDGSRILGLGDLG+NGM I +GKLQLYVA AG+DPR+TL
Sbjct: 182 IIADYKQRSGE---TPDITVMTDGSRILGLGDLGLNGMPISMGKLQLYVAGAGVDPRKTL 238

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GTNNEKNL DE YLG+R KR +D  FY+ VD V+K+L++ +P+LL+QFEDFSSE
Sbjct: 239 PIVLDFGTNNEKNLADEHYLGVREKRPNDKVFYNAVDQVLKALIRAFPDLLVQFEDFSSE 298

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVE--KDVHPTKHRLLFFXXXXXX 238
           HAF LL +Y+    CFNDDIQGTGAV+LSG INA + VE   ++  + HR++F+      
Sbjct: 299 HAFGLLEEYQNKMLCFNDDIQGTGAVILSGLINAFRKVETESNIPLSDHRIVFYGAGSAA 358

Query: 239 XXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQF 298
               +Q+ E+ ++EHG++EE+AK++ ++ D+KGLVT DRGD LA+HKVY+AR DN G Q+
Sbjct: 359 IGVARQIQEYLELEHGLTEEQAKKVFYICDSKGLVTADRGDRLAEHKVYYARHDNQGAQY 418

Query: 299 KTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAM 358
           ++L+++I+YVKPT LIGLSS+ G F++ ++ RM+++N  PI+FPLSNP   AECTFEDAM
Sbjct: 419 QSLDDIIDYVKPTTLIGLSSSTGAFSKSVLERMSQINDQPIVFPLSNPSTKAECTFEDAM 478

Query: 359 KGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYI 418
           K T+N+V+FASGTAFP Y VPET + + PGQGNNMY+FPGLGLG+I+AKP+ IT++ I  
Sbjct: 479 KATNNKVVFASGTAFPAYIVPETKEVRMPGQGNNMYMFPGLGLGSIVAKPESITNRIILR 538

Query: 419 XXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDI 478
                              YP +SRIR VS                 RDK       + +
Sbjct: 539 AAMALADSLTEQERANGWLYPELSRIRDVSTTVAAAVVDQ-----AVRDK------ISTV 587

Query: 479 EVLKTRKGKEWDNLVKFVQENMWDPDSE 506
           + LK+ K  E+ N   +V+E MW    E
Sbjct: 588 DELKSVKPSEYQN---YVKERMWTSSYE 612



>gi|347832297|emb|CCD47994.1| hypothetical protein BofuT4_P113040.1 [Botryotinia fuckeliana T4]
          Length = 650

 Score =  466 bits (1199), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 239/448 (53%), Positives = 304/448 (67%), Gaps = 19/448 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+V   L +ITPLIYTPTVG ACL +S I         P+GLYLS +D  NL +
Sbjct: 157 NVHLFYRLVQEHLTDITPLIYTPTVGEACLRWSEIYQ------QPEGLYLSYHDRGNLEE 210

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++  +R          ++ V+TDGSRILGLGDLGVNGMGIPVGKL LY   AGI P +TL
Sbjct: 211 VLGNWRQSDV------EMTVVTDGSRILGLGDLGVNGMGIPVGKLSLYTGCAGIHPSKTL 264

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PITLDLGTNNEK LKD  Y+G R KRV   +   F++ +M +L K++P +++Q+EDF  +
Sbjct: 265 PITLDLGTNNEKFLKDPLYMGNRMKRVSTKEEAEFMEELMVALNKMWPGIIVQYEDF--K 322

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L+KY+    CFNDDIQGTGAV+L+G INA++     V     R +F         
Sbjct: 323 NPFPSLAKYQNKYPCFNDDIQGTGAVILAGIINALR--RTGVPVKDQRAVFMGAGSAGVG 380

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             +Q++EFF+ E G++E+EA+R  W VDTKGL+T DRGD LA+HKVYF+RDDNDG Q+KT
Sbjct: 381 VAQQIVEFFRKE-GLTEDEARRCFWFVDTKGLITNDRGDKLAEHKVYFSRDDNDGKQYKT 439

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L EV+EYVKPT L+GLS+  G+F+E I+ RMA+LNK+PIIFPLSNP   AECTFE+AMK 
Sbjct: 440 LPEVVEYVKPTILMGLSTIRGIFDESIVKRMAQLNKSPIIFPLSNPSSQAECTFEEAMKW 499

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           TD R +FASG+ FP+Y   + GKT   GQGNNMY+FPG+GLG+IL K   I  + IY   
Sbjct: 500 TDCRALFASGSPFPDYV--QDGKTYSAGQGNNMYVFPGIGLGSILCKASCINQEMIYASA 557

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                            YP ++RIR VS
Sbjct: 558 EALSTSLTPSEISAGRLYPELNRIREVS 585



>gi|154302961|ref|XP_001551889.1| hypothetical protein BC1G_09224 [Botryotinia fuckeliana B05.10]
          Length = 685

 Score =  466 bits (1199), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 240/448 (53%), Positives = 304/448 (67%), Gaps = 19/448 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+V   L +ITPLIYTPTVG ACL +S I         P+GLYLS +D  NL +
Sbjct: 157 NVHLFYRLVQEHLTDITPLIYTPTVGEACLRWSEIYQ------QPEGLYLSYHDRGNLEE 210

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++  +R    + T      V+TDGSRILGLGDLGVNGMGIPVGKL LY   AGI P +TL
Sbjct: 211 VLGNWRQSDVEMT------VVTDGSRILGLGDLGVNGMGIPVGKLSLYTGCAGIHPSKTL 264

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PITLDLGTNNEK LKD  Y+G R KRV   +   F++ +M +L K++P +++Q+EDF  +
Sbjct: 265 PITLDLGTNNEKFLKDPLYMGNRMKRVSTKEEAEFMEELMVALNKMWPGIIVQYEDF--K 322

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L+KY+    CFNDDIQGTGAV+L+G INA++     V     R +F         
Sbjct: 323 NPFPSLAKYQNKYPCFNDDIQGTGAVILAGIINALR--RTGVPVKDQRAVFMGAGSAGVG 380

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             +Q++EFF+ E G++E+EA+R  W VDTKGL+T DRGD LA+HKVYF+RDDNDG Q+KT
Sbjct: 381 VAQQIVEFFRKE-GLTEDEARRCFWFVDTKGLITNDRGDKLAEHKVYFSRDDNDGKQYKT 439

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L EV+EYVKPT L+GLS+  G+F+E I+ RMA+LNK+PIIFPLSNP   AECTFE+AMK 
Sbjct: 440 LPEVVEYVKPTILMGLSTIRGIFDESIVKRMAQLNKSPIIFPLSNPSSQAECTFEEAMKW 499

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           TD R +FASG+ FP+Y   + GKT   GQGNNMY+FPG+GLG+IL K   I  + IY   
Sbjct: 500 TDCRALFASGSPFPDYV--QDGKTYSAGQGNNMYVFPGIGLGSILCKASCINQEMIYASA 557

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                            YP ++RIR VS
Sbjct: 558 EALSTSLTPSEISAGRLYPELNRIREVS 585



>gi|472245557|gb|EMR90126.1| putative nadp-dependent malic enzyme protein [Botryotinia
           fuckeliana BcDW1]
          Length = 650

 Score =  465 bits (1197), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 238/448 (53%), Positives = 303/448 (67%), Gaps = 19/448 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+V   L +ITPLIYTPTVG ACL +S I         P+GLYLS +D  NL +
Sbjct: 157 NVHLFYRLVQEHLTDITPLIYTPTVGEACLRWSEIYQ------QPEGLYLSYHDRGNLEE 210

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++  +R          ++ V+TDGSRILGLGDLG NGMGIPVGKL LY   AGI P +TL
Sbjct: 211 VLGNWRQSDV------EMTVVTDGSRILGLGDLGANGMGIPVGKLSLYTGCAGIHPSKTL 264

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PITLDLGTNNEK LKD  Y+G R KRV   +   F++ +M +L K++P +++Q+EDF  +
Sbjct: 265 PITLDLGTNNEKFLKDPLYMGNRMKRVSTKEEAEFMEELMVALNKMWPGIIVQYEDF--K 322

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L+KY+    CFNDDIQGTGAV+L+G INA++     V     R +F         
Sbjct: 323 NPFPSLAKYQNKYPCFNDDIQGTGAVILAGIINALR--RTGVPVKDQRAVFMGAGSAGVG 380

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             +Q++EFF+ E G++E+EA+R  W VDTKGL+T DRGD LA+HKVYF+RDDNDG Q+KT
Sbjct: 381 VAQQIVEFFRKE-GLTEDEARRCFWFVDTKGLITNDRGDKLAEHKVYFSRDDNDGKQYKT 439

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L EV+EYVKPT L+GLS+  G+F+E I+ RMA+LNK+PIIFPLSNP   AECTFE+AMK 
Sbjct: 440 LPEVVEYVKPTILMGLSTIRGIFDESIVKRMAQLNKSPIIFPLSNPSSQAECTFEEAMKW 499

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           TD R +FASG+ FP+Y   + GKT   GQGNNMY+FPG+GLG+IL K   I  + IY   
Sbjct: 500 TDCRALFASGSPFPDYV--QDGKTYSAGQGNNMYVFPGIGLGSILCKASCINQEMIYASA 557

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                            YP ++RIR VS
Sbjct: 558 EALSTSLTLSEISAGRLYPELNRIREVS 585



>gi|367025765|ref|XP_003662167.1| hypothetical protein MYCTH_2302433 [Myceliophthora thermophila ATCC
           42464]
 gi|347009435|gb|AEO56922.1| hypothetical protein MYCTH_2302433 [Myceliophthora thermophila ATCC
           42464]
          Length = 567

 Score =  464 bits (1193), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 246/515 (47%), Positives = 322/515 (62%), Gaps = 40/515 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+++   +E+ PL+YTPT+G  CL+YS +         P+ LY+S+    ++  
Sbjct: 79  NVDLFYRLLVDNAKELMPLVYTPTIGDVCLQYSTLYTR------PEALYISIKQRKSIKT 132

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I++ + PYP      P+I V+TDGSRILGLGDLGVNG+GIP+GKL LY AAAGI P +TL
Sbjct: 133 ILRNW-PYP-----NPEICVVTDGSRILGLGDLGVNGVGIPIGKLALYTAAAGIHPAKTL 186

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GT NE NLKD  YLGLRSKRV   +   F+D  M++  +VYP++++QFEDF SE
Sbjct: 187 PIVLDCGTANEANLKDPLYLGLRSKRVSVAEQQDFMDEFMQAAAEVYPDMVVQFEDFESE 246

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF+ L +YR N  CFNDDIQGTGAVVL G+I AV L    V   + RL+F         
Sbjct: 247 KAFNYLDRYRNNYKCFNDDIQGTGAVVLGGYIGAVNL--SGVPIEEQRLVFMGAGSAGVG 304

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL+E++  + G+SE+ AK   WLVDTKGLVT DRGD LA+HK YFAR DN+G+QF+T
Sbjct: 305 VAKQLVEYY-TKRGLSEQAAKDKFWLVDTKGLVTKDRGDKLAEHKKYFARSDNNGHQFRT 363

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAE------LNKNPIIFPLSNPKVNAECTF 354
           LEEVIEYVKPTAL+GL++T GVF E ++  +        L + PI+FPLSNP   AECTF
Sbjct: 364 LEEVIEYVKPTALVGLTATHGVFTESVVRALKASVDAGGLGRRPILFPLSNPLTKAECTF 423

Query: 355 EDAMKGTDNRVIFASGTAFPEYTVPETGK--TKYPGQGNNMYIFPGLGLGAILAKPKVIT 412
           E A+  TD  VIFASG+ F  +TV  T    T YP QGNN+Y+FPG+GLGAIL+K   +T
Sbjct: 424 EQAVAWTDGTVIFASGSPFSAFTVKTTDHSVTYYPNQGNNVYVFPGIGLGAILSKASRVT 483

Query: 413 DKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLAR--DKQI 470
           D  IY                    YP + R+R  S              G+++  D+Q 
Sbjct: 484 DNMIYTSAAALAGSLNAEEIHKGLIYPRIERVREASLIVAREVMKAARRDGVSQLPDEQW 543

Query: 471 IEMVQNDIEVLKTRKGKEWDN--LVKFVQENMWDP 503
           +E              +EW +  L K+++  ++DP
Sbjct: 544 LEW-------------EEWGDPALDKYIKARIYDP 565



>gi|367038781|ref|XP_003649771.1| hypothetical protein THITE_2108695 [Thielavia terrestris NRRL 8126]
 gi|346997032|gb|AEO63435.1| hypothetical protein THITE_2108695 [Thielavia terrestris NRRL 8126]
          Length = 785

 Score =  461 bits (1186), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 237/456 (51%), Positives = 301/456 (66%), Gaps = 23/456 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR++I   +E+ PL+YTPT+G  CL+YS +         P+ LY+S+    ++  
Sbjct: 297 NVDLFYRLLIDNAKELMPLVYTPTIGDVCLQYSTLYTR------PEALYISIKQRKSIKT 350

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+K + PYP      PQI V+TDGSRILGLGDLG NG+GIP+GKL LY AAAGI P +TL
Sbjct: 351 ILKNW-PYP-----NPQICVVTDGSRILGLGDLGFNGVGIPIGKLALYTAAAGIHPDKTL 404

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GT+NE NLKD  YLGLR+KRV   +   F+D  M++  +VYPE+++QFEDF SE
Sbjct: 405 PIVLDCGTSNEANLKDPLYLGLRAKRVSVAEQQDFMDEFMQAAAEVYPEMVVQFEDFESE 464

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF+ L +YR    CFNDDIQGTGAVVL+G+I AV L    V   + RL+F         
Sbjct: 465 KAFNYLDRYRNTYKCFNDDIQGTGAVVLAGYIGAVNL--SGVPIEEQRLVFMGAGSAGVG 522

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL+E++  + G+SE+ AK   WLVDTKGLVT DRGD LA+HK YFAR DN+G+QF+T
Sbjct: 523 VAKQLVEYY-TKRGLSEQAAKDKFWLVDTKGLVTKDRGDKLAEHKKYFARSDNNGHQFRT 581

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAE------LNKNPIIFPLSNPKVNAECTF 354
           LEEVIEYVKPTAL+GL++T GVF E ++  +        L + PI+FPLSNP   AECTF
Sbjct: 582 LEEVIEYVKPTALVGLTATHGVFTESVVRALKASVDAGGLGRRPILFPLSNPLSKAECTF 641

Query: 355 EDAMKGTDNRVIFASGTAFPEYTVP--ETGKTKYPGQGNNMYIFPGLGLGAILAKPKVIT 412
           E A+  TD  VIFASG+ F ++TV   +   T YP QGNN+Y+FPG+GLGAILAK   +T
Sbjct: 642 EQAVAWTDGTVIFASGSPFSQFTVKSGDHAVTYYPNQGNNVYVFPGIGLGAILAKASRVT 701

Query: 413 DKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
           D  IY                    YP + R+R  S
Sbjct: 702 DNMIYTSAAALAGSLNAEEIHKGLIYPRIERVRDAS 737



>gi|345568542|gb|EGX51435.1| hypothetical protein AOL_s00054g134 [Arthrobotrys oligospora ATCC
           24927]
          Length = 715

 Score =  459 bits (1182), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 240/517 (46%), Positives = 327/517 (63%), Gaps = 37/517 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N+ LFYR+++   +E+ P++YTPT+G  CL+YS I  F  P    + LY+S+    +L  
Sbjct: 207 NLDLFYRLLMDNAKELMPIVYTPTIGDVCLQYSTI--FTKP----EALYISIKQRASLVT 260

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+K + PYP+     P+I V+TDGSRILGLGDLG+NG+GIP+GKL LYVAAAGI+P +TL
Sbjct: 261 ILKNW-PYPH-----PEICVVTDGSRILGLGDLGINGVGIPIGKLALYVAAAGIEPEKTL 314

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LDLGT NE+NL+D  YLGLR +RV   +   F+D  M +   V+P+++IQFEDF ++
Sbjct: 315 PIVLDLGTENEENLRDPLYLGLRQRRVPKPEALEFMDEFMAAAASVFPDMIIQFEDFETD 374

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF  L +YR+    FNDD+QGTGAV+LSG++NAV+L   +V     RL+F         
Sbjct: 375 KAFHYLDRYRDEYKSFNDDVQGTGAVILSGYMNAVRL--SNVPLQDQRLVFMGAGSAGVG 432

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ++E++    G+SE EAK   +LVDTKGLVT+DRGD LA+HK  FAR DN G+QFKT
Sbjct: 433 VAKQVMEYY-TRQGLSEMEAKSKFYLVDTKGLVTMDRGDRLAEHKKVFARTDNAGHQFKT 491

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRM------AELNKNPIIFPLSNPKVNAECTF 354
           LE+VIEYV+PTAL+GL++T G+F E ++  +        +N+ PI+FPLSNP   AECTF
Sbjct: 492 LEDVIEYVRPTALLGLAATFGIFTESVVRALKVSVDAGGMNRRPILFPLSNPLTKAECTF 551

Query: 355 EDAMKGTDNRVIFASGTAFPEYTVPETGKTKY-PGQGNNMYIFPGLGLGAILAKPKVITD 413
           + A+  T+  VIFASG+ FP YT    G   Y PGQGNN+YIFPGLG GAILAK   ITD
Sbjct: 552 QQAVDWTEGTVIFASGSPFPSYTPTNGGGVTYQPGQGNNVYIFPGLGKGAILAKATKITD 611

Query: 414 KQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLAR-DKQIIE 472
           + +Y                    YP + R+R  S              G+++ D+ +  
Sbjct: 612 EMVYSSAVALANCLNAEEIAAGLIYPRIERVRDASVAVAREVMKASRREGVSKLDENLW- 670

Query: 473 MVQNDIEVLKTRKGKEWDNLV--KFVQENMWDPDSEK 507
                      R+  EW ++V  +++Q N +DPD  K
Sbjct: 671 -----------REWSEWGDVVMDQWIQSNSYDPDLSK 696



>gi|302663795|ref|XP_003023535.1| malate dehydrogenase, putative [Trichophyton verrucosum HKI 0517]
 gi|291187538|gb|EFE42917.1| malate dehydrogenase, putative [Trichophyton verrucosum HKI 0517]
          Length = 660

 Score =  458 bits (1179), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 242/509 (47%), Positives = 316/509 (62%), Gaps = 34/509 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           +V LFYR+V+  L+E+TPLIYTP VG AC ++S I         P+G+YLS  D  N+  
Sbjct: 146 SVHLFYRLVMDHLQELTPLIYTPVVGEACQKWSEIYQ------QPEGMYLSYEDRGNIAA 199

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+ + P P  D     I VITDGSRILGLGDLG+NGMGIP+GKL LY A AGI P  TL
Sbjct: 200 VIQNW-PQPNVD-----ITVITDGSRILGLGDLGINGMGIPIGKLALYTACAGIRPEATL 253

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT+N+   +D  Y+G R  +V  +Q   F+D +M +L + +P ++IQFEDF  +
Sbjct: 254 PLTLDLGTSNKALREDPLYMGSRRGKVTQEQELEFMDELMAALTERWPGIVIQFEDF--K 311

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L KYR N  CFNDDIQGTGAV+L G INAVK     V P  HR +F         
Sbjct: 312 NPFPALEKYRHNYTCFNDDIQGTGAVILGGVINAVK--RSGVPPKDHRAVFLGAGSAGVG 369

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ+++FF V+ GM+E+EAK   +LVDTKGLVT DRGD LA HKVYFAR DN+G QFKT
Sbjct: 370 VAKQIVDFF-VKEGMTEDEAKACFYLVDTKGLVTADRGDRLAAHKVYFARHDNNGQQFKT 428

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           LEEV+++VKPT L+GLS+ GGVF  +I+ +MA+ NK PIIFPLSNP  N+EC F+ A+  
Sbjct: 429 LEEVVDHVKPTMLMGLSTLGGVFTPEILKKMADNNKQPIIFPLSNPSANSECDFKSAITH 488

Query: 361 TDNRVIFASGTAFPEYTVPETG---KTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
           TD R +FASG+ FP ++   +     T YPGQGNNMY+FPG+GLG IL+K   +TD  IY
Sbjct: 489 TDGRALFASGSPFPSFSFKNSAGETSTYYPGQGNNMYVFPGIGLGTILSKAVEVTDSMIY 548

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP ++RIR VS               + R+  I     +D
Sbjct: 549 AAADALSTSLTTEELDRGLLYPEITRIREVSVAVARGVIRAAQEAKVDRETAIRTFTDSD 608

Query: 478 IEVLKTRKGKEWDNLVKFVQENMWDPDSE 506
           ++               +++  M++P SE
Sbjct: 609 LD--------------SWIKSKMYNPHSE 623



>gi|326471119|gb|EGD95128.1| NADP-dependent malic enzyme MaeA [Trichophyton tonsurans CBS
           112818]
          Length = 657

 Score =  458 bits (1179), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 242/509 (47%), Positives = 316/509 (62%), Gaps = 34/509 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           +V LFYR+V+  L+E+TPLIYTP VG AC ++S I         P+G+YLS  D  N+  
Sbjct: 143 SVHLFYRLVMDHLQELTPLIYTPVVGEACQKWSEIYQ------QPEGMYLSYEDRGNIAA 196

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+ + P P  D     I VITDGSRILGLGDLG+NGMGIP+GKL LY A AGI P  TL
Sbjct: 197 VIQNW-PQPNVD-----ITVITDGSRILGLGDLGINGMGIPIGKLALYTACAGIRPEATL 250

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT+N+   +D  Y+G R  +V  +Q   F+D +M +L + +P ++IQFEDF  +
Sbjct: 251 PLTLDLGTSNKALREDPLYMGSRRGKVTQEQELEFMDELMAALTERWPGIVIQFEDF--K 308

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L KYR N  CFNDDIQGTGAV+L G INAVK     V P  HR +F         
Sbjct: 309 NPFPALEKYRHNYTCFNDDIQGTGAVILGGVINAVK--RSGVPPKDHRAVFLGAGSAGVG 366

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ+++FF V+ GM+E+EAK   +LVDTKGLVT DRGD LA HKVYFAR DN+G QFKT
Sbjct: 367 VAKQIVDFF-VKEGMTEDEAKACFYLVDTKGLVTADRGDRLAAHKVYFARHDNNGQQFKT 425

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           LEEV+++VKPT L+GLS+ GGVF  +I+ +MA+ NK PIIFPLSNP  N+EC F+ A+  
Sbjct: 426 LEEVVDHVKPTMLMGLSTLGGVFTPEILKKMADNNKQPIIFPLSNPSANSECDFKSAITH 485

Query: 361 TDNRVIFASGTAFPEYTVPETG---KTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
           TD R +FASG+ FP ++   +     T YPGQGNNMY+FPG+GLG IL+K   +TD  IY
Sbjct: 486 TDGRALFASGSPFPSFSFKNSAGETSTYYPGQGNNMYVFPGIGLGTILSKAVEVTDSMIY 545

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP ++RIR VS               + R+  I     +D
Sbjct: 546 AAADALSTSLTTEELDRGLLYPEITRIREVSVAVARGVIRAAQEAKVDRETAIRTFTDSD 605

Query: 478 IEVLKTRKGKEWDNLVKFVQENMWDPDSE 506
           ++               +++  M++P SE
Sbjct: 606 LD--------------SWIKSKMYNPHSE 620



>gi|302509976|ref|XP_003016948.1| malate dehydrogenase, putative [Arthroderma benhamiae CBS 112371]
 gi|291180518|gb|EFE36303.1| malate dehydrogenase, putative [Arthroderma benhamiae CBS 112371]
          Length = 662

 Score =  458 bits (1179), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 242/509 (47%), Positives = 316/509 (62%), Gaps = 34/509 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           +V LFYR+V+  L+E+TPLIYTP VG AC ++S I         P+G+YLS  D  N+  
Sbjct: 148 SVHLFYRLVMDHLQELTPLIYTPVVGEACQKWSEIYQ------QPEGMYLSYEDRGNIAA 201

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+ + P P  D     I VITDGSRILGLGDLG+NGMGIP+GKL LY A AGI P  TL
Sbjct: 202 VIQNW-PQPNVD-----ITVITDGSRILGLGDLGINGMGIPIGKLALYTACAGIRPEATL 255

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT+N+   +D  Y+G R  +V  +Q   F+D +M +L + +P ++IQFEDF  +
Sbjct: 256 PLTLDLGTSNKALREDPLYMGSRRGKVTQEQELEFMDELMAALTERWPGIVIQFEDF--K 313

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L KYR N  CFNDDIQGTGAV+L G INAVK     V P  HR +F         
Sbjct: 314 NPFPALEKYRHNYTCFNDDIQGTGAVILGGVINAVK--RSGVPPKDHRAVFLGAGSAGVG 371

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ+++FF V+ GM+E+EAK   +LVDTKGLVT DRGD LA HKVYFAR DN+G QFKT
Sbjct: 372 VAKQIVDFF-VKEGMTEDEAKACFYLVDTKGLVTADRGDRLAAHKVYFARHDNNGQQFKT 430

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           LEEV+++VKPT L+GLS+ GGVF  +I+ +MA+ NK PIIFPLSNP  N+EC F+ A+  
Sbjct: 431 LEEVVDHVKPTMLMGLSTLGGVFTPEILKKMADNNKQPIIFPLSNPSANSECDFKSAITH 490

Query: 361 TDNRVIFASGTAFPEYTVPETG---KTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
           TD R +FASG+ FP ++   +     T YPGQGNNMY+FPG+GLG IL+K   +TD  IY
Sbjct: 491 TDGRALFASGSPFPSFSFKNSAGETSTYYPGQGNNMYVFPGIGLGTILSKAVEVTDSMIY 550

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP ++RIR VS               + R+  I     +D
Sbjct: 551 AAADALSTSLTTEELDRGLLYPEITRIREVSVAVARGVIRAAQEAKVDRETAIRTFTDSD 610

Query: 478 IEVLKTRKGKEWDNLVKFVQENMWDPDSE 506
           ++               +++  M++P SE
Sbjct: 611 LD--------------SWIKSKMYNPHSE 625



>gi|327302642|ref|XP_003236013.1| NAD-dependent malic enzyme [Trichophyton rubrum CBS 118892]
 gi|326461355|gb|EGD86808.1| NAD-dependent malic enzyme [Trichophyton rubrum CBS 118892]
          Length = 603

 Score =  457 bits (1175), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 242/509 (47%), Positives = 316/509 (62%), Gaps = 34/509 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           +V LFYR+V+  L+E+TPLIYTP VG AC ++S I         P+G+YLS  D  N+  
Sbjct: 89  SVHLFYRLVMDHLQELTPLIYTPVVGEACQKWSEIYQ------QPEGMYLSYEDRGNIAA 142

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+ + P P  D     I VITDGSRILGLGDLG+NGMGIP+GKL LY A AGI P  TL
Sbjct: 143 VIQNW-PQPNVD-----ITVITDGSRILGLGDLGINGMGIPIGKLALYTACAGIRPEATL 196

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT+N+   +D  Y+G R  +V  +Q   F+D +M +L + +P ++IQFEDF  +
Sbjct: 197 PLTLDLGTSNKALREDPLYMGSRRGKVTQEQELEFMDELMAALTERWPGIVIQFEDF--K 254

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L KYR N  CFNDDIQGTGAV+L G INAVK     V P  HR +F         
Sbjct: 255 NPFPALEKYRHNYTCFNDDIQGTGAVILGGVINAVK--RSGVPPKDHRAVFLGAGSAGVG 312

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ+++FF V+ GM+E+EAK   +LVDTKGLVT DRGD LA HKVYFAR DN+G QFKT
Sbjct: 313 VAKQIVDFF-VKEGMTEDEAKACFYLVDTKGLVTADRGDRLAAHKVYFARHDNNGQQFKT 371

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           LEEV+++VKPT L+GLS+ GGVF  +I+ +MA+ NK PIIFPLSNP  N+EC F+ A+  
Sbjct: 372 LEEVVDHVKPTMLMGLSTLGGVFTPEILKKMADNNKQPIIFPLSNPSANSECDFKSAITH 431

Query: 361 TDNRVIFASGTAFPEYTVPETG---KTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
           TD R +FASG+ FP ++   +     T YPGQGNNMY+FPG+GLG IL+K   +TD  IY
Sbjct: 432 TDGRALFASGSPFPSFSFKNSAGETSTYYPGQGNNMYVFPGIGLGTILSKAVEVTDSMIY 491

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP ++RIR VS               + R+  I     +D
Sbjct: 492 AAADALSTSLTTEELDRGLLYPEITRIREVSVAVARGVIRAAQEAKVDRETAIRTFTDSD 551

Query: 478 IEVLKTRKGKEWDNLVKFVQENMWDPDSE 506
           ++               +++  M++P SE
Sbjct: 552 LD--------------SWIKSKMYNPHSE 566



>gi|340914859|gb|EGS18200.1| malic enzyme-like protein [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 846

 Score =  456 bits (1173), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 244/514 (47%), Positives = 324/514 (63%), Gaps = 36/514 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N+ LFYR++I   +E+ PL+YTPT+G  CL+YS +         P+ LY+S+    ++  
Sbjct: 358 NIDLFYRLLIDNAKELMPLVYTPTIGDVCLQYSTLYTR------PEALYISIKQRKSMKT 411

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I++ + PYP      P+I V+TDGSRILGLGDLGVNG+GIP+GKL LYVAAAGI P +TL
Sbjct: 412 ILRNW-PYP-----NPEICVVTDGSRILGLGDLGVNGVGIPIGKLALYVAAAGIHPEKTL 465

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GTNNE NLKD  YLGLR+KR    +   F+D  M++  +VYP++++QFEDF SE
Sbjct: 466 PIVLDCGTNNETNLKDPLYLGLRAKRPSVAEQQEFMDEFMEACREVYPDMVVQFEDFESE 525

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF+ L +YR +  CFNDDIQGTGAVVL+G+I AV L   +V   + RL+F         
Sbjct: 526 KAFNYLDRYRNSYKCFNDDIQGTGAVVLAGYIGAVNL--SNVPIEEQRLVFMGAGSAGVG 583

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL+E++  + G+SE++AK   +LVDTKGLVT DRGD LA+HK YFAR DN+G QF+T
Sbjct: 584 VAKQLVEYY-TKRGLSEQQAKDKFYLVDTKGLVTKDRGDKLAEHKKYFARTDNNGRQFRT 642

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAEL------NKNPIIFPLSNPKVNAECTF 354
           LEEVIEYVKPTALIGL++T GVF E ++  +          + PI+FPLSNP   AECTF
Sbjct: 643 LEEVIEYVKPTALIGLTATHGVFTESVVRALKASVDGGGHGRRPILFPLSNPLSKAECTF 702

Query: 355 EDAMKGTDNRVIFASGTAFPEYT--VPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVIT 412
           E A+  TD  VIFASG+ F +YT  V +   T YP QGNN+Y+FPG+GLGAILAK   +T
Sbjct: 703 EQAVDWTDGTVIFASGSPFSQYTKNVGDVEVTYYPNQGNNVYVFPGIGLGAILAKASRVT 762

Query: 413 DKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIE 472
           D  IY                    YP + R+R  S              G++   Q+ E
Sbjct: 763 DNMIYTSAAALAGTLNADEIRKGLIYPRIERVRESSLVVAREVMKAARRDGVS---QLDE 819

Query: 473 MVQNDIEVLKTRKGKEWDN--LVKFVQENMWDPD 504
            +    E        EW +  L K++++ +++P 
Sbjct: 820 SLWQQFE--------EWGDPALDKWIKDRIYNPQ 845



>gi|116197989|ref|XP_001224806.1| hypothetical protein CHGG_07150 [Chaetomium globosum CBS 148.51]
 gi|88178429|gb|EAQ85897.1| hypothetical protein CHGG_07150 [Chaetomium globosum CBS 148.51]
          Length = 659

 Score =  456 bits (1172), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 233/456 (51%), Positives = 300/456 (65%), Gaps = 23/456 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR++I   +E+ PL+YTPT+G  CL+YS +         P+ LY+S+    ++  
Sbjct: 171 NVDLFYRLLIDNAKELMPLVYTPTIGDVCLQYSTLYTR------PEALYISIKQRKSIRT 224

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++K +R YP      P+I V+TDGSRILGLGDLGVNG+GIP+GKL LY AAAGI P + L
Sbjct: 225 MLKNWR-YP-----NPEICVVTDGSRILGLGDLGVNGVGIPIGKLALYTAAAGIHPEKAL 278

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GT NE NLKD  YLGLR+KR    +  +F+D  M++  +VYPE+++QFEDF SE
Sbjct: 279 PIVLDCGTANESNLKDPLYLGLRAKRPSVAEQQAFMDEFMEAAAEVYPEMVVQFEDFESE 338

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF+ L +YR N  CFNDDIQGTGAVVL G+I AV L    V   + RL+F         
Sbjct: 339 KAFNYLDRYRNNYKCFNDDIQGTGAVVLGGYIGAVNL--SGVPLEEQRLVFMGAGSAGVG 396

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL+E++  + G+SE+ AK   WLVDTKGLVT DRGD LA+HK YFAR DN+G+QF++
Sbjct: 397 VAKQLVEYY-TKRGLSEQAAKDKFWLVDTKGLVTRDRGDKLAEHKKYFARTDNNGHQFRS 455

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAE------LNKNPIIFPLSNPKVNAECTF 354
           LEEVIEYVKPTAL+GL++T GVF E ++  +        L + PI+FPLSNP   AECTF
Sbjct: 456 LEEVIEYVKPTALVGLTATHGVFTESVVRALKASVDAGGLGRRPILFPLSNPLTKAECTF 515

Query: 355 EDAMKGTDNRVIFASGTAFPEYTVPETGK--TKYPGQGNNMYIFPGLGLGAILAKPKVIT 412
           E A+  TD  VIFASG+ F  +TV  + +  T YP QGNN+Y+FPG+GLGAIL+K   +T
Sbjct: 516 EQAVTWTDGTVIFASGSPFSAFTVKSSEQPVTYYPNQGNNVYVFPGIGLGAILSKSSRVT 575

Query: 413 DKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
           D  IY                    YP + R+R  S
Sbjct: 576 DNMIYTSAAALAGSLNAEEVQKGLIYPRIERVRDAS 611



>gi|315040924|ref|XP_003169839.1| NAD-dependent malic enzyme [Arthroderma gypseum CBS 118893]
 gi|311345801|gb|EFR05004.1| NAD-dependent malic enzyme [Arthroderma gypseum CBS 118893]
          Length = 650

 Score =  454 bits (1169), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 241/509 (47%), Positives = 316/509 (62%), Gaps = 34/509 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           +V LFYR+V+  L+E+TPLIYTP VG AC ++S I         P+G+YLS  D  N+  
Sbjct: 136 SVHLFYRLVMDHLQELTPLIYTPVVGEACQKWSEIYQ------QPEGMYLSYEDRGNIAA 189

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+ + P P  D     I VITDGSRILGLGDLG+NGMGIP+GKL LY A AGI P  TL
Sbjct: 190 VIQNW-PQPNVD-----ITVITDGSRILGLGDLGINGMGIPIGKLALYTACAGIRPEATL 243

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT+N+   +D  Y+G R  +V  +Q   F+D +M +L + +P ++IQFEDF  +
Sbjct: 244 PLTLDLGTSNKALREDPLYMGSRRGKVTQEQELEFMDELMAALTERWPGIVIQFEDF--K 301

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L KYR N  CFNDDIQGTGAV+L G INAVK     + P  HR +F         
Sbjct: 302 NPFPALVKYRHNYTCFNDDIQGTGAVILGGVINAVK--RSGLPPKDHRAVFLGAGSAGVG 359

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ+++FF V+ GM+E+EAK   +LVDTKGLVT DRGD LA HKVYFAR DN+G QFKT
Sbjct: 360 VAKQIVDFF-VKEGMTEDEAKACFYLVDTKGLVTADRGDRLAAHKVYFARHDNNGQQFKT 418

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           LEEV+++VKPT L+GLS+ GGVF  +I+ +MA+ NK PIIFPLSNP  N+EC F+ A+  
Sbjct: 419 LEEVVDHVKPTMLMGLSTLGGVFTPEILKKMADNNKQPIIFPLSNPSANSECDFKSAITH 478

Query: 361 TDNRVIFASGTAFPEYTVPETG---KTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
           TD R +FASG+ FP ++   +     T YPGQGNNMY+FPG+GLG IL+K   +TD  IY
Sbjct: 479 TDGRALFASGSPFPSFSFKNSAGETSTYYPGQGNNMYVFPGIGLGTILSKAVEVTDTMIY 538

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP ++RIR VS               + R+  I     +D
Sbjct: 539 AAADALATSLTTEELDRGLLYPEITRIREVSVSVARGVIRAAQDAKVDRETAIRTFSDSD 598

Query: 478 IEVLKTRKGKEWDNLVKFVQENMWDPDSE 506
           ++               +++  M++P SE
Sbjct: 599 LD--------------SWIKSKMYNPHSE 613



>gi|346974189|gb|EGY17641.1| NADP-dependent malic enzyme [Verticillium dahliae VdLs.17]
          Length = 618

 Score =  454 bits (1169), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 241/526 (45%), Positives = 325/526 (61%), Gaps = 44/526 (8%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N+ LFYR++I  + E+ PL+YTPT+G  CL+YS +         P+ LY+S+    ++  
Sbjct: 121 NMDLFYRVIIDNIRELMPLVYTPTIGDVCLQYSSLYTR------PEALYISIKQRKSIRT 174

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +++ + PYP      P+I V+TDGSRILGLGDLGVNG+GI +GKL LY  AAG+DP +TL
Sbjct: 175 MLRNW-PYP-----DPEICVVTDGSRILGLGDLGVNGVGISIGKLALYTGAAGVDPSKTL 228

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GTNNE NLKD FYLGLR KRV  +    F+D  M++  +V+P +++QFEDF +E
Sbjct: 229 PIVLDTGTNNEDNLKDPFYLGLRHKRVSVETQQEFMDEFMEAATEVFPNMVVQFEDFDTE 288

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF+ L +YR    CFNDDIQGTGAVVL G+I AV L    V   + RL+F         
Sbjct: 289 KAFNYLDRYRNKYRCFNDDIQGTGAVVLGGYIGAVNL--SGVPLEEQRLVFMGAGSAGVG 346

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL+E++    G+SE++A+   WLVDTKGLVT DRGDNLA+HK YFAR DN+G+QF+T
Sbjct: 347 VAKQLVEYY-TRRGLSEQQAREKFWLVDTKGLVTRDRGDNLAEHKKYFARTDNNGHQFRT 405

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAE------LNKNPIIFPLSNPKVNAECTF 354
           LEEVIEYVKP+AL+GL++T GVF E  +  +        L + PI+FPLSNP   AECTF
Sbjct: 406 LEEVIEYVKPSALVGLTATFGVFTESTVRALKASVDSGGLGRRPILFPLSNPLTKAECTF 465

Query: 355 EDAMKGTDNRVIFASGTAFPEYTVPE---TGKTKYPGQGNNMYIFPGLGLGAILAKPKVI 411
           E A++ TD  VIFASG+ F  +T+        T +P QGNN+Y+FPGLGLGAIL+K   +
Sbjct: 466 EQAVQWTDGSVIFASGSPFSPFTMKTPDGQAITYHPNQGNNVYVFPGLGLGAILSKATHV 525

Query: 412 TDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLAR--DKQ 469
           TD+ +Y                    YP + R+R  S              G+++  + Q
Sbjct: 526 TDEMVYTSAAALAESLNAEEIYKGLIYPNIERVRDASLVVAREVMKAARREGVSKLPESQ 585

Query: 470 IIEMVQNDIEVLKTRKGKEWDN--LVKFVQENMWDPDSEKFFNTEE 513
            IE              +EW +  L  ++++ M+DP S   F TE+
Sbjct: 586 WIEW-------------EEWGDVALTAYIKDRMYDPMS---FGTEK 615



>gi|171693999|ref|XP_001911924.1| hypothetical protein [Podospora anserina S mat+]
 gi|170946948|emb|CAP73752.1| unnamed protein product [Podospora anserina S mat+]
          Length = 659

 Score =  454 bits (1167), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 243/518 (46%), Positives = 319/518 (61%), Gaps = 45/518 (8%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFYR++I   +E+ PL+YTPT+G  CL+YS +         P+ LY+S+    ++  
Sbjct: 170 NADLFYRLLIDNAKELMPLVYTPTIGDVCLQYSTLYTR------PEALYISIKQRKSIKT 223

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+K + PYP      P+I V+TDGSRILGLGDLGVNG+GIP+GKL LY AAAGI P +TL
Sbjct: 224 ILKNW-PYP-----NPEICVVTDGSRILGLGDLGVNGVGIPIGKLALYTAAAGIHPDKTL 277

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GT NE NLKD  YLGLRSKR    +   F+D  M +  +VYPE+++QFEDF SE
Sbjct: 278 PIVLDCGTANETNLKDPLYLGLRSKRPSVAEQQEFMDEFMTAAAEVYPEMVVQFEDFESE 337

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF+ L +YR    CFNDDIQGTGAVVL G+I AV L    V   + RL+F         
Sbjct: 338 KAFNYLDRYRNKYKCFNDDIQGTGAVVLGGYIGAVNL--SGVPLEEQRLVFMGAGSAGVG 395

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL+E++  + G+SE+ AK   WLVDTKGLVT DRGD LA+HK YFAR DN+G QFK+
Sbjct: 396 VAKQLVEYY-TKRGLSEQAAKDKFWLVDTKGLVTKDRGDKLAEHKKYFARGDNNGLQFKS 454

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAE------LNKNPIIFPLSNPKVNAECTF 354
           LEEVIEYVKPTAL+GL++T GVF E ++  +        L + PI+FPLSNP   AECTF
Sbjct: 455 LEEVIEYVKPTALVGLTATFGVFTESVVRALKASVDAGGLGRRPILFPLSNPLTKAECTF 514

Query: 355 EDAMKGTDNRVIFASGTAFPEYTV---PETGKTKYPGQGNNMYIFPGLGLGAILAKPKVI 411
           E A+  TD  VIFASG+ F ++T+    +   T YP QGNN+Y+FPG+GLGAILAK   +
Sbjct: 515 EQAVTWTDGTVIFASGSPFSQFTIKLGSDQAITYYPNQGNNVYVFPGIGLGAILAKATRV 574

Query: 412 TDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQII 471
           TD  IY                    YP + R+R  S                   ++++
Sbjct: 575 TDNMIYTSAAALAGSLNAEEVHKGLIYPRIERVRDASVIVA---------------REVM 619

Query: 472 EMVQND-IEVLKTRKGKEWDN-----LVKFVQENMWDP 503
           +  + D +  L   +   W+      L K+++E+++DP
Sbjct: 620 KAARRDGVSALPEEQWLTWEEWGDPALDKYIKEHIYDP 657



>gi|296813573|ref|XP_002847124.1| malic enzyme [Arthroderma otae CBS 113480]
 gi|238842380|gb|EEQ32042.1| malic enzyme [Arthroderma otae CBS 113480]
          Length = 608

 Score =  453 bits (1166), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 241/509 (47%), Positives = 315/509 (61%), Gaps = 31/509 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           +V LFYR+V+  L E+TPLIYTP VG AC ++S I      P +  G+YLS  D  N+  
Sbjct: 91  SVHLFYRLVMDHLRELTPLIYTPVVGEACQKWSEI---YQQPEVWIGMYLSYEDRGNIAA 147

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+ + P P  D     I VITDGSRILGLGDLG+NGMGIP+GKL LY A AGI P  TL
Sbjct: 148 VIQNW-PQPNVD-----ITVITDGSRILGLGDLGINGMGIPIGKLALYTACAGIRPEATL 201

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT+N+   +D  Y+G R  +V  +Q   F+D +M +L + +P ++IQFEDF  +
Sbjct: 202 PLTLDLGTSNKTLREDPLYMGSRRGKVTQEQELEFMDELMAALTERWPGIVIQFEDF--K 259

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L KYR N  CFNDDIQGTGAV+L+G INAVK     V P  HR +F         
Sbjct: 260 NPFPALEKYRHNYTCFNDDIQGTGAVILAGIINAVK--RSGVPPKDHRAVFLGAGSAGVG 317

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ+++FF V+ GM+E+EAK   +LVDTKGLVT DRGD LA HKVYFAR DN+G Q KT
Sbjct: 318 VAKQIVDFF-VKEGMTEDEAKACFYLVDTKGLVTADRGDRLAAHKVYFARHDNNGQQLKT 376

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           LEEV+++VKPT L+GLS+ GGVF  +I+ +MA+ NK PIIFPLSNP  N+EC F+ A+  
Sbjct: 377 LEEVVDHVKPTMLMGLSTLGGVFTPEILKKMADNNKQPIIFPLSNPSANSECDFKAAITH 436

Query: 361 TDNRVIFASGTAFPEYTVPETG---KTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
           TD R +FASG+ FP ++   +     T YPGQGNNMY+FPG+GLG IL+K   +TD  IY
Sbjct: 437 TDGRALFASGSPFPSFSFKNSAGETATYYPGQGNNMYVFPGIGLGTILSKAVEVTDSMIY 496

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP ++RIR VS               + R+  I     +D
Sbjct: 497 AAADALSTSLTTEELDRGLLYPEITRIREVSVAVARGVIRAAQEAKVDRETAIRTFTDSD 556

Query: 478 IEVLKTRKGKEWDNLVKFVQENMWDPDSE 506
           ++               +++  M++P SE
Sbjct: 557 LD--------------SWIKSKMYNPHSE 571



>gi|336274679|ref|XP_003352093.1| hypothetical protein SMAC_02528 [Sordaria macrospora k-hell]
 gi|380092172|emb|CCC09948.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 859

 Score =  453 bits (1165), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 230/454 (50%), Positives = 303/454 (66%), Gaps = 23/454 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYRI++   +E+ PL+YTPT+G  CL+YS +         P+ LY+S+    ++  
Sbjct: 375 NVDLFYRILMDHAKEMMPLVYTPTIGDVCLQYSTLYTR------PEALYISIKQRKSIRT 428

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I++ + PYP      P+I V+TDGSRILGLGDLGVNG+GIP+GKL LY AAAGI P +TL
Sbjct: 429 ILRNW-PYP-----KPEICVVTDGSRILGLGDLGVNGVGIPIGKLALYTAAAGIHPDKTL 482

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GT NE NL+D  YLGLR KR+   +   F+D  M++  +V+PE+++QFEDF SE
Sbjct: 483 PIVLDCGTANETNLRDPLYLGLRQKRIPVSEQQEFMDEFMEAAAEVFPEMVVQFEDFESE 542

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF+ L +YR+   CFNDDIQGTGAVVL+G+I AV L   +V   + RL+F         
Sbjct: 543 KAFNYLDRYRDQYKCFNDDIQGTGAVVLAGYIGAVNL--SNVPIEEQRLVFMGAGSAGVG 600

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL+E++  + G+SE++AK   WLVDTKGLVT DRGD LA+HK YFAR DN+G+QF+T
Sbjct: 601 VAKQLVEYY-TKRGLSEQQAKDKFWLVDTKGLVTKDRGDKLAEHKKYFARTDNNGHQFRT 659

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAE------LNKNPIIFPLSNPKVNAECTF 354
           LEEVIEYVKP+AL+GL++T GVF E ++  +        L + PI+FPLSNP   AECTF
Sbjct: 660 LEEVIEYVKPSALVGLTATHGVFTESVVRALKASVDAGGLGRRPILFPLSNPLTKAECTF 719

Query: 355 EDAMKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDK 414
           ++A+  T+  V+FASG+ F  YTV   G T +P QGNN+Y+FPG+GLGAILAK   +TD 
Sbjct: 720 KEAVDWTEGTVLFASGSPFSNYTV--NGVTYHPNQGNNVYVFPGIGLGAILAKASKVTDD 777

Query: 415 QIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
            IY                    YP + R+R  S
Sbjct: 778 MIYTSAAALSNSLNADEVKQGLIYPRIDRVREAS 811



>gi|296414462|ref|XP_002836919.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295632763|emb|CAZ81110.1| unnamed protein product [Tuber melanosporum]
          Length = 591

 Score =  452 bits (1162), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 229/448 (51%), Positives = 298/448 (66%), Gaps = 19/448 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV+LFYR+++  ++EITPL+YTP VG AC+++SHI         P+GLYLS  D  NL  
Sbjct: 98  NVNLFYRLLMDNMKEITPLVYTPVVGEACVKWSHIYT------QPEGLYLSYADRGNLRG 151

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+  +     D      IAV+TDGSRILGLGDLGVNGMGIPVGKL LYV  AGI P RTL
Sbjct: 152 ILDNWTADKVD------IAVVTDGSRILGLGDLGVNGMGIPVGKLALYVGCAGIQPDRTL 205

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PIT+D+GT N  NLKD  YLG +  RV + +   F+D +M +L   +P L++QFEDF  +
Sbjct: 206 PITIDVGTENAANLKDPLYLGAKMHRVSEAEQLEFLDEMMIALNDKWPGLVVQFEDF--K 263

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L +YR    CFNDDIQGTGAVVL G INA+K    D+     +L+FF        
Sbjct: 264 NPFPSLERYRNTYTCFNDDIQGTGAVVLGGTINALK--NTDIPFKDQKLVFFGAGSAAVG 321

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ+ E F ++ G+ E +A+++ WLVD+KG+VT DRGD L +HKVYF+RDDN+G QFK+
Sbjct: 322 VAKQICELF-IQSGIPESDARKMFWLVDSKGMVTNDRGDTLQEHKVYFSRDDNNGQQFKS 380

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           LEEV++YVKPTAL+GLS+ GG F E II +MA  N+ PIIFPLSNP   +ECT+E AM+ 
Sbjct: 381 LEEVVDYVKPTALMGLSTIGGAFTESIIRKMASYNEKPIIFPLSNPSSKSECTYEQAMQW 440

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           T+N+VIFASG+ FPE+     G+   PGQGNNMY+FPG+GLG +L +   +T + +Y   
Sbjct: 441 TNNKVIFASGSPFPEFEA--DGRVHTPGQGNNMYVFPGIGLGTVLCEAVHVTQEMVYASA 498

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                            YP + RIR +S
Sbjct: 499 VGLADSLTDEEREKGWLYPNLDRIRSIS 526



>gi|453084827|gb|EMF12871.1| NADP-dependent malic enzyme [Mycosphaerella populorum SO2202]
          Length = 648

 Score =  452 bits (1162), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 245/515 (47%), Positives = 318/515 (61%), Gaps = 35/515 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV+LFYR+    ++E+TPLIYTPTVG AC  +S +         P+GLYLS  D  NL  
Sbjct: 157 NVNLFYRLFADNVKELTPLIYTPTVGEACQRWSELY------TQPEGLYLSFEDKGNLHS 210

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I   R +P+D     +I V+TDGSRILGLGDLG+NGMGIPVGKL LY A AGI P +TL
Sbjct: 211 VI---RNWPHDV----EITVVTDGSRILGLGDLGINGMGIPVGKLSLYTACAGIHPMKTL 263

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ LDLGT+NE+   D  YLG R  +V  ++   F+D +M +L + +P ++IQFEDF  +
Sbjct: 264 PLCLDLGTSNEQFRNDPLYLGSRRDKVTAEEEKEFLDEMMAALTERWPSIVIQFEDF--K 321

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L +Y++    FNDDIQGTGAV+  GFINAVK  +  V P   R +FF        
Sbjct: 322 NPFPSLERYQDTYTMFNDDIQGTGAVITGGFINAVK--QSGVKPADQRAVFFGAGSAGVG 379

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDR-GDNLAKHKVYFARDDNDGNQFK 299
             KQL EFF ++ G+SEE+AK+  WLVD++G+VTLDR G  LA+HKVYFARDDNDG QF+
Sbjct: 380 VAKQLTEFF-IKEGLSEEQAKKRFWLVDSQGMVTLDRPGKPLAEHKVYFARDDNDGQQFE 438

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
           TLEE +EYVKPT L+GLS+ GG F  +I+ RMAELN  P+IFPLSNP   +ECTFEDA+K
Sbjct: 439 TLEETLEYVKPTILMGLSTIGGAFTPQILTRMAELNDKPVIFPLSNPSSKSECTFEDAVK 498

Query: 360 GTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIX 419
            T  R +FASG+ FP  T    GK   PGQGNNMY+FPG+GLGAIL+K   +T   IY  
Sbjct: 499 YTKGRCLFASGSPFPTLTY--EGKELTPGQGNNMYVFPGIGLGAILSKAVNVTQNMIYAS 556

Query: 420 XXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIE 479
                             YP + RIR VS              G+ R+  +  +   D++
Sbjct: 557 AESLSTSLTKEEVSDNWLYPDIRRIREVSVTVTRGVIRAAQKDGMDRELSLRNLSDEDLD 616

Query: 480 VLKTRKGKEWDNLVKFVQENMWDPDSEKFFNTEEL 514
                          +++  M+DP +E     EE+
Sbjct: 617 --------------SYIRARMYDPFTEHEKVVEEI 637



>gi|310794313|gb|EFQ29774.1| malic enzyme [Glomerella graminicola M1.001]
          Length = 624

 Score =  451 bits (1161), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 244/518 (47%), Positives = 322/518 (62%), Gaps = 41/518 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFYR++I  + E+ PL+YTPT+G  CL+YS +         P+ LY+S+    ++  
Sbjct: 128 NFDLFYRLLIDNIRELMPLVYTPTIGDVCLQYSTLYTR------PEALYISIKQRKSIRT 181

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +++ + PYP      PQI V+TDGSRILGLGDLGVNG+GI +GKL LY  AAGI P  TL
Sbjct: 182 MLRNW-PYP-----NPQICVVTDGSRILGLGDLGVNGVGISIGKLALYTGAAGIHPENTL 235

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GTNNE NLKD FYLG+RSKRV   +  +F+D  M+++ +VYP + +QFEDF SE
Sbjct: 236 PIVLDTGTNNEGNLKDPFYLGIRSKRVPVPEQQAFMDEFMEAVTEVYPNMTVQFEDFESE 295

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF+ L +YR    CFNDDIQGTGAVVL+G+INAV+L    V   + RL+F         
Sbjct: 296 KAFNYLDRYRNKYRCFNDDIQGTGAVVLAGYINAVEL--SGVPIEEQRLVFMGAGSAGVG 353

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL+E++  + G+SE+ AK   WLVDTKGLVT DRGD LA+HK YFAR DN+G+QF++
Sbjct: 354 VAKQLVEYY-TKRGISEQAAKDKFWLVDTKGLVTKDRGDKLAEHKKYFARTDNNGHQFRS 412

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAE------LNKNPIIFPLSNPKVNAECTF 354
           LEEVIEYVKPTALIGL++T GVF E ++  +        L + P++FPLSNP   AECTF
Sbjct: 413 LEEVIEYVKPTALIGLTATFGVFTESVVRALKASVDSGGLGRRPVLFPLSNPLTKAECTF 472

Query: 355 EDAMKGTDNRVIFASGTAFPEYTV--PETGKTKY-PGQGNNMYIFPGLGLGAILAKPKVI 411
           E A++ TD  VIFASG+ F  +T+  P+     Y P QGNN+Y+FPGLGLGAILAK   I
Sbjct: 473 EQAVQWTDGTVIFASGSPFSPFTMKTPDGHAVTYHPNQGNNVYVFPGLGLGAILAKASKI 532

Query: 412 TDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLAR--DKQ 469
           TD  +Y                    YP + R+R  S              G++   + Q
Sbjct: 533 TDDMVYTSAAALAAGLTADEIHKGLIYPRIERVRDASVLVAREVMKSARRDGVSTLPESQ 592

Query: 470 IIEMVQNDIEVLKTRKGKEWDNLV--KFVQENMWDPDS 505
            IE              +EW ++    +++E ++DP S
Sbjct: 593 WIEW-------------EEWGDVALDAWIKERVYDPVS 617



>gi|164426796|ref|XP_960731.2| hypothetical protein NCU03651 [Neurospora crassa OR74A]
 gi|157071481|gb|EAA31495.2| conserved hypothetical protein [Neurospora crassa OR74A]
          Length = 659

 Score =  451 bits (1159), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 229/454 (50%), Positives = 302/454 (66%), Gaps = 23/454 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+++   +E+ PL+YTPT+G  CL+YS +         P+ LY+S+    ++  
Sbjct: 175 NVDLFYRLLMDHAKEMMPLVYTPTIGDVCLQYSTLYTR------PEALYISIKQRKSIRT 228

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I++ + PYP      P+I V+TDGSRILGLGDLGVNG+GIP+GKL LY AAAGI P +TL
Sbjct: 229 ILRNW-PYP-----QPEICVVTDGSRILGLGDLGVNGVGIPIGKLALYTAAAGIHPDKTL 282

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GT NE NLKD  YLGLR KR+   +   F+D  M++  +V+P++++QFEDF SE
Sbjct: 283 PIVLDCGTANETNLKDPLYLGLRQKRIPVAEQQEFMDEFMEAAAEVFPDMVVQFEDFESE 342

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF+ L +YR+   CFNDDIQGTGAVVL+G+I AV L   +V   + RL+F         
Sbjct: 343 KAFNYLDRYRDQYKCFNDDIQGTGAVVLAGYIGAVNL--SNVPIEEQRLVFMGAGSAGVG 400

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL+E++  + G+SE++AK   WLVDTKGLVT DRGD LA+HK YFAR DN+G+QF+T
Sbjct: 401 VAKQLVEYY-TKRGLSEQQAKDKFWLVDTKGLVTKDRGDKLAEHKKYFARTDNNGHQFRT 459

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAE------LNKNPIIFPLSNPKVNAECTF 354
           LEEVIEYVKP+AL+GL++T GVF E ++  +        L + PI+FPLSNP   AECTF
Sbjct: 460 LEEVIEYVKPSALVGLTATHGVFTESVVRALKASVDAGGLGRRPILFPLSNPLTKAECTF 519

Query: 355 EDAMKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDK 414
           ++A+  TD  V+FASG+ F  YT    G T +P QGNN+Y+FPG+GLGAILAK   +TD 
Sbjct: 520 KEAIDWTDGTVLFASGSPFSSYTT--NGVTYHPNQGNNVYVFPGIGLGAILAKATRVTDD 577

Query: 415 QIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
            IY                    YP + R+R  S
Sbjct: 578 MIYTSAAALANSLNADEVKQGLIYPRIDRVREAS 611



>gi|512187180|gb|EPE02962.1| malic enzyme [Ophiostoma piceae UAMH 11346]
          Length = 835

 Score =  451 bits (1159), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 235/456 (51%), Positives = 294/456 (64%), Gaps = 23/456 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR++I    E+ PL+YTPT+G  CL+YS +         P+ LY+S+    ++  
Sbjct: 347 NVDLFYRLLIDNARELMPLVYTPTIGDVCLQYSTLYTR------PEALYISIKQRKSMKT 400

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+   R +PY     P+I V+TDGSRILGLGDLG+NG+GIP+GKL LY  AAGI P +TL
Sbjct: 401 IL---RNWPY---AAPEICVVTDGSRILGLGDLGINGVGIPIGKLSLYTGAAGIRPEKTL 454

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GT NE NLKD  YLG+RSKRV   +   F+D  M++  +V+P++L+QFEDF SE
Sbjct: 455 PIVLDCGTANETNLKDPLYLGIRSKRVPVSEQLEFMDEFMEACAEVFPDMLVQFEDFESE 514

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF  L +YR    CFNDDIQGTGAVVL G+I AV L    V   + RL+F         
Sbjct: 515 KAFKYLDRYRNKYRCFNDDIQGTGAVVLGGYIGAVNL--SGVPLEEQRLVFMGAGSAGVG 572

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL+E++    G+SE+ A+   WLVDTKGLVT DRGD LA HK YFAR DN G+QF+T
Sbjct: 573 VAKQLVEYY-TRRGLSEQAARDKFWLVDTKGLVTKDRGDKLADHKKYFARTDNSGHQFRT 631

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAE------LNKNPIIFPLSNPKVNAECTF 354
           LEEVIEYVKP+ALIGL++T GVF E ++  +        LN+ PI+FPLSNP   AECTF
Sbjct: 632 LEEVIEYVKPSALIGLTATFGVFTESVVRALKASVDAGGLNRRPILFPLSNPLTKAECTF 691

Query: 355 EDAMKGTDNRVIFASGTAFPEYTV--PETGKTKYPGQGNNMYIFPGLGLGAILAKPKVIT 412
           E A+  T+  VIFASG+ F  YTV   E+  T YP QGNN+Y+FPGLGLGAILAK   IT
Sbjct: 692 EQAVNWTEGSVIFASGSPFNNYTVKTAESSITYYPNQGNNVYVFPGLGLGAILAKASSIT 751

Query: 413 DKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
           D  +Y                    YP + R+R  S
Sbjct: 752 DDMVYTSAAALANSLNADEIHKGLIYPRIERVRDAS 787



>gi|16944467|emb|CAC18164.2| related to malate dehydrogenase (oxaloacetate-decarboxylating)
           (NADP+) [Neurospora crassa]
          Length = 1023

 Score =  450 bits (1158), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 229/454 (50%), Positives = 302/454 (66%), Gaps = 23/454 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+++   +E+ PL+YTPT+G  CL+YS +         P+ LY+S+    ++  
Sbjct: 539 NVDLFYRLLMDHAKEMMPLVYTPTIGDVCLQYSTLY------TRPEALYISIKQRKSIRT 592

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I++ + PYP      P+I V+TDGSRILGLGDLGVNG+GIP+GKL LY AAAGI P +TL
Sbjct: 593 ILRNW-PYP-----QPEICVVTDGSRILGLGDLGVNGVGIPIGKLALYTAAAGIHPDKTL 646

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GT NE NLKD  YLGLR KR+   +   F+D  M++  +V+P++++QFEDF SE
Sbjct: 647 PIVLDCGTANETNLKDPLYLGLRQKRIPVAEQQEFMDEFMEAAAEVFPDMVVQFEDFESE 706

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF+ L +YR+   CFNDDIQGTGAVVL+G+I AV L   +V   + RL+F         
Sbjct: 707 KAFNYLDRYRDQYKCFNDDIQGTGAVVLAGYIGAVNL--SNVPIEEQRLVFMGAGSAGVG 764

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL+E++  + G+SE++AK   WLVDTKGLVT DRGD LA+HK YFAR DN+G+QF+T
Sbjct: 765 VAKQLVEYY-TKRGLSEQQAKDKFWLVDTKGLVTKDRGDKLAEHKKYFARTDNNGHQFRT 823

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAE------LNKNPIIFPLSNPKVNAECTF 354
           LEEVIEYVKP+AL+GL++T GVF E ++  +        L + PI+FPLSNP   AECTF
Sbjct: 824 LEEVIEYVKPSALVGLTATHGVFTESVVRALKASVDAGGLGRRPILFPLSNPLTKAECTF 883

Query: 355 EDAMKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDK 414
           ++A+  TD  V+FASG+ F  YT    G T +P QGNN+Y+FPG+GLGAILAK   +TD 
Sbjct: 884 KEAIDWTDGTVLFASGSPFSSYTT--NGVTYHPNQGNNVYVFPGIGLGAILAKATRVTDD 941

Query: 415 QIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
            IY                    YP + R+R  S
Sbjct: 942 MIYTSAAALANSLNADEVKQGLIYPRIDRVREAS 975



>gi|336473113|gb|EGO61273.1| hypothetical protein NEUTE1DRAFT_77164 [Neurospora tetrasperma FGSC
           2508]
          Length = 659

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 228/454 (50%), Positives = 302/454 (66%), Gaps = 23/454 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+++   +E+ PL+YTPT+G  CL+YS +         P+ LY+S+    ++  
Sbjct: 175 NVDLFYRLLMDHAKEMMPLVYTPTIGDVCLQYSTLYTR------PEALYISIKQRKSIRT 228

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I++ + PYP      P+I V+TDGSRILGLGDLGVNG+GIP+GKL LY AAAGI P +TL
Sbjct: 229 ILRNW-PYP-----QPEICVVTDGSRILGLGDLGVNGVGIPIGKLALYTAAAGIHPDKTL 282

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GT NE NLKD  YLGLR KR+   +   F+D  M++  +V+P++++QFEDF SE
Sbjct: 283 PIVLDCGTANETNLKDPLYLGLRQKRIPVAEQQEFMDEFMEAAAEVFPDMVVQFEDFESE 342

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF+ L +YR+   CFNDDIQGTGAVVL+G+I AV L   +V   + RL+F         
Sbjct: 343 KAFNYLDRYRDQYKCFNDDIQGTGAVVLAGYIGAVNL--SNVPIEEQRLVFMGAGSAGVG 400

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL+E++  + G+SE++AK   WLVDTKGLVT DRGD LA+HK YFAR DN+G+QF+T
Sbjct: 401 VAKQLVEYY-TKRGLSEQQAKDKFWLVDTKGLVTKDRGDKLAEHKKYFARTDNNGHQFRT 459

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAE------LNKNPIIFPLSNPKVNAECTF 354
           LEEVIEYVKP+AL+GL++T GVF E ++  +        L + PI+FPLSNP   AECTF
Sbjct: 460 LEEVIEYVKPSALVGLTATHGVFTESVVRALKASVDAGGLGRRPILFPLSNPLTKAECTF 519

Query: 355 EDAMKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDK 414
           ++A+  T+  V+FASG+ F  YT    G T +P QGNN+Y+FPG+GLGAILAK   +TD 
Sbjct: 520 KEAIDWTEGTVLFASGSPFSSYTT--NGVTYHPNQGNNVYVFPGIGLGAILAKASRVTDD 577

Query: 415 QIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
            IY                    YP + R+R  S
Sbjct: 578 MIYTSAAALANSLNADEVKQGLIYPRIDRVREAS 611



>gi|471562229|gb|EMR63785.1| putative nadp-dependent malic enzyme protein [Eutypa lata UCREL1]
          Length = 592

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 239/518 (46%), Positives = 319/518 (61%), Gaps = 40/518 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N+ LFYR++I  + E+ PL+YTPT+G  CL+YS +         P+ LY+S+    ++  
Sbjct: 103 NLDLFYRVLIDNVRELMPLVYTPTIGDVCLQYSTLYTR------PEALYISIKQRKSIRT 156

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+   R +PY +   P+I V+TDGSRILGLGDLG+NG+GI +GKL LY  AAGI P +TL
Sbjct: 157 IL---RNWPYQN---PEICVVTDGSRILGLGDLGINGVGISIGKLSLYTGAAGIHPEKTL 210

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GTNNE NLKD  YLGLR++R   +    F+D  M+++  V+P +L QFEDF +E
Sbjct: 211 PIVLDCGTNNEGNLKDPLYLGLRARRPSPEIQQQFMDEFMEAVADVFPNMLTQFEDFETE 270

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF+ L++YR    CFNDDIQGTGAVVL G+I AV L    V   + RL+F         
Sbjct: 271 KAFNYLARYRNKYKCFNDDIQGTGAVVLGGYIGAVNL--SGVPLEEQRLVFMGAGSAGVG 328

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL+E++    G++EEEAK   WLVDTKGLVT DRGD LA+HK YFAR DN+G+QF++
Sbjct: 329 VAKQLVEYY-TRRGLTEEEAKNKFWLVDTKGLVTRDRGDRLAEHKKYFARTDNNGHQFRS 387

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAE------LNKNPIIFPLSNPKVNAECTF 354
           LEEVIEYV+P+AL+GL++T GVF E +I  +        +N+ PI+FPLSNP   AECTF
Sbjct: 388 LEEVIEYVRPSALVGLTATFGVFTESVIRALKASVESGGVNRRPILFPLSNPLTKAECTF 447

Query: 355 EDAMKGTDNRVIFASGTAFPEYTVP--ETGKTKYPGQGNNMYIFPGLGLGAILAKPKVIT 412
           E A++ TD   IFASG+ F  + V   E   T +P QGNN+Y+FPGLGLGAILAK   IT
Sbjct: 448 EQAIQWTDGTAIFASGSPFSPFAVKAGEQAVTYWPNQGNNVYVFPGLGLGAILAKASKIT 507

Query: 413 DKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLAR--DKQI 470
           D+ +YI                   YP + R+R  S              G++   + Q 
Sbjct: 508 DEMVYISASALADTLNAEEIQKGLIYPNIERVRDASIVVAREVMKAARREGVSELSEAQW 567

Query: 471 IEMVQNDIEVLKTRKGKEWD--NLVKFVQENMWDPDSE 506
           IE              +EW   +L K+++  ++DP  E
Sbjct: 568 IEW-------------EEWGDVDLEKYIKNRVYDPLRE 592



>gi|350293635|gb|EGZ74720.1| hypothetical protein NEUTE2DRAFT_82305 [Neurospora tetrasperma FGSC
           2509]
          Length = 1026

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 228/454 (50%), Positives = 302/454 (66%), Gaps = 23/454 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+++   +E+ PL+YTPT+G  CL+YS +         P+ LY+S+    ++  
Sbjct: 542 NVDLFYRLLMDHAKEMMPLVYTPTIGDVCLQYSTLYTR------PEALYISIKQRKSIRT 595

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I++ + PYP      P+I V+TDGSRILGLGDLGVNG+GIP+GKL LY AAAGI P +TL
Sbjct: 596 ILRNW-PYP-----QPEICVVTDGSRILGLGDLGVNGVGIPIGKLALYTAAAGIHPDKTL 649

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GT NE NLKD  YLGLR KR+   +   F+D  M++  +V+P++++QFEDF SE
Sbjct: 650 PIVLDCGTANETNLKDPLYLGLRQKRIPVAEQQEFMDEFMEAAAEVFPDMVVQFEDFESE 709

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF+ L +YR+   CFNDDIQGTGAVVL+G+I AV L   +V   + RL+F         
Sbjct: 710 KAFNYLDRYRDQYKCFNDDIQGTGAVVLAGYIGAVNL--SNVPIEEQRLVFMGAGSAGVG 767

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL+E++  + G+SE++AK   WLVDTKGLVT DRGD LA+HK YFAR DN+G+QF+T
Sbjct: 768 VAKQLVEYY-TKRGLSEQQAKDKFWLVDTKGLVTKDRGDKLAEHKKYFARTDNNGHQFRT 826

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAE------LNKNPIIFPLSNPKVNAECTF 354
           LEEVIEYVKP+AL+GL++T GVF E ++  +        L + PI+FPLSNP   AECTF
Sbjct: 827 LEEVIEYVKPSALVGLTATHGVFTESVVRALKASVDAGGLGRRPILFPLSNPLTKAECTF 886

Query: 355 EDAMKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDK 414
           ++A+  T+  V+FASG+ F  YT    G T +P QGNN+Y+FPG+GLGAILAK   +TD 
Sbjct: 887 KEAIDWTEGTVLFASGSPFSSYTT--NGVTYHPNQGNNVYVFPGIGLGAILAKASRVTDD 944

Query: 415 QIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
            IY                    YP + R+R  S
Sbjct: 945 MIYTSAAALANSLNADEVKQGLIYPRIDRVREAS 978



>gi|477530946|gb|ENH82671.1| nadp-dependent malic enzyme [Colletotrichum orbiculare MAFF 240422]
          Length = 617

 Score =  449 bits (1156), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 238/520 (45%), Positives = 325/520 (62%), Gaps = 45/520 (8%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFYR+++  + E+ PL+YTPT+G  CL+YS +         P+ LY+S+    ++  
Sbjct: 121 NFDLFYRLLMDNIRELMPLVYTPTIGDVCLQYSTLYTR------PEALYISIKQRKSIRT 174

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +++ + PYP      P+I V+TDGSRILGLGDLGVNG+GI +GKL LY  AAGI P  TL
Sbjct: 175 MLRNW-PYP-----NPEICVVTDGSRILGLGDLGVNGVGISIGKLALYTGAAGIHPENTL 228

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GTNNE NLKD FYLG+RSKRV   +  +F+D  M+++ +VYP + +QFEDF SE
Sbjct: 229 PIVLDTGTNNETNLKDPFYLGIRSKRVSVAEQQAFMDEFMEAVAEVYPNMTVQFEDFESE 288

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF+ L +YR    CFNDDIQGTGAVVL+G+INA +L    V   + RL+F         
Sbjct: 289 KAFNYLDRYRNKYRCFNDDIQGTGAVVLAGYINAAEL--SGVPLEEQRLVFMGAGSAGVG 346

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL+E++  + G++E+ AK   WLVDTKGLVT DRGD LA+HK YFAR DN+G+QF+T
Sbjct: 347 VAKQLVEYY-TKRGLTEQAAKDKFWLVDTKGLVTKDRGDKLAEHKKYFARTDNNGHQFRT 405

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAE------LNKNPIIFPLSNPKVNAECTF 354
           LEEVIEYVKP+AL+GL++T GVF E ++  +        L + P++FPLSNP   AECTF
Sbjct: 406 LEEVIEYVKPSALVGLTATFGVFTESVVRALKASVDAGGLGRRPVLFPLSNPLTKAECTF 465

Query: 355 EDAMKGTDNRVIFASGTAFPEYTVPET-GK--TKYPGQGNNMYIFPGLGLGAILAKPKVI 411
           E A++ TD  V+FASG+ F   TV  + G+  T +P QGNN+Y+FPGLGLGAILAK   I
Sbjct: 466 EQAIQWTDGTVLFASGSPFQPVTVKSSEGQTITYHPNQGNNVYVFPGLGLGAILAKASKI 525

Query: 412 TDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQII 471
           TD  +Y                    YP + R+R  S               L   ++++
Sbjct: 526 TDNMVYTSAAALADSLTADEVHKGLIYPRIERVREAS---------------LIVAREVM 570

Query: 472 EMVQND-IEVLKTRKGKEWDN-----LVKFVQENMWDPDS 505
           +  + D +  L   +  EW+      L  ++++ ++DP S
Sbjct: 571 KAARRDGVSTLAESQWVEWEEWGDVALNAWIKDRVYDPVS 610



>gi|501309949|dbj|GAC98752.1| hypothetical protein PHSY_006346 [Pseudozyma hubeiensis SY62]
          Length = 632

 Score =  448 bits (1152), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 239/509 (46%), Positives = 313/509 (61%), Gaps = 32/509 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  L+Y  ++   EEI PLIYTPTVG AC ++SHI         P+GL +SL D   +  
Sbjct: 143 NTRLYYATILANKEEILPLIYTPTVGEACQKFSHIYRR------PEGLSISLEDKGKIAS 196

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I++ + P P     +P+IAVITDGSRILGLGDLG NG GI +GKL LYVA AGI PR TL
Sbjct: 197 IVENW-PVPAG---SPRIAVITDGSRILGLGDLGWNGQGISIGKLSLYVAGAGIHPRATL 252

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI +DLGTNN+KNL+D  YLGLR +R   +++  F+D VM++L   YP L+IQFEDF+SE
Sbjct: 253 PIVVDLGTNNKKNLEDPLYLGLRRERASTEEYIEFMDEVMEALHSRYPNLIIQFEDFTSE 312

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKD----VHPTKHRLLFFXXXX 236
           +AF  L +Y++    FNDDIQGTG+V+L+GF NA ++  K+    +H   HR+L      
Sbjct: 313 NAFRFLDRYQDKYPMFNDDIQGTGSVILAGFTNAARIASKESGRPLH--DHRILMAGAGS 370

Query: 237 XXXXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGN 296
                 KQL+ FF    G+S++EA+  +++ D+KGLVT DRGD LA+HKV+FARDDN G 
Sbjct: 371 AAVGVGKQLMSFF-TRQGLSQDEARERIFITDSKGLVTKDRGDKLAEHKVFFARDDNSGR 429

Query: 297 QFKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFED 356
           Q K L E+I+YVKPTA++GLS+  G F+E +I +MA LNK PIIFPLSNP  N+ECTFE+
Sbjct: 430 QIKDLAEIIDYVKPTAILGLSTIKGTFDETVIRKMATLNKRPIIFPLSNPTDNSECTFEE 489

Query: 357 AMKGTDNRVIFASGTAFPEYTVPE--TGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDK 414
           A++ TD  V+FA+G+ FPE       TGK   PGQGNN  +FPG+GL A L K   +T++
Sbjct: 490 AVRYTDGSVLFAAGSPFPEIEAGSSPTGKRLIPGQGNNFLVFPGIGLCAALCKAARVTNE 549

Query: 415 QIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMV 474
            I                     YP   RIR +S              G+ RD    +  
Sbjct: 550 MITESALALSDALNEEERAEGRLYPNTERIREISRDIAVRCIQMANKQGVTRDGG--KTA 607

Query: 475 QNDIEVLKTRKGKEWDNLVKFVQENMWDP 503
             D E L     ++W      VQ  MW P
Sbjct: 608 NMDEEQL-----RDW------VQGEMWSP 625



>gi|119192994|ref|XP_001247103.1| NAD-dependent malic enzyme [Coccidioides immitis RS]
          Length = 552

 Score =  448 bits (1152), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 228/451 (50%), Positives = 299/451 (66%), Gaps = 20/451 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+V+  L+ +TPLIYTP VG ACL++S I         P+G+Y+S  D  N+  
Sbjct: 38  NVHLFYRLVVDHLKALTPLIYTPVVGEACLKWSEIYQ------QPEGMYISYEDRGNIAG 91

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+ + P P       +I  ITDGSRILGLGDLG+NGMGIP+GKL LY A AGI P  TL
Sbjct: 92  VIQNW-PQP-----NVEITCITDGSRILGLGDLGINGMGIPIGKLALYTACAGIRPEVTL 145

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT+N+   +D  Y+G R ++V  +Q   F+D +M +L + +P ++IQFEDF  +
Sbjct: 146 PLTLDLGTSNKSLREDPLYMGSRREKVTPEQELEFLDELMTALTERWPGIVIQFEDF--K 203

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L++YR N  CFNDDIQGTGAV+L+G +NAVK  +  + P  H+ +F         
Sbjct: 204 NPFPALARYRHNYTCFNDDIQGTGAVILAGVMNAVK--KSGIPPQNHKAVFLGAGSAGVG 261

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ+++FF V  GM+E+EA+   +LVDTKGLVT DRGD LA HKVYFAR DN G Q+KT
Sbjct: 262 VAKQIVDFF-VREGMTEDEARACFYLVDTKGLVTADRGDKLAAHKVYFARTDNGGRQYKT 320

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           LEEV++YV+PT L+GLS+ GGVF  +I+ +M++ NK PIIFPLSNP  N+EC FE A+  
Sbjct: 321 LEEVVDYVRPTMLMGLSTLGGVFTPQILKKMSDWNKKPIIFPLSNPSANSECNFESAVVN 380

Query: 361 TDNRVIFASGTAFPEYTVPETG---KTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
           TD R +FASG+ F  ++        KT YPGQGNNMY+FPG+GLG IL+K   ITD  IY
Sbjct: 381 TDGRCLFASGSPFQPFSYTNHAGETKTHYPGQGNNMYVFPGIGLGTILSKAVEITDTMIY 440

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                               YP ++RIR VS
Sbjct: 441 ASAQALSTALTSEEIEQGLLYPDITRIREVS 471



>gi|500258497|gb|EOO01409.1| putative nadp-dependent malic enzyme protein [Togninia minima
           UCRPA7]
          Length = 603

 Score =  447 bits (1151), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 234/458 (51%), Positives = 298/458 (65%), Gaps = 27/458 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFYR++I    E+ PL+YTPT+G  CL+YS I         P+ LY+S+    ++  
Sbjct: 115 NTDLFYRLLIDNARELMPLVYTPTIGDVCLQYSTIYTR------PEALYISIKQRKSIRT 168

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +++ + PYP      P+I V+TDGSRILGLGDLGVNG+GIP+GKL LY AAAGI P +TL
Sbjct: 169 MLRNW-PYP-----NPEICVVTDGSRILGLGDLGVNGVGIPIGKLSLYTAAAGIHPEKTL 222

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKR--VDDDQFYSFVDAVMKSLLKVYPELLIQFEDFS 178
           PI LD GT NE NLKDE YLGLR KR  V D Q   F+D  M++++ V+P +++QFEDF 
Sbjct: 223 PIVLDCGTANETNLKDEMYLGLRCKRPSVQDQQ--DFMDEFMEAVVDVFPNMVVQFEDFE 280

Query: 179 SEHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXX 238
           SE AF+ L +YR    CFNDDIQGTGAVVL+G+I AV L    V   + RL+F       
Sbjct: 281 SEKAFNYLDRYRNKYKCFNDDIQGTGAVVLAGYIGAVNL--SGVPLEEQRLVFMGAGSAG 338

Query: 239 XXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQF 298
               KQL+E++    G+SE+ A+   WLVDTKGLVT DRGD LA+HK YFAR DN+G+QF
Sbjct: 339 VGVAKQLVEYY-TRRGLSEQAARDKFWLVDTKGLVTKDRGDKLAEHKKYFARSDNNGHQF 397

Query: 299 KTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAE------LNKNPIIFPLSNPKVNAEC 352
           ++LEEVIEYVKPTALIGL++T GVF E ++  +        L++ PI+FPLSNP   AEC
Sbjct: 398 RSLEEVIEYVKPTALIGLTATFGVFTESVVRALKASVDAGGLSRRPILFPLSNPLTKAEC 457

Query: 353 TFEDAMKGTDNRVIFASGTAFPEYTVPETGK--TKYPGQGNNMYIFPGLGLGAILAKPKV 410
           TFE A+  TD  VIFASG+ F   TV       T +P QGNN+Y+FPG+GLGAILAK   
Sbjct: 458 TFEQAVTWTDGTVIFASGSPFSPLTVKAADHTITYHPNQGNNVYVFPGIGLGAILAKATR 517

Query: 411 ITDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
           +TD+ IY                    YP + R+R  S
Sbjct: 518 VTDEMIYTSAAALADSLNAEELYKGLIYPRIERVREAS 555



>gi|392863662|gb|EAS35573.2| NAD-dependent malic enzyme [Coccidioides immitis RS]
          Length = 640

 Score =  447 bits (1151), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 234/509 (45%), Positives = 315/509 (61%), Gaps = 34/509 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+V+  L+ +TPLIYTP VG ACL++S I         P+G+Y+S  D  N+  
Sbjct: 126 NVHLFYRLVVDHLKALTPLIYTPVVGEACLKWSEIYQ------QPEGMYISYEDRGNIAG 179

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+ + P P       +I  ITDGSRILGLGDLG+NGMGIP+GKL LY A AGI P  TL
Sbjct: 180 VIQNW-PQP-----NVEITCITDGSRILGLGDLGINGMGIPIGKLALYTACAGIRPEVTL 233

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT+N+   +D  Y+G R ++V  +Q   F+D +M +L + +P ++IQFEDF  +
Sbjct: 234 PLTLDLGTSNKSLREDPLYMGSRREKVTPEQELEFLDELMTALTERWPGIVIQFEDF--K 291

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L++YR N  CFNDDIQGTGAV+L+G +NAVK  +  + P  H+ +F         
Sbjct: 292 NPFPALARYRHNYTCFNDDIQGTGAVILAGVMNAVK--KSGIPPQNHKAVFLGAGSAGVG 349

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ+++FF V  GM+E+EA+   +LVDTKGLVT DRGD LA HKVYFAR DN G Q+KT
Sbjct: 350 VAKQIVDFF-VREGMTEDEARACFYLVDTKGLVTADRGDKLAAHKVYFARTDNGGRQYKT 408

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           LEEV++YV+PT L+GLS+ GGVF  +I+ +M++ NK PIIFPLSNP  N+EC FE A+  
Sbjct: 409 LEEVVDYVRPTMLMGLSTLGGVFTPQILKKMSDWNKKPIIFPLSNPSANSECNFESAVVN 468

Query: 361 TDNRVIFASGTAFPEYTVPETG---KTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
           TD R +FASG+ F  ++        KT YPGQGNNMY+FPG+GLG IL+K   ITD  IY
Sbjct: 469 TDGRCLFASGSPFQPFSYTNHAGETKTHYPGQGNNMYVFPGIGLGTILSKAVEITDTMIY 528

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP ++RIR VS               + R+  I     +D
Sbjct: 529 ASAQALSTALTSEEIEQGLLYPDITRIREVSVLVARGVIRAAQEAKVDRETGIRTFSDSD 588

Query: 478 IEVLKTRKGKEWDNLVKFVQENMWDPDSE 506
           ++               +++  M++P  E
Sbjct: 589 LDA--------------WIKSRMYNPHGE 603



>gi|340522298|gb|EGR52531.1| malate dehydrogenase [Trichoderma reesei QM6a]
          Length = 601

 Score =  447 bits (1150), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 232/458 (50%), Positives = 301/458 (65%), Gaps = 25/458 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+++  + E+ PL+YTPT+G  CL+YS +         P+ LY+S+    ++  
Sbjct: 103 NVDLFYRLLMDNIRELMPLVYTPTIGDVCLQYSTLYTR------PEALYISIKQRKSIRT 156

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +++ + P P      P+I V+TDGSRILGLGDLGVNG+GI +GKL LY AAAGI P +TL
Sbjct: 157 MLRNW-PGP-----EPEICVVTDGSRILGLGDLGVNGVGISIGKLALYTAAAGIHPAKTL 210

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GTNNE NL+D FYLGLR KRV  D    F+D  M ++  VYP +++QFEDF SE
Sbjct: 211 PIVLDTGTNNESNLRDPFYLGLRQKRVPVDVQQDFMDEFMAAVKDVYPNMVVQFEDFDSE 270

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF+ L +YR N   FNDDIQGTGAVVL+G+INAV L    V   + RL+F         
Sbjct: 271 KAFNYLDRYRHNYRAFNDDIQGTGAVVLAGYINAVNL--SGVPLAEQRLVFMGAGSAGVG 328

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL+E++    G+SE+EA+   +LVDTKGLVT+DRGD LA+HK YFAR DN G+QF+T
Sbjct: 329 VAKQLVEYY-TRRGLSEKEARDKFYLVDTKGLVTMDRGDRLAEHKKYFARTDNAGHQFRT 387

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAE------LNKNPIIFPLSNPKVNAECTF 354
           LEEVIEYVKP+AL+GL++T G+F E II  +        L + PI+FPLSNP   AECTF
Sbjct: 388 LEEVIEYVKPSALVGLAATFGIFTESIIRGLKASVDAGGLGRRPILFPLSNPLTKAECTF 447

Query: 355 EDAMKGTDNRVIFASGTAFPEYTVPETGK----TKYPGQGNNMYIFPGLGLGAILAKPKV 410
           E A++ TD  V+FASG+ F  +T+   G+    T +P QGNN+Y+FPGLGLGAILAK   
Sbjct: 448 EQAVQWTDGSVVFASGSPFSSFTLKIGGEAGDITYHPNQGNNVYVFPGLGLGAILAKATR 507

Query: 411 ITDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
           ITD+ +Y                    YP + R+R  S
Sbjct: 508 ITDEMVYTSAAALAGSLNAEEVHMGLIYPKIDRVREAS 545



>gi|512205311|gb|EPE34133.1| NAD(P)-binding Rossmann-fold containing protein [Glarea lozoyensis
           ATCC 20868]
          Length = 611

 Score =  447 bits (1150), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 237/506 (46%), Positives = 320/506 (63%), Gaps = 33/506 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+V+     +TPLIYTP VG ACL++S I         P+G+YLS +D  NL +
Sbjct: 106 NVHLFYRLVLDNFTTLTPLIYTPVVGEACLKWSEIY------RQPEGMYLSYSDRGNLKE 159

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I++ + P P       ++ V+TDGSRILGLGDLG+NGMGIPVGKL LY   AGI P  +L
Sbjct: 160 ILQNW-PKP-----NVELTVVTDGSRILGLGDLGINGMGIPVGKLALYTGCAGIRPEVSL 213

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGTNNE  L D  Y+G R KRV +++   F+D +M +L +V+P +++QFEDF  +
Sbjct: 214 PLTLDLGTNNEGLLNDPLYMGTRMKRVSEEEEGKFLDELMVALNEVWPGIVVQFEDF--K 271

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L KY+    CFNDDIQGTGAVVL+G I+A+K     +     R +F         
Sbjct: 272 NPFPALEKYQHKYSCFNDDIQGTGAVVLAGIISALK--SSGLKAKDQRAVFMGAGSAGTG 329

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ++E++ ++ G+SE+EA++  W VDTKG++T DRGD LA+HK YFARDDN+G Q K+
Sbjct: 330 VAKQIVEYY-MKEGLSEDEARKAFWFVDTKGMITNDRGDKLAEHKKYFARDDNNGLQLKS 388

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L E+++YVKPT L+GLS+  G+F+E ++N+MA+LNKNPIIFPLSNP  NAECTFE+A+K 
Sbjct: 389 LPEIVDYVKPTILMGLSTIRGIFDEPLLNKMAKLNKNPIIFPLSNPSSNAECTFEEAVKY 448

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           TD R +FASG+ F +Y     GK   P QGNNMY+FPG+GL AIL+K K I+ + IY   
Sbjct: 449 TDGRALFASGSPFQDYVY--KGKVMKPSQGNNMYVFPGIGLAAILSKAKHISQEMIYASA 506

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YP + RIR VS               L R+  + +M  ND + 
Sbjct: 507 TALSSTLLPEEFASGMLYPSLDRIREVSVIVARDVIRTAQREKLDREPVLRDM--NDAQ- 563

Query: 481 LKTRKGKEWDNLVKFVQENMWDPDSE 506
                      L  +++E M+DP  E
Sbjct: 564 -----------LEAWIKERMYDPRKE 578



>gi|303312421|ref|XP_003066222.1| Malic enzyme, NAD binding domain containing protein [Coccidioides
           posadasii C735 delta SOWgp]
 gi|240105884|gb|EER24077.1| Malic enzyme, NAD binding domain containing protein [Coccidioides
           posadasii C735 delta SOWgp]
 gi|320033710|gb|EFW15657.1| NAD-dependent malic enzyme [Coccidioides posadasii str. Silveira]
          Length = 595

 Score =  447 bits (1150), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 228/451 (50%), Positives = 299/451 (66%), Gaps = 20/451 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+V+  L+ +TPLIYTP VG ACL++S I         P+G+Y+S  D  N+  
Sbjct: 81  NVHLFYRLVVDHLKALTPLIYTPVVGEACLKWSEIYQ------QPEGMYISYEDRGNIAG 134

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+ + P P       +I  ITDGSRILGLGDLG+NGMGIP+GKL LY A AGI P  TL
Sbjct: 135 VIQNW-PQP-----NVEITCITDGSRILGLGDLGINGMGIPIGKLALYTACAGIRPEVTL 188

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT+N+   +D  Y+G R ++V  +Q   F+D +M +L + +P ++IQFEDF  +
Sbjct: 189 PLTLDLGTSNKSLREDPLYMGSRREKVTPEQELEFLDELMTALTERWPGIVIQFEDF--K 246

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L++YR N  CFNDDIQGTGAV+L+G +NAVK  +  + P  H+ +F         
Sbjct: 247 NPFPALARYRHNYTCFNDDIQGTGAVILAGVMNAVK--KSGIPPQNHKAVFLGAGSAGVG 304

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ+++FF V  GM+E+EA+   +LVDTKGLVT DRGD LA HKVYFAR DN G Q+KT
Sbjct: 305 VAKQIVDFF-VREGMTEDEARACFYLVDTKGLVTADRGDKLAAHKVYFARTDNGGRQYKT 363

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           LEEV++YV+PT L+GLS+ GGVF  +I+ +M++ NK PIIFPLSNP  N+EC FE A+  
Sbjct: 364 LEEVVDYVRPTMLMGLSTLGGVFTPQILKKMSDWNKKPIIFPLSNPSANSECNFESAVVN 423

Query: 361 TDNRVIFASGTAFPEYTVPETG---KTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
           TD R +FASG+ F  ++        KT YPGQGNNMY+FPG+GLG IL+K   ITD  IY
Sbjct: 424 TDGRCLFASGSPFQPFSYTNHAGETKTHYPGQGNNMYVFPGIGLGTILSKAVEITDTMIY 483

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                               YP ++RIR VS
Sbjct: 484 ASAQALSTALTSEEIEQGLLYPDITRIREVS 514



>gi|402085634|gb|EJT80532.1| NADP-dependent malic enzyme [Gaeumannomyces graminis var. tritici
           R3-111a-1]
          Length = 816

 Score =  446 bits (1148), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 232/458 (50%), Positives = 302/458 (65%), Gaps = 25/458 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LF+R+++  + E+ PL+YTPT+G  CL+YS +         P+ LY+S+    ++  
Sbjct: 325 NVDLFFRLLMDNVRELMPLVYTPTIGDVCLQYSSLYTR------PEALYISIKQRRSIKT 378

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+  + PYP      P+I V+TDGSRILGLGDLG+NG+GIP+GKL LY AAAGIDP +TL
Sbjct: 379 ILSNW-PYP-----RPEICVVTDGSRILGLGDLGINGVGIPIGKLSLYTAAAGIDPSKTL 432

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GTNNE+NLKD  YLGLRSKR   +   +F+D  M+++ +VYP++++QFEDF SE
Sbjct: 433 PIVLDTGTNNEENLKDPLYLGLRSKRPAFEAEQAFMDEFMQAVKEVYPDMVVQFEDFQSE 492

Query: 181 HAFDLLSKYRENTF--CFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXX 238
            AFD L +YR   +   FNDDIQGTGAVVL+G+INAVKL    V   + RL+F       
Sbjct: 493 KAFDYLDRYRTTKYNAAFNDDIQGTGAVVLAGYINAVKL--SGVPIEEQRLVFMGAGSAG 550

Query: 239 XXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQF 298
               KQ++E++    GMSE+EAK   +LVD++GLVT DRGD LA HKVYFAR DN G+QF
Sbjct: 551 VGVAKQVMEYY-TRRGMSEQEAKDKFFLVDSRGLVTADRGDKLAAHKVYFARRDNSGHQF 609

Query: 299 KTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAE------LNKNPIIFPLSNPKVNAEC 352
           +TLE+VIEYVKP+ALIGL++T GVF E I+  +          + PI+FPLSNP   AEC
Sbjct: 610 QTLEQVIEYVKPSALIGLTATFGVFTESIVRGLKASVESGGRGRRPILFPLSNPLTKAEC 669

Query: 353 TFEDAMKGTDNRVIFASGTAFPEYTVPETGK--TKYPGQGNNMYIFPGLGLGAILAKPKV 410
           TFE A+  TD  V+FASG+ F  YTV    +  T  P QGNN+Y+FPG+GLGAILAK   
Sbjct: 670 TFEQAVNWTDGTVVFASGSPFAPYTVKNGDQPITYLPNQGNNVYVFPGIGLGAILAKVSQ 729

Query: 411 ITDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
           +TD  IY                    YP + R++  S
Sbjct: 730 VTDDMIYTSAEALSNCLNAEEIHKGLIYPRIERVQRAS 767



>gi|400600978|gb|EJP68646.1| malic enzyme [Beauveria bassiana ARSEF 2860]
          Length = 675

 Score =  446 bits (1148), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 229/457 (50%), Positives = 294/457 (64%), Gaps = 24/457 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N+ LFYR+++  + E+ PL+YTPT+G  CL+YS +         P+ LY+S+    ++  
Sbjct: 177 NIDLFYRLLMDNIRELMPLVYTPTIGDVCLQYSTLYTR------PEALYISIKQRRSIKT 230

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++   R +P  D   P+I V+TDGSRILGLGDLGVNG+GI +GKL LY AAAGI P +TL
Sbjct: 231 ML---RNWPCTD---PEICVVTDGSRILGLGDLGVNGVGISIGKLSLYTAAAGISPEKTL 284

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GT+NE NLKD  YLGLR KRV       F+D  M ++ +VYP +++QFEDF SE
Sbjct: 285 PIVLDTGTDNESNLKDPLYLGLRQKRVSKAAQQEFMDEFMDAVKEVYPSMVVQFEDFESE 344

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF+ L +YR    CFNDD+QGTGAVVL G+I AV L    V     RL+F         
Sbjct: 345 KAFNYLDRYRNTHRCFNDDVQGTGAVVLGGYIGAVNL--SGVPLEDQRLVFMGAGSAGVG 402

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL+E++  + G+S+ EA+   WLVDTKGLVT DRGD+LA+HK YFAR DN G QF+T
Sbjct: 403 VAKQLVEYY-TKRGLSQSEARDRFWLVDTKGLVTKDRGDHLAEHKQYFARTDNQGQQFRT 461

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAEL------NKNPIIFPLSNPKVNAECTF 354
           LEEVIEYV+P+AL+GL++T GVF E  I  +         N+ PI+FPLSNP   AECTF
Sbjct: 462 LEEVIEYVRPSALVGLAATYGVFTESCIRALKHSVDGGGPNRRPILFPLSNPHTKAECTF 521

Query: 355 EDAMKGTDNRVIFASGTAFPEYTV--PETGKTKY-PGQGNNMYIFPGLGLGAILAKPKVI 411
           E A++ TD  VIFASG+ FP  TV  P   +  Y P QGNN+Y+FPGLGLGAILA+   I
Sbjct: 522 EQAVEWTDGSVIFASGSPFPSLTVAGPNGNEITYHPNQGNNVYVFPGLGLGAILAQATRI 581

Query: 412 TDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
           TD+ +Y                    YP + R+R  S
Sbjct: 582 TDEMVYTSASALANCLNADELAKGLIYPRIERVREAS 618



>gi|443895078|dbj|GAC72424.1| NADP+-dependent malic enzyme [Pseudozyma antarctica T-34]
          Length = 902

 Score =  444 bits (1143), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 238/509 (46%), Positives = 311/509 (61%), Gaps = 32/509 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  L+Y  ++   EEI PLIYTPTVG AC ++SHI         P+GL +SL D   +  
Sbjct: 412 NTRLYYATILANKEEILPLIYTPTVGEACQKFSHIY------RRPEGLSISLEDKGKIAS 465

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I++ + P P      P+IAV+TDGSRILGLGDLG NG GI +GKL LYVA AGI PR TL
Sbjct: 466 IVENW-PVPAG---APRIAVVTDGSRILGLGDLGWNGQGISIGKLSLYVAGAGIHPRATL 521

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI +DLGTNN+K L+D  YLGLR +R   +++  F+D VM +L   YP L+IQFEDF+SE
Sbjct: 522 PIVVDLGTNNKKMLEDPLYLGLRRERASTEEYIEFMDEVMDALHTKYPNLIIQFEDFTSE 581

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKD----VHPTKHRLLFFXXXX 236
           +AF  L +Y++    FNDDIQGTG+V+L+GF NA ++  K+    +H   HR+L      
Sbjct: 582 NAFRFLERYQDKYPMFNDDIQGTGSVILAGFTNAARIASKESGRPLH--DHRILMAGAGS 639

Query: 237 XXXXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGN 296
                 KQL+ FF    G+SE+EA+  +++ D+KGLVT DRGD L +HKV+FARDDN G 
Sbjct: 640 AAVGVGKQLMSFF-TRQGLSEDEARSRIYITDSKGLVTADRGDKLPEHKVFFARDDNAGR 698

Query: 297 QFKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFED 356
           Q K L E+I+YVKPTA++GLS+  G F+E +I +MA LNK PIIFPLSNP  N+ECTFE+
Sbjct: 699 QIKDLAEIIDYVKPTAILGLSTVKGTFDETVIRKMATLNKRPIIFPLSNPTDNSECTFEE 758

Query: 357 AMKGTDNRVIFASGTAFPEYTVPE--TGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDK 414
           A+K T+ RV+FA+G+ FPE    +  TGK   PGQGNN  +FPG+GL A L K   +T++
Sbjct: 759 AVKFTEGRVLFAAGSPFPEIEAGQSPTGKRMIPGQGNNFLVFPGIGLCAALCKASRVTNE 818

Query: 415 QIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMV 474
            I                     YP   RIR +S              G+ RD    +  
Sbjct: 819 MITESALALSDALNDEERAEGRLYPNTERIREISRDIAVRCIQMANKQGVTRDNG--KTA 876

Query: 475 QNDIEVLKTRKGKEWDNLVKFVQENMWDP 503
             D E L     ++W      VQ  MW P
Sbjct: 877 AMDEEQL-----RDW------VQGEMWTP 894



>gi|429861963|gb|ELA36626.1| nadp-dependent malic enzyme [Colletotrichum gloeosporioides Nara
           gc5]
          Length = 667

 Score =  444 bits (1142), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 236/518 (45%), Positives = 320/518 (61%), Gaps = 41/518 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFYR+++  + ++ PL+YTPT+G  CL+YS +         P+ LY+S+    ++  
Sbjct: 171 NFDLFYRLLMDNIRDLMPLVYTPTIGDVCLQYSTLYTR------PEALYISIKQRKSIRT 224

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +++ + PYP      P+I V+TDGSRILGLGDLGVNG+GI +GKL LY  AAGI P  TL
Sbjct: 225 MLRNW-PYP-----NPEICVVTDGSRILGLGDLGVNGVGISIGKLALYTGAAGIHPENTL 278

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GTNNE NLKD FYLG+RSKRV   +  +F+D  M+++ +VYP + +QFEDF SE
Sbjct: 279 PIVLDTGTNNENNLKDPFYLGIRSKRVSVAEQQAFMDEFMEAVAEVYPNMTVQFEDFESE 338

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF+ L +YR    CFNDDIQGTGAVVL+G+INAV+L    V   + RL+F         
Sbjct: 339 KAFNYLDRYRNKYRCFNDDIQGTGAVVLAGYINAVEL--SGVPLEEQRLVFMGAGSAGVG 396

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL+E++  + G+SE+ AK   WLVDTKGLVT DRGD LA+HK YFAR DN+G+QF+T
Sbjct: 397 VAKQLVEYY-TKRGLSEQAAKDKFWLVDTKGLVTKDRGDKLAEHKKYFARTDNNGHQFRT 455

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAE------LNKNPIIFPLSNPKVNAECTF 354
           LEEVI YVKP+AL+GL++T GVF E ++  +        L + P++FPLSNP   AECTF
Sbjct: 456 LEEVIAYVKPSALVGLTATFGVFTESVVRALKASVDAGGLGRRPVLFPLSNPLTKAECTF 515

Query: 355 EDAMKGTDNRVIFASGTAFPEYTVPET---GKTKYPGQGNNMYIFPGLGLGAILAKPKVI 411
           E A++ TD  V+FASG+ F   TV        T +P QGNN+Y+FPGLGLGAILAK   +
Sbjct: 516 EQAIQWTDGTVLFASGSPFNPVTVKSKEGESITYHPNQGNNVYVFPGLGLGAILAKATKV 575

Query: 412 TDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLAR--DKQ 469
           TD  +Y                    YP + R+R  S              G+++  + Q
Sbjct: 576 TDDMVYTSAASLAASLNADEIHKGLIYPRIERVRDASLVVAREVMKAARRAGVSQLPESQ 635

Query: 470 IIEMVQNDIEVLKTRKGKEWDNLV--KFVQENMWDPDS 505
            +E              +EW ++    +++E ++DP S
Sbjct: 636 WVEW-------------EEWGDVALNAWIKERVYDPVS 660



>gi|452840162|gb|EME42100.1| hypothetical protein DOTSEDRAFT_45660 [Dothistroma septosporum
           NZE10]
          Length = 664

 Score =  444 bits (1141), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 246/507 (48%), Positives = 320/507 (63%), Gaps = 37/507 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV+LFYR++   ++E TPLIYTPTVG AC  +S +         P+G+YLS  D  +L  
Sbjct: 162 NVNLFYRLLAENVKEFTPLIYTPTVGEACQRWSKLY------TQPEGMYLSFADKGHLHS 215

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+ +   P+D     +I V+TDGSRILGLGDLG+NGMGIPVGKL LY A AGI P RTL
Sbjct: 216 VIQNW---PHD----VEITVVTDGSRILGLGDLGINGMGIPVGKLSLYTACAGIHPMRTL 268

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ LDLGT+NE+   D  YLG R  +V  ++   F+D +M +L + +P ++IQFEDF  +
Sbjct: 269 PLCLDLGTSNEELRNDPLYLGSRRPKVTAEEEKDFLDEMMAALTERWPSIVIQFEDF--K 326

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L +Y++    FNDDIQGTGAV+  GFINAVK  +  V P   R +F         
Sbjct: 327 NPFPSLERYQDTYTMFNDDIQGTGAVITGGFINAVK--QSGVAPKDQRAVFLGAGSAGVG 384

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL EFF  E G+SEEEAK+  WLVD++GLVTLDRG  LA+HK+YFARDDN+G QFKT
Sbjct: 385 VAKQLTEFFMKE-GLSEEEAKKRFWLVDSQGLVTLDRG-KLAEHKLYFARDDNNGQQFKT 442

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L EV+EYVKPT L+GLS+ GG F  +I+ RMAELN  P+IFPLSNP   +ECTFE+A+K 
Sbjct: 443 LPEVVEYVKPTILMGLSTIGGAFTPEILTRMAELNDRPVIFPLSNPSSKSECTFEEAIKY 502

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           T  + +FASG+ FP  T+   GK   PGQGNNMY+FPG+GLGAIL+K   +T   IY   
Sbjct: 503 TKGKCLFASGSPFP--TLEWEGKELVPGQGNNMYVFPGIGLGAILSKAVNVTQNMIYASA 560

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YP ++RIR VS              G+ R  Q   M   D E+
Sbjct: 561 EALSTSLLPSEIEDNWLYPAINRIREVS---------VVVTRGVIRAAQKDSM---DREL 608

Query: 481 -LKTRKGKEWDNLVKFVQENMWDPDSE 506
            L+    ++ D+   +++E M+DP  E
Sbjct: 609 ALRNISDEQLDD---YIRERMYDPFKE 632



>gi|71011147|ref|XP_758454.1| hypothetical protein UM02307.1 [Ustilago maydis 521]
 gi|46097874|gb|EAK83107.1| hypothetical protein UM02307.1 [Ustilago maydis 521]
          Length = 634

 Score =  444 bits (1141), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 239/509 (46%), Positives = 310/509 (60%), Gaps = 32/509 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  L+Y  ++   EEI PLIYTPTVG AC ++SHI         P+GL +SL D   +  
Sbjct: 144 NTRLYYATILANKEEILPLIYTPTVGEACQKFSHIYRR------PEGLSISLEDKGKIAS 197

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I++ + P P     +P+IAVITDGSRILGLGDLG NG GI +GKL LYVA AGI PR TL
Sbjct: 198 IVENW-PVPAG---SPRIAVITDGSRILGLGDLGWNGQGISIGKLSLYVAGAGIHPRATL 253

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI +DLGTNN+KNL+D  YLGLR +R   +++  F+D VM +L   YP L+IQFEDF+SE
Sbjct: 254 PIVVDLGTNNKKNLEDPLYLGLRRERASTEEYIEFMDEVMHALHTRYPNLIIQFEDFTSE 313

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKD----VHPTKHRLLFFXXXX 236
           +AF  L +Y+     FNDDIQGTG+V+L+GF NA ++  K+    +H   HR+L      
Sbjct: 314 NAFRFLERYQGKYPMFNDDIQGTGSVILAGFTNAARIASKESGRPLH--DHRILMAGAGS 371

Query: 237 XXXXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGN 296
                 KQL+ FF    G+S +EA+  +++ D+KGLVT DRGD LA+HKV+FARDDN G 
Sbjct: 372 AAVGVGKQLMSFF-TRQGLSADEARERIFITDSKGLVTKDRGDKLAEHKVFFARDDNAGK 430

Query: 297 QFKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFED 356
           Q K L E+I+YVKPTA++GLS+  G F+E +I +MA LNK PIIFPLSNP  N+ECTFE+
Sbjct: 431 QIKDLGEIIDYVKPTAILGLSTIKGTFDENVIRKMATLNKRPIIFPLSNPTDNSECTFEE 490

Query: 357 AMKGTDNRVIFASGTAFPEYTVPE--TGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDK 414
           A+K T+ RV+FA+G+ F E       TGK   PGQGNN  +FPG+GL A L K   +T++
Sbjct: 491 AVKYTEGRVLFAAGSPFAEIDAASSPTGKRMIPGQGNNFLVFPGIGLCAALCKAGRVTNE 550

Query: 415 QIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMV 474
            I                     YP   RIR +S              G+ RD    +  
Sbjct: 551 MITESALALSDALTDQERAEGRLYPNTERIREISRDIAVKCIQMANKQGVTRDGG--KTA 608

Query: 475 QNDIEVLKTRKGKEWDNLVKFVQENMWDP 503
             D E L     ++W      VQ  MW P
Sbjct: 609 AMDEEQL-----RDW------VQGEMWTP 626



>gi|71000960|ref|XP_755161.1| NADP-dependent malic enzyme MaeA [Aspergillus fumigatus Af293]
 gi|66852799|gb|EAL93123.1| NADP-dependent malic enzyme MaeA [Aspergillus fumigatus Af293]
          Length = 661

 Score =  442 bits (1138), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 237/510 (46%), Positives = 315/510 (61%), Gaps = 36/510 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+V   L+E+TPLIYTP VG AC ++S I         P+G+YLS  D  NL  
Sbjct: 149 NVHLFYRLVTDHLKELTPLIYTPVVGEACQKWSEIYQ------QPEGMYLSWEDRGNLAA 202

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I  + P P       +I  ITDGSRILGLGDLG+NGMGIP+GKL LY A AGI P  TL
Sbjct: 203 VIANW-PQP-----NVEITCITDGSRILGLGDLGINGMGIPIGKLALYTACAGIRPEATL 256

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT+N+   +D  Y+G R  ++  ++   F+D +M +L + +P ++IQFEDF  +
Sbjct: 257 PLTLDLGTSNKALREDPLYMGTRRDKISPEEEREFMDELMAALTERWPGIVIQFEDF--K 314

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTK-HRLLFFXXXXXXX 239
           + F  L +YR+   CFNDDIQGTGAV+L G INAVK   +   P K HR +F        
Sbjct: 315 NPFPALERYRDAYTCFNDDIQGTGAVILGGVINAVK---RSGLPCKEHRAVFLGAGSAGV 371

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK 299
              KQ++ FF  E GM+E+EA+   +LVDTKGLVT DRGD LA HKVYFAR DN+G QFK
Sbjct: 372 GVAKQIVAFFMRE-GMTEDEARSCFYLVDTKGLVTADRGDKLADHKVYFARTDNNGQQFK 430

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
           TL+EV+++VKPT L+GLS+ GGVF  +I+ +MA+ N +PIIFPLSNP  N+EC FE A+ 
Sbjct: 431 TLDEVVDHVKPTILMGLSTLGGVFTPEILRKMADWNTHPIIFPLSNPSANSECDFESAIT 490

Query: 360 GTDNRVIFASGTAFPEYTVPET---GKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQI 416
            TD R +FASG+ F  ++   +    +T YPGQGNNMY+FPG+GLG IL+K   +TD+ I
Sbjct: 491 HTDGRALFASGSPFQPFSFKNSSGESRTYYPGQGNNMYVFPGIGLGTILSKAVKVTDEMI 550

Query: 417 YIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQN 476
           Y                    YP ++RIR VS              G+ R+  +  M   
Sbjct: 551 YASGAALSQALTAEEIDLGLLYPDLTRIRQVSIVVARKVIRAAQDAGVDRETSLRNM--- 607

Query: 477 DIEVLKTRKGKEWDNLVKFVQENMWDPDSE 506
                      + ++L  +++  M+DP SE
Sbjct: 608 -----------DDESLDAWIKARMYDPHSE 626



>gi|388854604|emb|CCF51761.1| related to NADP-dependent malic enzyme [Ustilago hordei]
          Length = 605

 Score =  442 bits (1137), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 235/509 (46%), Positives = 307/509 (60%), Gaps = 32/509 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  L+Y  ++   EEI PLIYTPTVG AC ++SHI         P+GL +SL D   +  
Sbjct: 115 NTRLYYATILANKEEILPLIYTPTVGEACQKFSHIYRR------PEGLSISLEDKGKIAS 168

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I++ + P P     +P+IAVITDGSRILGLGDLG NG GI +GKL LYVA AGI PR TL
Sbjct: 169 IVENW-PVPAG---SPRIAVITDGSRILGLGDLGWNGQGISIGKLSLYVAGAGIHPRATL 224

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI +DLGTNN K L+D  YLGLR KR   +++  F+D VM +L   YP L+IQFEDF+SE
Sbjct: 225 PIVVDLGTNNNKILQDPLYLGLRRKRASTEEYIEFMDEVMDALHSRYPNLVIQFEDFTSE 284

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKD----VHPTKHRLLFFXXXX 236
           +AF  L +Y+     FNDDIQGTG+V+L GF NA ++  K+    +H   HR+L      
Sbjct: 285 NAFRFLDRYQNKYPMFNDDIQGTGSVILGGFANAARIASKESGRPLH--DHRILMAGAGS 342

Query: 237 XXXXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGN 296
                 KQL+ FF +  G+SE+EA+  +++ D+KGLVT DRGD L +HK++FARDDN G 
Sbjct: 343 AAVGVGKQLMSFF-IRQGLSEDEARERIYITDSKGLVTKDRGDKLPEHKIFFARDDNSGR 401

Query: 297 QFKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFED 356
           Q K L E+I+YVKPTA++GLS+  G F+E +I +MA LN+ PIIFPLSNP  N+ECTFE+
Sbjct: 402 QIKDLAEIIDYVKPTAILGLSTVKGTFDETVIRKMAALNQRPIIFPLSNPTDNSECTFEE 461

Query: 357 AMKGTDNRVIFASGTAFPEYTVPE--TGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDK 414
           A+K TD +V+FA+G+ FPE       TGK   PGQGNN  +FPG+GL A L K   +T++
Sbjct: 462 AVKYTDGKVLFAAGSPFPEIEAENSPTGKRLIPGQGNNFLVFPGIGLCAALCKAGRVTNE 521

Query: 415 QIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMV 474
            I                     YP   RIR +S              G+ARD      +
Sbjct: 522 MITESALALSDALNDEERAEGRLYPNTERIREISRDIAVRCIQMANKQGVARDAGKTAAM 581

Query: 475 QNDIEVLKTRKGKEWDNLVKFVQENMWDP 503
                        + + L  +V   MW P
Sbjct: 582 -------------DQEQLSDWVHGEMWTP 597



>gi|159129255|gb|EDP54369.1| NADP-dependent malic enzyme MaeA [Aspergillus fumigatus A1163]
          Length = 598

 Score =  442 bits (1136), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 237/510 (46%), Positives = 315/510 (61%), Gaps = 36/510 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+V   L+E+TPLIYTP VG AC ++S I         P+G+YLS  D  NL  
Sbjct: 86  NVHLFYRLVTDHLKELTPLIYTPVVGEACQKWSEIYQ------QPEGMYLSWEDRGNLAA 139

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I  + P P       +I  ITDGSRILGLGDLG+NGMGIP+GKL LY A AGI P  TL
Sbjct: 140 VIANW-PQP-----NVEITCITDGSRILGLGDLGINGMGIPIGKLALYTACAGIRPEATL 193

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT+N+   +D  Y+G R  ++  ++   F+D +M +L + +P ++IQFEDF  +
Sbjct: 194 PLTLDLGTSNKALREDPLYMGTRRDKISPEEEREFMDELMAALTERWPGIVIQFEDF--K 251

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTK-HRLLFFXXXXXXX 239
           + F  L +YR+   CFNDDIQGTGAV+L G INAVK   +   P K HR +F        
Sbjct: 252 NPFPALERYRDAYTCFNDDIQGTGAVILGGVINAVK---RSGLPCKEHRAVFLGAGSAGV 308

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK 299
              KQ++ FF  E GM+E+EA+   +LVDTKGLVT DRGD LA HKVYFAR DN+G QFK
Sbjct: 309 GVAKQIVAFFMRE-GMTEDEARSCFYLVDTKGLVTADRGDKLADHKVYFARTDNNGQQFK 367

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
           TL+EV+++VKPT L+GLS+ GGVF  +I+ +MA+ N +PIIFPLSNP  N+EC FE A+ 
Sbjct: 368 TLDEVVDHVKPTILMGLSTLGGVFTPEILRKMADWNTHPIIFPLSNPSANSECDFESAIT 427

Query: 360 GTDNRVIFASGTAFPEYTVPET---GKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQI 416
            TD R +FASG+ F  ++   +    +T YPGQGNNMY+FPG+GLG IL+K   +TD+ I
Sbjct: 428 HTDGRALFASGSPFQPFSFKNSSGESRTYYPGQGNNMYVFPGIGLGTILSKAVKVTDEMI 487

Query: 417 YIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQN 476
           Y                    YP ++RIR VS              G+ R+  +  M   
Sbjct: 488 YASGAALSQALTAEEIDLGLLYPDLTRIRQVSIVVARKVIRAAQDAGVDRETSLRNM--- 544

Query: 477 DIEVLKTRKGKEWDNLVKFVQENMWDPDSE 506
                      + ++L  +++  M+DP SE
Sbjct: 545 -----------DDESLDAWIKARMYDPHSE 563



>gi|449299577|gb|EMC95590.1| hypothetical protein BAUCODRAFT_71830 [Baudoinia compniacensis UAMH
           10762]
          Length = 611

 Score =  442 bits (1136), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 235/506 (46%), Positives = 317/506 (62%), Gaps = 34/506 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR++   ++E+TPLIYTPTVG AC  +S +         P+G+YLS  D  NL  
Sbjct: 81  NVHLFYRLLAENVKELTPLIYTPTVGEACQRWSELYT------QPEGMYLSFEDRGNLHS 134

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+ +   P+D     +I V+TDGSRILGLGDLG+NGMGIPVGKL LY A AGI P +TL
Sbjct: 135 VIQNW---PHD----VEITVVTDGSRILGLGDLGINGMGIPVGKLSLYTACAGIHPLKTL 187

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ LDLGT+NE    D  YLG R ++V  ++   F+D +M +L + +P ++IQ+EDF  +
Sbjct: 188 PLCLDLGTSNESFRNDPLYLGSRREKVTAEEEKDFLDEMMAALTERWPGIVIQYEDF--K 245

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L +Y+E    FNDDIQGTGAV+L GFINAVK  +  V P   R +F         
Sbjct: 246 NPFPSLERYQETYTMFNDDIQGTGAVILGGFINAVK--QSGVAPADQRAVFLGAGSAGVG 303

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL EFF ++ G+SE++AKR  WLVD++GLVT DR   LA HK+YF+RDDN G Q+KT
Sbjct: 304 VAKQLTEFF-MKEGLSEDDAKRRFWLVDSQGLVTNDRPGKLADHKIYFSRDDNKGKQYKT 362

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           LEE++EYVKPT L+GLS+ GG F  KI++RMAE+N  P+IFPLSNP   +ECTFE+A+K 
Sbjct: 363 LEEIVEYVKPTILMGLSTIGGAFTPKILSRMAEMNDRPVIFPLSNPSSKSECTFEEAIKY 422

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           T+ + +FASG+ FP  T+   GK   PGQGNNMY+FPG+GLGAIL+K   +T   IY   
Sbjct: 423 TNGKCLFASGSPFP--TLNFGGKDLVPGQGNNMYVFPGIGLGAILSKAVSVTQNMIYSSA 480

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YP + RIR VS              G+ R+  +  +   ++E 
Sbjct: 481 EALATSMLPTELQDHWLYPDIRRIREVSVIVTRGVIRAAQRDGVDRELALRNISDEELE- 539

Query: 481 LKTRKGKEWDNLVKFVQENMWDPDSE 506
                        +++++ M+DP +E
Sbjct: 540 -------------EYIRQRMYDPFTE 552



>gi|358389717|gb|EHK27309.1| hypothetical protein TRIVIDRAFT_140682 [Trichoderma virens Gv29-8]
          Length = 601

 Score =  441 bits (1135), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 225/458 (49%), Positives = 302/458 (65%), Gaps = 25/458 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+++  + E+ PL+YTPT+G  CL+YS +         P+ LY+S+    ++  
Sbjct: 103 NVDLFYRLLMDNIRELMPLVYTPTIGDVCLQYSTLYTR------PEALYISIKQRKSIRT 156

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +++ + P P      P+I V+TDGSRILGLGDLG+NG+GI +GKL LY+AAAGI P +TL
Sbjct: 157 MLRNW-PCP-----NPEICVVTDGSRILGLGDLGINGVGISIGKLALYIAAAGIHPAKTL 210

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GTNNE NLKD FYLGLR KRV  +   +F+D  M ++ +VYP +++QFEDF SE
Sbjct: 211 PIVLDTGTNNETNLKDPFYLGLRQKRVPMEDQQAFMDEFMDAVKEVYPNMVVQFEDFDSE 270

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF+ L +YR     FNDDIQGTGAVVL+G+INAV L    V   + RL+F         
Sbjct: 271 KAFNYLDRYRNTHRAFNDDIQGTGAVVLAGYINAVNL--SSVPLEEQRLVFMGAGSAGVG 328

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL+E++    G++E EA+   +LVDTKGLVT+DRGD LA+HK YFAR DN+G+QF+T
Sbjct: 329 VAKQLVEYY-TRRGLTEAEARDKFFLVDTKGLVTMDRGDKLAEHKKYFARIDNNGHQFRT 387

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAE------LNKNPIIFPLSNPKVNAECTF 354
           LEEVIEYVKP+AL+GL++T G+F E ++  +        L + PI+FPLSNP   AECTF
Sbjct: 388 LEEVIEYVKPSALVGLAATFGIFTESVVRALKASVDAGGLGRRPILFPLSNPFTKAECTF 447

Query: 355 EDAMKGTDNRVIFASGTAFPEYTVPETGK----TKYPGQGNNMYIFPGLGLGAILAKPKV 410
           E A++ TD  V+FASG+ F  +T+   G     T +P QGNN+Y+FPGLGLGAIL+K   
Sbjct: 448 EQAVQWTDGSVVFASGSPFSSFTLKVGGDAGDITYHPNQGNNVYVFPGLGLGAILSKATR 507

Query: 411 ITDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
           +TD+ +Y                    YP + R+R  S
Sbjct: 508 VTDEMVYTSAAALAGSLNAEEVHQGLIYPKIDRVRDAS 545



>gi|67539996|ref|XP_663772.1| hypothetical protein AN6168.2 [Aspergillus nidulans FGSC A4]
 gi|24637711|gb|AAN63880.1| NADP-dependent malic enzyme [Emericella nidulans]
 gi|40738764|gb|EAA57954.1| hypothetical protein AN6168.2 [Aspergillus nidulans FGSC A4]
 gi|259479640|tpe|CBF70049.1| TPA: Malic enzyme [Source:UniProtKB/TrEMBL;Acc:Q8J260] [Aspergillus
           nidulans FGSC A4]
          Length = 648

 Score =  441 bits (1135), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 242/510 (47%), Positives = 315/510 (61%), Gaps = 36/510 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+V   L E+TPLIYTP VG AC  +S I         P+G+YLS  D  NL  
Sbjct: 140 NVHLFYRLVTDHLRELTPLIYTPVVGEACQRWSEIYQ------QPEGMYLSWEDRGNLAS 193

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I  + P P       +I  ITDGSRILGLGDLG+NGMGIP+GKL LY   AGI P  TL
Sbjct: 194 VIANW-PQP-----NVEITCITDGSRILGLGDLGINGMGIPIGKLALYTTCAGIRPEATL 247

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT+N+   +D  YLG R  ++  D+   F+D +M +L + +P ++IQFEDF  +
Sbjct: 248 PLTLDLGTSNKALREDPLYLGSRRDKITPDEEREFLDELMAALTERWPGIVIQFEDF--K 305

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L +Y++   CFNDDIQGTGAV+L G INAVK     V     R +FF        
Sbjct: 306 NPFPALERYQDVYTCFNDDIQGTGAVILGGVINAVK--RSGVPCKDQRAVFFGAGSAGVG 363

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ++ FF  E GM+E+EA+   WLVDTKGLVT DRGD LA+HKVYFAR DN G QFKT
Sbjct: 364 VAKQIVAFFMRE-GMTEDEARSCFWLVDTKGLVTADRGDKLAEHKVYFARTDNAGQQFKT 422

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           LEEV+++VKP+ L+GLS+ GGVF  +I+ +MAE N NP+IFPLSNP   +EC FE A+  
Sbjct: 423 LEEVVDHVKPSILMGLSTQGGVFTPEILRKMAEWNTNPMIFPLSNPSSKSECDFETAVTN 482

Query: 361 TDNRVIFASGTAFPEYTVPET-GKTK--YPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
           TD RV+FASG+ FP  +   + G+TK  YPGQGNNMY+FPG+GLG IL+K   +TD  IY
Sbjct: 483 TDGRVLFASGSPFPTMSFTNSAGETKMYYPGQGNNMYVFPGIGLGTILSKAVKVTDSMIY 542

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQN- 476
                               YP ++RIR VS               +AR+  +I   Q  
Sbjct: 543 ASGEALSKALTAEEIERGLLYPDLTRIRKVSVV-------------VARN--VIRAAQEA 587

Query: 477 DIEVLKTRKGKEWDNLVKFVQENMWDPDSE 506
            ++   T +  + + L  +++  M+DP +E
Sbjct: 588 KVDRETTLRTMDDETLDAWIKSRMYDPHTE 617



>gi|482807862|gb|EOA84795.1| hypothetical protein SETTUDRAFT_89679 [Setosphaeria turcica Et28A]
          Length = 581

 Score =  441 bits (1135), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 240/523 (45%), Positives = 329/523 (62%), Gaps = 37/523 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR++   ++E+TPLIYTPTVG AC+ +  I         P+G+YLS +D  NL +
Sbjct: 76  NVHLFYRLLGENIKELTPLIYTPTVGEACVRWHEIWT------QPEGMYLSWSDRGNLRR 129

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+  + P+  D      I V+TDGSRILGLGDLGVNGMGIPVGKL LY A AGI P  TL
Sbjct: 130 ILDNW-PHEVD------ITVLTDGSRILGLGDLGVNGMGIPVGKLALYTACAGIRPDGTL 182

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGTNN+   +D  Y+G R  +V  +Q   F+D +M +L   +P ++IQFEDF  +
Sbjct: 183 PLTLDLGTNNKTLREDPLYMGSRMPKVTAEQEKEFLDELMAALTDKWPSIVIQFEDF--K 240

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L +Y+     FNDD+QGTGAV++ GFINAVK     V   +H+ +F         
Sbjct: 241 NPFPALERYQNQYAMFNDDVQGTGAVIVGGFINAVK--ASGVPAREHKAIFLGAGSAGVG 298

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ++E+F ++ G++E+EA+R  W VD+ GLVTLDRGD LA+HKVYFARDDN G Q+++
Sbjct: 299 VAKQIVEYF-IKEGLTEDEARRKFWFVDSNGLVTLDRGDKLAEHKVYFARDDNGGRQYQS 357

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L  +I+YVKPT L+GLS+ GG FN+ I+ +MA LN  PIIFPLSNP   +ECTFE+A+  
Sbjct: 358 LSRLIDYVKPTILMGLSTIGGAFNKDILEKMASLNNRPIIFPLSNPSSKSECTFEEAVLA 417

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           T+ R +FASG+ FP  ++   GKT  PGQGNNMY+FPG+GLGAI++K   +T   IY   
Sbjct: 418 TEGRCLFASGSPFP--SMEYGGKTLTPGQGNNMYVFPGIGLGAIISKSVSVTQDMIYASA 475

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YP V RIR VS              G+ R  Q     +N ++ 
Sbjct: 476 ESLATSLNKQEVADGWLYPDVRRIREVS---------VVVTRGVIRAAQ-----KNGVDR 521

Query: 481 LKTRKGKEWDNLVKFVQENMWDPDSE-KFFNTE--ELLSKSKM 520
               +G   + L  F+++NM+DP +E ++F+ +  +L+S  K+
Sbjct: 522 ATELRGLTDEQLDDFIKQNMYDPYTEHQYFDRKLSQLVSSDKL 564



>gi|358401365|gb|EHK50671.1| hypothetical protein TRIATDRAFT_187381 [Trichoderma atroviride IMI
           206040]
          Length = 665

 Score =  441 bits (1134), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 235/517 (45%), Positives = 319/517 (61%), Gaps = 38/517 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+++  + ++ PL+YTPT+G  CL+YS +         P+ LY+S+    ++  
Sbjct: 167 NVDLFYRLLMDNVRDLMPLVYTPTIGDVCLQYSTLYTR------PEALYISIKQRKSIRA 220

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +++ + P P      P+I V+TDGSRILGLGDLG+NG+GI +GKL LY AAAGI P +TL
Sbjct: 221 MLRNW-PCP-----NPEICVVTDGSRILGLGDLGINGVGISIGKLALYTAAAGIHPAKTL 274

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GTNNE NLKD FYLGLR KRV       F+D  M+++ +VYP +++QFEDF SE
Sbjct: 275 PIVLDSGTNNETNLKDPFYLGLRQKRVSYKDQQDFMDEFMEAVKEVYPNMVVQFEDFDSE 334

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF+ L +YR     FNDDIQGTGAVVL+G+INAV L    V   + RL+F         
Sbjct: 335 KAFNYLDRYRNTHRAFNDDIQGTGAVVLAGYINAVNL--SGVPLEEQRLVFMGAGSAGVG 392

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL+E++    G++E EA+   +LVDTKGLVT+DRGD LA+HK YFAR DN G+QF+T
Sbjct: 393 VAKQLVEYY-TRRGLTEAEARDKFYLVDTKGLVTMDRGDKLAEHKKYFARVDNSGHQFRT 451

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAE------LNKNPIIFPLSNPKVNAECTF 354
           LEEVIEYVKP+AL+GL++T G+F E I+  +          + PI+FPLSNP   AECTF
Sbjct: 452 LEEVIEYVKPSALVGLAATHGIFTESIVRALKASVDAGGFGRRPILFPLSNPLTKAECTF 511

Query: 355 EDAMKGTDNRVIFASGTAFPEYTVPETGK----TKYPGQGNNMYIFPGLGLGAILAKPKV 410
           E A++ TD  V+FASG+ F  +T+   G     T +P QGNN+Y+FPGLGLGAILAK   
Sbjct: 512 EQAVQWTDGSVVFASGSPFNSFTLKVGGDAGEITYHPNQGNNVYVFPGLGLGAILAKATR 571

Query: 411 ITDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQI 470
           ITD  +Y                    YP + R+R  S              G++   ++
Sbjct: 572 ITDDMVYTSAAALAGSLNAEEVHKGLIYPKIERVRDASVIVAREVMKAARRDGVS---EL 628

Query: 471 IEMVQNDIEVLKTRKGKEWDN--LVKFVQENMWDPDS 505
            E +  + E        EW +  L  ++++ ++DP S
Sbjct: 629 PESLWVEWE--------EWGDVALTNYIKQRVYDPTS 657



>gi|425766411|gb|EKV05023.1| Malic enzyme [Penicillium digitatum Pd1]
 gi|425775187|gb|EKV13469.1| Malic enzyme [Penicillium digitatum PHI26]
          Length = 602

 Score =  441 bits (1134), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 238/510 (46%), Positives = 312/510 (61%), Gaps = 36/510 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+V   L E+TPLIYTP VG AC  +S I         P+G+YLS  D  NL  
Sbjct: 89  NVHLFYRLVTDHLREMTPLIYTPVVGEACQRWSEIYQ------QPEGMYLSWEDRGNLAS 142

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I  +   P       +I  ITDGSRILGLGDLG+NGMGIP+GKL LY A AGI P  TL
Sbjct: 143 VISNW---PESSV---EITCITDGSRILGLGDLGINGMGIPIGKLALYTACAGIRPEVTL 196

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGTNN+   +D  Y+G R +++  ++   F+D +M +L   +P ++IQFEDF  +
Sbjct: 197 PLTLDLGTNNKALREDPLYMGSRREKISPEEEREFLDELMAALTDRWPGIVIQFEDF--K 254

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTK-HRLLFFXXXXXXX 239
           + F  L +YR +  CFNDDIQGTGAV+L G INAVK   +   P K HR +FF       
Sbjct: 255 NPFPALERYRNSYTCFNDDIQGTGAVILGGVINAVK---RSGLPCKDHRAVFFGAGSAGV 311

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK 299
              +Q++EFF  E GM+E+EA+   +LVDTKGLVT DRGD LA HKVYFAR DN+  Q+K
Sbjct: 312 GVARQIVEFFMRE-GMTEDEARNCFYLVDTKGLVTADRGDKLADHKVYFARRDNNAEQYK 370

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
           TLEEVI+YVKP+ L+GLS+ GGVF  +I+ +MA+ N  P+IFPLSNP   +EC FE A+ 
Sbjct: 371 TLEEVIDYVKPSILMGLSTMGGVFTPEILRKMADWNTAPLIFPLSNPSSKSECDFETAIT 430

Query: 360 GTDNRVIFASGTAFPEYTVPETG---KTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQI 416
            TD R +FASG+ FP +T   +    +T YPGQGNNMY+FPG+GLG+IL+K   +TD  I
Sbjct: 431 HTDGRCLFASGSPFPNFTFTNSAGETRTYYPGQGNNMYVFPGIGLGSILSKAVRVTDSMI 490

Query: 417 YIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQN 476
           Y                    YP ++RIR VS               + R+  +  M  +
Sbjct: 491 YASGDALSTALTGEELERGLLYPDITRIREVSVVVTRKVIRAAQEDKVDREISLRSM--S 548

Query: 477 DIEVLKTRKGKEWDNLVKFVQENMWDPDSE 506
           D+E            L  +++  M+DP +E
Sbjct: 549 DVE------------LNNWIKSRMYDPHTE 566



>gi|295660242|ref|XP_002790678.1| malic enzyme [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226281553|gb|EEH37119.1| malic enzyme [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 599

 Score =  440 bits (1132), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 235/509 (46%), Positives = 311/509 (61%), Gaps = 34/509 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+V+  L+E+TPLIYTP VG AC  +S I         P+G+Y+S  D  N+  
Sbjct: 86  NVHLFYRLVVDHLKELTPLIYTPVVGEACQRWSEIYQG------PEGMYISYEDRGNIAA 139

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+ + P P+      +I  ITDGSRILGLGDLG+NGMGIP+GKL LY A AGI P  TL
Sbjct: 140 VIQNW-PQPH-----VEITCITDGSRILGLGDLGINGMGIPIGKLALYTACAGIRPEATL 193

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT+N+   ++  Y+G R  +V  +Q   F+D +M +L + +P ++IQFEDF  +
Sbjct: 194 PLTLDLGTSNKALRENPLYMGSRRDKVTPEQELEFMDELMTALTEKWPGIVIQFEDF--K 251

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L +YR    CFNDDIQGTGAV+L+G INAVK  +  +   KH+ +F         
Sbjct: 252 NPFPALERYRHRYTCFNDDIQGTGAVILAGVINAVK--QSGIPTRKHKAVFLGAGSAGVG 309

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ+++FF  E GM+E+EAK   +LVDTKGLVT DRGD LA HKVYFAR DN G Q KT
Sbjct: 310 VAKQIVDFFMYE-GMTEDEAKACFYLVDTKGLVTADRGDKLAPHKVYFARTDNHGLQLKT 368

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L EV+E+VKPT L+GLS+ GGVF  +I+ +M+  NK PIIFPLSNP  N+EC FE A+  
Sbjct: 369 LSEVVEHVKPTMLMGLSTLGGVFTPQILKKMSTYNKRPIIFPLSNPSANSECDFESAITH 428

Query: 361 TDNRVIFASGTAFPEYTVPETG---KTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
           TD   +FASG+ F  ++   +    KT YPGQGNNMY+FPG+GLG IL+K   +TD  IY
Sbjct: 429 TDGTALFASGSPFQPFSFKNSAGQTKTYYPGQGNNMYVFPGIGLGTILSKAVEVTDSMIY 488

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP ++RIR VS               + R+K I E+   D
Sbjct: 489 ASAQALANTLTPEELDHGLLYPDLTRIREVSVVVARGVIRAAQEANVDREKGIRELSDED 548

Query: 478 IEVLKTRKGKEWDNLVKFVQENMWDPDSE 506
           ++               +++  M+ P SE
Sbjct: 549 LD--------------SWIKSKMYAPHSE 563



>gi|485923371|gb|EOD48553.1| putative nadp-dependent malic enzyme protein [Neofusicoccum parvum
           UCRNP2]
          Length = 585

 Score =  440 bits (1132), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 237/506 (46%), Positives = 319/506 (63%), Gaps = 34/506 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR++   ++EITPLIYTPTVG ACL++  I         P+G+YLS  D  NL  
Sbjct: 91  NVHLFYRLLSENIKEITPLIYTPTVGEACLKWHEIYT------QPEGMYLSYADRGNLHA 144

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I   ++ +P++     +I V+TDGSRILGLGDLGVNGMGIPVGKL LY A AGI P  TL
Sbjct: 145 I---FQHWPHN----VEITVLTDGSRILGLGDLGVNGMGIPVGKLALYTACAGIRPDATL 197

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGTNN+   +D  Y+G R +++  ++   F+D +M +L + +P ++IQFEDF  +
Sbjct: 198 PLTLDLGTNNKALREDPLYMGSRREKITPEEEREFLDELMAALTERWPGIVIQFEDF--K 255

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L +Y+     FNDD+QGTGAV+++GFINAVK     V    HR +F         
Sbjct: 256 NPFPALERYQNTYTMFNDDVQGTGAVIVAGFINAVKAAGIPVR--DHRAIFLGAGSAGTG 313

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ++EFF ++ G++E+EA+R  W VD+ GLVT DRGD LA+HKVYFARDDN+G Q ++
Sbjct: 314 VAKQIVEFF-IKEGLTEDEARRKFWFVDSNGLVTNDRGDKLAEHKVYFARDDNNGKQIQS 372

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L  +IE+VKPT L+GLS+ GG F ++II+RMA+LN++PIIFPLSNP   +EC FEDA+K 
Sbjct: 373 LTRLIEFVKPTILMGLSTIGGAFTKEIISRMAQLNEHPIIFPLSNPSSKSECNFEDAVKY 432

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           TD +V+FASG+ FP   V   GKT  PGQGNNMY+FPG+GLGAIL+K   +T   IY   
Sbjct: 433 TDGKVLFASGSPFP--NVNFAGKTLVPGQGNNMYVFPGIGLGAILSKAVNVTQDMIYASA 490

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YP + RIR VS              G+ R+  +  +    +E 
Sbjct: 491 VALSESLTPEERAQGWLYPDIRRIRDVSVVVTRGVIRAAQENGVDRELALRNLDDAGLEA 550

Query: 481 LKTRKGKEWDNLVKFVQENMWDPDSE 506
                         +++E M+DP SE
Sbjct: 551 --------------YIKERMYDPFSE 562



>gi|121698222|ref|XP_001267753.1| malic enzyme [Aspergillus clavatus NRRL 1]
 gi|119395895|gb|EAW06327.1| malic enzyme [Aspergillus clavatus NRRL 1]
          Length = 597

 Score =  440 bits (1131), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 238/510 (46%), Positives = 314/510 (61%), Gaps = 36/510 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR++   L+E+TPLIYTP VG AC  +S I         P+G+YLS  D  NL  
Sbjct: 86  NVHLFYRLITDHLKELTPLIYTPVVGEACQRWSEIYQ------QPEGMYLSWEDRGNLAA 139

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I  + P P       +I  ITDGSRILGLGDLG+NGMGIP+GKL LY A AGI P  TL
Sbjct: 140 VIANW-PQP-----NVEITCITDGSRILGLGDLGINGMGIPIGKLALYTACAGIRPEVTL 193

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT+N+   +D  Y+G R  ++  ++   F+D +M +L + +P ++IQFEDF  +
Sbjct: 194 PLTLDLGTSNKTLREDPLYMGTRRDKISPEEDREFMDELMAALTERWPGIVIQFEDF--K 251

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTK-HRLLFFXXXXXXX 239
           + F  L +YR+   CFNDDIQGTGAV+L G INAV+   +   P K HR +FF       
Sbjct: 252 NPFPALERYRDTYTCFNDDIQGTGAVILGGVINAVR---RSGLPCKEHRAVFFGAGSAGV 308

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK 299
              KQ++ FF  E GM+E+EA+   +LVDTKGLVT DRGD LA HKVYFAR DNDG Q K
Sbjct: 309 GVAKQIVAFFMRE-GMTEDEARACFYLVDTKGLVTADRGDRLADHKVYFARTDNDGQQLK 367

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
           TL+EV+++VKPT L+GLS+ GGVF  +I+++MA+ N +PIIFPLSNP   +EC FE A+ 
Sbjct: 368 TLDEVVDHVKPTILMGLSTLGGVFTPQILSKMADWNTHPIIFPLSNPSSKSECDFESAIT 427

Query: 360 GTDNRVIFASGTAFPEYTVPETG---KTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQI 416
            TD R +FASG+ F  ++   +    +T YPGQGNNMY+FPG+GLG IL+K   +TD+ I
Sbjct: 428 HTDGRALFASGSPFQPFSFKNSAGETQTYYPGQGNNMYVFPGIGLGTILSKAVKVTDEMI 487

Query: 417 YIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQN 476
           Y                    YP ++RIR VS              G+ R+  +  M  N
Sbjct: 488 YASGAAISQALTAEEIDRGLLYPDLTRIRQVSIVVARRVIRAAQEAGVDRETPLRTM--N 545

Query: 477 DIEVLKTRKGKEWDNLVKFVQENMWDPDSE 506
           D            DNL  +++  M+D  SE
Sbjct: 546 D------------DNLDAWIKARMYDAHSE 563



>gi|238493799|ref|XP_002378136.1| NADP-dependent malic enzyme MaeA [Aspergillus flavus NRRL3357]
 gi|220696630|gb|EED52972.1| NADP-dependent malic enzyme MaeA [Aspergillus flavus NRRL3357]
 gi|391869493|gb|EIT78690.1| NADP+-dependent malic enzyme [Aspergillus oryzae 3.042]
          Length = 658

 Score =  439 bits (1129), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 239/511 (46%), Positives = 314/511 (61%), Gaps = 38/511 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+V   L E+TPLIYTP VG AC  +S I         P+G+YLS  D  NL  
Sbjct: 149 NVHLFYRLVTDHLRELTPLIYTPVVGEACQRWSEIYQ------QPEGMYLSWEDRGNLAA 202

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I  + P P       +I  ITDGSRILGLGDLG+NGMGIP+GKL LY A AGI P  TL
Sbjct: 203 VIANW-PQP-----NVEITCITDGSRILGLGDLGINGMGIPIGKLALYTACAGIRPEATL 256

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT+N+   +D  Y+G R  ++  ++   F+D +M +L + +P ++IQFEDF  +
Sbjct: 257 PLTLDLGTSNKTLREDPLYMGSRRDKITPEEEREFMDELMSALTERWPGIVIQFEDF--K 314

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTK-HRLLFFXXXXXXX 239
           + F  L +YR+   CFNDDIQGTGAV+L G INAVK   +   P K HR +FF       
Sbjct: 315 NPFPALERYRDIYTCFNDDIQGTGAVILGGVINAVK---RSGLPCKDHRAVFFGAGSAGV 371

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK 299
              KQ++ FF  E GM+E+EA+   +LVDTKGLVT DRGD LA+HKVYFAR+DN+G Q+K
Sbjct: 372 GVAKQIVAFFMRE-GMTEDEARSCFYLVDTKGLVTNDRGDKLAEHKVYFAREDNEGQQYK 430

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
           TLEEV++YVKPT L+GLS+ GGVF  +I+ +MA+ N  PIIFPLSNP   +EC FE A+ 
Sbjct: 431 TLEEVVDYVKPTILMGLSTIGGVFTPEILRKMADWNTAPIIFPLSNPSSKSECDFETAIT 490

Query: 360 GTDNRVIFASGTAFPEYTVPETG---KTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQI 416
            TD R +FASG+ F  ++   +    +T YPGQGNNMY+FPG+GLG IL+K   ITD  I
Sbjct: 491 HTDGRALFASGSPFQPFSFTNSAGETRTYYPGQGNNMYVFPGIGLGTILSKAVKITDSMI 550

Query: 417 YIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQN 476
           Y                    YP ++RIR VS               +   +++I   Q 
Sbjct: 551 YASGAALSQALTAEEIERGLLYPDLTRIRQVS---------------VVVTRKVIRAAQE 595

Query: 477 D-IEVLKTRKGKEWDNLVKFVQENMWDPDSE 506
           D ++     +    D L  +++  M+D  SE
Sbjct: 596 DKVDRETALRSMNDDALDAWIKARMYDAHSE 626



>gi|358369780|dbj|GAA86393.1| malic enzyme [Aspergillus kawachii IFO 4308]
          Length = 596

 Score =  439 bits (1128), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 237/510 (46%), Positives = 311/510 (60%), Gaps = 36/510 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+V   L E+TPLIYTP VG AC  +S I         P+G+YLS  D  NL  
Sbjct: 84  NVHLFYRLVTDHLRELTPLIYTPVVGEACQRWSEIYQ------QPEGMYLSWEDRGNLAA 137

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I  + P P       +I  ITDGSRILGLGDLG+NGMGIP+GKL LY A AGI P  TL
Sbjct: 138 VIANW-PQP-----NVEITCITDGSRILGLGDLGINGMGIPIGKLALYTACAGIRPEATL 191

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT+N+   +D  Y+G R  +V  ++   F+D +M +L + +P ++IQFEDF  +
Sbjct: 192 PLTLDLGTSNKAFREDPLYMGSRRDKVTPEEEREFLDELMAALTERWPGIVIQFEDF--K 249

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTK-HRLLFFXXXXXXX 239
           + F  L +YR+N  CFNDDIQGTGAV+L G INAVK   +   P K HR +FF       
Sbjct: 250 NPFPALERYRDNYTCFNDDIQGTGAVILGGVINAVK---RSGLPCKDHRAVFFGAGSAGV 306

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK 299
              KQ+++FF V  GM+E+EA+   +LVDTKGLVT DRGD LA HKVYFAR DN+G Q K
Sbjct: 307 GVAKQIVDFF-VREGMTEDEARACFYLVDTKGLVTADRGDKLADHKVYFARTDNNGLQLK 365

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
           TLE+V+++VKPT L+GLS+ GGVF  +++ +MAE N  PI+FPLSNP   +EC +E A+ 
Sbjct: 366 TLEDVVDHVKPTILMGLSTIGGVFTPELLRKMAEWNTAPIVFPLSNPSHKSECDYESAVT 425

Query: 360 GTDNRVIFASGTAFPEYTVPETG---KTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQI 416
            TD RV+FASG+ FP  +   T    +T YPGQGNNMY+FPG+GLG IL+K   +TD  I
Sbjct: 426 NTDGRVLFASGSPFPPMSYTNTAGETRTYYPGQGNNMYVFPGIGLGTILSKSVKVTDSMI 485

Query: 417 YIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQN 476
           Y                    YP ++RIR VS               + R+  +  M   
Sbjct: 486 YASGEALSKALLPEEIERGLLYPDLTRIREVSVVVARNVIRAAQEAKVDRETALRSMSD- 544

Query: 477 DIEVLKTRKGKEWDNLVKFVQENMWDPDSE 506
                        +NL  +++  M++P +E
Sbjct: 545 -------------ENLDAWIKARMYNPHTE 561



>gi|452981088|gb|EME80848.1| hypothetical protein MYCFIDRAFT_140451 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 597

 Score =  439 bits (1128), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 236/506 (46%), Positives = 316/506 (62%), Gaps = 34/506 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR++   ++E+TPLIYTPTVG AC  +S +         P+GLYLS  D  +L  
Sbjct: 76  NVHLFYRLLSENIKELTPLIYTPTVGEACQRWSELYT------QPEGLYLSYEDKGHLHS 129

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+ +   P+D     +I V+TDGSRILGLGDLGVNGMGIPVGKL LY A AGI P RTL
Sbjct: 130 VIQNW---PHD----VEITVVTDGSRILGLGDLGVNGMGIPVGKLSLYTACAGIHPLRTL 182

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ LDLGT+NE +  D  YLG R  +V  ++   F+D +M +L + +P ++IQ+EDF  +
Sbjct: 183 PLCLDLGTSNEASRNDPLYLGSRRPKVTAEEEKEFLDEMMAALTERWPSIVIQYEDF--K 240

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L +Y++    FNDDIQGTGAV+L GFINAVK  +  V P   R +F         
Sbjct: 241 NPFPSLERYQDTYTMFNDDIQGTGAVILGGFINAVK--QSGVAPADQRAVFLGAGSAGVG 298

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL EFF ++ G+SE+EA++  WLVD++G+V LDR   LA+HK+YFARDDN+G Q+KT
Sbjct: 299 VAKQLTEFF-MKEGLSEDEARKRFWLVDSQGMVALDRPGKLAEHKLYFARDDNNGQQYKT 357

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           LEEV+EYVKPT L+GLS+ GG F  KI+ RMAELN  P+IFPLSNP   +ECTFE+A+K 
Sbjct: 358 LEEVVEYVKPTILMGLSTIGGAFTPKILERMAELNDKPVIFPLSNPSSKSECTFEEAIKY 417

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           T  + +FASG+ FP  T+   GK   PGQGNNMY+FPG+GLGAIL+K   +T   IY   
Sbjct: 418 TKGKCLFASGSPFP--TLNWEGKDLTPGQGNNMYVFPGIGLGAILSKSVNVTQNMIYASA 475

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YP + RIR VS              G+ R+  +  +   +++ 
Sbjct: 476 EGLSTSLLPSEVADNWLYPDIRRIREVSVVVTRVVIRAAQKDGMDRELALRNLSDEELD- 534

Query: 481 LKTRKGKEWDNLVKFVQENMWDPDSE 506
                        ++++  M+DP +E
Sbjct: 535 -------------EYIRARMYDPFTE 547



>gi|119480619|ref|XP_001260338.1| malic enzyme [Neosartorya fischeri NRRL 181]
 gi|119408492|gb|EAW18441.1| malic enzyme [Neosartorya fischeri NRRL 181]
          Length = 598

 Score =  439 bits (1128), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 237/510 (46%), Positives = 313/510 (61%), Gaps = 36/510 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+V   L+E+TPLIYTP VG AC ++S I         P+G+YLS  D  NL  
Sbjct: 86  NVHLFYRLVTDHLKELTPLIYTPVVGEACQKWSEIYQ------QPEGMYLSWEDRGNLAA 139

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I  + P P       +I  ITDGSRILGLGDLG+NGMGIP+GKL LY A AGI P  TL
Sbjct: 140 VIANW-PQP-----NVEITCITDGSRILGLGDLGINGMGIPIGKLALYTACAGIRPEATL 193

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT+N+   +D  Y+G R  ++  ++   F+D +M +L + +P ++IQFEDF  +
Sbjct: 194 PLTLDLGTSNKALREDPLYMGTRRDKISPEEEREFMDELMAALTERWPGIVIQFEDF--K 251

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTK-HRLLFFXXXXXXX 239
           + F  L +YR+   CFNDDIQGTGAV+L G INAVK   +   P K HR +F        
Sbjct: 252 NPFPALERYRDVYTCFNDDIQGTGAVILGGVINAVK---RSGLPCKEHRAVFLGAGSAGV 308

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK 299
              KQ++ FF  E GM+E+EA+   +LVDTKGLVT DRGD LA HKVYFAR DN+G QFK
Sbjct: 309 GVAKQIVAFFMRE-GMTEDEARSCFYLVDTKGLVTADRGDKLADHKVYFARTDNNGQQFK 367

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
           TL+EV+++VKPT L+GLS+ GGVF  +I+ +MA+ N +PIIFPLSNP   +EC FE A+ 
Sbjct: 368 TLDEVVDHVKPTILMGLSTLGGVFTPEILRKMADWNTHPIIFPLSNPSSKSECDFESAIT 427

Query: 360 GTDNRVIFASGTAFPEYTVPETG---KTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQI 416
            TD R +FASG+ F  ++   +     T YPGQGNNMY+FPG+GLG IL+K   +TD+ I
Sbjct: 428 HTDGRALFASGSPFQPFSFKNSSGETHTYYPGQGNNMYVFPGIGLGTILSKAVKVTDEMI 487

Query: 417 YIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQN 476
           Y                    YP ++RIR VS              G+ R+  +  M   
Sbjct: 488 YASGAALSQALTAEEIDLGLLYPDLTRIRQVSIVVARKVIRAAQDAGVDRETSLRSM--- 544

Query: 477 DIEVLKTRKGKEWDNLVKFVQENMWDPDSE 506
                      + +NL  +++  M+DP SE
Sbjct: 545 -----------DDENLDAWIKARMYDPHSE 563



>gi|343427509|emb|CBQ71036.1| related to NADP-dependent malic enzyme [Sporisorium reilianum SRZ2]
          Length = 606

 Score =  439 bits (1128), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 228/473 (48%), Positives = 299/473 (63%), Gaps = 19/473 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  L+Y  ++   EEI PLIYTPTVG AC ++SHI         P+GL +SL D   +  
Sbjct: 116 NTRLYYATILANKEEILPLIYTPTVGEACQKFSHIYRR------PEGLSISLEDKGQIAS 169

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I++ + P P     +P+IAVITDGSRILGLGDLG NG GI +GKL LYVA AGI PR TL
Sbjct: 170 IVENW-PVPAG---SPRIAVITDGSRILGLGDLGWNGQGISIGKLSLYVAGAGIHPRATL 225

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI +DLGTNN+K L+D  YLGLR +R   +++  F+D VM +L   YP L+IQFEDF+SE
Sbjct: 226 PIVVDLGTNNKKILEDPLYLGLRRERATTEEYIEFMDEVMDALHSRYPNLIIQFEDFTSE 285

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKD----VHPTKHRLLFFXXXX 236
           +AF  L +Y++    FNDDIQGTG+V+L+GF NA ++  K+    +H   HR+L      
Sbjct: 286 NAFRFLKRYQDKYPMFNDDIQGTGSVILAGFTNAARIASKESGRPLH--DHRILMAGAGS 343

Query: 237 XXXXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGN 296
                 KQL+ FF    G+SE+EA+  +++ D+KGLVT DRGD LA+HKV+FARDDN+G 
Sbjct: 344 AAVGVGKQLMSFF-TRQGLSEDEARERIFITDSKGLVTKDRGDKLAEHKVFFARDDNEGK 402

Query: 297 QFKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFED 356
           Q   L E+I+YVKPTA++GLS+  G F+E +I +MA LNK PIIFPLSNP  N+ECTFE+
Sbjct: 403 QINDLAEIIDYVKPTAILGLSTIKGTFDETVIRKMATLNKRPIIFPLSNPTDNSECTFEE 462

Query: 357 AMKGTDNRVIFASGTAFPEYT--VPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDK 414
           A++ TD RV+FA+G+ F E       TG+   PGQGNN  +FPG+GL A L K   +T++
Sbjct: 463 AVRYTDGRVLFAAGSPFAEIDAGASPTGQRMIPGQGNNFLVFPGIGLCAALCKASRVTNE 522

Query: 415 QIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARD 467
            I                     YP   RIR +S              G+ RD
Sbjct: 523 MITESALALSDALSDEERAEGRLYPNTERIREISRDIAVRCIQMANKQGVTRD 575



>gi|350636788|gb|EHA25146.1| hypothetical protein ASPNIDRAFT_211661 [Aspergillus niger ATCC
           1015]
          Length = 665

 Score =  438 bits (1127), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 236/510 (46%), Positives = 311/510 (60%), Gaps = 36/510 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+V   L E+TPLIYTP VG AC  +S I         P+G+YLS  D  NL  
Sbjct: 153 NVHLFYRLVTDHLRELTPLIYTPVVGEACQRWSEIY------QQPEGMYLSWEDRGNLAA 206

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I  + P P       +I  ITDGSRILGLGDLG+NGMGIP+GKL LY A AGI P  TL
Sbjct: 207 VIANW-PQP-----NVEITCITDGSRILGLGDLGINGMGIPIGKLALYTACAGIRPEATL 260

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT+N+   +D  Y+G R  +V  ++   F+D +M +L + +P ++IQFEDF  +
Sbjct: 261 PLTLDLGTSNKAFREDPLYMGSRRDKVTPEEEREFLDELMAALTERWPGIVIQFEDF--K 318

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTK-HRLLFFXXXXXXX 239
           + F  L +YR+N  CFNDDIQGTGAV+L G INAVK   +   P K HR +FF       
Sbjct: 319 NPFPALERYRDNYTCFNDDIQGTGAVILGGVINAVK---RSGLPCKDHRAVFFGAGSAGV 375

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK 299
              KQ+++FF V  GM+E+EA+   +LVDTKGLVT DRGD LA HKVYFAR DN+G Q K
Sbjct: 376 GVAKQIVDFF-VREGMTEDEARACFYLVDTKGLVTADRGDKLADHKVYFARTDNNGLQLK 434

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
           TLE+V+++VKPT L+GLS+ GGVF  +++ +MAE N  PI+FPLSNP   +EC +E A+ 
Sbjct: 435 TLEDVVDHVKPTILMGLSTIGGVFTPELLRKMAEWNTAPIVFPLSNPSHKSECDYESAVT 494

Query: 360 GTDNRVIFASGTAFPEYTVPETG---KTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQI 416
            TD RV+FASG+ FP  +   +    +T YPGQGNNMY+FPG+GLG IL+K   +TD  I
Sbjct: 495 NTDGRVLFASGSPFPPMSYTNSAGETRTYYPGQGNNMYVFPGIGLGTILSKSVKVTDSMI 554

Query: 417 YIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQN 476
           Y                    YP ++RIR VS               + R+  +  M   
Sbjct: 555 YASGEALSKALLPEEIERGLLYPDLTRIREVSVVVARNVIRAAQEAKVDRETALRTMSD- 613

Query: 477 DIEVLKTRKGKEWDNLVKFVQENMWDPDSE 506
                        +NL  +++  M++P +E
Sbjct: 614 -------------ENLDAWIKARMYNPHTE 630



>gi|325088515|gb|EGC41825.1| NADP-dependent malic enzyme MaeA [Ajellomyces capsulatus H88]
          Length = 605

 Score =  438 bits (1127), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 236/509 (46%), Positives = 312/509 (61%), Gaps = 31/509 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+V+  L+E+TPLIYTP VG AC  +S I  +  P G   G+Y+S  D  N+  
Sbjct: 84  NVHLFYRLVVDHLKELTPLIYTPVVGEACQRWSEI--YQQPEGCL-GMYISYEDRGNIAA 140

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+ + P P+ D     I VITDGSRILGLGDLG+NGMGIP+GKL LY A AGI P  TL
Sbjct: 141 VIQNW-PQPHVD-----ITVITDGSRILGLGDLGINGMGIPIGKLALYTACAGIRPEATL 194

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT+N+   +D  YLG R  +V  +Q   F+D +M +L + +P ++IQFEDF  +
Sbjct: 195 PLTLDLGTSNKALREDPLYLGSRRNKVSPEQELEFMDELMTALTEKWPGVVIQFEDF--K 252

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L +YR    CFNDDIQGTGAV+L+G INAVK  +  +   +H+ +F         
Sbjct: 253 NPFPALERYRHRFTCFNDDIQGTGAVILAGVINAVK--QSGIPAKEHKAVFLGAGSAGVG 310

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ+++FF V  GM+E+EAK   +LVDTKGLVT DRGD LA HKVYFAR DN G Q KT
Sbjct: 311 VAKQIVDFF-VREGMTEDEAKACFYLVDTKGLVTADRGDQLASHKVYFARTDNQGLQLKT 369

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L EV+++VKPT L+GLS+ GGVF  +I+  MA  +K PIIFPLSNP  N+EC FE A+  
Sbjct: 370 LSEVVDHVKPTMLMGLSTLGGVFTPEILRSMASFSKRPIIFPLSNPSANSECDFESAIIH 429

Query: 361 TDNRVIFASGTAFPEYTVPETG---KTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
           TD + +FASG+ F  ++   +    KT YPGQGNNMY+FPG+GLG IL+K   +TD  IY
Sbjct: 430 TDGQALFASGSPFQPFSYKNSAGQIKTYYPGQGNNMYVFPGIGLGTILSKAVEVTDSMIY 489

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP ++RIR VS               + R+  I ++   D
Sbjct: 490 ASGEALSKTLTSEELEHGLLYPDLTRIRDVSVIVARGVIRAAQEAKVDRETGIRDLSDAD 549

Query: 478 IEVLKTRKGKEWDNLVKFVQENMWDPDSE 506
           ++               +++  M+ P SE
Sbjct: 550 MDA--------------WIRSKMYAPHSE 564



>gi|317028775|ref|XP_001390670.2| NADP-dependent malic enzyme MaeA [Aspergillus niger CBS 513.88]
          Length = 665

 Score =  438 bits (1127), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 236/510 (46%), Positives = 311/510 (60%), Gaps = 36/510 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+V   L E+TPLIYTP VG AC  +S I         P+G+YLS  D  NL  
Sbjct: 153 NVHLFYRLVTDHLRELTPLIYTPVVGEACQRWSEIY------QQPEGMYLSWEDRGNLAA 206

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I  + P P       +I  ITDGSRILGLGDLG+NGMGIP+GKL LY A AGI P  TL
Sbjct: 207 VIANW-PQP-----NVEITCITDGSRILGLGDLGINGMGIPIGKLALYTACAGIRPEATL 260

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT+N+   +D  Y+G R  +V  ++   F+D +M +L + +P ++IQFEDF  +
Sbjct: 261 PLTLDLGTSNKAFREDPLYMGSRRDKVTPEEEREFLDELMAALTERWPGIVIQFEDF--K 318

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTK-HRLLFFXXXXXXX 239
           + F  L +YR+N  CFNDDIQGTGAV+L G INAVK   +   P K HR +FF       
Sbjct: 319 NPFPALERYRDNYTCFNDDIQGTGAVILGGVINAVK---RSGLPCKDHRAVFFGAGSAGV 375

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK 299
              KQ+++FF V  GM+E+EA+   +LVDTKGLVT DRGD LA HKVYFAR DN+G Q K
Sbjct: 376 GVAKQIVDFF-VREGMTEDEARACFYLVDTKGLVTADRGDKLADHKVYFARTDNNGLQLK 434

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
           TLE+V+++VKPT L+GLS+ GGVF  +++ +MAE N  PI+FPLSNP   +EC +E A+ 
Sbjct: 435 TLEDVVDHVKPTILMGLSTIGGVFTPELLRKMAEWNTAPIVFPLSNPSHKSECDYESAVT 494

Query: 360 GTDNRVIFASGTAFPEYTVPETG---KTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQI 416
            TD RV+FASG+ FP  +   +    +T YPGQGNNMY+FPG+GLG IL+K   +TD  I
Sbjct: 495 NTDGRVLFASGSPFPPMSYTNSAGETRTYYPGQGNNMYVFPGIGLGTILSKSVKVTDSMI 554

Query: 417 YIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQN 476
           Y                    YP ++RIR VS               + R+  +  M   
Sbjct: 555 YASGEALSKALLPEEIERGLLYPDLTRIREVSVVVARNVIRAAQEAKVDRETALRTMSD- 613

Query: 477 DIEVLKTRKGKEWDNLVKFVQENMWDPDSE 506
                        +NL  +++  M++P +E
Sbjct: 614 -------------ENLDAWIKARMYNPHTE 630



>gi|452004771|gb|EMD97227.1| hypothetical protein COCHEDRAFT_1209085 [Bipolaris maydis C5]
 gi|477587230|gb|ENI04312.1| hypothetical protein COCC4DRAFT_41102 [Bipolaris maydis ATCC 48331]
          Length = 581

 Score =  438 bits (1126), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 237/523 (45%), Positives = 322/523 (61%), Gaps = 37/523 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR++   ++E+TPLIYTPTVG ACL +  I         P+G+YLS +D  NL +
Sbjct: 76  NVHLFYRLLGENIKELTPLIYTPTVGEACLRWHEIWT------QPEGMYLSWSDRGNLRK 129

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+  + P+  D      I V+TDGSRILGLGDLGVNGMGIPVGKL LY A AGI P  TL
Sbjct: 130 ILDNW-PHEVD------ITVLTDGSRILGLGDLGVNGMGIPVGKLALYTACAGIKPDSTL 182

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGTNN+    D  Y+G R  +V  +Q   F+D +M +L   +P ++IQFEDF  +
Sbjct: 183 PLTLDLGTNNKALRDDPLYMGSRMPKVTPEQEKEFLDELMVALTDRWPSIVIQFEDF--K 240

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L +Y+     FNDD+QGTGAV++ GFINAV+     V    HR +F         
Sbjct: 241 NPFPALERYQNQYSMFNDDVQGTGAVIVGGFINAVR--ASGVPAKDHRAIFLGAGSAGVG 298

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ++E+F ++ G++EEEA+R  W VD+ GLVTLDRGD LA HKVYFARDDN G Q+++
Sbjct: 299 VAKQIVEYF-IKEGLTEEEARRKFWFVDSNGLVTLDRGDKLADHKVYFARDDNSGRQYQS 357

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L  +I+YV+PT L+GLS+ GG FN+ I+ +MA LN  PIIFPLSNP   +ECTFE+A+  
Sbjct: 358 LSRLIDYVQPTILMGLSTIGGAFNKDILEKMASLNNRPIIFPLSNPSSKSECTFEEAVLA 417

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           T+ R +FASG+ FP  ++   GK   PGQGNNMY+FPG+GLGAIL+K   IT   IY   
Sbjct: 418 TEGRCLFASGSPFP--SMEYDGKLLTPGQGNNMYVFPGIGLGAILSKAVSITQDMIYASA 475

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YP + RIR VS              G+ R  ++ +M    ++ 
Sbjct: 476 EYLSTSLNRQEVADGWLYPDIRRIREVSVVVTRGVIRAAQKNGVDRTVELRDMSDEQLD- 534

Query: 481 LKTRKGKEWDNLVKFVQENMWDPDSE-KFFNTE--ELLSKSKM 520
                         F++++M+DP +E ++F+ +  +L+S  K+
Sbjct: 535 -------------DFIKKSMYDPHTENQYFDRKMSQLVSSEKL 564



>gi|226293734|gb|EEH49154.1| malic enzyme [Paracoccidioides brasiliensis Pb18]
          Length = 628

 Score =  437 bits (1125), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 234/509 (45%), Positives = 310/509 (60%), Gaps = 34/509 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+V+  L+E+TPLIYTP VG AC  +S I         P+G+Y+S  D  N+  
Sbjct: 115 NVHLFYRLVVDHLKELTPLIYTPVVGEACQRWSEIYQG------PEGMYISYEDRGNIAA 168

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+ + P P+      +I  ITDGSRILGLGDLG+NGMGIP+GKL LY A AGI P  TL
Sbjct: 169 VIENW-PQPH-----VEITCITDGSRILGLGDLGINGMGIPIGKLALYTACAGIRPETTL 222

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT+N+   ++  Y+G R  +V  +Q   F+D +M +L + +P ++IQFEDF  +
Sbjct: 223 PLTLDLGTSNKALRENPLYMGSRRDKVTPEQELEFMDELMTALTEKWPGIVIQFEDF--K 280

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L +YR    CFNDDIQGTGAV+L+G INAVK  +  +   KH+ +F         
Sbjct: 281 NPFPALERYRHRFTCFNDDIQGTGAVILAGVINAVK--QSGIPTRKHKAVFLGAGSAGVG 338

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ+++FF  E GM+E+EAK   +LVDTKGLVT DRGD LA HKVYFAR DN G Q KT
Sbjct: 339 VAKQIVDFFMYE-GMTEDEAKACFYLVDTKGLVTADRGDKLAPHKVYFARTDNHGLQLKT 397

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L EV+E+VKPT L+GLS+ GGVF  +I+ +M+  NK PIIFPLSNP  N+EC FE A+  
Sbjct: 398 LNEVVEHVKPTMLMGLSTLGGVFTPQILKKMSTYNKRPIIFPLSNPSANSECDFESAVTH 457

Query: 361 TDNRVIFASGTAFPEYTVPETG---KTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
           TD   +FASG+ F  ++   +    KT YPGQGNNMY+FPG+GLG IL+K   +TD  IY
Sbjct: 458 TDGTALFASGSPFQPFSFKNSAGQTKTYYPGQGNNMYVFPGIGLGTILSKAVKVTDSMIY 517

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP ++RIR VS               + R+  I E+   D
Sbjct: 518 ASAQALANTLTPEELDHGLLYPDLTRIRKVSIVVARGVIRAAQEANVDRETGIRELSDED 577

Query: 478 IEVLKTRKGKEWDNLVKFVQENMWDPDSE 506
           ++               +++  M+ P SE
Sbjct: 578 LD--------------SWIKSKMYSPHSE 592



>gi|255935719|ref|XP_002558886.1| Pc13g04510 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211583506|emb|CAP91520.1| Pc13g04510 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 602

 Score =  437 bits (1124), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 238/510 (46%), Positives = 314/510 (61%), Gaps = 36/510 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+V   L E+TPLIYTP VG AC ++S I         P+G+YLS  D  NL  
Sbjct: 89  NVHLFYRLVTDHLRELTPLIYTPVVGEACQKWSEIYQ------QPEGMYLSWEDRGNLAS 142

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I  +   P  +    +I  ITDGSRILGLGDLG+NGMGIP+GKL LY A AGI P  TL
Sbjct: 143 VIANW---PESNV---EITCITDGSRILGLGDLGINGMGIPIGKLALYTACAGIRPEATL 196

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT N+   +D  Y+G R  +V  ++   F+D +M +L + +P ++IQFEDF  +
Sbjct: 197 PLTLDLGTGNKALREDPLYMGSRRDKVSPEEEREFLDELMAALTERWPGIVIQFEDF--K 254

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTK-HRLLFFXXXXXXX 239
           + F  L +YR+   CFNDDIQGTGAV+L G INAVK   +   P K HR +FF       
Sbjct: 255 NPFPALERYRDMYTCFNDDIQGTGAVILGGVINAVK---RSGLPCKDHRAVFFGAGSAGV 311

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK 299
              +Q++EFF  E GM+E+EA+   +LVDTKGLVT DRGD LA HKVYFAR DN+G Q+K
Sbjct: 312 GVARQIVEFFMRE-GMTEDEARNCFYLVDTKGLVTADRGDKLADHKVYFARRDNNGEQYK 370

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
           TL+EV+++VKP+ L+GLS+ GGVF  +I+ +MA+ N  P+IFPLSNP   +EC FE A+ 
Sbjct: 371 TLDEVVDHVKPSILMGLSTMGGVFTPEILRKMADWNTAPLIFPLSNPSSKSECDFETAIA 430

Query: 360 GTDNRVIFASGTAFPEYTVPETG---KTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQI 416
            TD R +FASG+ FP  T   +    +T YPGQGNNMY+FPG+GLG+IL+K   +TD  I
Sbjct: 431 NTDGRCLFASGSPFPNCTFTNSAGETRTYYPGQGNNMYVFPGIGLGSILSKAVRVTDSMI 490

Query: 417 YIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQN 476
           Y                    YP ++RIR VS               +  D++I     +
Sbjct: 491 YASGEALSAALNGEELERGLLYPDITRIREVSVVVTRKVMRAAQEDKV--DREIALRSLS 548

Query: 477 DIEVLKTRKGKEWDNLVKFVQENMWDPDSE 506
           D+E+         DN +K     M+DP +E
Sbjct: 549 DVEL---------DNWIK---ARMYDPHTE 566



>gi|134075120|emb|CAK39130.1| unnamed protein product [Aspergillus niger]
          Length = 596

 Score =  437 bits (1124), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 236/510 (46%), Positives = 311/510 (60%), Gaps = 36/510 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+V   L E+TPLIYTP VG AC  +S I         P+G+YLS  D  NL  
Sbjct: 84  NVHLFYRLVTDHLRELTPLIYTPVVGEACQRWSEIYQ------QPEGMYLSWEDRGNLAA 137

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I  + P P       +I  ITDGSRILGLGDLG+NGMGIP+GKL LY A AGI P  TL
Sbjct: 138 VIANW-PQP-----NVEITCITDGSRILGLGDLGINGMGIPIGKLALYTACAGIRPEATL 191

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT+N+   +D  Y+G R  +V  ++   F+D +M +L + +P ++IQFEDF  +
Sbjct: 192 PLTLDLGTSNKAFREDPLYMGSRRDKVTPEEEREFLDELMAALTERWPGIVIQFEDF--K 249

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTK-HRLLFFXXXXXXX 239
           + F  L +YR+N  CFNDDIQGTGAV+L G INAVK   +   P K HR +FF       
Sbjct: 250 NPFPALERYRDNYTCFNDDIQGTGAVILGGVINAVK---RSGLPCKDHRAVFFGAGSAGV 306

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK 299
              KQ+++FF V  GM+E+EA+   +LVDTKGLVT DRGD LA HKVYFAR DN+G Q K
Sbjct: 307 GVAKQIVDFF-VREGMTEDEARACFYLVDTKGLVTADRGDKLADHKVYFARTDNNGLQLK 365

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
           TLE+V+++VKPT L+GLS+ GGVF  +++ +MAE N  PI+FPLSNP   +EC +E A+ 
Sbjct: 366 TLEDVVDHVKPTILMGLSTIGGVFTPELLRKMAEWNTAPIVFPLSNPSHKSECDYESAVT 425

Query: 360 GTDNRVIFASGTAFPEYTVPETG---KTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQI 416
            TD RV+FASG+ FP  +   +    +T YPGQGNNMY+FPG+GLG IL+K   +TD  I
Sbjct: 426 NTDGRVLFASGSPFPPMSYTNSAGETRTYYPGQGNNMYVFPGIGLGTILSKSVKVTDSMI 485

Query: 417 YIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQN 476
           Y                    YP ++RIR VS               + R+  +  M   
Sbjct: 486 YASGEALSKALLPEEIERGLLYPDLTRIREVSVVVARNVIRAAQEAKVDRETALRTMSD- 544

Query: 477 DIEVLKTRKGKEWDNLVKFVQENMWDPDSE 506
                        +NL  +++  M++P +E
Sbjct: 545 -------------ENLDAWIKARMYNPHTE 561



>gi|154274203|ref|XP_001537953.1| hypothetical protein HCAG_07375 [Ajellomyces capsulatus NAm1]
 gi|150415561|gb|EDN10914.1| hypothetical protein HCAG_07375 [Ajellomyces capsulatus NAm1]
          Length = 587

 Score =  437 bits (1124), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 237/509 (46%), Positives = 311/509 (61%), Gaps = 34/509 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+V+  L+E+TPLIYTP VG AC  +S I         P+G+Y+S  D  N+  
Sbjct: 84  NVHLFYRLVVDHLKELTPLIYTPVVGEACQRWSEIYQ------QPEGMYISYEDRGNIAA 137

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+ + P P+ D     I VITDGSRILGLGDLG+NGMGIP+GKL LY A AGI P  TL
Sbjct: 138 VIQNW-PQPHVD-----ITVITDGSRILGLGDLGINGMGIPIGKLALYTACAGIRPEATL 191

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT+N+   +D  YLG R  +V  +Q   F+D +M +L + +P ++IQFEDF  +
Sbjct: 192 PLTLDLGTSNKALREDPLYLGSRRNKVSPEQELEFMDELMTALTEKWPGVVIQFEDF--K 249

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L +YR    CFNDDIQGTGAV+L+G INAVK  +  +   +H+ +F         
Sbjct: 250 NPFPALERYRHRFTCFNDDIQGTGAVILAGVINAVK--QSGIPAKEHKAVFLGAGSAGVG 307

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ+++FF V  GM+E EAK   +LVDTKGLVT DRGD LA HKVYFAR DN G Q KT
Sbjct: 308 VAKQIVDFF-VREGMTEAEAKACFYLVDTKGLVTADRGDQLASHKVYFARTDNQGLQLKT 366

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L EV+++VKPT L+GLS+ GGVF  +I+  MA  +K PIIFPLSNP  N+EC FE A+  
Sbjct: 367 LSEVVDHVKPTMLMGLSTLGGVFTPEILRSMASFSKRPIIFPLSNPSANSECDFESAIIH 426

Query: 361 TDNRVIFASGTAFPEYTVP-ETG--KTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
           TD + +FASG+ F  ++    TG  KT YPGQGNNMY+FPG+GLG IL+K   +TD  IY
Sbjct: 427 TDGQALFASGSPFQPFSYKNSTGQIKTYYPGQGNNMYVFPGIGLGTILSKAVEVTDSMIY 486

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP ++RIR VS               + R+  I ++   D
Sbjct: 487 ASGEALSKTLTSEELEHGLLYPDLTRIRDVSVIVARGVIRAAQEAKVDRETGIRDLSDAD 546

Query: 478 IEVLKTRKGKEWDNLVKFVQENMWDPDSE 506
           ++               +++  M+ P SE
Sbjct: 547 MDA--------------WIRSKMYAPHSE 561



>gi|440639467|gb|ELR09386.1| hypothetical protein GMDG_03950 [Geomyces destructans 20631-21]
          Length = 794

 Score =  437 bits (1123), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 226/456 (49%), Positives = 296/456 (64%), Gaps = 24/456 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N+ LFYR++I  +E++ PL+YTPT+G  CL+YS +         P+ LY+S+    ++  
Sbjct: 299 NIDLFYRVLIDNVEQLMPLVYTPTIGDVCLQYSTLYTR------PEALYISIKQRNSIRT 352

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+K + PYP      P I V+TDGSRILGLGDLGVNG+GIP+GKL LY AAAGI P +TL
Sbjct: 353 ILKNW-PYP-----NPSICVVTDGSRILGLGDLGVNGVGIPIGKLALYTAAAGIHPEKTL 406

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GTNNE+NLKD  YLGLR KRV  ++   F+D  M+++  VYP++++QFEDF +E
Sbjct: 407 PIVLDYGTNNEQNLKDPLYLGLRQKRVSVNEAREFMDEFMEAVTDVYPDMVVQFEDFETE 466

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF  L +Y+     FNDDIQGTGAV+L+G+I AV L   +V     +L+F         
Sbjct: 467 KAFAYLERYKHKKV-FNDDIQGTGAVILAGYIGAVNL--SNVPIKDQKLVFMGAGSAGVG 523

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQLLE++    G+++ EAK   +LVDTKGLVT DRGD LA+HK +FAR DN G+QFKT
Sbjct: 524 VAKQLLEYY-TRRGLTDAEAKEKFYLVDTKGLVTKDRGDRLAEHKKFFARHDNAGHQFKT 582

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRM------AELNKNPIIFPLSNPKVNAECTF 354
           LEEVIEYVKPTAL+GL++T GVF + ++  +      +   + PI+FPLSNP   AECTF
Sbjct: 583 LEEVIEYVKPTALVGLTATYGVFTQSVVRALKASVDASGAGRRPILFPLSNPLTKAECTF 642

Query: 355 EDAMKGTDNRVIFASGTAFP--EYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVIT 412
           E A+  TD  V+FASG+ F   E  + +     YP QGNN+YIFPGLGLGAIL K   +T
Sbjct: 643 EQAVTWTDGTVLFASGSPFSAFETKIGDITTIHYPNQGNNVYIFPGLGLGAILGKVSRVT 702

Query: 413 DKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
           D  +Y                    YP +SR+R  S
Sbjct: 703 DDMVYTSAAALSGCLNSEEIAKGLIYPHISRVRDAS 738



>gi|115442968|ref|XP_001218291.1| hypothetical protein ATEG_09669 [Aspergillus terreus NIH2624]
 gi|114188160|gb|EAU29860.1| hypothetical protein ATEG_09669 [Aspergillus terreus NIH2624]
          Length = 657

 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 234/489 (47%), Positives = 306/489 (62%), Gaps = 23/489 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+V   L E+TPLIYTP VG AC  +S I         P+G+YLS  D  NL  
Sbjct: 144 NVHLFYRLVTDHLRELTPLIYTPVVGEACQRWSEIYQ------QPEGMYLSWEDRGNLAA 197

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I  +   P  +    +I  ITDGSRILGLGDLG+NGMGIP+GKL LY A AGI P  TL
Sbjct: 198 VIANW---PQHNV---EITCITDGSRILGLGDLGINGMGIPIGKLALYTACAGIRPEATL 251

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT+N+   +D  Y+G R  +V  ++   F+D +M +L + +P ++IQFEDF  +
Sbjct: 252 PLTLDLGTSNKTLREDPLYMGSRRDKVTPEEEKEFMDELMAALTERWPGIVIQFEDF--K 309

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTK-HRLLFFXXXXXXX 239
           + F  L +YR+   CFNDDIQGTGAV+L G INAVK   +   P K HR +F        
Sbjct: 310 NPFPALERYRDVYTCFNDDIQGTGAVILGGVINAVK---RSGLPCKDHRAVFLGAGSAGV 366

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK 299
              KQ+++FF V  GM+E+EA+   +LVDTKGLVTLDRGD LA HKVYFAR+DN+G QFK
Sbjct: 367 GVAKQIVDFF-VREGMTEDEARACFYLVDTKGLVTLDRGDKLADHKVYFARNDNNGQQFK 425

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
           TLEEV+++VKPT L+GLS+ GGVF  +I+ +MA+ N  PIIFPLSNP   +EC +E A+ 
Sbjct: 426 TLEEVVDHVKPTILMGLSTIGGVFTPEILRKMADWNTRPIIFPLSNPSSKSECDYESAVT 485

Query: 360 GTDNRVIFASGTAFPEYTVPET---GKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQI 416
            TD R +FASG+ F  ++   +    +T YPGQGNNMY+FPG+GLG IL+K   +TD  I
Sbjct: 486 HTDGRCLFASGSPFQPFSFTNSKGETQTYYPGQGNNMYVFPGIGLGTILSKAVKVTDSMI 545

Query: 417 YIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQN 476
           Y                    YP ++RIR VS              G+ R+  +  M   
Sbjct: 546 YASGEALSTALTAEEIDRGLLYPDLTRIRPVSVVVARKVIRAAQEAGVDRETNLRTMSDE 605

Query: 477 DIEV-LKTR 484
            ++  +KTR
Sbjct: 606 ALDAWIKTR 614



>gi|317157399|ref|XP_001826448.2| NADP-dependent malic enzyme MaeA [Aspergillus oryzae RIB40]
          Length = 658

 Score =  436 bits (1122), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 238/511 (46%), Positives = 313/511 (61%), Gaps = 38/511 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+V   L E+TPLIYTP VG AC  +S I         P+G+YLS  D  NL  
Sbjct: 149 NVHLFYRLVTDHLRELTPLIYTPVVGEACQRWSEIYQ------QPEGMYLSWEDRGNLAA 202

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I  + P P       +I  ITDGSRILGLGDLG+NGMGIP+GKL LY A AGI P  TL
Sbjct: 203 VIANW-PQP-----NVEITCITDGSRILGLGDLGINGMGIPIGKLALYTACAGIRPEATL 256

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT+N+   +D  Y+G    ++  ++   F+D +M +L + +P ++IQFEDF  +
Sbjct: 257 PLTLDLGTSNKTLREDPLYMGSNRDKITPEEEREFMDELMSALTERWPGIVIQFEDF--K 314

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTK-HRLLFFXXXXXXX 239
           + F  L +YR+   CFNDDIQGTGAV+L G INAVK   +   P K HR +FF       
Sbjct: 315 NPFPALERYRDIYTCFNDDIQGTGAVILGGVINAVK---RSGLPCKDHRAVFFGAGSAGV 371

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK 299
              KQ++ FF  E GM+E+EA+   +LVDTKGLVT DRGD LA+HKVYFAR+DN+G Q+K
Sbjct: 372 GVAKQIVAFFMRE-GMTEDEARSCFYLVDTKGLVTNDRGDKLAEHKVYFAREDNEGQQYK 430

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
           TLEEV++YVKPT L+GLS+ GGVF  +I+ +MA+ N  PIIFPLSNP   +EC FE A+ 
Sbjct: 431 TLEEVVDYVKPTILMGLSTIGGVFTPEILRKMADWNTAPIIFPLSNPSSKSECDFETAIT 490

Query: 360 GTDNRVIFASGTAFPEYTVPETG---KTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQI 416
            TD R +FASG+ F  ++   +    +T YPGQGNNMY+FPG+GLG IL+K   ITD  I
Sbjct: 491 HTDGRALFASGSPFQPFSFTNSAGETRTYYPGQGNNMYVFPGIGLGTILSKAVKITDSMI 550

Query: 417 YIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQN 476
           Y                    YP ++RIR VS               +   +++I   Q 
Sbjct: 551 YASGAALSQALTAEEIERGLLYPDLTRIRQVS---------------VVVTRKVIRAAQE 595

Query: 477 D-IEVLKTRKGKEWDNLVKFVQENMWDPDSE 506
           D ++     +    D L  +++  M+D  SE
Sbjct: 596 DKVDRETALRSMNDDALDAWIKARMYDAHSE 626



>gi|83775192|dbj|BAE65315.1| unnamed protein product [Aspergillus oryzae RIB40]
          Length = 595

 Score =  436 bits (1121), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 238/511 (46%), Positives = 313/511 (61%), Gaps = 38/511 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+V   L E+TPLIYTP VG AC  +S I         P+G+YLS  D  NL  
Sbjct: 86  NVHLFYRLVTDHLRELTPLIYTPVVGEACQRWSEIYQ------QPEGMYLSWEDRGNLAA 139

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I  + P P       +I  ITDGSRILGLGDLG+NGMGIP+GKL LY A AGI P  TL
Sbjct: 140 VIANW-PQP-----NVEITCITDGSRILGLGDLGINGMGIPIGKLALYTACAGIRPEATL 193

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT+N+   +D  Y+G    ++  ++   F+D +M +L + +P ++IQFEDF  +
Sbjct: 194 PLTLDLGTSNKTLREDPLYMGSNRDKITPEEEREFMDELMSALTERWPGIVIQFEDF--K 251

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTK-HRLLFFXXXXXXX 239
           + F  L +YR+   CFNDDIQGTGAV+L G INAVK   +   P K HR +FF       
Sbjct: 252 NPFPALERYRDIYTCFNDDIQGTGAVILGGVINAVK---RSGLPCKDHRAVFFGAGSAGV 308

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK 299
              KQ++ FF  E GM+E+EA+   +LVDTKGLVT DRGD LA+HKVYFAR+DN+G Q+K
Sbjct: 309 GVAKQIVAFFMRE-GMTEDEARSCFYLVDTKGLVTNDRGDKLAEHKVYFAREDNEGQQYK 367

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
           TLEEV++YVKPT L+GLS+ GGVF  +I+ +MA+ N  PIIFPLSNP   +EC FE A+ 
Sbjct: 368 TLEEVVDYVKPTILMGLSTIGGVFTPEILRKMADWNTAPIIFPLSNPSSKSECDFETAIT 427

Query: 360 GTDNRVIFASGTAFPEYTVPETG---KTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQI 416
            TD R +FASG+ F  ++   +    +T YPGQGNNMY+FPG+GLG IL+K   ITD  I
Sbjct: 428 HTDGRALFASGSPFQPFSFTNSAGETRTYYPGQGNNMYVFPGIGLGTILSKAVKITDSMI 487

Query: 417 YIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQN 476
           Y                    YP ++RIR VS               +   +++I   Q 
Sbjct: 488 YASGAALSQALTAEEIERGLLYPDLTRIRQVS---------------VVVTRKVIRAAQE 532

Query: 477 D-IEVLKTRKGKEWDNLVKFVQENMWDPDSE 506
           D ++     +    D L  +++  M+D  SE
Sbjct: 533 DKVDRETALRSMNDDALDAWIKARMYDAHSE 563



>gi|451853341|gb|EMD66635.1| hypothetical protein COCSADRAFT_85454 [Bipolaris sorokiniana
           ND90Pr]
          Length = 581

 Score =  436 bits (1121), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 236/523 (45%), Positives = 321/523 (61%), Gaps = 37/523 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR++   ++E+TPLIYTPTVG ACL +  I         P+G+YLS +D  NL +
Sbjct: 76  NVHLFYRLLGENIKELTPLIYTPTVGEACLRWHEIWT------QPEGMYLSWSDRGNLRK 129

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+  + P+  D      I V+TDGSRILGLGDLGVNGMGIPVGKL LY A AGI P  TL
Sbjct: 130 ILDNW-PHEVD------ITVLTDGSRILGLGDLGVNGMGIPVGKLALYTACAGIKPDSTL 182

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGTNN+    D  Y+G R  +V  +Q   F+D +M +L   +P ++IQFEDF  +
Sbjct: 183 PLTLDLGTNNQALRDDPLYMGSRMPKVTPEQEKEFLDELMVALTDRWPSIVIQFEDF--K 240

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L +Y+     FNDD+QGTGAV++ GFINAV+     V    HR +F         
Sbjct: 241 NPFPALERYQNQYAMFNDDVQGTGAVIVGGFINAVR--ASGVPAKDHRAIFLGAGSAGVG 298

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ++E+F ++ G++EEEA+R  W VD+ GLVT DRGD LA HKVYFARDDN+G Q+++
Sbjct: 299 VAKQIVEYF-IKEGLTEEEARRKFWFVDSNGLVTHDRGDKLADHKVYFARDDNNGRQYQS 357

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L  +I+YV+PT L+GLS+ GG FN+ I+ +MA LN  PIIFPLSNP   +ECTFE+A+  
Sbjct: 358 LSRLIDYVQPTILMGLSTIGGAFNKDILEKMASLNNRPIIFPLSNPSSKSECTFEEAVLA 417

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           T+ R +FASG+ FP   +   GK   PGQGNNMY+FPG+GLGAIL+K   +T   IY   
Sbjct: 418 TEGRCLFASGSPFP--AMEYDGKLLTPGQGNNMYVFPGIGLGAILSKAVSVTQDMIYASA 475

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YP V RIR VS              G+ R  ++ +M    ++ 
Sbjct: 476 EYLSTSLNRQEVADGWLYPDVRRIREVSVVVTRGVIRAAQKNGVDRATELRDMSDEQLD- 534

Query: 481 LKTRKGKEWDNLVKFVQENMWDPDSE-KFFNTE--ELLSKSKM 520
                         F++++M+DP +E ++F+ +  +L+S  K+
Sbjct: 535 -------------DFIKKSMYDPHTENQYFDRKLSQLVSNEKL 564



>gi|225678895|gb|EEH17179.1| NAD-dependent malic enzyme [Paracoccidioides brasiliensis Pb03]
          Length = 578

 Score =  436 bits (1120), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 234/509 (45%), Positives = 310/509 (60%), Gaps = 34/509 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+V+  L+E+TPLIYTP VG AC  +S I         P+G+Y+S  D  N+  
Sbjct: 65  NVHLFYRLVVDHLKELTPLIYTPVVGEACQRWSEIYQG------PEGMYISYEDRGNIAA 118

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+ + P P+      +I  ITDGSRILGLGDLG+NGMGIP+GKL LY A AGI P  TL
Sbjct: 119 VIENW-PQPH-----VEITCITDGSRILGLGDLGINGMGIPIGKLALYTACAGIRPETTL 172

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT+N+   ++  Y+G R  +V  +Q   F+D +M +L + +P ++IQFEDF  +
Sbjct: 173 PLTLDLGTSNKALRENPLYMGSRRDKVTPEQELEFMDELMTALTEKWPGIVIQFEDF--K 230

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L +YR    CFNDDIQGTGAV+L+G INAVK  +  +   KH+ +F         
Sbjct: 231 NPFPALERYRHRFTCFNDDIQGTGAVILAGVINAVK--QSGIPTRKHKAVFLGAGSAGVG 288

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ+++FF  E GM+E+EAK   +LVDTKGLVT DRGD LA HKVYFAR DN G Q KT
Sbjct: 289 VAKQIVDFFMYE-GMTEDEAKACFYLVDTKGLVTADRGDKLAPHKVYFARTDNHGLQLKT 347

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L EV+E+VKPT L+GLS+ GGVF  +I+ +M+  NK PIIFPLSNP  N+EC FE A+  
Sbjct: 348 LIEVVEHVKPTMLMGLSTLGGVFTPQILKKMSTYNKRPIIFPLSNPSANSECDFESAVTH 407

Query: 361 TDNRVIFASGTAFPEYTVPETG---KTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
           TD   +FASG+ F  ++   +    KT YPGQGNNMY+FPG+GLG IL+K   +TD  IY
Sbjct: 408 TDGTALFASGSPFQPFSFKNSAGQTKTYYPGQGNNMYVFPGIGLGTILSKAVKVTDSMIY 467

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP ++RIR VS               + R+  I E+   D
Sbjct: 468 ASAQALANTLTPEELDHGLLYPDLTRIRKVSIVVARGVIRAAQEANVDRETGIRELSDED 527

Query: 478 IEVLKTRKGKEWDNLVKFVQENMWDPDSE 506
           ++               +++  M+ P SE
Sbjct: 528 LD--------------SWIKSKMYSPHSE 542



>gi|322703511|gb|EFY95119.1| putative malate dehydrogenase (NADP+) [Metarhizium anisopliae ARSEF
           23]
          Length = 761

 Score =  436 bits (1120), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 235/517 (45%), Positives = 316/517 (61%), Gaps = 38/517 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N+ LFYR+++  + E+ PL+YTPT+G  CL+YS I         P+ LY+S+    ++  
Sbjct: 263 NIDLFYRLLMDNVRELMPLVYTPTIGDVCLQYSSIYTR------PEALYISIKQRKSIRT 316

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++   R +P  D   P+I V+TDGSRILGLGDLG+NG+GI +GKL LY AAAGI P +TL
Sbjct: 317 ML---RNWPCAD---PEICVVTDGSRILGLGDLGMNGVGISIGKLALYTAAAGIHPDKTL 370

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GTNNE NLKD  YLGLR KR   +    F+D  M+++ +VYP +++QFEDF SE
Sbjct: 371 PIVLDCGTNNETNLKDPLYLGLRQKRPSFEVQQQFMDEFMEAVKEVYPNMVVQFEDFESE 430

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF+ L +YR     FNDDIQGTGAVVL G+I A  L    V   + RL+F         
Sbjct: 431 KAFNYLDRYRNTHRAFNDDIQGTGAVVLGGYIGACNL--SGVPIEEQRLVFMGAGSAGVG 488

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL+E++    G SE EA+   +LVDTKGLVT DRGDNLA+HK YFAR DN+G+QF+T
Sbjct: 489 VAKQLVEYY-TRRGFSEAEARDKFFLVDTKGLVTKDRGDNLAEHKKYFARIDNNGHQFRT 547

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAE------LNKNPIIFPLSNPKVNAECTF 354
           LEEVIEYVKP+ALIGL++T G+F E ++  +        L + PI+FPLSNP   AECTF
Sbjct: 548 LEEVIEYVKPSALIGLAATFGIFTESVVRALKASVDAGGLGRRPILFPLSNPLTKAECTF 607

Query: 355 EDAMKGTDNRVIFASGTAFPEYTVPETGK----TKYPGQGNNMYIFPGLGLGAILAKPKV 410
           E A++ TD  VIFASG+ F  +TV   G+    T +P QGNN+Y+FPGLGLGAILAK   
Sbjct: 608 EQAVQWTDGSVIFASGSPFQSFTVKVGGEIGEVTYHPNQGNNVYVFPGLGLGAILAKASR 667

Query: 411 ITDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQI 470
           +TD  +Y                    YP + R+R  S              G++   ++
Sbjct: 668 VTDNMVYTSAEALAGSLNSEEIHKGLIYPRIERVREASVIVAREVMKAARRDGVS---EL 724

Query: 471 IEMVQNDIEVLKTRKGKEWDN--LVKFVQENMWDPDS 505
            E   ++ E        EW +  L  ++++ +++P  
Sbjct: 725 PEAYWHEWE--------EWGDVALTAYIKQRIYNPSC 753



>gi|408397500|gb|EKJ76642.1| hypothetical protein FPSE_03192 [Fusarium pseudograminearum CS3096]
          Length = 732

 Score =  435 bits (1118), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 234/515 (45%), Positives = 318/515 (61%), Gaps = 38/515 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFYR++I  + E+ PL+YTPT+G  CL+YS I         P+ LY+S+    ++  
Sbjct: 236 NTDLFYRLLIDNVRELMPLVYTPTIGDVCLQYSSIYTR------PEALYISIKQRKSIRA 289

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++   R +P  D   P+I V+TDGSRILGLGDLG+NG+GI +GKL LY  AAGI P +TL
Sbjct: 290 ML---RNWPCQD---PEICVVTDGSRILGLGDLGINGVGISIGKLALYTGAAGIHPSKTL 343

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GTNNE+NL+D FYLGLR KR    +  +F+D  M++  +V+P +++QFEDF SE
Sbjct: 344 PIVLDCGTNNEENLQDPFYLGLRQKRPSYPEQQAFMDEFMEATREVFPNMVVQFEDFDSE 403

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF  L +YR+   CFNDDIQGTGAVVL G+I AV+  + +V   + RL+F         
Sbjct: 404 KAFGYLDRYRDQYRCFNDDIQGTGAVVLGGYIGAVE--QSNVPIEEQRLVFMGAGSAGVG 461

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL+E++    G+SE  A+   WLVDTKGLVT DRGD LA+HK YFAR DN+G QF+T
Sbjct: 462 VAKQLVEYY-TRRGLSEAAAREKFWLVDTKGLVTKDRGDRLAEHKKYFARTDNNGQQFRT 520

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAE------LNKNPIIFPLSNPKVNAECTF 354
           LEEVIEYVKP+AL+GL++T GVF E ++  +        L + PI+FPLSNP   AECTF
Sbjct: 521 LEEVIEYVKPSALVGLTATFGVFTEPVVRALKSSVQEGGLERRPILFPLSNPLTKAECTF 580

Query: 355 EDAMKGTDNRVIFASGTAFPEYTVP---ETGKTKY-PGQGNNMYIFPGLGLGAILAKPKV 410
           E A++ T+  V+FASG+ F         ET  T Y P QGNN+YIFPGLGLGAILAK   
Sbjct: 581 EQAIEWTEGTVLFASGSPFNPVKAKFGDETHHTVYHPNQGNNVYIFPGLGLGAILAKASR 640

Query: 411 ITDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQI 470
           +TD+ +Y                    YP + R+R  S                AR   +
Sbjct: 641 VTDEMVYTSAAALAGSLNADEVHKGLIYPRIERVRDASVIVAREVMKA------ARRGGV 694

Query: 471 IEMVQNDIEVLKTRKGKEWDN--LVKFVQENMWDP 503
            E+ ++     +  + +EW +  L  F+++++++P
Sbjct: 695 SELPES-----QWAEWEEWGDVALTSFIKQHIYNP 724



>gi|398396982|ref|XP_003851949.1| hypothetical protein MYCGRDRAFT_93697 [Zymoseptoria tritici IPO323]
 gi|339471829|gb|EGP86925.1| hypothetical protein MYCGRDRAFT_93697 [Zymoseptoria tritici IPO323]
          Length = 664

 Score =  434 bits (1116), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 237/505 (46%), Positives = 310/505 (61%), Gaps = 35/505 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR++   ++EITPLIYTPTVG AC  +S +         P+G+YLS  D  NL  
Sbjct: 164 NVHLFYRLLSENIKEITPLIYTPTVGEACQRWSELY------TQPEGMYLSFEDRGNLHS 217

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +IK + P+  D      I V+TDGSRILGLGDLGVNGMGIPVGKL LY A AGI P++TL
Sbjct: 218 VIKNW-PHEVD------ITVVTDGSRILGLGDLGVNGMGIPVGKLSLYTACAGIHPQKTL 270

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ LDLGT+NE    D  YLG R  +V  ++   F+D +M +L   +P ++IQFEDF  +
Sbjct: 271 PLCLDLGTSNETLRNDPLYLGSRRDKVTPEEEKEFLDEMMAALTDRWPSIVIQFEDF--K 328

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L +Y++    FNDDIQGTGAV+  GFINAVK  +  V P   R +F         
Sbjct: 329 NPFPSLERYQDTYTMFNDDIQGTGAVITGGFINAVK--QSGVAPADQRAVFLGAGSAGVG 386

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDR-GDNLAKHKVYFARDDNDGNQFK 299
             KQL EFF ++ G++EE+A++   LVD++G+VTLDR G  LA+HK+YFARDDN G QFK
Sbjct: 387 VAKQLTEFF-IKEGLTEEQARKRFTLVDSEGMVTLDRPGRPLAEHKLYFARDDNHGKQFK 445

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
           TL EV+EYVKPT L+GLS+ GG F   I++RMAELN  P+IFPLSNP   +ECTFEDA+K
Sbjct: 446 TLSEVVEYVKPTILMGLSTIGGAFTPAILSRMAELNDRPVIFPLSNPSSKSECTFEDAIK 505

Query: 360 GTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIX 419
            T  + +FASG+ FP  T+   G+   PGQGNNMY+FPG+GL AIL+K   IT   IY  
Sbjct: 506 YTHGKCLFASGSPFP--TLNYKGEELVPGQGNNMYVFPGIGLAAILSKSLTITQNMIYAS 563

Query: 420 XXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIE 479
                             YP ++RIR VS              G+ R+  +         
Sbjct: 564 AESLSTSLLPEEVEKNWLYPDIARIREVSVVVTRGVIRAAQRDGVDREVGL--------- 614

Query: 480 VLKTRKGKEWDNLVKFVQENMWDPD 504
                +G   + L  +++  M+DP+
Sbjct: 615 -----RGLGDEELESWIRSKMYDPE 634



>gi|327353020|gb|EGE81877.1| malic enzyme [Ajellomyces dermatitidis ATCC 18188]
          Length = 602

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 230/509 (45%), Positives = 309/509 (60%), Gaps = 34/509 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+V+  L+E+TPLIYTP VG AC  +S I         P+G+Y+S  D  N+  
Sbjct: 85  NVHLFYRLVVDHLKELTPLIYTPVVGEACQRWSEIYQ------QPEGMYISYEDRGNIAA 138

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+ + P P+ D     I VITDGSRILGLGDLG+NGMGIP+GKL LY A AG+ P  TL
Sbjct: 139 VIQNW-PQPHVD-----ITVITDGSRILGLGDLGINGMGIPIGKLALYTACAGVRPDATL 192

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT+N+   +D  Y+G R  +V  +Q   F+D +M +L + +P +++QFEDF  +
Sbjct: 193 PLTLDLGTSNKALREDPLYMGSRRDKVTPEQELEFMDELMIALTEKWPSIVVQFEDF--K 250

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L +YR    CFNDDIQGTGAV+L+G +NAVK  +  +   +H+ +F         
Sbjct: 251 NPFPALERYRHRFTCFNDDIQGTGAVILAGVMNAVK--QSGIPTREHKAVFLGAGSAGVG 308

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ+++FF V  GM+E++AK   +LVDTKGLVT DRGD LA HKVYFAR DN G Q KT
Sbjct: 309 VAKQIVDFF-VREGMTEDDAKACFYLVDTKGLVTADRGDKLAPHKVYFARTDNQGQQLKT 367

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L EV+ +VKPT L+GLS+ GGVF  +I+  MA  +K PIIFPLSNP  N+EC FE A+  
Sbjct: 368 LSEVVNHVKPTMLMGLSTLGGVFTPEILRSMASFSKRPIIFPLSNPSANSECDFEAAITH 427

Query: 361 TDNRVIFASGTAFPEYTVPETG---KTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
           TD + +FASG+ F  ++   +    KT YPGQGNNMY+FPG+GLG IL+K   +TD  IY
Sbjct: 428 TDGQALFASGSPFQPFSFKNSAGQTKTYYPGQGNNMYVFPGIGLGTILSKAVEVTDSMIY 487

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP ++RIR VS               + R+  I  +   D
Sbjct: 488 ASAEALSKTLTPEELEHGLLYPDLTRIREVSVVVARGVIHAAQEAKVDRETGIRALSDAD 547

Query: 478 IEVLKTRKGKEWDNLVKFVQENMWDPDSE 506
           ++               +++  M+ P SE
Sbjct: 548 MDA--------------WIRSKMYAPHSE 562



>gi|346319932|gb|EGX89533.1| NAD-binding malic dehydrase [Cordyceps militaris CM01]
          Length = 788

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 226/459 (49%), Positives = 290/459 (63%), Gaps = 26/459 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N+ LFYR+++  + E+ PL+YTPT+G  CL+YS +         P+ LY+S+    ++  
Sbjct: 288 NIDLFYRLLMNNIRELMPLVYTPTIGDVCLQYSTLYTR------PEALYISIKQRRSIKT 341

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIP--VGKLQLYVAAAGIDPRR 118
           +++ +          P+I V+TDGSRILGLGDLGVNG+GI   +GKL LY AAAGI P +
Sbjct: 342 MLRNW------PCTNPEICVVTDGSRILGLGDLGVNGVGISFQIGKLSLYTAAAGISPDK 395

Query: 119 TLPITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFS 178
           TLPI LD GT+NE NLKD  YLGLR KRV       F+D  M ++ +VYP +++QFEDF 
Sbjct: 396 TLPIVLDTGTDNESNLKDPLYLGLRQKRVPKSVQQEFMDEFMDAVKEVYPNMVVQFEDFE 455

Query: 179 SEHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXX 238
           SE AF+ L +YR    CFNDD+QGTGAVVL G+I AV L    V     RL+F       
Sbjct: 456 SEKAFNYLDRYRNTHRCFNDDVQGTGAVVLGGYIGAVNL--SGVPIDDQRLVFMGAGSAG 513

Query: 239 XXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQF 298
               KQL+E++  + G+S  EA+   WLVDTKGLVT DRGD+LA+HK YFAR DN G QF
Sbjct: 514 VGVAKQLVEYY-TKRGLSPSEARDRFWLVDTKGLVTKDRGDHLAEHKQYFARSDNHGQQF 572

Query: 299 KTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAEL------NKNPIIFPLSNPKVNAEC 352
           +TLEEVIEYV+P+AL+GL++T G+F E  I  +         N+ PI+FPLSNP   AEC
Sbjct: 573 RTLEEVIEYVRPSALVGLAATFGIFTESTIRALKHSVDGGGPNRRPILFPLSNPLTKAEC 632

Query: 353 TFEDAMKGTDNRVIFASGTAFPEYTV--PETGKTKY-PGQGNNMYIFPGLGLGAILAKPK 409
           TFE A+  TD  VIFASG+ FP  +V  P   +  Y P QGNN+YIFPGLGLGAILAK  
Sbjct: 633 TFEQAIDWTDGSVIFASGSPFPSCSVVGPSGNEITYHPNQGNNVYIFPGLGLGAILAKAT 692

Query: 410 VITDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
            ITD+ +Y                    YP + R+R  S
Sbjct: 693 RITDEMVYTSASALANCLNADEIAKGLIYPRIERVREAS 731



>gi|46125627|ref|XP_387367.1| hypothetical protein FG07191.1 [Fusarium graminearum PH-1]
          Length = 597

 Score =  434 bits (1115), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 234/515 (45%), Positives = 318/515 (61%), Gaps = 38/515 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFYR++I  + E+ PL+YTPT+G  CL+YS I         P+ LY+S+    ++  
Sbjct: 101 NTDLFYRLLIDNVRELMPLVYTPTIGDVCLQYSSIYTR------PEALYISIKQRKSIRA 154

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++   R +P  D   P+I V+TDGSRILGLGDLG+NG+GI +GKL LY  AAGI P +TL
Sbjct: 155 ML---RNWPCQD---PEICVVTDGSRILGLGDLGINGVGISIGKLALYTGAAGIHPSKTL 208

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GTNNE+NL+D FYLGLR KR    +  +F+D  M++  +V+P +++QFEDF SE
Sbjct: 209 PIVLDCGTNNEENLQDPFYLGLRQKRPSYPEQQAFMDEFMEATREVFPNMVVQFEDFDSE 268

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF  L +YR+   CFNDDIQGTGAVVL G+I AV+  + +V   + RL+F         
Sbjct: 269 KAFGYLDRYRDQYRCFNDDIQGTGAVVLGGYIGAVE--QSNVPIEEQRLVFMGAGSAGVG 326

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL+E++    G+SE  A+   WLVDTKGLVT DRGD LA+HK YFAR DN+G QF+T
Sbjct: 327 VAKQLVEYY-TRRGLSEAAAREKFWLVDTKGLVTKDRGDRLAEHKKYFARTDNNGQQFRT 385

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAE------LNKNPIIFPLSNPKVNAECTF 354
           LEEVIEYVKP+AL+GL++T GVF E ++  +        L + PI+FPLSNP   AECTF
Sbjct: 386 LEEVIEYVKPSALVGLTATFGVFTEPVVRALKSSVQEGGLERRPILFPLSNPLTKAECTF 445

Query: 355 EDAMKGTDNRVIFASGTAFPEYTVP---ETGKTKY-PGQGNNMYIFPGLGLGAILAKPKV 410
           E A++ T+  V+FASG+ F         ET  T Y P QGNN+YIFPGLGLGAILAK   
Sbjct: 446 EQAIEWTEGTVLFASGSPFNPVKAKFGDETHHTVYHPNQGNNVYIFPGLGLGAILAKASR 505

Query: 411 ITDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQI 470
           +TD+ +Y                    YP + R+R  S                AR   +
Sbjct: 506 VTDEMVYTSAAALAGSLNADEVHKGLIYPRIERVRDASVIVAREVMKA------ARRGGV 559

Query: 471 IEMVQNDIEVLKTRKGKEWDN--LVKFVQENMWDP 503
            E+ ++     +  + +EW +  L  F+++++++P
Sbjct: 560 SELPES-----QWAEWEEWGDVALTSFIKQHIYNP 589



>gi|512204403|gb|EPE33226.1| Aminoacid dehydrogenase-like, N-terminal [Glarea lozoyensis ATCC
           20868]
          Length = 653

 Score =  433 bits (1114), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 226/457 (49%), Positives = 294/457 (64%), Gaps = 26/457 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFYR++I  +E++ PL+YTPT+G  CL+YS I         P+ LY+S+    ++  
Sbjct: 166 NTDLFYRLLIDNVEQLMPLVYTPTIGDVCLQYSTIYTR------PEALYISIKQRKSIPT 219

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I++ + PYP      P I V+TDGSRILGLGDLGVNG+GI +GKL LY  AAGI P + L
Sbjct: 220 ILRNW-PYP-----NPSICVVTDGSRILGLGDLGVNGVGISIGKLALYTGAAGIHPEQCL 273

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GT NE NL+D  YLGLR KRV  +    F+D  M ++ +VYP +L+QFEDF +E
Sbjct: 274 PIVLDCGTANEGNLRDPLYLGLRQKRVSPEVALEFMDEFMAAVKEVYPSMLVQFEDFETE 333

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF  L +Y+    CFNDDIQGTGAVVL+G+I AV L    V     +L+F         
Sbjct: 334 KAFQYLERYKMEK-CFNDDIQGTGAVVLAGYIGAVNL--SGVPMEDQKLVFMGAGSAGVG 390

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ++E++    G+SE++A+   +LVDTKGLVT DRGD LA+HK  FAR DN+G+QF+T
Sbjct: 391 VAKQVMEYY-TRRGLSEQQAREKFYLVDTKGLVTYDRGDKLAEHKKIFARKDNNGHQFRT 449

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRM------AELNKNPIIFPLSNPKVNAECTF 354
           LEEVIEYVKPTALIGL++T GVF E ++  +      + L + P++FPLSNP   AECTF
Sbjct: 450 LEEVIEYVKPTALIGLTATFGVFTESVVRALKASVDASGLGRRPVLFPLSNPLTKAECTF 509

Query: 355 EDAMKGTDNRVIFASGTAFPEYTVPETG---KTKYPGQGNNMYIFPGLGLGAILAKPKVI 411
           E A+  TD  VIFASG+ F  +T+ +TG    T YP QGNN+Y+FPGLGLGAILAK   +
Sbjct: 510 EQAVTWTDGTVIFASGSPFAPFTM-KTGDGITTYYPNQGNNVYVFPGLGLGAILAKTTRV 568

Query: 412 TDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
           TD  +Y                    YP + R+R  S
Sbjct: 569 TDAMVYTSAAALSGCLNKEEIQMGLIYPKIQRVRDAS 605



>gi|261190208|ref|XP_002621514.1| NADP-dependent malic enzyme MaeA [Ajellomyces dermatitidis
           SLH14081]
 gi|239591342|gb|EEQ73923.1| NADP-dependent malic enzyme MaeA [Ajellomyces dermatitidis
           SLH14081]
 gi|239606402|gb|EEQ83389.1| NADP-dependent malic enzyme MaeA [Ajellomyces dermatitidis ER-3]
          Length = 602

 Score =  433 bits (1113), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 230/509 (45%), Positives = 309/509 (60%), Gaps = 34/509 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+V+  L+E+TPLIYTP VG AC  +S I         P+G+Y+S  D  N+  
Sbjct: 85  NVHLFYRLVVDHLKELTPLIYTPVVGEACQRWSEIYQ------QPEGMYISYEDRGNIAA 138

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+ + P P+ D     I VITDGSRILGLGDLG+NGMGIP+GKL LY A AG+ P  TL
Sbjct: 139 VIQNW-PQPHVD-----ITVITDGSRILGLGDLGINGMGIPIGKLALYTACAGVRPDATL 192

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT+N+   +D  Y+G R  +V  +Q   F+D +M +L + +P +++QFEDF  +
Sbjct: 193 PLTLDLGTSNKALREDPLYMGSRRDKVTPEQELEFMDELMIALTEKWPGIVVQFEDF--K 250

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L +YR    CFNDDIQGTGAV+L+G +NAVK  +  +   +H+ +F         
Sbjct: 251 NPFPALERYRHRFTCFNDDIQGTGAVILAGVMNAVK--QSGIPTREHKAVFLGAGSAGVG 308

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ+++FF V  GM+E++AK   +LVDTKGLVT DRGD LA HKVYFAR DN G Q KT
Sbjct: 309 VAKQIVDFF-VREGMTEDDAKACFYLVDTKGLVTADRGDKLAPHKVYFARTDNQGQQLKT 367

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L EV+ +VKPT L+GLS+ GGVF  +I+  MA  +K PIIFPLSNP  N+EC FE A+  
Sbjct: 368 LSEVVNHVKPTMLMGLSTLGGVFTPEILRSMASFSKRPIIFPLSNPSANSECDFEAAITH 427

Query: 361 TDNRVIFASGTAFPEYTVPETG---KTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
           TD + +FASG+ F  ++   +    KT YPGQGNNMY+FPG+GLG IL+K   +TD  IY
Sbjct: 428 TDGQALFASGSPFQPFSFKNSAGQTKTYYPGQGNNMYVFPGIGLGTILSKAVEVTDSMIY 487

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP ++RIR VS               + R+  I  +   D
Sbjct: 488 ASAEALSKTLTPEELEHGLLYPDLTRIREVSVVVARGVIHAAQEAKVDRETGIRALSDAD 547

Query: 478 IEVLKTRKGKEWDNLVKFVQENMWDPDSE 506
           ++               +++  M+ P SE
Sbjct: 548 MDA--------------WIRSKMYAPHSE 562



>gi|302909249|ref|XP_003050031.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256730968|gb|EEU44318.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 599

 Score =  433 bits (1113), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 228/517 (44%), Positives = 316/517 (61%), Gaps = 42/517 (8%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFYR++I  + ++ PL+YTPT+G  CL+YS I         P+ LY+S+    ++  
Sbjct: 101 NTDLFYRLLIDNIRDLMPLVYTPTIGDVCLQYSSIYTR------PEALYISIKQRKSIRT 154

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +++ +          P+I V+TDGSRILGLGDLG+NG+GI +GKL LY  AAGI P++TL
Sbjct: 155 MLRNW------PCQKPEICVVTDGSRILGLGDLGINGVGISIGKLALYTGAAGIHPQKTL 208

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GTNNE+NLKD FYLGLR KR   ++   F+D  M+++  V+P++++QFEDF S+
Sbjct: 209 PIVLDCGTNNEENLKDPFYLGLRQKRPAYEEQQGFMDEFMEAVRDVFPDMVVQFEDFESQ 268

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF  L +YR+   CFNDDIQGTGAVVL+G+I AV+  +  V   + RL+F         
Sbjct: 269 KAFGYLERYRDEYRCFNDDIQGTGAVVLAGYIGAVE--QSGVPLEEQRLVFMGAGSAGVG 326

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL+E++    G+SEE A+   WLVDTKGLVT DRGD LA+HK YFAR DNDG Q++T
Sbjct: 327 VAKQLVEYY-TRRGLSEEVARDKFWLVDTKGLVTKDRGDRLAEHKKYFARTDNDGQQYRT 385

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAE------LNKNPIIFPLSNPKVNAECTF 354
           L++VIEYVKP+AL+GL++T GVF E I+  +        L + PI+FPLSNP   AECTF
Sbjct: 386 LQDVIEYVKPSALVGLTATFGVFTEDIVRSLKASVEAGGLGRRPILFPLSNPLTKAECTF 445

Query: 355 EDAMKGTDNRVIFASGTAF----PEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKV 410
           E A++ T+  V+FASG+ F     ++       T YP QGNN+Y+FPG+GLGAILAK   
Sbjct: 446 EQAIEWTEGTVLFASGSPFNPVKAKFGDESHLTTYYPNQGNNVYVFPGIGLGAILAKASR 505

Query: 411 ITDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLAR--DK 468
           +TD+ IY                    YP + R+R  S              G++   D 
Sbjct: 506 VTDEMIYTSAAALAGSLTAEEVHKGLIYPRIERVRDASVIVAREVMKAARRGGVSELPDS 565

Query: 469 QIIEMVQNDIEVLKTRKGKEWDN--LVKFVQENMWDP 503
           Q  E              +EW +  L  +++++++DP
Sbjct: 566 QWAEW-------------EEWGDVALTTYIKKHIYDP 589



>gi|326497939|dbj|BAJ94832.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 611

 Score =  432 bits (1112), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 235/514 (45%), Positives = 318/514 (61%), Gaps = 34/514 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR++   ++E+TPLIYTPTVG AC  +S +         P+GLYLS  D  NL  
Sbjct: 96  NVHLFYRLLSNNVKELTPLIYTPTVGEACQRWSELYT------QPEGLYLSFADKGNLAS 149

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+ +   P++     +I V+TDGSRILGLGDLG+NGMGIPVGKL LY A AGI+P +TL
Sbjct: 150 VIENW---PHE----VEITVVTDGSRILGLGDLGINGMGIPVGKLSLYTACAGINPLKTL 202

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PITLDLGTNN+  + D  YLG R  +V  D+   F+D +M +L + +P ++IQ+EDF  +
Sbjct: 203 PITLDLGTNNQDLINDPLYLGSRRPKVTADEEREFLDEMMAALTERWPSIVIQYEDF--K 260

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L +Y++    FNDDIQGTGAV+L+GFINAVK  +  V     R +F         
Sbjct: 261 NPFPSLERYKDTYTMFNDDIQGTGAVILAGFINAVK--QSGVPAKDQRAVFLGAGSAGVG 318

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL  FF +  G++E+EA++  WLVD+KG+VT DR   LA HK YF+RDDN+G Q+KT
Sbjct: 319 VAKQLAAFF-INEGLTEDEARKCFWLVDSKGMVTNDREGELADHKRYFSRDDNNGEQYKT 377

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           LEEV++YVKPT L+GLS+ GG F  +I+ +MA +N+ P++FPLSNP   +ECTFEDA+K 
Sbjct: 378 LEEVVDYVKPTILMGLSTIGGAFTPQILEKMAAMNERPVVFPLSNPSSKSECTFEDAIKY 437

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           T  + +FASG+ FP  T+   G+   PGQGNNMY+FPG+GLGAIL+K   +T   IY   
Sbjct: 438 TKGKCLFASGSPFP--TLDFEGQKLVPGQGNNMYVFPGIGLGAILSKSVSVTQAMIYASA 495

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YP + RIR VS              G+ R  Q  E V  ++ +
Sbjct: 496 EALSTSLLPEEVEKNWLYPAIERIRDVS---------VVVTRGVIRSAQ-AEKVDRELAL 545

Query: 481 LKTRKGKEWDNLVKFVQENMWDPDSEKFFNTEEL 514
               +    D L  +++  M+DP  E    T E+
Sbjct: 546 ----RNMTDDQLDDYIRARMYDPFKEHDKITNEI 575



>gi|389634985|ref|XP_003715145.1| NADP-dependent malic enzyme [Magnaporthe oryzae 70-15]
 gi|351647478|gb|EHA55338.1| NADP-dependent malic enzyme [Magnaporthe oryzae 70-15]
          Length = 669

 Score =  432 bits (1111), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 223/462 (48%), Positives = 300/462 (64%), Gaps = 28/462 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFYR+++  + E+ PL+YTPT+G  CL+YS +  F  P    + LY+S+    ++  
Sbjct: 173 NTDLFYRLLMDNVRELMPLVYTPTIGDVCLQYSSL--FTRP----EALYISIKQRKSIKT 226

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++  + PYP      P+I VITDGSRILGLGDLG+NG+GI +GKL LY AAAGI P + L
Sbjct: 227 MLANW-PYP-----NPEICVITDGSRILGLGDLGINGVGISIGKLALYTAAAGIHPSKQL 280

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI +D GTNNE+NL+D  YLGLRSKR    +   F D VM S+ +VYP +++QFEDF +E
Sbjct: 281 PIVIDCGTNNEENLRDPLYLGLRSKRPSVQEQQDFCDEVMHSIKEVYPNMVVQFEDFETE 340

Query: 181 HAFDLLSKYREN---TFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXX 237
            AF+ L +YR +      FNDDIQGTGAVVL+G+INAVKL   +V   + RL+F      
Sbjct: 341 KAFNYLDRYRFDPKLNCMFNDDIQGTGAVVLAGYINAVKL--SNVPVEEQRLVFMGAGSA 398

Query: 238 XXXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDR--GDNLAKHKVYFARDDNDG 295
                +QL+++++  HGMSE+EAK   +LVDTKGL+T DR  G  L  HK YFARDDN+G
Sbjct: 399 GAGVARQLVDYYRNAHGMSEQEAKDKFYLVDTKGLITSDRFDGAKLPSHKRYFARDDNNG 458

Query: 296 NQFKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRM-------AELNKNPIIFPLSNPKV 348
           +QF+TLE+VIE+ +P+AL+GL++T GVF E I+  +          N+ PI+FPLSNP  
Sbjct: 459 HQFQTLEDVIEFARPSALVGLTATFGVFTESIVRGLKASVDAAGHRNRRPILFPLSNPLT 518

Query: 349 NAECTFEDAMKGTDNRVIFASGTAFPEYTVP--ETGKTKYPGQGNNMYIFPGLGLGAILA 406
            AECTF  A+  TD  VIFASG+ F  +TV   ++  T YP QGNN+Y+FPG+GLGAILA
Sbjct: 519 KAECTFSQAIDWTDGTVIFASGSPFAPHTVKNGDSATTYYPNQGNNVYVFPGIGLGAILA 578

Query: 407 KPKVITDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
           K   +TD+ +Y                    YP + R++  S
Sbjct: 579 KASRVTDEMVYTSAEALANCLNADEIATGLIYPRIDRVQDAS 620



>gi|322693713|gb|EFY85564.1| putative malate dehydrogenase (NADP+) [Metarhizium acridum CQMa
           102]
          Length = 666

 Score =  431 bits (1109), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 226/458 (49%), Positives = 291/458 (63%), Gaps = 25/458 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N+ LFYR+++  + E+ PL+YTPT+G  CL+YS I         P+ LY+S+    ++  
Sbjct: 168 NIDLFYRLLMDNIRELMPLVYTPTIGDVCLQYSSIYTR------PEALYISIKQRKSIRT 221

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++   R +P  D   P+I V+TDGSRILGLGDLG+NG+GI +GKL LY AAAGI P +TL
Sbjct: 222 ML---RNWPCAD---PEICVVTDGSRILGLGDLGMNGVGISIGKLALYTAAAGIHPAKTL 275

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GTNNE NLKD  YLGLR  R   +    F+D  M+++ +VYP +++QFEDF SE
Sbjct: 276 PIVLDCGTNNEANLKDPMYLGLRQNRPSLEVQQQFMDEFMEAVKEVYPNMVVQFEDFESE 335

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF+ L +YR     FNDDIQGTGAVVL G+I A  L    V   + RL+F         
Sbjct: 336 KAFNYLDRYRNTHRAFNDDIQGTGAVVLGGYIGACNL--SGVPIEEQRLVFMGAGSAGVG 393

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL+E++    G SE EA+   +LVDTKGLVT DRGD LA+HK YFAR DN+G+QF+T
Sbjct: 394 VAKQLVEYY-TRRGFSEAEARDKFFLVDTKGLVTKDRGDKLAEHKKYFARTDNNGHQFRT 452

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAE------LNKNPIIFPLSNPKVNAECTF 354
           LEEVIEYVKP+ALIGL++T G+F E ++  +        L + PI+FPLSNP   AECTF
Sbjct: 453 LEEVIEYVKPSALIGLAATFGIFTESVVRALKASVDAGGLGRRPILFPLSNPLTKAECTF 512

Query: 355 EDAMKGTDNRVIFASGTAFPEYTVPETGK----TKYPGQGNNMYIFPGLGLGAILAKPKV 410
           E A++ TD  VIFASG+ F   TV   G+    T +P QGNN+YIFPGLGLG ILAK   
Sbjct: 513 EQAVQWTDGSVIFASGSPFQSITVKVGGEIGEVTYHPNQGNNVYIFPGLGLGTILAKASR 572

Query: 411 ITDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
           +TD  +Y                    YP + R+R  S
Sbjct: 573 VTDNMVYTSAEALAGSLNSEEIHKGLIYPRIERVREAS 610



>gi|409048128|gb|EKM57606.1| hypothetical protein PHACADRAFT_115852 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 549

 Score =  431 bits (1108), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 228/492 (46%), Positives = 308/492 (62%), Gaps = 19/492 (3%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           + ++FY++ +  L E+TPLIYTPTVG ACL+YSHI         PDGL++S  D  N+ +
Sbjct: 68  DTNMFYKLCLEHLSEMTPLIYTPTVGDACLQYSHIF------RRPDGLFVSHKDKGNIGK 121

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +++ + P   D     +IAV+TDGSRILGLGDLG NGM I +GKL LY+A AGI P  T+
Sbjct: 122 VLRNW-PRIND----ARIAVVTDGSRILGLGDLGANGMPISIGKLSLYIAGAGIRPSSTI 176

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI +D+GT+N+K L+D  YLGLR  R+ + +   F++  M  +  V+PELLIQFEDF+++
Sbjct: 177 PICIDVGTDNKKYLEDPLYLGLRQPRISEAEMNEFMEEFMHEMSVVFPELLIQFEDFATD 236

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKL--VEKDVHPTKHRLLFFXXXXXX 238
            AF  LS +R+    FNDDIQGTGAVVLSGF+NA KL     D     HR+LF       
Sbjct: 237 KAFSFLSSFRDRYPLFNDDIQGTGAVVLSGFLNAAKLSSAASDRPLADHRILFLGAGSAG 296

Query: 239 XXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQF 298
                QL+ FFK++ G+SEEEA++ +WLVD++GL+   RG  LA+HK +F+R D  G   
Sbjct: 297 VGVGMQLMSFFKLQ-GLSEEEARQRIWLVDSQGLIYDGRG-KLAEHKKFFSRKDYSGPPM 354

Query: 299 KTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAM 358
             L E++ +VKPTAL+GLS+  G FN+ ++  M   N  PI+FPLSNP   +EC F DA+
Sbjct: 355 TDLVEIVNHVKPTALLGLSTIKGAFNQAVVEAMCAHNSRPIVFPLSNPVRLSECEFADAV 414

Query: 359 KGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYI 418
           + +  RVIFASG+ FPE +    G+T YPGQGNNMY+FPG+GLGAILAK   +TD  I  
Sbjct: 415 EWSRGRVIFASGSPFPECSY--EGRTLYPGQGNNMYVFPGIGLGAILAKASTVTDSMIEA 472

Query: 419 XXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDI 478
                              YP V RIR +S               + R+ Q+ ++  +D 
Sbjct: 473 SSLGLAESLTDEERAFELIYPRVERIRDISAQIALSVIRVAQKESVDRNSQLRQL--DDT 530

Query: 479 EVLKTRKGKEWD 490
           E+LK  KGK WD
Sbjct: 531 ELLKYIKGKMWD 542



>gi|440482326|gb|ELQ62826.1| NADP-dependent malic enzyme [Magnaporthe oryzae P131]
          Length = 617

 Score =  431 bits (1108), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 222/462 (48%), Positives = 299/462 (64%), Gaps = 28/462 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFYR+++  + E+ PL+YTPT+G  CL+YS +         P+ LY+S+    ++  
Sbjct: 121 NTDLFYRLLMDNVRELMPLVYTPTIGDVCLQYSSLFTR------PEALYISIKQRKSIKT 174

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++  + PYP      P+I VITDGSRILGLGDLG+NG+GI +GKL LY AAAGI P + L
Sbjct: 175 MLANW-PYP-----NPEICVITDGSRILGLGDLGINGVGISIGKLALYTAAAGIHPSKQL 228

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI +D GTNNE+NL+D  YLGLRSKR    +   F D VM S+ +VYP +++QFEDF +E
Sbjct: 229 PIVIDCGTNNEENLRDPLYLGLRSKRPSVQEQQDFCDEVMHSIKEVYPNMVVQFEDFETE 288

Query: 181 HAFDLLSKYREN---TFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXX 237
            AF+ L +YR +      FNDDIQGTGAVVL+G+INAVKL   +V   + RL+F      
Sbjct: 289 KAFNYLDRYRFDPKLNCMFNDDIQGTGAVVLAGYINAVKL--SNVPVEEQRLVFMGAGSA 346

Query: 238 XXXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDR--GDNLAKHKVYFARDDNDG 295
                +QL+++++  HGMSE+EAK   +LVDTKGL+T DR  G  L  HK YFARDDN+G
Sbjct: 347 GAGVARQLVDYYRNAHGMSEQEAKDKFYLVDTKGLITSDRFDGAKLPSHKRYFARDDNNG 406

Query: 296 NQFKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRM-------AELNKNPIIFPLSNPKV 348
           +QF+TLE+VIE+ +P+AL+GL++T GVF E I+  +          N+ PI+FPLSNP  
Sbjct: 407 HQFQTLEDVIEFARPSALVGLTATFGVFTESIVRGLKASVDAAGHRNRRPILFPLSNPLT 466

Query: 349 NAECTFEDAMKGTDNRVIFASGTAFPEYTVP--ETGKTKYPGQGNNMYIFPGLGLGAILA 406
            AECTF  A+  TD  VIFASG+ F  +TV   ++  T YP QGNN+Y+FPG+GLGAILA
Sbjct: 467 KAECTFSQAIDWTDGTVIFASGSPFAPHTVKNGDSATTYYPNQGNNVYVFPGIGLGAILA 526

Query: 407 KPKVITDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
           K   +TD+ +Y                    YP + R++  S
Sbjct: 527 KASRVTDEMVYTSAEALANCLNADEIATGLIYPRIDRVQDAS 568



>gi|225559440|gb|EEH07723.1| NADP-dependent malic enzyme MaeA [Ajellomyces capsulatus G186AR]
          Length = 618

 Score =  430 bits (1106), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 236/522 (45%), Positives = 312/522 (59%), Gaps = 44/522 (8%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+V+  L+E+TPLIYTP VG AC  +S I  +  P G   G+Y+S  D  N+  
Sbjct: 84  NVHLFYRLVVDHLKELTPLIYTPVVGEACQRWSEI--YQQPEGCL-GMYISYEDRGNIAA 140

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+ + P P+ D     I VITDGSRILGLGDLG+NGMGIP+GKL LY A AGI P  TL
Sbjct: 141 VIQNW-PQPHVD-----ITVITDGSRILGLGDLGINGMGIPIGKLALYTACAGIRPEATL 194

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYP------------ 168
           P+TLDLGT+N+   +D  YLG R  +V  +Q   F+D +M +L + +P            
Sbjct: 195 PLTLDLGTSNKALREDPLYLGSRRNKVSPEQELEFMDELMTALTEKWPGHSLLLCLANKI 254

Query: 169 -ELLIQFEDFSSEHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKH 227
             ++IQFEDF  ++ F  L +YR    CFNDDIQGTGAV+L+G INAVK  +  +   +H
Sbjct: 255 LSVVIQFEDF--KNPFPALERYRHRFTCFNDDIQGTGAVILAGVINAVK--QSGIPAKEH 310

Query: 228 RLLFFXXXXXXXXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVY 287
           + +F           KQ+++FF V  GM+E+EAK   +LVDTKGLVT DRGD LA HKVY
Sbjct: 311 KAVFLGAGSAGVGVAKQIVDFF-VREGMTEDEAKACFYLVDTKGLVTADRGDQLASHKVY 369

Query: 288 FARDDNDGNQFKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPK 347
           FAR DN G Q KTL EV+++VKPT L+GLS+ GGVF  +I+  MA  +K PIIFPLSNP 
Sbjct: 370 FARTDNQGLQLKTLSEVVDHVKPTMLMGLSTLGGVFTPEILRSMASFSKRPIIFPLSNPS 429

Query: 348 VNAECTFEDAMKGTDNRVIFASGTAFPEYTVPETG---KTKYPGQGNNMYIFPGLGLGAI 404
            N+EC FE A+  TD + +FASG+ F  ++   +    KT YPGQGNNMY+FPG+GLG I
Sbjct: 430 ANSECDFESAIIHTDGQALFASGSPFQPFSYKNSAGQIKTYYPGQGNNMYVFPGIGLGTI 489

Query: 405 LAKPKVITDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGL 464
           L+K   +TD  IY                    YP ++RIR VS               +
Sbjct: 490 LSKAVEVTDSMIYASGEALSKTLTSEELEHGLLYPDLTRIRDVSVIVARGVIRAAQEAKV 549

Query: 465 ARDKQIIEMVQNDIEVLKTRKGKEWDNLVKFVQENMWDPDSE 506
            R+  I ++   D++               +++  M+ P SE
Sbjct: 550 DRETGIRDLSNADMDA--------------WIRSKMYAPHSE 577



>gi|212532737|ref|XP_002146525.1| NADP-dependent malic enzyme MaeA [Talaromyces marneffei ATCC 18224]
 gi|210071889|gb|EEA25978.1| NADP-dependent malic enzyme MaeA [Talaromyces marneffei ATCC 18224]
          Length = 660

 Score =  430 bits (1105), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 229/483 (47%), Positives = 300/483 (62%), Gaps = 20/483 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+V   +EE+TPLIYTP VG AC  +S I         P+G+YLS  D  NL  
Sbjct: 144 NVHLFYRLVTDHIEEMTPLIYTPVVGEACQRWSEIYQ------QPEGMYLSYEDKGNLAA 197

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I  + P P+      +I VITDGSRILGLGDLG+NGMGIP+GKL LY A AGI P  TL
Sbjct: 198 VIANW-PQPH-----VEITVITDGSRILGLGDLGINGMGIPIGKLSLYTACAGIRPEVTL 251

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT+N+   +D  Y+G R  +V  ++   F+D +M +L + +P ++IQFEDF  +
Sbjct: 252 PLTLDLGTSNKAFREDPLYMGSRRDKVSPEEEQEFLDELMAALTERWPGIVIQFEDF--K 309

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L +YR     FNDDIQGTGAV+L G +NAVK     VHP   R +F         
Sbjct: 310 NPFPALERYRHTYTSFNDDIQGTGAVILGGVMNAVK--RSGVHPKDQRAVFLGAGSAGVG 367

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ++++F V  GM+EEEAK   +LVD++GLVT DRGD LA HK+YFAR DN G Q+KT
Sbjct: 368 VAKQIVDYF-VREGMTEEEAKACFYLVDSRGLVTADRGDRLADHKIYFARKDNKGQQWKT 426

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L+EVI++VKPT LIGLS+ GGVF  +I+ +MA  N+ PIIFPLSNP   +EC  E A+  
Sbjct: 427 LDEVIDHVKPTMLIGLSTIGGVFTPEILKKMAAWNEQPIIFPLSNPSSKSECDLEAAIVN 486

Query: 361 TDNRVIFASGTAFPEYTVPET-GKTK--YPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
           TD R +FASG+ FP  T   + G+TK  + GQGNNMY+FPG+GLG IL K   +TD  +Y
Sbjct: 487 TDGRALFASGSPFPPVTFTNSAGETKEYHGGQGNNMYVFPGIGLGTILCKAVEVTDGMVY 546

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP ++RIR VS               + R+  I ++  +D
Sbjct: 547 ASGEALTKCMLPDEIEKGYLYPDITRIREVSVVVAREVIRAAQEAKVDRETAIRDLSDSD 606

Query: 478 IEV 480
           ++ 
Sbjct: 607 LDA 609



>gi|242776288|ref|XP_002478815.1| NADP-dependent malic enzyme MaeA [Talaromyces stipitatus ATCC
           10500]
 gi|218722434|gb|EED21852.1| NADP-dependent malic enzyme MaeA [Talaromyces stipitatus ATCC
           10500]
          Length = 658

 Score =  429 bits (1104), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 230/483 (47%), Positives = 298/483 (61%), Gaps = 20/483 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+V   + E TPLIYTP VG AC  +S I         P+G+YLS  D  NL  
Sbjct: 142 NVHLFYRLVTDHIREFTPLIYTPVVGEACQRWSEIYQ------QPEGMYLSYEDKGNLAA 195

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I  + P P       +I VITDGSRILGLGDLG+NGMGIP+GKL LY A AGI P  TL
Sbjct: 196 VIANW-PQP-----NVEITVITDGSRILGLGDLGINGMGIPIGKLSLYTACAGIRPEATL 249

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT+N+   +D  Y+G R  +V  ++   F+D +M +L + +P ++IQFEDF  +
Sbjct: 250 PLTLDLGTSNKAFREDPLYMGSRRDKVSPEEEQEFLDELMAALTERWPGIVIQFEDF--K 307

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L +YR     FNDDIQGTGAV+L G +NAVK     VHP   R +F         
Sbjct: 308 NPFPALQRYRHTYTSFNDDIQGTGAVILGGVMNAVK--RSGVHPRDQRAVFLGAGSAGVG 365

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ++++F V  G++E+EAK   +LVD++GLVT DRGD LA HK+YFAR DN+  Q+KT
Sbjct: 366 VAKQIVDYF-VREGLTEDEAKACFYLVDSRGLVTADRGDRLADHKIYFARKDNNSQQWKT 424

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           LEEVI++VKPT LIGLS+ GGVF  +I+ +MA  N+ PIIFPLSNP   +EC  E A+  
Sbjct: 425 LEEVIDHVKPTMLIGLSTIGGVFTPEILKKMATFNEQPIIFPLSNPSSQSECDLETAIIH 484

Query: 361 TDNRVIFASGTAFPEYTVPET-GKTK--YPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
           TD R +FASG+ FP  T   T G+TK  Y GQGNNMY+FPG+GLG IL+K   +TD  IY
Sbjct: 485 TDGRALFASGSPFPPVTYTNTAGETKIYYGGQGNNMYVFPGIGLGTILSKAVEVTDSMIY 544

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP ++RIR VS               + R+  I ++  ND
Sbjct: 545 ASGEALTKCMLPDEIEKGFLYPDITRIREVSVVVAREVIRAAQEAQVDRETAIRDLSDND 604

Query: 478 IEV 480
           ++ 
Sbjct: 605 LDA 607



>gi|189191676|ref|XP_001932177.1| NADP-dependent malic enzyme [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187973783|gb|EDU41282.1| NADP-dependent malic enzyme [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 575

 Score =  429 bits (1102), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 233/515 (45%), Positives = 315/515 (61%), Gaps = 34/515 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFYR++   ++EITPLIYTPTVG AC+ +  I         P+G+YLS +D  NL +
Sbjct: 76  NPHLFYRLLSENIKEITPLIYTPTVGEACVRWHEIWT------QPEGMYLSWSDRGNLRR 129

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+  + P+  D      I V+TDGSRILGLGDLGVNGMGIPVGKL LY A AGI P  TL
Sbjct: 130 ILDNW-PHEVD------ITVLTDGSRILGLGDLGVNGMGIPVGKLALYTACAGIKPDSTL 182

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT+NEK   D  Y+G R  +V   Q   F+D +M +L   +P ++IQFEDF  +
Sbjct: 183 PLTLDLGTSNEKLRNDPLYMGSRMPKVTAAQEKEFLDELMAALTDKWPSIVIQFEDF--K 240

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L +Y+     FNDD+QGTGAV++ GFINA++     V    HR +F         
Sbjct: 241 NPFPALERYQNQYAMFNDDVQGTGAVIVGGFINAIR--ASGVPAKDHRAIFLGAGSAGVG 298

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ++E+F ++ G++E+EA+   W VD+ GLVTLDRGD LA+HKVYFARDDN G Q+++
Sbjct: 299 VAKQIVEYF-IKEGLTEDEARHKFWFVDSNGLVTLDRGDRLAEHKVYFARDDNQGRQYQS 357

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L  +I+YV+PT L+GLS+ GG FN  I+ RMA+LN  PIIFPLSNP   +ECTFE+A+  
Sbjct: 358 LARIIDYVQPTILMGLSTIGGAFNSDILTRMAKLNNRPIIFPLSNPSSKSECTFEEAVIA 417

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           T+ R +FASG+ FP  ++   GK   PGQGNNMY+FPG+GLGAI+ K   IT   IY   
Sbjct: 418 TEGRCLFASGSPFP--SLEWEGKLLTPGQGNNMYVFPGIGLGAIVCKAVSITQDMIYASA 475

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YP + RIR VS              G+ R  Q     +N ++ 
Sbjct: 476 ESLSTSLNKQEVADGWLYPDIRRIREVS---------VVVTRGVIRAAQ-----KNGVDR 521

Query: 481 LKTRKGKEWDNLVKFVQENMWDPDSEKFFNTEELL 515
               +G     L   ++++M+DP +E  +  ++L+
Sbjct: 522 AVELRGLTDAQLDAHIKKSMYDPYTEGQYFDKKLV 556



>gi|406861833|gb|EKD14886.1| NADP-dependent malic enzyme MaeA [Marssonina brunnea f. sp.
           'multigermtubi' MB_m1]
          Length = 555

 Score =  428 bits (1101), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 226/509 (44%), Positives = 311/509 (61%), Gaps = 33/509 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR+V+   E I PLIYTP VG ACL++S I          +GLY+S  D  ++ Q
Sbjct: 76  NVHLFYRLVLANFETIAPLIYTPVVGEACLKWSEIYQ------QAEGLYISYKDRGSILQ 129

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +++ + P P       +I V+TDGSRILGLGDLG+NGMGIPVGKL LY   AGI P  TL
Sbjct: 130 VLQNW-PQP-----NVEITVVTDGSRILGLGDLGINGMGIPVGKLALYTGCAGIRPEVTL 183

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ LDLGTNNE  LKD  Y+G + ++V + +   F+D +M +L  ++P +++QFEDF  +
Sbjct: 184 PLCLDLGTNNENLLKDPLYMGAKMRKVSEKEESDFLDELMVALNTMWPGIVVQFEDF--K 241

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L +Y+     FNDDIQGTGAV+L+G INA+K  +  V   + R +F         
Sbjct: 242 NPFPALERYQHKFGFFNDDIQGTGAVILAGIINALK--KSGVPAKEQRAVFMGAGSAGVG 299

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ++E+F ++ G++E+EA++  W VDTKGL+T DRGD LA HKVYF+RDDN+G QFK+
Sbjct: 300 VAKQIVEYF-IKEGLTEDEARKCFWFVDTKGLITNDRGDKLAAHKVYFSRDDNNGQQFKS 358

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L EV++YVKPT L+GLS+  G+F++ I+  MA+LNK+PIIFPLSNP  N+ECTFE+A+K 
Sbjct: 359 LPEVVDYVKPTILMGLSTIRGIFDKNILETMAKLNKHPIIFPLSNPSSNSECTFEEAIKH 418

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           TD + IFASG+ F  Y   +  K   P QGNNMY+FPG+GLG+IL K   IT + IY   
Sbjct: 419 TDGKAIFASGSPFQPYLYKD--KVMIPSQGNNMYVFPGIGLGSILCKTANITQEMIYASA 476

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YP + RIR  S               L  +K + ++   D++ 
Sbjct: 477 VALSTAITTSELNDGRLYPELCRIRECSVIVAREVIRQSQRQNLDGEKSLRDLSDADLDA 536

Query: 481 LKTRKGKEWDNLVKFVQENMWDPDSEKFF 509
                         +++  M+DP  E   
Sbjct: 537 --------------WIRSKMYDPTKESII 551



>gi|396500411|ref|XP_003845712.1| similar to malic enzyme [Leptosphaeria maculans JN3]
 gi|312222293|emb|CBY02233.1| similar to malic enzyme [Leptosphaeria maculans JN3]
          Length = 581

 Score =  428 bits (1101), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 225/509 (44%), Positives = 314/509 (61%), Gaps = 34/509 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR++   ++E+TPLIYTPTVG AC+ +  I         P+G+YLS ND  NL Q
Sbjct: 77  NVHLFYRLLSENIKELTPLIYTPTVGEACVRWHEIWT------QPEGMYLSWNDRGNLRQ 130

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+  + P+  D      I V+TDGSRILGLGDLGVNGMGIPVGKL LY A AGI+P  TL
Sbjct: 131 ILDNW-PHNVD------ITVLTDGSRILGLGDLGVNGMGIPVGKLSLYTACAGINPDATL 183

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ LDLGTNN+   +D  Y+G R  +V  +Q   F+D +M++L   +P ++IQFEDF  +
Sbjct: 184 PLCLDLGTNNQALREDPLYMGSRMPKVTPEQECEFLDELMEALTDKWPSIVIQFEDF--K 241

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  + +Y+     FNDD+QGTGAV++ GFINAVK     V    H+ +F         
Sbjct: 242 NPFPAIERYQNKYTMFNDDVQGTGAVIVGGFINAVK--ASGVPVKDHKAIFLGAGSAGTG 299

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             +Q++EFF ++ G++E+EA+R  W VD+ GLVT DRGD LA HKVYFARDDN+G Q+++
Sbjct: 300 VARQIVEFF-IKEGLTEDEARRKFWFVDSNGLVTQDRGDKLADHKVYFARDDNNGRQYQS 358

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L  +I++V+PT L+GLS+ GG F  +I+ +MA+LN  PIIFPLSNP   +ECTFE+A+  
Sbjct: 359 LARLIDFVQPTILMGLSTIGGAFTTEILQKMAKLNDRPIIFPLSNPSSKSECTFEEAVVN 418

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           T+ R +FASG+ FP  ++   GK   PGQGNNMY+FPG+GLGAI++K   +T   IY   
Sbjct: 419 TEGRCLFASGSPFP--SMEWDGKLLTPGQGNNMYVFPGIGLGAIISKAVSVTQDMIYASA 476

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YP + RIR VS              G+ R  ++  +    ++V
Sbjct: 477 ESLSTSLNEQEIADGWLYPDIRRIREVSVVVTRGVIRAAQRNGVDRATELRNLSDEQLDV 536

Query: 481 LKTRKGKEWDNLVKFVQENMWDPDSEKFF 509
                          +++NM++P +E+ +
Sbjct: 537 --------------HIKKNMYNPYAEREY 551



>gi|353235795|emb|CCA67802.1| related to NADP-dependent malic enzyme [Piriformospora indica DSM
           11827]
          Length = 553

 Score =  428 bits (1101), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 230/493 (46%), Positives = 308/493 (62%), Gaps = 27/493 (5%)

Query: 4   LFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQIIK 63
           +FY I++  + EI PLIYTPTVG ACL +SHI         P+GLY+S+ D  ++  ++ 
Sbjct: 74  MFYAILMANMPEICPLIYTPTVGDACLNFSHIY------RKPEGLYVSIEDKGSIKNVL- 126

Query: 64  TYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPIT 123
             R +P+ D    +I V+TDGSRILGLGDLGVNGM I +GKL LY+A AG  P  TLPI 
Sbjct: 127 --RVWPHKDKA--RITVVTDGSRILGLGDLGVNGMPISIGKLSLYIAGAGFKPESTLPIC 182

Query: 124 LDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSEHAF 183
           LDLGTNN KNL D  YLGLR KRVDD +   F+D  M ++ +V+P +L+QFEDFS++HAF
Sbjct: 183 LDLGTNNAKNLDDPLYLGLRRKRVDDKEMDEFMDEFMHAMAEVFPNILVQFEDFSTDHAF 242

Query: 184 DLLSKYRENTF---CFNDDIQGTGAVVLSGFINAVKLVE----KDVHPTKHRLLFFXXXX 236
             L +Y +NT     FNDDIQGTGAVVLSGF+NA KL      +D+  T HR+LF     
Sbjct: 243 HYLERY-QNTAKVPVFNDDIQGTGAVVLSGFVNAAKLSSEASGRDL--TDHRVLFLGAGS 299

Query: 237 XXXXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGN 296
                 KQ++ FF ++ G+SEEEAK  +W +D++G++T DR   L  HK+YFAR D  G 
Sbjct: 300 AGVGVAKQVMSFFTLQ-GLSEEEAKSRIWFIDSQGMITADR-PKLQAHKIYFARKDYSGP 357

Query: 297 QFKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFED 356
             K L ++I+YVKPTAL+GLS+  G F ++ + +MAELN  PIIFPLSNP   +EC F+D
Sbjct: 358 PLKNLLDIIDYVKPTALVGLSTMRGAFTKEAVEKMAELNPRPIIFPLSNPVSLSECEFKD 417

Query: 357 AMKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQI 416
           A++ TD +VIFASG+ F  YT    GK  YPGQGNNMY+FPG+G G +L+K K +T   +
Sbjct: 418 AIEWTDGKVIFASGSPFLPYTY--KGKEYYPGQGNNMYVFPGIGFGGVLSKCKHVTPSMV 475

Query: 417 YIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQN 476
                                YP ++R+R VS               + R+  +  M  +
Sbjct: 476 ENASLALAESLTQEERDMGLIYPKLTRVREVSMQIAARVIHVAQEEHVDRNAPLRHM--D 533

Query: 477 DIEVLKTRKGKEW 489
           D  +L+  + + W
Sbjct: 534 DEHLLEFARKRSW 546



>gi|342875995|gb|EGU77660.1| hypothetical protein FOXB_11835 [Fusarium oxysporum Fo5176]
          Length = 742

 Score =  427 bits (1099), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 226/461 (49%), Positives = 294/461 (63%), Gaps = 28/461 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFYR++I  + E+ PL+YTPT+G  CL+YS I         P+ LY+S+    ++  
Sbjct: 241 NTDLFYRLLIDNIRELMPLVYTPTIGDVCLQYSSIYTR------PEALYISIKQRKSIRA 294

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIP---VGKLQLYVAAAGIDPR 117
           ++   R +P  D   P+I V+TDGSRILGLGDLG+NG+GI    +GKL LY  AAGI P 
Sbjct: 295 ML---RNWPCQD---PEICVVTDGSRILGLGDLGINGVGISEHQIGKLALYTGAAGIHPS 348

Query: 118 RTLPITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDF 177
           +TLPI LD GTNNE+NLKD FYLGLR KR    +  +F+D  M++  +V+P +++QFEDF
Sbjct: 349 KTLPIVLDCGTNNEENLKDPFYLGLRQKRPSYPEQQAFMDEFMEAAREVFPSMVVQFEDF 408

Query: 178 SSEHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXX 237
            SE AF  L +YR+   CFNDDIQGTGAVVL G+I AV+  +  V   + RL+F      
Sbjct: 409 DSEKAFGYLDRYRDQYRCFNDDIQGTGAVVLGGYIGAVE--QSGVPIEEQRLVFMGAGSA 466

Query: 238 XXXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQ 297
                KQL+E++    G+SE  A+   WLVDTKGLVT DRGD LA+HK YFAR DN+G Q
Sbjct: 467 GVGVAKQLVEYY-TRRGLSEAAARDKFWLVDTKGLVTKDRGDRLAEHKKYFARTDNNGQQ 525

Query: 298 FKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAE------LNKNPIIFPLSNPKVNAE 351
           ++TLEEVIEYVKP+AL+GL++T GVF E ++  +        L + PI+FPLSNP   AE
Sbjct: 526 YRTLEEVIEYVKPSALVGLTATFGVFTEPVVRALKHSVQEGGLERRPILFPLSNPLTKAE 585

Query: 352 CTFEDAMKGTDNRVIFASGTAFPEYTVP---ETGKTKY-PGQGNNMYIFPGLGLGAILAK 407
           CTFE A++ T+  V+FASG+ F         ET  T Y P QGNN+YIFPGLGLGAILAK
Sbjct: 586 CTFEQAIEWTEGTVLFASGSPFNPVKAKFGDETHHTVYHPNQGNNVYIFPGLGLGAILAK 645

Query: 408 PKVITDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
              +TD+ +Y                    YP + R+R  S
Sbjct: 646 ASRVTDEMVYTSAAALAGSLNADEVHKGLIYPRIERVRDAS 686



>gi|465792336|emb|CCU97444.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 514

 Score =  427 bits (1099), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 232/505 (45%), Positives = 300/505 (59%), Gaps = 28/505 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFY  VI  L E  PL+YTPTVG  C ++S  S F  P    +GL  +L D  N+  
Sbjct: 32  NERLFYAYVIKNLLETLPLVYTPTVGEGCQKFS--SMFRRP----EGLTFTLKDKGNIAN 85

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
            +  + P P D   TP++AVITDGSRILGLGDLG NGMGI +GKL LYVA AG+ P+ T+
Sbjct: 86  CVANW-PRPQD---TPRVAVITDGSRILGLGDLGWNGMGITIGKLSLYVACAGVHPQSTM 141

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI +D+GTNNE+ L D  YLGLR KR  D++    VD +M  L K YP L+IQFED+SS 
Sbjct: 142 PIAVDIGTNNEELLNDPLYLGLRQKRASDEELTELVDEIMYELNKRYPFLIIQFEDWSSA 201

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPT--KHRLLFFXXXXXX 238
           +AF  L +Y+E    FNDDIQGTGAV+L GF+NA +   +         R+L        
Sbjct: 202 NAFRFLDRYQEKYPMFNDDIQGTGAVILGGFVNAARKSSEASGKALEDQRILMVGAGSAS 261

Query: 239 XXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQF 298
               KQL+ FF  EHG++EE+AK  +W  D+KGLVT +RGD LA+HK +FAR DN   Q+
Sbjct: 262 VGVAKQLMNFF-TEHGLTEEQAKDRIWTTDSKGLVTANRGDELAEHKRFFARHDNGDKQY 320

Query: 299 KTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAM 358
           K LEE+I+YVKPTAL+G+S+  G F  +++ RMA+LNK PI+  LSNP   AECTFE+A+
Sbjct: 321 KDLEEIIDYVKPTALLGMSTVRGTFTPEVLKRMAKLNKRPIVMALSNPTSKAECTFEEAL 380

Query: 359 KGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYI 418
           K TDN+VIFA+G+ F    +   GKT+Y  QGNN YIFPG+GL   L + K IT+  I  
Sbjct: 381 KYTDNKVIFAAGSPFDPVEI--DGKTRYSDQGNNFYIFPGVGLAGALTRAKHITEAIITE 438

Query: 419 XXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDI 478
                              YP+  R+R V+              GLA+D      + +  
Sbjct: 439 SAMALADSMNDKEKEMDLLYPLPERVREVAHYIAFRCIKAINKAGLAQDDGFTAGLSD-- 496

Query: 479 EVLKTRKGKEWDNLVKFVQENMWDP 503
                      D L K+V + MW P
Sbjct: 497 -----------DELFKWVHDEMWVP 510



>gi|399171461|emb|CCE27651.1| related to malate dehydrogenase (oxaloacetate-decarboxylating)
           (NADP+) [Claviceps purpurea 20.1]
          Length = 628

 Score =  426 bits (1094), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 219/463 (47%), Positives = 292/463 (63%), Gaps = 30/463 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFYR+++  + ++ PL+YTPT+G  CL+YS +         P+ LY+S+    ++  
Sbjct: 125 NTDLFYRLLMDNIRDLMPLVYTPTIGDVCLQYSSLYSR------PEALYISITQRNSIRT 178

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++   R +P  D   P+I V+TDGSRILGLGDLG+NG+GIP+GKL LY AAAGI P +TL
Sbjct: 179 ML---RNWPCSD---PEICVVTDGSRILGLGDLGMNGVGIPIGKLSLYTAAAGIHPSKTL 232

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GTNNE NL+D  YLGLR KR   +    F+D  M+++ +VYP++++QFEDF S+
Sbjct: 233 PIVLDCGTNNESNLQDPLYLGLRQKRPSAEVQQEFMDEFMEAVKEVYPKMVVQFEDFESQ 292

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF+ L +Y+     FNDDIQGTGAV+L G+I AV L    V     RL+F         
Sbjct: 293 KAFNYLERYKNTHRAFNDDIQGTGAVILGGYIGAVNL--SGVPIQDQRLVFMGAGSAGVG 350

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQLLE++    G SE+EA+   +LVDTKGLVT DRGD LA+HK YFAR DN G QF+T
Sbjct: 351 VAKQLLEYY-TRRGFSEDEARSKFYLVDTKGLVTHDRGDTLAEHKKYFARTDNQGRQFRT 409

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAE------LNKNPIIFPLSNPKVNAECTF 354
           LEEVI +V+P+AL+GL++T G+F E +I  +          + PI+FPLSNP   AECTF
Sbjct: 410 LEEVIAHVQPSALVGLAATYGIFTESVIRALKSSVDAGGSGRRPILFPLSNPLSKAECTF 469

Query: 355 EDAMKGTDNRVIFASGTAFPEYTVPETGK---------TKYPGQGNNMYIFPGLGLGAIL 405
           E+A++ +D  VIFASG+ F   T+   G+         T +P QGNN+Y+FPGLGLGAIL
Sbjct: 470 EEAIQWSDGSVIFASGSPFESLTIKTEGRGSGGSAEEVTYHPNQGNNVYVFPGLGLGAIL 529

Query: 406 AKPKVITDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
           AK   ITD  +Y                    YP + R+R  S
Sbjct: 530 AKASHITDDMVYASAEALAGTLNAEEMQRGLIYPRIERVREAS 572



>gi|330913003|ref|XP_003296149.1| hypothetical protein PTT_05114 [Pyrenophora teres f. teres 0-1]
 gi|311331933|gb|EFQ95751.1| hypothetical protein PTT_05114 [Pyrenophora teres f. teres 0-1]
          Length = 567

 Score =  426 bits (1094), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 231/515 (44%), Positives = 314/515 (60%), Gaps = 34/515 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LF+R++   ++EITPLIYTPTVG AC+ +  I         P+G+YLS +D  NL +
Sbjct: 68  NPHLFFRLLSENIKEITPLIYTPTVGEACVRWHEIWT------QPEGMYLSWSDRGNLRR 121

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+  + P+  D      I V+TDGSRILGLGDLGVNGMGIPVGKL LY A AGI P  TL
Sbjct: 122 ILDNW-PHEVD------ITVLTDGSRILGLGDLGVNGMGIPVGKLALYTACAGIKPDSTL 174

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLDLGT+NE    D  Y+G R  +V   Q   F+D +M +L   +P ++IQFEDF  +
Sbjct: 175 PLTLDLGTSNETLRNDPLYMGSRMPKVTAAQEKEFLDELMAALTDKWPSIVIQFEDF--K 232

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L +Y+     FNDD+QGTGAV++ GFINA++     V    HR +F         
Sbjct: 233 NPFPALERYQNQYAMFNDDVQGTGAVIVGGFINAIR--ASGVPAKDHRAIFLGAGSAGVG 290

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ++E+F ++ G++E+EA+   W VD+ GLVTLDRGD LA+HKVYFARDDN G Q+++
Sbjct: 291 VAKQIVEYF-IKEGLTEDEARHKFWFVDSNGLVTLDRGDRLAEHKVYFARDDNQGRQYQS 349

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L  +I+YV+PT L+GLS+ GG FN  I+ RMA+LN  PIIFPLSNP   +ECTFE+A+  
Sbjct: 350 LARIIDYVQPTILMGLSTIGGAFNSDILTRMAKLNNRPIIFPLSNPSSKSECTFEEAVIA 409

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           T+ R +FASG+ FP  ++   GK   PGQGNNMY+FPG+GLGAI+ K   IT   IY   
Sbjct: 410 TEGRCLFASGSPFP--SLEWEGKLLTPGQGNNMYVFPGIGLGAIVCKAVSITQDMIYASA 467

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YP + RIR VS              G+ R  Q     +N ++ 
Sbjct: 468 ESLSTSLNKQEVADGWLYPDIRRIREVS---------VVVTRGVIRAAQ-----KNGVDR 513

Query: 481 LKTRKGKEWDNLVKFVQENMWDPDSEKFFNTEELL 515
               +G     L   ++++M+DP +E  +  ++L+
Sbjct: 514 AVELRGLTDAQLDAHIKKSMYDPYTEGQYFDKKLV 548



>gi|472238488|gb|EMR83353.1| putative nadp-dependent malic enzyme protein [Botryotinia
           fuckeliana BcDW1]
          Length = 686

 Score =  425 bits (1093), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 226/464 (48%), Positives = 288/464 (62%), Gaps = 32/464 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFYR++I  +  + PL+YTPT+G  CL+YS +         P+ LY+S+    ++T 
Sbjct: 191 NTDLFYRLLIDNIATLMPLVYTPTIGDVCLQYSTLYTR------PEALYISIKQRKSMTT 244

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I++ + PYP      P I V+TDGSRILGLGDLGVNG+GI +GKL LY  AAGI P +TL
Sbjct: 245 ILRNW-PYP-----NPSICVVTDGSRILGLGDLGVNGVGISIGKLALYTGAAGIHPSQTL 298

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GT NE+NL+D  YLGLR KR   +    F+D  M ++ +VYP++L+QFEDF SE
Sbjct: 299 PIVLDCGTANEENLRDPLYLGLRMKRPGPEIEQQFMDEFMAAVKEVYPDMLVQFEDFESE 358

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF  L +Y++    FNDDIQGTGAVVL+G+I AV L    V     RL+F         
Sbjct: 359 KAFKYLDRYKKEKM-FNDDIQGTGAVVLAGYIGAVNL--SGVPIEDQRLVFMGAGSAGVG 415

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ++E++    G+SE++A+   WLVDTKGLVT DRGD LA HK  FARDDN G+QF T
Sbjct: 416 VAKQVMEYY-TRRGLSEKDARDKFWLVDTKGLVTTDRGDKLAAHKKIFARDDNHGHQFAT 474

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRM------AELNKNPIIFPLSNPKVNAECTF 354
           LEEVIEYVKPTALIGL++T GVF E ++  +        L + PI+FPLSNP   AECTF
Sbjct: 475 LEEVIEYVKPTALIGLTATFGVFTESVVRALKGSVDAGGLGRRPILFPLSNPLTKAECTF 534

Query: 355 EDAMKGTDNRVIFASGTAFPEYTVPE----------TGKTKYPGQGNNMYIFPGLGLGAI 404
           E A+  T+  VIFASG+ F   T+               T YP QGNN+Y+FPGLGLGAI
Sbjct: 535 EQAITWTEGTVIFASGSPFSPVTIKHSDSSSSLSSENSTTYYPNQGNNVYVFPGLGLGAI 594

Query: 405 LAKPKVITDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
           LAK   +TD  +Y                    YP + R+R  S
Sbjct: 595 LAKASRVTDAMVYQSAEALSGCLNREELMMGLIYPKIGRVRDAS 638



>gi|347838424|emb|CCD52996.1| hypothetical protein BofuT4_P139200.1 [Botryotinia fuckeliana T4]
          Length = 686

 Score =  425 bits (1092), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 226/464 (48%), Positives = 288/464 (62%), Gaps = 32/464 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFYR++I  +  + PL+YTPT+G  CL+YS +         P+ LY+S+    ++T 
Sbjct: 191 NTDLFYRLLIDNIATLMPLVYTPTIGDVCLQYSTLYTR------PEALYISIKQRKSMTT 244

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I++ + PYP      P I V+TDGSRILGLGDLGVNG+GI +GKL LY  AAGI P +TL
Sbjct: 245 ILRNW-PYP-----NPSICVVTDGSRILGLGDLGVNGVGISIGKLALYTGAAGIHPSQTL 298

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GT NE+NL+D  YLGLR KR   +    F+D  M ++ +VYP++L+QFEDF SE
Sbjct: 299 PIVLDCGTANEENLRDPLYLGLRMKRPGPEIEQQFMDEFMAAVKEVYPDMLVQFEDFESE 358

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF  L +Y++    FNDDIQGTGAVVL+G+I AV L    V     RL+F         
Sbjct: 359 KAFKYLDRYKKEKM-FNDDIQGTGAVVLAGYIGAVNL--SGVPIEDQRLVFMGAGSAGVG 415

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ++E++    G+SE++A+   WLVDTKGLVT DRGD LA HK  FARDDN G+QF T
Sbjct: 416 VAKQVMEYY-TRRGLSEKDARDKFWLVDTKGLVTTDRGDKLAAHKKIFARDDNHGHQFAT 474

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRM------AELNKNPIIFPLSNPKVNAECTF 354
           LEEVIEYVKPTALIGL++T GVF E ++  +        L + PI+FPLSNP   AECTF
Sbjct: 475 LEEVIEYVKPTALIGLTATFGVFTESVVRALKGSVDAGGLGRRPILFPLSNPLTKAECTF 534

Query: 355 EDAMKGTDNRVIFASGTAFPEYTVPE----------TGKTKYPGQGNNMYIFPGLGLGAI 404
           E A+  T+  VIFASG+ F   T+               T YP QGNN+Y+FPGLGLGAI
Sbjct: 535 EQAITWTEGTVIFASGSPFSPVTIKHSDSSSSSSSENSTTYYPNQGNNVYVFPGLGLGAI 594

Query: 405 LAKPKVITDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
           LAK   +TD  +Y                    YP + R+R  S
Sbjct: 595 LAKASRVTDAMVYQSAEALSGCLNREELMMGLIYPKIGRVRDAS 638



>gi|304366186|gb|ADM26561.1| malic enzyme [Cunninghamella echinulata]
          Length = 550

 Score =  422 bits (1086), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 224/490 (45%), Positives = 313/490 (63%), Gaps = 19/490 (3%)

Query: 3   SLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQII 62
           ++FY++ I  + EITPLIYTPTVG AC++YSHI         P+GL++S+ D  N+ +++
Sbjct: 70  NMFYKLCIENMSEITPLIYTPTVGDACIQYSHIFRR------PEGLFVSIKDKGNVGKVL 123

Query: 63  KTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPI 122
              R +P  +    +IAV+TDGSRILGLGDLGVNGM I +GKL LYVA AGI P  T+PI
Sbjct: 124 ---RNWPRINE--ARIAVVTDGSRILGLGDLGVNGMPISIGKLSLYVAGAGIRPSSTVPI 178

Query: 123 TLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSEHA 182
            +D+GT+N++ L+D  YLGLR  RV + + + F++  M  +  V+PELLIQFEDF+++ A
Sbjct: 179 CIDVGTDNKEFLEDPLYLGLRQPRVPEAEMHEFMEEFMHEMSVVFPELLIQFEDFATDKA 238

Query: 183 FDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDV-HP-TKHRLLFFXXXXXXXX 240
           F  LS +R+    FNDDIQGTGAVVLSGF+NA KL       P T HR+LF         
Sbjct: 239 FAFLSSFRDRYPLFNDDIQGTGAVVLSGFLNAAKLSSAASGRPLTDHRILFLGAGSAGVG 298

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
              QL+ FFK++ GMSE+EA+  +WLVD++GLV   RG  LA+HK +F+R D  G+    
Sbjct: 299 VGMQLMSFFKLQ-GMSEQEARERIWLVDSQGLVYDARG-KLAEHKKFFSRKDYAGSPMTN 356

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L ++I+YVKPTAL+GLS+  G FN++++ +M+ELN+ PIIFPLSNP   +EC F++A++ 
Sbjct: 357 LVDIIDYVKPTALLGLSTIKGAFNQQVVEKMSELNERPIIFPLSNPVRLSECEFDEAVQW 416

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           ++  VIFASG+ FPE      G+  YPGQGNNMY+FPG+GLGAIL++   +TD  I    
Sbjct: 417 SNGNVIFASGSPFPEQQF--AGRMLYPGQGNNMYVFPGIGLGAILSRVSSVTDSMIEAAS 474

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YP + RIR +S               + R   + ++  +D  +
Sbjct: 475 LGLANSLTDEERGLELVYPRIERIRDISAQIALSVIRAAQKANVDRSPHLRQL--DDSAL 532

Query: 481 LKTRKGKEWD 490
           +K   GK W+
Sbjct: 533 VKHIMGKMWN 542



>gi|409076993|gb|EKM77361.1| hypothetical protein AGABI1DRAFT_115281 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 543

 Score =  422 bits (1086), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 227/502 (45%), Positives = 302/502 (60%), Gaps = 31/502 (6%)

Query: 4   LFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQIIK 63
           +FY++ +  + E TP+IYTPTVG ACL+YSHI         P+GL++S+ D  N+ ++I 
Sbjct: 70  VFYKLCLQNMSEFTPIIYTPTVGDACLQYSHIYRR------PEGLFVSIKDKGNIHEVIN 123

Query: 64  TYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPIT 123
            +   P  D    +I+V+TDGSRILGLGDLG+NGM I +GKL LY+A AGI P  T+PI 
Sbjct: 124 NW---PKIDE--ARISVVTDGSRILGLGDLGINGMPIAIGKLSLYIAGAGIRPESTIPIC 178

Query: 124 LDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSEHAF 183
           LDLGTN E+ L+D  YLGLR KR  D +   F+D  M  +   +P+L+IQFEDFS+++AF
Sbjct: 179 LDLGTNTERYLEDPLYLGLRQKRASDQEMTEFMDEFMYEMSVAFPKLMIQFEDFSTDNAF 238

Query: 184 DLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDV-HPT-KHRLLFFXXXXXXXXX 241
             L +YR     FNDDIQGTGAVVLSGF NA KL      +P   HR+LFF         
Sbjct: 239 KYLERYRNTYPVFNDDIQGTGAVVLSGFFNAAKLSSAASGNPLDSHRILFFGAGSAGVGV 298

Query: 242 XKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKTL 301
            +QL+ FF +  G+ +EEA+R VW VD++GLV   RG  LA+HK YFARDD  G     L
Sbjct: 299 AQQLMSFF-ILQGLPKEEARRRVWFVDSQGLVYNARG-RLAEHKKYFARDDYSGPPMTNL 356

Query: 302 EEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKGT 361
            ++I+YVKPTAL+GLS+  G F  ++I  MA +N  PIIFPLSNP   +EC+F DA++ T
Sbjct: 357 VDIIKYVKPTALLGLSTISGAFTSEVIQTMASINARPIIFPLSNPVRLSECSFNDAVEHT 416

Query: 362 DNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXXX 421
           +  V+FASG+ FPE      G T YPGQGNNMYIFPG+GLGAI+ + K +TD  +     
Sbjct: 417 NGHVLFASGSPFPEQEF--QGSTLYPGQGNNMYIFPGVGLGAIIGRVKSVTDAMVEAASL 474

Query: 422 XXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEVL 481
                           YP + RIR +S              G+ R++ +           
Sbjct: 475 GLADSLTDEERALGLLYPRIERIRDISMHIARAVIEAAQREGVDRNESL----------- 523

Query: 482 KTRKGKEWDNLVKFVQENMWDP 503
              +G     L+  ++E MW P
Sbjct: 524 ---RGLGDAGLLDVIKEKMWSP 542



>gi|320592797|gb|EFX05206.1| NADP-dependent malic enzyme [Grosmannia clavigera kw1407]
          Length = 665

 Score =  421 bits (1083), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 236/465 (50%), Positives = 296/465 (63%), Gaps = 32/465 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR++I    E+ PL+YTPT+G  CL+YS +         P+ LY+++    ++  
Sbjct: 168 NVDLFYRVLIDNAGEMMPLVYTPTIGDVCLQYSTLYTR------PEALYINIKQRKSIRT 221

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I++ + PYP      P + V+TDGSRILGLGDLG+NG+GIP+GKL LY  AAGI P +TL
Sbjct: 222 ILRNW-PYP-----DPDMCVVTDGSRILGLGDLGLNGVGIPIGKLALYTGAAGILPHKTL 275

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GT NE+NLKD  YLG+RSKRV   +   F+D  M++   VYP + +QFEDF SE
Sbjct: 276 PIVLDCGTANEENLKDPLYLGMRSKRVPVSEQEEFMDEFMEACADVYPNMFVQFEDFESE 335

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF  L+KYRE   CFNDDIQGTGAVVL+G++ AV L    V     RL+F         
Sbjct: 336 KAFKYLAKYRETYRCFNDDIQGTGAVVLAGYMGAVGL--SGVPIDDQRLVFMGAGSAGVG 393

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL+E++ V HG++EE A+   WLVDTKGLVT DRGD LA+HK YFAR DN G+QFKT
Sbjct: 394 VAKQLVEYY-VRHGLTEEAARDKFWLVDTKGLVTSDRGDRLAEHKKYFARTDNHGHQFKT 452

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAE------LNKNPIIFPLSNPKVNAECTF 354
           LEEVIEYVKP+AL+GL++T G+F E  +  +        + + PI+FPLSNP   AECTF
Sbjct: 453 LEEVIEYVKPSALVGLTATYGIFTESAVRALKASVEAGGVGRRPILFPLSNPLTKAECTF 512

Query: 355 EDAMKGTDNRVIFASGTAFPEYT----------VPETGK-TKYPGQGNNMYIFPGLGLGA 403
           E A+  TD  VIFASG+ F  YT            +TG  T YP QGNN+YIFPGLGLGA
Sbjct: 513 EQAVDWTDGTVIFASGSPFAPYTTNVASNGTNGTDQTGSVTYYPNQGNNVYIFPGLGLGA 572

Query: 404 ILAKPKVITDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
           ILAK K ITD  +Y                    YP + R+R  S
Sbjct: 573 ILAKAKRITDDMVYTSADSLAHSLSADEVEQGLIYPRIERVREAS 617



>gi|426195337|gb|EKV45267.1| hypothetical protein AGABI2DRAFT_194243 [Agaricus bisporus var.
           bisporus H97]
          Length = 543

 Score =  420 bits (1079), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 226/502 (45%), Positives = 301/502 (59%), Gaps = 31/502 (6%)

Query: 4   LFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQIIK 63
           +FY++ +  + E TP+IYTPTVG ACL+YSHI         P+GL++S+ D  N+ ++I 
Sbjct: 70  VFYKLCLQNMSEFTPIIYTPTVGDACLQYSHIYRR------PEGLFVSIKDKGNIHEVIN 123

Query: 64  TYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPIT 123
            +   P  D    +I+V+TDGSRILGLGDLG+NGM I +GKL LY+A AGI P  T+PI 
Sbjct: 124 NW---PKIDE--ARISVVTDGSRILGLGDLGINGMPIAIGKLSLYIAGAGIRPESTIPIC 178

Query: 124 LDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSEHAF 183
           LDLGTN E+ L+D  YLGLR KR  D +   F+D  M  +   +P+L+IQFEDFS+++AF
Sbjct: 179 LDLGTNTERYLEDPLYLGLRQKRASDQEMTEFMDEFMYEMSVAFPKLMIQFEDFSTDNAF 238

Query: 184 DLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDV-HPT-KHRLLFFXXXXXXXXX 241
             L +YR     FNDDIQGTGAVVLSGF NA K       +P   HR+LFF         
Sbjct: 239 KYLERYRNTYPVFNDDIQGTGAVVLSGFFNAAKHSSAASGNPLDSHRILFFGAGSAGVGV 298

Query: 242 XKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKTL 301
            +QL+ FF +  G+ +EEA+R VW VD++GLV   RG  LA+HK YFARDD  G     L
Sbjct: 299 AQQLMSFF-ILQGLPKEEARRRVWFVDSQGLVYNARG-RLAEHKKYFARDDYSGPPMTNL 356

Query: 302 EEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKGT 361
            ++I+YVKPTAL+GLS+  G F  ++I  MA +N  PIIFPLSNP   +EC+F DA++ T
Sbjct: 357 VDIIKYVKPTALLGLSTISGAFTSEVIQTMASINARPIIFPLSNPVRLSECSFNDAVEHT 416

Query: 362 DNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXXX 421
           +  V+FASG+ FPE      G T YPGQGNNMYIFPG+GLGAI+ + K +TD  +     
Sbjct: 417 NGHVLFASGSPFPEQEF--QGSTLYPGQGNNMYIFPGVGLGAIIGRVKSVTDAMVEAASL 474

Query: 422 XXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEVL 481
                           YP + RIR +S              G+ R++ +           
Sbjct: 475 GLADSLTDEERALGLLYPRIERIRDISMHIARAVIEAAQREGVDRNESL----------- 523

Query: 482 KTRKGKEWDNLVKFVQENMWDP 503
              +G     L+  ++E MW P
Sbjct: 524 ---RGLGDAGLLDVIKEKMWSP 542



>gi|392589134|gb|EIW78465.1| malic enzyme [Coniophora puteana RWD-64-598 SS2]
          Length = 544

 Score =  420 bits (1079), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 227/505 (44%), Positives = 310/505 (61%), Gaps = 31/505 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           ++++FY++ +  + EITPLIYTPTVG ACL++S           P+GL++S+ D   +  
Sbjct: 68  DLNMFYKLCVAHMSEITPLIYTPTVGDACLQFSRNY------RRPEGLFISIKDKGRVGS 121

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++K++ P P D     +I+V+TDGSRILGLGDLGVNGM I +GKL LYVA AGI P  T+
Sbjct: 122 VLKSW-PKPND----ARISVVTDGSRILGLGDLGVNGMPIAIGKLSLYVAGAGIRPNSTV 176

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LDLGT+N++ L D  YLGLR KRV D +   F+D  M  +   +P+LL+QFEDFS++
Sbjct: 177 PICLDLGTDNQEFLDDPLYLGLRQKRVSDQEMNEFMDEFMYEMSITFPKLLVQFEDFSTD 236

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDV-HP-TKHRLLFFXXXXXX 238
           HAF  LS++R+    FNDDIQGTGAVVL+GF+NA  L  K    P T  R+LFF      
Sbjct: 237 HAFAYLSRFRDQYPLFNDDIQGTGAVVLAGFVNAAALSAKASGRPLTDQRILFFGAGSAG 296

Query: 239 XXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQF 298
                QL  FF + +G SE+EA+  +WLVD++GLV   RG  L +HK YF+R+D  G   
Sbjct: 297 VGVAHQLTSFFTL-NGFSEQEARERIWLVDSQGLVYDARG-TLPEHKKYFSRNDYSGPPI 354

Query: 299 KTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAM 358
            +L ++I+YVKPTAL+GLS+    FN+ ++  MA+ N  PIIFPLSNP   +EC+F DA+
Sbjct: 355 TSLLDIIDYVKPTALLGLSTIPNAFNQPVVEAMAKHNPRPIIFPLSNPVRLSECSFADAV 414

Query: 359 KGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYI 418
           + TD +VIFASG+ FPE  +   G+   PGQGNNMYIFPGLGLGAI+++   +TD  +  
Sbjct: 415 QWTDGQVIFASGSPFPE--LQHNGRRLIPGQGNNMYIFPGLGLGAIVSRVTKVTDSMVEA 472

Query: 419 XXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDI 478
                              YP V RIR +S              G+ R   + +M   +I
Sbjct: 473 SALGLASSLTIEERDLDLVYPSVERIRDISARIALNVIRAAQKEGVDRSTDLRKMSDGEI 532

Query: 479 EVLKTRKGKEWDNLVKFVQENMWDP 503
                         +KF+Q+ MW+P
Sbjct: 533 --------------LKFLQQRMWNP 543



>gi|361128581|gb|EHL00513.1| putative NADP-dependent malic enzyme [Glarea lozoyensis 74030]
          Length = 590

 Score =  418 bits (1075), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 221/457 (48%), Positives = 289/457 (63%), Gaps = 36/457 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFYR++I  +E++ PL+YTPT+G                 +P+ LY+S+    ++  
Sbjct: 113 NTDLFYRLLIDNVEQLMPLVYTPTIGD----------------VPEALYISIKQRKSIPT 156

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I++ + PYP      P I V+TDGSRILGLGDLGVNG+GI +GKL LY  AAGI P + L
Sbjct: 157 ILRNW-PYP-----NPSICVVTDGSRILGLGDLGVNGVGISIGKLALYTGAAGIHPEQCL 210

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GT NE NL+D  YLGLR KRV  +    F+D  M ++ +VYP +L+QFEDF +E
Sbjct: 211 PIVLDCGTANEGNLRDPLYLGLRQKRVSPEVALEFMDEFMAAVKEVYPSMLVQFEDFETE 270

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF  L +Y+    CFNDDIQGTGAVVL+G+I AV L    V     +L+F         
Sbjct: 271 KAFQYLERYKMEK-CFNDDIQGTGAVVLAGYIGAVNL--SGVPMEDQKLVFMGAGSAGVG 327

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ++E++    G+SE++A+   +LVDTKGLVT DRGD LA+HK  FAR DN+G+QF+T
Sbjct: 328 VAKQVMEYY-TRRGLSEQQAREKFYLVDTKGLVTYDRGDKLAEHKKIFARKDNNGHQFRT 386

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRM------AELNKNPIIFPLSNPKVNAECTF 354
           LEEVIEYVKPTALIGL++T GVF E ++  +      + L + P++FPLSNP   AECTF
Sbjct: 387 LEEVIEYVKPTALIGLTATFGVFTESVVRALKASVDASGLGRRPVLFPLSNPLTKAECTF 446

Query: 355 EDAMKGTDNRVIFASGTAFPEYTVPETG---KTKYPGQGNNMYIFPGLGLGAILAKPKVI 411
           E A+  TD  VIFASG+ F  +T+ +TG    T YP QGNN+Y+FPGLGLGAILAK   +
Sbjct: 447 EQAVTWTDGTVIFASGSPFAPFTM-KTGDGITTYYPNQGNNVYVFPGLGLGAILAKTTRV 505

Query: 412 TDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
           TD  +Y                    YP + R+R  S
Sbjct: 506 TDAMVYTSAAALSGCLNKEEIQMGLIYPKIQRVRDAS 542



>gi|392561660|gb|EIW54841.1| malic enzyme [Trametes versicolor FP-101664 SS1]
          Length = 543

 Score =  417 bits (1071), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 223/503 (44%), Positives = 304/503 (60%), Gaps = 31/503 (6%)

Query: 3   SLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQII 62
           ++FYR+ +  + E TPLIYTPTVG ACL+YSHI         P+GL++S+ D  N+ +I+
Sbjct: 70  AMFYRLCMANMAEFTPLIYTPTVGDACLQYSHIF------RRPEGLFISIKDKGNIGKIL 123

Query: 63  KTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPI 122
           + +  +  DD    +I+V+TDGSRILGLGDLGVNGM I +GKL LYVA AGI P  T+PI
Sbjct: 124 RNW--HRTDDA---RISVVTDGSRILGLGDLGVNGMPISIGKLSLYVAGAGIRPESTVPI 178

Query: 123 TLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSEHA 182
            LDLGT+N+K L D  YLGLR +R    +   F++  M  +  V+P+LLIQFEDF+++ A
Sbjct: 179 CLDLGTDNQKFLDDPLYLGLRQRRPPMAELEGFMEEFMTEMAAVFPKLLIQFEDFATDKA 238

Query: 183 FDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDV-HP-TKHRLLFFXXXXXXXX 240
           F  L  +R+    FNDDIQGTGAVVLSGF+NA +L       P  +HR+LF         
Sbjct: 239 FAYLEAFRDRYPLFNDDIQGTGAVVLSGFLNAARLSSAASGRPLAEHRILFLGAGSAGVG 298

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
              QL+ FFK++ G+S E+A+  +WLVD++GL+   RG  +A+HK YF+R D +G     
Sbjct: 299 VGMQLMSFFKLQ-GLSTEQAREKIWLVDSQGLIYDGRGP-MAEHKKYFSRKDYNGPPMTN 356

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L ++I YV+PTAL+GLS+T G F++ +I  M+ +N  PIIFPLSNP   +EC F +A++ 
Sbjct: 357 LTDIINYVQPTALLGLSTTKGAFDQSVIETMSAINPRPIIFPLSNPVRLSECEFHEAVEW 416

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           +  +V+FASG+ FPE      G   YPGQGNNMYIFPGLGLGAILA+   +TD  +    
Sbjct: 417 SKGQVLFASGSPFPEEEY--NGHMLYPGQGNNMYIFPGLGLGAILARAAAVTDSMVEASS 474

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YP V RIR +S              G+ R   + +M   +   
Sbjct: 475 LGLANALTEDERAYDLLYPRVERIREISAQIALSVIRAAQKAGVDRSSDLRKMSDKE--- 531

Query: 481 LKTRKGKEWDNLVKFVQENMWDP 503
                      L+ FVQ  MW+P
Sbjct: 532 -----------LLAFVQSKMWNP 543



>gi|156048192|ref|XP_001590063.1| hypothetical protein SS1G_08827 [Sclerotinia sclerotiorum 1980]
 gi|154693224|gb|EDN92962.1| hypothetical protein SS1G_08827 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 600

 Score =  416 bits (1068), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 211/401 (52%), Positives = 270/401 (67%), Gaps = 13/401 (3%)

Query: 48  LYLSLNDLPNLTQIIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQL 107
           LYLS +D  NL +I+  +R    + T      V+TDGSRILGLGDLGVNGMGIPVGKL L
Sbjct: 157 LYLSYHDRGNLAEILSNWRQPEVEMT------VVTDGSRILGLGDLGVNGMGIPVGKLSL 210

Query: 108 YVAAAGIDPRRTLPITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVY 167
           Y   AGI P +TLPITLDLGTNNE  L D  Y+G R KRV   +   F++ +M +L K++
Sbjct: 211 YTGCAGIHPSKTLPITLDLGTNNETFLNDPLYMGNRMKRVSSKEEAEFMEELMVALNKIW 270

Query: 168 PELLIQFEDFSSEHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKH 227
           P +++Q+EDF  ++ F  L+KY+    CFNDDIQGTGAV+L+G INA++     +     
Sbjct: 271 PGIIVQYEDF--KNPFQSLAKYQNQYPCFNDDIQGTGAVILAGIINALR--RTGIPAKDQ 326

Query: 228 RLLFFXXXXXXXXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVY 287
           R +F           +Q++EFF+ E G++E+EA+R  W VDTKGL+T DRGD LA+HKVY
Sbjct: 327 RAVFMGAGSAGVGVAQQIVEFFRKE-GLTEDEARRCFWFVDTKGLITNDRGDKLAEHKVY 385

Query: 288 FARDDNDGNQFKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPK 347
           F+RDDN+G QFKTL EV+EYVKPT L+GLS+  G+F+E I+ +MA+LNKNPIIFPLSNP 
Sbjct: 386 FSRDDNEGKQFKTLPEVVEYVKPTILMGLSTIRGIFDESIVKKMAKLNKNPIIFPLSNPS 445

Query: 348 VNAECTFEDAMKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAK 407
             AECTFE+AMK TD R +FASG+ FP+Y      KT   GQGNNMY+FPG+GLG+IL K
Sbjct: 446 SQAECTFEEAMKWTDCRALFASGSPFPDYV--HDDKTYSAGQGNNMYVFPGIGLGSILCK 503

Query: 408 PKVITDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
              I  + IY                    YP ++RIR VS
Sbjct: 504 TSCINQEMIYASAEALSTSLTPSEISSGRLYPKLNRIREVS 544



>gi|302676053|ref|XP_003027710.1| hypothetical protein SCHCODRAFT_79137 [Schizophyllum commune H4-8]
 gi|300101397|gb|EFI92807.1| hypothetical protein SCHCODRAFT_79137 [Schizophyllum commune H4-8]
          Length = 609

 Score =  415 bits (1067), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 225/501 (44%), Positives = 310/501 (61%), Gaps = 31/501 (6%)

Query: 5   FYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQIIKT 64
           F+++ +  + E TP+IYTPTVG ACL++S+I         PDGL++S+ D  ++ ++++ 
Sbjct: 137 FFKLCMNYMSECTPIIYTPTVGDACLQFSNIY------RRPDGLFVSIKDKGSIGEVLRN 190

Query: 65  YRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPITL 124
           + P   D     +I+V+TDGSRILGLGDLGVNGM I VGKL LYVA AGI P  T+PI L
Sbjct: 191 W-PRMED----ARISVVTDGSRILGLGDLGVNGMPISVGKLSLYVAGAGIRPHSTVPICL 245

Query: 125 DLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSEHAFD 184
           DLGTNN++NL D FYLGLR  RV + +   F+D  M  +   +P+LL+QFEDFS++HAF 
Sbjct: 246 DLGTNNQQNLADPFYLGLRQPRVSEQEMDEFMDEFMHEMRVNFPKLLVQFEDFSTDHAFG 305

Query: 185 LLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDV-HP-TKHRLLFFXXXXXXXXXX 242
            L++YR     FNDDIQGTGAVVLSGFINA +L       P T  R+LFF          
Sbjct: 306 YLARYRHKYPVFNDDIQGTGAVVLSGFINAARLSSAASGRPLTDQRVLFFGAGSAGVGVA 365

Query: 243 KQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKTLE 302
           +QL+ FF + +G+SEEEA+  ++LVD++GLV   RG  L +HK YF+R D  G   K+L 
Sbjct: 366 QQLMSFFTL-NGLSEEEARERIYLVDSQGLVYDGRG-KLQEHKKYFSRKDYTGPPMKSLL 423

Query: 303 EVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKGTD 362
           +++++VKPTAL+GLS+    F  ++I RM+ELN  PIIFPLSNP   +EC+FE A+  +D
Sbjct: 424 DIVDHVKPTALLGLSTITDAFTPEVIRRMSELNPRPIIFPLSNPVRLSECSFESAVAHSD 483

Query: 363 NRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXXXX 422
            RV+FASG+ F    +   G+T YPGQGNNMYIFPGLGLG ILA+   +TD  +      
Sbjct: 484 GRVLFASGSPF--EPIDFNGRTLYPGQGNNMYIFPGLGLGCILARVSAVTDSMVEASSLG 541

Query: 423 XXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEVLK 482
                          YP + RIR +S              G+ +++ +            
Sbjct: 542 LANSLTEDERAHDLLYPRIERIREISAANAAAVIRAAQKAGVDQNEGL------------ 589

Query: 483 TRKGKEWDNLVKFVQENMWDP 503
             +G   D L+++V++ MW P
Sbjct: 590 --RGLSDDELLEYVKQKMWSP 608



>gi|299742234|ref|XP_001832332.2| malate dehydrogenase [Coprinopsis cinerea okayama7#130]
 gi|298405090|gb|EAU89493.2| malate dehydrogenase [Coprinopsis cinerea okayama7#130]
          Length = 559

 Score =  415 bits (1067), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 229/523 (43%), Positives = 309/523 (59%), Gaps = 49/523 (9%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           +  LFY++ +  + EITP+IYTPTVG AC+++SHI         P+GLY+S+ D   + Q
Sbjct: 66  DAPLFYKLCLENMSEITPIIYTPTVGDACIQFSHIYRR------PEGLYVSIKDKGQIKQ 119

Query: 61  IIKTYRPYPYDDTLTPQIAVITDG------------------SRILGLGDLGVNGMGIPV 102
           +I  + P  ++     +I+V+TDG                  SRILGLGDLGVNGMGI +
Sbjct: 120 VIANW-PKIHE----ARISVVTDGEQISGLLSSDFDLSLELGSRILGLGDLGVNGMGISI 174

Query: 103 GKLQLYVAAAGIDPRRTLPITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKS 162
           GKL LYVA AGI P  T+PIT+DLGTNNE  L D FYLGLR KR+   +   F+D  M  
Sbjct: 175 GKLSLYVAGAGIRPESTVPITVDLGTNNETFLNDPFYLGLRQKRITGPEMDEFMDEFMHE 234

Query: 163 LLKVYPELLIQFEDFSSEHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVE--K 220
           +   +P+++IQFEDFS+++AF  L +YR     FNDDIQGTGAVVLSGF+NA +L     
Sbjct: 235 MSMAFPKMMIQFEDFSTDNAFRYLERYRRKYPVFNDDIQGTGAVVLSGFLNAAQLSSDAS 294

Query: 221 DVHPTKHRLLFFXXXXXXXXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDN 280
            +  ++HR+LFF           QL+ FF ++ G+S EEA+  +WL+D++GLV   RG  
Sbjct: 295 GMPMSEHRILFFGAGSAGVGVATQLMSFFTLQ-GLSVEEARSRIWLIDSQGLVYDGRG-R 352

Query: 281 LAKHKVYFARDDNDGNQFKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPII 340
           LA+HK YF+R D +G     + ++I+YVKPTAL+GLS+  G F  ++I  MA +N  PII
Sbjct: 353 LAEHKKYFSRKDYNGPPMTNILDIIDYVKPTALLGLSTISGAFTPEVIQAMAAINPRPII 412

Query: 341 FPLSNPKVNAECTFEDAMKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLG 400
           FPLSNP   +EC+F DA+K T+  V+FASG+ FPE    +     YPGQGNNMYIFPG+G
Sbjct: 413 FPLSNPVRLSECSFADAVKYTNGNVLFASGSPFPEQQYGD--HILYPGQGNNMYIFPGIG 470

Query: 401 LGAILAKPKVITDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXX 460
           LGAILA+   +TD  +                     YP V RIR +S            
Sbjct: 471 LGAILARASQVTDSMVEASSLGLANSLTEDERALDLLYPRVERIREISAHIARQVIRAAQ 530

Query: 461 XXGLARDKQIIEMVQNDIEVLKTRKGKEWDNLVKFVQENMWDP 503
             G+ R + + +M  ND E            L+ FV+  MW P
Sbjct: 531 KAGVDRSEALRKM--NDAE------------LLAFVKRKMWKP 559



>gi|389751270|gb|EIM92343.1| malic enzyme [Stereum hirsutum FP-91666 SS1]
          Length = 543

 Score =  414 bits (1065), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 228/503 (45%), Positives = 300/503 (59%), Gaps = 31/503 (6%)

Query: 3   SLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQII 62
           ++FYR+ +  + E TP+IYTPTVG ACL++SHI         P+GLY+S+ D   +  I+
Sbjct: 70  NMFYRLCLMNMAEFTPIIYTPTVGDACLQHSHIFRR------PEGLYISIQDKGKIGSIL 123

Query: 63  KTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPI 122
           + + P   D     +I+V+TDGSRILGLGDLGVNGM I +GKL LYVA AGI P  T+PI
Sbjct: 124 RNW-PRSKD----ARISVVTDGSRILGLGDLGVNGMPISIGKLSLYVAGAGIRPSSTIPI 178

Query: 123 TLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSEHA 182
            LDLGTN ++ L D  YLGLR KRV DD    F++  M  +   +P+LL+QFEDFS++HA
Sbjct: 179 CLDLGTNTQRYLDDPLYLGLRHKRVSDDVMTEFMEEFMHEMSVNFPKLLVQFEDFSTDHA 238

Query: 183 FDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDV-HP-TKHRLLFFXXXXXXXX 240
           F  L K+R     FNDDIQGTGAVVLSGFINA KL       P ++HR+LF         
Sbjct: 239 FLYLEKFRHRYPLFNDDIQGTGAVVLSGFINAAKLSSAASGRPLSEHRILFLGAGSAGVG 298

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
              QL+ FFK++ G+SE EA+  ++LVD++GL+   RG  +A+HK YF+R D  G     
Sbjct: 299 VAMQLMSFFKLQ-GLSEAEARSRIYLVDSQGLIFDSRGP-MAEHKKYFSRSDYHGPPMTD 356

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L ++I +VKPTAL GLS+    FN+ ++  MA LN  PIIFPLSNP   +EC F DA++ 
Sbjct: 357 LVDIIGHVKPTALFGLSTIKNAFNQSVVETMAALNPRPIIFPLSNPVRLSECEFHDAIEW 416

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           T   V+FASG+ FPE +    GK  YPGQGNNMY+FPG+GLGAIL + K +TD  +    
Sbjct: 417 TQGSVLFASGSPFPEESF--NGKMLYPGQGNNMYVFPGMGLGAILCQTKTMTDSMVEAAS 474

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YP + RIR +S              G+ R          D+  
Sbjct: 475 LGLADSLTQSEKKDDLIYPRLERIREISAFIAFRVIRKAQEEGVDR--------LTDLRA 526

Query: 481 LKTRKGKEWDNLVKFVQENMWDP 503
           L        D L+K +Q  MW+P
Sbjct: 527 LSD------DKLMKHIQSRMWNP 543



>gi|395326905|gb|EJF59309.1| malic enzyme [Dichomitus squalens LYAD-421 SS1]
          Length = 554

 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 226/503 (44%), Positives = 303/503 (60%), Gaps = 31/503 (6%)

Query: 3   SLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQII 62
           ++FYR+ +  + E TPLIYTPTVG AC++YSHI         P+GL++S+ D   + QI+
Sbjct: 81  NMFYRLCLTNMAEFTPLIYTPTVGDACIQYSHIYRR------PEGLFISIKDKGRIGQIL 134

Query: 63  KTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPI 122
              R +P  +    +I+V+TDGSRILGLGDLGVNGM I +GKL LYVA AGI P  T+PI
Sbjct: 135 ---RNWPRKNE--ARISVVTDGSRILGLGDLGVNGMPISIGKLSLYVAGAGIRPESTIPI 189

Query: 123 TLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSEHA 182
            LDLGT+ ++ L D  YLGLR KRV       F+D  M  + K +P+LLIQFEDF+++ A
Sbjct: 190 CLDLGTDTQRYLDDPLYLGLRQKRVPMAVMDEFMDEFMGEMAKAFPKLLIQFEDFATDKA 249

Query: 183 FDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDV-HP-TKHRLLFFXXXXXXXX 240
           F  L ++R+    FNDDIQGTGAVVLSGFINA KL       P + HR+LF         
Sbjct: 250 FAYLDRFRDRYPLFNDDIQGTGAVVLSGFINAAKLSSAASGRPLSDHRILFLGAGSAGVG 309

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
              QL  FF ++ G+S+EEA+  ++LVD++GLV   RG  +A+HK YF+R D +G     
Sbjct: 310 VAMQLQSFFMLQ-GLSKEEARSRIYLVDSQGLVFDGRGP-MAEHKKYFSRKDYNGPALTN 367

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L E+I+++KPTAL+GLS+T G FN+ +I  M+ LN  PIIFPLSNP   +EC F +A++ 
Sbjct: 368 LTEIIKFIKPTALMGLSTTKGAFNQSVIEAMSALNPRPIIFPLSNPVRLSECEFHEAVEW 427

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           +   V+FASG+ FPE      G+T YPGQGNNMYIFPGLGLGAIL++   +TD  +    
Sbjct: 428 SKGNVLFASGSPFPEQDY--NGRTLYPGQGNNMYIFPGLGLGAILSRASAVTDSMVEASS 485

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YP + RIR +S              G+ R   +          
Sbjct: 486 LGLAESLTPDERADDLLYPRIERIREISADIALAVIRAAQKAGVDRSADL---------- 535

Query: 481 LKTRKGKEWDNLVKFVQENMWDP 503
               + K    L+ FV+E MW+P
Sbjct: 536 ----RRKSDAELLAFVKERMWNP 554



>gi|164658389|ref|XP_001730320.1| hypothetical protein MGL_2702 [Malassezia globosa CBS 7966]
 gi|159104215|gb|EDP43106.1| hypothetical protein MGL_2702 [Malassezia globosa CBS 7966]
          Length = 467

 Score =  413 bits (1061), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 222/490 (45%), Positives = 298/490 (60%), Gaps = 29/490 (5%)

Query: 18  PLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQIIKTYRPYPYDDTLTPQ 77
           PL+YTPTVG ACL +S +         P+GL LS++D   + + I+ + P P D    P+
Sbjct: 5   PLVYTPTVGDACLNFSRMFRR------PEGLTLSIDDKGAIEKCIENW-PRPAD---APR 54

Query: 78  IAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPITLDLGTNNEKNLKDE 137
           +AVITDGSRILGLGDLG NGMGI +GKL LYVA AG+ P+  +PI +D+GT+NE+ L D 
Sbjct: 55  VAVITDGSRILGLGDLGWNGMGIAIGKLSLYVAGAGVHPQSVMPIAVDVGTDNEELLNDP 114

Query: 138 FYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSEHAFDLLSKYRENTFCFN 197
            YLGLR +R   ++   FVD +M+ L   YP L+IQFED+SSEHAF  L +Y++    FN
Sbjct: 115 MYLGLRRRRPSTEELVEFVDEIMEKLHAHYPSLIIQFEDWSSEHAFMFLDRYKDKYPMFN 174

Query: 198 DDIQGTGAVVLSGFINAVKLVEKDVHPTK-HRLLFFXXXXXXXXXXKQLLEFFKVEHGMS 256
           DDIQGTGAV+L+G I+A +LVEK+   +  HR+L            KQL+ FF + +GMS
Sbjct: 175 DDIQGTGAVILAGLISATRLVEKETKKSSDHRILMVGAGSASVGVAKQLMSFFTL-NGMS 233

Query: 257 EEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKTLEEVIEYVKPTALIGL 316
             EA+  +W  D+KGLVT++RGD L  +K YFAR DN   Q K L ++I+YVKPT L+GL
Sbjct: 234 --EARLRIWTTDSKGLVTMNRGDKLPDYKQYFARRDNGDMQLKELSDIIDYVKPTVLLGL 291

Query: 317 SSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKGTDNRVIFASGTAFPEY 376
           S+  G+F+EKI+ +MA+LN+ PIIFPLSNP   +ECTFE+A+  TD R +FA+G+ F   
Sbjct: 292 STIHGLFDEKILRKMADLNERPIIFPLSNPTSKSECTFEEALTHTDGRCVFAAGSPFG-- 349

Query: 377 TVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXXXXXXXXXXXXXXXXXX 436
           TV   GK ++  QGNN YIFPGLGL   L K K +  K I                    
Sbjct: 350 TVNFHGKQRFADQGNNFYIFPGLGLAGALVKAKHMDHKVITEAAVALADSMTKDEVDEGR 409

Query: 437 XYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEVLKTRKGKEWDNLVKFV 496
            YP + R+R +S              GL RD  I   + +             D L ++V
Sbjct: 410 LYPKLGRVREISQYVAFRCIKVLNKDGLCRDDGITASMSD-------------DELFRYV 456

Query: 497 QENMWDPDSE 506
            ++MW+P  E
Sbjct: 457 GDHMWEPHYE 466



>gi|393213749|gb|EJC99244.1| hypothetical protein FOMMEDRAFT_142841 [Fomitiporia mediterranea
           MF3/22]
          Length = 546

 Score =  411 bits (1056), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 223/489 (45%), Positives = 307/489 (62%), Gaps = 19/489 (3%)

Query: 4   LFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQIIK 63
           +FY + +  + EITPLIYTPTVG AC+++SHI         P+G+++S+ D  N+  I+ 
Sbjct: 72  MFYHLCVDNMTEITPLIYTPTVGDACIQFSHIYRR------PEGIFVSIEDRGNIRSILN 125

Query: 64  TYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPIT 123
           ++   P  +    +I+V+TDGSRILGLGDLGVNGM I VGKL LYVA AGI P  T+PI 
Sbjct: 126 SW---PRKEE--ARISVVTDGSRILGLGDLGVNGMPISVGKLSLYVAGAGIRPSSTIPIC 180

Query: 124 LDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSEHAF 183
           LDLGTNNEK L D  YLG+R +RV D++   F++  M  + + +P+LL+QFEDFS+++AF
Sbjct: 181 LDLGTNNEKFLDDPLYLGMRRRRVSDEEMSEFMEEFMYEMHRAFPKLLVQFEDFSTDNAF 240

Query: 184 DLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHP--TKHRLLFFXXXXXXXXX 241
             L  +R+    FNDDIQGTGAVVLSGF+NA KL            R+LF          
Sbjct: 241 KYLDAFRDRYPVFNDDIQGTGAVVLSGFVNAAKLASAAAGTPLQDQRILFLGAGSAGVGV 300

Query: 242 XKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKTL 301
             QL+ FF +  GMS+EEA+R +WLVD++GL+  +RG +LA+HK YF+RDD  G   K L
Sbjct: 301 AMQLMSFFTL-LGMSKEEARRRIWLVDSQGLIYNERG-SLAEHKKYFSRDDYSGPPLKNL 358

Query: 302 EEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKGT 361
            ++IEY++PTAL+GLS+  G FN++++  M+ +N  PIIFPLSNP   +EC F++A++ +
Sbjct: 359 VDIIEYIRPTALLGLSTINGAFNKEVVETMSRINARPIIFPLSNPVRLSECQFDEAVEWS 418

Query: 362 DNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXXX 421
           D RV+FASG+ FP+      GK  YPGQGNNMYIFPGLGLGAIL++   ++D+ +     
Sbjct: 419 DGRVVFASGSPFPQLNY--KGKDYYPGQGNNMYIFPGLGLGAILSRAAKVSDRMVEAASL 476

Query: 422 XXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEVL 481
                           YP V RIR +S              G   D+ +    +ND E+ 
Sbjct: 477 ALADSLTEEERSLDMVYPRVERIREISVHIAVRVIRTAQKDGT--DQSVYLRSKNDEELF 534

Query: 482 KTRKGKEWD 490
              K K W+
Sbjct: 535 AYVKSKMWN 543



>gi|358058521|dbj|GAA95484.1| hypothetical protein E5Q_02138 [Mixia osmundae IAM 14324]
          Length = 692

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 217/487 (44%), Positives = 297/487 (60%), Gaps = 22/487 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFYR++I  + E+  L+YTPT+G ACL +SHI  +     + +GLYLS +D  +L  
Sbjct: 194 NTDLFYRLLIDHISELLGLVYTPTIGLACLSFSHIFAY-----VDNGLYLSWHDKGHLQD 248

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           II +Y   P +    PQIAV TDGSRILGLGDLGVNGMGIP+GKL LYVA AGIDP RTL
Sbjct: 249 IINSY---PGE---APQIAVATDGSRILGLGDLGVNGMGIPIGKLSLYVACAGIDPSRTL 302

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI  DLGT N KNL+D  Y+G++  RV ++Q   F+   M ++ K +P+L++QFED ++E
Sbjct: 303 PIVFDLGTANAKNLQDPLYVGIKQPRVSNEQAQEFISEFMVAVSKRWPQLIVQFEDLNTE 362

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTK-HRLLFFXXXXXXX 239
            AFD+L+  RE   CFNDDIQGT AV L+G INA+K   +   P + H+L+FF       
Sbjct: 363 LAFDVLASQREQYPCFNDDIQGTAAVCLAGIINAIK---QSGSPLRDHKLVFFGAGSAAV 419

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK 299
              + + E F V+ G+ EE A+R+ WLVD+KGLV  +RGD L  HKVYF+R + D  +  
Sbjct: 420 GIAQLICEHF-VKQGVPEETARRMFWLVDSKGLVADNRGDKLPAHKVYFSRPEADAPRLT 478

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
           TL  V+++V+PTAL+GLS+ G  F E I+  MAE+   PIIFPLSNP   +ECTF +AM 
Sbjct: 479 TLLSVVQHVRPTALLGLSTVGSTFTEDIVRFMAEIQHAPIIFPLSNPSSKSECTFREAMT 538

Query: 360 GTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIX 419
            ++ R IFASG+ +P    P  GK     QGNN++ FPGLGLG I+A+   I +  ++  
Sbjct: 539 WSEGRAIFASGSPWPSERWP--GKNN---QGNNVFSFPGLGLGCIMAQVTKIPEGLVHTA 593

Query: 420 XXXXXXXXXXXXXXX-XXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDI 478
                              YP + RIR +S              G+  +K +  M   ++
Sbjct: 594 AESLSISMNEEERNTPGMLYPSLPRIREISAVIAREVVKTAQALGVDGNKDLKGMTDAEM 653

Query: 479 EVLKTRK 485
           +    ++
Sbjct: 654 DAYIAKR 660



>gi|403157826|ref|XP_003890783.1| malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+), variant
           [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
 gi|375163567|gb|EHS62466.1| malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+), variant
           [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
          Length = 600

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 233/450 (51%), Positives = 296/450 (65%), Gaps = 17/450 (3%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV+LFY +++    E+ PL+YTP VG AC+++SHI         P+GLY+S ND   +  
Sbjct: 111 NVNLFYHVLLTNTSEVVPLVYTPVVGEACIKWSHIYQR------PEGLYVSWNDRGCIRD 164

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++K + P P +     +I V+TDGSRILGLGDLGV GMGI VGKL LYVAAAGI P  T+
Sbjct: 165 VLKNW-PLPEE----ARICVVTDGSRILGLGDLGVGGMGISVGKLSLYVAAAGIRPWATV 219

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI +DLGT+NEKNL D  YLGLR KR   ++   F+D  M ++   +PEL+IQ EDF++E
Sbjct: 220 PICIDLGTDNEKNLTDPLYLGLRMKRRSKEEALEFMDEFMAAVHAEFPELVIQHEDFATE 279

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVK--LVEKDVHPTKHRLLFFXXXXXX 238
            AFD L +Y+ +   FNDDIQGTGAV+L GFINA +             R++F       
Sbjct: 280 RAFDYLKRYQHSYPMFNDDIQGTGAVILGGFINAARHSASASGKELRDQRIVFMGAGSAG 339

Query: 239 XXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQF 298
               KQLL FF +  G+SEEEAK  VWLVDTKGLVTLDRGD LA HK +FAR    G+Q 
Sbjct: 340 VGVAKQLLSFF-INLGLSEEEAKERVWLVDTKGLVTLDRGDKLAAHKTFFARQPG-GSQI 397

Query: 299 KTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAM 358
           KTL EVI++VKPTALIGL++T  +F+E ++  MAELN  PIIFPLSNP   AECTF++A+
Sbjct: 398 KTLIEVIQHVKPTALIGLAATAHLFDEAVVKLMAELNPRPIIFPLSNPVHLAECTFDEAV 457

Query: 359 KGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYI 418
           K TD +V+FASG+ F   +    G T  PGQGNNMY+FPG+GLGAILA+ K I+DK I  
Sbjct: 458 KWTDGQVLFASGSPFA--SCGWRGHTIEPGQGNNMYVFPGIGLGAILARVKTISDKMIEA 515

Query: 419 XXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                              YP ++RIR +S
Sbjct: 516 SALALSDSLTDEEKADGLLYPRLNRIRDIS 545



>gi|403157828|ref|XP_003307217.2| malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+)
           [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
 gi|375163568|gb|EFP74211.2| malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+)
           [Puccinia graminis f. sp. tritici CRL 75-36-700-3]
          Length = 629

 Score =  410 bits (1054), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 233/450 (51%), Positives = 296/450 (65%), Gaps = 17/450 (3%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV+LFY +++    E+ PL+YTP VG AC+++SHI         P+GLY+S ND   +  
Sbjct: 140 NVNLFYHVLLTNTSEVVPLVYTPVVGEACIKWSHIYQR------PEGLYVSWNDRGCIRD 193

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++K + P P +     +I V+TDGSRILGLGDLGV GMGI VGKL LYVAAAGI P  T+
Sbjct: 194 VLKNW-PLPEE----ARICVVTDGSRILGLGDLGVGGMGISVGKLSLYVAAAGIRPWATV 248

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI +DLGT+NEKNL D  YLGLR KR   ++   F+D  M ++   +PEL+IQ EDF++E
Sbjct: 249 PICIDLGTDNEKNLTDPLYLGLRMKRRSKEEALEFMDEFMAAVHAEFPELVIQHEDFATE 308

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVK--LVEKDVHPTKHRLLFFXXXXXX 238
            AFD L +Y+ +   FNDDIQGTGAV+L GFINA +             R++F       
Sbjct: 309 RAFDYLKRYQHSYPMFNDDIQGTGAVILGGFINAARHSASASGKELRDQRIVFMGAGSAG 368

Query: 239 XXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQF 298
               KQLL FF +  G+SEEEAK  VWLVDTKGLVTLDRGD LA HK +FAR    G+Q 
Sbjct: 369 VGVAKQLLSFF-INLGLSEEEAKERVWLVDTKGLVTLDRGDKLAAHKTFFARQPG-GSQI 426

Query: 299 KTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAM 358
           KTL EVI++VKPTALIGL++T  +F+E ++  MAELN  PIIFPLSNP   AECTF++A+
Sbjct: 427 KTLIEVIQHVKPTALIGLAATAHLFDEAVVKLMAELNPRPIIFPLSNPVHLAECTFDEAV 486

Query: 359 KGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYI 418
           K TD +V+FASG+ F   +    G T  PGQGNNMY+FPG+GLGAILA+ K I+DK I  
Sbjct: 487 KWTDGQVLFASGSPFA--SCGWRGHTIEPGQGNNMYVFPGIGLGAILARVKTISDKMIEA 544

Query: 419 XXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                              YP ++RIR +S
Sbjct: 545 SALALSDSLTDEEKADGLLYPRLNRIRDIS 574



>gi|393237840|gb|EJD45380.1| malic enzyme [Auricularia delicata TFB-10046 SS5]
          Length = 546

 Score =  408 bits (1048), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 223/502 (44%), Positives = 302/502 (60%), Gaps = 32/502 (6%)

Query: 4   LFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQIIK 63
           +F++I +  + E+TPLIYTPTVG ACL+YS      A    P+GL++S  D  ++ ++I 
Sbjct: 73  MFFKITLENMAEVTPLIYTPTVGDACLQYS------ANFRRPEGLFVSYKDKGSIGKVI- 125

Query: 64  TYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPIT 123
             R +P  +    +IAV+TDGSRILGLGDLGVNGM I +GKL LYVA AGI P  TLPI 
Sbjct: 126 --RNWPRREE--ARIAVVTDGSRILGLGDLGVNGMPISIGKLSLYVAGAGIRPESTLPIC 181

Query: 124 LDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSEHAF 183
           LDLGTNNEK L D  YLG+R KRV D +   F+D  M  +  V+P+LL+QFEDFS++HAF
Sbjct: 182 LDLGTNNEKFLNDPLYLGMRRKRVSDAEMDEFMDEFMHEMSVVFPKLLVQFEDFSTDHAF 241

Query: 184 DLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKL-VEKDVHP-TKHRLLFFXXXXXXXXX 241
             L+++RE    FNDDIQGTGAVVLSGF+NA +L  E    P + HR+LF          
Sbjct: 242 AYLARFRERYPLFNDDIQGTGAVVLSGFLNAAQLSSEASGRPLSDHRILFLGSGSAGVGV 301

Query: 242 XKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKTL 301
             QL+ FF +  G++ EEA+  ++ +D++GL+T DR   LA+HK +FAR   D    K L
Sbjct: 302 GMQLMSFFTLIAGLTPEEARSRIYYIDSQGLITADR-KGLAEHKKFFAR--TDCPPLKDL 358

Query: 302 EEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKGT 361
            ++I YVKPTAL+GLS+    F  +++  M+ LN+ PI+FPLSNP   +EC F DA+  +
Sbjct: 359 VDIIGYVKPTALLGLSTIKNAFTREVVEAMSSLNERPIVFPLSNPVALSECEFADAVAWS 418

Query: 362 DNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXXX 421
           + RVIFASG+ FP+ T    G+    GQGNNMY+FPGLGLGAILA+   ++D  +     
Sbjct: 419 EGRVIFASGSPFPQLTY--NGRDYVAGQGNNMYVFPGLGLGAILARASSVSDSMVEAASL 476

Query: 422 XXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEVL 481
                           YP + RIR +S              G+ R+  +           
Sbjct: 477 ALANALTDDERAAGLIYPRLERIREISVGIAAAVVREAQKRGVDRNSAL----------- 525

Query: 482 KTRKGKEWDNLVKFVQENMWDP 503
              +G   + L  +V+E MW P
Sbjct: 526 ---RGMRPEELEAWVKERMWQP 544



>gi|336375547|gb|EGO03883.1| hypothetical protein SERLA73DRAFT_165450 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336388664|gb|EGO29808.1| hypothetical protein SERLADRAFT_359663 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 543

 Score =  407 bits (1046), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 222/503 (44%), Positives = 304/503 (60%), Gaps = 31/503 (6%)

Query: 3   SLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQII 62
           ++FY++ +  + EITPL+YTPTVG ACL++S    F  P    +GL++S+ D   +  I+
Sbjct: 70  NIFYKLCLANMPEITPLVYTPTVGDACLQFSR--NFRRP----EGLFISIKDKGKIGAIL 123

Query: 63  KTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPI 122
           + +     D+    +I+V+TDGSRILGLGDLGVNGM I +GKL LYVA AGI P  T+PI
Sbjct: 124 RNWSRK--DEA---RISVVTDGSRILGLGDLGVNGMPISIGKLSLYVAGAGIRPSSTIPI 178

Query: 123 TLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSEHA 182
            LDLGTNN+  L D  YLGLR KR  D++  +F+D  M  +   +P+LL+QFEDFS++HA
Sbjct: 179 CLDLGTNNQAFLDDPLYLGLRQKRGSDEEMTAFMDEFMHEMSVTFPKLLVQFEDFSTDHA 238

Query: 183 FDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKL-VEKDVHP-TKHRLLFFXXXXXXXX 240
           F  L ++R     FNDDIQGTGAVVL+GFINA +L  +    P T HR+LF         
Sbjct: 239 FMYLERFRNQYPLFNDDIQGTGAVVLAGFINAARLSSQASGRPLTSHRILFLGAGSAGVG 298

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
              QLL FF    G+S +EA++ +WLVD++GLV   RG  +A+HK YF+R D  G+    
Sbjct: 299 VAMQLLSFF-TNAGLSVDEARKRIWLVDSQGLVYNGRG-AMAEHKKYFSRQDYTGSPITN 356

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L ++I YVKPTAL+GLS+    FN+++I  MA LN+ PI+FPLSNP   +EC F +A++ 
Sbjct: 357 LVDIISYVKPTALLGLSTIKSAFNQQVIKTMATLNEKPIVFPLSNPVRLSECEFGEAVEW 416

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           +   VIFASG+ FPE  +   G+T  PGQGNNMYIFPGLGLGAIL++   +TD  +    
Sbjct: 417 SQGSVIFASGSPFPE--MEYNGRTLIPGQGNNMYIFPGLGLGAILSRASSVTDSMVEASA 474

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YP + RIR +S              G+ R K + ++   D   
Sbjct: 475 LGLANSLTPEEHKLDLVYPRIERIRDISADIALQVIRASQKAGVDRSKDLRKLSDVD--- 531

Query: 481 LKTRKGKEWDNLVKFVQENMWDP 503
                      L+ F+++ MW P
Sbjct: 532 -----------LLAFIKKMMWIP 543



>gi|378733260|gb|EHY59719.1| malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+)
           [Exophiala dermatitidis NIH/UT8656]
          Length = 603

 Score =  407 bits (1045), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 232/506 (45%), Positives = 309/506 (61%), Gaps = 33/506 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR++     E+TPL+YTPTVG AC  +S I         P+G+YLS +D  +L+ 
Sbjct: 110 NVHLFYRLLTDHFTELTPLVYTPTVGEACQRWSEIY------QQPEGMYLSFDDRGHLSS 163

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           II+ + P P       +I V+TDGSRILGLGDLGV GMGIP+GKL LY   AGI P  TL
Sbjct: 164 IIQNW-PQP-----NVEITVVTDGSRILGLGDLGVGGMGIPIGKLALYTGCAGIRPEVTL 217

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+T+DLGT+N++  +D  Y+G R  +V  ++   F+D +M +L + +P+++IQFED+  +
Sbjct: 218 PLTVDLGTSNKELREDPLYMGSRRDKVTPEEEKEFLDELMAALKERWPDIVIQFEDW--K 275

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L +YR++   FNDDIQGTGAV++ G I AVK  +  V P  HR +F         
Sbjct: 276 NPFPSLERYRQDYAMFNDDIQGTGAVIMGGVIGAVK--QSGVAPKDHRAVFLGSGSAGVG 333

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ++E+F  E G++EEEAK   WLVD+KGLVT DRGD LA HK+YF+R DN+G QFKT
Sbjct: 334 VAKQIVEYFMHE-GLTEEEAKSCFWLVDSKGLVTQDRGDKLADHKIYFSRTDNNGQQFKT 392

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L+EVIEYVKPT L+GLS+ GG F  +I+ +M + N  PIIFPLSNP   +ECTFEDA+  
Sbjct: 393 LDEVIEYVKPTILMGLSTIGGAFTPEILQKMGKWNNRPIIFPLSNPSSKSECTFEDAITH 452

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           TD R +FASG+ F    VP  GK  +PGQGNNMY+FPG+GLG IL+K   +T   +Y   
Sbjct: 453 TDGRALFASGSPF--QPVPYKGKIYHPGQGNNMYVFPGIGLGTILSKAVQVTPNMVYASG 510

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YP ++RIR VS               + R   + EM    +E 
Sbjct: 511 EALPTMITEEEKELALLYPSITRIRDVSARVALYVIRAAQRDNVDRIHHLREMSDEALE- 569

Query: 481 LKTRKGKEWDNLVKFVQENMWDPDSE 506
                  EW      ++  M+DP  E
Sbjct: 570 -------EW------IKGKMYDPHQE 582



>gi|328859767|gb|EGG08875.1| hypothetical protein MELLADRAFT_47694 [Melampsora larici-populina
           98AG31]
          Length = 573

 Score =  406 bits (1043), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 233/452 (51%), Positives = 298/452 (65%), Gaps = 21/452 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV+LFY +++    E+ PL+YTP VG AC+++SHI         P+GLY+S ND  ++ +
Sbjct: 84  NVNLFYHVLLKNTAEVVPLVYTPVVGEACIKWSHIYQR------PEGLYVSWNDRGSIKE 137

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++  + P P +     +I V+TDGSRILGLGDLG+ GMGI VGKL LYVAAAGI P  T+
Sbjct: 138 VLGNW-PMPEE----ARICVVTDGSRILGLGDLGIGGMGISVGKLSLYVAAAGIRPWATV 192

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI +DLGT+NEKNL D FYLGLR KR    +   F+D  M+++   +PEL+IQ EDF++E
Sbjct: 193 PICIDLGTDNEKNLSDPFYLGLRMKRRSKAEAEVFMDEFMEAVHATFPELVIQHEDFATE 252

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKL----VEKDVHPTKHRLLFFXXXX 236
            AFD L KY+     FNDDIQGTGAV+L GFINA +L     ++D+     R++F     
Sbjct: 253 RAFDYLEKYQPKYPMFNDDIQGTGAVILGGFINAARLSAAASKRDLK--DQRIVFMGAGS 310

Query: 237 XXXXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGN 296
                 KQLL FF    GM+EEEAK  VWLVDTKGLVT DRGD LA HKV+FAR    G 
Sbjct: 311 AGVGVAKQLLSFF-CNWGMTEEEAKERVWLVDTKGLVTEDRGDRLAAHKVFFARKAG-GP 368

Query: 297 QFKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFED 356
           QFK+L +VI  +KPTALIGL++T  +F+E ++  MAE N  PIIFPLSNP   AECTFE+
Sbjct: 369 QFKSLIDVIRSIKPTALIGLAATANLFDEAVVKLMAEFNPRPIIFPLSNPVHLAECTFEE 428

Query: 357 AMKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQI 416
           A+K TD +V+FASG+ F   +    GKT  PGQGNNMY+FPG+GLGAILA+ K ++DK I
Sbjct: 429 AVKWTDGQVLFASGSPFA--SSGWRGKTIEPGQGNNMYVFPGIGLGAILARVKTVSDKMI 486

Query: 417 YIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                                YP + RIR +S
Sbjct: 487 EASALALSDALTPEEKEAGLLYPRLDRIREIS 518



>gi|389740476|gb|EIM81667.1| malate dehydrogenase [Stereum hirsutum FP-91666 SS1]
          Length = 529

 Score =  405 bits (1042), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 225/508 (44%), Positives = 299/508 (58%), Gaps = 31/508 (6%)

Query: 3   SLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQII 62
           +LFY I+   + EI P++YTPTVG AC  YSHI         P+GLY+S+ D   + +++
Sbjct: 45  NLFYSILYDNMREIVPILYTPTVGDACQNYSHIWRR------PEGLYVSIGDKGRIREVL 98

Query: 63  KTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPI 122
            T+ P   D     +IAV+TDG RILGLGDLG NG+ I +GKL LY+A AGI P  T+PI
Sbjct: 99  ATW-PNLRD----ARIAVVTDGIRILGLGDLGANGLPISIGKLDLYIAGAGIRPTSTVPI 153

Query: 123 TLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSEHA 182
            LDLGT+ +K L+D  Y+G+R  R D  +   F+   M ++ +V+P LL+QFEDFS+++A
Sbjct: 154 CLDLGTSTKKYLEDPLYIGVRRPRPDAKEMDEFMTEFMTAMKEVFPNLLVQFEDFSTDNA 213

Query: 183 FDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLV-EKDVHPTK-HRLLFFXXXXXXXX 240
           F  L K+R    CFNDDIQGTGAVVLSGF NA +L  E    P K HR+LFF        
Sbjct: 214 FKYLDKFRNTYKCFNDDIQGTGAVVLSGFFNAARLASEASGLPLKDHRILFFGAGSAGIG 273

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL  FFK   GMSEEEAK+ +W VD+KGL+T DR   L +HK YFAR + +G     
Sbjct: 274 VAKQLTSFFKF-MGMSEEEAKKQIWTVDSKGLITADR-KGLQEHKKYFARTNYEGPPLTN 331

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L ++I +VKPTAL+GLS+    F +++I  MA LN  PI+ PLSNP   +E  +EDA++ 
Sbjct: 332 LIDIINHVKPTALLGLSTIRNAFTKEVITSMAALNARPIVLPLSNPISMSEVDYEDAVEW 391

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           T+  VIFASG+ +  Y  P TG+T  PGQGNNMYIFPG+GLG +L+K   +TD  I    
Sbjct: 392 TNGSVIFASGSPYRSYFSPSTGRTHEPGQGNNMYIFPGIGLGTLLSKASRVTDSMIEQAS 451

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YP + RIR +S                     +I   QN    
Sbjct: 452 VALAGSLDKEETKSGLVYPRLDRIRDISAQIAM---------------SVIRAAQNSYVD 496

Query: 481 LKTRKGKEWDN-LVKFVQENMWDPDSEK 507
              +     DN L+++++E MW P   K
Sbjct: 497 NSPQLRHVTDNVLLQYIKEQMWSPQPSK 524



>gi|494826857|gb|EON63884.1| hypothetical protein W97_03112 [Coniosporium apollinis CBS 100218]
          Length = 606

 Score =  405 bits (1042), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 232/506 (45%), Positives = 316/506 (62%), Gaps = 34/506 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR++   +++ITPLIYTPTVG AC  +S +         P+GLYLS +D  +L  
Sbjct: 100 NVHLFYRLLAQNVKQITPLIYTPTVGEACQRWSELYT------QPEGLYLSYSDRGHLYS 153

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I++ + P+  D      I V+TDGSRILGLGDLGV GMGIPVGKL LY A AGI P  TL
Sbjct: 154 ILQNW-PHNVD------ITVLTDGSRILGLGDLGVGGMGIPVGKLALYTACAGIRPEGTL 206

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ LDLGTNN+   +D  Y+G R ++V   +   F+D +M +L + +P ++IQFEDF  +
Sbjct: 207 PLCLDLGTNNKALREDPLYMGSRREKVSPQEEKEFLDELMAALTERWPGIVIQFEDF--K 264

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L +Y++    FNDD+QGTG+V+ +G I+AVKL    V    H+ +F         
Sbjct: 265 NPFPALERYKDTYTMFNDDVQGTGSVITAGIISAVKLAGIPVR--DHKAIFLGAGSAGVG 322

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ++EFF ++ G++E+EA+R  W VD++GLVT DRG  LA+HKVYF+RDDN+G Q  +
Sbjct: 323 VAKQIVEFF-IKEGLTEDEARRKFWFVDSQGLVTNDRGGRLAEHKVYFSRDDNEGRQITS 381

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           LEE+I+YVKPT L+GLS+ GG FN +I+ RMA+LN  PIIFPLSNP   +ECTFE+A+K 
Sbjct: 382 LEELIDYVKPTILMGLSTIGGAFNAEILQRMAQLNDRPIIFPLSNPSSKSECTFEEAVKH 441

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           TD R +FASG+ FP  T+   GK+  PGQGNNMY+FPG+GLGAIL+K   +T   IY   
Sbjct: 442 TDGRCLFASGSPFP--TLEHAGKSLTPGQGNNMYVFPGIGLGAILSKAVSVTQDMIYASA 499

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YP + RIR VS              G+ R+  I  +  +D + 
Sbjct: 500 VGLATSLNESETQQGWLYPDIRRIREVSVSVTRHVIRAAQDGGVDRELAIRHL--DDAQ- 556

Query: 481 LKTRKGKEWDNLVKFVQENMWDPDSE 506
                      L ++++E M+DP  E
Sbjct: 557 -----------LDQYIKERMYDPFRE 571



>gi|326498765|dbj|BAK02368.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 600

 Score =  399 bits (1024), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 230/515 (44%), Positives = 314/515 (60%), Gaps = 39/515 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV LFYR++     E+TPL+YTPTVG AC  +S I         P+G+YLS  D  +L+ 
Sbjct: 106 NVHLFYRLLTDHFTELTPLVYTPTVGEACQRWSEIYQ------QPEGMYLSFEDRGHLSN 159

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           II+ + P  +      +I V+TDGSRILGLGDLGV GMGIP+GKL LY   AGI P  TL
Sbjct: 160 IIQNW-PQAH-----VEITVVTDGSRILGLGDLGVGGMGIPIGKLALYTGCAGIRPEGTL 213

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+T+DLGT N+  L+D  Y+G R ++V  ++   F+D +M +L   +P+++IQFED+  +
Sbjct: 214 PLTVDLGTGNKALLEDPLYMGSRREKVTAEEEKEFLDELMAALKDRWPDIVIQFEDW--K 271

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           + F  L +YR +   FNDDIQGTGAV++ G I AVK  +  V P  HR +F         
Sbjct: 272 NPFPSLERYRHDYAMFNDDIQGTGAVIMGGIIGAVK--QSGVAPKDHRAVFLGSGSAGVG 329

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ++++F V+ G++EEEAK   WLVD+KGLVT DRGD LA HK+YF+R DN G Q+KT
Sbjct: 330 VAKQIVDYF-VKEGLTEEEAKNCFWLVDSKGLVTSDRGDKLADHKIYFSRTDNKGEQYKT 388

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L++VIEYVKPT ++GLS+ GG F  +I+ +M + N  PIIFPLSNP   +ECTFE+A+  
Sbjct: 389 LDDVIEYVKPTIIMGLSTIGGAFTPEILQKMGKWNDRPIIFPLSNPSSKSECTFEEAISN 448

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           TD R +FASG+ F  + V   GK  +PGQGNNMY+FPG+GLG IL K   +T   IY   
Sbjct: 449 TDGRALFASGSPF--HPVTYNGKQYHPGQGNNMYVFPGIGLGTILCKAVQVTSNMIYASG 506

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND-IE 479
                            YP ++RIR VS                     +I   Q D ++
Sbjct: 507 EALPTMITEEEKDLALLYPGITRIRDVSARVALY---------------VIRAAQKDNVD 551

Query: 480 VLKTRKGKEWDNLVKFVQENMWDPDSEKFFNTEEL 514
            L + +  +   L +++++ M+DP  E    TEEL
Sbjct: 552 RLHSLRDMDDATLEEWIKDKMYDPHKE----TEEL 582



>gi|407924764|gb|EKG17792.1| Malic oxidoreductase [Macrophomina phaseolina MS6]
          Length = 454

 Score =  399 bits (1024), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 216/459 (47%), Positives = 286/459 (62%), Gaps = 28/459 (6%)

Query: 48  LYLSLNDLPNLTQIIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQL 107
           +YLS  D  NL  I++ +   P++     +I V+TDGSRILGLGDLGVNGMGIPVGKL L
Sbjct: 1   MYLSYADRGNLHSILQNW---PHN----VEITVLTDGSRILGLGDLGVNGMGIPVGKLAL 53

Query: 108 YVAAAGIDPRRTLPITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVY 167
           Y A AGI P  TLP+TLDLGTNN+   +D  Y+G R ++V  ++   F+D +M +L + +
Sbjct: 54  YTACAGIRPDATLPLTLDLGTNNKALREDPLYMGSRREKVSPEEEREFLDELMAALTERW 113

Query: 168 PELLIQFEDFSSEHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKH 227
           P ++IQFEDF  ++ F  L +Y+     FNDD+QGTGAV++ GFINAVK     V    H
Sbjct: 114 PGIVIQFEDF--KNPFPALERYQNTYTMFNDDVQGTGAVIVGGFINAVKAAGIPVK--DH 169

Query: 228 RLLFFXXXXXXXXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVY 287
           R +F           KQ++E+F ++ G++E+EA+R  W VD+ GLVTLDRGD LA+HKVY
Sbjct: 170 RAIFLGAGSAGTGVAKQIVEYF-MKEGLTEDEARRKFWFVDSNGLVTLDRGDKLAEHKVY 228

Query: 288 FARDDNDGNQFKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPK 347
           FARDDN+G Q ++L  +IEYVKPT L+GLS+ GG F ++II RMAELN+ PIIFPLSNP 
Sbjct: 229 FARDDNNGKQIQSLTRLIEYVKPTILMGLSTIGGAFTKEIITRMAELNERPIIFPLSNPS 288

Query: 348 VNAECTFEDAMKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAK 407
             +ECTFEDA+K T+ RV+FASG+ FP  TV   GK   PGQGNNMY+FPG+GLGAIL+K
Sbjct: 289 SKSECTFEDAVKYTNGRVLFASGSPFP--TVEFNGKKLVPGQGNNMYVFPGIGLGAILSK 346

Query: 408 PKVITDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARD 467
              +T   IY                    YP + RIR VS              G+ R+
Sbjct: 347 AVNVTQDMIYESAVALSESLTPEEREQQWLYPDIRRIREVSVVVTRGVIRAAQMNGVDRE 406

Query: 468 KQIIEMVQNDIEVLKTRKGKEWDNLVKFVQENMWDPDSE 506
             +  +    +E               +++E M+DP  E
Sbjct: 407 LALRNLDDAALEA--------------YIRERMYDPFHE 431



>gi|390598910|gb|EIN08307.1| malate dehydrogenase [Punctularia strigosozonata HHB-11173 SS5]
          Length = 549

 Score =  398 bits (1023), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 221/494 (44%), Positives = 301/494 (60%), Gaps = 23/494 (4%)

Query: 3   SLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQII 62
           ++FY++ +  + E TPLIYTPTVG AC+++SH          P+GL++S++D   +  +I
Sbjct: 75  NMFYKLCLRYMAEFTPLIYTPTVGDACIQFSHNF------RRPEGLFVSIHDKGRIGSVI 128

Query: 63  KTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPI 122
           + +   P       +IAV+TDGSRILGLGDLGVNGM I +GKL LYVA AGI P  TLPI
Sbjct: 129 RNWPRIP-----EARIAVVTDGSRILGLGDLGVNGMPISIGKLSLYVAGAGIRPSSTLPI 183

Query: 123 TLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSEHA 182
            LDLGTNNE  L D  YLG R  RV      +F+   M  + K +P++LIQFEDFS+E+A
Sbjct: 184 CLDLGTNNETFLADPLYLGHRHPRVPSPDMSAFMHEFMDEMSKAFPKMLIQFEDFSTENA 243

Query: 183 FDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDV-HP-TKHRLLFFXXXXXXXX 240
           F  L  +RE    FNDDIQGTGAVVL+GF+NA KL       P T HR+LF         
Sbjct: 244 FMYLDAFRERYPVFNDDIQGTGAVVLAGFLNAAKLSSAASGRPLTDHRILFLGAGSAGVG 303

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
              QL+ FF ++ G+SEEEA+  ++LVD++GL+   RG  +A+HK YF+R D  G   K 
Sbjct: 304 VAMQLMSFFTLQ-GLSEEEARSRIYLVDSQGLIYDGRGP-MAEHKKYFSRTDYAGPPVKD 361

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L ++++ VKPTAL+GLS+T G F++ ++  MA LN  PI+FPLSNP   +EC F +A+  
Sbjct: 362 LLDIVDLVKPTALLGLSTTKGAFSQPVLELMAALNPRPIVFPLSNPVRLSECEFHEALTY 421

Query: 361 TDNRVIFASGTAFPEYTVPET--GKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYI 418
           T   V+FASG+ F     PE   G+T YPGQGNNMY+FPG+GLGAILA+ K +TD  +  
Sbjct: 422 TRGAVVFASGSPFD----PEAYGGRTHYPGQGNNMYVFPGIGLGAILAQAKSVTDSMVEA 477

Query: 419 XXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDI 478
                              YP + RIR +S              G+ R++ + ++  +D 
Sbjct: 478 SALGLADALTPDERADDLIYPRLERIREISAHIACAVIRAAQKAGVDRNEALRKL--SDG 535

Query: 479 EVLKTRKGKEWDNL 492
           E+ +   GK W+ L
Sbjct: 536 ELNEYVTGKMWNPL 549



>gi|380478945|emb|CCF43308.1| malic enzyme [Colletotrichum higginsianum]
          Length = 537

 Score =  397 bits (1020), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 201/379 (53%), Positives = 260/379 (68%), Gaps = 21/379 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFYR+++  + E+ PL+YTPT+G  CL+YS +         P+ LY+S+    ++  
Sbjct: 169 NFDLFYRLLMDNIRELMPLVYTPTIGDVCLQYSTLYTR------PEALYISIKQRKSIRT 222

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +++ + PYP      PQI V+TDGSRILGLGDLGVNG+GI +GKL LY  AAGI P  TL
Sbjct: 223 MLRNW-PYP-----NPQICVVTDGSRILGLGDLGVNGVGISIGKLALYTGAAGIHPENTL 276

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GTNNE NLKD FYLG+RSKRV   +  +F+D  M++  +VYP + +QFEDF SE
Sbjct: 277 PIVLDTGTNNETNLKDPFYLGIRSKRVSVAEQQAFMDEFMEAATEVYPNMTVQFEDFESE 336

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF+ L +YR    CFNDDIQGTGAVVL+G+INAV+L    V   + RL+F         
Sbjct: 337 KAFNYLDRYRNKYRCFNDDIQGTGAVVLAGYINAVEL--SGVPLEEQRLVFMGAGSAGVG 394

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL+E++  + G+SE+ A+   WLVDTKGLVT DRGD LA+HK YFAR DN+G+QF+T
Sbjct: 395 VAKQLVEYY-TKRGLSEQVARDKFWLVDTKGLVTKDRGDKLAEHKKYFARTDNNGHQFRT 453

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAE------LNKNPIIFPLSNPKVNAECTF 354
           LEEVIEYVKPTAL+GL++T GVF E +   +        L + PI+FPLSNP   AECTF
Sbjct: 454 LEEVIEYVKPTALVGLTATFGVFTESVXRALKASVDSGGLGRRPILFPLSNPLTKAECTF 513

Query: 355 EDAMKGTDNRVIFASGTAF 373
           E A++ TD   IFASG++ 
Sbjct: 514 EQAVQWTDGTAIFASGSSL 532



>gi|170100006|ref|XP_001881221.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164643900|gb|EDR08151.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 579

 Score =  396 bits (1018), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 230/540 (42%), Positives = 307/540 (56%), Gaps = 69/540 (12%)

Query: 3   SLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQII 62
           S+FY++ +  + EITP+IYTPTVG ACL++SHI         P+GLY+S+ D  N+  ++
Sbjct: 70  SIFYKLCLENMVEITPIIYTPTVGDACLQFSHIY------RRPEGLYVSIKDKGNIRSVL 123

Query: 63  KTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPI 122
             +   P  D    +I+V+TDGSRILGLGDLGVNGMGI +GKL LY+A AGI P  T+PI
Sbjct: 124 NNW---PKLDE--ARISVVTDGSRILGLGDLGVNGMGISIGKLSLYIAGAGIRPESTIPI 178

Query: 123 TLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFE------- 175
            LDLGTNN+K L D FYLG R +RV D +   F+D  M  + + YP+L++QFE       
Sbjct: 179 CLDLGTNNQKFLDDPFYLGNRHQRVSDKEMEEFMDEFMHEMSRAYPKLMVQFEVSYDYIL 238

Query: 176 -----------DFSSEHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDV-H 223
                      DFSS++AF  L +YR     FNDDIQGTGAVVLSGF+NA K+       
Sbjct: 239 RLQCPHLMPNQDFSSDNAFKYLDRYRNKYAVFNDDIQGTGAVVLSGFLNAAKIASAASGR 298

Query: 224 P-TKHRLLFFXXXXXXXXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLA 282
           P T HR+LFF           QL  FF ++ G+S EEA++ ++L+D++GLV   RG  LA
Sbjct: 299 PLTSHRILFFGAGSAGVGVAIQLQSFFTLQ-GLSTEEARQQIYLIDSQGLVYNARG-RLA 356

Query: 283 KHK------------VY------FARDDNDGNQFKTLEEVIEYVKPTALIGLSSTGGVFN 324
           ++K            +Y      F+RDD  G     + ++I+YVKPTAL GLS+  G F 
Sbjct: 357 EYKKCMLPFSLFPSWMYSSSKPDFSRDDYSGPPMTNILDIIDYVKPTALFGLSTITGAFT 416

Query: 325 EKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKGTDNRVIFASGTAFPEYTVPETGKT 384
            ++I  MA  N  PIIFPLSNP   +EC+F DA++ T   V+FASG+ FP+      G+T
Sbjct: 417 PEVIRAMAANNPRPIIFPLSNPVRLSECSFADAVEHTQGAVLFASGSPFPQQQY--EGRT 474

Query: 385 KYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRI 444
            YPGQGNNMYIFPGLGLGAILA+   +TD  +                     YP + RI
Sbjct: 475 LYPGQGNNMYIFPGLGLGAILARVSSVTDSMVKASSLGLADSLTDEERSLGLLYPRIERI 534

Query: 445 RHVSXXXXXXXXXXXXXXGLARDKQIIEMVQN-DIEVLKTRKGKEWDNLVKFVQENMWDP 503
           R +S                   K +I   QN D++     +      L++F+   MW P
Sbjct: 535 REISAHIA---------------KAVIRAAQNADVDRSIDLRNVSDSELLRFIHGKMWKP 579



>gi|345569909|gb|EGX52735.1| hypothetical protein AOL_s00007g518 [Arthrobotrys oligospora ATCC
           24927]
          Length = 683

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 227/498 (45%), Positives = 309/498 (62%), Gaps = 31/498 (6%)

Query: 8   IVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQIIKTYRP 67
           +V G L++ITPL+YTP VG AC  +SHI         P+GLYL   +  NL + IK +  
Sbjct: 188 LVSGTLQDITPLVYTPVVGDACENWSHIF------SEPEGLYLPWKERGNLAETIKNWPE 241

Query: 68  YPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPITLDLG 127
              D      I V+TDGSRILGLGDLGV G+GI +GKL LY A AGI P +TLPI +DLG
Sbjct: 242 KEVD------ICVVTDGSRILGLGDLGVGGIGISIGKLALYTACAGIHPTKTLPIVIDLG 295

Query: 128 TNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSEHAFDLLS 187
           T+NE+ L DE YLG R KR+ +     F+D +M +L   +P ++IQFEDF  ++ F  L+
Sbjct: 296 TDNERLLNDELYLGTRMKRLGEKDMMKFLDEMMAALKARWPSIIIQFEDF--KNPFPSLA 353

Query: 188 KYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXXXXKQLLE 247
           KY+    CFNDDIQGTGAVVL+G IN V+  +  + P   RL+F           +Q++E
Sbjct: 354 KYQNMYTCFNDDIQGTGAVVLAGVINGVR--DTGIAPKDQRLVFLGAGSAGVGVARQIME 411

Query: 248 FFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKTLEEVIEY 307
            FK E  +SE+EA++L +LVD+KGLVT DRGD L +HK+ F+R DN+G Q+KTLE+V++Y
Sbjct: 412 MFKKEGNLSEDEARKLFYLVDSKGLVTNDRGDKLQEHKLIFSRSDNNGQQYKTLEDVLDY 471

Query: 308 VKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKGTDNRVIF 367
           VKPT L+GLS+ GG F E II +MA  ++ PIIFPLSNP   +ECTFE+AMK T+ +V+F
Sbjct: 472 VKPTILMGLSTIGGAFTEGIIKKMASYSERPIIFPLSNPVSKSECTFEEAMKYTNEKVLF 531

Query: 368 ASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXXXXXXXXX 427
           ASG+ FP Y   + GK   PGQGNNMY+FPG+G+G I+++  +I    IY          
Sbjct: 532 ASGSPFPTYEGKD-GKLYEPGQGNNMYVFPGIGMGTIISQASLINQDMIYASAEYLATSL 590

Query: 428 XXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEVLKTRKGK 487
                     YP ++RIR VS               LAR+ +I+              G 
Sbjct: 591 TKEERDDGLIYPRINRIRDVSARVALGVVRAAERNHLARNPEIV--------------GM 636

Query: 488 EWDNLVKFVQENMWDPDS 505
           + D L+++++  M+DP +
Sbjct: 637 DDDTLIEYIKGKMYDPTA 654



>gi|449544664|gb|EMD35637.1| hypothetical protein CERSUDRAFT_85576 [Ceriporiopsis subvermispora
           B]
          Length = 543

 Score =  396 bits (1017), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 225/488 (46%), Positives = 301/488 (61%), Gaps = 19/488 (3%)

Query: 4   LFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQIIK 63
           +FY++ +  + EITPLIYTPTVG ACL++SHI         P+GL++SL D  N+ +++ 
Sbjct: 71  MFYKLCLANMSEITPLIYTPTVGDACLQFSHIY------RRPEGLFVSLKDKGNIGKVL- 123

Query: 64  TYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPIT 123
             R +P  D    +I+V+TDGSRILGLGDLG+NGM I +GKL LYVA AGI P  T+PI 
Sbjct: 124 --RNWPRIDE--ARISVVTDGSRILGLGDLGLNGMPISIGKLSLYVAGAGIRPSSTVPIC 179

Query: 124 LDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSEHAF 183
           LDLGTNN+K L+D  YLGLR  R   +    F++  M  +  V+P+LL+QFEDFS++ AF
Sbjct: 180 LDLGTNNQKYLEDPLYLGLRQTRPSPEVMTEFMEEFMHEMSVVFPKLLVQFEDFSTDKAF 239

Query: 184 DLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKL--VEKDVHPTKHRLLFFXXXXXXXXX 241
             L  +R     FNDDIQGTGAVVLSGF+NA KL      +  ++HR+LFF         
Sbjct: 240 LYLDSFRNRYPVFNDDIQGTGAVVLSGFLNAAKLSSAASGLPLSEHRILFFGAGSAGVGV 299

Query: 242 XKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKTL 301
             QL+ FFK++ G+S EEA++ +WLVD++GL+   RG  LA+HK YF+R D  G     L
Sbjct: 300 AMQLMSFFKLQ-GLSTEEARQRIWLVDSQGLIFDARGP-LAEHKKYFSRRDYTGAPMTDL 357

Query: 302 EEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKGT 361
            E+++YVKPTAL+GLS+  G F + ++  M+ LN  PIIFPLSNP   +EC F DA++ +
Sbjct: 358 TEILKYVKPTALMGLSTIKGAFTQSVVETMSALNPCPIIFPLSNPVRLSECEFRDAVEWS 417

Query: 362 DNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXXX 421
             RVIFASG+ FPE      G+  YPGQGNNMYIFPGLGLGAIL++   +TD  +     
Sbjct: 418 QGRVIFASGSPFPEQEY--NGRMLYPGQGNNMYIFPGLGLGAILSRAASVTDTMVEASSL 475

Query: 422 XXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEVL 481
                           YP + RIR +S              G+ R   +  +   D E+L
Sbjct: 476 GLADSLTEEEHAQGLVYPRIERIREISAQIARSVIRAAQRAGVDRSSDLRNL--TDAELL 533

Query: 482 KTRKGKEW 489
           +  K K W
Sbjct: 534 EFVKSKMW 541



>gi|470243022|ref|XP_004355233.1| NADP-dependent malate dehydrogenase [Dictyostelium fasciculatum]
 gi|328868381|gb|EGG16759.1| NADP-dependent malate dehydrogenase [Dictyostelium fasciculatum]
          Length = 609

 Score =  395 bits (1016), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 202/467 (43%), Positives = 283/467 (60%), Gaps = 18/467 (3%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +LFY ++   LE + P++YTPTVG AC ++ +   F        G+Y +  D   + +
Sbjct: 134 NETLFYYLLTNNLELMMPIVYTPTVGEACQKFGNEFRF------AQGMYFATQDRGEIRR 187

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++  +   P  D     I V++DGSRILGLGDLG NGMGIPVGKLQLYVA AG +P +TL
Sbjct: 188 MLDNW---PNKDV---DIIVVSDGSRILGLGDLGTNGMGIPVGKLQLYVAGAGFNPAKTL 241

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ +D GTN +K L D+FYLG +  R+ D+++Y+ +D  + ++   +P++L+QFED S++
Sbjct: 242 PVIIDAGTNTKKYLDDKFYLGEKHARIKDEEYYALMDEFLSAVYNKWPKVLVQFEDISND 301

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H F LL  YR   FCFNDDIQGTG+V+LSGFIN ++ V+K +  T+HRL+F         
Sbjct: 302 HCFALLENYRNKYFCFNDDIQGTGSVILSGFINCIRAVQKPI--TEHRLVFLGAGSAGIG 359

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGN-QFK 299
               ++  F+ E GMSEE+A++  W VD+KGL+T  RGD L ++K  +AR D   + Q K
Sbjct: 360 VADCIMTLFQ-EAGMSEEDARKCFWFVDSKGLITTTRGDELTRYKKAYARGDVAADKQLK 418

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
           +L +V+  VKPTA+IGLS  GG F ++++  MA LN+ PI+  LSNP  NAECT E A  
Sbjct: 419 SLADVVRSVKPTAIIGLSGIGGSFTQEVVEEMARLNEKPIVMALSNPTSNAECTAEQAYT 478

Query: 360 GTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIX 419
            +  R IFASG+ F    V   GKT  PGQGNNMYIFP LGLG+++   + ITD  +   
Sbjct: 479 WSQGRCIFASGSPFA--PVQYNGKTLIPGQGNNMYIFPALGLGSVVVNARHITDGMVIAA 536

Query: 420 XXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLAR 466
                             YP + RIR +S              G+A+
Sbjct: 537 AKSLASQVDDSEVIQGKIYPGLHRIRELSVTIAVAVAEKAYEEGMAQ 583



>gi|336363747|gb|EGN92120.1| hypothetical protein SERLA73DRAFT_173095 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336382825|gb|EGO23975.1| hypothetical protein SERLADRAFT_450272 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 529

 Score =  392 bits (1006), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 215/503 (42%), Positives = 306/503 (60%), Gaps = 31/503 (6%)

Query: 3   SLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQII 62
           +LFY I++  ++E+ P++YTPTVG AC+ YSHI         P+GL++S+ D  ++ +++
Sbjct: 45  NLFYDILLDNMQELVPILYTPTVGDACVNYSHIWRR------PEGLFVSIEDKGHIREVL 98

Query: 63  KTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPI 122
            ++ P  +D     +IAV+TDGSRILGLGDLG NG+ I VGKL LY+A AGI P  T+PI
Sbjct: 99  SSW-PNIHDS----RIAVVTDGSRILGLGDLGANGLPISVGKLDLYIAGAGIKPTSTVPI 153

Query: 123 TLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSEHA 182
            LDLGTN +K L D  Y+G+R +R    +  +F++  M+++  V+P L+IQFEDFS+++A
Sbjct: 154 CLDLGTNTQKYLDDPLYIGVRRQRPGPAEMDAFMEEFMQAMKDVFPHLVIQFEDFSTDNA 213

Query: 183 FDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKL--VEKDVHPTKHRLLFFXXXXXXXX 240
           F  L KYR     FNDDIQGTG+V+L GFINA +L     ++  + H++LFF        
Sbjct: 214 FKYLDKYRSQYTVFNDDIQGTGSVILGGFINAARLSSAASNLPLSDHKILFFGAGSAGIG 273

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQLL FF +  G+SEEEA++ ++ VD+KGL+T DR   L +HK +FAR D +G     
Sbjct: 274 VAKQLLSFFTMS-GLSEEEARKRIYTVDSKGLITADR-KGLQEHKKFFARTDYNGPALTN 331

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L ++I+YVKPTAL+GLS+    F+E+++  M+ LNK PIIFPLSNP   +E  + DA++ 
Sbjct: 332 LVDIIKYVKPTALLGLSTMRNAFSEEVVKAMSGLNKRPIIFPLSNPVALSELDYSDAIQW 391

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           ++  VIFASG+  P   V   GK   PGQGNNMYIFPG+GLG IL+K   ++D  +    
Sbjct: 392 SNGEVIFASGS--PYKPVSHGGKDFEPGQGNNMYIFPGIGLGTILSKAHHVSDGMVEQAA 449

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YP + RIR +S               LA  +Q  +   +D   
Sbjct: 450 NALASSLNAEEQAAQLVYPRLGRIRDIS-----------AQIALAVIRQAQKEHLDDNAY 498

Query: 481 LKTRKGKEWDNLVKFVQENMWDP 503
           L+T    E   L   +Q+ MW P
Sbjct: 499 LRTLPDAE---LFGLIQDKMWQP 518



>gi|330789939|ref|XP_003283056.1| malic enzyme [Dictyostelium purpureum]
 gi|325087128|gb|EGC40509.1| malic enzyme [Dictyostelium purpureum]
          Length = 546

 Score =  391 bits (1005), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 219/510 (42%), Positives = 295/510 (57%), Gaps = 36/510 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +LFY +++  LE + P+IYTPTVG AC ++ +   F        G+Y +  D  ++  
Sbjct: 72  NETLFYYLLMNNLELMFPIIYTPTVGEACQKFGNEFRF------AQGMYFATQDKGSIRS 125

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++  +   P D      I V++DGSRILGLGDLG NGMGIPVGKLQLYVA AG  P RTL
Sbjct: 126 MMDNW---PADGV---DIIVVSDGSRILGLGDLGTNGMGIPVGKLQLYVAGAGFHPTRTL 179

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ +D GTN +K L+D++YLG R  RV DDQ+Y  VD  +++    +P +L+QFED S++
Sbjct: 180 PVIIDAGTNTKKYLEDKYYLGERHTRVADDQYYPLVDEFLQAAFDKWPNVLVQFEDISND 239

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H F LL  YR+   CFNDDIQGTG+V+LSGFIN+V+ V+K +  T+ R++F         
Sbjct: 240 HCFKLLDDYRDKFLCFNDDIQGTGSVILSGFINSVRAVQKPI--TEQRMVFLGAGSAGIG 297

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
               ++  F+ E G+S+E+A++  W VD+KGL+T  RGD L   K  +AR+D D  Q K+
Sbjct: 298 VADCIMSLFE-EAGVSKEQARKSFWFVDSKGLITTTRGDTLTPQKRAYAREDYD-YQLKS 355

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L EV+  VKPTALIGLS  G  F ++II  M++  + PIIF LSNP  NAECT E A + 
Sbjct: 356 LLEVVRDVKPTALIGLSGIGASFTQEIIEEMSKHVEKPIIFALSNPTTNAECTAEQAYQW 415

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           TD R IFASG+ F    V     T  PGQGNNMYIFPGLGLGA L + K +TD  I    
Sbjct: 416 TDGRCIFASGSPFK--PVEYKNHTFVPGQGNNMYIFPGLGLGAHLCRSKHVTDAMIITAA 473

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YP +  IR +S              G+A+    +     DIE 
Sbjct: 474 KTLSKFVDDSEVVTGKIYPGLQHIREISTKIAVRVIEKAYEEGMAQ----LTPRPTDIEA 529

Query: 481 LKTRKGKEWDNLVKFVQENMWDPDSEKFFN 510
                         FV+ N ++P  ++ FN
Sbjct: 530 --------------FVRMNQYNPSYDQKFN 545



>gi|170089365|ref|XP_001875905.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164649165|gb|EDR13407.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 533

 Score =  390 bits (1003), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 214/510 (41%), Positives = 304/510 (59%), Gaps = 33/510 (6%)

Query: 3   SLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQII 62
           +LFY +++G + EI P++YTPTVG AC  YSHI         P+GLY+++ +  ++ Q++
Sbjct: 51  NLFYEVLLGNMLEIIPILYTPTVGDACSNYSHIWRR------PEGLYVTIENKGHINQVL 104

Query: 63  KTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPI 122
           +T+           +IAV+TDGSRILGLGDLG NG+ I +GKL LY+A AGI P  T+PI
Sbjct: 105 RTWA-----SGQASRIAVVTDGSRILGLGDLGANGLPISIGKLDLYIAGAGIKPTTTVPI 159

Query: 123 TLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSEHA 182
            LDLGTN ++ L+D  YLG+R KR D  +   F+   M+++  V+P+LL+QFEDFS+++A
Sbjct: 160 CLDLGTNTQRYLEDPLYLGVRRKRPDAAEMDEFMKEFMEAMKDVFPQLLVQFEDFSTDNA 219

Query: 183 FDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHP--TKHRLLFFXXXXXXXX 240
           F  L  +R     FNDDIQGTG+VVLSGF NA +L         ++HR+LFF        
Sbjct: 220 FKYLDMFRSQYRVFNDDIQGTGSVVLSGFFNAARLASSAAGTPISEHRVLFFGAGSAGIG 279

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQL+ FF +  G+SE+EAK+ ++ VD+KGL+T DR   L +HK YFAR D DG+    
Sbjct: 280 VAKQLMSFFTL-LGLSEDEAKKRIYTVDSKGLITADR-PGLQEHKKYFARTDYDGSALTK 337

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L ++IE+VKPTAL+GLS+    F E ++  +A+ N  PIIFPLSNP    E  + DA++ 
Sbjct: 338 LIDIIEHVKPTALLGLSTIPNAFTEDVVKLLAKTNVRPIIFPLSNPVSLCELDYSDAIRW 397

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           T+  VIFASG+  P   V   GK   PGQGNNMYIFPG+GLG+IL+K + +TD  +    
Sbjct: 398 TNGSVIFASGS--PYKPVEFEGKIYEPGQGNNMYIFPGIGLGSILSKARHVTDAMVEQAA 455

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND-IE 479
                            YP ++RIR +S                     +I   Q D ++
Sbjct: 456 ISLASSLTNEEKDCDLVYPRLTRIRDISAHIALA---------------VIRAAQKDNVD 500

Query: 480 VLKTRKGKEWDNLVKFVQENMWDPDSEKFF 509
                +G   D L+++++   W P + + F
Sbjct: 501 ENALFRGLSDDALLEYIKAKQWQPTNIQSF 530



>gi|299743333|ref|XP_001835695.2| malate dehydrogenase [Coprinopsis cinerea okayama7#130]
 gi|298405606|gb|EAU86040.2| malate dehydrogenase [Coprinopsis cinerea okayama7#130]
          Length = 531

 Score =  390 bits (1001), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 214/509 (42%), Positives = 302/509 (59%), Gaps = 33/509 (6%)

Query: 3   SLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQII 62
           +LFY +++  + E+ P++YTPTVG AC  YSHI         P+GLY+++ +  ++ +++
Sbjct: 50  NLFYELLLANMLEMVPILYTPTVGDACSNYSHIWRR------PEGLYVTIENKGHIREVL 103

Query: 63  KTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPI 122
           +T+   P       +IAV+TDGSRILGLGDLG NG+ I +GKL LYVA AGI P  TLPI
Sbjct: 104 RTW---PAGQA--ARIAVVTDGSRILGLGDLGANGLPISIGKLDLYVAGAGIKPTTTLPI 158

Query: 123 TLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSEHA 182
            LDLGTN ++ L+D  Y+G+R KR    +   F+   M+++ +V+P+LL+QFEDFS+++A
Sbjct: 159 CLDLGTNTQRFLEDPLYIGVRRKRPATAEMDEFMHEFMEAMREVFPQLLVQFEDFSTDNA 218

Query: 183 FDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHP--TKHRLLFFXXXXXXXX 240
           F  L  +R     FNDDIQGTG+V+LSGF+NA ++  +      T+HR+LFF        
Sbjct: 219 FRYLDLFRNQYRVFNDDIQGTGSVILSGFLNAARIASEAAGTPLTEHRILFFGAGSAGIG 278

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQLL FF ++ GMS EEAK+ ++ VD+KGL+T DR   L +HK++FAR D  G     
Sbjct: 279 VAKQLLSFFTLQ-GMSVEEAKKRIYTVDSKGLITADR-KGLQEHKIFFARTDYQGPPLTN 336

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L +VI YVKPTAL+GLS+    F E+++  MA LN  PIIFPLSNP    E  + DA+K 
Sbjct: 337 LVDVINYVKPTALLGLSTVRNAFPEEVVRLMASLNTRPIIFPLSNPVSLCEVDYADAIKW 396

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           T+  VIFASG+  P   V   GKT  PGQGNNMY+FPG+G+GAIL+K + +TD  +    
Sbjct: 397 TNGSVIFASGS--PYKPVEYEGKTYEPGQGNNMYVFPGIGMGAILSKARHVTDSMVEQAS 454

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND-IE 479
                            YP + RIR +S                     +I   Q D ++
Sbjct: 455 IALASSLTPEEKAAGLVYPRLVRIRDISAQVALA---------------VIRAAQKDNVD 499

Query: 480 VLKTRKGKEWDNLVKFVQENMWDPDSEKF 508
                +    D L+++++   W P S   
Sbjct: 500 ENSLFRNLSDDALLEYIKAKQWQPASSHL 528



>gi|342185670|emb|CCC95155.1| unnamed protein product [Trypanosoma congolense IL3000]
          Length = 570

 Score =  389 bits (998), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 210/520 (40%), Positives = 299/520 (57%), Gaps = 38/520 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  L+Y+IV   ++E  P+IYTPTVG AC  Y  +           GLYLS+ +L  + Q
Sbjct: 83  NAVLYYKIVETHMKETLPIIYTPTVGEACQRYGAMFQR------DHGLYLSMRELGKVQQ 136

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
            +K  R    D      + VITDGSRILGLGDLG NGMGI +GK  LYVAA G+ P R L
Sbjct: 137 TLKNLRKPEVD------VVVITDGSRILGLGDLGANGMGISIGKCSLYVAAGGVKPSRIL 190

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ +D+GT+NE    D  YLGLR KR  DDQFY+ +D  M+S+ +V+P+ ++QFEDFS+ 
Sbjct: 191 PVMMDVGTDNESLRSDPLYLGLREKRAPDDQFYALLDEFMESVREVWPKAVVQFEDFSNN 250

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H FD+L +Y++   CFNDDIQGTGAV+ +GF+NA++     +   + R++FF        
Sbjct: 251 HCFDMLDRYQKKYRCFNDDIQGTGAVIAAGFLNAIE--ASGIPYDEQRIVFFGAGSAAAG 308

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK- 299
               +++   +++  + EE ++ V+L+DTKG++T  RGD LA HKV +AR D    Q K 
Sbjct: 309 VANCIVDLVAMKYNRTPEEVRKSVYLLDTKGVITTTRGDKLAPHKVPWARSDISAEQSKS 368

Query: 300 --TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDA 357
             TL + +E+VKPTALIGL + GGVF E I+ +M    K P+IFPLSNP   AE   +DA
Sbjct: 369 LLTLADAVEFVKPTALIGLGAQGGVFTESIVKKMTTYCKRPVIFPLSNPSSKAEILPQDA 428

Query: 358 MKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
            + T+ + I ASG+ FP  T+   GK     QGNN+YIFPG+GLG  +A+P  I D+ + 
Sbjct: 429 FRWTNGKAIVASGSPFPPTTL--EGKVYSASQGNNLYIFPGVGLGCAIAQPSYIPDEALQ 486

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP++  +R VS               LA++          
Sbjct: 487 TAAVTLSKMVDRNAVREGILYPLIDNVREVSKEVACAVIEKLQEMKLAKEG--------- 537

Query: 478 IEVLKTRKGKEWDNLVKFVQENMWDPDSEKFFNTEELLSK 517
             +  T++G+     +++V++ MW P   K+ N E  LS+
Sbjct: 538 --LPDTKEGR-----LRYVEKEMWVP---KYHNPEYYLSQ 567



>gi|66823513|ref|XP_645111.1| NADP-dependent malate dehydrogenase [Dictyostelium discoideum AX4]
 gi|74914933|sp|Q6TU48.1|MAOX_DICDI RecName: Full=NADP-dependent malic enzyme; Short=NADP-ME; AltName:
           Full=SrfA-induced gene A protein
 gi|37622953|gb|AAQ95658.1| malic enzyme [Dictyostelium discoideum]
 gi|60473239|gb|EAL71186.1| NADP-dependent malate dehydrogenase [Dictyostelium discoideum AX4]
          Length = 544

 Score =  387 bits (994), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 206/466 (44%), Positives = 279/466 (59%), Gaps = 18/466 (3%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +LFY ++   LE + P+IYTPTVG AC ++ +   F        G+Y +  D  N+  
Sbjct: 72  NETLFYYLLSNNLELMMPIIYTPTVGEACQKFGNEFRF------AQGMYFASQDKGNIRA 125

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++  +     D      I V++DGSRILGLGDLG NGMGIPVGKLQLYVA AG  P RTL
Sbjct: 126 MMDNWPAEGVD------IIVVSDGSRILGLGDLGTNGMGIPVGKLQLYVAGAGFCPTRTL 179

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ +D GTN +K L+D++YLG R  R+ D ++Y  VD  + +    +P++++QFED S++
Sbjct: 180 PVIIDSGTNTKKYLEDKYYLGERHPRIPDSEYYPLVDEFLAAAFNKWPKVIVQFEDISND 239

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H F+LL +YR    CFNDDIQGTG+V+LSGFINAV+ V+K +   +HR++F         
Sbjct: 240 HCFNLLDEYRNKYLCFNDDIQGTGSVILSGFINAVRSVQKPIK--EHRMVFLGAGSAGIG 297

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
               ++  F  E G+S+EEA++  W VD+KGL+T  RGD L   K  +AR+D    Q K+
Sbjct: 298 VADCIMSLFD-EAGVSKEEARKSFWFVDSKGLITTTRGDELTSQKKQYAREDYT-YQLKS 355

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L EV+  VKPTA+IGLS  GG F++++I  MA+  + PI+F LSNP  NAECT E A + 
Sbjct: 356 LLEVVRDVKPTAIIGLSGIGGSFSQEVIEEMAKHVEKPIVFALSNPTTNAECTAEQAYQW 415

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           TD R IFASG+ F    V   GKT  PGQGNNMYIFPGLGL A + + K +TD  I    
Sbjct: 416 TDGRCIFASGSPFK--PVEYKGKTFVPGQGNNMYIFPGLGLAASVCEAKHVTDAMIITAA 473

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLAR 466
                            YP +  IR +S              G+A+
Sbjct: 474 KTLASFVEDSEVLTGKIYPGLQHIREISTRIAVKVIEKAYEEGMAQ 519



>gi|290977620|ref|XP_002671535.1| predicted protein [Naegleria gruberi]
 gi|284085105|gb|EFC38791.1| predicted protein [Naegleria gruberi]
          Length = 761

 Score =  379 bits (973), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 214/518 (41%), Positives = 307/518 (59%), Gaps = 41/518 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +LF++++I  + E+ P++YTPTVG ACL++  I        +  G+Y+SL D  +++ 
Sbjct: 270 NQTLFFKLLIDNMVEMLPIVYTPTVGDACLQFDQIWR------VAQGMYISLEDKGSISA 323

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+K + P        P I V++DGSRILGLGDLG NGMGIP+GKL LYVAAAG  P +TL
Sbjct: 324 ILKNWEPK------QPDIIVVSDGSRILGLGDLGANGMGIPIGKLNLYVAAAGFHPDKTL 377

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI +D+GTNN   L+D+ YLGL+ KRV   +F+ F+   M ++   +P  L+QFEDFS++
Sbjct: 378 PICIDVGTNNPGLLEDDLYLGLKRKRVRGQEFFDFMKEFMIAVKTTWPNCLVQFEDFSND 437

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
             FDLL +YR    CFNDDIQGTGAV+++GFINA K+  K  +  +H+LLF         
Sbjct: 438 VCFDLLDQYRNEQLCFNDDIQGTGAVIVAGFINAAKITGKRTY--QHKLLFMGAGSAATG 495

Query: 241 XXKQLLEFFKV---EHGMSEEE----AKRLVWLVDTKGLVTLDRGD--NLAKHKVYFAR- 290
              Q +   K+   E G+S+EE    ++  V+LVD+KGLVT  R D   +  HK  +A+ 
Sbjct: 496 VADQCVGVMKLQAEEDGLSKEEIDAMSEHWVYLVDSKGLVTQTRSDYEEMPHHKKKYAKK 555

Query: 291 -DDNDGN-QFKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKV 348
            D+  GN Q K+L E+++  +PTALIGL    GVF + II  MA++N+ PI+F LSNP  
Sbjct: 556 GDETLGNFQSKSLLEIVQKTQPTALIGLCGQSGVFTQDIIEEMAKINQKPIVFALSNPTK 615

Query: 349 NAECTFEDAMKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKP 408
           N+ECT ++A++ +  R IFASG+ F + T    GKT    QGNN+YIFP LGLGA++ + 
Sbjct: 616 NSECTAKEAIEYSSGRAIFASGSPFEDVTY--NGKTYQLSQGNNLYIFPALGLGAVVTRS 673

Query: 409 KVITDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDK 468
           K ++D  I                     YP ++ IR ++              GL+   
Sbjct: 674 KHVSDVMILRAAQTLADLTSQDRLDNGLLYPSLTNIREIAQKIAVQVGKQSVKEGLS--- 730

Query: 469 QIIEMVQNDIEVLKTRKGKEWDNLVKFVQENMWDPDSE 506
           Q+ E      E L  +  +EW   VK V++ ++ PD E
Sbjct: 731 QLTE------EQLP-KSEEEW---VKIVKDYVYTPDYE 758



>gi|281209464|gb|EFA83632.1| NADP-dependent malate dehydrogenase [Polysphondylium pallidum
           PN500]
          Length = 531

 Score =  378 bits (971), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 196/448 (43%), Positives = 277/448 (61%), Gaps = 18/448 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +LF+ +++  LE + P++YTPTVG AC ++ +   F        G+Y S  D     +
Sbjct: 71  NETLFFYLLVNNLELMMPIVYTPTVGEACQKFGNEFRF------AQGMYFSSQDKGQFRE 124

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++  +   P+ +     I V++DGSRILGLGDLG NGMGIPVGKLQLYVA AG  P RTL
Sbjct: 125 MLDNW---PHKEV---DIIVVSDGSRILGLGDLGTNGMGIPVGKLQLYVAGAGFHPSRTL 178

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ +D G N +K L D+FYLG +  R+ D ++Y+ ++  + ++   +P++L+QFED S++
Sbjct: 179 PVIIDAGVNTKKYLDDKFYLGEKHARLSDPEYYALMEEFLVAVYNKWPKVLVQFEDISND 238

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H F LL  YR    CFNDDIQGTG+V+L+GFINAV+  +  +    HR++FF        
Sbjct: 239 HCFTLLENYRNRFLCFNDDIQGTGSVILAGFINAVRATQ--IPLKDHRMVFFGAGSAGIG 296

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
               ++   + E GM++EEA++  W VD+KGL+T +RGD LA+HK  +AR D    Q K+
Sbjct: 297 VADCIVSLME-EQGMTKEEARKRFWFVDSKGLITTNRGDELAEHKKAYARTDYT-TQLKS 354

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L EV++ VKPTAL+GLS  G  F ++I+  M++  + PI+F LSNP  NAECT E A + 
Sbjct: 355 LLEVVKDVKPTALVGLSGIGRSFTQEIVEEMSKNVEKPIVFSLSNPTSNAECTAEQAYQW 414

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           ++ R IFASG+ F    V   G T  PGQGNNMYIFPGLGLGA L +   +TD+ I    
Sbjct: 415 SEGRCIFASGSPFA--PVEYRGHTFVPGQGNNMYIFPGLGLGAFLCQSLRVTDEMINTAA 472

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                            YP +S+IR +S
Sbjct: 473 KTLASNVDDAEVITGKIYPGLSKIREIS 500



>gi|392591609|gb|EIW80936.1| malate dehydrogenase [Coniophora puteana RWD-64-598 SS2]
          Length = 525

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 208/506 (41%), Positives = 299/506 (59%), Gaps = 37/506 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           + +LFY +++  ++E+ P++YTPTVG AC+ YSHI         P+GLY+S+ D   + +
Sbjct: 43  DANLFYDMLLENMQEMVPILYTPTVGEACVNYSHIWRR------PEGLYISIEDRGRIRE 96

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +++++ P  +D     +IAV+TDGSRILGLGDLG NG+ I +GKL LY+AAAGI P  T+
Sbjct: 97  VLRSW-PNLHDG----RIAVVTDGSRILGLGDLGANGLPISLGKLDLYIAAAGIKPSSTV 151

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LDLGTN ++ L D  Y+G+R  R   D+   F+D  M ++ +V+P+LL+QFEDFS++
Sbjct: 152 PICLDLGTNTQRYLDDPLYIGVRRTRPGPDEMDGFMDEFMDAMTEVFPQLLVQFEDFSTD 211

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLV-EKDVHP-TKHRLLFFXXXXXX 238
           +AF  L +YR+    FNDDIQGTGAV+L GF NA +L  E    P ++H++LFF      
Sbjct: 212 NAFRYLDRYRQKYRVFNDDIQGTGAVILGGFTNAARLASEASKKPLSEHKILFFGAGSAG 271

Query: 239 XXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQF 298
               KQL  FF    G+S EEA+R ++ VD+KGL+T DR   L +HK +FAR D  G   
Sbjct: 272 IGVAKQLTAFF-TSAGLSPEEARRRIYTVDSKGLITADR-KGLQEHKKFFARTDYQGPPL 329

Query: 299 KTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAM 358
             L ++I +V+PTAL+GLS+    F E+++  M+ LN+ PIIFPLSNP   +E  F DA 
Sbjct: 330 TNLVDIINHVQPTALLGLSTQRNAFTEEVVKAMSALNERPIIFPLSNPVSLSEIDFVDAH 389

Query: 359 KGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYI 418
             ++ R IFASG+ +      E       GQGNNMY+FPG+GLG+IL++   ++D  +  
Sbjct: 390 YWSEGRAIFASGSPYKPIGDREA------GQGNNMYVFPGIGLGSILSRTAHVSDAMVET 443

Query: 419 XXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDI 478
                              YP + RIR +S              GL            DI
Sbjct: 444 AAMALAGSLTPEESAAGLVYPRIERIRDISATVATAVIRQAQKEGL------------DI 491

Query: 479 E-VLKTRKGKEWDNLVKFVQENMWDP 503
              L+T    E   L++ V++ MW+P
Sbjct: 492 NGYLRTLPDAE---LLELVKDKMWEP 514



>gi|472582305|gb|EMS19997.1| malic enzyme [Rhodosporidium toruloides NP11]
          Length = 545

 Score =  376 bits (966), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 220/506 (43%), Positives = 306/506 (60%), Gaps = 26/506 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYS--HISPFLAPPGIPDGLYLSLNDLPNL 58
           N  +FY +V G ++E  P+IYTP +G AC  +S  H  P  + P I D LYLS +DLPNL
Sbjct: 54  NPDVFYGLVGGNMKECCPIIYTPVIGLACQNWSLIHPPPPESDPTI-DALYLSYSDLPNL 112

Query: 59  TQIIKTYRP-YPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPR 117
            Q+I   +   P+D     QI+V+TDGSR+LGLGDLGV GMGI  GKL LYVAA G++P+
Sbjct: 113 PQLIGGLKTRLPHDQM---QISVVTDGSRVLGLGDLGVGGMGISQGKLSLYVAAGGVNPK 169

Query: 118 RTLPITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDF 177
            TLPI +D GT+NE  L D  Y+G R +R+  ++   F++  M+ + + +P ++IQ ED+
Sbjct: 170 ATLPIAIDFGTDNETLLADPLYVGQRIRRLSQEKCLEFMEVFMRCMHETFPNMVIQHEDW 229

Query: 178 SSEHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXX 237
            +  AF LL K R+   CFNDDIQGTGAVVL+G I A  L    V     ++LFF     
Sbjct: 230 QTPLAFPLLHKNRDLYPCFNDDIQGTGAVVLAGAIRAFHL--NGVALKDQKILFFGAGSS 287

Query: 238 XXXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQ 297
                + + ++F+++ GMSE+EAK   WLVD+KGLV  +RGD L  HK Y AR + D  +
Sbjct: 288 GVGVAETICKYFELQ-GMSEDEAKSKFWLVDSKGLVAHNRGDTLPSHKKYLARSEPDAPK 346

Query: 298 FKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDA 357
            +TL+EV+E+V+PTAL+GLS+ GG F ++I+  MA  NK PI+F LSNP   AECTFE+A
Sbjct: 347 LRTLKEVVEHVQPTALLGLSTVGGTFTKEILEAMATYNKRPIVFALSNPVAQAECTFEEA 406

Query: 358 MKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
           ++GTD RV++ASG+ F    V   GK   PGQGNNMYIFPGLG+GAILA+   I ++ ++
Sbjct: 407 VEGTDGRVLYASGSPFD--PVEYKGKRYEPGQGNNMYIFPGLGIGAILARVSKIPEELVH 464

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP + RIR VS              G+ R++++       
Sbjct: 465 ASAQGLADSLTPEETARHLLYPDIERIREVSIKIAVTVIQAAQKLGVDRNEEL------- 517

Query: 478 IEVLKTRKGKEWDNLVKFVQENMWDP 503
                  +GK    +  +V++ M+ P
Sbjct: 518 -------RGKSSAEIEAYVRKGMYHP 536



>gi|409079038|gb|EKM79400.1| hypothetical protein AGABI1DRAFT_120798 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 529

 Score =  375 bits (963), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 213/488 (43%), Positives = 286/488 (58%), Gaps = 22/488 (4%)

Query: 4   LFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQIIK 63
           +FY +V+  + E+ P++YTPTVG AC  YSHI          +GLY+S+    ++  ++ 
Sbjct: 52  IFYELVLANVLELIPILYTPTVGDACSNYSHIWRH------SEGLYISIEHKGHIRDVL- 104

Query: 64  TYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPIT 123
             R +P       +IAV+TDGSRILGLGDLG NG+ I +GKL LY+  AG+ P  T+PI 
Sbjct: 105 --RAWPAGQL--ARIAVVTDGSRILGLGDLGANGLPIAIGKLDLYIVGAGVRPSTTVPIC 160

Query: 124 LDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSEHAF 183
           LDLGTN +K + D  YLGLR KR D ++  +F+   + S+ +++P LL+QFEDFS+++AF
Sbjct: 161 LDLGTNTQKFIDDPLYLGLRRKRPDTEEMDAFMQEFIDSMKEIFPHLLVQFEDFSTDNAF 220

Query: 184 DLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKH--RLLFFXXXXXXXXX 241
             L  +R     FNDD+   GAVVLSGFINA KL  +      H  R+LFF         
Sbjct: 221 RYLDLFRTKYCVFNDDV---GAVVLSGFINAAKLSSQAAGTPLHDQRILFFGAGSAGIGV 277

Query: 242 XKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKTL 301
            KQL+ FF V  G+SEEEAK  ++ VD+KGL+T DR   L  HK YFAR D  G    +L
Sbjct: 278 AKQLMSFFTV-LGLSEEEAKNRIYTVDSKGLITADR-KGLQAHKTYFARTDYTGPPLTSL 335

Query: 302 EEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKGT 361
            ++I +VKPTAL+GLS+    F E+++  MA++NK PIIFPLSNP    E  F DA++ T
Sbjct: 336 IDIIRFVKPTALLGLSTIRNAFTEEVVRLMAKMNKRPIIFPLSNPVALCEVDFADAVQWT 395

Query: 362 DNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXXX 421
           +  VIFASG+  P  +V   GKT  PGQGNNMYIFPGLGLG IL+K K +TD  +     
Sbjct: 396 NGSVIFASGS--PYKSVEFKGKTYEPGQGNNMYIFPGLGLGTILSKAKHVTDSMVERASI 453

Query: 422 XXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEVL 481
                           YP + RIR +S              G+  D   +    +D  + 
Sbjct: 454 ALSDSLTREEKEAQLVYPRLGRIRDISVEIAFAVIRAAQKDGV--DGNTLFRNLSDDVLF 511

Query: 482 KTRKGKEW 489
            T K K+W
Sbjct: 512 DTIKSKQW 519



>gi|340058718|emb|CCC53078.1| putative malic enzyme [Trypanosoma vivax Y486]
          Length = 564

 Score =  372 bits (954), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 207/508 (40%), Positives = 289/508 (56%), Gaps = 38/508 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +L+Y  ++  LEE+ P+IYTPTVG AC  +S +  F        GLY + +       
Sbjct: 80  NTTLYYATILAHLEEVLPIIYTPTVGEACQNFSDL--FFCE----RGLYFNRHCKGMFRN 133

Query: 61  IIKT--YRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRR 118
           I++   YR           + VITDGSRILGLGDLGVNG+GI +GK  LYVA AGIDPR 
Sbjct: 134 IMRNAGYR--------NAAVTVITDGSRILGLGDLGVNGVGISIGKCSLYVAGAGIDPRN 185

Query: 119 TLPITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFS 178
            +P+ LD+GTN EK L+D+ Y+GLRS R  D+ FY+ +D  M +  + +P  ++QFEDFS
Sbjct: 186 VIPVVLDVGTNTEKYLQDKRYIGLRSNRASDEDFYALLDEFMDAAREEWPNAVVQFEDFS 245

Query: 179 SEHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXX 238
           + H FD+L +Y+    CFNDDIQGTGAV+ +GF+NA+      +    HR++ F      
Sbjct: 246 TNHCFDMLDRYQNKYRCFNDDIQGTGAVIAAGFLNAIHASGLPIE--DHRIVVFGAGSAA 303

Query: 239 XXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDD---NDG 295
               + +++     +  + EE ++ V+L+DTKGLVT  RGD LA HKV +AR D      
Sbjct: 304 VGVAQFIVDLVARTYKKTTEEVRKAVYLIDTKGLVTTTRGDTLAAHKVSWARTDITAEQS 363

Query: 296 NQFKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFE 355
           N  +TL +V+++VKPTALIGL  TGGVF E+++  + +    PII PLSNP   AE   E
Sbjct: 364 NSLRTLLDVVKFVKPTALIGLGGTGGVFTEEVVRCVMQNTPRPIILPLSNPTSKAEIIPE 423

Query: 356 DAMKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQ 415
           DA K TD   I ASG+ FP  T+   G+T  P QGNN+Y+FPG+GLG  LA+P  I D  
Sbjct: 424 DAYKWTDGAAIVASGSPFPPTTL--NGRTYKPSQGNNLYVFPGIGLGCALAQPSYIPDDL 481

Query: 416 IYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQ 475
           +                     YP +  I +VS               +A D  I+E  +
Sbjct: 482 LVAASQSLNDLVSKEDLQMGNLYPPLEEIHNVS-------------ANIATDV-ILEAQR 527

Query: 476 NDIEVLKTRKGKEWDNLVKFVQENMWDP 503
             I+   T   +    L+++V+ +MW+P
Sbjct: 528 LKIDA-NTALPRTRPELLEYVRRSMWNP 554



>gi|407425453|gb|EKF39432.1| malic enzyme, putative [Trypanosoma cruzi marinkellei]
          Length = 565

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 208/506 (41%), Positives = 290/506 (57%), Gaps = 34/506 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +L+Y  ++  LEE+ P+IYTPTVG AC+EYSH+  F    G+        N L    Q
Sbjct: 80  NTTLYYATILAHLEEMLPIIYTPTVGEACMEYSHL--FFRERGV------YFNRLYK-GQ 130

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
                R   Y      ++ VITDGSRILGLGDLG NG+GI +GK  LYV  AGIDPR  +
Sbjct: 131 FRNIVRDAGYKKV---EVIVITDGSRILGLGDLGSNGIGISIGKCSLYVVGAGIDPRLIV 187

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ LD+GTNNE  L+D+ YLG+R KR+ D++FY  +D  M++  + +P  +IQFEDFS+ 
Sbjct: 188 PVILDVGTNNEMYLQDKGYLGMREKRLGDEEFYELLDEFMEAASEEWPNAVIQFEDFSNN 247

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H FD+L +Y++   CFNDDIQGTGAVV +GF+NA+KL    V P + R++ F        
Sbjct: 248 HCFDILERYQKKYRCFNDDIQGTGAVVAAGFLNAIKL--SGVSPLQQRIVVFGAGSAAVG 305

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDD---NDGNQ 297
               +       + +  ++  +  +LVDTKGLVT  RGD LA HK  FAR D    D  +
Sbjct: 306 VANNIAALAARMYKLPVQDLVKTFYLVDTKGLVTTTRGDQLAAHKKLFARTDVSAEDSAR 365

Query: 298 FKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDA 357
            +TLEE++ +VKPT L+GL   G  F E+I+  + +  + PIIFPLSNP   AE T E+A
Sbjct: 366 LRTLEEIVRFVKPTTLLGLGGVGPAFTEEIVKMVMQNTERPIIFPLSNPTSKAEVTPENA 425

Query: 358 MKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
            K T+   I ASG+ FP  T+   GKT  P QGNN+Y+FPG+GLG  L +P  I D+ + 
Sbjct: 426 YKWTNGAAIVASGSPFPPTTI--GGKTFKPSQGNNLYVFPGIGLGCALVQPTHIPDELLL 483

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP +  I ++S               +  + Q +++ +ND
Sbjct: 484 TASESLNLLTTEADLREGRLYPPLQDIHNISANVATD---------VILEAQRMKIDKND 534

Query: 478 IEVLKTRKGKEWDNLVKFVQENMWDP 503
            ++ +TR     D L+ FV++ MW P
Sbjct: 535 -KLPRTR-----DELLAFVKKAMWKP 554



>gi|505755190|gb|EOQ99414.1| NADP-dependent malic enzyme [Wallemia ichthyophaga EXF-994]
          Length = 544

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 232/504 (46%), Positives = 288/504 (57%), Gaps = 40/504 (7%)

Query: 5   FYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQIIKT 64
           FYR++I  + +I P +YTPTVG AC  YS I         PD LYLS ND  NL +I+  
Sbjct: 59  FYRLLIDNIIDICPYVYTPTVGAACQLYSTIYR------KPDALYLSYNDRGNLAEIMSN 112

Query: 65  YRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPITL 124
           +  +        +IAV++DGSRILGLGDLG+ G  I VGKL LYV  AGI P  TLPI L
Sbjct: 113 WPQHGI------RIAVVSDGSRILGLGDLGIGGCQIAVGKLTLYVGGAGIKPDSTLPIIL 166

Query: 125 DLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSEHAFD 184
           D+GTNNE  L D  YLGLR KRV DD   +F+D    ++   +P+ LIQFEDFSSE AF 
Sbjct: 167 DMGTNNETLLNDPLYLGLRMKRVYDD---AFLDEFYAAVRTTFPDCLIQFEDFSSESAFK 223

Query: 185 LLSKYRENTF----------------CFNDDIQGTGAVVLSGFINAVKLVEKDV-HPT-K 226
            L +YR                    CFNDDIQGTGAV+L+GFINAVKL       P   
Sbjct: 224 YLDRYRHKESLIQAPSAPSGQLHTGKCFNDDIQGTGAVILAGFINAVKLASAASGRPILD 283

Query: 227 HRLLFFXXXXXXXXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKV 286
            R++F            QL+EFF   +G +EEEAK+  +LVD+KGLVT DRGDNL  HK 
Sbjct: 284 QRIVFLGAGSAGVGVAMQLVEFF-TRNGFTEEEAKQKFYLVDSKGLVTDDRGDNLPAHKR 342

Query: 287 YFARDDNDGNQFKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNP 346
             +R    G QFKTLEEV+E+V+P+ALIGLS+ GG F+EKI+  M      PIIFPLSNP
Sbjct: 343 ALSRKAG-GPQFKTLEEVVEHVRPSALIGLSTVGGAFSEKIVRMMGSFKARPIIFPLSNP 401

Query: 347 KVNAECTFEDAMKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILA 406
              +ECTFEDA+K T+ RVIFASG+ F    V   G T    QGNN   FPG+GLG I+A
Sbjct: 402 SHLSECTFEDAIKWTNGRVIFASGSPFK--AVEHGGSTYESNQGNNFLSFPGIGLGCIVA 459

Query: 407 KPKVITDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLAR 466
           K   + D  +Y                    YP + RIR +S              G A 
Sbjct: 460 KANEVNDDMVY-ESALALADSLDDSEINTLLYPRLHRIRDISATIAARVAKAAVRTGAAE 518

Query: 467 DKQIIEMVQNDIEVLKTRKGKEWD 490
           + ++  M   D ++L   K K++D
Sbjct: 519 NSKLGGMA--DTDLLAYIKSKQYD 540



>gi|340058719|emb|CCC53079.1| putative malic enzyme [Trypanosoma vivax Y486]
          Length = 571

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 207/508 (40%), Positives = 280/508 (55%), Gaps = 36/508 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV+L+Y++V   L ++ PLIYTPTVG  C  YS++            LYLS  +   + Q
Sbjct: 83  NVTLYYKVVNANLTDVLPLIYTPTVGEVCERYSNLFTR------DQALYLSCKERGTVRQ 136

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
            IK       D      I V+TDGSRILGLGDLGVNG+GI +GK  LYVAA GI P R L
Sbjct: 137 AIKNLHQSDVD------IIVVTDGSRILGLGDLGVNGVGISIGKCSLYVAAGGIHPGRAL 190

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ LD+GTN ++ L+D  Y+GLRS R  D+ FY+ +D  M +  + +P  ++QFEDFS+ 
Sbjct: 191 PVVLDVGTNTKRLLEDPMYIGLRSPRASDEDFYALLDEFMDAAREEWPNAVVQFEDFSTN 250

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H FD+L +Y+    CFNDDIQGTGAV+ +GF+NA+      +    HR++ F        
Sbjct: 251 HCFDMLDRYQNKYRCFNDDIQGTGAVIAAGFLNAIHASGLPIE--DHRIVVFGAGSAAVG 308

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDD---NDGNQ 297
             + +++     +  + EE ++ V+L+DTKGLVT  RGD LA HKV +AR D      N 
Sbjct: 309 VAQFIVDLVARTYKKTTEEVRKAVYLIDTKGLVTTTRGDTLAAHKVSWARTDITAEQSNS 368

Query: 298 FKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDA 357
            +TL +V+++VKPTALIGL + GGVF E ++  MA   K P++FPLSNP   AE   EDA
Sbjct: 369 LRTLLDVVKFVKPTALIGLGAQGGVFTEDVVRLMASNCKRPVLFPLSNPSSKAEIIPEDA 428

Query: 358 MKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVI-TDKQI 416
            K TD   I ASG+ FP   +   GK     QGNN+Y+FPG+GLG  LA+P  I  +   
Sbjct: 429 YKWTDGAAIVASGSPFPPCVL--NGKQLSASQGNNLYVFPGIGLGCALAQPPYIPHEALA 486

Query: 417 YIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQN 476
                                YP +   R VS              GLA++         
Sbjct: 487 AAAAALSQMVDREVVVSESKLYPPIESAREVSKNVAVAVIEELQQLGLAKE--------- 537

Query: 477 DIEVLKTRKGKEWDNLVKFVQENMWDPD 504
           D+       G+E   L+ FVQ  MW P+
Sbjct: 538 DLPC-----GRE--ALIDFVQGKMWQPE 558



>gi|71662504|ref|XP_818258.1| malic enzyme [Trypanosoma cruzi strain CL Brener]
 gi|70883498|gb|EAN96407.1| malic enzyme, putative [Trypanosoma cruzi]
          Length = 573

 Score =  369 bits (947), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 211/521 (40%), Positives = 288/521 (55%), Gaps = 39/521 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV+LFY+ V   ++E  P+IYTPTVG AC  Y  I  F+       GLY+S+ +  N+ Q
Sbjct: 85  NVTLFYKFVQKHIKETLPVIYTPTVGEACERYGAI--FMRD----HGLYVSMQERGNIRQ 138

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
            +K  R    D      I V+TDGSRILGLGDLG NGMGI +GK  LYVA AGI P R L
Sbjct: 139 CLKNLRKPNID------IMVVTDGSRILGLGDLGANGMGISIGKCSLYVAGAGIRPSRVL 192

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ LD+GTNNEK   D  YLG R+ R  D +FY  +D  M++    +P  +IQFEDFS+ 
Sbjct: 193 PVMLDVGTNNEKLRNDPLYLGQRTSRAQDREFYELLDEFMEAASAEWPNAVIQFEDFSNN 252

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H FD++ +Y++   CFNDDIQGTGAV+ +GF+NA+ +    V   + R++F         
Sbjct: 253 HCFDIMERYQKKYRCFNDDIQGTGAVIAAGFLNAMHV--SGVPVNEQRVVFLGAGSAATG 310

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDD---NDGNQ 297
             + + E   +E   S E+ +  V+LVD+KGLVT  RGD LA HKV +AR D        
Sbjct: 311 VAEIIAELAALELETSVEKVRNSVYLVDSKGLVTTTRGDELAPHKVPWARTDIAPEQNES 370

Query: 298 FKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDA 357
            +TL +V+ +V+PTALIGL++ GG F E++I  MA   K PI+FPLSNP   +E   +DA
Sbjct: 371 LRTLTDVVRHVRPTALIGLAAAGGAFTEEMIKYMASYCKRPILFPLSNPSSKSEVNPDDA 430

Query: 358 MKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAK-PKVITDKQI 416
            K T+   I ASG+ FP   V   GK   P QGNN+YIFPG+GLG ++A+ P +  +  +
Sbjct: 431 YKWTNGTAIVASGSPFPSSVV--DGKVLSPAQGNNLYIFPGVGLGCVIAQSPYIPQEVFV 488

Query: 417 YIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQN 476
                                YP +  +R+VS              GLA           
Sbjct: 489 TAALALSRLVDTEVVLAEGKLYPSIDGVRNVSMHVAVDVIEELQRMGLA----------- 537

Query: 477 DIEVLKTRKGKEWDNLVKFVQENMWDPDSEKFFNTEELLSK 517
                KT   +   +L+  V++ MW+P   ++   E  LSK
Sbjct: 538 -----KTDLPRNKSDLINLVKQFMWEP---QYLEPEYYLSK 570



>gi|407425452|gb|EKF39431.1| malic enzyme, putative [Trypanosoma cruzi marinkellei]
          Length = 573

 Score =  369 bits (946), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 213/521 (40%), Positives = 292/521 (56%), Gaps = 39/521 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV+LFY+ +   ++E  P+IYTPTVG AC  Y  I  F+       GLY+S+ +  N+ Q
Sbjct: 85  NVTLFYKFIQKHIKETLPVIYTPTVGEACERYGAI--FMRD----HGLYVSMQERGNIRQ 138

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
            +K  R    D      I V+TDGSRILGLGDLG NGMGI +GK  LYVA AGI P R L
Sbjct: 139 CLKNLRKPNID------IMVVTDGSRILGLGDLGANGMGISIGKCSLYVAGAGIRPSRVL 192

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLD+GTNNEK   D  YLG R+ R  D +FY  +D  M++    +P  +IQFEDFS+ 
Sbjct: 193 PVTLDVGTNNEKLRNDPLYLGQRTPRGQDREFYELLDEFMEAASAEWPNAVIQFEDFSNN 252

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H FD+L +Y++   CFNDDIQGTGAV+ +GF+NA+ L    V+  + R++F         
Sbjct: 253 HCFDILERYQKKYRCFNDDIQGTGAVIAAGFLNAMHLSGIPVN--EQRVVFLGAGSAATG 310

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDD---NDGNQ 297
             + + E   +E   S E+ ++ V+LVD+KGLVT  RGD LA HKV +AR D        
Sbjct: 311 VAEIIAEVAALELETSVEKVRKSVYLVDSKGLVTTTRGDELAPHKVPWARTDIAPEQNKS 370

Query: 298 FKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDA 357
            +TL +V+ +V+PTALIGL++ GG F E+II  MA   K PI+FPLSNP   +E   +DA
Sbjct: 371 LRTLTDVVRHVRPTALIGLAAAGGAFTEEIIKYMASYCKRPILFPLSNPSSKSEVIPDDA 430

Query: 358 MKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAK-PKVITDKQI 416
            K T+   I ASG+ FP   V   GK   P QGNN+YIFPG+GLG ++A+ P +  +  +
Sbjct: 431 YKWTNGTAIVASGSPFPSSVV--DGKVLSPAQGNNLYIFPGVGLGCVIAQSPYIPQEVFV 488

Query: 417 YIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQN 476
                                YP +  +R+VS              GLA+     ++ QN
Sbjct: 489 TAALALSRLVDNEVVLAEGKLYPPIDDVRNVSMHVAVEVIEELQRMGLAKS----DLPQN 544

Query: 477 DIEVLKTRKGKEWDNLVKFVQENMWDPDSEKFFNTEELLSK 517
                         +L   V++ +W+P   ++   E  LSK
Sbjct: 545 K------------SDLTNLVKQFVWEP---QYLEPEYYLSK 570



>gi|71651465|ref|XP_814410.1| malic enzyme [Trypanosoma cruzi strain CL Brener]
 gi|70879379|gb|EAN92559.1| malic enzyme, putative [Trypanosoma cruzi]
          Length = 565

 Score =  368 bits (945), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 205/507 (40%), Positives = 290/507 (57%), Gaps = 36/507 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIP-DGLYLSLNDLPNLT 59
           N +L+Y  ++  LEE+ P+IYTPTVG AC+EYSH+  F    G+  + LY          
Sbjct: 80  NTTLYYATILAHLEEMLPIIYTPTVGEACMEYSHL--FFRERGVYFNRLYKG-------- 129

Query: 60  QIIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRT 119
           Q     R   Y      ++ VITDGSRILGLGDLG NG+GI +GK  LYVA AGIDPR  
Sbjct: 130 QFRNIMRDAGYQKV---EVVVITDGSRILGLGDLGSNGIGISIGKCSLYVAGAGIDPRLI 186

Query: 120 LPITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSS 179
           +P+ LD+GTNNE+ L+D+ YLG+R KR+ D++FY  +D  M++    +P  +IQFEDFS+
Sbjct: 187 VPVILDVGTNNERYLQDKDYLGMREKRLGDEEFYELLDEFMEAASAEWPNAVIQFEDFSN 246

Query: 180 EHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXX 239
            H FD++ +Y++   CFNDDIQGTGAV+ +GF+NA+KL    V P + R++ F       
Sbjct: 247 NHCFDIMERYQKKYRCFNDDIQGTGAVIAAGFLNAIKL--SGVSPLQQRIVVFGAGSAAV 304

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDD---NDGN 296
                +       +    ++  +  +LVDTKGLVT  RGD LA HK   AR D    D  
Sbjct: 305 GVANNIAALAARMYKFPVQDLVKTFYLVDTKGLVTTTRGDQLAAHKKLLARTDVSAEDSA 364

Query: 297 QFKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFED 356
           + +TLEE++ +VKPT L+GL   G  F E+I+  + +  + PIIFPLSNP   AE T E+
Sbjct: 365 KLRTLEEIVRFVKPTTLLGLGGVGPAFTEEIVKMVMQNTERPIIFPLSNPTSKAEVTPEN 424

Query: 357 AMKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQI 416
           A K T+   I ASG+ FP  T+   GKT  P QGNN+Y+FPG+GLG  LA+P  I ++ +
Sbjct: 425 AYKWTNGAAIVASGSPFPPTTI--GGKTFKPSQGNNLYVFPGVGLGCALAQPTHIPEELL 482

Query: 417 YIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQN 476
                                YP +  I ++S               +  + Q ++ + N
Sbjct: 483 LTASESLNLLTTEGDLREGRLYPPLEDIHNISANVATD---------VILEAQRMK-IDN 532

Query: 477 DIEVLKTRKGKEWDNLVKFVQENMWDP 503
           + ++ +TR     D L+ FV++ MW P
Sbjct: 533 NKKLPRTR-----DELLAFVKKAMWKP 554



>gi|71651463|ref|XP_814409.1| malic enzyme [Trypanosoma cruzi strain CL Brener]
 gi|70879378|gb|EAN92558.1| malic enzyme, putative [Trypanosoma cruzi]
          Length = 573

 Score =  368 bits (944), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 211/521 (40%), Positives = 287/521 (55%), Gaps = 39/521 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV+LFY+ V   ++E  P+IYTPTVG AC  Y  I  F+       GLY+S+ +  N+ Q
Sbjct: 85  NVTLFYKFVQKHIKETLPVIYTPTVGEACERYGAI--FMRD----HGLYVSMQERGNIRQ 138

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
            +K  R    D      I V+TDGSRILGLGDLG NGMGI +GK  LYVA AGI P R L
Sbjct: 139 CLKNLRKPNID------IMVVTDGSRILGLGDLGANGMGISIGKCSLYVAGAGIRPSRVL 192

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ LD+GTNNEK   D  YLG R+ R  D +FY  +D  M++    +P  +IQFEDFS+ 
Sbjct: 193 PVMLDVGTNNEKLRNDPLYLGQRTSRAQDREFYELLDEFMEAASAEWPNAVIQFEDFSNN 252

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H FD++ +Y++   CFNDDIQGTGAV+ +GF+NA+ +    V   + R++F         
Sbjct: 253 HCFDIMERYQKKYRCFNDDIQGTGAVIAAGFLNAMHV--SGVPVNEQRVVFLGAGSAATG 310

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDD---NDGNQ 297
             + + E   +E   S E+ +  V+LVD+KGLVT  RGD LA HKV +AR D        
Sbjct: 311 VAEIIAELAALELETSVEKVRNSVYLVDSKGLVTTTRGDELAPHKVPWARTDIAPEQNES 370

Query: 298 FKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDA 357
            +TL +V+ +V+PTALIGL++ GG F E++I  MA   K PI+FPLSNP   +E   +DA
Sbjct: 371 LRTLTDVVRHVRPTALIGLAAAGGAFTEEMIKYMASYCKRPILFPLSNPSSKSEVNPDDA 430

Query: 358 MKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAK-PKVITDKQI 416
            K T+   I ASG+ FP   V   GK   P QGNN+YIFPG+GLG ++A+ P +  +  +
Sbjct: 431 YKWTNGTAIVASGSPFPSSVV--DGKVLSPAQGNNLYIFPGVGLGCVIAQSPYIPQEVFV 488

Query: 417 YIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQN 476
                                YP +  +R+VS              GLA           
Sbjct: 489 TAALALSRLVDTEVVLAEGKLYPSIDGVRNVSMHVAVDVIEELQRMGLA----------- 537

Query: 477 DIEVLKTRKGKEWDNLVKFVQENMWDPDSEKFFNTEELLSK 517
                K+   +   +L   V+E MW+P   ++   E  LSK
Sbjct: 538 -----KSDLPRNKSDLTNLVKEFMWEP---QYLEPEYYLSK 570



>gi|407860360|gb|EKG07369.1| malic enzyme, putative [Trypanosoma cruzi]
          Length = 565

 Score =  368 bits (944), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 205/507 (40%), Positives = 289/507 (57%), Gaps = 36/507 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIP-DGLYLSLNDLPNLT 59
           N +L+Y  ++  LEE+ P+IYTPTVG AC+EYSH+  F    G+  + LY          
Sbjct: 80  NTTLYYATILAHLEEMLPIIYTPTVGEACMEYSHL--FFRERGVYFNRLYKG-------- 129

Query: 60  QIIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRT 119
           Q     R   Y      ++ VITDGSRILGLGDLG NG+GI +GK  LYVA AGIDPR  
Sbjct: 130 QFRNIMRDAGYQKV---EVVVITDGSRILGLGDLGSNGIGISIGKCSLYVAGAGIDPRLI 186

Query: 120 LPITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSS 179
           +P+ LD+GTN E+ L+D+ YLG+R KR+ D++FY  +D  M++    +P  +IQFEDFS+
Sbjct: 187 VPVILDVGTNTERYLQDKDYLGMREKRLGDEEFYELLDEFMEAASAEWPNAVIQFEDFSN 246

Query: 180 EHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXX 239
            H FD++ +Y++   CFNDDIQGTGAV+ +GF+NA+KL    V P + R++ F       
Sbjct: 247 NHCFDIMERYQKKYRCFNDDIQGTGAVIAAGFLNAIKL--SGVSPLQQRIVVFGAGSAAV 304

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDD---NDGN 296
                +       +    ++  +  +LVDTKGLVT  RGD LA HK   AR D    D  
Sbjct: 305 GVANNIAALAARMYKFPVQDLVKTFYLVDTKGLVTTTRGDQLAAHKKLLARTDVSAEDSA 364

Query: 297 QFKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFED 356
           + +TLEE++ +VKPT L+GL   G  F E+I+  + +  + PIIFPLSNP   AE T E+
Sbjct: 365 KLRTLEEIVRFVKPTTLLGLGGVGPAFTEEIVKMVMQNTERPIIFPLSNPTSKAEVTPEN 424

Query: 357 AMKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQI 416
           A K T+   I ASG+ FP  T+   GKT  P QGNN+Y+FPG+GLG  LA+P  I D+ +
Sbjct: 425 AYKWTNGAAIVASGSPFPPTTI--GGKTFKPSQGNNLYVFPGVGLGCALAQPTHIPDELL 482

Query: 417 YIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQN 476
                                YP +  I ++S               +  + Q ++ + N
Sbjct: 483 LTASESLNLLTTEGDLREGRLYPPLEDIHNISANVATD---------VILEAQRMK-IDN 532

Query: 477 DIEVLKTRKGKEWDNLVKFVQENMWDP 503
           + ++ +TR     D L+ FV++ MW P
Sbjct: 533 NKKLPRTR-----DELLAFVKKEMWKP 554



>gi|407860363|gb|EKG07371.1| malic enzyme, putative [Trypanosoma cruzi]
          Length = 573

 Score =  367 bits (943), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 211/521 (40%), Positives = 286/521 (54%), Gaps = 39/521 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV+LFY+ V   ++E  P+IYTPTVG AC  Y  I  F+       GLY+S+ +  N+ Q
Sbjct: 85  NVTLFYKFVQKHIKETLPVIYTPTVGEACERYGAI--FMRD----HGLYVSMQERGNIRQ 138

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
            +K  R    D      I V+TDGSRILGLGDLG NGMGI +GK  LYVA AGI P R L
Sbjct: 139 CLKNLRKPNID------IMVVTDGSRILGLGDLGANGMGISIGKCSLYVAGAGIRPSRVL 192

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ LD+GTNNEK   D  YLG R+ R  D +FY  +D  M++    +P  +IQFEDFS+ 
Sbjct: 193 PVMLDVGTNNEKLRNDPLYLGQRTSRAQDREFYELLDEFMEAASAEWPNAVIQFEDFSNN 252

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H FD++ +Y++   CFNDDIQGTGAV+ +GF+NA+ +    V   + R++F         
Sbjct: 253 HCFDIMERYQKKYRCFNDDIQGTGAVIAAGFLNAMHV--SGVPVNEQRVVFLGAGSAATG 310

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDD---NDGNQ 297
             + + E   +E   S E+ +  V+LVD+KGLVT  RGD LA HKV +AR D        
Sbjct: 311 VAEIIAELAALELETSVEKVRNSVYLVDSKGLVTTTRGDELAPHKVPWARTDIAPEQNES 370

Query: 298 FKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDA 357
            +TL +V+ +V+PTALIGL++ GG F E++I  M    K PI+FPLSNP   +E   +DA
Sbjct: 371 LRTLTDVVRHVRPTALIGLAAAGGAFTEEMIKYMVSYCKRPILFPLSNPSSKSEVNPDDA 430

Query: 358 MKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAK-PKVITDKQI 416
            K T+   I ASG+ FP   V   GK   P QGNN+YIFPG+GLG ++A+ P +  +  +
Sbjct: 431 YKWTNGTAIVASGSPFPSSVV--DGKVLSPAQGNNLYIFPGVGLGCVIAQSPYIPQEVFV 488

Query: 417 YIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQN 476
                                YP +  +R+VS              GLA           
Sbjct: 489 TAALALSRLVDTEVVLAEGKLYPSIDGVRNVSVHVAVDVIEELQRMGLA----------- 537

Query: 477 DIEVLKTRKGKEWDNLVKFVQENMWDPDSEKFFNTEELLSK 517
                K+   +   +L   V+E MW+P   K+   E  LSK
Sbjct: 538 -----KSDLPRNKSDLTNLVKEFMWEP---KYLEPEYYLSK 570



>gi|71755409|ref|XP_828619.1| malic enzyme [Trypanosoma brucei brucei strain 927/4 GUTat10.1]
 gi|70834005|gb|EAN79507.1| malic enzyme, putative [Trypanosoma brucei brucei strain 927/4
           GUTat10.1]
          Length = 564

 Score =  367 bits (942), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 206/507 (40%), Positives = 286/507 (56%), Gaps = 34/507 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +L+Y  +   LEE  P+IYTPTVG AC  YS +  F        GLYL          
Sbjct: 80  NTTLYYATIFAHLEETLPIIYTPTVGEACQRYSSLL-FRE-----RGLYLCRTYKGMFRT 133

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+   R   Y++   P++ VITDGSRILGLGDLG NG+GI +GK  LYVA AGI+P+  +
Sbjct: 134 IM---RDSGYEN---PKVVVITDGSRILGLGDLGANGVGISIGKCSLYVAGAGINPKNVV 187

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ LD GT+N   L D+ Y+G+R KR  D+ FY+ +D  M++  + +PE +IQFEDFS+ 
Sbjct: 188 PVVLDAGTDNAAMLSDDNYIGVRQKRPSDEDFYALLDEFMEAASEAWPEAVIQFEDFSNN 247

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H FD+L +Y+    CFNDDIQGTGAV+ +GF+NAVKL + D  P  HR++ F        
Sbjct: 248 HCFDMLERYQNKYRCFNDDIQGTGAVIAAGFLNAVKLSKVD--PLDHRIVVFGAGSAAIG 305

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDD---NDGNQ 297
               + E     + +  ++ K+  +LVDTKGLVT  RGD LA HKV  AR D    D  +
Sbjct: 306 VVDNIAELTAQLYNLKSDDVKKTFYLVDTKGLVTTTRGDKLASHKVSLARTDVSAEDSAK 365

Query: 298 FKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDA 357
            KTLE+V+ +VKPT L+GL   G VF E ++  +    K PIIFPLSNP   +E T ++A
Sbjct: 366 LKTLEDVVNFVKPTTLLGLGGVGPVFTESMVKGILNNTKRPIIFPLSNPTSKSEITADNA 425

Query: 358 MKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
            K TD + I ASG+ FP  T+   GKT    QGNN+Y+FPG+GLG  +AKP  I +  + 
Sbjct: 426 FKWTDGKAIVASGSPFPPTTL--NGKTYKASQGNNLYVFPGIGLGCAIAKPAYIPNDLLI 483

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP +S I ++S               +  + Q ++ + N+
Sbjct: 484 AASRCLNGLVSKVGLEDGSLYPPLSDIHNISANIATD---------VIMEAQRLK-IDNN 533

Query: 478 IEVLKTRKGKEWDNLVKFVQENMWDPD 504
             + +TR       L+ +V+  MW P+
Sbjct: 534 SSLPRTRA-----ELMDYVKHAMWKPE 555



>gi|261334502|emb|CBH17496.1| malic enzyme, putative [Trypanosoma brucei gambiense DAL972]
          Length = 564

 Score =  366 bits (940), Expect = 9e-99,   Method: Compositional matrix adjust.
 Identities = 205/507 (40%), Positives = 286/507 (56%), Gaps = 34/507 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +L+Y  +   LEE  P+IYTPTVG AC  YS +  F        GLYL          
Sbjct: 80  NTTLYYATIFAHLEETLPIIYTPTVGEACQRYSSLL-FRE-----RGLYLCRTYKGMFRT 133

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+   R   Y++   P++ VITDGSRILGLGDLG NG+GI +GK  LYVA AGI+P+  +
Sbjct: 134 IM---RDSGYEN---PKVVVITDGSRILGLGDLGANGVGISIGKCSLYVAGAGINPKNVV 187

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ LD GT+N   L D+ Y+G+R KR  D+ FY+ +D  M++  + +PE +IQFEDFS+ 
Sbjct: 188 PVVLDAGTDNAAMLSDDNYIGVREKRPSDEDFYALLDEFMEAASEAWPEAVIQFEDFSNN 247

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H FD+L +Y+    CFNDDIQGTGAV+ +GF+NAVKL + D  P  HR++ F        
Sbjct: 248 HCFDMLERYQNKYRCFNDDIQGTGAVIAAGFLNAVKLSKVD--PLDHRIVVFGAGSAAIG 305

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDD---NDGNQ 297
               + E     + +  ++ K+  +LVDTKGLVT  RGD LA HKV  AR D    D  +
Sbjct: 306 VVDNIAELTAQLYNLKSDDVKKTFYLVDTKGLVTTTRGDKLASHKVSLARTDVSAEDSAK 365

Query: 298 FKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDA 357
            KTLE+V+ +VKPT L+GL   G VF E ++  +    K PIIFPLSNP   +E T ++A
Sbjct: 366 LKTLEDVVNFVKPTTLLGLGGVGPVFTESMVKGILNNTKRPIIFPLSNPTSKSEITADNA 425

Query: 358 MKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
            K TD + I A+G+ FP  T+   GKT    QGNN+Y+FPG+GLG  +AKP  I +  + 
Sbjct: 426 FKWTDGKAIVATGSPFPPTTL--NGKTYKASQGNNLYVFPGIGLGCAIAKPAYIPNDLLI 483

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP +S I ++S               +  + Q ++ + N+
Sbjct: 484 AASRCLNGLVSKVGLEDGSLYPPLSDIHNISANIATD---------VIMEAQRLK-IDNN 533

Query: 478 IEVLKTRKGKEWDNLVKFVQENMWDPD 504
             + +TR       L+ +V+  MW P+
Sbjct: 534 SSLPRTRA-----ELMDYVKHAMWKPE 555



>gi|388583791|gb|EIM24092.1| hypothetical protein WALSEDRAFT_59083 [Wallemia sebi CBS 633.66]
          Length = 537

 Score =  366 bits (939), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 229/497 (46%), Positives = 291/497 (58%), Gaps = 36/497 (7%)

Query: 5   FYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQIIKT 64
           FYR++I  + +I P +YTPTVG AC  YS+I         PD LYLS  D  +L +I+  
Sbjct: 55  FYRLLIDNIIDICPYVYTPTVGAACQLYSNIYR------KPDALYLSYQDRGHLAEIMSN 108

Query: 65  YRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPITL 124
           +   P  D    +IAV++DGSRILGLGDLG+ G  I VGKL LYV  AGI P  TLPI L
Sbjct: 109 W---PQKDI---RIAVVSDGSRILGLGDLGIGGCQISVGKLTLYVGGAGIKPEGTLPIIL 162

Query: 125 DLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSEHAFD 184
           D+GTNNE  L D  YLGL+ KRV DD+F   +D    +   V+ + LIQFEDFSSE AF 
Sbjct: 163 DMGTNNEALLNDPLYLGLKMKRVYDDEF---MDEFYTATRTVFKDCLIQFEDFSSESAFK 219

Query: 185 LLSKYR--ENTF-----------CFNDDIQGTGAVVLSGFINAVKLVEKDVHPT--KHRL 229
            L +YR  +N             CFNDDIQGTGAV+L+GFINAVKL       +    R+
Sbjct: 220 YLDRYRYKKNAVISNDGTPYGGKCFNDDIQGTGAVILAGFINAVKLASAASGRSLFDQRI 279

Query: 230 LFFXXXXXXXXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFA 289
           +FF           QL+EFF   +G + EEAK+  +LVD+KGLVT DRGD L +HK   +
Sbjct: 280 VFFGAGSAGVGVAMQLVEFF-TRNGFTLEEAKQKFYLVDSKGLVTDDRGDKLPEHKKALS 338

Query: 290 RDDNDGNQFKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVN 349
           R    G Q++TLEE++E V+PTALIGLS+ GG FNEK++  MAE    PIIFPLSNP   
Sbjct: 339 RKAG-GPQYRTLEEIVENVRPTALIGLSTVGGAFNEKVVRMMAEFKTRPIIFPLSNPSHL 397

Query: 350 AECTFEDAMKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPK 409
           +ECTFEDA+K T+ +VIFASG+ F   T     KT    QGNN   FPG+GLG IL+K  
Sbjct: 398 SECTFEDAIKWTNGKVIFASGSPFKAVTY--NSKTYESNQGNNFLSFPGIGLGCILSKAN 455

Query: 410 VITDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQ 469
            + D  IY                    YP + RIR VS              G+A +++
Sbjct: 456 EVNDDMIY-ESALALSESLDETESATLLYPRLHRIRDVSATIATRVAQAAAKTGVAENEK 514

Query: 470 IIEMVQNDI-EVLKTRK 485
           +  M    I E +K+++
Sbjct: 515 LYGMSTEQILEYIKSKQ 531



>gi|342319135|gb|EGU11086.1| Malic enzyme [Rhodotorula glutinis ATCC 204091]
          Length = 743

 Score =  365 bits (938), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 213/491 (43%), Positives = 296/491 (60%), Gaps = 30/491 (6%)

Query: 18  PLIYTPTVGTACLEYSHISPFLAPPGIPD----GLYLSLNDLPNLTQIIKTYRP-YPYDD 72
           P+IYTP +G AC  +S I P   PP   D     LYLS +DLPNL  +IK  +   P++ 
Sbjct: 269 PIIYTPVIGLACQNWSLIHP---PPPESDPTIEALYLSYSDLPNLPSLIKGLKTRLPHNQ 325

Query: 73  TLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPITLDLGTNNEK 132
               QI+V+TDGSR+LGLGDLGV GMGI  GKL LYVAA G++P+ TLPI +D GT+NEK
Sbjct: 326 M---QISVVTDGSRVLGLGDLGVGGMGISQGKLSLYVAAGGVNPKATLPIAIDFGTDNEK 382

Query: 133 NLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSEHAFDLLSKYREN 192
            L D  Y+G R +R+ +++   F+D  M+ + + +P ++IQ ED+ +  AF LL K R+ 
Sbjct: 383 LLADPLYVGQRMRRLSEEKCLEFMDVFMRCMHETFPNMVIQHEDWQTPLAFPLLHKNRDL 442

Query: 193 TFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXXXXKQLLEFFKVE 252
             CFNDDIQGTGAVVL+G I A  L    V     ++LFF          + + ++F+++
Sbjct: 443 YPCFNDDIQGTGAVVLAGAIRAFHL--NGVALKDQKILFFGAGSSGVGVAETICKYFELQ 500

Query: 253 HGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKTLEEVIEYVKPTA 312
            GMSE+EAK   WLVD+KGLV  +RGD L  HK Y AR + D  + ++L+EV+E+V+PTA
Sbjct: 501 -GMSEQEAKSKFWLVDSKGLVAHNRGDTLPSHKKYLARSEPDAPKLRSLKEVVEHVQPTA 559

Query: 313 LIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKGTDNRVIFASGTA 372
           L+GLS+ GG F ++I+  MA  NK PI+F LSNP   AECTFE+A++GTD RV++ASG+ 
Sbjct: 560 LLGLSTVGGTFTKEILESMATYNKRPIVFALSNPVAQAECTFEEAIEGTDGRVLYASGSP 619

Query: 373 FPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXXXXXXXXXXXXXX 432
           F      E  K   PGQGNNMYIFPGLG+GAILA+   I ++ ++               
Sbjct: 620 FDPVEYKE--KRYEPGQGNNMYIFPGLGIGAILARVSKIPEELVHASAQGLADSLTPEET 677

Query: 433 XXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEVLKTRKGKEWDNL 492
                YP + RIR VS              G+ R++++              +GK    +
Sbjct: 678 ARHLLYPDIERIREVSIKIAVTVIQAAQKLGVDRNEEL--------------RGKSSAEI 723

Query: 493 VKFVQENMWDP 503
             +V++ M+ P
Sbjct: 724 EAYVRKGMYHP 734



>gi|71662506|ref|XP_818259.1| malic enzyme [Trypanosoma cruzi strain CL Brener]
 gi|70883499|gb|EAN96408.1| malic enzyme, putative [Trypanosoma cruzi]
          Length = 565

 Score =  365 bits (938), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 204/507 (40%), Positives = 290/507 (57%), Gaps = 36/507 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIP-DGLYLSLNDLPNLT 59
           N +L+Y  ++  LEE+ P+IYTPTVG AC+EYSH+  F    G+  + LY          
Sbjct: 80  NTTLYYATILAHLEEMLPIIYTPTVGEACMEYSHL--FFRERGVYFNRLYKG-------- 129

Query: 60  QIIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRT 119
           Q     R   Y      ++ VITDGSRILGLGDLG NG+GI +GK  LYVA AGIDPR  
Sbjct: 130 QFRDIMRDAGYQKV---KVVVITDGSRILGLGDLGSNGIGISIGKCSLYVAGAGIDPRLI 186

Query: 120 LPITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSS 179
           +P+ LD+GTN E+ L+D+ YLG+R +R+ D++FY  +D  M++    +P  +IQFEDFS+
Sbjct: 187 VPVILDVGTNTERYLQDKDYLGMRERRLGDEEFYELLDEFMEAASAEWPNAVIQFEDFSN 246

Query: 180 EHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXX 239
            H FD++ +Y++   CFNDDIQGTGAV+ +GF+NA+KL    V P + R++ F       
Sbjct: 247 NHCFDIMERYQKKYRCFNDDIQGTGAVIAAGFLNAIKL--SGVSPLQQRIVVFGAGSAAV 304

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDD---NDGN 296
                +       +    ++  +  +LVDTKGLVT  RGD LA HK   AR D    D  
Sbjct: 305 GVANNIAALAARMYKFPVQDLVKTFYLVDTKGLVTTTRGDQLAAHKKLLARTDVSAEDSA 364

Query: 297 QFKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFED 356
           + +TLEE++ +VKPT L+GL   G  F E+I+  + +  + PIIFPLSNP   AE T E+
Sbjct: 365 RLRTLEEIVRFVKPTTLLGLGGVGPAFTEEIVKMVMQNTERPIIFPLSNPTSKAEVTPEN 424

Query: 357 AMKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQI 416
           A K T+   I ASG+ FP  T+   GKT  P QGNN+Y+FPG+GLG  LA+P  I D+ +
Sbjct: 425 AYKWTNGAAIVASGSPFPPTTI--GGKTFKPSQGNNLYVFPGVGLGCALAEPTHIPDELL 482

Query: 417 YIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQN 476
                                YP +  I ++S               +  + Q +++ +N
Sbjct: 483 LTASESLNLLTTEGDLREGRLYPPLEDIHNISANVATD---------VILEAQRMKIDKN 533

Query: 477 DIEVLKTRKGKEWDNLVKFVQENMWDP 503
           + ++ +TR     D L+ FV++ MW P
Sbjct: 534 N-KLPRTR-----DELLAFVKKAMWKP 554



>gi|154296927|ref|XP_001548892.1| hypothetical protein BC1G_12552 [Botryotinia fuckeliana B05.10]
          Length = 569

 Score =  365 bits (937), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 190/368 (51%), Positives = 244/368 (66%), Gaps = 22/368 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFYR++I  +  + PL+YTPT+G  CL+YS +         P+ LY+S+    ++T 
Sbjct: 191 NTDLFYRLLIDNIATLMPLVYTPTIGDVCLQYSTLYTR------PEALYISIKQRKSMTT 244

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I++ + PYP      P I V+TDGSRILGLGDLGVNG+GI +GKL LY  AAGI P +TL
Sbjct: 245 ILRNW-PYP-----NPSICVVTDGSRILGLGDLGVNGVGISIGKLALYTGAAGIHPSQTL 298

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD GT NE+NL+D  YLGLR KR   +    F+D  M ++ +VYP++L+QFEDF SE
Sbjct: 299 PIVLDCGTANEENLRDPLYLGLRMKRPGPEIEQQFMDEFMAAVKEVYPDMLVQFEDFESE 358

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF  L +Y++    FNDDIQGTGAVVL+G+I AV L    V     RL+F         
Sbjct: 359 KAFKYLDRYKKEKM-FNDDIQGTGAVVLAGYIGAVNL--SGVPIEDQRLVFMGAGSAGVG 415

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
             KQ++E++    G+SE++A+   WLVDTKGLVT DRGD LA HK  FARDDN G+QF T
Sbjct: 416 VAKQVMEYY-TRRGLSEKDARDKFWLVDTKGLVTTDRGDKLAAHKKIFARDDNHGHQFAT 474

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRM------AELNKNPIIFPLSNPKVNAECTF 354
           LEEVIEYVKPTALIGL++T GVF E ++  +        L + PI+FPLSNP   AECTF
Sbjct: 475 LEEVIEYVKPTALIGLTATFGVFTESVVRALKGSVDAGGLGRRPILFPLSNPLTKAECTF 534

Query: 355 EDAMKGTD 362
           E A+  T+
Sbjct: 535 EQAITWTE 542



>gi|71755411|ref|XP_828620.1| malic enzyme [Trypanosoma brucei brucei strain 927/4 GUTat10.1]
 gi|70834006|gb|EAN79508.1| malic enzyme, putative [Trypanosoma brucei brucei strain 927/4
           GUTat10.1]
          Length = 571

 Score =  365 bits (937), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 208/521 (39%), Positives = 289/521 (55%), Gaps = 39/521 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  L+Y+IV   ++E  P+IYTPTVG AC +Y +I           GLY+S+ +   + Q
Sbjct: 83  NTVLYYKIVETYMKETLPIIYTPTVGEACQKYGNIFQR------DHGLYISMKERGVIRQ 136

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
            ++  R          ++ VITDGSRILGLGDLG NGMGI +GK  LYVAA GI+P R L
Sbjct: 137 TLENLRKPEV------EVIVITDGSRILGLGDLGANGMGISIGKCSLYVAAGGINPSRIL 190

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ +D+GT+NE    D  YLGLR KR  D+ FY+ +D  M++  + +PE +IQFEDFS+ 
Sbjct: 191 PVMMDVGTDNEGLRADPQYLGLRQKRPSDEDFYALLDEFMEAASEAWPEAVIQFEDFSNN 250

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H FD+L +Y+    CFNDDIQGTGAV+ +GF+NA++     +    HR++FF        
Sbjct: 251 HCFDMLERYQNKYRCFNDDIQGTGAVIAAGFLNAIE--ASGIPAEDHRIVFFGAGSAATG 308

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK- 299
               +++    ++  +  E +  V+L+DTKG++T  RGD LA HKV +AR D    Q K 
Sbjct: 309 VATCIVDLVAAKYKKTFAEVQNNVYLLDTKGVITTTRGDKLAPHKVPWARTDISAEQSKS 368

Query: 300 --TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDA 357
             TL + +++VKPTALIGL + GGVF E I+  M    + P+IF LSNP    E T ++A
Sbjct: 369 LSTLVDAVKFVKPTALIGLGAQGGVFTEDILKFMRSYCEKPVIFALSNPSSKVEVTPDNA 428

Query: 358 MKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
            K TD + I A+G+ FP  T+   GK     QGNN+Y+FPG+GLG  +A+PK I  + + 
Sbjct: 429 FKWTDGKAIVATGSPFPPTTL--NGKKYEASQGNNLYVFPGIGLGCAIAQPKNIPQEVLQ 486

Query: 418 IXXXXXXXXX-XXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQN 476
                                YP +  +R VS              GLA+          
Sbjct: 487 TAAVTLSKLVDRNVMASEGALYPCIDEVREVSKQVAAAVIEKLQEMGLAK---------- 536

Query: 477 DIEVLKTRKGKEWDNLVKFVQENMWDPDSEKFFNTEELLSK 517
             E L T KG+     +K V+E MW P   K+   E  LSK
Sbjct: 537 --EGLPTSKGER----LKLVEERMWTP---KYLEPEYYLSK 568



>gi|258574269|ref|XP_002541316.1| hypothetical protein UREG_00830 [Uncinocarpus reesii 1704]
 gi|237901582|gb|EEP75983.1| hypothetical protein UREG_00830 [Uncinocarpus reesii 1704]
          Length = 625

 Score =  364 bits (934), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 199/438 (45%), Positives = 263/438 (60%), Gaps = 23/438 (5%)

Query: 51  SLNDLPNLTQIIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVA 110
           S  D  N+  I+  + P P       +I  ITDGSRILGLGDLG+NGMGIP+GKL LY A
Sbjct: 101 SYEDRGNIAAILNNW-PQP-----NVEITCITDGSRILGLGDLGINGMGIPIGKLALYTA 154

Query: 111 AAGIDPRRTLPITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPEL 170
            AGI P  TLP+TLDLGT+N+   +D  Y+G R  +V   Q   F+D +M +L + +P +
Sbjct: 155 CAGIRPEATLPLTLDLGTSNKALREDPLYMGSRRDKVTPAQELEFLDELMVALTEKWPGI 214

Query: 171 LIQFEDFSSEHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLL 230
           ++QFEDF  ++ F  L +YR     FNDDIQGTGAV+L+G +NAVK  +  + P  H+ +
Sbjct: 215 VVQFEDF--KNPFPALERYRHKYTSFNDDIQGTGAVILAGVMNAVK--KSGIPPRNHKAV 270

Query: 231 FFXXXXXXXXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFAR 290
           F           KQ+++FF V  GMSE++A+   +LVDTKGLVT DRGD LA HKVYFAR
Sbjct: 271 FLGAGSAGVGVAKQIVDFF-VREGMSEDDARACFYLVDTKGLVTADRGDKLAPHKVYFAR 329

Query: 291 DDNDGNQFKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNA 350
            DN G QFKTLE+V+ YVKPT L+GLS+ GGVF  +I+ +M++ N+ PIIFPLSNP  N+
Sbjct: 330 TDNAGQQFKTLEDVVNYVKPTMLMGLSTLGGVFTPQILKKMSDWNRTPIIFPLSNPSANS 389

Query: 351 ECTFEDAMKGTDNRVIFASGTAFPEYTVPETG---KTKYPGQGNNMYIFPGLGLGAILAK 407
           EC FE A+  TD R +FASG+ F  ++        KT YPGQ        G+GLG IL+K
Sbjct: 390 ECNFESAIVNTDGRCLFASGSPFQPFSYTNHAGETKTHYPGQ--------GIGLGTILSK 441

Query: 408 PKVITDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARD 467
              ITD  IY                    YP ++RIR VS               + R+
Sbjct: 442 AVEITDSMIYASAQALSTALTKEETDLGLLYPDITRIREVSVTVARGVIRAAQDAKVDRE 501

Query: 468 KQIIEMVQNDIEV-LKTR 484
             I  +  +D++  +KTR
Sbjct: 502 TGIRSLSDSDLDAWIKTR 519



>gi|390950814|ref|YP_006414573.1| malic enzyme [Thiocystis violascens DSM 198]
 gi|504591790|ref|WP_014778892.1| malic enzyme [Thiocystis violascens]
 gi|390427383|gb|AFL74448.1| malic enzyme [Thiocystis violascens DSM 198]
          Length = 562

 Score =  364 bits (934), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 192/465 (41%), Positives = 265/465 (56%), Gaps = 19/465 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +L+YR+++  L E+TP+IYTP VG AC ++ HI           G+Y S  D  +  +
Sbjct: 90  NETLYYRVLLSHLNELTPIIYTPVVGQACSQFGHIYQR------ARGMYFSSADARHFEE 143

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++  +   P D     +  V+TDGSRILGLGDLG NGMGIP+GKL LYV  AG+ PR TL
Sbjct: 144 MVGNW---PEDAI---EAVVVTDGSRILGLGDLGANGMGIPIGKLSLYVLGAGLHPRNTL 197

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ LD+GTNN+   +D FYLG R  R+  D +   V+A M+++   +P+ LIQFEDFS++
Sbjct: 198 PVLLDMGTNNQALREDPFYLGQRIPRLTGDAYDKVVEAFMRAVHARWPDALIQFEDFSND 257

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF LL +YR    CFNDDIQGTGAV L+G ++A+++  + +  T+ R++F         
Sbjct: 258 QAFRLLERYRHRMLCFNDDIQGTGAVTLAGILSALRVTGQTL--TEQRVVFLGAGAAARG 315

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
               ++   + E G+  E A+R +W +D++GLVTLDR DNL++HK  FA+D         
Sbjct: 316 IADTIVAGMRAESGIGLEAARRQIWTLDSQGLVTLDRLDNLSEHKRPFAQDSAP---LAD 372

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L EVI  V+PT LIG+S   G F E+ +  M      PI+FPLSNP   AECT E A   
Sbjct: 373 LIEVIRTVRPTVLIGVSGQPGSFTEEAVREMHRHCARPILFPLSNPTSKAECTAEQAYTW 432

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           TD   +FASG+ FP  T    G    PGQ NNMYIFPG+G G +  +   +TD   Y+  
Sbjct: 433 TDGAALFASGSPFPPIT--RAGHLLVPGQCNNMYIFPGVGQGVVACQASQVTDTMFYVAA 490

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLA 465
                            YP +++IR +S              GLA
Sbjct: 491 RTLAGLVGEDSLAVGRLYPDLTQIREISAKIAVAVCELAFAEGLA 535



>gi|392574404|gb|EIW67540.1| hypothetical protein TREMEDRAFT_45110 [Tremella mesenterica DSM
           1558]
          Length = 551

 Score =  364 bits (934), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 217/506 (42%), Positives = 297/506 (58%), Gaps = 36/506 (7%)

Query: 4   LFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQIIK 63
           LF+  +  +L ++ PL+YTPTVG AC +YSHI         P+GLYLS++D   L +I++
Sbjct: 70  LFFAALKDDLNQMAPLVYTPTVGEACQKYSHIYTG------PEGLYLSIDDKDRLPEILQ 123

Query: 64  TYRPYPYDDTLT--PQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLP 121
            Y       TL+  PQI V+TDGSRILGLGDLG+ GMGI VGKL LYVA  GIDP  TLP
Sbjct: 124 AYAA-----TLSRIPQIVVVTDGSRILGLGDLGIGGMGISVGKLNLYVAGGGIDPNGTLP 178

Query: 122 ITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSEH 181
           + LD+GTNN+  L D  Y+GL+  R    +  SF+D  M ++  ++P  +IQ EDF SE 
Sbjct: 179 VVLDMGTNNQTLLDDPLYIGLKRPRASLAEAESFMDTFMATVSTLFPTTVIQHEDFYSEA 238

Query: 182 AFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEK-DVHPTK-HRLLFFXXXXXXX 239
           AF  L KY++    FNDDIQGTGAV+L+GF+ A +        P K H+++F        
Sbjct: 239 AFLFLEKYQKKYRMFNDDIQGTGAVILAGFLAAARKASALSGLPLKDHKVVFLGGGSAAV 298

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDR----GDNLAKHKVYFARDDNDG 295
              K+++ FF +E G+SE+EAK   WL+DTKGL+T  R     D +A HK YF R D +G
Sbjct: 299 GVAKEMMNFFLME-GLSEQEAKERFWLIDTKGLITSTRTDVVTDKIAGHKKYFIRYDTEG 357

Query: 296 NQFKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFE 355
            ++KTL +VIEYVKPTAL+GLS+T G F + ++ RMAELNK PIIFPLSNP    E  F 
Sbjct: 358 KEYKTLSDVIEYVKPTALVGLSTTFGAFEQPVVRRMAELNKAPIIFPLSNPTSKCELAFS 417

Query: 356 DAMKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQ 415
           DA++ T+ +V+FASG+  P   +   GK +   QGNN  +FPG+G GA++A  K +TD  
Sbjct: 418 DALEWTNGKVLFASGS--PYSPIVYQGKLREAAQGNNFLVFPGIGFGALMAGAKHVTDGM 475

Query: 416 IYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQ 475
           I                     YP + RIR VS                     ++   +
Sbjct: 476 ITASAIALSEAMTPDEESDELLYPRLDRIREVSARVAAGV--------------VLAAQK 521

Query: 476 NDIEVLKTRKGKEWDNLVKFVQENMW 501
             ++  +  +G  WD LV+ + ++ W
Sbjct: 522 EGVDTTERLRGMSWDKLVQEMLDSQW 547



>gi|146087792|ref|XP_001465906.1| malic enzyme [Leishmania infantum JPCM5]
 gi|398015959|ref|XP_003861168.1| malic enzyme [Leishmania donovani]
 gi|134070007|emb|CAM68337.1| malic enzyme [Leishmania infantum JPCM5]
 gi|322499393|emb|CBZ34466.1| malic enzyme [Leishmania donovani]
          Length = 571

 Score =  364 bits (934), Expect = 4e-98,   Method: Compositional matrix adjust.
 Identities = 197/492 (40%), Positives = 279/492 (56%), Gaps = 22/492 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +L+Y +V+  +EE+ P+IYTPTVG AC  +S+            G+YLS     + ++
Sbjct: 86  NTTLYYALVLTHIEELLPIIYTPTVGEACQNFSNYWVR------ERGMYLSKYLKGHFSE 139

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++K      YD+     + VITDGSRILGLGDLG NG+GI +GK  LYVA AG+ P R L
Sbjct: 140 VMKESL---YDNV---DVIVITDGSRILGLGDLGANGIGISIGKCSLYVAGAGLHPSRVL 193

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ +D+GTN E+ L D  YLG R KR+DDDQFYS +D  M+++   +P  ++QFEDFS+ 
Sbjct: 194 PVVMDVGTNTERYLNDREYLGTREKRLDDDQFYSLLDEFMEAVKDTWPSAVVQFEDFSNN 253

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H FD+L +Y++   CFNDDIQGTGAV+ +GF+NAVK  +  + P + R++ F        
Sbjct: 254 HCFDMLERYQKKYRCFNDDIQGTGAVIAAGFLNAVK--KSGLGPLEQRIVVFGAGSAAVG 311

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDD---NDGNQ 297
             K + +     + +   E  +  +LVDTKGLV+  RGD LA HKV  +R D    D   
Sbjct: 312 VAKNIAQLASRMYNVDIAEVLKTFYLVDTKGLVSDTRGDKLAAHKVLLSRKDISAEDSQN 371

Query: 298 FKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDA 357
            K+LE+V+++VKPTAL+GL   G VF E I+  +A     PIIFPLSNP   +E   +DA
Sbjct: 372 LKSLEDVVQFVKPTALLGLGGVGPVFTEAIVKSVAANAARPIIFPLSNPTSKSEVMPDDA 431

Query: 358 MKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
            + T+   I ASG+ FP  T+   GKT  P QGNN+Y+FPG+GLG  L +P  I D  + 
Sbjct: 432 YRWTNGAAIIASGSPFPASTI--NGKTIKPSQGNNLYVFPGVGLGCALVQPSYIPDDLLV 489

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP +  I ++S              G+  +K   ++ +  
Sbjct: 490 AASACLNLLTTPEQMEVEQLYPPLEDIHNISAHIATEVIMEAQRLGIDGNK---DLPREK 546

Query: 478 IEVLKTRKGKEW 489
             +L   K  +W
Sbjct: 547 DAILAAIKTSQW 558



>gi|261334503|emb|CBH17497.1| malic enzyme, putative [Trypanosoma brucei gambiense DAL972]
          Length = 571

 Score =  362 bits (930), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 207/521 (39%), Positives = 288/521 (55%), Gaps = 39/521 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  L+Y+IV   ++E  P+IYTPTVG AC +Y +I           GLY+S+ +   + Q
Sbjct: 83  NTVLYYKIVETYMKETLPIIYTPTVGEACQKYGNIFQR------DHGLYISMKERGVIRQ 136

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
            ++  R          ++ VITDGSRILGLGDLG NGMGI +GK  LYVAA GI+P R L
Sbjct: 137 TLENLRKPEV------EVIVITDGSRILGLGDLGANGMGISIGKCSLYVAAGGINPSRIL 190

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ +D+GT+NE    D  YLGLR KR  D+ FY+ +D  M++  + +PE +IQFEDFS+ 
Sbjct: 191 PVMMDVGTDNEGLRADPQYLGLRQKRPSDEDFYALLDEFMEAASEAWPEAVIQFEDFSNN 250

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H FD+L +Y+    CFNDDIQGTGAV+ +GF+NA++     +    HR++FF        
Sbjct: 251 HCFDMLERYQNKYRCFNDDIQGTGAVIAAGFLNAIE--ASGIPAEDHRIVFFGAGSAATG 308

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK- 299
               +++    ++  +  E +  V+L+DTKG++T  RGD LA HKV +AR D    Q K 
Sbjct: 309 VATCIVDLVAAKYKKTFAEVQNNVYLLDTKGVITTTRGDKLAPHKVPWARTDISAEQSKS 368

Query: 300 --TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDA 357
             TL + +++VKPTALIGL + GGVF E I+  M    + P+IF LSNP    E T ++A
Sbjct: 369 LSTLVDAVKFVKPTALIGLGAQGGVFTEDILKFMRSYCEKPVIFALSNPSSKVEVTPDNA 428

Query: 358 MKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
            K TD + I A+G+ FP  T+   GK     QGNN+Y+FPG+GLG  +A+PK I  + + 
Sbjct: 429 FKWTDGKAIVATGSPFPPTTL--NGKKYEASQGNNLYVFPGIGLGCAIAQPKNIPQEVLQ 486

Query: 418 IXXXXXXXXX-XXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQN 476
                                YP +  +R VS              GLA+          
Sbjct: 487 TAAVTLSKLVDRNVMASEGALYPCIDEVREVSKQVAAAVIEKLQEMGLAK---------- 536

Query: 477 DIEVLKTRKGKEWDNLVKFVQENMWDPDSEKFFNTEELLSK 517
             E L T K    +  +K V+E MW P   K+   E  LSK
Sbjct: 537 --EGLPTSK----EERLKLVEERMWTP---KYLEPEYYLSK 568



>gi|401422804|ref|XP_003875889.1| malic enzyme [Leishmania mexicana MHOM/GT/2001/U1103]
 gi|322492129|emb|CBZ27403.1| malic enzyme [Leishmania mexicana MHOM/GT/2001/U1103]
          Length = 571

 Score =  362 bits (929), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 195/488 (39%), Positives = 278/488 (56%), Gaps = 19/488 (3%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +L+Y +V+  +E++ P+IYTPTVG AC  +S+            G+YLS     + ++
Sbjct: 86  NTTLYYALVLAHIEDLLPIIYTPTVGEACQNFSNYWVR------ERGMYLSKYLKSHFSE 139

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++K      YD+     + VITDGSRILGLGDLG NG+GI +GK  LYVA AG+ P R L
Sbjct: 140 VMKESL---YDNV---DVIVITDGSRILGLGDLGANGIGISIGKCSLYVAGAGLHPSRVL 193

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ +D+GTN E+ L D  YLG R KR+DDD FYS +D  M+++ + +P  ++QFEDFS+ 
Sbjct: 194 PVVMDVGTNTERYLNDPEYLGTREKRLDDDLFYSLLDEFMEAVKETWPSAVVQFEDFSNN 253

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H FD+L +Y++   CFNDDIQGTGAV+ +GF+NAVK  +  + P + R++ F        
Sbjct: 254 HCFDMLERYQKKYRCFNDDIQGTGAVIAAGFLNAVK--KSGLGPLEQRIVVFGAGSAAVG 311

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDD---NDGNQ 297
             K + +     + +   E  +  +LVDTKGLV+  RGD LA HK   +R D    D   
Sbjct: 312 VAKNIAQLASRMYNVDIAEVLKTFYLVDTKGLVSDTRGDKLAAHKALLSRKDISAEDSQN 371

Query: 298 FKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDA 357
            K+LE+V+++VKPTAL+GL   G VF E I+  +A     PIIFPLSNP   AE   +DA
Sbjct: 372 LKSLEDVVQFVKPTALLGLGGVGPVFTEAIVKSVAANAARPIIFPLSNPTSKAEVMPDDA 431

Query: 358 MKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
            + T+   I ASG+ FP  T+   GKT  P QGNN+Y+FPG+GLG  L +P  I+D  + 
Sbjct: 432 YRWTNGAAIIASGSPFPPSTI--NGKTIKPSQGNNLYVFPGVGLGCALVQPSYISDDLLV 489

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP +  I ++S              G+  +K +       
Sbjct: 490 AASACLNLLTTPEQMEAEQLYPPLGDIHNISAHIATEVIMEAQRLGIDGNKDLPREKDAI 549

Query: 478 IEVLKTRK 485
           + V+KT +
Sbjct: 550 LAVIKTSQ 557



>gi|342185669|emb|CCC95154.1| unnamed protein product [Trypanosoma congolense IL3000]
          Length = 561

 Score =  361 bits (927), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 203/506 (40%), Positives = 278/506 (54%), Gaps = 34/506 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  L+Y  +   LEE  P+IYTPTVG AC +Y+ +  F        GLY +       + 
Sbjct: 80  NTVLYYATIFAHLEETLPIIYTPTVGEACQKYNKLL-FRE-----RGLYFNHTYKGMFSS 133

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+       YDD   P++ VITDGSRILGLGDLG NG+GI +GK  LYVA AGI P + +
Sbjct: 134 IMGDAG---YDD---PEVIVITDGSRILGLGDLGANGVGISIGKCSLYVAGAGIKPEKVI 187

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ LD+GT+NE    D  YLGLR KR  DDQFY+ +D  M+S+ +V+P+ ++QFEDFS+ 
Sbjct: 188 PVILDVGTDNESLRSDPLYLGLREKRAPDDQFYTLLDEFMESVREVWPKAVVQFEDFSNN 247

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H FD+L +Y++   CFNDDIQGTGAV+ +GF+NA+KL    + P KHR++ F        
Sbjct: 248 HCFDMLDRYQKKYRCFNDDIQGTGAVIAAGFLNAMKL--SGIEPLKHRIVVFGAGSAAVG 305

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDD---NDGNQ 297
               +       + ++  +  +  +LVDTKGLVT  RGD LA HKV  AR D    D  +
Sbjct: 306 VVNNIAALAAQVYNLNAGDVIKTFYLVDTKGLVTTTRGDKLAPHKVPLARTDVSAEDSAK 365

Query: 298 FKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDA 357
             TLE+V+ + KPT L+GL   G VF E ++  M E    PII PLSNP   AE   +DA
Sbjct: 366 LTTLEDVVRFAKPTTLLGLGGVGPVFTESMVKSMLEYTNRPIILPLSNPTSKAEILPQDA 425

Query: 358 MKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
            + T+ + I ASG+ FP  T+   GK     QGNN+YIFPG+GLG  +A+P  I D+ + 
Sbjct: 426 FRWTNGKAIVASGSPFPPTTL--EGKVYSASQGNNLYIFPGVGLGCAIAQPSYIPDELLV 483

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP +S I ++S               +A +     + Q  
Sbjct: 484 TASYCLKNLVSEADLQKGSLYPPLSDIHNISANIATDVILEAQRLKVAANS---SLPQTR 540

Query: 478 IEVLKTRKGKEWDNLVKFVQENMWDP 503
            EVL             +V++ MW+P
Sbjct: 541 AEVL------------AYVKQVMWEP 554



>gi|510034073|gb|AGN32876.1| malic enzyme [Trypanosoma rangeli]
          Length = 563

 Score =  360 bits (925), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 202/515 (39%), Positives = 285/515 (55%), Gaps = 52/515 (10%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIP-----DGLYLSLNDL 55
           N +L+Y  ++  +EE+ P++YTPTVG AC +YS    F    G+       G++ S+   
Sbjct: 79  NTTLYYATILAHVEELLPIVYTPTVGEACEDYSR--HFFRERGLYFNRLYKGMFRSI--- 133

Query: 56  PNLTQIIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGID 115
                     R   Y+      + V+TDGSRILGLGDLG NG+GI +GK  LYV  AGI 
Sbjct: 134 ---------MRDAAYERV---DVVVVTDGSRILGLGDLGSNGIGISIGKCSLYVVGAGIS 181

Query: 116 PRRTLPITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFE 175
           PR T+P+ LD+GTN E+ L+++ YLG+R KR+ D++FY+ +D  M +    +P  +IQFE
Sbjct: 182 PRHTVPVMLDVGTNTERYLQEKEYLGVREKRLSDEEFYAVMDEFMDAARAEWPNAVIQFE 241

Query: 176 DFSSEHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXX 235
           DFS++H FD+L +Y++   CFNDDIQGTGAV+ +GF+NAVKL    + P +HR++ F   
Sbjct: 242 DFSNDHCFDILERYQKKYRCFNDDIQGTGAVIAAGFLNAVKL--SGIAPLQHRIIVFGAG 299

Query: 236 XXXXXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDG 295
                  K + E     + +  E+  +  +LVDT+GLVT  RGD LA HK   AR D   
Sbjct: 300 SAAVGVAKSIAELAAHLYSIPVEDVLKTFYLVDTRGLVTTTRGDELAPHKKLLARTDVSA 359

Query: 296 NQ---FKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAEC 352
            +     TLE+V+ +VKPT L+GL+  G VF E+I+  + +    PIIFPLSNP   AE 
Sbjct: 360 EEVARLHTLEDVVRFVKPTTLLGLAGAGPVFTEEIVRLVKQNAPRPIIFPLSNPTRKAEV 419

Query: 353 TFEDAMKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVIT 412
           T EDA K TD   I ASG+ FP   +    KT  P QGNN+Y+FPG+GLG  LA+P  I 
Sbjct: 420 TPEDAYKWTDGAAIVASGSPFPSTVI--GNKTLIPSQGNNLYVFPGIGLGCALAQPTHIP 477

Query: 413 DKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIE 472
           D+ +                     YP +S I ++S                    QI  
Sbjct: 478 DELLLASSKTLNLLTTEENLREGRLYPPLSDIHNIS-------------------AQIAT 518

Query: 473 MVQNDIEVLKTRKGKEW----DNLVKFVQENMWDP 503
            V  + + LK           D L+ +V+++MW+P
Sbjct: 519 AVVLEAQRLKIAANHNLPHSRDELLAYVKKSMWNP 553



>gi|294933125|ref|XP_002780610.1| malic enzyme, putative [Perkinsus marinus ATCC 50983]
 gi|239890544|gb|EER12405.1| malic enzyme, putative [Perkinsus marinus ATCC 50983]
          Length = 845

 Score =  359 bits (921), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 203/507 (40%), Positives = 282/507 (55%), Gaps = 39/507 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +L+YR+++  + ++ P++YTP+VG AC ++  I  F    GI    Y ++++  N  Q
Sbjct: 324 NETLYYRLLLDNITDLMPIVYTPSVGQACKDFDRI--FRGSRGI----YFNISEKGNFKQ 377

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I        D      I V+TDGSRILGLGDLG NGMGIP+GKL LYVA AGI+P RT+
Sbjct: 378 VIWNSNVRDAD------IIVVTDGSRILGLGDLGTNGMGIPIGKLSLYVACAGINPGRTV 431

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLD+GTNN   L D+ YLG R KRVD +++Y+ VD  + ++   +P +LIQFEDF+++
Sbjct: 432 PVTLDVGTNNPDLLNDDMYLGERHKRVDGEEYYAAVDEFVDAVRSRWPGVLIQFEDFTND 491

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           HAF LL +Y+EN  CFNDDIQGTG+V L+G + A++   K       R++FF        
Sbjct: 492 HAFPLLKRYQENILCFNDDIQGTGSVALAGVLTAMR--AKSEALADQRIVFFGAGSAAVG 549

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
               ++    V+ G++ EEA++  WLVD++GLVT  RG  L +HK+ F RDD      ++
Sbjct: 550 VADSIVSAM-VQQGLTIEEARQRFWLVDSRGLVTSKRGGELQEHKIRFCRDD---EPLES 605

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L EV++ VKPT L+GLS   G F E+II  M      P+IF LSNP   AE T E     
Sbjct: 606 LLEVVQVVKPTILLGLSGQYGAFTEEIIKEMHAHCPAPVIFALSNPTPKAEATPEQLYIW 665

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           T      A+G+ F   T    GK   PGQGNNMYIFPG+GL AI+ K K I D   Y   
Sbjct: 666 TGGEAWVATGSPFKPVTY--NGKIYIPGQGNNMYIFPGVGLAAIVGKFKNIPDTMFYRAA 723

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YP ++RIR +S              G+A+  +           
Sbjct: 724 KTLSEKVAEEDLAQGLLYPQINRIRELSHAIAVACIKEALDTGIAQISRP---------- 773

Query: 481 LKTRKGKEWDNLVKFVQENMWDPDSEK 507
                    D+L + VQ+ MW P+  +
Sbjct: 774 ---------DDLNQLVQDAMWQPEYSR 791



>gi|224001756|ref|XP_002290550.1| NAD dependent malic enzyme [Thalassiosira pseudonana CCMP1335]
 gi|220973972|gb|EED92302.1| NAD dependent malic enzyme [Thalassiosira pseudonana CCMP1335]
          Length = 559

 Score =  358 bits (920), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 196/508 (38%), Positives = 290/508 (57%), Gaps = 42/508 (8%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +L++RI++  +EE+ P+IYTPTVG AC E+     F  P     G+Y    D  ++  
Sbjct: 76  NETLYHRILVDHIEEMAPIIYTPTVGQACKEFGM--RFRRP----RGMYFCEEDRGHMAA 129

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++  +   P  D     + V+TDGSRILGLGDLG NGMGIP+GKL LY AA GI P R +
Sbjct: 130 MVYNW---PQKDV---HVIVVTDGSRILGLGDLGANGMGIPIGKLSLYCAAGGIAPHRVM 183

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ LD+GTNNE+ +KD FYLG++  R+   ++Y  VD  ++++   +P +LIQFEDFSS+
Sbjct: 184 PVVLDVGTNNEELIKDPFYLGMQRPRLQGTKYYHLVDEFIQAVRHRWPNVLIQFEDFSSD 243

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPT---KHRLLFFXXXXX 237
            A  LL+KYR+   CFNDDIQGTGA  L+G +  ++   K   PT   + R+L       
Sbjct: 244 KAQKLLNKYRDEILCFNDDIQGTGATTLAGVLGGLR--AKGEQPTSLGEQRILIAGAGSA 301

Query: 238 XXXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQ 297
                + L++   +EHG +EEEAK+  ++ D KGL+  DR   L+  +  FARD++ G  
Sbjct: 302 GIGVAQVLMQAM-MEHGRTEEEAKKCFYIADEKGLLGTDRIHELSPEQAMFARDEDGG-- 358

Query: 298 FKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDA 357
             +L E++   KPT ++G+++ GG+F E++I  MA+  + PIIFPLSNP   AEC+ E A
Sbjct: 359 -LSLNEIVNKYKPTMILGMTAVGGLFTEQLIRNMAKHCERPIIFPLSNPTTKAECSAEQA 417

Query: 358 MKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
            + TD + IFASG+ F    + + G+  YP Q NNM++FPG+GLG  L   + ++D+ +Y
Sbjct: 418 FEWTDGKCIFASGSPFEPVEMND-GRKFYPTQCNNMFVFPGIGLGVTLCGARTVSDRMLY 476

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
           +                   +P ++ IR VS                   K  I +++  
Sbjct: 477 VAAEALANYVTEDELAEGKVFPSINTIRDVS------------------KKVAIAVIEEA 518

Query: 478 IEVLKTRKGKEWD--NLVKFVQENMWDP 503
           I   +  K  E D  +L  FV   M+DP
Sbjct: 519 ISTGQASKLTEKDISDLDDFVSRKMYDP 546



>gi|405123849|gb|AFR98612.1| malate dehydrogenase [Cryptococcus neoformans var. grubii H99]
          Length = 600

 Score =  358 bits (919), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 209/507 (41%), Positives = 300/507 (59%), Gaps = 32/507 (6%)

Query: 3   SLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQII 62
           +LF+ ++  EL ++ P++YTPTVG AC +YS I         P+GLYL++ D   + +I+
Sbjct: 120 NLFFSVMRDELTDLAPIVYTPTVGEACQKYSQIY------SGPEGLYLNIEDKDRIPEIL 173

Query: 63  KTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPI 122
              R Y       PQI V+TDGSRILGLGDLG+ GMGI VGKL LYVA  G++P   LP+
Sbjct: 174 ---RQYASKLVTPPQILVVTDGSRILGLGDLGIGGMGISVGKLNLYVAGGGVNPHGCLPV 230

Query: 123 TLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSEHA 182
            LD+GTNNE    D  Y+GL+  RV  ++   F+DA M +  + +P+ +IQ EDF SE A
Sbjct: 231 VLDMGTNNETIRNDPLYIGLKQSRVGLEEATEFMDAFMAAASEAFPKAVIQHEDFYSEAA 290

Query: 183 FDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLV-EKDVHPTK-HRLLFFXXXXXXXX 240
           FD L++Y+E    FNDDI+GTG+V+L+GF+ A K   E    P + H+++F         
Sbjct: 291 FDFLARYKEKYRMFNDDIEGTGSVILAGFLAAAKQASEASGKPLRDHKVVFLGGGSAAVG 350

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGD----NLAKHKVYFARDDNDGN 296
             K+++ FF ++ G++E+EA+   WL+DTKGL+T  R D     +A HK +F R+D +G 
Sbjct: 351 VAKEMMNFFMMQ-GLTEDEARERFWLIDTKGLITSTRADVVSGKIASHKKFFIRNDTEGK 409

Query: 297 QFKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFED 356
           ++ +LE VIEYV+PTAL+GLS+T G F+E  + RMAELN++PIIFPLSNP    E  F D
Sbjct: 410 EYPSLESVIEYVQPTALVGLSTTFGAFSEFAVRRMAELNQSPIIFPLSNPTSKCELAFSD 469

Query: 357 AMKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQI 416
           A++ TD RV+FASG+ +P       G  + PGQGNN  +FPG+G GA+ A  K IT   I
Sbjct: 470 ALEWTDGRVLFASGSPYPPQQF--KGTLREPGQGNNFLVFPGIGFGALQAGCKRITTGMI 527

Query: 417 YIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQN 476
                                YP + RIR VS              G+ +  Q     ++
Sbjct: 528 TASAIALSEALTPEEKQKGLLYPRLERIRAVS---------ARVAAGVVKQAQ-----ED 573

Query: 477 DIEVLKTRKGKEWDNLVKFVQENMWDP 503
            ++  +T +G + + L + + +  W P
Sbjct: 574 GVDTNETLRGLDIEALTEEMNKAQWWP 600



>gi|148257076|ref|YP_001241661.1| malate dehydrogenase [Bradyrhizobium sp. BTAi1]
 gi|500992225|ref|WP_012045714.1| malate dehydrogenase [Bradyrhizobium sp. BTAi1]
 gi|146409249|gb|ABQ37755.1| Malate dehydrogenase [Bradyrhizobium sp. BTAi1]
          Length = 543

 Score =  356 bits (914), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 205/503 (40%), Positives = 275/503 (54%), Gaps = 41/503 (8%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +LF+R+V   ++EI PLIYTPTVG AC +Y  I         P GL++S ND   + +
Sbjct: 80  NEALFFRVVCDNIDEIQPLIYTPTVGLACQKYGLIFQR------PRGLFISANDRGRIAE 133

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+  +   PY   L     V+TDG RILGLGDLG NGMGIPVGKL LY A AGI P   L
Sbjct: 134 ILANW---PYRAKLI----VVTDGERILGLGDLGANGMGIPVGKLSLYSACAGIHPEECL 186

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ LD+GTNNE+ LKD +Y+GLR KR+    +  FVD  M +    +P +LIQFEDF++ 
Sbjct: 187 PVMLDVGTNNEEFLKDPYYIGLRQKRITGAAYDEFVDEFMTAARAAFPGVLIQFEDFANH 246

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF LL KYR++   FNDDIQGT AV L+G  +A+++    +     R+LF         
Sbjct: 247 AAFKLLHKYRDDACVFNDDIQGTAAVALAGLFSALRITGGRLR--DQRVLFLGAGEAATG 304

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
               ++     E G+SE EA +  WL D++GLV   R +NL  HK+ +A +      F T
Sbjct: 305 IADLVVSAMMAE-GLSEAEALQRNWLTDSRGLVVKGR-ENLHGHKLRYAHEQAPIGDFLT 362

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
               I  +KPTA+IG+++ GG F  +++  MAELN+ PIIF LSNP   AEC+ E A + 
Sbjct: 363 ---SIRTLKPTAIIGVAAVGGAFTPEVLQAMAELNERPIIFALSNPTSKAECSAEAAYRY 419

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           T  R +FA G+  P   V   GKT  P QGNN YIFPG+GLGAI +  +++TD+      
Sbjct: 420 TQGRALFACGS--PYDPVKLDGKTFVPRQGNNSYIFPGVGLGAIASGARLVTDEMFMAAA 477

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YP + RIR VS              GLA               
Sbjct: 478 HTLANCVTGADLEQGSLYPALPRIREVSALIGAAVAGVAYQNGLA--------------- 522

Query: 481 LKTRKGKEWDNLVKFVQENMWDP 503
                G   ++L+ FV++ M+DP
Sbjct: 523 ----SGPAPNDLLGFVEQKMYDP 541



>gi|94469707|gb|ABF20307.1| cytosolic NADP-malic enzyme [Leishmania gerbilli]
          Length = 548

 Score =  355 bits (912), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 198/504 (39%), Positives = 282/504 (55%), Gaps = 26/504 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV+L+Y I+   L++  P++YTPTVG AC  Y  +           GLYL +     + +
Sbjct: 63  NVTLYYAILTRYLKQTLPIVYTPTVGEACQRYGDLYQ------KDHGLYLDVASKGKVRK 116

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+  R    D      + VITDGSRILGLGDLG NG+GI +GK  LYVAA G+ P R L
Sbjct: 117 LIQNLRKTNVD------VIVITDGSRILGLGDLGANGIGISIGKCSLYVAAGGVKPSRVL 170

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ +D+GTNN +   +  YLGLR  R  D  FY+ +D  M+++   +P  ++QFEDFS+ 
Sbjct: 171 PVVMDVGTNNLELRNNPLYLGLRKPRCGDADFYALLDEFMEAVKDTWPSAVVQFEDFSNN 230

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H FD+L +Y++   CFNDDIQGTGAV+ +GF  AVKL +  +   + R++FF        
Sbjct: 231 HCFDMLERYQQKYRCFNDDIQGTGAVIAAGFHTAVKLSK--IPMEQQRIVFFGAGSAATG 288

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARD---DNDGNQ 297
             + + +    E GM +E  K+ ++ VD+ G+V  +RGD LAKHK+ +AR    D D   
Sbjct: 289 VAESIAD-LAAEAGMKKEGIKKNIFFVDSMGMVATNRGDKLAKHKLGWARTDIPDADIAS 347

Query: 298 FKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDA 357
            KTLE+V+ YV+PTALIGL +T  VF+ KI+  M     +PIIFPLSNP   AE     A
Sbjct: 348 LKTLEDVVRYVRPTALIGLGATANVFSRKIVEFMHSCCPHPIIFPLSNPSSKAEIVPASA 407

Query: 358 MKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
            K T+   I ASG+ FPE  V  +G+T  P QGNN+YIFPG+GLG  +A+P  I  + + 
Sbjct: 408 YKWTNGDAIVASGSPFPETVV--SGRTLQPSQGNNLYIFPGVGLGCCIAQPPYIPQEVLV 465

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP +  +R VS              GLA+     ++  N 
Sbjct: 466 AAAACLSTLATPDDLAKGQLYPPIEEVRRVSREVAVACIQKLQELGLAK----ADLPDNR 521

Query: 478 IEVLKTRKGKEWDNLVKFVQENMW 501
            +++K  K   W+   +++ EN +
Sbjct: 522 PDLMKLVKTAFWEP--RYLPENYY 543



>gi|58262262|ref|XP_568541.1| malate dehydrogenase (oxaloacetate-decarboxylating) [Cryptococcus
           neoformans var. neoformans JEC21]
 gi|134118836|ref|XP_771921.1| hypothetical protein CNBN1010 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50254525|gb|EAL17274.1| hypothetical protein CNBN1010 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57230715|gb|AAW47024.1| malate dehydrogenase (oxaloacetate-decarboxylating), putative
           [Cryptococcus neoformans var. neoformans JEC21]
          Length = 600

 Score =  355 bits (910), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 209/496 (42%), Positives = 294/496 (59%), Gaps = 26/496 (5%)

Query: 3   SLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQII 62
           +LF+ ++  EL E+ P++YTPTVG AC +YS I         P+GLYL++ D   + +I+
Sbjct: 120 NLFFSVMRDELTELAPIVYTPTVGEACQKYSQIY------SGPEGLYLNIEDKDRIPEIL 173

Query: 63  KTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPI 122
             Y          PQI V+TDGSRILGLGDLG+ GMGI VGKL LYVA  G++P   LP+
Sbjct: 174 HQY---ASKLVAPPQILVVTDGSRILGLGDLGIGGMGISVGKLNLYVAGGGVNPHGCLPV 230

Query: 123 TLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSEHA 182
            LD+GTNNE    D  Y+GL+  RV  ++   F+DA M +  + +P+ +IQ EDF SE A
Sbjct: 231 VLDMGTNNEAVRNDPLYIGLKQPRVGLEEATEFMDAFMAAASEAFPKAVIQHEDFYSEAA 290

Query: 183 FDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLV-EKDVHPTK-HRLLFFXXXXXXXX 240
           FD L++Y+E    FNDDI+GTG+V+L+GF+ A K   E    P + H+++F         
Sbjct: 291 FDFLARYKEKYRMFNDDIEGTGSVILAGFLAAAKHASEASGKPLRDHKVVFLGGGSAAVG 350

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGD----NLAKHKVYFARDDNDGN 296
             K+++ FF ++ G++E+EA+   WL+DTKGL+T  R D     +A HK +F R+D +G 
Sbjct: 351 VAKEMMNFFMMQ-GLTEDEARERFWLIDTKGLITSTRADVVSGKVASHKKFFIRNDTEGK 409

Query: 297 QFKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFED 356
           ++ +LE VIEYV+PTAL+GLS+T G F+E  + RMAELN++PIIFPLSNP    E  F D
Sbjct: 410 EYPSLESVIEYVQPTALVGLSTTFGAFSESAVRRMAELNQSPIIFPLSNPTSKCELAFSD 469

Query: 357 AMKGTDNRVIFASGTAFPEYTVPET--GKTKYPGQGNNMYIFPGLGLGAILAKPKVITDK 414
           A++ TD RV+FASG+ +     P+   G  + PGQGNN  +FPG+G GA+ A  K IT  
Sbjct: 470 ALEWTDGRVLFASGSPY----APQQFKGTFREPGQGNNFLVFPGIGFGALQAGCKRITTG 525

Query: 415 QIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMV 474
            I                     YP + RIR VS              G+  ++++  + 
Sbjct: 526 MITASAIALSEALTPEEKQKGLLYPRLERIRAVSARVAAGVVKQAQEDGVDTNEKLRGL- 584

Query: 475 QNDIEVLKTRKGK-EW 489
             DIE L     K +W
Sbjct: 585 --DIETLTEEMNKAQW 598



>gi|428186275|gb|EKX55125.1| hypothetical protein GUITHDRAFT_91319 [Guillardia theta CCMP2712]
          Length = 546

 Score =  355 bits (910), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 191/448 (42%), Positives = 264/448 (58%), Gaps = 20/448 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +LFYR+++  L+E+ P+IYTP VG ACL Y HI         P G+YLS+ D  N++ 
Sbjct: 74  NETLFYRVLVDHLQELMPIIYTPVVGLACLRYGHIFQR------PRGMYLSIEDKGNVSN 127

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+  +     D      +AVITDG RILGLGDLG  GMGIP+GKL LY A AGI PRR L
Sbjct: 128 ILNNWPECQVD------VAVITDGERILGLGDLGAYGMGIPIGKLNLYTACAGIHPRRCL 181

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI +D+GTNN+K   D  Y GL S RV  + +++F++ V+ SL   +P +LIQFEDF + 
Sbjct: 182 PILVDVGTNNKKLHADAMYTGLPSARVRGEAYFAFMEEVLTSLSSKFPGILIQFEDFGNT 241

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF LL  YR+    FNDDIQGT AV L+G ++AV++  K        L+F         
Sbjct: 242 TAFQLLQSYRQRICTFNDDIQGTAAVALAGLLSAVRV--KGTRLRDEVLVFMGAGEAGTG 299

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
               ++E    E G+++EEA+   WLVD+KGLV   R + L  HK+ +A +     + K 
Sbjct: 300 IADLVVEQMHAE-GLTKEEARARCWLVDSKGLVVKSRREELQHHKLNYAHEH---GKIKD 355

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L  ++  ++PTALIG+ +T  VF  +I+  M+E+N+ PI+FPLSNP   AEC+ E+A   
Sbjct: 356 LLSIVRTLRPTALIGVCATAKVFTREIVELMSEINERPILFPLSNPTQLAECSAEEAWTW 415

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           T  +V+FASG+ F    +   G+   PGQGNN YIFPG+GLGA++ K + ITD    I  
Sbjct: 416 TRGKVLFASGSPFD--PIERDGRLFVPGQGNNAYIFPGVGLGAVVGKLRHITDNMFRIAA 473

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                            +P +  +R VS
Sbjct: 474 RALADQVTDGDIKNGCLFPPLQDMRRVS 501



>gi|406698215|gb|EKD01456.1| malate dehydrogenase (oxaloacetate-decarboxylating) [Trichosporon
           asahii var. asahii CBS 8904]
          Length = 575

 Score =  354 bits (909), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 209/460 (45%), Positives = 278/460 (60%), Gaps = 27/460 (5%)

Query: 4   LFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQIIK 63
           LF+ +V  +L  + P++YTPTVG AC +YSH+         P+GLY++++D  +L +I+ 
Sbjct: 77  LFFSVVQADLVNLAPIVYTPTVGEACQKYSHVYSG------PEGLYINIDDKDSLREILA 130

Query: 64  TYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPIT 123
            Y     D    P+I V+TDGSRILGLGDLG+ GMGI VGKL LYVA  GI P   LPI 
Sbjct: 131 EYDA-TLDAAHKPKIIVVTDGSRILGLGDLGLGGMGISVGKLNLYVAGGGIRPMGCLPIV 189

Query: 124 LD-------LGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFED 176
           LD       +GTNNE   +D  YLGLR  RV+  +   F+D  M ++   +P+ +IQ ED
Sbjct: 190 LDIVADENSMGTNNESLREDPLYLGLRRPRVELKEAREFMDEFMGAVSAQWPKTVIQHED 249

Query: 177 FSSEHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAV-KLVEKDVHP-TKHRLLFFXX 234
           F SE AFD L  Y+     FNDDIQGTG+V+L GF+ A  +  E    P T H+++F   
Sbjct: 250 FYSEAAFDFLDGYQNEYRMFNDDIQGTGSVILGGFLTAAQRASEASGRPLTDHKVVFLGG 309

Query: 235 XXXXXXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGD----NLAKHKVYFAR 290
                   K+++ FF+++ G+SE+EA+   WL+DTKGL+T  R D     LA HK YF R
Sbjct: 310 GSAAVGVAKEMMNFFRMQ-GLSEDEARDRFWLIDTKGLITSTRPDVVAGKLAAHKEYFIR 368

Query: 291 DDNDGNQFKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNA 350
            D +G +FKTL EV++YV+PTAL+GLS+T G F E+I+ +MA+LN  PIIFPLSNP    
Sbjct: 369 KDTEGQEFKTLAEVVDYVQPTALVGLSTTFGAFPEEIVRKMADLNAAPIIFPLSNPTSKC 428

Query: 351 ECTFEDAMKGTDNRVIFASGTAFP--EYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKP 408
           E  FEDA+K T+  V+FASG+ +P  EY     GK   PGQGNN  +FPG+G G+I    
Sbjct: 429 ELAFEDALKWTNGTVLFASGSPYPPTEY----EGKLYEPGQGNNFLVFPGIGFGSIFCDA 484

Query: 409 KVITDKQIYIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
             ITD  I                     YP ++RIR VS
Sbjct: 485 DRITDGMITAAAIGLSRSLTEDEQQHQLLYPRLTRIRDVS 524



>gi|146342172|ref|YP_001207220.1| malate dehydrogenase [Bradyrhizobium sp. ORS 278]
 gi|500948900|ref|WP_012028935.1| malate dehydrogenase [Bradyrhizobium sp. ORS 278]
 gi|146194978|emb|CAL79003.1| Malate dehydrogenase (oxaloacetate-decarboxylating) (NADP(+))
           [Bradyrhizobium sp. ORS 278]
          Length = 543

 Score =  354 bits (909), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 202/502 (40%), Positives = 275/502 (54%), Gaps = 41/502 (8%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +LF+R+V   ++EI PLIYTPTVG AC +Y  I         P GL++S ND   + +
Sbjct: 80  NEALFFRVVCDNIDEIQPLIYTPTVGLACQKYGLIFQR------PRGLFISANDRGRIAE 133

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+  +   PY   L     V+TDG RILGLGDLG NGMGIPVGKL LY A AGI P   L
Sbjct: 134 ILANW---PYRARLI----VVTDGERILGLGDLGANGMGIPVGKLSLYSACAGIHPEECL 186

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ LD+GTNNE+ L D +Y+GLR KR+  + + +FVD  M +    +P +LIQFEDF++ 
Sbjct: 187 PVMLDVGTNNEELLADPYYIGLRQKRLTGEAYDAFVDEFMTAARTAFPGVLIQFEDFANH 246

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF LL KYR+    FNDDIQGT AV L+G  +A+++    +   + + + F        
Sbjct: 247 AAFKLLHKYRDEACVFNDDIQGTAAVALAGLFSALRITGGKL---RDQTVLFLGAGEAAT 303

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
               L+    +  G+SE EA R  WL D++GLV   R +NL  HK+ +A D      F +
Sbjct: 304 GIADLVVSAMMAEGLSEAEALRRNWLTDSRGLVIKGR-ENLHGHKLRYAHDQAPIGDFLS 362

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
               I+ +KPTA+IG+++ GG F  +++  MAELN+ PIIF LSNP   AEC+ E A + 
Sbjct: 363 ---AIKTLKPTAIIGVAAVGGAFTPEVLQAMAELNERPIIFALSNPTSKAECSAEAAYRY 419

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           T  R +FA G+  P  +V   GKT  P QGNN YIFPG+GLGAI +  +++TD+      
Sbjct: 420 TQGRALFACGS--PYDSVKLDGKTFVPRQGNNSYIFPGVGLGAIASGARLVTDEMFMAAA 477

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YP + RIR VS              GLA               
Sbjct: 478 HTLANCVTGADLEQGSLYPALPRIREVSAHIGAAVAGVAYQNGLA--------------- 522

Query: 481 LKTRKGKEWDNLVKFVQENMWD 502
                G   ++L+ FV+  M+D
Sbjct: 523 ----TGPAPNDLLGFVESKMYD 540



>gi|496323022|ref|WP_009032200.1| Malate dehydrogenase (oxaloacetate-decarboxylating) (NADP(+))
           [Bradyrhizobium sp. ORS 375]
 gi|365285456|emb|CCD97360.1| Malate dehydrogenase (oxaloacetate-decarboxylating) (NADP(+))
           [Bradyrhizobium sp. ORS 375]
          Length = 543

 Score =  354 bits (908), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 204/502 (40%), Positives = 274/502 (54%), Gaps = 41/502 (8%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +LF+R+V   ++EI PLIYTPTVG AC +Y  I         P GL++S ND   + +
Sbjct: 80  NEALFFRVVCDNIDEIQPLIYTPTVGLACQKYGLIFQR------PRGLFISANDRGRIAE 133

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+  +   PY   L     V+TDG RILGLGDLG NGMGIPVGKL LY A AGI P   L
Sbjct: 134 ILANW---PYRARLI----VVTDGERILGLGDLGANGMGIPVGKLSLYSACAGIHPEECL 186

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ LD+GTNNE+ L D +Y+GLR KR+  + + +FVD  M +    +P +LIQFEDF++ 
Sbjct: 187 PVMLDVGTNNEEFLADPYYIGLRQKRLTGEAYDAFVDEFMTAARAAFPGVLIQFEDFANH 246

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF LL KYR+    FNDDIQGT AV L+G  +A+++    +  +   +LF         
Sbjct: 247 AAFKLLHKYRDEACVFNDDIQGTAAVALAGMFSALRITGGKL--SDQTVLFLGAGEAATG 304

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
               ++     E G+SE EA R  WL D++GLV   R DNL  HK+ +A D      F +
Sbjct: 305 IADLVVSAMMAE-GLSEAEALRRNWLTDSRGLVIKGR-DNLHGHKLRYAHDQAPIGDFLS 362

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
               I+ +KPTA+IG+++ GG F  +++  MAELN+ PIIF LSNP   AEC+ E A + 
Sbjct: 363 ---AIKTLKPTAIIGVAAVGGAFTPEVLQAMAELNERPIIFALSNPTSKAECSAEAAYRY 419

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           T  R +FA G+  P   V   GKT  P QGNN YIFPG+GLGAI +  +++TD+      
Sbjct: 420 TQGRALFACGS--PYDPVKLDGKTFVPRQGNNSYIFPGVGLGAIASGARLVTDEMFMAAA 477

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YP + RIR VS              GLA               
Sbjct: 478 HTLANCVTGADLEQGSLYPALPRIREVSAHIGAAVAGVAYQNGLA--------------- 522

Query: 481 LKTRKGKEWDNLVKFVQENMWD 502
                G   ++L+ FV+  M+D
Sbjct: 523 ----TGPAPNDLLGFVESKMYD 540



>gi|218778465|ref|YP_002429783.1| malate dehydrogenase [Desulfatibacillum alkenivorans AK-01]
 gi|501640126|ref|WP_012609754.1| malate dehydrogenase [Desulfatibacillum alkenivorans]
 gi|218759849|gb|ACL02315.1| Malic enzyme [Desulfatibacillum alkenivorans AK-01]
          Length = 609

 Score =  354 bits (908), Expect = 5e-95,   Method: Compositional matrix adjust.
 Identities = 190/465 (40%), Positives = 270/465 (58%), Gaps = 21/465 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +L+YR+++  +EE+ P++YTPTVG AC EY+HI  F    GI    Y+S  D   +  
Sbjct: 129 NKTLYYRVLMENIEELMPVVYTPTVGQACQEYAHI--FRRSRGI----YISAEDKGRVAD 182

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++   R +P  D    ++ V+TDG RILGLGDLG +GMGIPVGKL LY A AGI P  +L
Sbjct: 183 VL---RNWPQKDV---RLIVVTDGERILGLGDLGADGMGIPVGKLALYSACAGIHPSLSL 236

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+T+D+GT N++ L+D  Y GL   R+  D +   ++  + ++ +V+P  LIQFEDFS+ 
Sbjct: 237 PVTIDVGTENKELLEDPLYFGLTQNRLRGDAYDELLEEFVVAVQQVFPRCLIQFEDFSNA 296

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           +AF LL KYR+   CFNDDIQGT AV L+   +A++     +   K     F        
Sbjct: 297 NAFRLLDKYRDEVLCFNDDIQGTAAVALACIYSALRYTGGSMADQK---FLFLGAGEAGM 353

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
               L+    V+ G+SEE+A++  W VD+KGLV   R +NL  HK  FA D    +   +
Sbjct: 354 GAANLIVSALVDEGVSEEKARQCCWFVDSKGLVVKSR-NNLNAHKREFAHDHAPAS---S 409

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L E +E V+PTA+IG+S  G +F ++I+ RMA+ N+ PI+FPLSNP   AECT EDA + 
Sbjct: 410 LLEAVESVRPTAIIGVSGQGKMFTKEILERMADYNEKPIVFPLSNPTTKAECTAEDACQW 469

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           TD R +FASG+ F  +T    G+ ++P QGNN+YIFPG+G+G +    + +TD+      
Sbjct: 470 TDGRAVFASGSPFKPFTY--AGEKRFPAQGNNVYIFPGVGMGCMACWSRKVTDEMFLAAA 527

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLA 465
                             P ++RIR VS              GLA
Sbjct: 528 RVLSGLVTPEEQKQGMLLPPLTRIREVSLEIASAVAEVAYDQGLA 572



>gi|389601387|ref|XP_001565344.2| malic enzyme [Leishmania braziliensis MHOM/BR/75/M2904]
 gi|322505022|emb|CAM42254.2| malic enzyme [Leishmania braziliensis MHOM/BR/75/M2904]
          Length = 571

 Score =  353 bits (907), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 195/492 (39%), Positives = 275/492 (55%), Gaps = 22/492 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +L+Y +V+  +E + P+IYTPT+G ACL +S+            G+YLS +   +  +
Sbjct: 86  NTTLYYALVLAHIEALLPIIYTPTIGEACLNFSNHWVR------ERGMYLSKHLKGHFAE 139

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++K      YD+     + VITDGSRILGLGDLG NG+GI +GK  LYVA AG+ P R L
Sbjct: 140 VMKESL---YDNV---DVIVITDGSRILGLGDLGANGIGISIGKCSLYVAGAGMHPTRVL 193

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ LD+GTN +  L D  YLG R KR+DDDQF S +D  M+++   +P  ++QFEDFS+ 
Sbjct: 194 PVVLDVGTNTQHYLSDREYLGTREKRLDDDQFNSLLDEFMEAVKSTWPSAVVQFEDFSNN 253

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H FD+L +Y+    CFNDDIQGTGAV+ +GF+NAVK  +  + P + R++ F        
Sbjct: 254 HCFDMLERYQRKYRCFNDDIQGTGAVIAAGFLNAVK--KSGLGPLEQRIVVFGAGAAAVG 311

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDD---NDGNQ 297
             K + +     + +   E  +  +LVDTKGLV   RGD LA+HK+ F+R D        
Sbjct: 312 VAKNIAQLASRLYNVDIAEVLKTFYLVDTKGLVCDTRGDKLAEHKLLFSRKDVSAESSQN 371

Query: 298 FKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDA 357
            K LE+V+++VKPTAL+GL   G VF E+I+  +A     PIIFPLSNP   +E   EDA
Sbjct: 372 LKLLEDVVKFVKPTALLGLGGVGPVFTEEIVKSVAANAARPIIFPLSNPTSKSEVMPEDA 431

Query: 358 MKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
            + T+   I ASG+ FP  T+   GKT  P QGNN+Y+FPG+GLG  L +P  I D  + 
Sbjct: 432 YRWTNGAAIIASGSPFPASTI--NGKTIKPSQGNNLYVFPGVGLGCALVQPSYIPDDLLV 489

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP +  I ++S              G+  +K    + +  
Sbjct: 490 AASACLNLLTTPEQMEAEQLYPPLDDIHNISAHIATEVIMEAQRLGIDGNKN---LPREK 546

Query: 478 IEVLKTRKGKEW 489
             +L   K  +W
Sbjct: 547 EAILAVVKASQW 558



>gi|493658371|ref|WP_006609767.1| Malate dehydrogenase (oxaloacetate-decarboxylating) (NADP(+))
           [Bradyrhizobium sp. ORS 285]
 gi|365275460|emb|CCD84427.1| Malate dehydrogenase (oxaloacetate-decarboxylating) (NADP(+))
           [Bradyrhizobium sp. ORS 285]
          Length = 543

 Score =  353 bits (905), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 203/502 (40%), Positives = 274/502 (54%), Gaps = 41/502 (8%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +LF+R+V   ++EI PLIYTPTVG AC +Y  I         P GL++S ND   + +
Sbjct: 80  NEALFFRVVCDNIDEIQPLIYTPTVGLACQKYGLIFQR------PRGLFISANDRGRIAE 133

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+  +   PY   L     V+TDG RILGLGDLG NGMGIPVGKL LY A AGI P   L
Sbjct: 134 ILANW---PYRARLI----VVTDGERILGLGDLGANGMGIPVGKLSLYSACAGIHPEECL 186

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ LD+GTNNE+ L D +Y+GLR KR+    + SFVD  M +    +P +LIQFEDF++ 
Sbjct: 187 PVMLDVGTNNEELLADPYYIGLRQKRLTGAAYDSFVDEFMTAARAAFPGVLIQFEDFANH 246

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF LL KYR++   FNDDIQGT AV L+G  +A+++    +   + + + F        
Sbjct: 247 AAFKLLHKYRDDACVFNDDIQGTAAVALAGLFSALRITGGKL---RDQTVLFLGAGEAAT 303

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
               L+    +  G+SE EA R  WL D++GLV   R +NL  HK+ +A D      F +
Sbjct: 304 GIADLVVSAMMAEGLSEAEALRRNWLTDSRGLVIKGR-ENLHGHKLRYAHDQAPIADFLS 362

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
               I+ +KPTA+IG+++ GG F  +++  MAELN+ PIIF LSNP   AEC+ E A + 
Sbjct: 363 ---AIKTLKPTAIIGVAAVGGAFTPEVLQTMAELNERPIIFALSNPTSKAECSAEAAYRY 419

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           T  R +FA G+  P   V   GKT  P QGNN YIFPG+GLGAI +  +++TD+      
Sbjct: 420 TQGRALFACGS--PYDPVKLDGKTFVPRQGNNSYIFPGVGLGAIASGARLVTDEMFMAAA 477

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YP + RIR VS              GLA               
Sbjct: 478 HTLANCVTGADLEQGSLYPALPRIREVSAHIGAAVAGVAYQNGLA--------------- 522

Query: 481 LKTRKGKEWDNLVKFVQENMWD 502
                G   ++L+ FV+  M+D
Sbjct: 523 ----TGPAPNDLLGFVESKMYD 540



>gi|94469677|gb|ABF20292.1| cytosolic NADP-malic enzyme [Leishmania infantum]
          Length = 548

 Score =  353 bits (905), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 195/504 (38%), Positives = 282/504 (55%), Gaps = 26/504 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV+L+Y I+   L++  P++YTPTVG AC  Y  +           GLYL +     + +
Sbjct: 63  NVTLYYAILTRYLKQTLPIVYTPTVGEACQRYGDLYQ------KDHGLYLDVASKGKVRK 116

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+  R    D      + VITDGSRILGLGDLG NG+GI +GK  LYVAA G+ P R L
Sbjct: 117 LIQNLRKTNVD------VIVITDGSRILGLGDLGANGIGISIGKCSLYVAAGGVKPSRVL 170

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ +D+GTNN +   +  YLGLR  R  D  FY+ +D  M+++   +P  ++QFEDFS+ 
Sbjct: 171 PVVMDVGTNNLELRNNPLYLGLRKPRCGDADFYALLDEFMEAVKDTWPSAVVQFEDFSNN 230

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H FD+L +Y++   CFNDDIQGTGAV+ +GF  AVKL    +   + R++FF        
Sbjct: 231 HCFDMLERYQKKYRCFNDDIQGTGAVIAAGFHTAVKL--SKIPMEQQRIVFFGAGSAATG 288

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDG---NQ 297
             + + +    E GM +E+ K+ ++ VD+ G+V  +RGD LAKHK+ +AR D        
Sbjct: 289 VAESIAD-LAAEAGMKKEDVKKSIFFVDSMGMVATNRGDKLAKHKLGWARTDIPDAVIAS 347

Query: 298 FKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDA 357
            KTLE+V+ YV+PTALIGL +T  VF+ +I+  +     +PIIFPLSNP   AE    +A
Sbjct: 348 LKTLEDVVRYVRPTALIGLGATANVFSREIVEFLHSCCPHPIIFPLSNPSSKAEIVPANA 407

Query: 358 MKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
            K T+   I ASG+ FPE  V  +G+T  P QGNN+YIFPG+GLG  +A+P  I  + + 
Sbjct: 408 YKWTNGDAIVASGSPFPETVV--SGRTLQPSQGNNLYIFPGVGLGCCIAQPPYIPQEVLV 465

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP +  +R VS              GLA+     ++  N 
Sbjct: 466 AAAACLSTLATPDDLAKGQLYPSIEEVRRVSREVAVACIQKLQELGLAK----ADLPDNR 521

Query: 478 IEVLKTRKGKEWDNLVKFVQENMW 501
            +++K  K   W+   +++ EN +
Sbjct: 522 PDLMKLVKTAFWEP--RYLPENYY 543



>gi|384216662|ref|YP_005607828.1| malic enzyme [Bradyrhizobium japonicum USDA 6]
 gi|504305993|ref|WP_014493095.1| malic enzyme [Bradyrhizobium japonicum]
 gi|354955561|dbj|BAL08240.1| malic enzyme [Bradyrhizobium japonicum USDA 6]
          Length = 531

 Score =  353 bits (905), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 194/465 (41%), Positives = 268/465 (57%), Gaps = 21/465 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +LF+R+V+  ++EI P+IYTPTVG AC +Y  I         P G+++S +D   + +
Sbjct: 67  NEALFFRVVVDNIDEIQPIIYTPTVGLACQKYGLIFQR------PRGMFISSHDRGQIAE 120

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+K + PYP       ++ V+TDG RILGLGDLG NGMGIPVGKL LY A AG+ P   L
Sbjct: 121 ILKNW-PYP------AKLIVVTDGERILGLGDLGANGMGIPVGKLSLYSACAGVHPENCL 173

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD+GTNNE+ L D +YLGLR +R+  + + SFVD  M +  K +P +LIQFEDF++ 
Sbjct: 174 PIVLDVGTNNEELLNDPYYLGLRERRLTGEAYDSFVDEFMVAARKTFPGVLIQFEDFANH 233

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF LL KYR+    FNDDIQGT AV L+G  +A+++    +     R+LF         
Sbjct: 234 SAFKLLHKYRDEACVFNDDIQGTAAVALAGLFSALRVNGGKL--GDQRILFLGAGEAATG 291

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
               ++     E G+SE EA R  WLVD++GLV   R D L+ HK+ +A           
Sbjct: 292 IADLVVSAMMAE-GISEAEALRRNWLVDSRGLVVGGR-DGLSGHKLRYAHAGQ--APIAD 347

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
               I+ +KPTA+IG+++ GG F  +++  MAELN+ PI+F LSNP   AEC+ EDA + 
Sbjct: 348 FLTAIKTLKPTAIIGVAAVGGAFTPEVLKAMAELNEQPIVFALSNPTSKAECSAEDAYRY 407

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           T+ R +FA G+  P   V   G+T  P QGNN Y+FPG+GLG I ++ +++TD+      
Sbjct: 408 TEGRALFACGS--PYDPVKLNGRTFVPRQGNNSYVFPGVGLGVIASRSRLVTDEMFMAAA 465

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLA 465
                            YP + RIR VS              GLA
Sbjct: 466 HTLADCVGKEDLAQGSLYPALPRIREVSARIAVAVADVAYQRGLA 510



>gi|494887240|ref|WP_007613287.1| malic enzyme [Bradyrhizobium sp. WSM471]
 gi|374425437|gb|EHR04970.1| malic enzyme [Bradyrhizobium sp. WSM471]
          Length = 531

 Score =  352 bits (904), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 201/503 (39%), Positives = 277/503 (55%), Gaps = 40/503 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +LF+R+V+  ++EI P+IYTPTVG AC +Y  I         P G+++S  D   + +
Sbjct: 67  NEALFFRVVVDNIDEIQPIIYTPTVGLACQKYGLIFQR------PRGMFISSRDRGQIAE 120

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++K + P+P       ++ V+TDG RILGLGDLG NGMGIPVGKL LY A AG+ P   L
Sbjct: 121 VLKNW-PHP------AKLIVVTDGERILGLGDLGANGMGIPVGKLSLYSACAGVHPETCL 173

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD+GTNNE+ LKD +YLGLR +R+  + + SFVD  M +  K +P +LIQFEDF++ 
Sbjct: 174 PIVLDVGTNNEELLKDPYYLGLRERRLTGEAYDSFVDEFMVAARKTFPGVLIQFEDFANH 233

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF LL KYR+    FNDDIQGT AV L+G  +A+++    +     R+LF         
Sbjct: 234 SAFKLLHKYRDEACVFNDDIQGTAAVALAGLFSALRVNGGKLR--DQRILFLGAGEAATG 291

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
               +      E G SE EA R  WLVD++GLV   R + L+ HK+ +A  D        
Sbjct: 292 IADLVTSAMMAE-GASEAEALRRNWLVDSRGLVVGGR-EGLSGHKLRYAHADQ--APIAD 347

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
               I  +KPTA+IG+++ GG F  +++  MAELN+ PI+F LSNP   AEC+ EDA + 
Sbjct: 348 FLTAIRTLKPTAIIGVAAVGGAFTPEVLKTMAELNEQPIVFALSNPTSKAECSAEDAYRY 407

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           T+ R +FA G+  P   V   G+T  P QGNN YIFPG+GLG I ++ +++TD+      
Sbjct: 408 TEGRALFACGS--PYDPVKLNGRTFVPRQGNNSYIFPGVGLGVIASRSRLVTDEMFMAAA 465

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YP + RIR VS              GLA          ND++ 
Sbjct: 466 HTLANCVGKDDLAQGSLYPALPRIREVSVRIAAAVADVAFQRGLADGP-----APNDVKA 520

Query: 481 LKTRKGKEWDNLVKFVQENMWDP 503
           L              VQ  M++P
Sbjct: 521 L--------------VQSQMYEP 529



>gi|398015961|ref|XP_003861169.1| malic enzyme, putative [Leishmania donovani]
 gi|322499394|emb|CBZ34467.1| malic enzyme, putative [Leishmania donovani]
          Length = 573

 Score =  352 bits (904), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 195/504 (38%), Positives = 282/504 (55%), Gaps = 26/504 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV+L+Y I+   L++  P++YTPTVG AC  Y  +           GLYL +     + +
Sbjct: 86  NVTLYYAILTRYLKQTLPIVYTPTVGEACQRYGDLYQ------KDHGLYLDVASKGKVRK 139

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+  R    D      + VITDGSRILGLGDLG NG+GI +GK  LYVAA G+ P R L
Sbjct: 140 LIQNLRKTNVD------VIVITDGSRILGLGDLGANGIGISIGKCSLYVAAGGVKPSRVL 193

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ +D+GTNN +   +  YLGLR  R  D  FY+ +D  M+++   +P  ++QFEDFS+ 
Sbjct: 194 PVVMDVGTNNLELRNNPLYLGLRKPRCGDADFYALLDEFMEAVKDTWPSAVVQFEDFSNN 253

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H FD+L +Y++   CFNDDIQGTGAV+ +GF  AVKL    +   + R++FF        
Sbjct: 254 HCFDMLERYQKKYRCFNDDIQGTGAVIAAGFHTAVKL--SKIPMEQQRIVFFGAGSAATG 311

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDG---NQ 297
             + + +    E GM +E+ K+ ++ VD+ G+V  +RGD LAKHK+ +AR D        
Sbjct: 312 VAESIAD-LAAEAGMKKEDIKKSIFFVDSMGMVATNRGDKLAKHKLGWARTDIPDAVIAS 370

Query: 298 FKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDA 357
            KTLE+V+ YV+PTALIGL +T  VF+ +I+  +     +PIIFPLSNP   AE    +A
Sbjct: 371 LKTLEDVVRYVRPTALIGLGATANVFSREIVEFLHSCCPHPIIFPLSNPSSKAEIVPANA 430

Query: 358 MKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
            K T+   I ASG+ FPE  V  +G+T  P QGNN+YIFPG+GLG  +A+P  I  + + 
Sbjct: 431 YKWTNGDAIVASGSPFPETVV--SGRTLQPSQGNNLYIFPGVGLGCCIAQPPYIPQEVLV 488

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP +  +R VS              GLA+     ++  N 
Sbjct: 489 AAAACLSTLATPDDLAKGQLYPSIEEVRRVSREVAVACIQKLQELGLAK----ADLPDNR 544

Query: 478 IEVLKTRKGKEWDNLVKFVQENMW 501
            +++K  K   W+   +++ EN +
Sbjct: 545 PDLMKLVKTAFWEP--RYLPENYY 566



>gi|94469655|gb|ABF20281.1| cytosolic NADP-malic enzyme [Leishmania donovani]
 gi|94469657|gb|ABF20282.1| cytosolic NADP-malic enzyme [Leishmania donovani]
 gi|94469659|gb|ABF20283.1| cytosolic NADP-malic enzyme [Leishmania donovani archibaldi]
 gi|94469663|gb|ABF20285.1| cytosolic NADP-malic enzyme [Leishmania donovani]
 gi|94469667|gb|ABF20287.1| cytosolic NADP-malic enzyme [Leishmania infantum]
 gi|94469669|gb|ABF20288.1| cytosolic NADP-malic enzyme [Leishmania donovani]
 gi|94469673|gb|ABF20290.1| cytosolic NADP-malic enzyme [Leishmania infantum]
 gi|94469681|gb|ABF20294.1| cytosolic NADP-malic enzyme [Leishmania infantum]
 gi|94469683|gb|ABF20295.1| cytosolic NADP-malic enzyme [Leishmania infantum]
 gi|94469685|gb|ABF20296.1| cytosolic NADP-malic enzyme [Leishmania donovani archibaldi]
 gi|94469687|gb|ABF20297.1| cytosolic NADP-malic enzyme [Leishmania donovani archibaldi]
 gi|94469689|gb|ABF20298.1| cytosolic NADP-malic enzyme [Leishmania donovani]
 gi|189308559|gb|ACD87081.1| cytosolic NADP-malic enzyme [Leishmania infantum]
          Length = 548

 Score =  352 bits (904), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 195/504 (38%), Positives = 282/504 (55%), Gaps = 26/504 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV+L+Y I+   L++  P++YTPTVG AC  Y  +           GLYL +     + +
Sbjct: 63  NVTLYYAILTRYLKQTLPIVYTPTVGEACQRYGDLYQ------KDHGLYLDVASKGKVRK 116

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+  R    D      + VITDGSRILGLGDLG NG+GI +GK  LYVAA G+ P R L
Sbjct: 117 LIQNLRKTNVD------VIVITDGSRILGLGDLGANGIGISIGKCSLYVAAGGVKPSRVL 170

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ +D+GTNN +   +  YLGLR  R  D  FY+ +D  M+++   +P  ++QFEDFS+ 
Sbjct: 171 PVVMDVGTNNLELRNNPLYLGLRKPRCGDADFYALLDEFMEAVKDTWPSAVVQFEDFSNN 230

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H FD+L +Y++   CFNDDIQGTGAV+ +GF  AVKL    +   + R++FF        
Sbjct: 231 HCFDMLERYQKKYRCFNDDIQGTGAVIAAGFHTAVKL--SKIPMEQQRIVFFGAGSAATG 288

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDG---NQ 297
             + + +    E GM +E+ K+ ++ VD+ G+V  +RGD LAKHK+ +AR D        
Sbjct: 289 VAESIAD-LAAEAGMKKEDIKKSIFFVDSMGMVATNRGDKLAKHKLGWARTDIPDAVIAS 347

Query: 298 FKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDA 357
            KTLE+V+ YV+PTALIGL +T  VF+ +I+  +     +PIIFPLSNP   AE    +A
Sbjct: 348 LKTLEDVVRYVRPTALIGLGATANVFSREIVEFLHSCCPHPIIFPLSNPSSKAEIVPANA 407

Query: 358 MKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
            K T+   I ASG+ FPE  V  +G+T  P QGNN+YIFPG+GLG  +A+P  I  + + 
Sbjct: 408 YKWTNGDAIVASGSPFPETVV--SGRTLQPSQGNNLYIFPGVGLGCCIAQPPYIPQEVLV 465

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP +  +R VS              GLA+     ++  N 
Sbjct: 466 AAAACLSTLATPDDLAKGQLYPSIEEVRRVSREVAVACIQKLQELGLAK----ADLPDNR 521

Query: 478 IEVLKTRKGKEWDNLVKFVQENMW 501
            +++K  K   W+   +++ EN +
Sbjct: 522 PDLMKLVKTAFWEP--RYLPENYY 543



>gi|495406871|ref|WP_008131570.1| malic enzyme [Bradyrhizobium sp. YR681]
 gi|398229035|gb|EJN15128.1| malic enzyme [Bradyrhizobium sp. YR681]
          Length = 531

 Score =  352 bits (902), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 193/465 (41%), Positives = 266/465 (57%), Gaps = 21/465 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +LF+R+V+  ++EI P+IYTPTVG AC ++  I         P G+++S  D   + +
Sbjct: 67  NEALFFRVVVDNIDEIQPIIYTPTVGLACQKFGLIYQR------PRGMFISSRDRGQIAE 120

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+K + P P       ++ V+TDG RILGLGDLG NGMGIPVGKL LY A AG+ P   L
Sbjct: 121 ILKNW-PNP------AKLIVVTDGERILGLGDLGANGMGIPVGKLSLYSACAGVHPEHCL 173

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ LD+GTNNE+ L D +YLGLR +R+  + + SFVD  M++  K +P +LIQFEDF++ 
Sbjct: 174 PVVLDVGTNNEELLNDPYYLGLRERRLTGEAYDSFVDEFMQAARKTFPGVLIQFEDFANH 233

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF LL KYR+ T  FNDDIQGT AV L+G  +A+++   +    K + + F        
Sbjct: 234 SAFKLLHKYRDETCVFNDDIQGTAAVALAGLFSALRV---NGGKLKDQKILFLGAGEAAT 290

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
               L+    +  G SE EA R  WLVD++GLV   R D L  HK+ +A  D        
Sbjct: 291 GIADLVVSAMMAEGASEAEALRRNWLVDSRGLVVSGR-DGLHGHKLRYAHTDQ--APIAD 347

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
               I  +KPTA+IG+++ GG F  +++  MAELN+ PI+F LSNP   AEC+ EDA + 
Sbjct: 348 FLTAIRTLKPTAIIGVAAVGGAFTPEVLKAMAELNEQPIVFALSNPTSKAECSAEDAYRY 407

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           T+ R +FA G+  P   V   G+T  P QGNN YIFPG+GLG I ++ +++TD+      
Sbjct: 408 TEGRALFACGS--PYDPVKLNGRTFVPRQGNNSYIFPGVGLGVIASRSRLVTDEMFMAAA 465

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLA 465
                            YP + RIR VS              GLA
Sbjct: 466 HTLADCVGKEDLAQGSLYPALPRIREVSARIAVAVADVAYQRGLA 510



>gi|146087796|ref|XP_001465907.1| putative malic enzyme [Leishmania infantum JPCM5]
 gi|134070008|emb|CAM68338.1| putative malic enzyme [Leishmania infantum JPCM5]
          Length = 573

 Score =  352 bits (902), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 195/504 (38%), Positives = 282/504 (55%), Gaps = 26/504 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV+L+Y I+   L++  P++YTPTVG AC  Y  +           GLYL +     + +
Sbjct: 86  NVTLYYAILTRYLKQTLPIVYTPTVGEACQRYGDLYQ------KDHGLYLDVAIKGKVRK 139

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+  R    D      + VITDGSRILGLGDLG NG+GI +GK  LYVAA G+ P R L
Sbjct: 140 LIQNLRKTNVD------VIVITDGSRILGLGDLGANGIGISIGKCSLYVAAGGVKPSRVL 193

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ +D+GTNN +   +  YLGLR  R  D  FY+ +D  M+++   +P  ++QFEDFS+ 
Sbjct: 194 PVVMDVGTNNLELRNNPLYLGLRKPRCGDADFYALLDEFMEAVKDTWPSAVVQFEDFSNN 253

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H FD+L +Y++   CFNDDIQGTGAV+ +GF  AVKL    +   + R++FF        
Sbjct: 254 HCFDMLERYQKKYRCFNDDIQGTGAVIAAGFHTAVKL--SKIPMEQQRIVFFGAGSAATG 311

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDG---NQ 297
             + + +    E GM +E+ K+ ++ VD+ G+V  +RGD LAKHK+ +AR D        
Sbjct: 312 VAESIAD-LAAEAGMKKEDVKKSIFFVDSMGMVATNRGDKLAKHKLGWARTDIPDAVIAS 370

Query: 298 FKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDA 357
            KTLE+V+ YV+PTALIGL +T  VF+ +I+  +     +PIIFPLSNP   AE    +A
Sbjct: 371 LKTLEDVVRYVRPTALIGLGATANVFSREIVEFLHSCCPHPIIFPLSNPSSKAEIVPANA 430

Query: 358 MKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
            K T+   I ASG+ FPE  V  +G+T  P QGNN+YIFPG+GLG  +A+P  I  + + 
Sbjct: 431 YKWTNGDAIVASGSPFPETVV--SGRTLQPSQGNNLYIFPGVGLGCCIAQPPYIPQEVLV 488

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP +  +R VS              GLA+     ++  N 
Sbjct: 489 AAAACLSTLATPDDLAKGQLYPSIEEVRRVSREVAVACIQKLQELGLAK----ADLPDNR 544

Query: 478 IEVLKTRKGKEWDNLVKFVQENMW 501
            +++K  K   W+   +++ EN +
Sbjct: 545 PDLMKLVKTAFWEP--RYLPENYY 566



>gi|94469639|gb|ABF20273.1| cytosolic NADP-malic enzyme [Leishmania infantum]
 gi|94469641|gb|ABF20274.1| cytosolic NADP-malic enzyme [Leishmania infantum]
 gi|94469643|gb|ABF20275.1| cytosolic NADP-malic enzyme [Leishmania infantum]
 gi|94469645|gb|ABF20276.1| cytosolic NADP-malic enzyme [Leishmania infantum]
 gi|94469647|gb|ABF20277.1| cytosolic NADP-malic enzyme [Leishmania infantum]
 gi|94469649|gb|ABF20278.1| cytosolic NADP-malic enzyme [Leishmania infantum]
 gi|94469651|gb|ABF20279.1| cytosolic NADP-malic enzyme [Leishmania infantum]
 gi|94469653|gb|ABF20280.1| cytosolic NADP-malic enzyme [Leishmania infantum]
 gi|94469665|gb|ABF20286.1| cytosolic NADP-malic enzyme [Leishmania infantum]
 gi|94469675|gb|ABF20291.1| cytosolic NADP-malic enzyme [Leishmania infantum]
 gi|94469691|gb|ABF20299.1| cytosolic NADP-malic enzyme [Leishmania infantum]
 gi|94469693|gb|ABF20300.1| cytosolic NADP-malic enzyme [Leishmania infantum]
 gi|94469695|gb|ABF20301.1| cytosolic NADP-malic enzyme [Leishmania infantum]
 gi|94469697|gb|ABF20302.1| cytosolic NADP-malic enzyme [Leishmania infantum]
 gi|94469699|gb|ABF20303.1| cytosolic NADP-malic enzyme [Leishmania infantum]
 gi|94469701|gb|ABF20304.1| cytosolic NADP-malic enzyme [Leishmania infantum]
 gi|94469703|gb|ABF20305.1| cytosolic NADP-malic enzyme [Leishmania infantum]
 gi|94469705|gb|ABF20306.1| cytosolic NADP-malic enzyme [Leishmania infantum]
 gi|189308565|gb|ACD87084.1| cytosolic NADP-malic enzyme [Leishmania infantum]
          Length = 548

 Score =  352 bits (902), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 195/504 (38%), Positives = 282/504 (55%), Gaps = 26/504 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV+L+Y I+   L++  P++YTPTVG AC  Y  +           GLYL +     + +
Sbjct: 63  NVTLYYAILTRYLKQTLPIVYTPTVGEACQRYGDLYQ------KDHGLYLDVAIKGKVRK 116

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+  R    D      + VITDGSRILGLGDLG NG+GI +GK  LYVAA G+ P R L
Sbjct: 117 LIQNLRKTNVD------VIVITDGSRILGLGDLGANGIGISIGKCSLYVAAGGVKPSRVL 170

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ +D+GTNN +   +  YLGLR  R  D  FY+ +D  M+++   +P  ++QFEDFS+ 
Sbjct: 171 PVVMDVGTNNLELRNNPLYLGLRKPRCGDADFYALLDEFMEAVKDTWPSAVVQFEDFSNN 230

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H FD+L +Y++   CFNDDIQGTGAV+ +GF  AVKL    +   + R++FF        
Sbjct: 231 HCFDMLERYQKKYRCFNDDIQGTGAVIAAGFHTAVKL--SKIPMEQQRIVFFGAGSAATG 288

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDG---NQ 297
             + + +    E GM +E+ K+ ++ VD+ G+V  +RGD LAKHK+ +AR D        
Sbjct: 289 VAESIAD-LAAEAGMKKEDVKKSIFFVDSMGMVATNRGDKLAKHKLGWARTDIPDAVIAS 347

Query: 298 FKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDA 357
            KTLE+V+ YV+PTALIGL +T  VF+ +I+  +     +PIIFPLSNP   AE    +A
Sbjct: 348 LKTLEDVVRYVRPTALIGLGATANVFSREIVEFLHSCCPHPIIFPLSNPSSKAEIVPANA 407

Query: 358 MKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
            K T+   I ASG+ FPE  V  +G+T  P QGNN+YIFPG+GLG  +A+P  I  + + 
Sbjct: 408 YKWTNGDAIVASGSPFPETVV--SGRTLQPSQGNNLYIFPGVGLGCCIAQPPYIPQEVLV 465

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP +  +R VS              GLA+     ++  N 
Sbjct: 466 AAAACLSTLATPDDLAKGQLYPSIEEVRRVSREVAVACIQKLQELGLAK----ADLPDNR 521

Query: 478 IEVLKTRKGKEWDNLVKFVQENMW 501
            +++K  K   W+   +++ EN +
Sbjct: 522 PDLMKLVKTAFWEP--RYLPENYY 543



>gi|189308561|gb|ACD87082.1| cytosolic NADP-malic enzyme [Leishmania infantum]
 gi|189308563|gb|ACD87083.1| cytosolic NADP-malic enzyme [Leishmania infantum]
          Length = 548

 Score =  352 bits (902), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 195/504 (38%), Positives = 282/504 (55%), Gaps = 26/504 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV+L+Y I+   L++  P++YTPTVG AC  Y  +           GLYL +     + +
Sbjct: 63  NVTLYYAILTRYLKQTLPIVYTPTVGEACQRYGDLYQ------KDHGLYLDVAXKGKVRK 116

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+  R    D      + VITDGSRILGLGDLG NG+GI +GK  LYVAA G+ P R L
Sbjct: 117 LIQNLRKTNVD------VIVITDGSRILGLGDLGANGIGISIGKCSLYVAAGGVKPSRVL 170

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ +D+GTNN +   +  YLGLR  R  D  FY+ +D  M+++   +P  ++QFEDFS+ 
Sbjct: 171 PVVMDVGTNNLELRNNPLYLGLRKPRCGDADFYALLDEFMEAVKDTWPSAVVQFEDFSNN 230

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H FD+L +Y++   CFNDDIQGTGAV+ +GF  AVKL    +   + R++FF        
Sbjct: 231 HCFDMLERYQKKYRCFNDDIQGTGAVIAAGFHTAVKL--SKIPMEQQRIVFFGAGSAATG 288

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDG---NQ 297
             + + +    E GM +E+ K+ ++ VD+ G+V  +RGD LAKHK+ +AR D        
Sbjct: 289 VAESIAD-LAAEAGMKKEDIKKSIFFVDSMGMVATNRGDKLAKHKLGWARTDIPDAVIAS 347

Query: 298 FKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDA 357
            KTLE+V+ YV+PTALIGL +T  VF+ +I+  +     +PIIFPLSNP   AE    +A
Sbjct: 348 LKTLEDVVRYVRPTALIGLGATANVFSREIVEFLHSCCPHPIIFPLSNPSSKAEIVPANA 407

Query: 358 MKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
            K T+   I ASG+ FPE  V  +G+T  P QGNN+YIFPG+GLG  +A+P  I  + + 
Sbjct: 408 YKWTNGDAIVASGSPFPETVV--SGRTLQPSQGNNLYIFPGVGLGCCIAQPPYIPQEVLV 465

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP +  +R VS              GLA+     ++  N 
Sbjct: 466 AAAACLSTLATPDDLAKGQLYPSIEEVRRVSREVAVACIQKLQELGLAK----ADLPDNR 521

Query: 478 IEVLKTRKGKEWDNLVKFVQENMW 501
            +++K  K   W+   +++ EN +
Sbjct: 522 PDLMKLVKTAFWEP--RYLPENYY 543



>gi|494874947|ref|WP_007601042.1| malic enzyme [Bradyrhizobium sp. WSM1253]
 gi|385741551|gb|EIG61747.1| malic enzyme [Bradyrhizobium sp. WSM1253]
          Length = 531

 Score =  351 bits (901), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 194/465 (41%), Positives = 264/465 (56%), Gaps = 21/465 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +LF+R+V+  ++EI P+IYTPTVG AC +Y  I         P G+++S  D   + +
Sbjct: 67  NEALFFRVVVDNIDEIQPIIYTPTVGLACQKYGLIFQR------PRGMFISSRDRGQIAE 120

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+K + PYP       ++ V+TDG RILGLGDLG NGMGIPVGKL LY A AG+ P   L
Sbjct: 121 ILKNW-PYP------AKLIVVTDGERILGLGDLGANGMGIPVGKLSLYSACAGVHPETCL 173

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD+GTNNE+ LKD +YLGLR +R+  + + SFVD  M +  K +P +LIQFEDF++ 
Sbjct: 174 PIVLDVGTNNEELLKDPYYLGLRERRLTGEAYDSFVDEFMVAARKTFPGVLIQFEDFANH 233

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF LL KYR+    FNDDIQGT AV L+G  +A+++   +    K + + F        
Sbjct: 234 SAFKLLHKYRDEACVFNDDIQGTAAVALAGLFSALRV---NGGKLKEQRILFLGAGEAAT 290

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
               L+    +  G SE EA R  WLVD++GLV   R + L+ HK+ +A           
Sbjct: 291 GIADLVTSAMMAEGASEAEALRRNWLVDSRGLVVGGR-EGLSGHKLRYAHAGQ--APIAD 347

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
               I  +KPTA+IG+++ GG F   ++  MAELN+ PI+F LSNP   AEC+ EDA + 
Sbjct: 348 FLTAIRTLKPTAIIGVAAVGGAFTPDVLKAMAELNEQPIVFALSNPTSKAECSAEDAYRY 407

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           T  R +FA G+  P   V   G+T  P QGNN YIFPG+GLG I ++ +++TD+      
Sbjct: 408 TGGRALFACGS--PYDPVKLNGRTFVPRQGNNSYIFPGVGLGVIASRSRLVTDEMFMAAA 465

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLA 465
                            YP + RIR VS              GLA
Sbjct: 466 HTLADCVGKDDLAQGSLYPALPRIREVSVRIAAAVADVAFQRGLA 510



>gi|401422806|ref|XP_003875890.1| putative malic enzyme [Leishmania mexicana MHOM/GT/2001/U1103]
 gi|322492130|emb|CBZ27404.1| putative malic enzyme [Leishmania mexicana MHOM/GT/2001/U1103]
          Length = 573

 Score =  351 bits (901), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 195/504 (38%), Positives = 283/504 (56%), Gaps = 26/504 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV+L+Y I+   L++  P++YTPTVG AC  Y  +           GLYL +     + Q
Sbjct: 86  NVTLYYAILTRYLKQTLPIVYTPTVGEACQRYGDLYQ------KDHGLYLDIASKGKVRQ 139

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+  R    D      I VITDGSRILGLGDLG NG+GI +GK  LYVAA G+ P R L
Sbjct: 140 MIQNLRKTNVD------IIVITDGSRILGLGDLGANGIGISIGKCSLYVAAGGVKPSRVL 193

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ +D+GTNN +   +  YLGLR  R  D  FY+ +D  M+++ + +P  ++QFEDFS+ 
Sbjct: 194 PVVMDVGTNNLELRNNPLYLGLRKPRCGDAAFYALLDEFMEAVKETWPSAVVQFEDFSNN 253

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H FD+L +Y++   CFNDDIQGTGAV+ +GF  AVKL +  +   + R++FF        
Sbjct: 254 HCFDMLERYQKKYRCFNDDIQGTGAVIAAGFHTAVKLSK--IPMAQQRIVFFGAGSAATG 311

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARD---DNDGNQ 297
             + + +    E G+ +E+ K+  + VD+ G+V  +RGD LAKHK+ +AR    D D   
Sbjct: 312 VAESIAD-LAAEAGVKKEDIKKNTFFVDSMGMVATNRGDKLAKHKLGWARTDIPDADIAS 370

Query: 298 FKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDA 357
            KTLE+V+ YV+PTALIGL +T  VF+ +I+  +     +PIIFPLSNP   AE    +A
Sbjct: 371 LKTLEDVVRYVRPTALIGLGATANVFSREIVEFLHSCCAHPIIFPLSNPSSKAEIVPANA 430

Query: 358 MKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
            K T+   I ASG+ FPE  V  +G+T  P QGNN+YIFPG+GLG  +A+P  I  + + 
Sbjct: 431 YKWTNGDAIVASGSPFPETVV--SGRTLQPSQGNNLYIFPGVGLGCCIAQPPYIPQEVLV 488

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP +  +  VS              GLA+     ++  N 
Sbjct: 489 AAAACLSTLATPDDLARGQLYPPIEEVPRVSREVAVACIQKLQEMGLAK----ADLPDNR 544

Query: 478 IEVLKTRKGKEWDNLVKFVQENMW 501
            ++++  K   W+   +++ EN +
Sbjct: 545 PDLMRMVKTAFWEP--RYLPENYY 566



>gi|496139218|ref|WP_008863725.1| malic enzyme, NAD binding domain protein [Parasutterella
           excrementihominis]
 gi|329574841|gb|EGG56400.1| malic enzyme, NAD binding domain protein [Parasutterella
           excrementihominis YIT 11859]
          Length = 549

 Score =  351 bits (900), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 193/508 (37%), Positives = 287/508 (56%), Gaps = 39/508 (7%)

Query: 3   SLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQII 62
            L++ +++  +++  P++YTPTVG ACL+YSHI  +        GLY+S  D   + Q++
Sbjct: 80  CLYFELLVRYIDQFLPIVYTPTVGQACLQYSHIFRY------ARGLYVSSEDKGRVRQLV 133

Query: 63  KTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPI 122
                 P+ D     I V+TDG RILGLGDLGVNGMGIPVGKL LY A AG++P++TLP+
Sbjct: 134 ANV---PHKDV---DIIVVTDGQRILGLGDLGVNGMGIPVGKLALYTACAGVNPQKTLPV 187

Query: 123 TLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSEHA 182
            +D+GTNNE+ L D  Y+GLR KR+   ++ + +   + ++ + +P ++IQFEDF + HA
Sbjct: 188 CIDVGTNNEELLNDPLYMGLRQKRITGPEYDALIAEFVDAVRERWPNVVIQFEDFHNSHA 247

Query: 183 FDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXXXX 242
           +DLL +Y++   CFNDDIQGT +VV++G  +A++ +++ +   K + + F          
Sbjct: 248 YDLLDQYKDKVPCFNDDIQGTASVVVTGMFSAMRALKQQL---KDQKVLFLGAGSAATGI 304

Query: 243 KQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKTLE 302
             L+    VE G++ EEA   + L D+KGLVT  R   L   K+ FA +D     F    
Sbjct: 305 AHLIADAMVEEGLTREEALARIKLFDSKGLVTKKRTAPLTPAKMPFAAEDAPAETFL--- 361

Query: 303 EVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKGTD 362
           E I  +KPTA+IG+S+ GG F ++ +  MA++N+ PIIF LSNP   AECT E+A   TD
Sbjct: 362 EAIREIKPTAIIGVSAQGGAFTKECLEEMAKINERPIIFALSNPTSKAECTAEEAYTYTD 421

Query: 363 NRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXXXX 422
            R +FA G+ F    V   GKT  P QGNN Y+FPG+GLGAI ++ K+I ++   +    
Sbjct: 422 GRCLFACGSPFK--PVEYKGKTFVPRQGNNHYVFPGIGLGAIFSRAKLIPNEVFLVAAKV 479

Query: 423 XXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEVLK 482
                          YP +S +R +S              G   DK + E+         
Sbjct: 480 LADMVKPEDLERGSLYPALSEVREISAEIGAAVA------GYIFDKNLAEI--------- 524

Query: 483 TRKGKEWDNLVKFVQENMWDPDSEKFFN 510
               ++  +L K V++ MWDP    F  
Sbjct: 525 ----EKPADLKKAVKDAMWDPKHAHFIQ 548



>gi|94469661|gb|ABF20284.1| cytosolic NADP-malic enzyme [Leishmania donovani]
 gi|94469671|gb|ABF20289.1| cytosolic NADP-malic enzyme [Leishmania donovani]
          Length = 548

 Score =  351 bits (900), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 193/493 (39%), Positives = 277/493 (56%), Gaps = 24/493 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV+L+Y I+   L++  P++YTPTVG AC  Y  +           GLYL +     + +
Sbjct: 63  NVTLYYAILTRYLKQTLPIVYTPTVGEACQRYGDLYQ------KDHGLYLDVASKGKVRK 116

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+  R    D      + VITDGSRILGLGDLG NG+GI +GK  LYVAA G+ P R L
Sbjct: 117 LIQNLRKTNVD------VIVITDGSRILGLGDLGANGIGISIGKCSLYVAAGGVKPSRVL 170

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ +D+GTNN +   +  YLGLR  R  D  FY+ +D  M+++   +P  ++QFEDFS+ 
Sbjct: 171 PVVMDVGTNNLELRNNPLYLGLRKPRCGDADFYALLDEFMEAVKDTWPSAVVQFEDFSNN 230

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H FD+L +Y++   CFNDDIQGTGAV+ +GF  AVKL +  +   + R++FF        
Sbjct: 231 HCFDMLERYQKKYRCFNDDIQGTGAVIAAGFHTAVKLSK--IPMEQQRIVFFGAGSAATG 288

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDG---NQ 297
             + + +    E GM +E+ K+ ++ VD+ G+V  +RGD LAKHK+ +AR D        
Sbjct: 289 VAESIAD-LAAEAGMKKEDIKKSIFFVDSMGMVATNRGDKLAKHKLGWARTDIPDAVIAS 347

Query: 298 FKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDA 357
            KTLE+V+ YV+PTALIGL +T  VF+ +I+  +     +PIIFPLSNP   AE    +A
Sbjct: 348 LKTLEDVVRYVRPTALIGLGATANVFSREIVEFLHSCCPHPIIFPLSNPSSKAEIVPANA 407

Query: 358 MKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
            K T+   I ASG+ FPE  V  +G+T  P QGNN+YIFPG+GLG  +A+P  I  + + 
Sbjct: 408 YKWTNGDAIVASGSPFPETVV--SGRTLQPSQGNNLYIFPGVGLGCCIAQPPYIPQEVLV 465

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP +  +R VS              GLA+     ++  N 
Sbjct: 466 AAAACLSTLATPDDLAKGQLYPSIEEVRRVSREVAVACIQKLQELGLAK----ADLPDNR 521

Query: 478 IEVLKTRKGKEWD 490
            +++K  K   W+
Sbjct: 522 PDLMKLVKTAFWE 534



>gi|321265534|ref|XP_003197483.1| malate dehydrogenase (oxaloacetate-decarboxylating) [Cryptococcus
           gattii WM276]
 gi|317463963|gb|ADV25696.1| Malate dehydrogenase (oxaloacetate-decarboxylating), putative
           [Cryptococcus gattii WM276]
          Length = 600

 Score =  351 bits (900), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 211/494 (42%), Positives = 292/494 (59%), Gaps = 22/494 (4%)

Query: 3   SLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQII 62
           +LF+ ++  EL  + P++YTPTVG AC +YS I         P+GLYLS+ D   + +I+
Sbjct: 120 NLFFSVMRDELTNLAPIVYTPTVGEACQKYSQIY------SGPEGLYLSIEDKDRIPEIL 173

Query: 63  KTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPI 122
           + Y          PQI V+TDGSRILGLGDLG+ GMGI VGKL LYVA  G++P   LP+
Sbjct: 174 EEY---ASKLVTPPQILVVTDGSRILGLGDLGIGGMGISVGKLNLYVAGGGVNPHGCLPV 230

Query: 123 TLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSEHA 182
            LD+GTNNE    D  Y+GL+  RV  ++   F+DA M +    +P+ +IQ EDF SE A
Sbjct: 231 VLDMGTNNETIRNDPLYIGLKQARVGLEEATEFMDAFMAAASAAFPKAVIQHEDFYSEAA 290

Query: 183 FDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLV-EKDVHPTK-HRLLFFXXXXXXXX 240
           FD L++Y+E    FNDDI+GTG+V+L+GF+ A K   E    P + H+++F         
Sbjct: 291 FDFLARYKEKYRMFNDDIEGTGSVILAGFLAAAKQASEASGKPLRDHKVVFLGGGSAAVG 350

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGD----NLAKHKVYFARDDNDGN 296
             K+++ FF ++ G++E+EA+   WL+DTKGL+T  R D     +A HK YF R+D +G 
Sbjct: 351 VAKEMMNFFMMQ-GLTEDEARERFWLIDTKGLITSTRADVVSGKIASHKKYFIRNDTEGK 409

Query: 297 QFKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFED 356
           ++ +LE VIEYV+PTAL+GLS+T G F+E  I RMAELN++PIIFPLSNP    E  F D
Sbjct: 410 EYPSLESVIEYVQPTALVGLSTTFGAFSESAIRRMAELNQSPIIFPLSNPTSKCELAFCD 469

Query: 357 AMKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQI 416
           A++ TD RV+FASG+ +P       G  + PGQGNN  +FPG+G GA+ A  K IT   I
Sbjct: 470 ALEWTDGRVLFASGSPYPPQEF--NGSFREPGQGNNFLVFPGIGFGALQAGCKRITTGMI 527

Query: 417 YIXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQN 476
                                YP + RIR VS              G+  ++++  +   
Sbjct: 528 TASAIALSEALTPEEKQKGLLYPRLERIRAVSARVAAGVVKKAQEDGVDTNEKLRGL--- 584

Query: 477 DIEVLKTRKGK-EW 489
           DIE L     K +W
Sbjct: 585 DIEALTEEMNKAQW 598



>gi|496087450|ref|WP_008811957.1| NADP-dependent malic enzyme [Burkholderiales bacterium 1_1_47]
 gi|302859344|gb|EFL82426.1| malic enzyme, NAD binding domain protein [Burkholderiales bacterium
           1_1_47]
          Length = 541

 Score =  350 bits (899), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 193/508 (37%), Positives = 287/508 (56%), Gaps = 39/508 (7%)

Query: 3   SLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQII 62
            L++ +++  +++  P++YTPTVG ACL+YSHI  +        GLY+S  D   + Q++
Sbjct: 72  CLYFELLVRYIDQFLPIVYTPTVGQACLQYSHIFRY------ARGLYVSSEDKGRVRQLV 125

Query: 63  KTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPI 122
                 P+ D     I V+TDG RILGLGDLGVNGMGIPVGKL LY A AG++P++TLP+
Sbjct: 126 ANV---PHKDV---DIIVVTDGQRILGLGDLGVNGMGIPVGKLALYTACAGVNPQKTLPV 179

Query: 123 TLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSEHA 182
            +D+GTNNE+ L D  Y+GLR KR+   ++ + +   + ++ + +P ++IQFEDF + HA
Sbjct: 180 CIDVGTNNEELLNDPLYMGLRQKRITGPEYDALIAEFVDAVRERWPNVVIQFEDFHNSHA 239

Query: 183 FDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXXXX 242
           +DLL +Y++   CFNDDIQGT +VV++G  +A++ +++ +   K + + F          
Sbjct: 240 YDLLDQYKDKVPCFNDDIQGTASVVVTGMFSAMRALKQQL---KDQKVLFLGAGSAATGI 296

Query: 243 KQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKTLE 302
             L+    VE G++ EEA   + L D+KGLVT  R   L   K+ FA +D     F    
Sbjct: 297 AHLIADAMVEEGLTREEALARIKLFDSKGLVTKKRTAPLTPAKMPFAAEDAPAETFL--- 353

Query: 303 EVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKGTD 362
           E I  +KPTA+IG+S+ GG F ++ +  MA++N+ PIIF LSNP   AECT E+A   TD
Sbjct: 354 EAIREIKPTAIIGVSAQGGAFTKECLEEMAKINERPIIFALSNPTSKAECTAEEAYTYTD 413

Query: 363 NRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXXXX 422
            R +FA G+ F    V   GKT  P QGNN Y+FPG+GLGAI ++ K+I ++   +    
Sbjct: 414 GRCLFACGSPFK--PVEYKGKTFVPRQGNNHYVFPGIGLGAIFSRAKLIPNEVFLVAAKV 471

Query: 423 XXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEVLK 482
                          YP +S +R +S              G   DK + E+         
Sbjct: 472 LADMVKPEDLERGSLYPALSEVREISAEIGAAVA------GYIFDKNLAEI--------- 516

Query: 483 TRKGKEWDNLVKFVQENMWDPDSEKFFN 510
               ++  +L K V++ MWDP    F  
Sbjct: 517 ----EKPADLKKAVKDAMWDPKHAHFIQ 540



>gi|94469679|gb|ABF20293.1| cytosolic NADP-malic enzyme [Leishmania infantum]
          Length = 548

 Score =  350 bits (899), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 193/493 (39%), Positives = 276/493 (55%), Gaps = 24/493 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV+L+Y I+   L++  P++YTPTVG AC  Y  +           GLYL +     + +
Sbjct: 63  NVTLYYAILTRYLKQTLPIVYTPTVGEACQRYGDLYQ------KDHGLYLDVAIKGKVRK 116

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+  R    D      + VITDGSRILGLGDLG NG+GI +GK  LYVAA G+ P R L
Sbjct: 117 LIQNLRKTNVD------VIVITDGSRILGLGDLGANGIGISIGKCSLYVAAGGVKPSRVL 170

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ +D+GTNN +   +  YLGLR  R  D  FY+ +D  M+++   +P  ++QFEDFS+ 
Sbjct: 171 PVVMDVGTNNLELRNNPLYLGLRKPRCGDADFYALLDEFMEAVKDTWPSAVVQFEDFSNN 230

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H FD+L +Y++   CFNDDIQGTGAV+ +GF  AVKL    +   + R++FF        
Sbjct: 231 HCFDMLERYQKKYRCFNDDIQGTGAVIAAGFHTAVKL--SKIPMEQQRIVFFGAGSAATG 288

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDG---NQ 297
             + + +    E GM +E+ K+ ++ VD+ G+V  +RGD LAKHK+ +AR D        
Sbjct: 289 VAESIAD-LAAEAGMKKEDVKKSIFFVDSMGMVATNRGDKLAKHKLGWARTDIPDAVIAS 347

Query: 298 FKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDA 357
            KTLE+V+ YV+PTALIGL +T  VF+ +I+  +     +PIIFPLSNP   AE    +A
Sbjct: 348 LKTLEDVVRYVRPTALIGLGATANVFSREIVEFLHSCCPHPIIFPLSNPSSKAEIVPANA 407

Query: 358 MKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
            K T+   I ASG+ FPE  V  +G+T  P QGNN+YIFPG+GLG  +A+P  I  + + 
Sbjct: 408 YKWTNGDAIVASGSPFPETVV--SGRTLQPSQGNNLYIFPGVGLGCCIAQPPYIPQEVLV 465

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP +  +R VS              GLA+     ++  N 
Sbjct: 466 AAAACLSTLATPDDLAKGQLYPSIEEVRRVSREVAVACIQKLQELGLAK----ADLPDNR 521

Query: 478 IEVLKTRKGKEWD 490
            +++K  K   W+
Sbjct: 522 PDLMKLVKTAFWE 534



>gi|459288815|ref|YP_007511972.1| malate dehydrogenase [Bradyrhizobium oligotrophicum S58]
 gi|505478966|ref|WP_015665508.1| malate dehydrogenase [Bradyrhizobium oligotrophicum]
 gi|456353940|dbj|BAM88385.1| malate dehydrogenase [Bradyrhizobium oligotrophicum S58]
          Length = 549

 Score =  350 bits (898), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 201/502 (40%), Positives = 273/502 (54%), Gaps = 41/502 (8%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +LF+R+V   ++EI PLIYTPTVG AC +Y  I         P GL++S ND   + +
Sbjct: 86  NEALFFRVVCDNIDEIQPLIYTPTVGLACQKYGLIFQR------PRGLFISANDRGRIAE 139

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+  +   PY   L     V+TDG RILGLGDLG NGMGIPVGKL LY A AGI P   L
Sbjct: 140 ILANW---PYRAKLI----VVTDGERILGLGDLGANGMGIPVGKLSLYSACAGIHPEECL 192

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ LD+GTNNE+ L D +Y+GLR KR+    + +FVD  M +    +P +LIQFEDF++ 
Sbjct: 193 PVMLDVGTNNEELLNDAYYIGLRQKRITGAAYDAFVDEFMTAARAAFPGVLIQFEDFANH 252

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF LL KYR++   FNDDIQGT AV L+G  +A+++   +    + + + F        
Sbjct: 253 AAFKLLHKYRDDACVFNDDIQGTAAVALAGLFSALRI---NGGKLRDQTVLFLGAGEAAT 309

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
               L+    +  G+SE EA R  WL D++GLV   R +NL  HK+ +A +      F T
Sbjct: 310 GIADLVVSAMMAEGLSEAEALRRNWLTDSRGLVIKGR-ENLHGHKLRYAHEQAPIGDFLT 368

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
               I+ +KPTA+IG+++ GG F  +++  MAELN+ PI+F LSNP   AEC+ E A + 
Sbjct: 369 ---AIKTLKPTAIIGVAAVGGAFTPEVLQTMAELNERPIVFALSNPTSKAECSAEAAYRY 425

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           T  R +FA G+  P   V   GKT  P QGNN YIFPG+GLGAI    +++TD+      
Sbjct: 426 TKGRALFACGS--PYDPVRLDGKTFVPRQGNNSYIFPGVGLGAIATGARLVTDEMFMAAA 483

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YP + RIR VS              GLA               
Sbjct: 484 HTLANCVTGADLEQGSLYPALPRIREVSALIGAAVAGVAYQNGLA--------------- 528

Query: 481 LKTRKGKEWDNLVKFVQENMWD 502
                G   ++L+ FV+  M+D
Sbjct: 529 ----AGPAPNDLLGFVESKMYD 546



>gi|294874240|ref|XP_002766872.1| malic enzyme, putative [Perkinsus marinus ATCC 50983]
 gi|239868217|gb|EEQ99589.1| malic enzyme, putative [Perkinsus marinus ATCC 50983]
          Length = 642

 Score =  350 bits (897), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 198/504 (39%), Positives = 277/504 (54%), Gaps = 38/504 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +L++++++  + E+ P++YTP VG AC  + HI           GLY +L++  N  +
Sbjct: 123 NETLYFKLLVDHVAEMMPIVYTPVVGKACQLFGHIFRN------ARGLYFNLSEKGNFKE 176

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++        D      I V+TDGSRILGLGDLG NGMGIP+GKL LYVA AGI+P RT+
Sbjct: 177 MVWNSNVRDAD------IIVVTDGSRILGLGDLGTNGMGIPIGKLSLYVACAGINPGRTV 230

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLD+GTNN   L D+ YLG R KRVD +++Y+ VD  + ++   +P +LIQFEDF+++
Sbjct: 231 PVTLDVGTNNPDLLNDDMYLGERHKRVDGEEYYAAVDEFVDAVRSRWPGVLIQFEDFTND 290

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           HAF LL +Y+EN  CFNDDIQGTG+V L+G ++A+++ ++ +     R++F         
Sbjct: 291 HAFPLLKRYQENILCFNDDIQGTGSVALAGLVSAMRVKKEKLE--DQRIVFLGAGAAAVG 348

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
               ++    V  G+S E+A++  W VD++GLVT  RG N+  HKV + RDD +     +
Sbjct: 349 IADCIVAAM-VHDGLSPEDARKRFWFVDSRGLVTWKRGGNIQDHKVPYCRDDAE--PMTS 405

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L EV++ +KPT L+GLS   G F E II  M      P+IF LSNP   AE T E     
Sbjct: 406 LLEVVKAIKPTVLLGLSGQSGSFTEDIIKAMYANCPQPVIFALSNPTPKAEATPEQLYTW 465

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           TD      +G+ F   T    GK    GQGNNMYIFPG+GL  IL K K I D   Y   
Sbjct: 466 TDGNAWVCTGSPFGPVTY--NGKVYQSGQGNNMYIFPGVGLAGILGKFKWIPDSMFYTAA 523

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YP ++RIR +S              G+A     IE        
Sbjct: 524 KTLAERVTEEDIARGTLYPCLTRIRELSHDIAVSCIKEAFDLGIA----CIERPA----- 574

Query: 481 LKTRKGKEWDNLVKFVQENMWDPD 504
                     +L KFV ++MW P+
Sbjct: 575 ----------DLDKFVWDHMWKPE 588



>gi|470530455|ref|XP_004368256.1| NAD-dependent malic enzyme, putative [Acanthamoeba castellanii str.
           Neff]
 gi|440804624|gb|ELR25501.1| NAD-dependent malic enzyme, putative [Acanthamoeba castellanii str.
           Neff]
          Length = 615

 Score =  350 bits (897), Expect = 9e-94,   Method: Compositional matrix adjust.
 Identities = 192/449 (42%), Positives = 264/449 (58%), Gaps = 19/449 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +LFYR+V+  ++E+ P+IYTPTVG AC+E+   S F        G+Y S  D+  ++ 
Sbjct: 124 NETLFYRMVMDNIDEMAPIIYTPTVGKACIEFG--SQFRRA----RGMYFSSADMGQMSA 177

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I  + P  + D +     V+TDGSRILGLGDLG +GMGIP+GKL LYVAA GI P RTL
Sbjct: 178 MIYNW-PEKHVDVI-----VVTDGSRILGLGDLGAHGMGIPIGKLSLYVAAGGIHPARTL 231

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLD+GTNNEK L D FYLG + +R+  + +Y+ V+  M ++   +P  L+QFEDFS+ 
Sbjct: 232 PVTLDVGTNNEKLLDDPFYLGRQHRRLTGEDYYNVVEEFMSAVKLRWPSCLVQFEDFSNA 291

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHP-TKHRLLFFXXXXXXX 239
           +A +LL KYR+   CFNDDIQGTG+V L+G + A++   K     TK R++         
Sbjct: 292 NASNLLEKYRDRHLCFNDDIQGTGSVALAGILTALRAQGKAAKEITKQRIVCLGGGSAGL 351

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK 299
                L++   VE G+  E A + VW+VD  GL+   R       K +   D  +G + K
Sbjct: 352 GVINSLIDGM-VEEGLPREVANKNVWVVDADGLIAQGRSTISDAQKPFVRTDLPNGLKLK 410

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
              + ++ VKPT L+GLS  G  F E ++  MA   + PIIFPLSNP  +AECT E+A  
Sbjct: 411 ---DTVDKVKPTILLGLSGAGRTFTEDVVRSMAANTERPIIFPLSNPTDHAECTAEEAFT 467

Query: 360 GTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIX 419
            TD R I ASG+ F    V   GKT YP QGNNMYI+PG+GLG +  + K +T+   Y  
Sbjct: 468 WTDGRAIVASGSPFDP--VQYKGKTYYPSQGNNMYIYPGIGLGVVCCRAKKVTNAMFYAA 525

Query: 420 XXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                             YP +++IR VS
Sbjct: 526 AKKLASIVPEEDVQAGRVYPDIAKIREVS 554



>gi|27381580|ref|NP_773109.1| malate dehydrogenase [Bradyrhizobium japonicum USDA 110]
 gi|499401742|ref|WP_011089209.1| malate dehydrogenase [Bradyrhizobium japonicum]
 gi|27354748|dbj|BAC51734.1| malic enzyme [Bradyrhizobium japonicum USDA 110]
          Length = 531

 Score =  348 bits (893), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 198/503 (39%), Positives = 274/503 (54%), Gaps = 40/503 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +LF+R+V+  ++EI P+IYTPTVG AC +Y  I         P G+++S  D   + +
Sbjct: 67  NEALFFRVVVDNIDEIQPIIYTPTVGLACQKYGLIFQR------PRGMFISSRDRGQIAE 120

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+K + PYP       ++ V+TDG RILGLGDLG NGMGIPVGKL LY A AG+ P   L
Sbjct: 121 ILKNW-PYP------ARLIVVTDGERILGLGDLGANGMGIPVGKLSLYSACAGVHPEHCL 173

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PI LD+GTNNE+ L D +YLGLR +R+  + + SFVD  M +  K +P +LIQFEDF++ 
Sbjct: 174 PIVLDVGTNNEELLNDPYYLGLRERRLTGEAYDSFVDEFMVAARKTFPGVLIQFEDFANH 233

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF LL KYR+    FNDDIQGT AV L+G  + +++    +   K + + F        
Sbjct: 234 SAFKLLHKYRDEACVFNDDIQGTAAVALAGLFSGLRISGGKL---KDQKILFLGAGEAAT 290

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
               L+    +  G +E EA R  WLVD++GLV   R D L+ HK+ +A           
Sbjct: 291 GIADLVVSAMMAEGATEAEALRRNWLVDSRGLVVSGR-DGLSGHKLRYAHAGQ--APISD 347

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
               I+ +KPTA+IG+++ GG F   ++  MA LN++PI+F LSNP   AEC+ EDA + 
Sbjct: 348 FLTAIKTLKPTAIIGVAAVGGAFTPDVLKAMAGLNEHPIVFALSNPTSKAECSAEDAYRY 407

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           T+ R +FA G+  P   V   G+T  P QGNN YIFPG+GLG I  + +++TD+      
Sbjct: 408 TEGRALFACGS--PYDPVKLNGRTFVPRQGNNSYIFPGVGLGVIATRSRLVTDEMFMAAA 465

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YP + RIR VS              GLA          ND++ 
Sbjct: 466 HSLADCVGKEDLAQGSLYPALPRIREVSARIAAAVADVAYQRGLADGP-----APNDVKA 520

Query: 481 LKTRKGKEWDNLVKFVQENMWDP 503
           L              VQ  M++P
Sbjct: 521 L--------------VQSQMYEP 529



>gi|496260439|ref|WP_008973824.1| Malate dehydrogenase (oxaloacetate-decarboxylating) (NADP(+))
           [Bradyrhizobium sp. STM 3843]
 gi|365418264|emb|CCE11316.1| Malate dehydrogenase (oxaloacetate-decarboxylating) (NADP(+))
           [Bradyrhizobium sp. STM 3843]
          Length = 543

 Score =  348 bits (893), Expect = 2e-93,   Method: Compositional matrix adjust.
 Identities = 198/503 (39%), Positives = 274/503 (54%), Gaps = 41/503 (8%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +LF+R+V   ++E+ PLIYTPTVG AC ++  I         P GL++S ND   + +
Sbjct: 80  NEALFFRVVCDYIDEVQPLIYTPTVGLACQKFGLIFQR------PRGLFISANDRGRIAE 133

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+  +   PY   L     V+TDG RILGLGDLG NGMGIPVGKL LY A AGI P   L
Sbjct: 134 ILGNW---PYRAKLI----VVTDGERILGLGDLGANGMGIPVGKLSLYSACAGIHPELCL 186

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ LD+GTNNE+ L D +Y+GLR KR+    +  FVD  M +    +P +LIQFEDF++ 
Sbjct: 187 PVMLDVGTNNEELLNDPYYIGLRQKRMSGAAYDDFVDEFMTAARAAFPGVLIQFEDFANH 246

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF LL KYR++   FNDDIQGT AV L+G  +A+++    +     R+LF         
Sbjct: 247 SAFKLLHKYRDDACVFNDDIQGTAAVALAGLFSALRITGGKL--CDQRVLFLGAGEAATG 304

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
                +     E G+SE EA +  WLVD+KGLV   R +NL  HK+ +A +      F  
Sbjct: 305 IADLAVSAMMAE-GLSEAEALKRNWLVDSKGLVVKGR-ENLGGHKLRYAHEHAPIGDFPA 362

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
               ++ ++PTA+IG+++ GG F  +++  MAELN+ PIIF LSNP   AEC+ E A + 
Sbjct: 363 ---AVKTLRPTAIIGVAAVGGAFTPEVLQAMAELNERPIIFALSNPTSKAECSAEAAYRH 419

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           T  R +FA G+  P   V   G+T  P QGNN YIFPG+GLGAI +  +++TD+      
Sbjct: 420 TGGRALFACGS--PYDPVRLDGRTFVPRQGNNSYIFPGVGLGAIASGARLVTDEMFMAAA 477

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            YP + RIR VS              GL                
Sbjct: 478 HTLANCVTGADLEQGSLYPALPRIREVSAHIGAAVAHVAYQAGLT--------------- 522

Query: 481 LKTRKGKEWDNLVKFVQENMWDP 503
               +G+  ++L+ +V+  M+DP
Sbjct: 523 ----QGQPPNDLLGYVETQMYDP 541



>gi|94469709|gb|ABF20308.1| cytosolic NADP-malic enzyme [Leishmania tropica]
          Length = 548

 Score =  348 bits (892), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 195/504 (38%), Positives = 280/504 (55%), Gaps = 26/504 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV+L+Y I+   L++  P++YTPTVG AC  Y  +           GLYL +     + +
Sbjct: 63  NVTLYYAILTRYLKQTLPIVYTPTVGEACQRYGDLYQ------KDHGLYLDVASKGKVRK 116

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+  R    D      + VITDGSRILGLGDLG NG+GI +GK  LYVAA G+ P R L
Sbjct: 117 LIQNLRKTNVD------VIVITDGSRILGLGDLGANGIGISIGKCSLYVAAGGVKPSRVL 170

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ +D+GTNN +   +  YLGLR  R  D  FY+ +D  M+++   +P  ++QFEDFS+ 
Sbjct: 171 PVVMDVGTNNLELRNNPLYLGLRKPRCGDADFYALLDEFMEAVKDTWPSAVVQFEDFSNN 230

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H FD+L +Y++   CFNDDIQGTGAV+ +GF  AVKL +  +   + R++FF        
Sbjct: 231 HCFDMLERYQKKYRCFNDDIQGTGAVIAAGFHTAVKLSK--IPMEQQRIVFFGAGSAATG 288

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARD---DNDGNQ 297
             + + +    E GM +E  K+  + VD+ G+V  +RGD LAKHK+ +AR    D D   
Sbjct: 289 VAESIAD-LAAEAGMKKEGIKKNTFFVDSMGMVATNRGDKLAKHKLGWARTDIPDADIAS 347

Query: 298 FKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDA 357
            KTLE+V+ YV+PTALIGL +T  VF+ +I+  +     +PIIFPLSNP   AE     A
Sbjct: 348 LKTLEDVVRYVRPTALIGLGATANVFSREIVEFLHSCCPHPIIFPLSNPSSKAEIVPASA 407

Query: 358 MKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
            K T+   I ASG+ FPE  V  +G+T    QGNN+YIFPG+GLG  +A+P  I  + + 
Sbjct: 408 YKWTNGDAIVASGSPFPETVV--SGRTLQSSQGNNLYIFPGVGLGCCIAQPPYIPQEVLV 465

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP +  +R VS              GLA+     ++  N 
Sbjct: 466 AAAACLSTLATPDDLAKGQLYPPIEEVRRVSREVAVACIQKLQELGLAK----ADLPDNR 521

Query: 478 IEVLKTRKGKEWDNLVKFVQENMW 501
            +++K  K   W+   +++ EN +
Sbjct: 522 PDLMKLVKTAFWEP--RYLPENYY 543



>gi|27357017|gb|AAN86690.1| malic enzyme [Mastigamoeba balamuthi]
          Length = 568

 Score =  348 bits (892), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 181/448 (40%), Positives = 260/448 (58%), Gaps = 20/448 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +LF+ +V   +EE  PL+YTPTVG  C ++S      A    P GLY++  D  ++ +
Sbjct: 102 NQTLFFYLVQHHVEECVPLVYTPTVGEGCTKFS------AEFRNPTGLYITPEDKGHVAE 155

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I++ +   P++     +I V+TDG RILGLGDLG NGMGIP+GKL LY+A AG  P RTL
Sbjct: 156 ILENW---PHEV----EIIVVTDGGRILGLGDLGSNGMGIPIGKLHLYIACAGFRPDRTL 208

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ +D+GTN ++ L D  YLG+R  R+ D ++++ ++  M ++   +P  L+QFEDF + 
Sbjct: 209 PVMIDVGTNRQELLDDPMYLGVRKARLGDAEYFALLEEFMTAVRAKWPRCLVQFEDFPNP 268

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
             F LL  +    FCFNDDIQGTGAV+L+G INAV+     V    HR +F         
Sbjct: 269 RCFQLLDTWFGRQFCFNDDIQGTGAVILAGVINAVRATGVPV--ADHRFMFLGAGSAATG 326

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
               + ++   E  ++ E+A+R + + D +G V   R   L  H V +A    D  +  T
Sbjct: 327 VAGMIAKWIATETHVAIEQARRAITMFDVEGFVVKSRVAKLPAHLVPYA---ADAPECPT 383

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
             + I +VKPTA+IGLS  G +F + ++  +A LNK PI+F LSNP   AEC  EDA   
Sbjct: 384 FLDAIRHVKPTAIIGLSGAGRLFTKPVVEEVAALNKRPIVFALSNPTSKAECVAEDAYTW 443

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           +D R IFASG+ FP   V   G+T  PGQGNNM+IFPGLG GA+ A+ K++TD+ I    
Sbjct: 444 SDGRAIFASGSPFPN--VEYKGRTYTPGQGNNMFIFPGLGFGAVAAQAKLVTDQMIMRSA 501

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                            +P ++RI  ++
Sbjct: 502 LELANTVSQADIDAGLIFPAIARIHEIT 529



>gi|383770127|ref|YP_005449190.1| malate dehydrogenase [Bradyrhizobium sp. S23321]
 gi|505722123|ref|WP_015684409.1| malate dehydrogenase [Bradyrhizobium sp. S23321]
 gi|381358248|dbj|BAL75078.1| malate dehydrogenase [Bradyrhizobium sp. S23321]
          Length = 531

 Score =  347 bits (891), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 191/465 (41%), Positives = 266/465 (57%), Gaps = 21/465 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +LF+R+V+  ++EI P+IYTPTVG AC ++  I         P G+++S  D   +  
Sbjct: 67  NEALFFRVVVDNIDEIQPIIYTPTVGLACQKFGLIYQR------PRGMFISSRDRGQIAD 120

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+K + P P       ++ V+TDG RILGLGDLG NGMGIPVGKL LY A AG+ P + L
Sbjct: 121 ILKNW-PNP------AKLIVVTDGERILGLGDLGANGMGIPVGKLSLYSACAGVHPEQCL 173

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ LD+GTNNE+ L D +YLGLR +R+  + + SFVD  M +  K +P +LIQFEDF++ 
Sbjct: 174 PVVLDVGTNNEELLSDPYYLGLRQRRLTGEAYDSFVDEFMVAARKTFPGVLIQFEDFANH 233

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF LL KYR++   FNDDIQGT AV L+G  +A+++    +     R+LF         
Sbjct: 234 SAFKLLHKYRDDACVFNDDIQGTAAVALAGLFSALRVNGGKLK--DQRILFLGAGEAATG 291

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
               ++     E G+SE EA R  WLVD++GLV   R + L  HK+ +A  D        
Sbjct: 292 IADLVVSAMMAE-GLSEAEALRRNWLVDSRGLVVGSR-EGLHGHKLRYAHSDQ--APIAD 347

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
               I+ +KPTA+IG+++ GG F  +++  MA LN+ PI+F LSNP   AEC+ EDA + 
Sbjct: 348 FLTAIKTLKPTAIIGVAAVGGAFTPEVLKTMAALNEQPIVFALSNPTSKAECSAEDAYRY 407

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           T+ R +FA G+  P   V   G+T  P QGNN YIFPG+GLG I ++ +++TD+      
Sbjct: 408 TEGRALFACGS--PYDPVKLNGRTFVPRQGNNSYIFPGVGLGVIASRSRLVTDEMFMAAA 465

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLA 465
                            YP + RIR VS              GLA
Sbjct: 466 HTLADCVGKEDLAQGSLYPALPRIREVSVRIAAAVADVAFQRGLA 510



>gi|389601389|ref|XP_001565345.2| putative malic enzyme [Leishmania braziliensis MHOM/BR/75/M2904]
 gi|322505023|emb|CAM42255.2| putative malic enzyme [Leishmania braziliensis MHOM/BR/75/M2904]
          Length = 573

 Score =  347 bits (890), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 197/519 (37%), Positives = 282/519 (54%), Gaps = 38/519 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV+L+Y I+   L++  P++YTPTVG AC  Y  +           GLYL + +   + +
Sbjct: 86  NVTLYYAILTRYLKQTLPIVYTPTVGEACQHYGDLYQ------KDHGLYLDVANKGKVRK 139

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+  R    D      + VITDGSRILGLGDLG NG+GI +GK  LYVAA G+ P R L
Sbjct: 140 MIQNLRKTNID------VIVITDGSRILGLGDLGANGIGISIGKCSLYVAAGGVKPSRVL 193

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ +D+GTNN     +  YLGLR  R  D  FY+ +D  M+++   +P  ++QFEDFS+ 
Sbjct: 194 PVVMDVGTNNINLRNNPLYLGLRKPRCSDADFYALLDEFMEAVKSTWPSAVVQFEDFSNN 253

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H FD+L +Y+    CFNDDIQGTGAV+ +GF  AVKL    +   + R++FF        
Sbjct: 254 HCFDMLERYQRKYRCFNDDIQGTGAVIAAGFHTAVKLSTIPID--QQRIVFFGAGSAATG 311

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARD---DNDGNQ 297
             + + +   V  G   E+ K+  + VD+ G+V  +RGD LAKHK+ +AR    D D   
Sbjct: 312 VAESIADLATV-IGAKREDTKKSAFFVDSMGMVATNRGDKLAKHKLEWARTDIPDADIAG 370

Query: 298 FKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDA 357
            +TL++V+ YV+PTALIGL +TG VF+ +++  M     +PIIFPLSNP   AE    +A
Sbjct: 371 LRTLDDVVRYVRPTALIGLGATGNVFSREMVEFMHSYCPHPIIFPLSNPSSKAEIVPANA 430

Query: 358 MKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
            K T+   I ASG+ FPE  V   G+T  P QGNN+YIFPG+GLG  +A+P  I  + + 
Sbjct: 431 YKWTNGNAIVASGSPFPETVV--NGRTLKPSQGNNLYIFPGVGLGCCIAQPPYIPQEVLV 488

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP +  +R VS              G+A+           
Sbjct: 489 AAAACLSTLVTPDDLAKGQLYPPIEDVRRVSREVAVACIQKLQAMGMAK----------- 537

Query: 478 IEVLKTRKGKEWDNLVKFVQENMWDPD--SEKFFNTEEL 514
            E L   +     +L+K V++  W+P    E ++  +EL
Sbjct: 538 -EGLPDNR----PDLMKVVKQAFWEPHYMPESYYLEKEL 571



>gi|308912542|gb|ADO51080.1| malic enzyme [Leishmania tropica]
 gi|308912546|gb|ADO51082.1| malic enzyme [Leishmania tropica]
 gi|308912548|gb|ADO51083.1| malic enzyme [Leishmania tropica]
          Length = 491

 Score =  346 bits (887), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 187/451 (41%), Positives = 260/451 (57%), Gaps = 20/451 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV+L+Y I+   L++  P++YTPTVG AC  Y  +           GLYL + +   + +
Sbjct: 47  NVTLYYAILTRYLKQTLPIVYTPTVGEACQRYGDLYQ------KDHGLYLDVANKGKVRK 100

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+  R    D      + VITDGSRILGLGDLG NG+GI +GK  LYVAA G+ P R L
Sbjct: 101 LIQNLRKTNVD------VIVITDGSRILGLGDLGANGIGISIGKCSLYVAAGGVMPSRVL 154

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ +D+GTNN +   +  YLGLR  R  D  FY+ +D  M+++   +P  ++QFEDFS+ 
Sbjct: 155 PVVMDVGTNNLELRNNPLYLGLRKPRCGDADFYALLDEFMEAVKDTWPSAVVQFEDFSNN 214

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H FD+L +Y++   CFNDDIQGTGAV+ +GF  AVKL    +   + R++FF        
Sbjct: 215 HCFDMLERYQKKYRCFNDDIQGTGAVIAAGFHTAVKL--SKIPMEQQRIVFFGAGSAATG 272

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARD---DNDGNQ 297
             + + +    E GM +E  K+  + VD+ G+V  +RGD LAKHK+ +AR    D D   
Sbjct: 273 VAESIAD-LAAEAGMKKEGIKKNTFFVDSMGMVATNRGDKLAKHKLGWARTDIPDADIAS 331

Query: 298 FKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDA 357
            KTLE+V+ YV+PTALIGL +T  VF+ KI+  +     +PIIFPLSNP   AE     A
Sbjct: 332 LKTLEDVVRYVRPTALIGLGATANVFSRKIVEFLHSCCPHPIIFPLSNPSSKAEIVPASA 391

Query: 358 MKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
            K T+   I ASG+ FPE  V  +G+T    QGNN+YIFPG+GLG  +A+P  I  + + 
Sbjct: 392 YKWTNGDAIVASGSPFPETVV--SGRTLQSSQGNNLYIFPGVGLGCCIAQPPYIPQEVLV 449

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                               YP +  +R VS
Sbjct: 450 AAAACLSTLATPDDLAKGQLYPPIEEVRRVS 480



>gi|157870083|ref|XP_001683592.1| putative malic enzyme [Leishmania major strain Friedlin]
 gi|68126658|emb|CAJ04473.1| putative malic enzyme [Leishmania major strain Friedlin]
          Length = 573

 Score =  345 bits (886), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 194/504 (38%), Positives = 281/504 (55%), Gaps = 26/504 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV+L+Y I+   L++  P++YTPTVG AC  Y  +           GLYL +     + +
Sbjct: 86  NVTLYYAILTRYLKQTLPIVYTPTVGEACQRYGDLYQ------KDHGLYLDVASKGKVRR 139

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+  R    D      + VITDGSRILGLGDLG NG+GI +GK  LYVAA G+ P R L
Sbjct: 140 LIQNLRKTNID------VIVITDGSRILGLGDLGSNGIGISIGKCSLYVAAGGVKPSRVL 193

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ +D+GTNN +   +  YLGLR  R  D  FY+ +D  M+++   +P  ++QFEDFS+ 
Sbjct: 194 PVVMDVGTNNLELRNNPLYLGLRKPRCGDADFYALLDEFMEAVKDTWPSAVVQFEDFSNN 253

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H FD+L +Y++   CFNDDIQGTGAV+ +GF  AVKL +  +   + R++FF        
Sbjct: 254 HCFDMLERYQKKYRCFNDDIQGTGAVIAAGFHTAVKLSKIPLE--QQRIVFFGAGSAATG 311

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARD---DNDGNQ 297
             + + +    E G+ +E  K+  + VD+ G+V  +RGD LAKHK+ +AR    D D   
Sbjct: 312 VAESIAD-LAAETGVKKEGIKKNTFFVDSMGMVATNRGDKLAKHKLGWARTDIPDADIAS 370

Query: 298 FKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDA 357
            KTLE+V+ YV+PTALIGL +T  VF+ +I+  +     +PIIFPLSNP   AE    +A
Sbjct: 371 LKTLEDVVRYVRPTALIGLGATANVFSREIVEFLHSCCPHPIIFPLSNPSSKAEIVPANA 430

Query: 358 MKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
            K T+   I ASG+ FPE  V  +G+T    QGNN+YIFPG+GLG  +A+P  I  + + 
Sbjct: 431 YKWTNGDAIVASGSPFPETVV--SGRTLQSSQGNNLYIFPGVGLGCCIAQPPYIPQEVLV 488

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQND 477
                               YP +  +R VS              GLA+     ++  N 
Sbjct: 489 AAAACLSTLATPDDLAKGQLYPPIEEVRRVSREVAVACIQKLQELGLAK----ADLPDNR 544

Query: 478 IEVLKTRKGKEWDNLVKFVQENMW 501
            +++K  K   W+   +++ EN +
Sbjct: 545 PDLMKLVKTAFWEP--RYLPENYY 566



>gi|428185540|gb|EKX54392.1| hypothetical protein GUITHDRAFT_149994 [Guillardia theta CCMP2712]
          Length = 532

 Score =  345 bits (886), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 197/450 (43%), Positives = 269/450 (59%), Gaps = 23/450 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +LFYR+V+  + +I PLIYTPTVG AC +Y HI         P G+Y+S+ D+ ++  
Sbjct: 67  NETLFYRLVVDHVTDIMPLIYTPTVGEACQKYGHIFQR------PRGMYISIEDMGSVKS 120

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+  +     D      + VITDG RILGLGDLG  GMGIPVGKL LY A  GI+P R L
Sbjct: 121 ILANWPSKKVD------VVVITDGERILGLGDLGTYGMGIPVGKLNLYTACGGINPDRCL 174

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           PIT+D+GTN +  + D +Y GL+  RV  +++  F++ V+  L + +P +LIQFEDF + 
Sbjct: 175 PITVDVGTNTQTLIDDPYYTGLKQPRVRGEKYMQFMEEVLIGLHEHFPGVLIQFEDFGNT 234

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF+LL KYR     FNDDIQGT +V L+G ++A ++    +   K  L  F        
Sbjct: 235 TAFELLEKYRNRICTFNDDIQGTASVTLAGLLSATRMKGTKL---KDELFLFSGAGEAGT 291

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
               L+    V  GM ++EAK+  WLVD+KGLV   R   L  HK+ +A +  +  + K 
Sbjct: 292 GIADLIVEELVAEGMPKDEAKKRCWLVDSKGLVVHSRLHELQHHKIPYAHEYPE--EIKE 349

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
             EV+  +KPTA+IG+S+  G F++++I  MAELN+ PIIFPLSNP   AECT E+A+K 
Sbjct: 350 FIEVVRKLKPTAIIGVSAQAGAFSQQVIELMAELNERPIIFPLSNPTSKAECTAEEAVKF 409

Query: 361 TDNRVIFASGTAFP--EYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYI 418
           T  +V+FASG+ FP  EY     GK   PGQGNN YIFPG+GLGA+L   K +TD  + I
Sbjct: 410 TKGKVLFASGSPFPAMEY----EGKRFVPGQGNNAYIFPGVGLGAVLGGLKHVTDGMLRI 465

Query: 419 XXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                              YP +++IR VS
Sbjct: 466 AAQAVADTVTPEDVAVECLYPPLTKIRSVS 495



>gi|308912544|gb|ADO51081.1| malic enzyme [Leishmania tropica]
 gi|308912550|gb|ADO51084.1| malic enzyme [Leishmania tropica]
 gi|308912552|gb|ADO51085.1| malic enzyme [Leishmania tropica]
          Length = 491

 Score =  345 bits (884), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 186/451 (41%), Positives = 259/451 (57%), Gaps = 20/451 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           NV+L+Y I+   L++  P++YTPTVG AC  Y  +           GLYL +     + +
Sbjct: 47  NVTLYYAILTRYLKQTLPIVYTPTVGEACQRYGDLYQ------KDHGLYLDVASKGKVRK 100

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +I+  R    D      + VITDGSRILGLGDLG NG+GI +GK  LYVAA G+ P R L
Sbjct: 101 LIQNLRKTNVD------VIVITDGSRILGLGDLGANGIGISIGKCSLYVAAGGVKPSRVL 154

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ +D+GTNN +   +  YLGLR  R  D  FY+ +D  M+++   +P  ++QFEDFS+ 
Sbjct: 155 PVVMDVGTNNLELRNNPLYLGLRKPRCGDADFYALLDEFMEAVKDTWPSAVVQFEDFSNN 214

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           H FD+L +Y++   CFNDDIQGTGAV+ +GF  AVKL    +   + R++FF        
Sbjct: 215 HCFDMLERYQKKYRCFNDDIQGTGAVIAAGFHTAVKL--SKIPMEQQRIVFFGAGSAATG 272

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARD---DNDGNQ 297
             + + +    E GM +E  K+  + VD+ G+V  +RGD LAKHK+ +AR    D D   
Sbjct: 273 VAESIAD-LAAEAGMKKEGIKKNTFFVDSMGMVATNRGDKLAKHKLGWARTDIPDADIAS 331

Query: 298 FKTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDA 357
            KTLE+V+ YV+PTALIGL +T  VF+ +I+  +     +PIIFPLSNP   AE     A
Sbjct: 332 LKTLEDVVRYVRPTALIGLGATANVFSREIVEFLHSCCPHPIIFPLSNPSSKAEIVPASA 391

Query: 358 MKGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIY 417
            K T+   I ASG+ FPE  V  +G+T    QGNN+YIFPG+GLG  +A+P  I  + + 
Sbjct: 392 YKWTNGDAIVASGSPFPETVV--SGRTLQSSQGNNLYIFPGVGLGCCIAQPPYIPQEVLV 449

Query: 418 IXXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                               YP +  +R VS
Sbjct: 450 AAAACLSTLATPDDLAKGQLYPPIEEVRRVS 480



>gi|491576226|ref|WP_005433803.1| hypothetical protein [Sutterella wadsworthensis]
 gi|404659053|gb|EKB31914.1| hypothetical protein HMPREF9465_00491 [Sutterella wadsworthensis
           2_1_59BFAA]
          Length = 540

 Score =  344 bits (883), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 184/466 (39%), Positives = 270/466 (57%), Gaps = 20/466 (4%)

Query: 4   LFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQIIK 63
           L+++I+I  +++  P++YTPTVG  C ++SHI  +      P G ++S+ND   + +II+
Sbjct: 79  LYFKILIDYIDDYMPVVYTPTVGEVCQKFSHIYRY------PRGAFISINDKGRVREIIE 132

Query: 64  TYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPIT 123
                P ++     + V+TDG RILGLGDLG+NGMGIP GKL LY A AGI P +TLP+T
Sbjct: 133 NC---PNEEV---DVIVVTDGQRILGLGDLGINGMGIPCGKLSLYTACAGIAPEKTLPVT 186

Query: 124 LDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSEHAF 183
           +D+GTNN + L D  YLGLR +RV  + +   ++  +    + +P +LIQFEDF + HAF
Sbjct: 187 IDVGTNNPEYLNDPMYLGLRQERVTGEAYDELIEEFVTEARRRWPNVLIQFEDFGNNHAF 246

Query: 184 DLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXXXXK 243
           DLL +Y++   CFNDDIQGT AV ++G  +A+++ ++ +     R LF           +
Sbjct: 247 DLLERYKDKVLCFNDDIQGTAAVAVTGVYSALRVTKQKL--ADQRFLFLGAGEAATGIAE 304

Query: 244 QLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKTLEE 303
            L++   V  G+  EEA +  +L D+KGLVT +RGD LA +KV FA D  +    KT  E
Sbjct: 305 LLVDAM-VAEGVEREEALKHCFLFDSKGLVTCNRGDKLAHNKVPFAHDVEN---CKTFIE 360

Query: 304 VIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKGTDN 363
            +  ++PT +IG+++  G FN +++  MAE+N+ PI+F LSNP   AEC    A + T+ 
Sbjct: 361 AVRALRPTGIIGVAAQPGAFNAEVLGAMAEINERPIVFALSNPTSRAECDAATAYRETNG 420

Query: 364 RVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXXXXX 423
           R +FASG+ F    V   GKT  P QGNN Y+FPGLGLGA+ A+ K +            
Sbjct: 421 RALFASGSPFA--PVDFNGKTFVPRQGNNSYVFPGLGLGAVFARAKTMPVGMFLAASREL 478

Query: 424 XXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQ 469
                         YP +S +R VS              GLA +++
Sbjct: 479 AELVSEADLEQGSLYPPLSTVREVSVKIGAAVAQYAYDNGLAGNER 524



>gi|325190506|emb|CCA25004.1| NADdependent malic enzyme putative [Albugo laibachii Nc14]
          Length = 1366

 Score =  344 bits (882), Expect = 4e-92,   Method: Compositional matrix adjust.
 Identities = 193/503 (38%), Positives = 281/503 (55%), Gaps = 35/503 (6%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +LF+R++I  +EE+ PL+YTPTVG  C ++   S F        G+Y S+ D      
Sbjct: 163 NEALFFRLLIDHIEELAPLVYTPTVGQVCQKFG--SMFRRT----RGMYFSIEDRGQFGA 216

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++  +   P  D    Q+ V+TDGSRILGLGDLGVNGMGIP+GKL LY AA GIDPR+ L
Sbjct: 217 MLHNW---PCGDV---QVIVVTDGSRILGLGDLGVNGMGIPIGKLALYTAAGGIDPRKVL 270

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ LD GTNNE  LKD +Y G++ KR+  + ++SF+D  M ++   +P+ L+QFEDFSS+
Sbjct: 271 PVMLDTGTNNESFLKDPYYFGMQHKRITGEDYWSFLDEFMTAVRYRWPQALVQFEDFSSD 330

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           HA  +L+ YR    CFNDDIQGTGA VL+G ++A   V  D+     R++          
Sbjct: 331 HAASVLNAYRLKQLCFNDDIQGTGATVLAGALSACARV--DIPLKDQRIVILGAGSAGLG 388

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
               LL+   +  G+  + A++  ++VD  GL+   R   LA  + YFAR     +Q   
Sbjct: 389 VATTLLQGM-LREGLDADTARKRFYIVDKDGLIGNSRS-TLASGQKYFAR-AGLPDQISL 445

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L EV+++VKPT L+GLS+  G F ++++  MA+  +NPIIFPLSNP   AECT + A + 
Sbjct: 446 L-EVVKHVKPTMLLGLSAAKGAFTQEVVREMAQHTRNPIIFPLSNPTSVAECTAKQAYEW 504

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           TD R +FASG+ F    V   GKT    Q NNM+IFPG+GL +++++   ++D+ +Y   
Sbjct: 505 TDGRCLFASGSPFD--PVEYNGKTYAVSQCNNMFIFPGVGLASVISQSSRVSDRMLYSAA 562

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            +P V  IR VS                     +++   +D   
Sbjct: 563 RALANCMTPDEIQRGQVFPSVRNIRQVSLKVAVA---------------VMQSAMDDEVA 607

Query: 481 LKTRKGKEWDNLVKFVQENMWDP 503
           L   K +   +L +F+   M+ P
Sbjct: 608 LNCPKMRRGASLEEFIASKMYTP 630



>gi|348676932|gb|EGZ16749.1| hypothetical protein PHYSODRAFT_314431 [Phytophthora sojae]
          Length = 514

 Score =  342 bits (878), Expect = 1e-91,   Method: Compositional matrix adjust.
 Identities = 190/450 (42%), Positives = 263/450 (58%), Gaps = 21/450 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  ++YR+++    E+ P++YTPTVG AC E+SHI         P GLY+S+ND+ ++ +
Sbjct: 23  NEDVYYRMLMENTVELLPIVYTPTVGQACQEFSHIYR-----QTPRGLYISINDIGHVAE 77

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+  +   P  D    +    TDG RILGLGD G NGMGIPVGKL LY A AG+ P+  L
Sbjct: 78  ILDNW---PEKDI---RAICFTDGERILGLGDQGANGMGIPVGKLSLYTACAGVPPQMCL 131

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPE-LLIQFEDFSS 179
           P+ LD GTNNE+ L D FY+GLR KR   ++F   VD  M +    Y + +L+QFEDF +
Sbjct: 132 PVVLDCGTNNEEYLADPFYIGLRQKRERGEKFEQLVDEFMNAANAKYGDKVLLQFEDFGN 191

Query: 180 EHAFDLLSKYRENTFC-FNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXX 238
             AF LL KY +NT C FNDDIQGT AVVL G + AV L  K +  ++ + +F       
Sbjct: 192 STAFHLLRKY-QNTHCTFNDDIQGTAAVVLGGLLAAVPLSGKPI--SEQKFVFLGAGTAG 248

Query: 239 XXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQF 298
                 +      E G + EE+++ +WLVD++GL+   R ++L  HK+ +A   +D  + 
Sbjct: 249 TGIADLIALAISRETGKTMEESRKQIWLVDSRGLIVESRKESLQPHKLPYA---HDAPEC 305

Query: 299 KTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAM 358
            +L E ++ +KPTALIGL +    FNE++  +M+E+N+ PIIF LSNP   AECT E+A 
Sbjct: 306 PSLVEALDRIKPTALIGLCTIAKAFNEEVCKKMSEINERPIIFALSNPTSKAECTAEEAY 365

Query: 359 KGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYI 418
             TD + IFASG+ F    +   GK   PGQGNN YIFPG+GLG + A    + D+ + I
Sbjct: 366 TFTDGKCIFASGSPFDPVEI--NGKLCVPGQGNNSYIFPGVGLGVVAAGLTHVNDEIMII 423

Query: 419 XXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                              YP +S IR VS
Sbjct: 424 AAKTLAGLTTPADLETGCVYPPLSSIREVS 453



>gi|294874440|ref|XP_002766957.1| malic enzyme, putative [Perkinsus marinus ATCC 50983]
 gi|239868332|gb|EEQ99674.1| malic enzyme, putative [Perkinsus marinus ATCC 50983]
          Length = 579

 Score =  342 bits (877), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 182/448 (40%), Positives = 260/448 (58%), Gaps = 19/448 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +L++++++  + E+ P++YTP VG AC  + HI           GLY +L++  N  +
Sbjct: 63  NETLYFKLLVDHVAEMMPIVYTPVVGKACQMFGHIFRN------ARGLYFNLSEKGNFKE 116

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++         +     I V+TDGSRILGLGDLG NGMGIP+GKL LYVA AGI P RT+
Sbjct: 117 MVWN------SNVRDADIIVVTDGSRILGLGDLGTNGMGIPIGKLSLYVACAGIHPGRTV 170

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+TLD+GTNN   L+D+ YLG R KR+D D++Y+ VD  + ++   +P +LIQFEDF+++
Sbjct: 171 PVTLDVGTNNPDLLEDDMYLGERRKRIDGDEYYAVVDEFVDAVRSRWPGVLIQFEDFTND 230

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           HAF LL +Y+EN  CFNDDIQGTG+V L+G ++A+++  + +     R++F         
Sbjct: 231 HAFPLLKRYQENILCFNDDIQGTGSVALAGLVSAMRVKREKLE--NQRIVFLGAGAAAVG 288

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
               ++    V  G++ E+A++  W VD+KGLVT  RG ++  HKV +  DD +    ++
Sbjct: 289 IADCIVAAM-VHDGLTPEDARKRFWFVDSKGLVTWKRGGSMQDHKVPYCHDDEE--PMES 345

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L EV++ +KPT L+GLS   G F E II  M      P+IF LSNP   AE T E     
Sbjct: 346 LLEVVKAIKPTVLLGLSGQPGSFTEDIIKAMYANCPQPVIFALSNPTPKAEATPEQLYTW 405

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           T+      +G+ F   T    GK    GQGNNMYIFPG+GL  I+ K K I D   Y   
Sbjct: 406 TEGNAWVCTGSPFGPVT--HNGKVYQAGQGNNMYIFPGVGLAGIVGKFKWIPDSMFYTAA 463

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                            YP ++RIR +S
Sbjct: 464 KTLAERVKEEDIARGTLYPCLTRIRELS 491



>gi|507924891|ref|XP_004673712.1| PREDICTED: NADP-dependent malic enzyme isoform X2 [Condylura
           cristata]
          Length = 497

 Score =  342 bits (876), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 188/450 (41%), Positives = 273/450 (60%), Gaps = 23/450 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFYR+++ ++E+  P++YTPTVG AC +YS     LA    P GL++S++D  ++  
Sbjct: 7   NEKLFYRVLMSDIEKFMPIVYTPTVGLACQQYS-----LAFRK-PRGLFISIHDRGHIAS 60

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++  +   P D     +  V+TDG RILGLGDLG NGMGIPVGKL LY A  G++P+  L
Sbjct: 61  VLNAW---PED---VIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECL 114

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYP-ELLIQFEDFSS 179
           P+TLD+GT NE+ LKD  Y+GLR +RV   ++ +F+D  M+++   Y    LIQFEDF++
Sbjct: 115 PVTLDVGTENEELLKDPLYIGLRQRRVRGPEYDAFLDEFMEAVSSKYGMNCLIQFEDFAN 174

Query: 180 EHAFDLLSKYRENTFC-FNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXX 238
            +AF LL+KY +N +C FNDDIQGT +V ++G + A+++ +  +     + + F      
Sbjct: 175 RNAFRLLNKY-QNQYCTFNDDIQGTASVAVAGVLAALRITKNKL---SDQTILFQGAGEA 230

Query: 239 XXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQF 298
                 LL    V+ G+S+E+A++ +WLVD+KGL+   R   L + K  FA +     + 
Sbjct: 231 ALGIANLLVMAMVKEGLSKEKARKNIWLVDSKGLIVKGRA-ALTEEKEEFAHEH---EEM 286

Query: 299 KTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAM 358
           K LE +++ +KPTALIG+++ GG F+E+I+  MA  N+ PIIF LSNP   AECT E   
Sbjct: 287 KNLETIVQKLKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECTAEQCY 346

Query: 359 KGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYI 418
           K T  R IFASG+ F   T+P  G+  YPGQGNN Y+FPG+ LG +    + ITDK    
Sbjct: 347 KLTKGRAIFASGSPFDPVTLP-NGQILYPGQGNNSYVFPGVALGVVACGLRHITDKIFLT 405

Query: 419 XXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                              YP +++IR VS
Sbjct: 406 TAEVIAQQVSDKHLEEGRLYPPLNKIRDVS 435



>gi|291232321|ref|XP_002736106.1| PREDICTED: cytosolic malic enzyme 1-like [Saccoglossus kowalevskii]
          Length = 562

 Score =  341 bits (875), Expect = 3e-91,   Method: Compositional matrix adjust.
 Identities = 192/466 (41%), Positives = 265/466 (56%), Gaps = 21/466 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFYR++   LEE+ P++YTPTVG AC  Y HI         P GL+++++D  ++ +
Sbjct: 81  NEKLFYRVINDHLEEMMPIVYTPTVGLACQRYGHIYRR------PRGLFITIHDRGHIAE 134

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I++ + P P    +     V+TDG RILGLGDLG +GMGIPVGKL LY A AG+DP  TL
Sbjct: 135 ILRNW-PEPNIKAI-----VVTDGERILGLGDLGAHGMGIPVGKLALYTACAGVDPSHTL 188

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYP-ELLIQFEDFSS 179
           P+ LD+GTNNEK L D  Y+GLR KR    ++   VD  MK+++K Y    LIQFEDF +
Sbjct: 189 PVCLDVGTNNEKLLNDPMYIGLRIKRFRSQEYDDLVDEFMKAVVKKYGYNCLIQFEDFGN 248

Query: 180 EHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXX 239
           ++AF  L KY+++   FNDDIQGT +V L+G   ++++  K +   K     F       
Sbjct: 249 QNAFRFLQKYKDDYCTFNDDIQGTASVALAGIYASLRMTGKKLSENK---FVFLGAGEAA 305

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK 299
                L+    +E G++EEEA + +WLVD  GLV +   + L K +  FA+     N   
Sbjct: 306 IGIASLIVMAMMEDGLTEEEAVKTIWLVDRTGLVVMVTSE-LNKQRSRFAQAH---NPIA 361

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
            L + I+ VKPTA+IG+S+  G F ++II  M+ +N +PIIF LSNP   AECT E A  
Sbjct: 362 NLADTIKTVKPTAIIGVSAAKGAFTDEIIKYMSTINDHPIIFALSNPTSMAECTAEQAYA 421

Query: 360 GTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIX 419
            +D+  +FASG+ F   T+P +GKT YP QGNN YIFPG+ LG + +  K + D    I 
Sbjct: 422 YSDSECMFASGSPFQPVTLP-SGKTLYPAQGNNSYIFPGVALGIVASGMKRVDDHAFLIA 480

Query: 420 XXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLA 465
                             YP +S I+ VS              GLA
Sbjct: 481 AKELADQVTDAHLSEGRLYPPLSTIKSVSLRIATKVVEYAYRKGLA 526



>gi|507924889|ref|XP_004673711.1| PREDICTED: NADP-dependent malic enzyme isoform X1 [Condylura
           cristata]
          Length = 572

 Score =  341 bits (874), Expect = 4e-91,   Method: Compositional matrix adjust.
 Identities = 188/450 (41%), Positives = 274/450 (60%), Gaps = 23/450 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFYR+++ ++E+  P++YTPTVG AC +YS     LA    P GL++S++D  ++  
Sbjct: 82  NEKLFYRVLMSDIEKFMPIVYTPTVGLACQQYS-----LAFRK-PRGLFISIHDRGHIAS 135

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++  +   P D     +  V+TDG RILGLGDLG NGMGIPVGKL LY A  G++P+  L
Sbjct: 136 VLNAW---PED---VIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECL 189

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYP-ELLIQFEDFSS 179
           P+TLD+GT NE+ LKD  Y+GLR +RV   ++ +F+D  M+++   Y    LIQFEDF++
Sbjct: 190 PVTLDVGTENEELLKDPLYIGLRQRRVRGPEYDAFLDEFMEAVSSKYGMNCLIQFEDFAN 249

Query: 180 EHAFDLLSKYRENTFC-FNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXX 238
            +AF LL+KY +N +C FNDDIQGT +V ++G + A+++ +  +     + + F      
Sbjct: 250 RNAFRLLNKY-QNQYCTFNDDIQGTASVAVAGVLAALRITKNKL---SDQTILFQGAGEA 305

Query: 239 XXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQF 298
                 LL    V+ G+S+E+A++ +WLVD+KGL+   R   L + K  FA   ++  + 
Sbjct: 306 ALGIANLLVMAMVKEGLSKEKARKNIWLVDSKGLIVKGRA-ALTEEKEEFA---HEHEEM 361

Query: 299 KTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAM 358
           K LE +++ +KPTALIG+++ GG F+E+I+  MA  N+ PIIF LSNP   AECT E   
Sbjct: 362 KNLETIVQKLKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECTAEQCY 421

Query: 359 KGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYI 418
           K T  R IFASG+ F   T+P  G+  YPGQGNN Y+FPG+ LG +    + ITDK    
Sbjct: 422 KLTKGRAIFASGSPFDPVTLP-NGQILYPGQGNNSYVFPGVALGVVACGLRHITDKIFLT 480

Query: 419 XXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                              YP +++IR VS
Sbjct: 481 TAEVIAQQVSDKHLEEGRLYPPLNKIRDVS 510



>gi|348578045|ref|XP_003474794.1| PREDICTED: NADP-dependent malic enzyme-like [Cavia porcellus]
          Length = 550

 Score =  340 bits (872), Expect = 6e-91,   Method: Compositional matrix adjust.
 Identities = 181/449 (40%), Positives = 266/449 (59%), Gaps = 21/449 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFYR+++ ++E+  P++YTPTVG AC +YS +         P GL++S++D  ++  
Sbjct: 60  NEKLFYRVLMSDVEKFMPIVYTPTVGLACQQYSLVFQ------KPRGLFISIHDRGHIAS 113

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++  +   P +     +  V+TDG RILGLGDLG NGMGIPVGKL LY A  G++P++ L
Sbjct: 114 VLNAW---PEN---VVKAVVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGVNPQQCL 167

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYP-ELLIQFEDFSS 179
           P+TLD+GT NE+ L D  Y+GLR +RV    + +F+D  M+++   Y    LIQFEDF++
Sbjct: 168 PVTLDVGTENEELLNDPLYIGLRQRRVRGQDYDAFLDEFMEAVSSKYGMNCLIQFEDFAN 227

Query: 180 EHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXX 239
            +AF LL+KYR     FNDDIQGT +V ++G + A+++ +  +     + + F       
Sbjct: 228 VNAFRLLNKYRNKYCTFNDDIQGTASVAVAGLLAALRITKNKL---SDQTILFQGAGEAA 284

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK 299
                L+     + G++ E+A R +WLVD+KGL+   R  +L + K  FA +  +    K
Sbjct: 285 LGIAHLIVMAMEKEGLTREKAIRKIWLVDSKGLIVKGRA-SLTQEKEKFAHEHEE---MK 340

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
           +LE +++ +KPTALIG+++ GG F E+I+  MA  N+ PIIF LSNP   AEC+ E   K
Sbjct: 341 SLEAIVQEIKPTALIGVAAVGGAFTEQILKDMAVFNERPIIFALSNPTSKAECSAEQCYK 400

Query: 360 GTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIX 419
            T  R IFASG+ F   T+P  G+T YPGQGNN Y+FPG+ LG +    + ITDK     
Sbjct: 401 ITQGRAIFASGSPFDPVTLP-NGRTLYPGQGNNSYVFPGVALGVVACGLRTITDKIFLTT 459

Query: 420 XXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                             YP ++ IR VS
Sbjct: 460 AEVISQQVSDEHLEEGRLYPPLTNIRDVS 488



>gi|493797922|ref|WP_006745900.1| malic protein NAD-binding [Thioalkalivibrio thiocyanoxidans]
 gi|349781686|gb|EGZ35969.1| malic protein NAD-binding [Thioalkalivibrio thiocyanoxidans ARh 4]
          Length = 557

 Score =  340 bits (872), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 192/503 (38%), Positives = 269/503 (53%), Gaps = 40/503 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +L++R+++   +E  P+IYTPTVG AC +Y HI  F +P     GLY+S  D   + +
Sbjct: 88  NEALYFRVIMEHPDETMPVIYTPTVGVACQQYGHI--FRSP----RGLYVSAQDRGRVAE 141

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           +++ +   PY D    +I VITDG RILGLGDLG +GMGIP GKL LY A AG+ PRR L
Sbjct: 142 VMRNW---PYRDV---RIIVITDGERILGLGDLGASGMGIPTGKLALYTACAGVHPRRCL 195

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ LD+GTNN   L+D  YLGLR +R+    +   +   + +  +V+P ++IQFEDF+S 
Sbjct: 196 PVMLDVGTNNASLLEDPLYLGLRQRRLTGAAYNDLMAEFIAAGQEVFPGVVIQFEDFASH 255

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           +AF LL  YRE   CFNDDIQGT AV L+G ++A+++  +   P   +   F        
Sbjct: 256 NAFRLLRAYRERICCFNDDIQGTAAVTLAGVLSALRVTAR---PLSEQTFLFLGAGEAAT 312

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
               LL    V  G+ E  A+   W+ D+KGLV  +RG NLA+HK  +A      + F  
Sbjct: 313 GIADLLVSAMVADGLDEAAARGRCWMFDSKGLVVRERG-NLAEHKRPYAHAHAPVSDFAA 371

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
               +E ++PTA+IG+ +    F  ++I  MA +N+ PI+F LSNP   AECT E A   
Sbjct: 372 ---AVEALRPTAIIGVGAVAQAFTREVITAMARINERPIVFALSNPTSKAECTAEQAYAW 428

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
           ++ R +FASG+ F    +   G+   P QGNN YIFPGLGLG I  +    TD       
Sbjct: 429 SEGRALFASGSPFDPVVL--DGQRFVPRQGNNSYIFPGLGLGLIAVQALRATDAMFMAAA 486

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIEV 480
                            +P +SR+R VS              GLA     I+  Q     
Sbjct: 487 RALADSVQPADLEQGSLFPALSRVRDVSVGIAAEVARVAFAEGLAG----IDRPQ----- 537

Query: 481 LKTRKGKEWDNLVKFVQENMWDP 503
                     +L  FV+E M++P
Sbjct: 538 ----------DLTAFVREQMYEP 550



>gi|145353063|ref|XP_001420849.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|144581084|gb|ABO99142.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 565

 Score =  340 bits (871), Expect = 8e-91,   Method: Compositional matrix adjust.
 Identities = 180/450 (40%), Positives = 259/450 (57%), Gaps = 17/450 (3%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +LFYR+V   +EE+ P+IYTPTVG ACLEYS +           G+Y S  D  +   
Sbjct: 75  NETLFYRLVHDHIEELAPVIYTPTVGDACLEYSKLLRR------ARGMYFSREDRGDFNS 128

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++  ++           + V+TDGSRILGLGDLG+NGMGI  GKL LYVA  G DP+  L
Sbjct: 129 MMFNWK-------RNVSVIVVTDGSRILGLGDLGMNGMGISQGKLDLYVAGGGFDPQHVL 181

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ LD+GTNN   L D +YLG   KR++ +++Y+FV+  ++ +   +P  LIQFEDF ++
Sbjct: 182 PVVLDVGTNNPDLLNDPYYLGSPHKRLEGEEYYAFVEEFIRGVRNRWPNALIQFEDFQTK 241

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           HA  +L  YR+   CFNDDIQGT AVVL+G   A+K +         +            
Sbjct: 242 HANKILQHYRDEVLCFNDDIQGTAAVVLAGVYGAMKCLHGHRKDIVKQTFVMCGAGSAGC 301

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRG-DNLAKHKVY-FARDDNDGNQF 298
                L    V +G++ EEA +  +++D  GLVT +R  D+  +  +  FAR+ ND  + 
Sbjct: 302 GIASFLHQAMVANGLTAEEAYKRFYIIDANGLVTAERALDDPGQEPLKGFARNRNDMPEG 361

Query: 299 KTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAM 358
            +L +VI+  KPT L+G+S+  G+F+++++  M ++N+ PII PLSNP   AECT EDA 
Sbjct: 362 ASLMDVIKKAKPTVLLGVSTVKGLFSKEVLEEMGKINERPIIMPLSNPTSRAECTAEDAA 421

Query: 359 KGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYI 418
             TD R IF+SG+ F +  +   G+     QGNN Y+FPGLGLGA+L+K  VI+D  +  
Sbjct: 422 NATDGRAIFSSGSPFSDVEI--NGRVMKANQGNNFYVFPGLGLGALLSKSSVISDAMLQA 479

Query: 419 XXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                              +P + RIR +S
Sbjct: 480 AAMAIPAMLTPEQYTEGTIFPRIDRIRDIS 509



>gi|498953102|ref|XP_004523448.1| PREDICTED: NADP-dependent malic enzyme-like isoform X3 [Ceratitis
           capitata]
          Length = 811

 Score =  340 bits (871), Expect = 9e-91,   Method: Compositional matrix adjust.
 Identities = 190/484 (39%), Positives = 279/484 (57%), Gaps = 26/484 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFY+++  ++  + PL+YTPTVG AC ++S I         P GLY+++ D  ++  
Sbjct: 329 NERLFYKVLASDISNMMPLVYTPTVGLACQKFSLIFQN------PKGLYITIRDKGHVYD 382

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++K +   P  D    +  V+TDG RILGLGDLG NGMGIPVGKL LY A AG+ P + L
Sbjct: 383 VLKNW---PETDI---RAIVVTDGERILGLGDLGANGMGIPVGKLSLYTALAGVKPHQCL 436

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPE-LLIQFEDFSS 179
           PITLD+GTN +  L D  Y+GLR KR+   ++ +F+D  M+++++ +    LIQFEDF +
Sbjct: 437 PITLDVGTNTQSILDDPLYIGLRHKRITGQEYDAFIDEFMQAVVRRFGRNCLIQFEDFGN 496

Query: 180 EHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXX 239
            +AF LL KYR+N   FNDDIQGT +V ++G + +++L E  +   ++++LFF       
Sbjct: 497 SNAFRLLDKYRDNYCTFNDDIQGTASVAVAGILASLRLTETTL--MENKILFFGAGEAAL 554

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDR-GDNLAKHKVYFARDDNDGNQF 298
                L +   +  G++++EA   +WLVD++GL+  +R    L++HK++FA         
Sbjct: 555 GIAN-LCKIAMIRLGLTDKEALDRIWLVDSRGLIVKNRPSGGLSEHKLHFAHQHEP---V 610

Query: 299 KTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAM 358
            TL + ++ VKPT LIG ++ GG F  +I+  MAELN+ P+IF LSNP   AECT E A 
Sbjct: 611 DTLLDAVKTVKPTMLIGAAAVGGAFTPEILQLMAELNERPVIFALSNPTSKAECTAEQAY 670

Query: 359 KGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYI 418
           + TD RVIF+SG+ F   T    GKT YPGQGNN YIFPG+GL  I A  K I ++   +
Sbjct: 671 QNTDGRVIFSSGSPFAPVTY--KGKTFYPGQGNNSYIFPGVGLAVIAAGIKTIPEEIFLM 728

Query: 419 XXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLA----RDKQIIEMV 474
                              YP + +I   S              GLA    + + I E +
Sbjct: 729 AAQELSLMSQEEDLAKGSLYPPLEKITECSIGIAVAIVKYAYDEGLATVFPKPENICEFI 788

Query: 475 QNDI 478
           ++ +
Sbjct: 789 KSQM 792



>gi|498953096|ref|XP_004523447.1| PREDICTED: NADP-dependent malic enzyme-like isoform X2 [Ceratitis
           capitata]
          Length = 869

 Score =  339 bits (870), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 190/484 (39%), Positives = 279/484 (57%), Gaps = 26/484 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFY+++  ++  + PL+YTPTVG AC ++S I         P GLY+++ D  ++  
Sbjct: 387 NERLFYKVLASDISNMMPLVYTPTVGLACQKFSLIFQN------PKGLYITIRDKGHVYD 440

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++K +   P  D    +  V+TDG RILGLGDLG NGMGIPVGKL LY A AG+ P + L
Sbjct: 441 VLKNW---PETDI---RAIVVTDGERILGLGDLGANGMGIPVGKLSLYTALAGVKPHQCL 494

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPE-LLIQFEDFSS 179
           PITLD+GTN +  L D  Y+GLR KR+   ++ +F+D  M+++++ +    LIQFEDF +
Sbjct: 495 PITLDVGTNTQSILDDPLYIGLRHKRITGQEYDAFIDEFMQAVVRRFGRNCLIQFEDFGN 554

Query: 180 EHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXX 239
            +AF LL KYR+N   FNDDIQGT +V ++G + +++L E  +   ++++LFF       
Sbjct: 555 SNAFRLLDKYRDNYCTFNDDIQGTASVAVAGILASLRLTETTL--MENKILFFGAGEAAL 612

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDR-GDNLAKHKVYFARDDNDGNQF 298
                L +   +  G++++EA   +WLVD++GL+  +R    L++HK++FA         
Sbjct: 613 GIAN-LCKIAMIRLGLTDKEALDRIWLVDSRGLIVKNRPSGGLSEHKLHFAHQHEP---V 668

Query: 299 KTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAM 358
            TL + ++ VKPT LIG ++ GG F  +I+  MAELN+ P+IF LSNP   AECT E A 
Sbjct: 669 DTLLDAVKTVKPTMLIGAAAVGGAFTPEILQLMAELNERPVIFALSNPTSKAECTAEQAY 728

Query: 359 KGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYI 418
           + TD RVIF+SG+ F   T    GKT YPGQGNN YIFPG+GL  I A  K I ++   +
Sbjct: 729 QNTDGRVIFSSGSPFAPVTY--KGKTFYPGQGNNSYIFPGVGLAVIAAGIKTIPEEIFLM 786

Query: 419 XXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLA----RDKQIIEMV 474
                              YP + +I   S              GLA    + + I E +
Sbjct: 787 AAQELSLMSQEEDLAKGSLYPPLEKITECSIGIAVAIVKYAYDEGLATVFPKPENICEFI 846

Query: 475 QNDI 478
           ++ +
Sbjct: 847 KSQM 850



>gi|498953090|ref|XP_004523446.1| PREDICTED: NADP-dependent malic enzyme-like isoform X1 [Ceratitis
           capitata]
          Length = 873

 Score =  339 bits (870), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 190/484 (39%), Positives = 279/484 (57%), Gaps = 26/484 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFY+++  ++  + PL+YTPTVG AC ++S I         P GLY+++ D  ++  
Sbjct: 391 NERLFYKVLASDISNMMPLVYTPTVGLACQKFSLIFQN------PKGLYITIRDKGHVYD 444

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++K +   P  D    +  V+TDG RILGLGDLG NGMGIPVGKL LY A AG+ P + L
Sbjct: 445 VLKNW---PETDI---RAIVVTDGERILGLGDLGANGMGIPVGKLSLYTALAGVKPHQCL 498

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPE-LLIQFEDFSS 179
           PITLD+GTN +  L D  Y+GLR KR+   ++ +F+D  M+++++ +    LIQFEDF +
Sbjct: 499 PITLDVGTNTQSILDDPLYIGLRHKRITGQEYDAFIDEFMQAVVRRFGRNCLIQFEDFGN 558

Query: 180 EHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXX 239
            +AF LL KYR+N   FNDDIQGT +V ++G + +++L E  +   ++++LFF       
Sbjct: 559 SNAFRLLDKYRDNYCTFNDDIQGTASVAVAGILASLRLTETTL--MENKILFFGAGEAAL 616

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDR-GDNLAKHKVYFARDDNDGNQF 298
                L +   +  G++++EA   +WLVD++GL+  +R    L++HK++FA         
Sbjct: 617 GIAN-LCKIAMIRLGLTDKEALDRIWLVDSRGLIVKNRPSGGLSEHKLHFAHQHEP---V 672

Query: 299 KTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAM 358
            TL + ++ VKPT LIG ++ GG F  +I+  MAELN+ P+IF LSNP   AECT E A 
Sbjct: 673 DTLLDAVKTVKPTMLIGAAAVGGAFTPEILQLMAELNERPVIFALSNPTSKAECTAEQAY 732

Query: 359 KGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYI 418
           + TD RVIF+SG+ F   T    GKT YPGQGNN YIFPG+GL  I A  K I ++   +
Sbjct: 733 QNTDGRVIFSSGSPFAPVTY--KGKTFYPGQGNNSYIFPGVGLAVIAAGIKTIPEEIFLM 790

Query: 419 XXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLA----RDKQIIEMV 474
                              YP + +I   S              GLA    + + I E +
Sbjct: 791 AAQELSLMSQEEDLAKGSLYPPLEKITECSIGIAVAIVKYAYDEGLATVFPKPENICEFI 850

Query: 475 QNDI 478
           ++ +
Sbjct: 851 KSQM 854



>gi|219112277|ref|XP_002177890.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217410775|gb|EEC50704.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 638

 Score =  339 bits (870), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 185/486 (38%), Positives = 273/486 (56%), Gaps = 20/486 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +L++R+++  +EE+ P IYTPTVG AC+E      F      P G+Y +  D  ++  
Sbjct: 155 NETLYHRVLVDHIEEMAPYIYTPTVGQACME------FATRYRRPRGMYFTEEDRGHMAA 208

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++  +   P+ D     +  +TDGSRILGLGDLG NGMGIP+GKL LY AA GI P R L
Sbjct: 209 MVYNW---PHRDV---HVICVTDGSRILGLGDLGANGMGIPIGKLALYCAAGGIAPHRVL 262

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+  D GTNNE  L+D++YLG++ KR+    ++  +D  M ++   +P +L+QFEDFSSE
Sbjct: 263 PVVFDAGTNNEALLQDKYYLGVQRKRLKGAAYFRMMDEFMDAVRFRWPNVLVQFEDFSSE 322

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            A  LL +YR++  CFNDDIQGTGA  L+G + A++   ++V     + +          
Sbjct: 323 VAQTLLDRYRDDHLCFNDDIQGTGATTLAGVLGALRAKGEEVTSLGDQRIVIAGAGSAGI 382

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNL-AKHKVYFARDDNDGNQFK 299
              Q+L     E G + EEAK   +++D  GL+  DR ++L A+ +V+    DN+     
Sbjct: 383 GIAQVLMQAMEEQGRTPEEAKNAFYILDQNGLLGTDRANDLNAEQRVFVRSADNN----L 438

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
           +L +V++  KPT L+G+++ GG+F   +I  M    + PIIFPLSNP   AECT E A +
Sbjct: 439 SLMDVVKKYKPTILLGVTTVGGLFTGDLIREMHSSCERPIIFPLSNPTNKAECTAEQAYE 498

Query: 360 GTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIX 419
            T+ + IFASG+ F      E G+  YP Q NNMY+FPGLGLGA +   + +TD+ +Y+ 
Sbjct: 499 WTNGQCIFASGSPFDTIEF-EDGRVFYPSQCNNMYVFPGLGLGASVCGAQKVTDRMLYVA 557

Query: 420 XXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIE 479
                             +P ++RIR VS              GLA   ++     ND++
Sbjct: 558 AETLANFVSKKDMEEGRLFPQLTRIREVSHRIAVAVVEEALREGLA--TKVKPADANDLD 615

Query: 480 VLKTRK 485
               RK
Sbjct: 616 SFVGRK 621



>gi|391330340|ref|XP_003739621.1| PREDICTED: NADP-dependent malic enzyme-like [Metaseiulus
           occidentalis]
          Length = 571

 Score =  339 bits (869), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 186/450 (41%), Positives = 267/450 (59%), Gaps = 23/450 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LF+R++    E + PL+YTPTVG ACL+YS I         P GL++S+ D   +++
Sbjct: 96  NEKLFFRVMKDHTEMLMPLVYTPTVGDACLKYSLIFRR------PKGLFISIKDKGKVSE 149

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++  +   P  +    +  V+TDG RILGLGDLG NGMGIPVGKL LY A  GI P +TL
Sbjct: 150 VLANW---PEKEV---ESIVVTDGERILGLGDLGANGMGIPVGKLALYTALGGIPPEKTL 203

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPE-LLIQFEDFSS 179
           PITLD+GTNNE NL D  Y+GL+ KRV    +  FV+  M++ +K + +  LIQFEDF +
Sbjct: 204 PITLDVGTNNESNLNDPLYIGLKEKRVRGKLYEEFVEEFMQAAVKRFGKTCLIQFEDFGN 263

Query: 180 EHAFDLLSKYRENTFC-FNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXX 238
            +AF LL+KY+ N++C FNDDIQGT AV ++G I ++++  + +     +++ F      
Sbjct: 264 ANAFSLLAKYK-NSYCTFNDDIQGTAAVAVAGLIASLRITGRSLQ---DQVVLFQGAGEA 319

Query: 239 XXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQF 298
                 LL    V+ G++++EA   +W++D++GL+  +R D +  HK+ ++++       
Sbjct: 320 ALGIADLLCQAMVKEGITDKEAASKIWMLDSRGLLCFERPDEMNDHKLKYSKES---PLT 376

Query: 299 KTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAM 358
           K L E+++ VKPT LIG S+    FN +I+  M E +  P+IF LSNP + AECT EDA 
Sbjct: 377 KDLHELVKRVKPTILIGASAQTNAFNAQILQNMLEFSSRPVIFALSNPTIKAECTAEDAF 436

Query: 359 KGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYI 418
             T  + +FASG+ FP  T    GKT YPGQGNN YIFPG+ L A   K   I D+   I
Sbjct: 437 VHTKGKCVFASGSPFPPVTY--EGKTYYPGQGNNAYIFPGIALAANACKATRIDDEVFLI 494

Query: 419 XXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                              YP +S+I+ VS
Sbjct: 495 TAKTVAEMVSQADLDEGRVYPPLSKIQDVS 524



>gi|395857964|ref|XP_003801349.1| PREDICTED: NADP-dependent malic enzyme [Otolemur garnettii]
          Length = 572

 Score =  338 bits (868), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 185/449 (41%), Positives = 265/449 (59%), Gaps = 21/449 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFYR+++ ++E+  P++YTPTVG AC  YS +         P GL++S++D  ++  
Sbjct: 82  NEKLFYRVLLSDIEKFMPIVYTPTVGLACQLYSFVF------RKPRGLFISIHDRGHVAS 135

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+  +   P +     +  V+TDG RILGLGDLG NGMGIPVGKL LY A  G+ P+  L
Sbjct: 136 ILDAW---PEE---VIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGVSPQECL 189

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYP-ELLIQFEDFSS 179
           P+ LD+GT NE+ LKD FY+GLR +RV   ++  FVD  M+++   Y    LIQFEDF++
Sbjct: 190 PVILDVGTENEELLKDPFYIGLRQRRVRGAEYDEFVDEFMEAVSSKYGMNCLIQFEDFAN 249

Query: 180 EHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXX 239
            +AF LL+KYR+    FNDDIQGT +V ++G + A+++ +  +     + + F       
Sbjct: 250 MNAFRLLNKYRDQYCTFNDDIQGTASVAVAGLLAALRITKNKL---SDQTILFQGAGEAA 306

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK 299
                L+     E G+ +E+A   +WLVD+KGL+   R  +L   K  FA   ++  + K
Sbjct: 307 LGIAHLIVMAMEEEGLPKEKAIEKIWLVDSKGLIVKHRA-SLTPEKEVFA---HEHKEMK 362

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
            LE V++ +KPTALIG+++ GG F+E+I+  MA  N+ PIIF LSNP   AEC+ E   K
Sbjct: 363 NLEAVVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYK 422

Query: 360 GTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIX 419
            T  R IFASG+ F   T+P+ G+T YPGQGNN Y+FPG+ LG +    + ITDK     
Sbjct: 423 VTQGRAIFASGSPFDPVTLPD-GRTLYPGQGNNSYVFPGVALGVVACGLRHITDKIFLTT 481

Query: 420 XXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                             YP ++ IR VS
Sbjct: 482 AEVIAQQVLDKHLEEGRLYPPLNTIRDVS 510



>gi|428175693|gb|EKX44581.1| hypothetical protein GUITHDRAFT_152903 [Guillardia theta CCMP2712]
          Length = 602

 Score =  338 bits (867), Expect = 2e-90,   Method: Compositional matrix adjust.
 Identities = 173/415 (41%), Positives = 259/415 (62%), Gaps = 20/415 (4%)

Query: 4   LFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQIIK 63
           L++ ++   L+E  PL+YTPTVG AC+++  I         P G+YLS++D+ ++ + + 
Sbjct: 134 LYFGVLGRNLKECMPLVYTPTVGQACIQWHQIYRH-----TPRGIYLSIDDIGHVEEALS 188

Query: 64  TYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPIT 123
            +   P  D    ++ V+TDG RILGLGDLGVNGMGIPVGKL LY A  GIDP+  LP+ 
Sbjct: 189 NW---PQQDV---KVIVVTDGERILGLGDLGVNGMGIPVGKLALYTACGGIDPKVCLPVH 242

Query: 124 LDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPE-LLIQFEDFSSEHA 182
           +D+GTNN        Y+GLRS RV  +++Y  +   ++S+ K +    LIQFEDF + +A
Sbjct: 243 IDVGTNNIPLRSHPAYMGLRSDRVRGEKYYDLLQEFIRSVQKRFGRTTLIQFEDFGNTNA 302

Query: 183 FDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXXXX 242
           FD+L+++R+   CFNDDIQGT AV L+G I++ KL   ++  ++H +LF+          
Sbjct: 303 FDILNRFRDQATCFNDDIQGTAAVALAGLISSEKLT--NIPLSRHTILFYGAGEAGTGIA 360

Query: 243 KQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKTLE 302
             + +    E G    EA++ +W++D+KGL+T  R +NLA HK+ +A +    ++  TLE
Sbjct: 361 DLIAKAISKELGSPVSEARKKIWMMDSKGLITSKR-ENLAHHKLAYAHE--SASECTTLE 417

Query: 303 EVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKGTD 362
           + +E +KP+ LIG+S+  G F + ++ +M+ +N+ P+IF LSNP   AECT EDA   T 
Sbjct: 418 DCVEQIKPSVLIGVSAVPGSFTKSVVEKMSAMNEKPVIFALSNPTSKAECTSEDAYTWTS 477

Query: 363 NRVIFASGTAFPEYTV---PETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDK 414
            R IFASG+  P  T+       +T  PGQGNN YIFPGLGLG + A+   + D+
Sbjct: 478 GRCIFASGSPMPSVTLTLPSGESRTLEPGQGNNAYIFPGLGLGIMAAEATAVDDE 532



>gi|507553465|ref|XP_004660523.1| PREDICTED: NADP-dependent malic enzyme [Jaculus jaculus]
          Length = 497

 Score =  338 bits (866), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 186/449 (41%), Positives = 265/449 (59%), Gaps = 21/449 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFY +++ ++E   P++YTPTVG AC +YS     LA    P GL++S+ D  ++  
Sbjct: 7   NEKLFYSVLMSDIERFMPIVYTPTVGLACQQYS-----LAFRK-PRGLFISIYDRGHIAS 60

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+  +   P D     +  V+TDG RILGLGDLG NGMGIPVGKL LY A  G++P++ L
Sbjct: 61  ILNAW---PED---VVKAVVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGVNPQQCL 114

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYP-ELLIQFEDFSS 179
           P+ LD+GT NE+ LKD  Y+GLR +RV   ++ SFVD  M+++   Y    LIQFEDF++
Sbjct: 115 PVILDVGTENEELLKDPLYIGLRQRRVRGAEYDSFVDEFMEAVSSKYGMNCLIQFEDFAN 174

Query: 180 EHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXX 239
            +AF LLSKYR     FNDDIQGT +V ++G + A+++ +  +     + + F       
Sbjct: 175 MNAFRLLSKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKL---SDQTILFQGAGEAA 231

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK 299
                L+     + G+ +E+A + +WLVD+KGL+   RG +L + K  FA +  +    K
Sbjct: 232 LGIAHLIVMAMEKEGLPKEKAIKKIWLVDSKGLIVKGRG-SLTQEKQEFAHEHEE---MK 287

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
            LE +++ +KPTALIG+++ GG F E+I+  MA  N+ PIIF LSNP   AEC+ E   K
Sbjct: 288 NLEAIVQKIKPTALIGVAAIGGAFTEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYK 347

Query: 360 GTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIX 419
            T  + IFASG+ F   T+P  GKT +PGQGNN Y+FPG+ LG +    + ITDK     
Sbjct: 348 ITKGQAIFASGSPFDPVTLP-NGKTLFPGQGNNSYVFPGVALGVVACGLRHITDKIFLTT 406

Query: 420 XXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                             YP ++ IR VS
Sbjct: 407 AEVISQQVSDKHLEEGRLYPPLNTIRDVS 435



>gi|482556049|gb|EOA20241.1| hypothetical protein CARUB_v10000542mg [Capsella rubella]
          Length = 588

 Score =  338 bits (866), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 193/481 (40%), Positives = 266/481 (55%), Gaps = 24/481 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFY+++I  +EE+ P++YTPTVG AC +Y  I         P GLY+SL +   + +
Sbjct: 116 NERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIYRR------PQGLYISLKEKGKILE 169

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++K +   P       Q+ V+TDG RILGLGDLG  GMGIPVGKL LY A  GI P   L
Sbjct: 170 VLKNW---PQRGI---QVIVVTDGERILGLGDLGCQGMGIPVGKLSLYTALGGIRPSACL 223

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPE-LLIQFEDFSS 179
           PIT+D+GTNNEK L DEFY+GL+ KR +  ++  F+   M ++ + Y E +L+QFEDF++
Sbjct: 224 PITIDVGTNNEKLLNDEFYIGLKQKRANGQEYAEFLHEFMCAVKQNYGEKVLVQFEDFAN 283

Query: 180 EHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXX 239
            HAF+LLSKY  +   FNDDIQGT +VVL+G I A K++ K +    H  LF        
Sbjct: 284 HHAFELLSKYCSSHLVFNDDIQGTASVVLAGLIAAQKVLGKSL--ADHTFLFLGAGEAGT 341

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK 299
              + +      E G   +E ++ +WLVD+KGL+   R ++L   K  +A +       K
Sbjct: 342 GIAELIALKISKETGAPIDETRKKIWLVDSKGLIVSSRKESLQHFKQPWAHEHEP---VK 398

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
            L   +  +KPT LIG S  G  F ++++  MA LN+ P+I  LSNP   AECT E+A K
Sbjct: 399 ELLGAVNAIKPTVLIGTSGVGKTFTKEVVEAMATLNEKPLILALSNPTSQAECTAEEAYK 458

Query: 360 GTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIX 419
            T+ R IFASG+ F    V   GKT  PGQ NN YIFPGLGLG I++    + D  +   
Sbjct: 459 WTEGRAIFASGSPFD--PVEYNGKTFTPGQANNCYIFPGLGLGLIMSGAIRVRDDMLLAA 516

Query: 420 XXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLA----RDKQIIEMVQ 475
                             YP  + IR +S              GLA    R K +++M +
Sbjct: 517 SEALASQVTEENFANGLIYPPFANIRKISANIAASVGAKTYELGLASNLPRPKNLVKMAE 576

Query: 476 N 476
           +
Sbjct: 577 S 577



>gi|495818567|ref|WP_008543146.1| malic enzyme, NAD binding domain protein [Sutterella parvirubra]
 gi|378597382|gb|EHY30681.1| malic enzyme, NAD binding domain protein [Sutterella parvirubra YIT
           11816]
          Length = 540

 Score =  337 bits (864), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 182/467 (38%), Positives = 267/467 (57%), Gaps = 21/467 (4%)

Query: 3   SLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQII 62
           +LF++++I   +   P++YTPTVG  C ++SHI  F      P GL++S  D   + +++
Sbjct: 79  NLFFKLLIEHTDRFMPIVYTPTVGEVCQKFSHIYRF------PRGLFVSYEDRGRVEELV 132

Query: 63  KTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPI 122
                 P ++     + V+TDG RILGLGDLG+NGMGIP+GKL LY A AGIDP RTLP+
Sbjct: 133 ANC---PQEEV---DVIVVTDGQRILGLGDLGMNGMGIPMGKLSLYTACAGIDPARTLPV 186

Query: 123 TLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSEHA 182
           T+D+GTN E  L D  YLGLR +RV  D++++ VD  +++  + +P++LIQFEDF + +A
Sbjct: 187 TIDVGTNTEAYLNDPLYLGLRRERVTGDEYFALVDEFIQAARRRWPKVLIQFEDFGNHNA 246

Query: 183 FDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXXXX 242
           F+LL +Y++   CFNDDIQGT AV L+G  +AV++ +K   P   +   F          
Sbjct: 247 FELLRRYQDKILCFNDDIQGTAAVALTGVYSAVRVTKK---PLAEQTFLFLGAGEAATGI 303

Query: 243 KQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKTLE 302
             L+    V+ GM   EA +   L D+KGLVT  R   LA++K  FA   ++  + +T  
Sbjct: 304 ANLIVDALVDEGMDRAEALKHCCLFDSKGLVTAAR-TGLAENKQPFA---HELPECRTFL 359

Query: 303 EVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKGTD 362
           E +  V+PT ++G+++    F+  ++  MA +N+ PIIF LSNP   AEC  E A + TD
Sbjct: 360 EAVRAVRPTGIVGVAAQPKAFDAAVLREMAAINERPIIFALSNPTSRAECDAETAYRETD 419

Query: 363 NRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXXXX 422
            R +FASG+ F    V   G+T  P QGNN Y+FPGLGLGA+ A+ + +           
Sbjct: 420 GRALFASGSPFA--PVELNGRTFVPRQGNNSYVFPGLGLGAVFAQAEWMPTGMFLAAART 477

Query: 423 XXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQ 469
                          YP +S +R VS              GLAR+++
Sbjct: 478 LAETVSEEDLERGSLYPSLSEVRDVSMKIGVAIAEYAYEHGLARNER 524



>gi|505829771|ref|XP_004610185.1| PREDICTED: NADP-dependent malic enzyme [Sorex araneus]
          Length = 514

 Score =  337 bits (863), Expect = 6e-90,   Method: Compositional matrix adjust.
 Identities = 187/449 (41%), Positives = 267/449 (59%), Gaps = 21/449 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFYR+++ ++E+  P++YTPTVG AC +YS     LA    P GL++S++D  ++  
Sbjct: 24  NEKLFYRVLMSDVEKFMPIVYTPTVGLACQQYS-----LAFRK-PRGLFISIHDQGHIAS 77

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+  +   P D+    +  V+TDG RILGLGDLG NGMGIPVGKL LY A  G++P+  L
Sbjct: 78  ILNAW---PEDNI---KAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECL 131

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYP-ELLIQFEDFSS 179
           PITLD+GT NE+ LKD  Y+GLR +RV   ++  F+D  M+++   Y    LIQFEDF++
Sbjct: 132 PITLDVGTENEELLKDPLYIGLRQRRVRGPEYDKFLDEFMEAVSSKYGMNCLIQFEDFAN 191

Query: 180 EHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXX 239
            +AF LL+KY+     FNDDIQGT +V ++G + A+++ +  +     + + F       
Sbjct: 192 RNAFRLLNKYQNQYCTFNDDIQGTASVAVAGILAALRITKNKL---SDQTILFQGAGEAA 248

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK 299
                LL     + G+S+E+A + +WLVD+KGL+   R  +L   K  FA +  +    K
Sbjct: 249 LGIAHLLVMAMEKEGLSKEKALKKIWLVDSKGLIVKGRA-SLTHEKEEFAHEHKE---MK 304

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
            LE+V++ +KPTALIG+++ GG F+E+I+  MA  N+ PIIF LSNP   AECT E    
Sbjct: 305 NLEDVVKELKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECTAEQCYT 364

Query: 360 GTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIX 419
            T  R IFASG+ F   T+P  G+T YPGQGNN Y+FPG+ LG +    + I DK     
Sbjct: 365 LTKGRAIFASGSPFDPVTLP-NGQTLYPGQGNNSYVFPGVALGVVACGLRHIPDKIFLTT 423

Query: 420 XXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                             YP ++ IR VS
Sbjct: 424 AEVIAQQVSDKHLQEGRLYPPLNTIRDVS 452



>gi|344264125|ref|XP_003404144.1| PREDICTED: NADP-dependent malic enzyme [Loxodonta africana]
          Length = 572

 Score =  337 bits (863), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 182/449 (40%), Positives = 267/449 (59%), Gaps = 21/449 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFYR++  ++E+  P++YTPTVG AC +YS +  F  P     GL++S++D  ++  
Sbjct: 82  NEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLV--FRKP----RGLFISIHDKGHIAS 135

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+  +   P D     +  V+TDG RILGLGDLG NGMGIPVGKL LY A  G++P+  L
Sbjct: 136 ILNAW---PED---VIKAVVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECL 189

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYP-ELLIQFEDFSS 179
           P+TLD+GT NE+ LKD  Y+GL+ +RV   ++  F+D  M+++   Y    LIQFEDF++
Sbjct: 190 PVTLDVGTENEELLKDPLYIGLQQRRVRGREYDDFLDEFMEAVSSKYGMNCLIQFEDFAN 249

Query: 180 EHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXX 239
            +AF LL+KYR     FNDDIQGT +V ++G + A+++ +  +     + + F       
Sbjct: 250 MNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKL---SDQTILFQGAGEAA 306

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK 299
                L+     + G+ +E+A + +WLVD+KGL+   R  +L K K  FA++  +    K
Sbjct: 307 LGIAHLIVMAMEKEGLPKEKAIKKIWLVDSKGLIVKGRA-SLTKEKEEFAQEHEE---MK 362

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
            LE +++ +KPTALIG+++ GG F E+I+  MA  N+ PIIF LSNP   AEC+ E   K
Sbjct: 363 NLEAIVQKIKPTALIGVAAIGGAFTEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYK 422

Query: 360 GTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIX 419
            T  R +FASG+ F   T+P  G+T YPGQGNN Y+FPG+ LG +    + IT+K   + 
Sbjct: 423 LTKGRAVFASGSPFDPVTLP-NGQTLYPGQGNNSYVFPGVALGVVACGLRHITEKIFLMT 481

Query: 420 XXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                             YP ++ IR VS
Sbjct: 482 AEVIAQQVSDKHLEEGRLYPPLNTIREVS 510



>gi|507619502|ref|XP_004696342.1| PREDICTED: NADP-dependent malic enzyme [Echinops telfairi]
          Length = 514

 Score =  337 bits (863), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 183/449 (40%), Positives = 266/449 (59%), Gaps = 21/449 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFY++++ ++E+  P++YTPTVG AC +YS     LA    P GL++S++D  ++  
Sbjct: 24  NEKLFYKVLMSDIEKFMPIVYTPTVGLACQQYS-----LAFRK-PRGLFISIHDKGHIRS 77

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+  +   P D     +  V+TDG RILGLGDLG NGMGIPVGKL LY A  G++P+  L
Sbjct: 78  ILNAW---PED---VIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECL 131

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYP-ELLIQFEDFSS 179
           PITLD+GT NE+ LKD  Y+GLR +RV   ++  F+D  M+++   Y    LIQFEDF++
Sbjct: 132 PITLDVGTENEELLKDPLYIGLRQRRVRGREYDDFLDEFMEAVSSKYGMNCLIQFEDFAN 191

Query: 180 EHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXX 239
            +AF LL KYR     FNDDIQGT +V ++G + A+++ +  +     + + F       
Sbjct: 192 MNAFRLLKKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKL---SDQTILFQGAGEAA 248

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK 299
                L+     + G+S E+A + +WLVD+KGL+   R  ++ + K  +A++     + K
Sbjct: 249 LGIAHLIVMAMEKEGLSREKATKKIWLVDSKGLIVKGRA-SITQEKEEYAQEH---EEMK 304

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
            LE +++ +KPTALIG+++ GG F E+I+  MA  N+ PIIF LSNP   AEC+ E   K
Sbjct: 305 NLEAIVQKLKPTALIGVAAIGGAFTEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYK 364

Query: 360 GTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIX 419
            T  R +FASG+ F   T+P  G+T YPGQGNN Y+FPG+ LG +    + ITDK     
Sbjct: 365 LTQGRAVFASGSPFDPVTLP-NGRTLYPGQGNNSYVFPGVALGVVACGLRHITDKIFLTT 423

Query: 420 XXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                             YP ++ IR VS
Sbjct: 424 AEVIAQQVSEKHLEEGRLYPPLNTIREVS 452



>gi|195108739|ref|XP_001998950.1| GI24244 [Drosophila mojavensis]
 gi|193915544|gb|EDW14411.1| GI24244 [Drosophila mojavensis]
          Length = 818

 Score =  336 bits (862), Expect = 8e-90,   Method: Compositional matrix adjust.
 Identities = 180/405 (44%), Positives = 251/405 (61%), Gaps = 22/405 (5%)

Query: 4   LFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQIIK 63
           LFY ++  ++  + PL+YTPTVG AC +YS    F+ P     GL++++ D  ++  ++K
Sbjct: 343 LFYNVISSDITHMMPLVYTPTVGLACQKYS--LGFIKP----KGLFITIKDKGHVYDVLK 396

Query: 64  TYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTLPIT 123
            +   P  D    +  V+TDG RILGLGDLGVNGMGIPVGKL LY A AGI P + LPIT
Sbjct: 397 NW---PETDV---RAIVVTDGERILGLGDLGVNGMGIPVGKLSLYTALAGIKPNQCLPIT 450

Query: 124 LDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPE-LLIQFEDFSSEHA 182
           LD+GTN E  L+D  Y+GLR KR   D +  F+D  M++ ++ + +  LIQFEDF++ +A
Sbjct: 451 LDVGTNTESILEDPLYVGLRQKRATGDLYNDFIDEFMRACVRRFGQNCLIQFEDFANANA 510

Query: 183 FDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXXXX 242
           F LLS YR+    FNDDIQGT +V + G + ++K+ +  +   K  +L F          
Sbjct: 511 FRLLSLYRDKYCTFNDDIQGTASVAVGGLLASLKIKKTKL---KDNVLLFLGAGEAALGI 567

Query: 243 KQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDR-GDNLAKHKVYFARDDNDGNQFKTL 301
            QL      + G++EEEAK  +W+VD++G++  DR    L +HK++FA+         TL
Sbjct: 568 AQLCVMAMKQEGLTEEEAKTRIWMVDSRGVIVRDRPKGGLTEHKLHFAQVSAP---IDTL 624

Query: 302 EEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKGT 361
            + +  V+P  LIG S+ GG FN++I+ +MAE+N+ PIIF LSNP   AECT E+A   T
Sbjct: 625 MDAVVRVRPNVLIGASAQGGAFNQEILEKMAEINETPIIFALSNPTSKAECTAEEAYTHT 684

Query: 362 DNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILA 406
             R IFASG+ FP  T    G   YPGQGNN YIFPG+ LG + A
Sbjct: 685 QGRCIFASGSPFPPVTY--NGHKYYPGQGNNSYIFPGVALGVLCA 727



>gi|478495574|ref|XP_004422129.1| PREDICTED: NADP-dependent malic enzyme isoform 2 [Ceratotherium
           simum simum]
          Length = 497

 Score =  336 bits (862), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 184/449 (40%), Positives = 266/449 (59%), Gaps = 21/449 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFYR+++ +LE+  P++YTPTVG AC +YS +  F  P     GL++S++D  ++  
Sbjct: 7   NEKLFYRVLMSDLEKFMPIVYTPTVGLACQQYSLV--FRKP----RGLFISIHDRGHIAS 60

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+  +   P D     +  V+TDG RILGLGDLG NGMGIPVGKL LY A  G++P+  L
Sbjct: 61  ILNAW---PED---VIKAVVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECL 114

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYP-ELLIQFEDFSS 179
           P+ LD+GT NE+ LKD  Y+GLR +RV   ++  F+D  M+++   Y    LIQFEDF++
Sbjct: 115 PVILDVGTENEELLKDPLYIGLRQRRVRGAEYDEFLDEFMEAVSSKYGMNCLIQFEDFAN 174

Query: 180 EHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXX 239
            +AF LL+KY+     FNDDIQGT +V ++G + A+++ +  +     + + F       
Sbjct: 175 VNAFRLLNKYQNQYCTFNDDIQGTASVAVAGILAALRITKNTL---SDQTILFQGAGEAA 231

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK 299
                L+     + G+ +E+A + +WLVD+KGL+   R   L + K  FA +     + K
Sbjct: 232 LGIAHLIVMAMEKEGLPKEKAIKKIWLVDSKGLIVKGRA-ALTQEKEEFAHEH---EEMK 287

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
            LE +++ +KPTALIG+++ GG F+E+I+  MA  N+ PIIF LSNP   AECT E   K
Sbjct: 288 NLEAIVQNIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECTAEQCYK 347

Query: 360 GTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIX 419
            T  R IFASG+ F   T+P+ G+T YPGQGNN Y+FPG+ LG +    + ITDK     
Sbjct: 348 LTKGRAIFASGSPFDPVTLPD-GQTLYPGQGNNSYVFPGVALGVVACGLRHITDKIFLTT 406

Query: 420 XXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                             YP ++ IR VS
Sbjct: 407 AKVIAQQVSDEHLEEGRLYPPLNTIRDVS 435



>gi|15029730|gb|AAH11081.1| Me1 protein [Mus musculus]
 gi|51873855|gb|AAH80660.1| Me1 protein [Mus musculus]
 gi|62825876|gb|AAH94028.1| Me1 protein [Mus musculus]
          Length = 572

 Score =  336 bits (862), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 183/449 (40%), Positives = 268/449 (59%), Gaps = 21/449 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFY +++ ++E+  P++YTPTVG AC +YS     LA    P GL++S++D  ++  
Sbjct: 82  NEKLFYSVLMSDVEKFMPIVYTPTVGLACQQYS-----LAFRK-PRGLFISIHDKGHIAS 135

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++  +   P D     +  V+TDG RILGLGDLG NGMGIPVGKL LY A  G++P++ L
Sbjct: 136 VLNAW---PED---VVKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGVNPQQCL 189

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYP-ELLIQFEDFSS 179
           PITLD+GT NE+ LKD  Y+GLR +RV   ++ +F+D  M++    Y    LIQFEDF++
Sbjct: 190 PITLDVGTENEELLKDPLYIGLRHRRVRGPEYDAFLDEFMEAASSKYGMNCLIQFEDFAN 249

Query: 180 EHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXX 239
            +AF LL+KYR     FNDDIQGT +V ++G + A+++ +  +     + + F       
Sbjct: 250 RNAFRLLNKYRNKYCTFNDDIQGTASVAVAGLLAALRITKNKL---SDQTVLFQGAGEAA 306

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK 299
                L+     + G+S+E A++ +WLVD+KGL+   R  +L + K  FA   ++  + K
Sbjct: 307 LGIAHLVVMAMEKEGLSKENARKKIWLVDSKGLIVKGRA-SLTEEKEVFA---HEHEEMK 362

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
            LE +++ +KPTALIG+++ GG F E+I+  MA  N+ PIIF LSNP   AEC+ E   K
Sbjct: 363 NLEAIVQKIKPTALIGVAAIGGAFTEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYK 422

Query: 360 GTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIX 419
            T  R IFASG+ F   T+P+ G+T +PGQGNN Y+FPG+ LG +    + I DK     
Sbjct: 423 VTKGRAIFASGSPFDPVTLPD-GRTLFPGQGNNSYVFPGVALGVVACGLRHIDDKVFLTT 481

Query: 420 XXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                             YP ++ IR VS
Sbjct: 482 AEVISQQVSDKHLQEGRLYPPLNTIRDVS 510



>gi|242089803|ref|XP_002440734.1| hypothetical protein SORBIDRAFT_09g005810 [Sorghum bicolor]
 gi|241946019|gb|EES19164.1| hypothetical protein SORBIDRAFT_09g005810 [Sorghum bicolor]
          Length = 570

 Score =  336 bits (862), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 190/504 (37%), Positives = 268/504 (53%), Gaps = 38/504 (7%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFY+++I  +EE+ P++YTPTVG AC +Y  I         P GLY+SL D   + +
Sbjct: 98  NERLFYKLLIDNVEELLPVVYTPTVGEACQKYGSIYRR------PQGLYISLKDKGKILE 151

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++K +         + Q+ V+TDG RILGLGDLG  GMGIPVGKL LY A  G+ P   L
Sbjct: 152 VLKNW------PERSIQVIVVTDGERILGLGDLGCQGMGIPVGKLSLYTALGGVRPSACL 205

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPE-LLIQFEDFSS 179
           PIT+D+GTNNE  L DEFY+GLR KR   ++++  ++  M ++ + Y E +L QFEDF++
Sbjct: 206 PITIDVGTNNETLLNDEFYIGLRQKRATGEEYHELLEEFMNAVKQNYGEKVLTQFEDFAN 265

Query: 180 EHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXX 239
            +AFDLL KYRE+   FNDDIQGT +VVL+G + A+K+V   +    H  LF        
Sbjct: 266 HNAFDLLEKYRESHLVFNDDIQGTASVVLAGLLAALKVVGGTL--ADHTYLFLGAGEAGT 323

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK 299
              + +        G   EE +  +WL+D++GL+   R D+L   K  +A +       +
Sbjct: 324 GIAELIALEMSKHAGSPIEECRSKIWLMDSRGLIVASRIDSLQAFKKPWAHEHEP---VE 380

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
           TL E ++ +KPT LIG S  GG F + ++  M   N+ P+IF LSNP  ++ECT E A  
Sbjct: 381 TLLEAVQSLKPTVLIGTSGKGGTFTQDVVEAMGAQNEKPVIFALSNPTSHSECTAEQAYT 440

Query: 360 GTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIX 419
            T  R +FASG+ FP  TV   GKT  PGQ NN YIFPG GLG +++    + D  +   
Sbjct: 441 WTQGRAVFASGSPFP--TVELDGKTLVPGQSNNAYIFPGFGLGVVISGAIRVRDDMLLAA 498

Query: 420 XXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDIE 479
                             +P  + IR +S              GLA              
Sbjct: 499 SEALAEQVTEEHFAKGLIFPPFTNIRAISARIAAKVAAKAYELGLA-------------- 544

Query: 480 VLKTRKGKEWDNLVKFVQENMWDP 503
                +    D+LVK+ +  M+ P
Sbjct: 545 ----SRLPRPDDLVKYAESCMYTP 564



>gi|148694555|gb|EDL26502.1| malic enzyme, supernatant, isoform CRA_b [Mus musculus]
 gi|148694556|gb|EDL26503.1| malic enzyme, supernatant, isoform CRA_b [Mus musculus]
          Length = 546

 Score =  336 bits (862), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 183/449 (40%), Positives = 267/449 (59%), Gaps = 21/449 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFY +++ ++E+  P++YTPTVG AC +YS     LA    P GL++S++D  ++  
Sbjct: 56  NEKLFYSVLMSDVEKFMPIVYTPTVGLACQQYS-----LAFRK-PRGLFISIHDKGHIAS 109

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++  +   P D     +  V+TDG RILGLGDLG NGMGIPVGKL LY A  G++P++ L
Sbjct: 110 VLNAW---PED---VVKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGVNPQQCL 163

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYP-ELLIQFEDFSS 179
           PITLD+GT NE+ LKD  Y+GLR +RV   ++ +F+D  M++    Y    LIQFEDF++
Sbjct: 164 PITLDVGTENEELLKDPLYIGLRHRRVRGPEYDAFLDEFMEAASSKYGMNCLIQFEDFAN 223

Query: 180 EHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXX 239
            +AF LL+KYR     FNDDIQGT +V ++G + A+++ +  +     + + F       
Sbjct: 224 RNAFRLLNKYRNKYCTFNDDIQGTASVAVAGLLAALRITKNKL---SDQTVLFQGAGEAA 280

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK 299
                L+     + G+S+E A++ +WLVD+KGL+   R  +L + K  FA +  +    K
Sbjct: 281 LGIAHLVVMAMEKEGLSKENARKKIWLVDSKGLIVKGRA-SLTEEKEVFAHEHEE---MK 336

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
            LE +++ +KPTALIG+++ GG F E+I+  MA  N+ PIIF LSNP   AEC+ E   K
Sbjct: 337 NLEAIVQKIKPTALIGVAAIGGAFTEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYK 396

Query: 360 GTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIX 419
            T  R IFASG+ F   T+P+ G+T +PGQGNN Y+FPG+ LG +    + I DK     
Sbjct: 397 VTKGRAIFASGSPFDPVTLPD-GRTLFPGQGNNSYVFPGVALGVVACGLRHIDDKVFLTT 455

Query: 420 XXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                             YP ++ IR VS
Sbjct: 456 AEVISQQVSDKHLQEGRLYPPLNTIRDVS 484



>gi|332218371|ref|XP_003258331.1| PREDICTED: NADP-dependent malic enzyme isoform 2 [Nomascus
           leucogenys]
          Length = 497

 Score =  336 bits (861), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 182/449 (40%), Positives = 266/449 (59%), Gaps = 21/449 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFYR++   +E+  P++YTPTVG AC +YS +  F  P     GL++S++D  ++  
Sbjct: 7   NEKLFYRVLTSNIEKFMPIVYTPTVGLACQQYSLV--FRKP----RGLFISIHDRGHIAS 60

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++  +   P D     +  V+TDG RILGLGDLG NGMGIPVGKL LY A  G++P+  L
Sbjct: 61  VLNAW---PED---VIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECL 114

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYP-ELLIQFEDFSS 179
           P+ LD+GT NE+ LKD  Y+GLR +RV   ++  F+D  M+++   Y    LIQFEDF++
Sbjct: 115 PVILDVGTENEELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQFEDFAN 174

Query: 180 EHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXX 239
            +AF LL+KYR     FNDDIQGT +V ++G + A+++ +  +     + + F       
Sbjct: 175 VNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKL---SDQTILFQGAGEAA 231

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK 299
                L+     + G+ +E+A + +WLVD+KGL+   R  +L + K  FA +  +    K
Sbjct: 232 LGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRA-SLTQEKEKFAHEHEE---MK 287

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
           +LE +++ +KPTALIG+++ GG F+E+I+  MA  N+ PIIF LSNP   AEC+ E   K
Sbjct: 288 SLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYK 347

Query: 360 GTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIX 419
            T  R IFASG+ F   T+P +G+T YPGQGNN Y+FPG+ LG +    + ITDK     
Sbjct: 348 ITKGRAIFASGSPFDPVTLP-SGQTLYPGQGNNSYVFPGVALGVVSCGLRQITDKIFLTT 406

Query: 420 XXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                             YP ++ IR VS
Sbjct: 407 AEVIAQQVSDKHLEEGRLYPPLNTIRDVS 435



>gi|162139827|ref|NP_032641.2| NADP-dependent malic enzyme isoform 1 [Mus musculus]
 gi|341940932|sp|P06801.2|MAOX_MOUSE RecName: Full=NADP-dependent malic enzyme; Short=NADP-ME; AltName:
           Full=Malic enzyme 1
 gi|12836576|dbj|BAB23716.1| unnamed protein product [Mus musculus]
 gi|26346875|dbj|BAC37086.1| unnamed protein product [Mus musculus]
          Length = 572

 Score =  336 bits (861), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 183/449 (40%), Positives = 268/449 (59%), Gaps = 21/449 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFY +++ ++E+  P++YTPTVG AC +YS     LA    P GL++S++D  ++  
Sbjct: 82  NEKLFYSVLMSDVEKFMPIVYTPTVGLACQQYS-----LAFRK-PRGLFISIHDKGHIAS 135

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++  +   P D     +  V+TDG RILGLGDLG NGMGIPVGKL LY A  G++P++ L
Sbjct: 136 VLNAW---PED---VVKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGVNPQQCL 189

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYP-ELLIQFEDFSS 179
           PITLD+GT NE+ LKD  Y+GLR +RV   ++ +F+D  M++    Y    LIQFEDF++
Sbjct: 190 PITLDVGTENEELLKDPLYIGLRHRRVRGPEYDAFLDEFMEAASSKYGMNCLIQFEDFAN 249

Query: 180 EHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXX 239
            +AF LL+KYR     FNDDIQGT +V ++G + A+++ +  +     + + F       
Sbjct: 250 RNAFRLLNKYRNKYCTFNDDIQGTASVAVAGLLAALRITKNKL---SDQTVLFQGAGEAA 306

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK 299
                L+     + G+S+E A++ +WLVD+KGL+   R  +L + K  FA   ++  + K
Sbjct: 307 LGIAHLVVMAMEKEGLSKENARKKIWLVDSKGLIVKGRA-SLTEEKEVFA---HEHEEMK 362

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
            LE +++ +KPTALIG+++ GG F E+I+  MA  N+ PIIF LSNP   AEC+ E   K
Sbjct: 363 NLEAIVQKIKPTALIGVAAIGGAFTEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYK 422

Query: 360 GTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIX 419
            T  R IFASG+ F   T+P+ G+T +PGQGNN Y+FPG+ LG +    + I DK     
Sbjct: 423 VTKGRAIFASGSPFDPVTLPD-GRTLFPGQGNNSYVFPGVALGVVACGLRHIDDKVFLTT 481

Query: 420 XXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                             YP ++ IR VS
Sbjct: 482 AEVISQQVSDKHLQEGRLYPPLNTIRGVS 510



>gi|307107318|gb|EFN55561.1| hypothetical protein CHLNCDRAFT_35453 [Chlorella variabilis]
          Length = 621

 Score =  336 bits (861), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 177/445 (39%), Positives = 261/445 (58%), Gaps = 16/445 (3%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +LFY++V+  LE   PLIYTPTVG AC ++ HI  + AP G    LYLS     +  +
Sbjct: 109 NQTLFYKVVMDNLEYCAPLIYTPTVGEACQKFDHI--YRAPLG----LYLSA--FQHRGR 160

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
             +  R +P  +    QI VITDGSRILGLGDLG NG+GI +GK+ LYV   G  P  +L
Sbjct: 161 FEQVLRNWPSHNV---QIIVITDGSRILGLGDLGTNGIGISIGKVALYVGGGGFHPEHSL 217

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ LD+G N ++ ++D FY+G R +R++ + +Y  V+    ++ K++P  L+Q       
Sbjct: 218 PVVLDVGCNRKEMVQDAFYMGERRERLEGEDYYGVVEEFCTAVKKLWPNALLQARSVGGT 277

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
            AF++L ++R    CFNDDIQGTGAVV SGF+N +K  + ++     R++F+        
Sbjct: 278 VAFEILHRHRNKLLCFNDDIQGTGAVVTSGFVNGMKFQKTELQDA--RVVFYGAGSSAVG 335

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFKT 300
               +  F + + G+S EEA++ +++VD+KGL+T  RGD+LA+HK  +ARDD   +  K 
Sbjct: 336 VADSIATFMEHKAGISWEEARKRIYMVDSKGLITTTRGDHLAEHKKRYARDDGTPD-MKD 394

Query: 301 LEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMKG 360
           L++++ +VKP ALIGLS+ G  + E +I  +      P+IFPLSNP   AE T E+A K 
Sbjct: 395 LKDIVAHVKPHALIGLSAAGPSWPEPVIRELGASVDCPLIFPLSNPTDKAEVTAENAYKW 454

Query: 361 TDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIXX 420
              + +FASG+ F    V   G T  PGQ NN++IFPG+G GA++AK   +TD+      
Sbjct: 455 CGGKCVFASGSPF--QPVHLDGTTYVPGQANNVFIFPGVGFGAVMAKASTVTDEMFVAAS 512

Query: 421 XXXXXXXXXXXXXXXXXYPVVSRIR 445
                            YP +  +R
Sbjct: 513 QALADCVTEEQLQAKQMYPNIKDLR 537



>gi|312147392|ref|NP_001185862.1| NADP-dependent malic enzyme isoform 2 [Mus musculus]
 gi|74194630|dbj|BAE37336.1| unnamed protein product [Mus musculus]
          Length = 552

 Score =  336 bits (861), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 183/449 (40%), Positives = 267/449 (59%), Gaps = 21/449 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFY +++ ++E+  P++YTPTVG AC +YS     LA    P GL++S++D  ++  
Sbjct: 62  NEKLFYSVLMSDVEKFMPIVYTPTVGLACQQYS-----LAFRK-PRGLFISIHDKGHIAS 115

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++  +   P D     +  V+TDG RILGLGDLG NGMGIPVGKL LY A  G++P++ L
Sbjct: 116 VLNAW---PED---VVKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGVNPQQCL 169

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYP-ELLIQFEDFSS 179
           PITLD+GT NE+ LKD  Y+GLR +RV   ++ +F+D  M++    Y    LIQFEDF++
Sbjct: 170 PITLDVGTENEELLKDPLYIGLRHRRVRGPEYDAFLDEFMEAASSKYGMNCLIQFEDFAN 229

Query: 180 EHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXX 239
            +AF LL+KYR     FNDDIQGT +V ++G + A+++ +  +     + + F       
Sbjct: 230 RNAFRLLNKYRNKYCTFNDDIQGTASVAVAGLLAALRITKNKL---SDQTVLFQGAGEAA 286

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK 299
                L+     + G+S+E A++ +WLVD+KGL+   R  +L + K  FA +  +    K
Sbjct: 287 LGIAHLVVMAMEKEGLSKENARKKIWLVDSKGLIVKGRA-SLTEEKEVFAHEHEE---MK 342

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
            LE +++ +KPTALIG+++ GG F E+I+  MA  N+ PIIF LSNP   AEC+ E   K
Sbjct: 343 NLEAIVQKIKPTALIGVAAIGGAFTEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYK 402

Query: 360 GTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIX 419
            T  R IFASG+ F   T+P+ G+T +PGQGNN Y+FPG+ LG +    + I DK     
Sbjct: 403 VTKGRAIFASGSPFDPVTLPD-GRTLFPGQGNNSYVFPGVALGVVACGLRHIDDKVFLTT 461

Query: 420 XXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                             YP ++ IR VS
Sbjct: 462 AEVISQQVSDKHLQEGRLYPPLNTIRGVS 490



>gi|478495572|ref|XP_004422128.1| PREDICTED: NADP-dependent malic enzyme isoform 1 [Ceratotherium
           simum simum]
          Length = 572

 Score =  335 bits (860), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 186/450 (41%), Positives = 270/450 (60%), Gaps = 23/450 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFYR+++ +LE+  P++YTPTVG AC +YS +  F  P     GL++S++D  ++  
Sbjct: 82  NEKLFYRVLMSDLEKFMPIVYTPTVGLACQQYSLV--FRKP----RGLFISIHDRGHIAS 135

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           I+  +   P D     +  V+TDG RILGLGDLG NGMGIPVGKL LY A  G++P+  L
Sbjct: 136 ILNAW---PED---VIKAVVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECL 189

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYP-ELLIQFEDFSS 179
           P+ LD+GT NE+ LKD  Y+GLR +RV   ++  F+D  M+++   Y    LIQFEDF++
Sbjct: 190 PVILDVGTENEELLKDPLYIGLRQRRVRGAEYDEFLDEFMEAVSSKYGMNCLIQFEDFAN 249

Query: 180 EHAFDLLSKYRENTFC-FNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXX 238
            +AF LL+KY +N +C FNDDIQGT +V ++G + A+++ +  +     + + F      
Sbjct: 250 VNAFRLLNKY-QNQYCTFNDDIQGTASVAVAGILAALRITKNTL---SDQTILFQGAGEA 305

Query: 239 XXXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQF 298
                 L+     + G+ +E+A + +WLVD+KGL+   R   L + K  FA   ++  + 
Sbjct: 306 ALGIAHLIVMAMEKEGLPKEKAIKKIWLVDSKGLIVKGRA-ALTQEKEEFA---HEHEEM 361

Query: 299 KTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAM 358
           K LE +++ +KPTALIG+++ GG F+E+I+  MA  N+ PIIF LSNP   AECT E   
Sbjct: 362 KNLEAIVQNIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECTAEQCY 421

Query: 359 KGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYI 418
           K T  R IFASG+ F   T+P+ G+T YPGQGNN Y+FPG+ LG +    + ITDK    
Sbjct: 422 KLTKGRAIFASGSPFDPVTLPD-GQTLYPGQGNNSYVFPGVALGVVACGLRHITDKIFLT 480

Query: 419 XXXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                              YP ++ IR VS
Sbjct: 481 TAKVIAQQVSDEHLEEGRLYPPLNTIRDVS 510



>gi|403261214|ref|XP_003923020.1| PREDICTED: NADP-dependent malic enzyme isoform 1 [Saimiri
           boliviensis boliviensis]
          Length = 497

 Score =  335 bits (860), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 182/449 (40%), Positives = 266/449 (59%), Gaps = 21/449 (4%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N  LFYR++  ++E+  P++YTPTVG AC +YS +  F  P     GL++S++D  ++  
Sbjct: 7   NEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLV--FRKP----RGLFISIHDRGHIAS 60

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++  +   P D     +  V+TDG RILGLGDLG NGMGIPVGKL LY A  G++P+  L
Sbjct: 61  VLNAW---PED---VIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTACGGMNPQECL 114

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYP-ELLIQFEDFSS 179
           P+ LD+GT NE+ LKD  Y+GLR +RV   ++  F+D  M+++   Y    LIQFEDF++
Sbjct: 115 PVILDVGTENEELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNCLIQFEDFAN 174

Query: 180 EHAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXX 239
            +AF LL+KYR +   FNDDIQGT +V ++G + A+++ +  +     + + F       
Sbjct: 175 VNAFRLLNKYRNHYCTFNDDIQGTASVAVAGLLAALRITKNKL---SDQTILFQGAGEAA 231

Query: 240 XXXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRGDNLAKHKVYFARDDNDGNQFK 299
                L+     + G+ +E+A + +WLVD+KGL+   R  +L + K  FA +     + K
Sbjct: 232 LGIAHLILMAMEKEGLPKEKAIKKIWLVDSKGLIVKGRA-SLTQEKEKFAHEH---EEMK 287

Query: 300 TLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAMK 359
            LE +++ +KPTALIG+++ GG F+E+I+  MA  N+ PIIF LSNP   AEC+ E   K
Sbjct: 288 NLETIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQCYK 347

Query: 360 GTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYIX 419
            T  R IFASG+ F   T+P  G+T YPGQGNN Y+FPG+ LG +    + ITDK     
Sbjct: 348 ITKGRAIFASGSPFDPVTLP-NGQTLYPGQGNNSYVFPGVALGVVACGLRHITDKVFLTT 406

Query: 420 XXXXXXXXXXXXXXXXXXYPVVSRIRHVS 448
                             YP ++ IR VS
Sbjct: 407 AEVIAQQVSDKHLEEGRLYPPLNTIRDVS 435



>gi|308810214|ref|XP_003082416.1| OJ1457_D07.117 gene product (ISS) [Ostreococcus tauri]
 gi|116060884|emb|CAL57362.1| OJ1457_D07.117 gene product (ISS) [Ostreococcus tauri]
          Length = 639

 Score =  335 bits (859), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 184/506 (36%), Positives = 280/506 (55%), Gaps = 28/506 (5%)

Query: 1   NVSLFYRIVIGELEEITPLIYTPTVGTACLEYSHISPFLAPPGIPDGLYLSLNDLPNLTQ 60
           N +LFYR+V   +EE+ P+IYTPTVG ACL +S +           G+Y S++D  ++  
Sbjct: 148 NETLFYRLVHDHIEELAPIIYTPTVGDACLNFSKLLRR------ARGMYFSVDDRGDINS 201

Query: 61  IIKTYRPYPYDDTLTPQIAVITDGSRILGLGDLGVNGMGIPVGKLQLYVAAAGIDPRRTL 120
           ++  ++        +  + V+TDGSRILGLGDLG NGMGI  GK+ LYVA  G DP+  L
Sbjct: 202 MMFNWK-------RSVSVIVVTDGSRILGLGDLGTNGMGISQGKVDLYVAGGGFDPQHVL 254

Query: 121 PITLDLGTNNEKNLKDEFYLGLRSKRVDDDQFYSFVDAVMKSLLKVYPELLIQFEDFSSE 180
           P+ LD+GTNNE  L D +YLG+  KR++ +++Y+F++  ++ +   +P  LIQFEDF ++
Sbjct: 255 PVVLDVGTNNEDLLNDPYYLGVPRKRLEGEEYYAFIEEFIRGVRNRWPNALIQFEDFQTK 314

Query: 181 HAFDLLSKYRENTFCFNDDIQGTGAVVLSGFINAVKLVEKDVHPTKHRLLFFXXXXXXXX 240
           HA  +L +YR +  CFNDDIQGT AVVL+G   A+K +         +            
Sbjct: 315 HANKILQRYRNDVLCFNDDIQGTAAVVLAGLYGAMKCLGGHRKDIVKQTFVMCGAGSAGS 374

Query: 241 XXKQLLEFFKVEHGMSEEEAKRLVWLVDTKGLVTLDRG-DNLAKHKVY-FARDDNDGNQF 298
                +    V +G+SE+EA +  +++D  GL+T DR  D      +  FAR  +D    
Sbjct: 375 GIASFIHQALVANGLSEDEAYQRFYIIDKDGLITHDRNLDAPGMEPIRPFARARSDLPDG 434

Query: 299 KTLEEVIEYVKPTALIGLSSTGGVFNEKIINRMAELNKNPIIFPLSNPKVNAECTFEDAM 358
             L +VIE  +PT L+G+S+  G+F  +++ +M E+N+ PII PLSNP   AECT + A 
Sbjct: 435 TRLLDVIEKARPTTLMGVSTVSGLFTREVLQKMGEINERPIIMPLSNPTSRAECTAQQAA 494

Query: 359 KGTDNRVIFASGTAFPEYTVPETGKTKYPGQGNNMYIFPGLGLGAILAKPKVITDKQIYI 418
           + T  R IF++G+ F +  +P  G      QGNN Y+FPG+GLGA+L+K  VI+D  +  
Sbjct: 495 EATGGRAIFSAGSPFEDVEMP-NGHVMKANQGNNFYVFPGVGLGALLSKSSVISDGMLQA 553

Query: 419 XXXXXXXXXXXXXXXXXXXYPVVSRIRHVSXXXXXXXXXXXXXXGLARDKQIIEMVQNDI 478
                              +P ++RIR +S                AR+ ++ E ++  +
Sbjct: 554 AAMAVPAMLTREQHESGTIFPRINRIRDIS-----AYVAIKVIEAAAREGRVPEDIRKIV 608

Query: 479 EVLKTRKGKEWDNLVKFVQENMWDPD 504
                 KG+E   L ++V   MW P+
Sbjct: 609 S-----KGEE--ALREYVYSTMWIPN 627