BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10202_c0_seq1-m.84 complete 308-1198(+) 297 (+)
         (296 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|511004755|gb|EPB86115.1| hypothetical protein HMPREF1544_0710...   260   3e-67   Mucor circinelloides f. circinelloides 1006PhL
gi|511001856|gb|EPB83313.1| hypothetical protein HMPREF1544_0995...   259   6e-67   Mucor circinelloides f. circinelloides 1006PhL
gi|511008408|gb|EPB89674.1| hypothetical protein HMPREF1544_0347...   257   2e-66   Mucor circinelloides f. circinelloides 1006PhL
gi|384498957|gb|EIE89448.1| hypothetical protein RO3G_14159 [Rhi...   226   6e-57   Rhizopus delemar RA 99-880
gi|384499107|gb|EIE89598.1| hypothetical protein RO3G_14309 [Rhi...   162   9e-38   Rhizopus delemar RA 99-880
gi|125559849|gb|EAZ05297.1| hypothetical protein OsI_27502 [Oryz...   147   4e-33   Oryza sativa Indica Group [Indian rice]
gi|222639768|gb|EEE67900.1| hypothetical protein OsJ_25742 [Oryz...   147   4e-33   Oryza sativa Japonica Group [Japonica rice]
gi|115474361|ref|NP_001060777.1| Os08g0104300 [Oryza sativa Japo...   147   4e-33   
gi|501755429|emb|CCG81348.1| Uncharacterized RING finger protein...   145   1e-32   Taphrina deformans PYCC 5710
gi|326488691|dbj|BAJ97957.1| predicted protein [Hordeum vulgare ...   144   3e-32   Hordeum vulgare subsp. vulgare [barley]
gi|336370166|gb|EGN98507.1| hypothetical protein SERLA73DRAFT_18...   143   5e-32   Serpula lacrymans var. lacrymans S7.3
gi|226531065|ref|NP_001147957.1| RING finger protein 13 precurso...   142   1e-31   Zea mays [maize]
gi|197245337|ref|NP_001127773.1| ring finger protein 13 precurso...   141   3e-31   Acyrthosiphon pisum
gi|242084184|ref|XP_002442517.1| hypothetical protein SORBIDRAFT...   140   4e-31   Sorghum bicolor [broomcorn]
gi|449528049|ref|XP_004171019.1| PREDICTED: E3 ubiquitin-protein...   139   7e-31   
gi|449441754|ref|XP_004138647.1| PREDICTED: E3 ubiquitin-protein...   139   8e-31   
gi|226504236|ref|NP_001145884.1| uncharacterized protein LOC1002...   139   1e-30   Zea mays [maize]
gi|223943603|gb|ACN25885.1| unknown [Zea mays] >gi|413941568|gb|...   139   1e-30   Zea mays [maize]
gi|302767092|ref|XP_002966966.1| hypothetical protein SELMODRAFT...   138   2e-30   Selaginella moellendorffii
gi|392585362|gb|EIW74702.1| hypothetical protein CONPUDRAFT_6713...   138   2e-30   Coniophora puteana RWD-64-598 SS2
gi|302755246|ref|XP_002961047.1| hypothetical protein SELMODRAFT...   137   3e-30   Selaginella moellendorffii
gi|356535715|ref|XP_003536389.1| PREDICTED: E3 ubiquitin-protein...   137   3e-30   Glycine max [soybeans]
gi|115450963|ref|NP_001049082.1| Os03g0167500 [Oryza sativa Japo...   137   3e-30   
gi|108706378|gb|ABF94173.1| ReMembR-H2 protein JR702, putative, ...   137   4e-30   Oryza sativa Japonica Group [Japonica rice]
gi|357166868|ref|XP_003580891.1| PREDICTED: E3 ubiquitin-protein...   136   6e-30   
gi|255586465|ref|XP_002533876.1| zinc finger protein, putative [...   135   1e-29   
gi|19071633|gb|AAL84300.1|AC073556_17 putative integral membrane...   135   2e-29   Oryza sativa Japonica Group [Japonica rice]
gi|308044561|ref|NP_001183725.1| uncharacterized LOC100502318 pr...   135   2e-29   Zea mays [maize]
gi|356576139|ref|XP_003556191.1| PREDICTED: E3 ubiquitin-protein...   135   2e-29   
gi|409042212|gb|EKM51696.1| hypothetical protein PHACADRAFT_1274...   134   2e-29   Phanerochaete carnosa HHB-10118-sp
gi|409078944|gb|EKM79306.1| hypothetical protein AGABI1DRAFT_742...   134   3e-29   Agaricus bisporus var. burnettii JB137-S8
gi|402218957|gb|EJT99032.1| transferrin receptor ectodomain apic...   134   3e-29   Dacryopinax primogenitus
gi|302758284|ref|XP_002962565.1| hypothetical protein SELMODRAFT...   134   3e-29   Selaginella moellendorffii
gi|426195852|gb|EKV45781.1| hypothetical protein AGABI2DRAFT_207...   134   3e-29   Agaricus bisporus var. bisporus H97
gi|470129614|ref|XP_004300704.1| PREDICTED: E3 ubiquitin-protein...   134   4e-29   Fragaria vesca subsp. vesca
gi|403416948|emb|CCM03648.1| predicted protein [Fibroporia radic...   133   6e-29   Fibroporia radiculosa
gi|222624258|gb|EEE58390.1| hypothetical protein OsJ_09552 [Oryz...   132   9e-29   Oryza sativa Japonica Group [Japonica rice]
gi|116790621|gb|ABK25681.1| unknown [Picea sitchensis]                132   1e-28   Picea sitchensis
gi|168020812|ref|XP_001762936.1| predicted protein [Physcomitrel...   132   1e-28   Physcomitrella patens
gi|502118717|ref|XP_004496378.1| PREDICTED: E3 ubiquitin-protein...   131   2e-28   Cicer arietinum [garbanzo]
gi|389744752|gb|EIM85934.1| hypothetical protein STEHIDRAFT_5873...   131   3e-28   Stereum hirsutum FP-91666 SS1
gi|224146378|ref|XP_002325986.1| predicted protein [Populus tric...   130   4e-28   Populus trichocarpa [western balsam poplar]
gi|508725329|gb|EOY17226.1| Protease-associated RING/U-box zinc ...   130   5e-28   Theobroma cacao [chocolate]
gi|357144351|ref|XP_003573261.1| PREDICTED: E3 ubiquitin-protein...   129   8e-28   
gi|242074888|ref|XP_002447380.1| hypothetical protein SORBIDRAFT...   129   1e-27   Sorghum bicolor [broomcorn]
gi|225470792|ref|XP_002269731.1| PREDICTED: E3 ubiquitin-protein...   128   2e-27   Vitis vinifera
gi|296081075|emb|CBI18269.3| unnamed protein product [Vitis vini...   128   2e-27   Vitis vinifera
gi|91095001|ref|XP_969305.1| PREDICTED: similar to zinc finger p...   128   2e-27   Tribolium castaneum [rust-red flour beetle]
gi|302822236|ref|XP_002992777.1| hypothetical protein SELMODRAFT...   128   2e-27   Selaginella moellendorffii
gi|15219930|ref|NP_173681.1| Protease-associated (PA) RING/U-box...   127   4e-27   Arabidopsis thaliana [mouse-ear cress]
gi|460392451|ref|XP_004241829.1| PREDICTED: E3 ubiquitin-protein...   126   6e-27   Solanum lycopersicum
gi|384484953|gb|EIE77133.1| hypothetical protein RO3G_01837 [Rhi...   126   8e-27   Rhizopus delemar RA 99-880
gi|460409963|ref|XP_004250405.1| PREDICTED: E3 ubiquitin-protein...   126   9e-27   Solanum lycopersicum
gi|195343973|ref|XP_002038565.1| GM10894 [Drosophila sechellia] ...   125   1e-26   Drosophila sechellia
gi|511008479|gb|EPB89744.1| hypothetical protein HMPREF1544_0340...   125   1e-26   Mucor circinelloides f. circinelloides 1006PhL
gi|218192160|gb|EEC74587.1| hypothetical protein OsI_10167 [Oryz...   125   2e-26   Oryza sativa Indica Group [Indian rice]
gi|413917979|gb|AFW57911.1| putative protease-associated RING zi...   124   3e-26   Zea mays [maize]
gi|226502198|ref|NP_001143559.1| uncharacterized protein LOC1002...   124   3e-26   Zea mays [maize]
gi|195502293|ref|XP_002098159.1| GE10219 [Drosophila yakuba] >gi...   124   4e-26   Drosophila yakuba
gi|505779208|ref|XP_004603253.1| PREDICTED: E3 ubiquitin-protein...   124   4e-26   Sorex araneus [Eurasian shrew]
gi|24644599|ref|NP_649653.1| CG10277, isoform A [Drosophila mela...   124   4e-26   Drosophila melanogaster
gi|195568735|ref|XP_002102369.1| GD19873 [Drosophila simulans] >...   123   6e-26   
gi|194899051|ref|XP_001979076.1| GG13423 [Drosophila erecta] >gi...   123   6e-26   Drosophila erecta
gi|482573466|gb|EOA37653.1| hypothetical protein CARUB_v10012186...   123   6e-26   Capsella rubella
gi|297850724|ref|XP_002893243.1| predicted protein [Arabidopsis ...   123   7e-26   Arabidopsis lyrata subsp. lyrata
gi|482570971|gb|EOA35159.1| hypothetical protein CARUB_v10020298...   122   8e-26   Capsella rubella
gi|22330577|ref|NP_177343.2| protease-associated and C3HC4-type ...   122   1e-25   Arabidopsis thaliana [mouse-ear cress]
gi|195995595|ref|XP_002107666.1| hypothetical protein TRIADDRAFT...   122   1e-25   Trichoplax adhaerens
gi|50550311|ref|XP_502628.1| YALI0D09735p [Yarrowia lipolytica] ...   122   1e-25   Yarrowia lipolytica CLIB122
gi|357168387|ref|XP_003581622.1| PREDICTED: E3 ubiquitin-protein...   122   1e-25   Brachypodium distachyon [annual false brome]
gi|224104529|ref|XP_002333929.1| predicted protein [Populus tric...   122   1e-25   
gi|148222567|ref|NP_001083709.1| ring finger protein 13 precurso...   121   2e-25   Xenopus laevis [clawed frog]
gi|482573150|gb|EOA37337.1| hypothetical protein CARUB_v10011046...   121   2e-25   Capsella rubella
gi|297839045|ref|XP_002887404.1| predicted protein [Arabidopsis ...   121   3e-25   Arabidopsis lyrata subsp. lyrata
gi|498980323|ref|XP_004529322.1| PREDICTED: uncharacterized prot...   121   3e-25   Ceratitis capitata
gi|498980339|ref|XP_004529326.1| PREDICTED: uncharacterized prot...   121   3e-25   
gi|6942149|gb|AAF32326.1|AF218808_1 ReMembR-H2 protein JR702 [Ar...   121   3e-25   Arabidopsis thaliana [mouse-ear cress]
gi|56118680|ref|NP_001008015.1| ring finger protein 13 precursor...   120   3e-25   Xenopus tropicalis [western clawed frog]
gi|321465867|gb|EFX76866.1| hypothetical protein DAPPUDRAFT_3060...   120   4e-25   Daphnia pulex
gi|197245355|ref|NP_001127781.1| ring finger protein 13 [Nasonia...   120   4e-25   Nasonia vitripennis
gi|12324534|gb|AAG52220.1|AC021665_3 unknown protein; 70660-7221...   120   5e-25   Arabidopsis thaliana [mouse-ear cress]
gi|395533607|ref|XP_003768847.1| PREDICTED: E3 ubiquitin-protein...   120   6e-25   Sarcophilus harrisii
gi|224061170|ref|XP_002189845.1| PREDICTED: E3 ubiquitin-protein...   119   8e-25   Taeniopygia guttata
gi|426218145|ref|XP_004003310.1| PREDICTED: E3 ubiquitin-protein...   119   9e-25   Ovis aries [domestic sheep]
gi|115497538|ref|NP_001069610.1| E3 ubiquitin-protein ligase RNF...   119   9e-25   Bos taurus [bovine]
gi|466050393|ref|XP_004278227.1| PREDICTED: E3 ubiquitin-protein...   119   9e-25   Orcinus orca [Orca]
gi|462421382|gb|EMJ25645.1| hypothetical protein PRUPE_ppa022081...   119   1e-24   Prunus persica
gi|507954017|ref|XP_004684781.1| PREDICTED: E3 ubiquitin-protein...   119   1e-24   
gi|2746335|gb|AAC03770.1| RING zinc finger protein [Mus musculus]     119   1e-24   Mus musculus [mouse]
gi|74191108|dbj|BAE39388.1| unnamed protein product [Mus musculus]    119   1e-24   Mus musculus [mouse]
gi|164663850|ref|NP_001106884.1| E3 ubiquitin-protein ligase RNF...   119   1e-24   Mus musculus [mouse]
gi|507566568|ref|XP_004666928.1| PREDICTED: E3 ubiquitin-protein...   118   2e-24   Jaculus jaculus
gi|512892941|ref|XP_004923057.1| PREDICTED: E3 ubiquitin-protein...   118   2e-24   Bombyx mori [silk moth]
gi|334323435|ref|XP_001371033.2| PREDICTED: e3 ubiquitin-protein...   118   2e-24   Monodelphis domestica
gi|350591630|ref|XP_003358656.2| PREDICTED: E3 ubiquitin-protein...   118   2e-24   Sus scrofa [pigs]
gi|512874366|ref|XP_004893417.1| PREDICTED: E3 ubiquitin-protein...   118   2e-24   
gi|354499654|ref|XP_003511923.1| PREDICTED: E3 ubiquitin-protein...   118   2e-24   Cricetulus griseus [Chinese hamsters]
gi|395527967|ref|XP_003766107.1| PREDICTED: E3 ubiquitin-protein...   118   2e-24   Sarcophilus harrisii
gi|440909106|gb|ELR59052.1| E3 ubiquitin-protein ligase RNF167, ...   118   2e-24   Bos mutus
gi|157821373|ref|NP_001102914.1| E3 ubiquitin-protein ligase RNF...   117   3e-24   Rattus norvegicus [brown rat]
gi|326513248|dbj|BAK06864.1| predicted protein [Hordeum vulgare ...   117   3e-24   Hordeum vulgare subsp. vulgare [barley]
gi|126338112|ref|XP_001363895.1| PREDICTED: e3 ubiquitin-protein...   117   3e-24   Monodelphis domestica
gi|145340038|ref|NP_192694.2| protease-associated (PA) RING/U-bo...   117   3e-24   Arabidopsis thaliana [mouse-ear cress]
gi|326926239|ref|XP_003209310.1| PREDICTED: e3 ubiquitin-protein...   117   3e-24   Meleagris gallopavo [common turkey]
gi|327266890|ref|XP_003218236.1| PREDICTED: e3 ubiquitin-protein...   117   3e-24   Anolis carolinensis [Carolina anole]
gi|45382515|ref|NP_990686.1| E3 ubiquitin-protein ligase RNF13 p...   117   4e-24   Gallus gallus [bantam]
gi|470105429|ref|XP_004289086.1| PREDICTED: E3 ubiquitin-protein...   117   4e-24   
gi|301778327|ref|XP_002924579.1| PREDICTED: e3 ubiquitin-protein...   117   4e-24   
gi|281342946|gb|EFB18530.1| hypothetical protein PANDA_013950 [A...   117   4e-24   Ailuropoda melanoleuca
gi|507543957|ref|XP_004655961.1| PREDICTED: E3 ubiquitin-protein...   117   5e-24   Jaculus jaculus
gi|296475697|tpg|DAA17812.1| TPA: ring finger protein 167-like [...   117   5e-24   Bos taurus [bovine]
gi|504177104|ref|XP_004597757.1| PREDICTED: E3 ubiquitin-protein...   116   6e-24   Ochotona princeps [southern American pika]
gi|194221716|ref|XP_001491239.2| PREDICTED: e3 ubiquitin-protein...   116   6e-24   Equus caballus [domestic horse]
gi|390178696|ref|XP_001359240.3| GA10212, partial [Drosophila ps...   116   7e-24   
gi|28076963|ref|NP_081721.1| E3 ubiquitin-protein ligase RNF167 ...   116   9e-24   Mus musculus [mouse]
gi|380017760|ref|XP_003692814.1| PREDICTED: E3 ubiquitin-protein...   116   9e-24   Apis florea [dwarf honeybee]
gi|403265778|ref|XP_003925091.1| PREDICTED: E3 ubiquitin-protein...   115   1e-23   
gi|74180382|dbj|BAE32356.1| unnamed protein product [Mus musculus]    115   1e-23   Mus musculus [mouse]
gi|472358022|ref|XP_004398637.1| PREDICTED: E3 ubiquitin-protein...   115   1e-23   Odobenus rosmarus divergens
gi|402861239|ref|XP_003895008.1| PREDICTED: E3 ubiquitin-protein...   115   1e-23   Papio anubis [Doguera baboon]
gi|355746972|gb|EHH51586.1| hypothetical protein EGM_10995 [Maca...   115   1e-23   Macaca fascicularis [crab eating macaque]
gi|6005864|ref|NP_009213.1| E3 ubiquitin-protein ligase RNF13 [H...   115   1e-23   Homo sapiens [man]
gi|344288944|ref|XP_003416206.1| PREDICTED: E3 ubiquitin-protein...   115   1e-23   Loxodonta africana [African bush elephant]
gi|488566568|ref|XP_004472943.1| PREDICTED: E3 ubiquitin-protein...   115   1e-23   Dasypus novemcinctus
gi|410971206|ref|XP_003992063.1| PREDICTED: E3 ubiquitin-protein...   115   1e-23   Felis catus [cat]
gi|390356491|ref|XP_796758.3| PREDICTED: E3 ubiquitin-protein li...   115   1e-23   
gi|296227840|ref|XP_002759543.1| PREDICTED: E3 ubiquitin-protein...   115   1e-23   Callithrix jacchus [common marmoset]
gi|194744271|ref|XP_001954618.1| GF18360 [Drosophila ananassae] ...   115   1e-23   Drosophila ananassae
gi|259155278|ref|NP_001158881.1| E3 ubiquitin-protein ligase RNF...   115   2e-23   Salmo salar
gi|511868782|ref|XP_004755584.1| PREDICTED: E3 ubiquitin-protein...   115   2e-23   Mustela putorius furo [black ferret]
gi|472371151|ref|XP_004405079.1| PREDICTED: E3 ubiquitin-protein...   115   2e-23   Odobenus rosmarus divergens
gi|410921626|ref|XP_003974284.1| PREDICTED: E3 ubiquitin-protein...   115   2e-23   Takifugu rubripes [tiger puffer]
gi|297813379|ref|XP_002874573.1| peptidase/ protein binding prot...   115   2e-23   Arabidopsis lyrata subsp. lyrata
gi|478258630|gb|ENN78680.1| hypothetical protein YQE_04852, part...   115   2e-23   Dendroctonus ponderosae
gi|148231430|ref|NP_001087597.1| ring finger protein 167 precurs...   115   2e-23   Xenopus laevis [clawed frog]
gi|291399975|ref|XP_002716309.1| PREDICTED: ring finger protein ...   114   2e-23   Oryctolagus cuniculus [European rabbit]
gi|512908556|ref|XP_004901371.1| PREDICTED: E3 ubiquitin-protein...   114   2e-23   
gi|57103676|ref|XP_534303.1| PREDICTED: E3 ubiquitin-protein lig...   114   2e-23   Canis lupus familiaris [dogs]
gi|328786465|ref|XP_391835.4| PREDICTED: e3 ubiquitin-protein li...   114   3e-23   Apis mellifera [European honey bee]
gi|195392144|ref|XP_002054719.1| GJ24605 [Drosophila virilis] >g...   114   3e-23   Drosophila virilis
gi|301776154|ref|XP_002923497.1| PREDICTED: RING finger protein ...   114   3e-23   Ailuropoda melanoleuca
gi|15239276|ref|NP_201417.1| receptor homology-transmembrane-rin...   114   3e-23   Arabidopsis thaliana [mouse-ear cress]
gi|511881184|ref|XP_004760488.1| PREDICTED: E3 ubiquitin-protein...   114   3e-23   
gi|511881188|ref|XP_004760490.1| PREDICTED: E3 ubiquitin-protein...   114   3e-23   Mustela putorius furo [black ferret]
gi|392565946|gb|EIW59122.1| hypothetical protein TRAVEDRAFT_6433...   114   4e-23   Trametes versicolor FP-101664 SS1
gi|507698743|ref|XP_004643968.1| PREDICTED: E3 ubiquitin-protein...   114   4e-23   Octodon degus
gi|348535847|ref|XP_003455409.1| PREDICTED: E3 ubiquitin-protein...   114   4e-23   Oreochromis niloticus
gi|499022509|ref|XP_004562021.1| PREDICTED: E3 ubiquitin-protein...   114   4e-23   Maylandia zebra
gi|56605798|ref|NP_001008362.1| E3 ubiquitin-protein ligase RNF1...   113   5e-23   Rattus norvegicus [brown rat]
gi|195454215|ref|XP_002074140.1| GK12779 [Drosophila willistoni]...   113   5e-23   Drosophila willistoni
gi|449271045|gb|EMC81660.1| RING finger protein 13 [Columba livia]    113   6e-23   Columba livia [carrier pigeon]
gi|507927419|ref|XP_004674965.1| PREDICTED: E3 ubiquitin-protein...   113   6e-23   Condylura cristata
gi|213512162|ref|NP_001135282.1| ring finger protein 13 [Salmo s...   113   7e-23   Salmo salar
gi|42573810|ref|NP_975001.1| receptor homology-transmembrane-rin...   113   7e-23   Arabidopsis thaliana [mouse-ear cress]
gi|482556272|gb|EOA20464.1| hypothetical protein CARUB_v10000777...   113   7e-23   Capsella rubella
gi|471371280|ref|XP_004376148.1| PREDICTED: E3 ubiquitin-protein...   113   7e-23   Trichechus manatus latirostris
gi|465992973|ref|XP_004267040.1| PREDICTED: E3 ubiquitin-protein...   112   8e-23   Orcinus orca [Orca]
gi|348581670|ref|XP_003476600.1| PREDICTED: E3 ubiquitin-protein...   112   8e-23   Cavia porcellus [guinea pig]
gi|507704770|ref|XP_004716190.1| PREDICTED: E3 ubiquitin-protein...   112   9e-23   Echinops telfairi [lesser hedgehog tenrec]
gi|116283986|gb|AAH17878.1| RNF13 protein [Homo sapiens]              112   9e-23   Homo sapiens [man]
gi|42562538|ref|NP_174800.2| protease-associated and C3HC4-type ...   112   9e-23   Arabidopsis thaliana [mouse-ear cress]
gi|507670860|ref|XP_004708697.1| PREDICTED: E3 ubiquitin-protein...   112   9e-23   
gi|478489879|ref|XP_004419314.1| PREDICTED: E3 ubiquitin-protein...   112   9e-23   Ceratotherium simum simum [southern square-lipped rhinoceros]
gi|344290093|ref|XP_003416773.1| PREDICTED: E3 ubiquitin-protein...   112   1e-22   Loxodonta africana [African bush elephant]
gi|444722982|gb|ELW63654.1| E3 ubiquitin-protein ligase RNF167 [...   112   1e-22   Tupaia chinensis
gi|508698927|gb|EOX90823.1| Receptor region transmembrane domain...   112   1e-22   Theobroma cacao [chocolate]
gi|499026378|ref|XP_004563932.1| PREDICTED: E3 ubiquitin-protein...   112   1e-22   Maylandia zebra
gi|470623922|ref|XP_004319545.1| PREDICTED: E3 ubiquitin-protein...   112   1e-22   Tursiops truncatus [Atlantic bottle-nosed dolphin]
gi|488510401|ref|XP_004447288.1| PREDICTED: E3 ubiquitin-protein...   112   1e-22   
gi|507616467|ref|XP_004623701.1| PREDICTED: E3 ubiquitin-protein...   112   1e-22   Octodon degus
gi|157167913|ref|XP_001662900.1| zinc finger protein [Aedes aegy...   111   2e-22   Aedes aegypti
gi|507674127|ref|XP_004638392.1| PREDICTED: E3 ubiquitin-protein...   111   2e-22   Octodon degus
gi|504170640|ref|XP_004594911.1| PREDICTED: E3 ubiquitin-protein...   111   2e-22   Ochotona princeps [southern American pika]
gi|403279778|ref|XP_003931422.1| PREDICTED: E3 ubiquitin-protein...   111   2e-22   Saimiri boliviensis boliviensis
gi|297271673|ref|XP_001099111.2| PREDICTED: e3 ubiquitin-protein...   111   2e-22   
gi|470320334|ref|XP_004348782.1| hypothetical protein CAOG_02032...   111   2e-22   Capsaspora owczarzaki ATCC 30864
gi|350423449|ref|XP_003493486.1| PREDICTED: E3 ubiquitin-protein...   111   3e-22   Bombus impatiens
gi|297797773|ref|XP_002866771.1| hypothetical protein ARALYDRAFT...   111   3e-22   Arabidopsis lyrata subsp. lyrata
gi|302564261|ref|NP_001181030.1| E3 ubiquitin-protein ligase RNF...   111   3e-22   Macaca mulatta [rhesus macaque]
gi|347967041|ref|XP_321026.4| AGAP002028-PA [Anopheles gambiae s...   111   3e-22   Anopheles gambiae str. PEST
gi|355568125|gb|EHH24406.1| E3 ubiquitin-protein ligase RNF167 [...   111   3e-22   Macaca mulatta [rhesus macaque]
gi|507674133|ref|XP_004638393.1| PREDICTED: E3 ubiquitin-protein...   111   3e-22   
gi|441662317|ref|XP_003277933.2| PREDICTED: E3 ubiquitin-protein...   111   3e-22   Nomascus leucogenys [White-cheeked Gibbon]
gi|348560880|ref|XP_003466241.1| PREDICTED: E3 ubiquitin-protein...   111   3e-22   Cavia porcellus [guinea pig]
gi|402898398|ref|XP_003912210.1| PREDICTED: E3 ubiquitin-protein...   111   3e-22   Papio anubis [Doguera baboon]
gi|395748403|ref|XP_002826927.2| PREDICTED: E3 ubiquitin-protein...   110   3e-22   Pongo abelii [Orang-utan]
gi|397477750|ref|XP_003810232.1| PREDICTED: E3 ubiquitin-protein...   110   3e-22   
gi|114665884|ref|XP_001164101.1| PREDICTED: E3 ubiquitin-protein...   110   3e-22   
gi|395836652|ref|XP_003791267.1| PREDICTED: E3 ubiquitin-protein...   110   3e-22   
gi|462398407|gb|EMJ04075.1| hypothetical protein PRUPE_ppa015768...   110   3e-22   Prunus persica
gi|340720205|ref|XP_003398532.1| PREDICTED: e3 ubiquitin-protein...   110   3e-22   Bombus terrestris [large earth bumblebee]
gi|291405221|ref|XP_002718877.1| PREDICTED: ring finger protein ...   110   4e-22   Oryctolagus cuniculus [European rabbit]
gi|311268237|ref|XP_003131954.1| PREDICTED: E3 ubiquitin-protein...   110   4e-22   Sus scrofa [pigs]
gi|149724219|ref|XP_001504799.1| PREDICTED: e3 ubiquitin-protein...   110   4e-22   Equus caballus [domestic horse]
gi|343959710|dbj|BAK63712.1| RING finger protein 167 precursor [...   110   4e-22   Pan troglodytes
gi|225431110|ref|XP_002265670.1| PREDICTED: E3 ubiquitin-protein...   110   4e-22   Vitis vinifera
gi|354469677|ref|XP_003497252.1| PREDICTED: E3 ubiquitin-protein...   110   4e-22   Cricetulus griseus [Chinese hamsters]
gi|14149702|ref|NP_056343.1| E3 ubiquitin-protein ligase RNF167 ...   110   5e-22   Homo sapiens [man]
gi|332021533|gb|EGI61898.1| RING finger protein 13 [Acromyrmex e...   110   5e-22   Acromyrmex echinatior
gi|296202306|ref|XP_002806882.1| PREDICTED: LOW QUALITY PROTEIN:...   110   5e-22   
gi|426237410|ref|XP_004012654.1| PREDICTED: E3 ubiquitin-protein...   110   5e-22   Ovis aries [domestic sheep]
gi|126323242|ref|XP_001375947.1| PREDICTED: zinc/RING finger pro...   110   5e-22   
gi|21739864|emb|CAD38958.1| hypothetical protein [Homo sapiens] ...   110   5e-22   Homo sapiens [man]
gi|478518069|ref|XP_004433265.1| PREDICTED: E3 ubiquitin-protein...   110   6e-22   Ceratotherium simum simum [southern square-lipped rhinoceros]
gi|383863227|ref|XP_003707083.1| PREDICTED: E3 ubiquitin-protein...   110   6e-22   Megachile rotundata
gi|164453037|ref|NP_001069873.2| E3 ubiquitin-protein ligase RNF...   110   6e-22   Bos taurus [bovine]
gi|297734999|emb|CBI17361.3| unnamed protein product [Vitis vini...   110   6e-22   Vitis vinifera
gi|4884104|emb|CAB43253.1| hypothetical protein [Homo sapiens]        110   6e-22   Homo sapiens [man]
gi|307190473|gb|EFN74498.1| RING finger protein 13 [Camponotus f...   109   7e-22   Camponotus floridanus
gi|410979837|ref|XP_003996287.1| PREDICTED: E3 ubiquitin-protein...   109   7e-22   
gi|328768378|gb|EGF78424.1| hypothetical protein BATDEDRAFT_2643...   109   1e-21   Batrachochytrium dendrobatidis JAM81
gi|168028812|ref|XP_001766921.1| predicted protein [Physcomitrel...   108   1e-21   Physcomitrella patens
gi|195038609|ref|XP_001990749.1| GH19534 [Drosophila grimshawi] ...   108   2e-21   Drosophila grimshawi
gi|224133660|ref|XP_002327649.1| predicted protein [Populus tric...   108   2e-21   
gi|195109971|ref|XP_001999555.1| GI23012 [Drosophila mojavensis]...   108   2e-21   
gi|7267651|emb|CAB78079.1| putative protein [Arabidopsis thaliana]    108   2e-21   Arabidopsis thaliana [mouse-ear cress]
gi|8778343|gb|AAF79351.1|AC007887_10 F15O4.19 [Arabidopsis thali...   108   3e-21   Arabidopsis thaliana [mouse-ear cress]
gi|297852010|ref|XP_002893886.1| predicted protein [Arabidopsis ...   107   3e-21   Arabidopsis lyrata subsp. lyrata
gi|41351101|gb|AAH65620.1| Ring finger protein 13 [Danio rerio]       107   3e-21   Danio rerio [leopard danio]
gi|148233415|ref|NP_001079892.1| uncharacterized protein LOC3795...   107   3e-21   Xenopus laevis [clawed frog]
gi|41054856|ref|NP_957338.1| ring finger protein 13 [Danio rerio...   107   3e-21   Danio rerio [leopard danio]
gi|322782489|gb|EFZ10438.1| hypothetical protein SINV_04750 [Sol...   107   3e-21   Solenopsis invicta [imported red fire ant]
gi|432854518|ref|XP_004067940.1| PREDICTED: E3 ubiquitin-protein...   107   3e-21   Oryzias latipes [Japanese rice fish]
gi|170050247|ref|XP_001859945.1| zinc finger protein [Culex quin...   107   3e-21   Culex quinquefasciatus
gi|301787345|ref|XP_002929081.1| PREDICTED: e3 ubiquitin-protein...   106   6e-21   Ailuropoda melanoleuca
gi|505788740|ref|XP_004605274.1| PREDICTED: E3 ubiquitin-protein...   106   7e-21   
gi|281343329|gb|EFB18913.1| hypothetical protein PANDA_019185 [A...   106   7e-21   Ailuropoda melanoleuca
gi|432102022|gb|ELK29842.1| Zinc/RING finger protein 4 [Myotis d...   106   1e-20   Myotis davidii
gi|482550564|gb|EOA14758.1| hypothetical protein CARUB_v10028055...   105   1e-20   Capsella rubella
gi|148908683|gb|ABR17449.1| unknown [Picea sitchensis]                104   2e-20   Picea sitchensis
gi|148703376|gb|EDL35323.1| ring finger protein 13, isoform CRA_...   104   3e-20   Mus musculus [mouse]
gi|507696250|ref|XP_004643365.1| PREDICTED: RING finger protein ...   103   4e-20   Octodon degus
gi|410915606|ref|XP_003971278.1| PREDICTED: E3 ubiquitin-protein...   103   4e-20   Takifugu rubripes [tiger puffer]
gi|168027185|ref|XP_001766111.1| predicted protein [Physcomitrel...   103   5e-20   Physcomitrella patens
gi|242005538|ref|XP_002423621.1| sperizin, RING finger protein, ...   103   6e-20   Pediculus humanus corporis [human body lice]
gi|149064727|gb|EDM14878.1| rCG50011, isoform CRA_c [Rattus norv...   103   7e-20   Rattus norvegicus [brown rat]
gi|395844712|ref|XP_003795099.1| PREDICTED: LOW QUALITY PROTEIN:...   103   7e-20   
gi|431893955|gb|ELK03761.1| E3 ubiquitin-protein ligase RNF167 [...   102   8e-20   Pteropus alecto
gi|326668275|ref|XP_002662262.2| PREDICTED: e3 ubiquitin-protein...   102   1e-19   
gi|459173360|ref|XP_002121719.2| PREDICTED: E3 ubiquitin-protein...   102   1e-19   
gi|168009680|ref|XP_001757533.1| predicted protein [Physcomitrel...   102   2e-19   Physcomitrella patens
gi|432899466|ref|XP_004076572.1| PREDICTED: E3 ubiquitin-protein...   101   2e-19   Oryzias latipes [Japanese rice fish]
gi|512908552|ref|XP_004901370.1| PREDICTED: E3 ubiquitin-protein...   100   4e-19   
gi|472351686|ref|XP_004395525.1| PREDICTED: LOW QUALITY PROTEIN:...   100   4e-19   Odobenus rosmarus divergens
gi|432091227|gb|ELK24432.1| RING finger protein 148 [Myotis davi...   100   4e-19   Myotis davidii
gi|256084210|ref|XP_002578324.1| zinc finger protein [Schistosom...   100   4e-19   
gi|507549664|ref|XP_004658645.1| PREDICTED: RING finger protein ...   100   5e-19   Jaculus jaculus
gi|256084206|ref|XP_002578322.1| zinc finger protein [Schistosom...   100   6e-19   
gi|348538752|ref|XP_003456854.1| PREDICTED: E3 ubiquitin-protein...   100   8e-19   
gi|488510399|ref|XP_004447287.1| PREDICTED: E3 ubiquitin-protein...    99   1e-18   
gi|395859874|ref|XP_003802254.1| PREDICTED: E3 ubiquitin-protein...    99   1e-18   
gi|226478932|emb|CAX72961.1| RING finger protein 13 [Schistosoma...    99   1e-18   Schistosoma japonicum
gi|156386240|ref|XP_001633821.1| predicted protein [Nematostella...    99   2e-18   Nematostella vectensis
gi|393231380|gb|EJD38973.1| hypothetical protein AURDEDRAFT_9174...    99   2e-18   Auricularia subglabra TFB-10046 SS5
gi|391334706|ref|XP_003741742.1| PREDICTED: E3 ubiquitin-protein...    98   2e-18   Metaseiulus occidentalis
gi|225711310|gb|ACO11501.1| RING finger protein 13 [Caligus roge...    98   2e-18   Caligus rogercresseyi
gi|12856076|dbj|BAB30557.1| unnamed protein product [Mus musculus]     98   2e-18   Mus musculus [mouse]
gi|26000653|gb|AAN75221.1| goliath-related E3 ubiquitin ligase 3...    98   3e-18   Mus musculus [mouse]
gi|254675281|ref|NP_082030.1| RING finger protein 148 precursor ...    97   4e-18   Mus musculus [mouse]
gi|149053217|gb|EDM05034.1| ring finger protein 167, isoform CRA...    97   4e-18   Rattus norvegicus [brown rat]
gi|432090751|gb|ELK24081.1| E3 ubiquitin-protein ligase RNF167 [...    97   4e-18   Myotis davidii
gi|513207026|ref|XP_004945008.1| PREDICTED: E3 ubiquitin-protein...    97   4e-18   
gi|363739014|ref|XP_414601.3| PREDICTED: E3 ubiquitin-protein li...    97   5e-18   Gallus gallus [bantam]
gi|414868934|tpg|DAA47491.1| TPA: putative protease-associated R...    97   5e-18   Zea mays [maize]
gi|512908548|ref|XP_004901369.1| PREDICTED: E3 ubiquitin-protein...    97   5e-18   
gi|194668808|ref|XP_595563.4| PREDICTED: zinc/RING finger protei...    97   5e-18   
gi|410952735|ref|XP_003983034.1| PREDICTED: RING finger protein ...    97   5e-18   Felis catus [cat]
gi|449474960|ref|XP_002195629.2| PREDICTED: E3 ubiquitin-protein...    97   6e-18   Taeniopygia guttata
gi|113911931|gb|AAI22824.1| ZNRF4 protein [Bos taurus]                 97   6e-18   Bos taurus [bovine]
gi|449267160|gb|EMC78126.1| Goliath like protein, partial [Colum...    97   6e-18   Columba livia [carrier pigeon]
gi|297476792|ref|XP_002688963.1| PREDICTED: zinc/RING finger pro...    97   6e-18   
gi|395505318|ref|XP_003756989.1| PREDICTED: E3 ubiquitin-protein...    97   8e-18   
gi|47212021|emb|CAF95427.1| unnamed protein product [Tetraodon n...    96   9e-18   Tetraodon nigroviridis
gi|215694851|dbj|BAG90042.1| unnamed protein product [Oryza sati...    96   9e-18   Oryza sativa Japonica Group [Japonica rice]
gi|512874374|ref|XP_004893419.1| PREDICTED: E3 ubiquitin-protein...    96   9e-18   
gi|334311270|ref|XP_001381191.2| PREDICTED: e3 ubiquitin-protein...    96   1e-17   
gi|224496062|ref|NP_001139044.1| RING finger protein 150 precurs...    96   1e-17   Danio rerio [leopard danio]
gi|465952058|gb|EMP24687.1| hypothetical protein UY3_18234 [Chel...    96   1e-17   Chelonia mydas [green seaturtle]
gi|440894099|gb|ELR46648.1| Zinc/RING finger protein 4, partial ...    96   1e-17   Bos mutus
gi|166795941|ref|NP_001107712.1| ring finger protein 130 precurs...    96   1e-17   
gi|134024402|gb|AAI35902.1| LOC100124963 protein [Xenopus (Silur...    96   1e-17   
gi|123959770|ref|NP_001074205.1| RING finger protein 148 precurs...    96   1e-17   
gi|326928675|ref|XP_003210501.1| PREDICTED: e3 ubiquitin-protein...    96   1e-17   
gi|504169395|ref|XP_004594308.1| PREDICTED: E3 ubiquitin-protein...    96   1e-17   
gi|300797473|ref|NP_001178011.1| RING finger protein 148 [Rattus...    96   2e-17   
gi|327265508|ref|XP_003217550.1| PREDICTED: e3 ubiquitin-protein...    95   2e-17   
gi|475595552|gb|EMT23074.1| hypothetical protein F775_01836 [Aeg...    95   3e-17   
gi|511878203|ref|XP_004759059.1| PREDICTED: E3 ubiquitin-protein...    95   3e-17   
gi|483507236|gb|EOA97885.1| Goliath-like protein, partial [Anas ...    95   3e-17   
gi|511878199|ref|XP_004759057.1| PREDICTED: E3 ubiquitin-protein...    95   3e-17   
gi|170089237|ref|XP_001875841.1| predicted protein [Laccaria bic...    95   3e-17   
gi|157132158|ref|XP_001662491.1| goliath E3 ubiquitin ligase [Ae...    94   3e-17   
gi|502161977|ref|XP_004512348.1| PREDICTED: uncharacterized prot...    94   3e-17   
gi|511989791|ref|XP_004812612.1| PREDICTED: E3 ubiquitin-protein...    94   3e-17   
gi|511878201|ref|XP_004759058.1| PREDICTED: E3 ubiquitin-protein...    94   3e-17   
gi|431892762|gb|ELK03195.1| Ras-GEF domain-containing family mem...    94   3e-17   
gi|395833640|ref|XP_003804021.1| PREDICTED: LOW QUALITY PROTEIN:...    94   4e-17   
gi|91081613|ref|XP_966546.1| PREDICTED: similar to goliath E3 ub...    94   4e-17   
gi|472369937|ref|XP_004404482.1| PREDICTED: RING finger protein ...    94   5e-17   
gi|351714500|gb|EHB17419.1| Goliath-like protein, partial [Heter...    94   5e-17   
gi|470291847|ref|XP_004343485.1| hypothetical protein CAOG_07611...    94   6e-17   
gi|512934473|ref|XP_004907668.1| PREDICTED: E3 ubiquitin-protein...    94   6e-17   
gi|511941404|ref|XP_004789488.1| PREDICTED: RING finger protein ...    94   6e-17   
gi|511834619|ref|XP_004741937.1| PREDICTED: RING finger protein ...    94   6e-17   
gi|392345650|ref|XP_003749329.1| PREDICTED: E3 ubiquitin-protein...    94   6e-17   
gi|512948663|ref|XP_004836796.1| PREDICTED: E3 ubiquitin-protein...    94   6e-17   
gi|363733104|ref|XP_003641201.1| PREDICTED: RING finger protein ...    94   6e-17   
gi|291410148|ref|XP_002721367.1| PREDICTED: ring finger protein ...    93   7e-17   
gi|511941406|ref|XP_004789489.1| PREDICTED: RING finger protein ...    93   7e-17   
gi|511834621|ref|XP_004741938.1| PREDICTED: RING finger protein ...    93   7e-17   
gi|296486233|tpg|DAA28346.1| TPA: ring finger protein 130 [Bos t...    93   7e-17   
gi|471411378|ref|XP_004387242.1| PREDICTED: E3 ubiquitin-protein...    93   7e-17   
gi|281351797|gb|EFB27381.1| hypothetical protein PANDA_010019 [A...    93   7e-17   
gi|395736598|ref|XP_002816366.2| PREDICTED: E3 ubiquitin-protein...    93   8e-17   
gi|440907942|gb|ELR58020.1| E3 ubiquitin-protein ligase RNF130, ...    93   8e-17   
gi|498978776|ref|XP_004549408.1| PREDICTED: RING finger protein ...    93   8e-17   
gi|355691932|gb|EHH27117.1| hypothetical protein EGK_17235, part...    93   8e-17   
gi|403256908|ref|XP_003921086.1| PREDICTED: RING finger protein ...    93   8e-17   
gi|153791581|ref|NP_001093178.1| E3 ubiquitin-protein ligase RNF...    93   8e-17   
gi|301771496|ref|XP_002921174.1| PREDICTED: goliath homolog, par...    93   8e-17   
gi|345322798|ref|XP_001507054.2| PREDICTED: E3 ubiquitin-protein...    93   8e-17   
gi|62089186|dbj|BAD93037.1| ring finger protein 130 variant [Hom...    93   8e-17   
gi|426230192|ref|XP_004009163.1| PREDICTED: E3 ubiquitin-protein...    93   9e-17   
gi|32425763|gb|AAH17100.2| RNF130 protein, partial [Homo sapiens]      93   9e-17   
gi|395853414|ref|XP_003799206.1| PREDICTED: E3 ubiquitin-protein...    93   9e-17   
gi|449271305|gb|EMC81765.1| RING finger protein 150 [Columba livia]    93   9e-17   
gi|29788758|ref|NP_060904.2| E3 ubiquitin-protein ligase RNF130 ...    93   9e-17   
gi|345777428|ref|XP_531881.3| PREDICTED: E3 ubiquitin-protein li...    93   9e-17   
gi|296193429|ref|XP_002744517.1| PREDICTED: E3 ubiquitin-protein...    93   9e-17   
gi|471410051|ref|XP_004391320.1| PREDICTED: LOW QUALITY PROTEIN:...    93   9e-17   
gi|472386747|ref|XP_004412723.1| PREDICTED: E3 ubiquitin-protein...    93   9e-17   
gi|488585697|ref|XP_004478199.1| PREDICTED: E3 ubiquitin-protein...    93   9e-17   
gi|119574158|gb|EAW53773.1| ring finger protein 130, isoform CRA...    93   9e-17   
gi|90441842|gb|AAI14473.1| RNF130 protein [Homo sapiens]               93   9e-17   
gi|119574157|gb|EAW53772.1| ring finger protein 130, isoform CRA...    93   9e-17   
gi|466079321|ref|XP_004284099.1| PREDICTED: E3 ubiquitin-protein...    93   9e-17   
gi|402873657|ref|XP_003900684.1| PREDICTED: E3 ubiquitin-protein...    93   1e-16   
gi|354486505|ref|XP_003505421.1| PREDICTED: E3 ubiquitin-protein...    93   1e-16   
gi|73976421|ref|XP_532535.2| PREDICTED: RING finger protein 148 ...    93   1e-16   
gi|470131780|ref|XP_004301769.1| PREDICTED: uncharacterized prot...    93   1e-16   
gi|357484513|ref|XP_003612544.1| RING finger protein [Medicago t...    92   1e-16   
gi|148701782|gb|EDL33729.1| ring finger protein 130, isoform CRA...    92   1e-16   
gi|148701781|gb|EDL33728.1| ring finger protein 130, isoform CRA...    92   1e-16   
gi|6175860|gb|AAF05310.1|AF171875_1 g1-related zinc finger prote...    92   1e-16   
gi|297459849|ref|XP_582694.4| PREDICTED: E3 ubiquitin-protein li...    92   1e-16   
gi|504165017|ref|XP_004592545.1| PREDICTED: RING finger protein ...    92   1e-16   
gi|297480110|ref|XP_002691197.1| PREDICTED: E3 ubiquitin-protein...    92   1e-16   
gi|511948739|ref|XP_004792825.1| PREDICTED: E3 ubiquitin-protein...    92   1e-16   
gi|511860446|ref|XP_004753102.1| PREDICTED: E3 ubiquitin-protein...    92   1e-16   
gi|83320103|ref|NP_001032747.1| E3 ubiquitin-protein ligase RNF1...    92   1e-16   
gi|31981195|ref|NP_067515.2| E3 ubiquitin-protein ligase RNF130 ...    92   1e-16   
gi|47222546|emb|CAG02911.1| unnamed protein product [Tetraodon n...    92   1e-16   
gi|47211328|emb|CAF96193.1| unnamed protein product [Tetraodon n...    92   1e-16   
gi|488527986|ref|XP_004485033.1| PREDICTED: LOW QUALITY PROTEIN:...    92   2e-16   
gi|488564241|ref|XP_004471814.1| PREDICTED: E3 ubiquitin-protein...    92   2e-16   
gi|478488852|ref|XP_004418808.1| PREDICTED: RING finger protein ...    92   2e-16   
gi|426227933|ref|XP_004008069.1| PREDICTED: RING finger protein ...    92   2e-16   
gi|313226923|emb|CBY22068.1| unnamed protein product [Oikopleura...    92   2e-16   
gi|302771708|ref|XP_002969272.1| hypothetical protein SELMODRAFT...    92   2e-16   
gi|301767294|ref|XP_002919065.1| PREDICTED: RING finger protein ...    92   2e-16   
gi|47206945|emb|CAF90643.1| unnamed protein product [Tetraodon n...    91   3e-16   
gi|348538050|ref|XP_003456505.1| PREDICTED: RING finger protein ...    91   3e-16   
gi|223943319|gb|ACN25743.1| unknown [Zea mays] >gi|414868935|tpg...    91   3e-16   
gi|356560617|ref|XP_003548587.1| PREDICTED: uncharacterized prot...    91   3e-16   
gi|471357745|ref|XP_004369461.1| PREDICTED: E3 ubiquitin-protein...    91   3e-16   
gi|356495268|ref|XP_003516501.1| PREDICTED: uncharacterized prot...    91   4e-16   
gi|149705819|ref|XP_001502246.1| PREDICTED: RING finger protein ...    91   4e-16   
gi|343427125|emb|CBQ70653.1| conserved hypothetical protein [Spo...    91   4e-16   
gi|345326230|ref|XP_001507758.2| PREDICTED: E3 ubiquitin-protein...    91   4e-16   
gi|398303834|ref|NP_001257653.1| RING finger protein 148 precurs...    91   4e-16   
gi|466048649|ref|XP_004277866.1| PREDICTED: E3 ubiquitin-protein...    91   4e-16   
gi|158290004|ref|XP_559104.3| AGAP010356-PA [Anopheles gambiae s...    91   5e-16   
gi|431911759|gb|ELK13907.1| RING finger protein 148 [Pteropus al...    90   6e-16   
gi|356529795|ref|XP_003533473.1| PREDICTED: uncharacterized prot...    90   6e-16   
gi|403294235|ref|XP_003938103.1| PREDICTED: E3 ubiquitin-protein...    90   6e-16   
gi|296210767|ref|XP_002807117.1| PREDICTED: LOW QUALITY PROTEIN:...    90   7e-16   
gi|242019016|ref|XP_002429963.1| protein goliath precursor, puta...    90   7e-16   
gi|164659948|ref|XP_001731098.1| hypothetical protein MGL_2097 [...    90   7e-16   
gi|348529600|ref|XP_003452301.1| PREDICTED: RING finger protein ...    90   8e-16   
gi|414868936|tpg|DAA47493.1| TPA: putative protease-associated R...    90   8e-16   
gi|342320847|gb|EGU12785.1| Hypothetical Protein RTG_00803 [Rhod...    90   8e-16   
gi|395539303|ref|XP_003771611.1| PREDICTED: RING finger protein ...    90   8e-16   
gi|403256906|ref|XP_003921085.1| PREDICTED: E3 ubiquitin-protein...    90   9e-16   
gi|507957781|ref|XP_004686071.1| PREDICTED: E3 ubiquitin-protein...    89   9e-16   
gi|310923322|ref|NP_001185635.1| RING finger protein 148 precurs...    89   1e-15   
gi|410918061|ref|XP_003972504.1| PREDICTED: RING finger protein ...    89   1e-15   
gi|281364272|ref|NP_523864.3| goliath, isoform C [Drosophila mel...    89   1e-15   
gi|327273898|ref|XP_003221716.1| PREDICTED: RING finger protein ...    89   1e-15   
gi|472585882|gb|EMS23424.1| PA domain containing zinc finger, C3...    89   1e-15   
gi|194886971|ref|XP_001976721.1| GG19861 [Drosophila erecta] >gi...    89   1e-15   
gi|24762824|ref|NP_726508.1| goliath, isoform B [Drosophila mela...    89   1e-15   
gi|195489910|ref|XP_002092938.1| GE11386 [Drosophila yakuba] >gi...    89   1e-15   
gi|350582073|ref|XP_003124931.3| PREDICTED: E3 ubiquitin-protein...    89   2e-15   
gi|195353364|ref|XP_002043175.1| GM11764 [Drosophila sechellia] ...    89   2e-15   
gi|281364274|ref|NP_001163300.1| goliath, isoform D [Drosophila ...    89   2e-15   
gi|222631461|gb|EEE63593.1| hypothetical protein OsJ_18410 [Oryz...    89   2e-15   
gi|125552196|gb|EAY97905.1| hypothetical protein OsI_19822 [Oryz...    89   2e-15   
gi|472373057|ref|XP_004406004.1| PREDICTED: RING finger protein ...    89   2e-15   
gi|196011289|ref|XP_002115508.1| hypothetical protein TRIADDRAFT...    89   2e-15   
gi|114579222|ref|XP_515662.2| PREDICTED: E3 ubiquitin-protein li...    89   2e-15   
gi|505792815|ref|XP_004606259.1| PREDICTED: RING finger protein ...    89   2e-15   
gi|62955085|ref|NP_001017554.1| RING finger protein 150 precurso...    89   2e-15   
gi|297681372|ref|XP_002818429.1| PREDICTED: RING finger protein ...    89   2e-15   
gi|115463671|ref|NP_001055435.1| Os05g0389600 [Oryza sativa Japo...    88   2e-15   
gi|505775070|ref|XP_004602107.1| PREDICTED: RING finger protein ...    88   2e-15   
gi|410956855|ref|XP_003985052.1| PREDICTED: RING finger protein ...    88   2e-15   
gi|300797709|ref|NP_001178022.1| RING finger protein 150 precurs...    88   2e-15   
gi|508778143|gb|EOY25399.1| RING/U-box superfamily protein, puta...    88   2e-15   
gi|296223107|ref|XP_002757475.1| PREDICTED: E3 ubiquitin-protein...    88   2e-15   
gi|413924199|gb|AFW64131.1| putative RING zinc finger domain sup...    88   2e-15   
gi|308081112|ref|NP_001183423.1| uncharacterized protein LOC1005...    88   2e-15   
gi|402594357|gb|EJW88283.1| RING finger protein [Wuchereria banc...    88   2e-15   
gi|482682975|ref|XP_004444260.1| GA15425, isoform C [Drosophila ...    88   3e-15   
gi|402864651|ref|XP_003896569.1| PREDICTED: RING finger protein ...    88   3e-15   
gi|388851839|emb|CCF54433.1| uncharacterized protein [Ustilago h...    88   3e-15   
gi|388522979|gb|AFK49551.1| unknown [Medicago truncatula]              88   3e-15   
gi|356560853|ref|XP_003548701.1| PREDICTED: uncharacterized prot...    88   3e-15   
gi|224074629|ref|XP_002304401.1| predicted protein [Populus tric...    88   3e-15   
gi|413941571|gb|AFW74220.1| putative protease-associated RING zi...    88   3e-15   
gi|170577717|ref|XP_001894112.1| RING finger domain containing p...    88   3e-15   
gi|393907110|gb|EFO18718.2| hypothetical protein LOAG_09777 [Loa...    88   3e-15   
gi|312087138|ref|XP_003145352.1| hypothetical protein LOAG_09777...    88   3e-15   
gi|443895189|dbj|GAC72535.1| predicted E3 ubiquitin ligase [Pseu...    88   3e-15   
gi|147812656|emb|CAN68374.1| hypothetical protein VITISV_033239 ...    87   4e-15   
gi|465972369|ref|XP_004263638.1| PREDICTED: RING finger protein ...    87   4e-15   
gi|260800644|ref|XP_002595208.1| hypothetical protein BRAFLDRAFT...    87   4e-15   
gi|195154835|ref|XP_002018318.1| GL16830 [Drosophila persimilis]...    87   4e-15   
gi|224137078|ref|XP_002327016.1| predicted protein [Populus tric...    87   5e-15   
gi|344284023|ref|XP_003413770.1| PREDICTED: E3 ubiquitin-protein...    87   5e-15   
gi|488564608|ref|XP_004471993.1| PREDICTED: RING finger protein ...    87   5e-15   
gi|488510397|ref|XP_004447286.1| PREDICTED: E3 ubiquitin-protein...    87   5e-15   
gi|297293422|ref|XP_002804252.1| PREDICTED: RING finger protein ...    87   5e-15   
gi|482682973|ref|XP_001361150.3| GA15425, isoform B [Drosophila ...    87   5e-15   
gi|512883664|ref|XP_002943385.2| PREDICTED: E3 ubiquitin-protein...    87   5e-15   
gi|194756348|ref|XP_001960441.1| GF11510 [Drosophila ananassae] ...    87   5e-15   
gi|225427655|ref|XP_002270708.1| PREDICTED: uncharacterized prot...    87   6e-15   
gi|301783245|ref|XP_002927037.1| PREDICTED: LOW QUALITY PROTEIN:...    87   6e-15   
gi|311275534|ref|XP_003134781.1| PREDICTED: RING finger protein ...    87   6e-15   
gi|284447287|ref|NP_775918.2| E3 ubiquitin-protein ligase RNF149...    87   6e-15   
gi|195606966|gb|ACG25313.1| zinc finger, C3HC4 type family prote...    87   6e-15   
gi|291401194|ref|XP_002716990.1| PREDICTED: ring finger protein ...    87   6e-15   
gi|119622223|gb|EAX01818.1| ring finger protein 149, isoform CRA...    87   6e-15   
gi|511881190|ref|XP_004760491.1| PREDICTED: E3 ubiquitin-protein...    87   6e-15   
gi|109104010|ref|XP_001106945.1| PREDICTED: e3 ubiquitin-protein...    87   6e-15   
gi|296085485|emb|CBI29217.3| unnamed protein product [Vitis vini...    87   7e-15   
gi|37537242|gb|AAH32328.2| Ring finger protein 149 [Homo sapiens]      87   7e-15   
gi|403272443|ref|XP_003928072.1| PREDICTED: RING finger protein ...    87   7e-15   
gi|297666917|ref|XP_002811748.1| PREDICTED: E3 ubiquitin-protein...    87   7e-15   
gi|358337587|dbj|GAA55949.1| E3 ubiquitin-protein ligase RNF167 ...    87   7e-15   
gi|462405989|gb|EMJ11453.1| hypothetical protein PRUPE_ppa003419...    87   7e-15   
gi|332820397|ref|XP_003310571.1| PREDICTED: RING finger protein ...    87   7e-15   
gi|395735356|ref|XP_003776575.1| PREDICTED: RING finger protein ...    87   7e-15   
gi|395735354|ref|XP_002815210.2| PREDICTED: RING finger protein ...    87   8e-15   
gi|472373059|ref|XP_004406005.1| PREDICTED: RING finger protein ...    87   8e-15   
gi|119622225|gb|EAX01820.1| ring finger protein 149, isoform CRA...    87   8e-15   
gi|90991708|ref|NP_796352.2| RING finger protein 150 precursor [...    87   8e-15   
gi|22760787|dbj|BAC11334.1| unnamed protein product [Homo sapien...    86   8e-15   
gi|22761039|dbj|BAC11430.1| unnamed protein product [Homo sapiens]     86   8e-15   
gi|114615707|ref|XP_001146959.1| PREDICTED: RING finger protein ...    86   8e-15   
gi|58331204|ref|NP_065775.1| RING finger protein 150 precursor [...    86   8e-15   
gi|119622224|gb|EAX01819.1| ring finger protein 149, isoform CRA...    86   9e-15   
gi|507667386|ref|XP_004707833.1| PREDICTED: RING finger protein ...    86   9e-15   
gi|74353727|gb|AAI01993.1| RNF150 protein [Homo sapiens]               86   9e-15   
gi|351707330|gb|EHB10249.1| RING finger protein 150 [Heterocepha...    86   9e-15   
gi|332217291|ref|XP_003257792.1| PREDICTED: RING finger protein ...    86   9e-15   
gi|149698202|ref|XP_001502278.1| PREDICTED: RING finger protein ...    86   9e-15   
gi|224135567|ref|XP_002327250.1| predicted protein [Populus tric...    86   9e-15   
gi|354483300|ref|XP_003503832.1| PREDICTED: RING finger protein ...    86   9e-15   
gi|512837999|ref|XP_004921348.1| PREDICTED: LOW QUALITY PROTEIN:...    86   9e-15   
gi|397500046|ref|XP_003820738.1| PREDICTED: RING finger protein ...    86   9e-15   
gi|513015218|ref|XP_004868949.1| PREDICTED: RING finger protein ...    86   9e-15   
gi|512884798|ref|XP_004896080.1| PREDICTED: RING finger protein ...    86   1e-14   
gi|512838002|ref|XP_004883842.1| PREDICTED: RING finger protein ...    86   1e-14   
gi|512937617|ref|XP_004908433.1| PREDICTED: LOW QUALITY PROTEIN:...    86   1e-14   
gi|93115134|gb|ABE98240.1| ring finger protein 128-like [Oreochr...    86   1e-14   
gi|511897878|ref|XP_004768518.1| PREDICTED: RING finger protein ...    86   1e-14   
gi|301767616|ref|XP_002919228.1| PREDICTED: e3 ubiquitin-protein...    86   1e-14   
gi|426247015|ref|XP_004017282.1| PREDICTED: RING finger protein ...    86   1e-14   
gi|6755338|ref|NP_036013.1| E3 ubiquitin-protein ligase RNF13 is...    86   1e-14   
gi|355687624|gb|EHH26208.1| hypothetical protein EGK_16119, part...    86   1e-14   
gi|332251563|ref|XP_003274914.1| PREDICTED: uncharacterized prot...    86   1e-14   
gi|126340629|ref|XP_001365432.1| PREDICTED: e3 ubiquitin-protein...    86   1e-14   
gi|355749588|gb|EHH53987.1| hypothetical protein EGM_14716, part...    86   2e-14   
gi|302797170|ref|XP_002980346.1| hypothetical protein SELMODRAFT...    86   2e-14   
gi|478504458|ref|XP_004426528.1| PREDICTED: RING finger protein ...    86   2e-14   
gi|395834484|ref|XP_003790231.1| PREDICTED: RING finger protein ...    86   2e-14   
gi|395843244|ref|XP_003794405.1| PREDICTED: E3 ubiquitin-protein...    86   2e-14   
gi|242087807|ref|XP_002439736.1| hypothetical protein SORBIDRAFT...    86   2e-14   
gi|26331532|dbj|BAC29496.1| unnamed protein product [Mus musculu...    86   2e-14   
gi|224139174|ref|XP_002326786.1| predicted protein [Populus tric...    85   2e-14   
gi|413945227|gb|AFW77876.1| putative RING zinc finger domain sup...    85   2e-14   
gi|449512895|ref|XP_004164172.1| PREDICTED: uncharacterized LOC1...    85   2e-14   
gi|402891731|ref|XP_003909094.1| PREDICTED: E3 ubiquitin-protein...    85   2e-14   
gi|426357708|ref|XP_004046176.1| PREDICTED: RING finger protein ...    85   2e-14   
gi|507543815|ref|XP_004655891.1| PREDICTED: RING finger protein ...    85   2e-14   
gi|449465663|ref|XP_004150547.1| PREDICTED: uncharacterized prot...    85   2e-14   
gi|302692928|ref|XP_003036143.1| hypothetical protein SCHCODRAFT...    85   2e-14   
gi|471407883|ref|XP_004385527.1| PREDICTED: RING finger protein ...    85   2e-14   
gi|444724961|gb|ELW65546.1| RING finger protein 148 [Tupaia chin...    85   2e-14   
gi|512991190|ref|XP_004857362.1| PREDICTED: E3 ubiquitin-protein...    85   2e-14   


>gi|511004755|gb|EPB86115.1| hypothetical protein HMPREF1544_07103 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 281

 Score =  260 bits (664), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 131/255 (51%), Positives = 173/255 (67%), Gaps = 18/255 (7%)

Query: 29  VDATIVVVATNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQW 88
           V A+++V+ATN TY DRIA+FGPRL+  G +GYLV        +  GC K++  AP   W
Sbjct: 17  VHASLLVIATNETYADRIASFGPRLSTNGKVGYLVE----PLADPTGCKKVE--APCMDW 70

Query: 89  IALVERGQCTFIEKVRNMQASGAIAVVVGDNE-KNGLITMYATGDTSDVNIPSVFIAQTE 147
           +ALV RG C+FI KVRNMQ SGAIAV VGD E ++G ITMYA G+        VF+A+ E
Sbjct: 71  VALVRRGGCSFITKVRNMQESGAIAVAVGDPEHQSGWITMYAPGN--------VFLAKNE 122

Query: 148 YKDLRSSSL---KPVEVHLVKDNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           Y+ L   S     P+ + L  D+ + WPLLD+++++ +SP++MMIFIY+ W         
Sbjct: 123 YRALLYLSKIVDTPMMILLQLDDFITWPLLDILMIIFVSPSIMMIFIYISWQLRQKRRKQ 182

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
            ++AP  VV  L  K F   K +ENE +ECAICLEDY +G+ELR+LPCKH+FH  C+D+W
Sbjct: 183 QEVAPIDVVSRLLMKQFLTEKVKENEAEECAICLEDYVNGEELRVLPCKHDFHTFCVDAW 242

Query: 265 LTTRKKFCPICKRDI 279
           LTT+KKFCPICKRDI
Sbjct: 243 LTTQKKFCPICKRDI 257



>gi|511001856|gb|EPB83313.1| hypothetical protein HMPREF1544_09959 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 285

 Score =  259 bits (662), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 143/272 (52%), Positives = 178/272 (65%), Gaps = 22/272 (8%)

Query: 38  TNVTYQDRIAAFGPRLTDE-GLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIALVERGQ 96
           +N T  DRIAAFGPR+  E G+ G+L++     AN+  GC  +      + WIALVERGQ
Sbjct: 16  SNDTLVDRIAAFGPRIDGEIGITGHLLAPPA--ANDSYGCIAVPNPN-IKNWIALVERGQ 72

Query: 97  CTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDL----- 151
           C+F++KV+ MQ SGAIAVVVGD   NG +TMYA GDTSDV+IPSVF+AQ +YK L     
Sbjct: 73  CSFLQKVKTMQDSGAIAVVVGDKHFNGWVTMYAPGDTSDVHIPSVFVAQHQYKALLQLFD 132

Query: 152 RSSSLKPVEVHLVKDNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQ 211
             ++  PV V L  D+LL WPLLD+++VV+LSP VMM+FIY+ W          DIAP  
Sbjct: 133 SKNTTTPVAVRLSGDDLLTWPLLDMLLVVVLSPAVMMLFIYLTWQLRQRQRRKNDIAPTN 192

Query: 212 VVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKF 271
            V  L T +F   K  + E  ECAICLEDY +GD+LR LPCKHEFH  C+D+WLT+ KKF
Sbjct: 193 FVAKLPTYVFRREKIVDIEHAECAICLEDYIEGDQLRTLPCKHEFHAKCVDAWLTSHKKF 252

Query: 272 CPICKRDICS-------------PTEETPLLS 290
           CPICK DIC              P+E TPLL+
Sbjct: 253 CPICKFDICQKTESSKSNNSSIPPSERTPLLN 284



>gi|511008408|gb|EPB89674.1| hypothetical protein HMPREF1544_03473 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 292

 Score =  257 bits (657), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 138/275 (50%), Positives = 181/275 (65%), Gaps = 19/275 (6%)

Query: 26  NFVVDATIVVVATNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT 85
           +FV  +T V ++ N T++DR AAFGPR++  G +G++V      + +  GCS ++   P 
Sbjct: 16  SFVYASTHVTIS-NETFEDRSAAFGPRISSNGKIGFIVE----PSQDPTGCSIVE--PPC 68

Query: 86  EQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQ 145
             WIALV+RG C+FI KVR MQ SGA+AVVVGD E  G ITMYA GDTSDV IPSVF+A 
Sbjct: 69  SDWIALVKRGGCSFITKVRYMQKSGAVAVVVGDPEHPGWITMYAPGDTSDVTIPSVFLAT 128

Query: 146 TEY-KDLRSSSL--KPVEVHLVKDNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXX 202
            EY K L  S L   P+   L  D+++ WPL+D++I+V++SP +M+I IY+ W       
Sbjct: 129 KEYNKILHLSKLLDTPMMAVLQYDDIVTWPLIDILIIVVVSPCIMLILIYISWKIRQGVQ 188

Query: 203 XXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCID 262
              ++AP  VV  L  KIF +   +E EP  CAICLEDY  G+ELR+LPC H+FH  C+D
Sbjct: 189 RRRELAPVSVVSKLTVKIF-KLDEKEQEPDSCAICLEDYQSGNELRLLPCNHQFHTLCVD 247

Query: 263 SWLTTRKKFCPICKRDI-CSPT-------EETPLL 289
           +WLTT+KK CPICKRDI C+ T       E TPLL
Sbjct: 248 AWLTTQKKLCPICKRDITCNDTGYRDKKDEVTPLL 282



>gi|384498957|gb|EIE89448.1| hypothetical protein RO3G_14159 [Rhizopus delemar RA 99-880]
          Length = 261

 Score =  226 bits (576), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 116/247 (46%), Positives = 156/247 (63%), Gaps = 15/247 (6%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIALVERGQC 97
           +N T  D IAAFGPR++  G LG+L         +  GC+ +    P   WIALV+RG C
Sbjct: 8   SNETLLDHIAAFGPRISLNGKLGFLAE----SVTDPNGCNIVD--PPCTDWIALVKRGGC 61

Query: 98  TFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYK---DLRSS 154
           +F+ KVR MQ SGA+AVVVGD+EK+G ITM+++GDTSD+ IPSVF+A+ EYK    L   
Sbjct: 62  SFVTKVRMMQKSGAVAVVVGDSEKSGWITMFSSGDTSDIVIPSVFLAKNEYKRILHLLKL 121

Query: 155 SLKPVEVHL-VKDNLLQWPL-LDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQV 212
              P+ + L   D+++ WP+  D+  ++ILSP +M++F Y+LW           +A    
Sbjct: 122 LKSPLMIVLQSNDDIVDWPITTDLFFIIILSPCIMLLFTYILWKIRQFIRIRKQLASASA 181

Query: 213 VGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFC 272
           V  L  KIF E    + E   CAICLEDY  G ELR+LPC H+FH  C+D+WL T++K C
Sbjct: 182 VSKLGIKIFNE----KEEESCCAICLEDYEKGSELRLLPCNHQFHTFCVDAWLMTQRKLC 237

Query: 273 PICKRDI 279
           PICKRDI
Sbjct: 238 PICKRDI 244



>gi|384499107|gb|EIE89598.1| hypothetical protein RO3G_14309 [Rhizopus delemar RA 99-880]
          Length = 230

 Score =  162 bits (410), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 96/249 (38%), Positives = 135/249 (54%), Gaps = 30/249 (12%)

Query: 29  VDATIVVVATNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQW 88
           V  +I V ATN TYQ + A+FGP L++   +GYL+        +  GC  +    P   W
Sbjct: 3   VYCSIYVFATNTTYQTKSASFGPTLSNSDKVGYLLQ----PLEDPTGCQLVT--TPFANW 56

Query: 89  IALVERGQCTFIEKVRNMQASGAIAVVVGDNE-KNGLITMYATGDTSDVNIPSVFIAQTE 147
           IAL++RG C+   KVRNMQ SGA+AV +GD E K+   TMY              +A+ E
Sbjct: 57  IALIKRGSCSVATKVRNMQQSGAVAVAIGDLELKSSWFTMYT-------------LAKNE 103

Query: 148 YKDLRSSSL---KPVEVHLVKDNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           YK L   S     P+ + L +D  + WPLLD +I+V +SP+VM++ IY+           
Sbjct: 104 YKTLLYLSELTDAPLMILLQRDQHMNWPLLDAMIIVFVSPSVMLVIIYIF--RQLKQQMH 161

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQE--CAICLEDYADGDELRILPCKHEFHITCID 262
            D   +     LA+ + ++   QE    E  CAICLEDY  G+ LR+LPC H +H  C+D
Sbjct: 162 HDGLTET---TLASLVLWQFTTQEEYGAESCCAICLEDYFKGEILRLLPCHHGYHAKCVD 218

Query: 263 SWLTTRKKF 271
           +WL T+K F
Sbjct: 219 AWLLTKKGF 227



>gi|125559849|gb|EAZ05297.1| hypothetical protein OsI_27502 [Oryza sativa Indica Group]
          Length = 442

 Score =  147 bits (370), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 97/279 (34%), Positives = 152/279 (54%), Gaps = 27/279 (9%)

Query: 33  IVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTE--QW 88
           +V++A N T  + D  A F P + D G+ G + +VE ++A     CS L++KA       
Sbjct: 9   VVLIANNTTLSFDDVEATFTPEVKDSGVNGAIYAVEPLDA-----CSPLRKKAANGPVSP 63

Query: 89  IALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEY 148
            ALV RG C F +KVRN Q +G  AV+V D+E +G++   A G +S + I +VF+++   
Sbjct: 64  FALVIRGGCQFDDKVRNAQNAGFKAVIVYDDEDSGVLVSMA-GSSSGIYIYAVFLSKASG 122

Query: 149 KDLRS-SSLKPVEVHL--VKDNLLQWPLLDVIIVVILS-PTVMMIFIYVLWXXXXXXXXX 204
           + L+  S    VEV +  V +N   W ++ +    +L+   V+    +V           
Sbjct: 123 EVLKKYSGQSDVEVWILPVYENS-AWSIMAISFTSLLAMAAVLATCFFVRRHQIRRDRGR 181

Query: 205 XDIAPQ------QVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHI 258
             +  +      Q+V  + + IF + +   +    CAICLEDY+ G++LR+LPC+H+FH 
Sbjct: 182 IPVTREFHGMSSQLVKAMPSLIFTKVQEDNSTSSSCAICLEDYSFGEKLRVLPCRHKFHA 241

Query: 259 TCIDSWLTTRKKFCPICKRDICSPT------EETPLLSN 291
           TC+D WLT+ K FCP+CKRD  + T      E TPLLS+
Sbjct: 242 TCVDMWLTSWKTFCPVCKRDASAGTSKPPASESTPLLSS 280



>gi|222639768|gb|EEE67900.1| hypothetical protein OsJ_25742 [Oryza sativa Japonica Group]
          Length = 442

 Score =  147 bits (370), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 97/279 (34%), Positives = 152/279 (54%), Gaps = 27/279 (9%)

Query: 33  IVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTE--QW 88
           +V++A N T  + D  A F P + D G+ G + +VE ++A     CS L++KA       
Sbjct: 9   VVLIANNTTLSFDDVEATFTPEVKDSGVNGAIYAVEPLDA-----CSPLRKKAANGPVSP 63

Query: 89  IALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEY 148
            ALV RG C F +KVRN Q +G  AV+V D+E +G++   A G +S + I +VF+++   
Sbjct: 64  FALVIRGGCQFDDKVRNAQNAGFKAVIVYDDEDSGVLVSMA-GSSSGIYIYAVFLSKASG 122

Query: 149 KDLRS-SSLKPVEVHL--VKDNLLQWPLLDVIIVVILS-PTVMMIFIYVLWXXXXXXXXX 204
           + L+  S    VEV +  V +N   W ++ +    +L+   V+    +V           
Sbjct: 123 EVLKKYSGQSDVEVWILPVYENS-AWSIMAISFTSLLAMAAVLATCFFVRRHQIRRDRGR 181

Query: 205 XDIAPQ------QVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHI 258
             +  +      Q+V  + + IF + +   +    CAICLEDY+ G++LR+LPC+H+FH 
Sbjct: 182 IPVTREFHGMSSQLVKAMPSLIFTKVQEDNSTSSSCAICLEDYSFGEKLRVLPCRHKFHA 241

Query: 259 TCIDSWLTTRKKFCPICKRDICSPT------EETPLLSN 291
           TC+D WLT+ K FCP+CKRD  + T      E TPLLS+
Sbjct: 242 TCVDMWLTSWKTFCPVCKRDASAGTSKPPASESTPLLSS 280



>gi|115474361|ref|NP_001060777.1| Os08g0104300 [Oryza sativa Japonica Group]
 gi|50725711|dbj|BAD33177.1| putative ReMembR-H2 protein [Oryza sativa Japonica Group]
 gi|113622746|dbj|BAF22691.1| Os08g0104300 [Oryza sativa Japonica Group]
 gi|215715363|dbj|BAG95114.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 495

 Score =  147 bits (370), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 97/279 (34%), Positives = 152/279 (54%), Gaps = 27/279 (9%)

Query: 33  IVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTE--QW 88
           +V++A N T  + D  A F P + D G+ G + +VE ++A     CS L++KA       
Sbjct: 62  VVLIANNTTLSFDDVEATFTPEVKDSGVNGAIYAVEPLDA-----CSPLRKKAANGPVSP 116

Query: 89  IALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEY 148
            ALV RG C F +KVRN Q +G  AV+V D+E +G++   A G +S + I +VF+++   
Sbjct: 117 FALVIRGGCQFDDKVRNAQNAGFKAVIVYDDEDSGVLVSMA-GSSSGIYIYAVFLSKASG 175

Query: 149 KDLRS-SSLKPVEVHL--VKDNLLQWPLLDVIIVVILS-PTVMMIFIYVLWXXXXXXXXX 204
           + L+  S    VEV +  V +N   W ++ +    +L+   V+    +V           
Sbjct: 176 EVLKKYSGQSDVEVWILPVYENS-AWSIMAISFTSLLAMAAVLATCFFVRRHQIRRDRGR 234

Query: 205 XDIAPQ------QVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHI 258
             +  +      Q+V  + + IF + +   +    CAICLEDY+ G++LR+LPC+H+FH 
Sbjct: 235 IPVTREFHGMSSQLVKAMPSLIFTKVQEDNSTSSSCAICLEDYSFGEKLRVLPCRHKFHA 294

Query: 259 TCIDSWLTTRKKFCPICKRDICSPT------EETPLLSN 291
           TC+D WLT+ K FCP+CKRD  + T      E TPLLS+
Sbjct: 295 TCVDMWLTSWKTFCPVCKRDASAGTSKPPASESTPLLSS 333



>gi|501755429|emb|CCG81348.1| Uncharacterized RING finger protein C57A7.09 [Taphrina deformans
           PYCC 5710]
          Length = 371

 Score =  145 bits (367), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 88/257 (34%), Positives = 135/257 (52%), Gaps = 21/257 (8%)

Query: 39  NVTYQDRIAAFGPRLTDEGLLGYLVSVEM--------IEANNQKGCSKLKRKAPTEQ--- 87
           N T + R+AAFG  + D   +   ++ ++        +   +    +K K ++PTE+   
Sbjct: 50  NHTLRARLAAFGANIEDRRPVNLSLTFDLNLGCDLDSLRQGHVSSETKKKHQSPTEESDE 109

Query: 88  WIALVERGQCTFIEKVRNMQASGAIAVVVGDNEK--NGLITMYATGDTSDVNIPSVFIAQ 145
           WI L+ RG+C+FI KVRN QA+G   V++GD+    + L+TM+A     DV IPS+F+  
Sbjct: 110 WILLM-RGECSFINKVRNAQAAGYEGVIIGDDGSSYDSLVTMFARF-ADDVVIPSLFVTH 167

Query: 146 TEYKDLRSSSLKPVEVHLVKDN---LLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXX 202
             Y  LR ++     + +  D       WPLLD ++ +  SP   +  +YV+        
Sbjct: 168 QSYVVLREAAAGEPFLQITTDTSEMRTDWPLLDTLVFICFSPLCTLFIVYVVLYFRRRRL 227

Query: 203 XXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCID 262
              +I P   +  L T + + +K   N   EC ICLE++ D ++L  LPCKH +H  CI 
Sbjct: 228 HLNNILPPAYLSKLET-VDYMAKDGVN--AECVICLENFQDEEKLLELPCKHLYHGDCIR 284

Query: 263 SWLTTRKKFCPICKRDI 279
            WL  RKK CPICKRD+
Sbjct: 285 KWLIERKKLCPICKRDV 301



>gi|326488691|dbj|BAJ97957.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326523861|dbj|BAJ96941.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 520

 Score =  144 bits (363), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 96/285 (33%), Positives = 151/285 (52%), Gaps = 27/285 (9%)

Query: 32  TIVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKA---PTE 86
           ++V++A N T  + D  A F P +   GL G + +VE ++A     CS L +KA   P  
Sbjct: 34  SVVLMANNTTLSFSDVEATFTPEVKGSGLNGVIYTVEPLDA-----CSPLTKKAVEGPVS 88

Query: 87  QWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQT 146
            + ALV RG C F +KVRN Q +G  AV+V DN+ +G++   A G +S ++I +VFI++T
Sbjct: 89  PF-ALVLRGGCQFDDKVRNAQDAGFKAVIVYDNKDHGVLVSMA-GSSSGIDIYAVFISKT 146

Query: 147 EYKDLRSSSLKP---VEVHLVKDNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXX 203
             + L+  S +    V +   +DN     +      ++    V+    +V          
Sbjct: 147 SGEVLKKYSGQSDAQVWIISTRDNSALSIMAISFTALVAMSAVLATCFFVRRHQMRRDRV 206

Query: 204 XXDIAPQ------QVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFH 257
               A +      Q+V  + + IF + +        CAICLEDY+ G+++R+LPC+H+FH
Sbjct: 207 RIPAAREFHGMSSQLVKAMPSLIFTKVQEDNCTSSTCAICLEDYSVGEKIRVLPCRHKFH 266

Query: 258 ITCIDSWLTTRKKFCPICKRDICS------PTEETPLLSNHEPTP 296
             C+D WLT+ + FCP+CKRD  +      P+E TPLLS+  P P
Sbjct: 267 AACVDLWLTSWRTFCPVCKRDANAGTSNLPPSESTPLLSSAIPLP 311



>gi|336370166|gb|EGN98507.1| hypothetical protein SERLA73DRAFT_183556 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336382931|gb|EGO24081.1| hypothetical protein SERLADRAFT_470789 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 434

 Score =  143 bits (361), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 101/339 (29%), Positives = 155/339 (45%), Gaps = 88/339 (25%)

Query: 29  VDATIVVV--ATNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEA----NNQK-------- 74
            ++T+ VV  + +++Y  R AAFGP L D  LLGY++ +    +    N+ K        
Sbjct: 47  AESTVSVVDRSPSLSYPARPAAFGPEL-DLPLLGYVIPMSSFTSPCPDNDSKAVFDEASN 105

Query: 75  -GCSKL-----KRKAPTEQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNE------KN 122
            GC  L         P E WIALV+RG C F++KVR  Q  GA AVVVG  +       +
Sbjct: 106 FGCPTLCVSGPHEPDPKESWIALVQRGHCPFVDKVREAQRLGARAVVVGGEDPKVSGFPD 165

Query: 123 GLITMYATGDTSDVNIPSVFIAQTEYKDL---------RSSSLKPVEVHLVKDNLLQW-- 171
            L+ MY+ GD SDV IPS +I  +++K+L           + L+ + + L+      W  
Sbjct: 166 TLVNMYSKGDASDVTIPSSYITYSDFKELSYLIETSNTSHAGLRTLSL-LISTQYSSWEW 224

Query: 172 --PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVVGNLATKIFFESKRQEN 229
             P++  I+++IL P+ +     ++           D APQ +V +L  +++  +  +++
Sbjct: 225 YSPIITFIVILIL-PSCLTFITLLIHRVRMARAAERDRAPQDMVKSLPWRVWTGTGWEKH 283

Query: 230 E-----PQ-----------------------------------------ECAICLEDYAD 243
           E     PQ                                         ECAICL ++  
Sbjct: 284 EGIVPLPQPSSSTSHTVDLESGLPAEALSESTSQDANTPIAMPWFETQMECAICLSEFVK 343

Query: 244 GDELRILPCKHEFHITCIDSWLTTRKKFCPICKRDICSP 282
           GD +R LPC H FH+  +D WL  RKK CP+CK D+  P
Sbjct: 344 GDRVRELPCHHIFHLDEVDEWLINRKKLCPVCKADVTQP 382



>gi|226531065|ref|NP_001147957.1| RING finger protein 13 precursor [Zea mays]
 gi|194705778|gb|ACF86973.1| unknown [Zea mays]
 gi|195614812|gb|ACG29236.1| RING finger protein 13 [Zea mays]
 gi|223942859|gb|ACN25513.1| unknown [Zea mays]
 gi|223949133|gb|ACN28650.1| unknown [Zea mays]
 gi|414868931|tpg|DAA47488.1| TPA: putative protease-associated RING zinc finger domain family
           protein isoform 1 [Zea mays]
 gi|414868932|tpg|DAA47489.1| TPA: putative protease-associated RING zinc finger domain family
           protein isoform 2 [Zea mays]
 gi|414868933|tpg|DAA47490.1| TPA: putative protease-associated RING zinc finger domain family
           protein isoform 3 [Zea mays]
          Length = 501

 Score =  142 bits (357), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 95/283 (33%), Positives = 152/283 (53%), Gaps = 29/283 (10%)

Query: 30  DATIVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKA---P 84
           DA +V++  N+T  + D  A+F P +   G+ G + + E + A     CS L  KA   P
Sbjct: 20  DANVVLLGNNLTLSFADIEASFSPGVKGSGVNGIVYASEPLNA-----CSPLTIKAVKGP 74

Query: 85  TEQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIA 144
              + AL+ RG CTF EKV+N Q +G  A +V DNE +G++   A G +S ++I +VF++
Sbjct: 75  PSPF-ALIVRGGCTFDEKVKNAQDAGFKAAIVYDNENSGVLVSMA-GSSSGIHIYAVFVS 132

Query: 145 QTEYKDLR-SSSLKPVEVHLVK--DNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXX 201
           +   + L+ SS    VEV ++   DN   W ++ +  + +L+ + ++   + +       
Sbjct: 133 KASGEVLKKSSGHTDVEVWILPTFDNS-AWSIMAISFISLLAMSAVLATCFFVRRHRIRR 191

Query: 202 -------XXXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKH 254
                           Q+V  + + IF + +        CAICLEDY+ G++LR+LPC+H
Sbjct: 192 DHPRIPEAREFHGMSSQLVKAMPSLIFTKVQEDNCTSSMCAICLEDYSVGEKLRVLPCRH 251

Query: 255 EFHITCIDSWLTTRKKFCPICKRDICS------PTEETPLLSN 291
           +FH  C+D WLT+ + FCP+CKRD  S       TE TPLLS+
Sbjct: 252 KFHAACVDLWLTSWRTFCPVCKRDATSGVSELPATEATPLLSS 294



>gi|197245337|ref|NP_001127773.1| ring finger protein 13 precursor [Acyrthosiphon pisum]
          Length = 407

 Score =  141 bits (355), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 81/253 (32%), Positives = 127/253 (50%), Gaps = 19/253 (7%)

Query: 40  VTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIALVERGQCTF 99
           + + D  + FG  +  EGL GY+     + AN + GC+K++    +  W AL++RG C F
Sbjct: 34  LQFSDAQSDFGGEIPSEGLKGYI-----LPANPEDGCTKIESPPKSGSWFALIKRGNCNF 88

Query: 100 IEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLRSSSLKPV 159
             KVRN Q S     +V +   + ++ M+   ++SD+ IPSVF+       LR       
Sbjct: 89  GVKVRNAQNSNYTLAIVFNVNSSTIVPMHGE-NSSDIVIPSVFVGDNTGLMLRDYYDYTN 147

Query: 160 EVHLVKDNLLQWP-------LLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQV 212
           + +++ DN  Q P       LL   ++V +    M+ F+ + W           + P  +
Sbjct: 148 KFYVIVDNN-QSPFDINLNLLLPFAVIVAVCFFAMLGFMLIKWIKDRRRAFRHRL-PASI 205

Query: 213 VGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFC 272
           +  +    F +    +     CAICL+DY DGD+LRILPC H +H  CID WLT  ++FC
Sbjct: 206 LRKIPISTFVKGDPYD----TCAICLDDYMDGDKLRILPCAHAYHCKCIDPWLTRNRRFC 261

Query: 273 PICKRDICSPTEE 285
           PICKR +    E+
Sbjct: 262 PICKRRVYGNNED 274



>gi|242084184|ref|XP_002442517.1| hypothetical protein SORBIDRAFT_08g021220 [Sorghum bicolor]
 gi|241943210|gb|EES16355.1| hypothetical protein SORBIDRAFT_08g021220 [Sorghum bicolor]
          Length = 550

 Score =  140 bits (353), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 92/282 (32%), Positives = 151/282 (53%), Gaps = 27/282 (9%)

Query: 30  DATIVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKA---P 84
           DA +V++  N+T  + D  A+F P +   G+ G + + E ++A     CS L  KA   P
Sbjct: 25  DANVVLLGNNLTLSFDDIEASFSPGVKGSGVNGVVYASEPLDA-----CSPLTIKAVKGP 79

Query: 85  TEQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIA 144
              + AL+ RG CTF EKV+N Q +G  A +V DNE +G++   A G +S ++I +VF++
Sbjct: 80  PSPF-ALIVRGGCTFDEKVKNAQDAGFKAAIVYDNENSGVLVSMA-GSSSGIHIYAVFVS 137

Query: 145 QTEYKDLRS-SSLKPVEVHLVKD-NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXX- 201
           +   + L++ S    VEV ++       W ++ +  + +L+ + ++   + +        
Sbjct: 138 KASGEVLKNFSGHTDVEVWILPTVENSAWSIMGISFISLLAMSAVLATCFFVRRHRIRRD 197

Query: 202 ------XXXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHE 255
                          Q+V  + + IF + +        CAICLEDY+ G++LR+LPC+H+
Sbjct: 198 HPRIPEAREFHGMSSQLVKAMPSLIFTKVQEDNCTSSMCAICLEDYSVGEKLRVLPCRHK 257

Query: 256 FHITCIDSWLTTRKKFCPICKRDICS------PTEETPLLSN 291
           FH  C+D WLT+ + FCP+CKRD  S       TE TPLLS+
Sbjct: 258 FHAACVDLWLTSWRTFCPVCKRDAMSGVSEFPATEATPLLSS 299



>gi|449528049|ref|XP_004171019.1| PREDICTED: E3 ubiquitin-protein ligase RNF167-like [Cucumis
           sativus]
          Length = 463

 Score =  139 bits (351), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 91/280 (32%), Positives = 140/280 (50%), Gaps = 28/280 (10%)

Query: 31  ATIVVVATNVTYQ-DRIAA-FGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKA----P 84
           A +V++  NVT   D I A F P +   G  G L   + ++A     CS L+ K      
Sbjct: 33  ANVVLIGANVTLSFDSIEANFAPSIESSGEPGVLYLAKPLDA-----CSTLENKVVVPVN 87

Query: 85  TEQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIA 144
           T    AL+ RG C+F +KVR  Q +G  A ++ DNE  GLI M   G ++ + I +VF+ 
Sbjct: 88  TSSPFALIVRGGCSFEDKVRRAQVAGFKAAIIYDNEDGGLIAM--AGSSAGIRIHAVFVT 145

Query: 145 QTEYKDLRS-SSLKPVEVHLVKD-NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXX 202
           +T  + L+  + L  VE+ +V       W ++ +  + +L+ + ++   + +        
Sbjct: 146 KTSGETLKKYAGLANVEIWIVPSFENSAWSIMAISFISLLAMSAVLATCFFVRRHRIRRG 205

Query: 203 XXXDIAPQQ-------VVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHE 255
                  Q+       VV  + + IF  +         CAICLEDY  G++LRILPC+H+
Sbjct: 206 RPRSSHTQEFRGMSRRVVKAMPSLIFTTALEDNCTSMTCAICLEDYTPGEKLRILPCRHK 265

Query: 256 FHITCIDSWLTTRKKFCPICKRDICS------PTEETPLL 289
           FH  C+DSWLT  + FCP+CKRD  +      P+  TPLL
Sbjct: 266 FHALCVDSWLTAWRTFCPVCKRDARTSTGDPPPSASTPLL 305



>gi|449441754|ref|XP_004138647.1| PREDICTED: E3 ubiquitin-protein ligase RNF167-like [Cucumis
           sativus]
          Length = 451

 Score =  139 bits (351), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 91/280 (32%), Positives = 140/280 (50%), Gaps = 28/280 (10%)

Query: 31  ATIVVVATNVTYQ-DRIAA-FGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKA----P 84
           A +V++  NVT   D I A F P +   G  G L   + ++A     CS L+ K      
Sbjct: 21  ANVVLIGANVTLSFDSIEANFAPSIESSGEPGVLYLAKPLDA-----CSTLENKVVVPVN 75

Query: 85  TEQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIA 144
           T    AL+ RG C+F +KVR  Q +G  A ++ DNE  GLI M   G ++ + I +VF+ 
Sbjct: 76  TSSPFALIVRGGCSFEDKVRRAQVAGFKAAIIYDNEDGGLIAM--AGSSAGIRIHAVFVT 133

Query: 145 QTEYKDLRS-SSLKPVEVHLVKD-NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXX 202
           +T  + L+  + L  VE+ +V       W ++ +  + +L+ + ++   + +        
Sbjct: 134 KTSGETLKKYAGLANVEIWIVPSFENSAWSIMAISFISLLAMSAVLATCFFVRRHRIRRG 193

Query: 203 XXXDIAPQQ-------VVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHE 255
                  Q+       VV  + + IF  +         CAICLEDY  G++LRILPC+H+
Sbjct: 194 RPRSSHTQEFRGMSRRVVKAMPSLIFTTALEDNCTSMTCAICLEDYTPGEKLRILPCRHK 253

Query: 256 FHITCIDSWLTTRKKFCPICKRDICS------PTEETPLL 289
           FH  C+DSWLT  + FCP+CKRD  +      P+  TPLL
Sbjct: 254 FHALCVDSWLTAWRTFCPVCKRDARTSTGDPPPSASTPLL 293



>gi|226504236|ref|NP_001145884.1| uncharacterized protein LOC100279400 precursor [Zea mays]
 gi|219884825|gb|ACL52787.1| unknown [Zea mays]
          Length = 512

 Score =  139 bits (349), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 93/282 (32%), Positives = 147/282 (52%), Gaps = 29/282 (10%)

Query: 31  ATIVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKA--PTE 86
           + +V++A N T  + D  A F P +   G+ G L +VE ++A     CS LK KA   + 
Sbjct: 27  SNVVLMANNTTLSFDDVEAIFTPAVKGSGVNGVLYAVEPMDA-----CSPLKTKAIGGSV 81

Query: 87  QWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQT 146
              ALV RG C F +KVRN Q +G  A VV D E NG++   A G +S V+I +VF+++ 
Sbjct: 82  SPFALVIRGGCHFDDKVRNAQNAGFKAAVVYDTEDNGVLVSMA-GSSSGVHIYAVFVSKA 140

Query: 147 EYKDLRS-SSLKPVEVHLVKDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
             ++L+  S     E+ ++       W ++ +  + +L   +  +     +         
Sbjct: 141 SGEELKKYSGQTDAELWIIPTYANSAWSIMAISFISLL--VMSAVLAACFFARRHQIRRD 198

Query: 205 XDIAPQ---------QVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHE 255
               PQ         ++V  + + IF + +  +     CAICLEDY+ G++LR+LPC+H+
Sbjct: 199 RARLPQTREFHGMNSRLVKAMPSLIFTKVQEDDCTSATCAICLEDYSAGEKLRVLPCRHK 258

Query: 256 FHITCIDSWLTTRKKFCPICKRDICSPT------EETPLLSN 291
           FH  C+D WLT+ + FCP+CKRD  + T      E TPLLS+
Sbjct: 259 FHAACVDLWLTSWRTFCPVCKRDANAGTPDPPVSESTPLLSS 300



>gi|223943603|gb|ACN25885.1| unknown [Zea mays]
 gi|413941568|gb|AFW74217.1| putative protease-associated RING zinc finger domain family protein
           isoform 1 [Zea mays]
 gi|413941569|gb|AFW74218.1| putative protease-associated RING zinc finger domain family protein
           isoform 2 [Zea mays]
 gi|413941570|gb|AFW74219.1| putative protease-associated RING zinc finger domain family protein
           isoform 3 [Zea mays]
          Length = 512

 Score =  139 bits (349), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 93/282 (32%), Positives = 147/282 (52%), Gaps = 29/282 (10%)

Query: 31  ATIVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKA--PTE 86
           + +V++A N T  + D  A F P +   G+ G L +VE ++A     CS LK KA   + 
Sbjct: 27  SNVVLMANNTTLSFDDVEAIFTPAVKGSGVNGVLYAVEPMDA-----CSPLKTKAIGGSV 81

Query: 87  QWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQT 146
              ALV RG C F +KVRN Q +G  A VV D E NG++   A G +S V+I +VF+++ 
Sbjct: 82  SPFALVIRGGCHFDDKVRNAQNAGFKAAVVYDTEDNGVLVSMA-GSSSGVHIYAVFVSKA 140

Query: 147 EYKDLRS-SSLKPVEVHLVKDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
             ++L+  S     E+ ++       W ++ +  + +L   +  +     +         
Sbjct: 141 SGEELKKYSGQTDAELWIIPTYANSAWSIMAISFISLL--VMSAVLAACFFARRHQIRRD 198

Query: 205 XDIAPQ---------QVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHE 255
               PQ         ++V  + + IF + +  +     CAICLEDY+ G++LR+LPC+H+
Sbjct: 199 RARLPQTREFHGMNSRLVKAMPSLIFTKVQEDDCTSATCAICLEDYSAGEKLRVLPCRHK 258

Query: 256 FHITCIDSWLTTRKKFCPICKRDICSPT------EETPLLSN 291
           FH  C+D WLT+ + FCP+CKRD  + T      E TPLLS+
Sbjct: 259 FHAACVDLWLTSWRTFCPVCKRDANAGTPDPPVSESTPLLSS 300



>gi|302767092|ref|XP_002966966.1| hypothetical protein SELMODRAFT_66937 [Selaginella moellendorffii]
 gi|300164957|gb|EFJ31565.1| hypothetical protein SELMODRAFT_66937 [Selaginella moellendorffii]
          Length = 291

 Score =  138 bits (348), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 87/279 (31%), Positives = 143/279 (51%), Gaps = 20/279 (7%)

Query: 30  DATIVVVA---TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTE 86
           +AT+V+      ++ + D  A F PR+   G+LG L     ++A +         ++P  
Sbjct: 15  NATVVITTPTNQSMPFSDMEAGFAPRVPQAGILGLLYRGNPLDACDPLKTGPALDQSPFS 74

Query: 87  QWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQT 146
            ++ LV+RG C F +KVRN Q +G  AV+V  N+++G   +  +GD+  + IP+VF++  
Sbjct: 75  SFV-LVKRGACRFEKKVRNAQDAGFSAVIV-YNDEDGRDLVIMSGDSYGIKIPAVFVSHA 132

Query: 147 EYKDLRSSSLKPVEVHLVKDNL--LQWPLLDVIIVVILSPT-VMMIFIYVLWXXXXXXXX 203
             K L   +  P     +   L    W ++ V  + +L+ T V+  F +V          
Sbjct: 133 AGKVLWRYAGNPQTRCFIFPTLDYPAWSVMAVAFISLLAVTAVLATFFFVRRHRLRRLGS 192

Query: 204 XXDIAPQ------QVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFH 257
              +  +        V +L T ++  +   +++   C IC+E+Y DG +LR+LPC+H FH
Sbjct: 193 RLLLPREPPGLTSSEVRSLPTLVYRRAGDGDDQADTCVICMEEYEDGQKLRVLPCRHAFH 252

Query: 258 ITCIDSWLTTRKKFCPICKRDIC----SPT--EETPLLS 290
             C+D WL TRK FCP+CKRD      +PT  E TPLL+
Sbjct: 253 AACVDQWLVTRKPFCPVCKRDAHAKSEAPTASESTPLLT 291



>gi|392585362|gb|EIW74702.1| hypothetical protein CONPUDRAFT_67133 [Coniophora puteana
           RWD-64-598 SS2]
          Length = 442

 Score =  138 bits (347), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 106/351 (30%), Positives = 151/351 (43%), Gaps = 97/351 (27%)

Query: 32  TIVVVATNVTYQDRIAAFGPRLTDEGLLGYLVSVEMI----------EANN--------- 72
           ++V  +  +T+  R AAFG R  DE LLGY++ +              AN+         
Sbjct: 50  SVVDRSPPLTFHARPAAFG-REVDEPLLGYVIPLSAFTVPCPATASAHANDTADDIINAL 108

Query: 73  QKGCSKLKRKAP-----TEQWIALVERGQCTFIEK-----VRNMQASGAIAVVVG--DNE 120
            KGC  L    P     +E WIALV+RG C F+EK     VR  Q  GA AVVVG  D  
Sbjct: 109 NKGCPPLCLIGPHEPDSSETWIALVQRGDCPFVEKASHFAVREAQRLGAKAVVVGGEDPR 168

Query: 121 KNGL----ITMYATGDTSDVNIPSVFIAQTEYKDLRSSSLKPVEVH--------LVKDNL 168
            +GL    ITMY+  D SD+ IPS ++   +Y +L +        H        L+    
Sbjct: 169 TSGLPDNPITMYSKSDASDIIIPSTYLRYADYAELNALIKSSTTWHAGIQTLSLLIATQY 228

Query: 169 LQW----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVVGNLATKIF--- 221
             W    P++  I+++IL P+ +     ++           D AP+  V NL  +++   
Sbjct: 229 SAWEWYSPIITFIVILIL-PSCLTFITLLIHRIRMARAAQRDRAPEDFVKNLPWRVWTGT 287

Query: 222 -----------------------FESKRQENEPQ----------------------ECAI 236
                                   E+   E EP+                      ECAI
Sbjct: 288 SWEKHEGVVPAVDPSTSSPNNVDLEAGVAEEEPRPHPSTSRSHEDDVAAPWCENQVECAI 347

Query: 237 CLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCPICKRDICSPTEETP 287
           CL ++A GD++R LPC H FH+  +D+WL  RKK CP+CK D+  P   TP
Sbjct: 348 CLSEFAKGDKVRELPCHHIFHLDEVDAWLINRKKLCPVCKADVTQPWHLTP 398



>gi|302755246|ref|XP_002961047.1| hypothetical protein SELMODRAFT_71236 [Selaginella moellendorffii]
 gi|300171986|gb|EFJ38586.1| hypothetical protein SELMODRAFT_71236 [Selaginella moellendorffii]
          Length = 291

 Score =  137 bits (345), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 87/279 (31%), Positives = 142/279 (50%), Gaps = 20/279 (7%)

Query: 30  DATIVVVA---TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTE 86
           +AT+V+      ++ + D  A F PR+   G+LG L     ++A +         ++P  
Sbjct: 15  NATVVITTPTNQSMPFSDMEAGFAPRVPQAGILGLLYRGNPLDACDPLKTGPALDQSPFS 74

Query: 87  QWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQT 146
            ++ LV+RG C F  KVRN Q +G  AV+V  N+++G   +  +GD+  + IP+VF++  
Sbjct: 75  SFV-LVKRGACRFETKVRNAQDAGFSAVIV-YNDEDGRDLVIMSGDSYGIKIPAVFVSHA 132

Query: 147 EYKDLRSSSLKPVEVHLVKDNL--LQWPLLDVIIVVILSPT-VMMIFIYVLWXXXXXXXX 203
             K L   +  P     +   L    W ++ V  + +L+ T V+  F +V          
Sbjct: 133 AGKVLWRYAGNPQTRCFIFPTLDYPAWSVMAVAFISLLAVTAVLATFFFVRRHRLRRLGS 192

Query: 204 XXDIAPQ------QVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFH 257
              +  +        V +L T ++  +   +++   C IC+E+Y DG +LR+LPC+H FH
Sbjct: 193 RLLLPREPPGLTSSEVRSLPTFVYRRAGDGDDQADTCVICMEEYEDGQKLRVLPCRHAFH 252

Query: 258 ITCIDSWLTTRKKFCPICKRDIC----SPT--EETPLLS 290
             C+D WL TRK FCP+CKRD      +PT  E TPLL+
Sbjct: 253 AACVDQWLVTRKPFCPVCKRDAHAKSEAPTASESTPLLT 291



>gi|356535715|ref|XP_003536389.1| PREDICTED: E3 ubiquitin-protein ligase RNF167-like [Glycine max]
          Length = 469

 Score =  137 bits (345), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 93/284 (32%), Positives = 146/284 (51%), Gaps = 35/284 (12%)

Query: 33  IVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQW-- 88
           +V++  N+T  + D  A F P +   G  G L   E ++A     C++L  K   EQ   
Sbjct: 23  VVLIGNNITLSFDDIEANFAPTVKGSGEYGILYLAEPLDA-----CTELTNK--VEQLPN 75

Query: 89  ----IALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIA 144
                ALV RG C+F EKVR  Q +G  AV+V DNE  G++   A G+++ + I +VF++
Sbjct: 76  ASSPFALVVRGGCSFEEKVRRAQKAGFKAVIVYDNEDGGILVAMA-GNSAGIKIHAVFVS 134

Query: 145 QTEYKDL-RSSSLKPVEVHLVKD-NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXX 202
           +   + L + + L  VE+ L+       W ++ +  + +L+ + ++   +  +       
Sbjct: 135 KASGEILSKYAGLTNVEIWLIPTFENSAWSIMAISFISLLAMSAVLATCF--FVRRHRIR 192

Query: 203 XXXDIAP---------QQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCK 253
                AP          ++V  + + IF          + CAICLEDY  G++LRILPC 
Sbjct: 193 RERPRAPLVREFHGMSSRLVKAMPSLIFTAVLEDNCTSRTCAICLEDYCVGEKLRILPCC 252

Query: 254 HEFHITCIDSWLTTRKKFCPICKRDICS------PTEETPLLSN 291
           H+FH  C+DSWLT+ + FCP+CKRD  S      P+E TPLLS+
Sbjct: 253 HKFHAACVDSWLTSWRTFCPVCKRDARSGLTDPPPSESTPLLSS 296



>gi|115450963|ref|NP_001049082.1| Os03g0167500 [Oryza sativa Japonica Group]
 gi|108706377|gb|ABF94172.1| ReMembR-H2 protein JR702, putative, expressed [Oryza sativa
           Japonica Group]
 gi|113547553|dbj|BAF10996.1| Os03g0167500 [Oryza sativa Japonica Group]
 gi|215697780|dbj|BAG91973.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 501

 Score =  137 bits (345), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 92/282 (32%), Positives = 149/282 (52%), Gaps = 29/282 (10%)

Query: 31  ATIVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKA---PT 85
           A +V++ TN+T  + D  A+F P +   G  G + + E ++A     CS L  KA   P 
Sbjct: 26  ANVVLMGTNLTLSFDDVEASFAPGVKGSGFEGVVYTAEPLDA-----CSPLTSKAEKGPP 80

Query: 86  EQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQ 145
             + AL+ RG CTF EKV+N Q +G  A +V DNE +G++   A G +  ++I +VFI++
Sbjct: 81  SPF-ALIIRGGCTFDEKVKNAQDAGFKAAIVYDNENSGVLISMA-GSSGGIHIYAVFISK 138

Query: 146 TEYKDLRS-SSLKPVEVHLVK--DNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXX- 201
              + L+  S    VEV ++   +N   W ++ +  + +L+ + ++   + +        
Sbjct: 139 ASGEVLKKFSGHTDVEVWILPAFENS-AWSIMAISFISLLAMSAVLATCFFVRRHHIRRD 197

Query: 202 ------XXXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHE 255
                          Q+V  + + IF + +        CAICLEDY  G++LR+LPC+H+
Sbjct: 198 RPRIPEAREFHGMSSQLVKAMPSLIFTKVQEDNCTSSMCAICLEDYNVGEKLRVLPCRHK 257

Query: 256 FHITCIDSWLTTRKKFCPICKRDICS------PTEETPLLSN 291
           FH  C+D WLTT + FCP+CKRD  +       +E TPLLS+
Sbjct: 258 FHAACVDLWLTTWRTFCPVCKRDASTGIPDPPASETTPLLSS 299



>gi|108706378|gb|ABF94173.1| ReMembR-H2 protein JR702, putative, expressed [Oryza sativa
           Japonica Group]
          Length = 533

 Score =  137 bits (344), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 91/281 (32%), Positives = 147/281 (52%), Gaps = 27/281 (9%)

Query: 31  ATIVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKA---PT 85
           A +V++ TN+T  + D  A+F P +   G  G + + E ++A     CS L  KA   P 
Sbjct: 26  ANVVLMGTNLTLSFDDVEASFAPGVKGSGFEGVVYTAEPLDA-----CSPLTSKAEKGPP 80

Query: 86  EQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQ 145
             + AL+ RG CTF EKV+N Q +G  A +V DNE +G++   A G +  ++I +VFI++
Sbjct: 81  SPF-ALIIRGGCTFDEKVKNAQDAGFKAAIVYDNENSGVLISMA-GSSGGIHIYAVFISK 138

Query: 146 TEYKDLRS-SSLKPVEVHLVKD-NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXX-- 201
              + L+  S    VEV ++       W ++ +  + +L+ + ++   + +         
Sbjct: 139 ASGEVLKKFSGHTDVEVWILPAFENSAWSIMAISFISLLAMSAVLATCFFVRRHHIRRDR 198

Query: 202 -----XXXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEF 256
                         Q+V  + + IF + +        CAICLEDY  G++LR+LPC+H+F
Sbjct: 199 PRIPEAREFHGMSSQLVKAMPSLIFTKVQEDNCTSSMCAICLEDYNVGEKLRVLPCRHKF 258

Query: 257 HITCIDSWLTTRKKFCPICKRDICS------PTEETPLLSN 291
           H  C+D WLTT + FCP+CKRD  +       +E TPLLS+
Sbjct: 259 HAACVDLWLTTWRTFCPVCKRDASTGIPDPPASETTPLLSS 299



>gi|357166868|ref|XP_003580891.1| PREDICTED: E3 ubiquitin-protein ligase RNF13-like [Brachypodium
           distachyon]
          Length = 486

 Score =  136 bits (343), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 95/281 (33%), Positives = 146/281 (51%), Gaps = 27/281 (9%)

Query: 31  ATIVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKA---PT 85
           A +V++  N+T  + D  A F P +   G+ G + + E + A     CS L  KA   P 
Sbjct: 32  ANVVLMGNNLTLSFDDIEANFAPGVKGSGVDGVVYTAEPLNA-----CSALTNKAVKGPP 86

Query: 86  EQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQ 145
             + ALV RG CTF EKV+N+Q +G  A +V DNE +G++   A G +S ++I +VFI++
Sbjct: 87  SPF-ALVIRGGCTFDEKVKNVQDAGFKAAIVYDNENSGVLVSMA-GSSSGIHIYAVFISK 144

Query: 146 TEYKDLRS-SSLKPVEVHLV---KDNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXX 201
              + L+  S    VEV L+   +++      +  I ++ +S  +   F           
Sbjct: 145 VSGEVLKKFSGRTDVEVWLIPTFENSAGSIMAISFISLLAMSAVLATCFFVRRHRIRRDR 204

Query: 202 XXXXDI-----APQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEF 256
               +         Q+V  L + IF + +        CAICLEDY  G++LR+LPC+H+F
Sbjct: 205 PRIPEAREFHGMSSQLVKALPSLIFTKVQEDNCTSSLCAICLEDYNVGEKLRVLPCRHKF 264

Query: 257 HITCIDSWLTTRKKFCPICKRDICSPT------EETPLLSN 291
           H  C+D WLT+ + FCP+CKRD  + T      E TPLLS+
Sbjct: 265 HAACVDMWLTSWRSFCPVCKRDADAGTSAPPASETTPLLSS 305



>gi|255586465|ref|XP_002533876.1| zinc finger protein, putative [Ricinus communis]
 gi|223526177|gb|EEF28507.1| zinc finger protein, putative [Ricinus communis]
          Length = 434

 Score =  135 bits (340), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 90/281 (32%), Positives = 144/281 (51%), Gaps = 28/281 (9%)

Query: 31  ATIVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKA--PTE 86
           A +V++  NVT  + D  A F P +   G  G L   E ++A     CS+L  K   PT 
Sbjct: 24  ANVVLIGRNVTLSFDDVEATFAPAVKSSGECGQLYLAEPVDA-----CSELTNKVVKPTS 78

Query: 87  QWIA---LVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFI 143
              +   LV RG C+F +KVR  Q +G  A +V DNE +G++   A G+++ + I +VFI
Sbjct: 79  NVTSPFVLVIRGGCSFEDKVRRAQRAGFKAAIVYDNEDDGVLVSMA-GNSAGIKIHAVFI 137

Query: 144 AQTEYKDLRSS-SLKPVEVHLVKD-NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXX 201
           +++  + L+    L  +E+ L+       W ++ +  + +L+ + ++   + +       
Sbjct: 138 SKSSGETLKKYVGLSEMELWLIPSFENSAWSIMAISFISLLAMSAVLATCFFVRRHRIRR 197

Query: 202 XXXXDI-------APQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKH 254
                           ++V  + + IF          Q CAICLEDY+ G++LRILPC+H
Sbjct: 198 GRPRSSRVREFHGMSSRLVKAMPSLIFTAVVEDNCTSQTCAICLEDYSVGEKLRILPCRH 257

Query: 255 EFHITCIDSWLTTRKKFCPICKRDICSPT------EETPLL 289
           +FH  C+DSWLT+ + FCP+CKRD  + T      E TPLL
Sbjct: 258 KFHALCVDSWLTSWRTFCPVCKRDARTSTGDPPASESTPLL 298



>gi|19071633|gb|AAL84300.1|AC073556_17 putative integral membrane protein [Oryza sativa Japonica Group]
          Length = 537

 Score =  135 bits (339), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 91/285 (31%), Positives = 148/285 (51%), Gaps = 31/285 (10%)

Query: 31  ATIVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKA---PT 85
           A +V++ TN+T  + D  A+F P +   G  G + + E ++A     CS L  KA   P 
Sbjct: 26  ANVVLMGTNLTLSFDDVEASFAPGVKGSGFEGVVYTAEPLDA-----CSPLTSKAEKGPP 80

Query: 86  EQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLI---TMYATGDTSDVNIPSVF 142
             + AL+ RG CTF EKV+N Q +G  A +V DNE +G++        G +  ++I +VF
Sbjct: 81  SPF-ALIIRGGCTFDEKVKNAQDAGFKAAIVYDNENSGVLISSNFTVAGSSGGIHIYAVF 139

Query: 143 IAQTEYKDLRS-SSLKPVEVHLVK--DNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXX 199
           I++   + L+  S    VEV ++   +N   W ++ +  + +L+ + ++   + +     
Sbjct: 140 ISKASGEVLKKFSGHTDVEVWILPAFENS-AWSIMAISFISLLAMSAVLATCFFVRRHHI 198

Query: 200 XX-------XXXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPC 252
                             Q+V  + + IF + +        CAICLEDY  G++LR+LPC
Sbjct: 199 RRDRPRIPEAREFHGMSSQLVKAMPSLIFTKVQEDNCTSSMCAICLEDYNVGEKLRVLPC 258

Query: 253 KHEFHITCIDSWLTTRKKFCPICKRDICS------PTEETPLLSN 291
           +H+FH  C+D WLTT + FCP+CKRD  +       +E TPLLS+
Sbjct: 259 RHKFHAACVDLWLTTWRTFCPVCKRDASTGIPDPPASETTPLLSS 303



>gi|308044561|ref|NP_001183725.1| uncharacterized LOC100502318 precursor [Zea mays]
 gi|238014182|gb|ACR38126.1| unknown [Zea mays]
 gi|413921534|gb|AFW61466.1| putative protease-associated RING zinc finger domain family protein
           isoform 1 [Zea mays]
 gi|413921535|gb|AFW61467.1| putative protease-associated RING zinc finger domain family protein
           isoform 2 [Zea mays]
          Length = 498

 Score =  135 bits (339), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 90/280 (32%), Positives = 145/280 (51%), Gaps = 25/280 (8%)

Query: 31  ATIVVVATNVTYQ--DRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKA--PTE 86
           + +V++A N T    D  A F P +   G+ G L +VE  +A     CS L+ KA   + 
Sbjct: 27  SNVVLMANNTTLSLDDVEATFTPAVEGSGVSGVLYAVEPKDA-----CSPLRAKAIQGSV 81

Query: 87  QWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQT 146
              AL+ RG C F +K+RN Q +G  A VV +NE N ++   A G +  V I +VFI++ 
Sbjct: 82  SPFALIIRGGCQFDDKIRNAQNAGFKAAVVYNNEDNDILVSMA-GSSLGVQIYAVFISKA 140

Query: 147 EYKDLRS-SSLKPVEVHLVKD-NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
             ++L+  S     E+ ++       WP++ +  V +L+ + +++  +            
Sbjct: 141 SGEELKKYSGQTDAELWIIPTYENSAWPIMAISFVSLLAMSAILVACFFARRHQIRRDRA 200

Query: 205 XDIAPQ-------QVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFH 257
                Q       Q+V  + + IF + +        CAICLEDY+ G+++R+LPC+H+FH
Sbjct: 201 RLPRAQESHGMSSQLVKAIPSLIFTKVQEDNCTSATCAICLEDYSVGEKIRVLPCRHKFH 260

Query: 258 ITCIDSWLTTRKKFCPICKRDICSPT------EETPLLSN 291
             C+D WLT+ + FCP+CKRD  + T      E TPLLS+
Sbjct: 261 AACVDLWLTSWRTFCPVCKRDASAGTSDPPVSESTPLLSS 300



>gi|356576139|ref|XP_003556191.1| PREDICTED: E3 ubiquitin-protein ligase RNF167-like [Glycine max]
          Length = 495

 Score =  135 bits (339), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 91/282 (32%), Positives = 147/282 (52%), Gaps = 31/282 (10%)

Query: 33  IVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQW-- 88
           +V++  N+T  + D  A F P +   G  G L   E ++A     C++L  K   EQ   
Sbjct: 23  VVLIGNNITLSFDDIEANFAPAVKGSGKYGVLYLAEPLDA-----CAELTNK--VEQLPN 75

Query: 89  ----IALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIA 144
                ALV RG C+F EKVR  Q +G  AV+V DNE+ G++   A G+++ + I +VF++
Sbjct: 76  ASSPFALVVRGGCSFEEKVRIAQKAGFKAVIVYDNEEGGILVAMA-GNSAGIRIHAVFVS 134

Query: 145 QTEYKDLRS-SSLKPVEVHLVKD-NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXX 202
           +   + L+  + L  VE+ L+       W ++ +  + +L+ + ++   + +        
Sbjct: 135 KASGEILKKYAGLTNVEIWLIPTFENSAWSIMAISFISLLAMSAVLATCFFVRKHRIRRE 194

Query: 203 XXXDIAPQQVVG------NLATKIFFESKRQEN-EPQECAICLEDYADGDELRILPCKHE 255
                  ++  G           + F S  ++N   + CAICLEDY  G++LRILPC H+
Sbjct: 195 RPRASLVREFHGMSSRLVKAMPSLVFTSVLEDNCTSRTCAICLEDYCVGEKLRILPCCHK 254

Query: 256 FHITCIDSWLTTRKKFCPICKRDICS------PTEETPLLSN 291
           FH  C+DSWLT+ + FCP+CKRD  +      P+E TPLLS+
Sbjct: 255 FHAACVDSWLTSWRTFCPVCKRDARTGLTDPPPSESTPLLSS 296



>gi|409042212|gb|EKM51696.1| hypothetical protein PHACADRAFT_127496 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 412

 Score =  134 bits (338), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 99/335 (29%), Positives = 152/335 (45%), Gaps = 81/335 (24%)

Query: 27  FVVDATIVVV--ATNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEA-------------- 70
           +  D T+ VV  +  + Y  R A+FG  L+D  LLGY++ +    +              
Sbjct: 45  WAADGTVSVVDRSPPLIYPARPASFGTELSDP-LLGYVIPLSAFTSPCPVSNTSTSYPSM 103

Query: 71  -NNQKGCSKLKRKAP-----TEQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEK--N 122
            +  +GC +L    P     +E WIALV+RG C F+EK R  Q  GA AVVVG + +  N
Sbjct: 104 PDPVQGCPELCVDGPNQPERSETWIALVQRGGCPFVEKARQAQRLGAKAVVVGGDRENPN 163

Query: 123 GLITMYATGDTSDVNIPSVFIAQTEYKDL---------RSSSLKPVEVHLVKD-NLLQW- 171
            L+ MY+  D SDV I + +I   +Y +L           S L+ V + L  + +  +W 
Sbjct: 164 ALLNMYSEQDPSDVTIAATYIKYWDYAELLALISASNTSHSGLRTVSLQLSTEYSAWEWY 223

Query: 172 -PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVVGNLATKIF--------- 221
            P++  +++++L P+++     ++           D AP+  V +L  +++         
Sbjct: 224 SPIITFVVILLL-PSILTFITLLIHRIRAARAAQRDRAPEDFVHSLPWRVWTGNGWEKHD 282

Query: 222 ----------------------------FESKRQENEPQ------ECAICLEDYADGDEL 247
                                         S+    EP       ECAICL+ +A GD +
Sbjct: 283 AGLQNAEDPSEDPSSGPEPDIERDTIAQSSSREASVEPSWVDGQMECAICLDMFAKGDRV 342

Query: 248 RILPCKHEFHITCIDSWLTTRKKFCPICKRDICSP 282
           R+LPC H FH+  ID WL T+KK CPICK DI  P
Sbjct: 343 RVLPCNHLFHMNEIDEWLITKKKVCPICKADITKP 377



>gi|409078944|gb|EKM79306.1| hypothetical protein AGABI1DRAFT_74212 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 431

 Score =  134 bits (337), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 100/342 (29%), Positives = 157/342 (45%), Gaps = 91/342 (26%)

Query: 30  DATIVVVATN--VTYQDRIAAFGPRLTDEGLLGYLVSVEMIEAN------------NQKG 75
           ++T+ VV  +  ++Y  R AAFG  + D  +LGY++ +    A             +  G
Sbjct: 48  ESTVSVVDHSPVISYTSRPAAFGAEIADP-ILGYVIPLSSFTAPCGSNDTADSDSPSNSG 106

Query: 76  CSKL---KRKAPTEQWIALVERGQCTFIEKVRNMQASGAIAVVVG--DNEKNG----LIT 126
           C KL     + PTE WIALV+RG C F++KVR +Q  GA AVVVG  D E +G    L+ 
Sbjct: 107 CPKLCLTDTRQPTETWIALVQRGGCEFVKKVREVQGFGAKAVVVGGEDPEVSGYPDTLVN 166

Query: 127 MYATGDTSDVNIPSVFIAQTEYKDLRS--SSLKPVEVHLVKDNLL--------QW--PLL 174
           MY+  D SD+NI + +I  ++Y  L +  SS       L   +LL        +W  P++
Sbjct: 167 MYSPEDASDINIAATYIKFSDYMQLYTLISSSNTTHSGLQTLSLLITAEYSAWEWYSPII 226

Query: 175 DVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVVGNLATKIFFESKRQENE---- 230
             I++++L P+V+     ++           + AP+ +V  L  +++  +  +++E    
Sbjct: 227 TFIVILLL-PSVLTFITLLIHRIRAARAAQRERAPEDIVQRLPWRVYTGTGWEKHEGGEP 285

Query: 231 -----------------------------PQEC---------------------AICLED 240
                                        P  C                     AICL +
Sbjct: 286 VYDTPRSSDVDLEEGRSPVEVAASERGSSPTACSDASTSERLMHHPWFEAQLECAICLSE 345

Query: 241 YADGDELRILPCKHEFHITCIDSWLTTRKKFCPICKRDICSP 282
           +A GD +R+LPC+H FH++ +D WL  RKK CPICK D+  P
Sbjct: 346 FAKGDRVRVLPCQHIFHLSEVDEWLIHRKKLCPICKADVTQP 387



>gi|402218957|gb|EJT99032.1| transferrin receptor ectodomain apical domain-containing protein
           [Dacryopinax sp. DJM-731 SS1]
          Length = 456

 Score =  134 bits (337), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 106/340 (31%), Positives = 159/340 (46%), Gaps = 76/340 (22%)

Query: 24  WSNFVVDATIVVVATNVTYQDRIAAFGPRLTDE-GLLGYLVSVEMIEAN---NQKGCSKL 79
           WS  V+  T++   +  T+  R AAFG R+ +  GL G+L+    +  +       C K+
Sbjct: 63  WSESVI--TVMQDNSTTTFSSRPAAFGLRIVNAPGLSGHLIPTSQLLPHCPTAAYSCPKI 120

Query: 80  KRKAP-----TEQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEK---NGLITMYATG 131
               P      E WIALV+RG+C+F+EKVR  Q  GA+ VVVG  EK   + LITMY+ G
Sbjct: 121 CPHYPFPRLENEGWIALVQRGECSFVEKVREAQRLGAVGVVVGGREKGRDDDLITMYSPG 180

Query: 132 DTSDVNIPSVFIAQTEYK----------DLRSSSLKPVEVHLVKDNLLQWPLLDVIIVVI 181
           D +D+ IPS ++    Y+          D   S  K +++ L +D   QWP+     +++
Sbjct: 181 DATDIGIPSCYVTYESYRGLMNLWEKSNDTTPSGYKALDLLLGEDEAWQWPVF-TFSLLL 239

Query: 182 LSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVVGNLATKIFFESKRQENEPQ--------- 232
           L P+++ +   V+           + AP+ +V NL T+++  +   ++E           
Sbjct: 240 LLPSILTLLTLVVHRIRQQRAEVRERAPEDIVSNLPTRVWNGTHWDKDETSHDIETGEAT 299

Query: 233 -------------------ECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCP 273
                              ECAICL  +  GD +R+LPC H FHI  ID WL  +KK CP
Sbjct: 300 PTVEIGKHKMHWAWFETQVECAICLSAFERGDRVRVLPCGHVFHIEEIDGWLVKQKKLCP 359

Query: 274 ICKRDIC-----------------------SPTEETPLLS 290
           ICK D+                        +PTE TPLL+
Sbjct: 360 ICKTDVTQPPVTPPTSPSIRAFPRAVHRTDTPTEHTPLLA 399



>gi|302758284|ref|XP_002962565.1| hypothetical protein SELMODRAFT_67002 [Selaginella moellendorffii]
 gi|300169426|gb|EFJ36028.1| hypothetical protein SELMODRAFT_67002 [Selaginella moellendorffii]
          Length = 290

 Score =  134 bits (337), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 94/280 (33%), Positives = 145/280 (51%), Gaps = 29/280 (10%)

Query: 33  IVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQ--KGCSKLKRKAPTEQW 88
           +++ A N T  + D  A+F PR+   G+ G       + A +    G   L    P    
Sbjct: 18  VLITAKNETLPFPDMEASFAPRVPASGISGLFYEAYPLNACDAIINGPGLLIGSIPV--- 74

Query: 89  IALVERGQCTFIEKVRNMQASGAIAVVVGDNEK-NGLITMYATGDTSDVNIPSVFIAQTE 147
            A+VERG C F EK+ N Q +G  AV+V +NE+ + LI+M  +G + DV+IP+VF++++ 
Sbjct: 75  FAIVERGGCKFDEKILNAQDAGFSAVIVYNNEEGHDLISM--SGSSDDVHIPAVFVSKSA 132

Query: 148 YKDLRSSSLKPVEVH---LVKDNLLQWPLLDVIIVVILSPT-VMMIFIYV-------LWX 196
            + L   S K +      L       W ++ V  + +L+ T V+  F++V       L  
Sbjct: 133 GETLLEYS-KQIGARCYILPAIENTAWSVMAVSFISLLAVTAVLTTFLFVRRYRLRHLGS 191

Query: 197 XXXXXXXXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEF 256
                     ++ ++V   L T IF      +     CAICLE+Y  G++LR+LPC H+F
Sbjct: 192 RLLLLRDSYGMSAREVKA-LPTVIFKCLGDGQGTSDTCAICLEEYESGEKLRVLPCHHDF 250

Query: 257 HITCIDSWLTTRKKFCPICKRDICS------PTEETPLLS 290
           H  C+D WLTTR+ FCP+CKRD  +      P+E TPLL+
Sbjct: 251 HAACVDQWLTTRRPFCPVCKRDAHNKNEEPPPSESTPLLA 290



>gi|426195852|gb|EKV45781.1| hypothetical protein AGABI2DRAFT_207032 [Agaricus bisporus var.
           bisporus H97]
          Length = 431

 Score =  134 bits (336), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 100/342 (29%), Positives = 157/342 (45%), Gaps = 91/342 (26%)

Query: 30  DATIVVVATN--VTYQDRIAAFGPRLTDEGLLGYLVSVEMIEAN------------NQKG 75
           ++T+ VV  +  ++Y  R AAFG  + D  +LGY++ +    A             +  G
Sbjct: 48  ESTVSVVDHSPVISYTSRPAAFGAEIADP-ILGYVIPLSSFTAPCGSNDTTDSDSPSNSG 106

Query: 76  CSKL---KRKAPTEQWIALVERGQCTFIEKVRNMQASGAIAVVVG--DNEKNG----LIT 126
           C KL     + PTE WIALV+RG C F++KVR +Q  GA AVVVG  D E +G    L+ 
Sbjct: 107 CPKLCLTDTRQPTETWIALVQRGGCEFVKKVREVQGFGAKAVVVGGEDPEVSGYPDTLVN 166

Query: 127 MYATGDTSDVNIPSVFIAQTEYKDLRS--SSLKPVEVHLVKDNLL--------QW--PLL 174
           MY+  D SD+NI + +I  ++Y  L +  SS       L   +LL        +W  P++
Sbjct: 167 MYSPEDASDINIAATYIKFSDYMQLYTLISSSNTTHSGLQTLSLLITAEYSAWEWYSPII 226

Query: 175 DVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVVGNLATKIFFESKRQENE---- 230
             I++++L P+V+     ++           + AP+ +V  L  +++  +  +++E    
Sbjct: 227 TFIVILLL-PSVLTFITLLIHRIRAARAAQRERAPEDIVRRLPWRVYTGTGWEKHEGGEP 285

Query: 231 -----------------------------PQEC---------------------AICLED 240
                                        P  C                     AICL +
Sbjct: 286 VYDTPRSSDVDLEEGRSPVEVATSERGSSPTACSDASTSERLMHHPWFEAQLECAICLSE 345

Query: 241 YADGDELRILPCKHEFHITCIDSWLTTRKKFCPICKRDICSP 282
           +A GD +R+LPC+H FH++ +D WL  RKK CPICK D+  P
Sbjct: 346 FAKGDRVRVLPCQHIFHLSEVDEWLIHRKKLCPICKADVTQP 387



>gi|470129614|ref|XP_004300704.1| PREDICTED: E3 ubiquitin-protein ligase RNF167-like [Fragaria vesca
           subsp. vesca]
          Length = 446

 Score =  134 bits (336), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 91/289 (31%), Positives = 148/289 (51%), Gaps = 37/289 (12%)

Query: 28  VVDATIVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKA-P 84
           + DA +V++  NVT  ++D  A+F P +   G  G L   E I+A     CS L  +A P
Sbjct: 20  MADANVVLIGDNVTLSFEDIEASFAPAVRGSGECGVLYLAEPIDA-----CSTLTNEAGP 74

Query: 85  TEQW---IALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSV 141
              +     L+ RG C+F EK+R  Q +   A +V DNE++G++   A G ++ + I +V
Sbjct: 75  GTNYSSPFVLIIRGGCSFEEKIRRAQKAMFKAAIVYDNEEDGILVSMA-GSSAGIKIHAV 133

Query: 142 FIAQTEYKDLRS-SSLKPVEVHLVKD-NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXX 199
           F+++   + L+  + +  VEV L+       W ++ +  + +L+ + ++   + +     
Sbjct: 134 FVSKASGEILKKYTGVSNVEVWLIASFENSAWSIMAISFISLLAMSAVLATCFFV----- 188

Query: 200 XXXXXXDIAPQ------------QVVGNLATKIFFESKRQENEPQECAICLEDYADGDEL 247
                    PQ            ++V  + + IF            CAICLEDY+ G++L
Sbjct: 189 RRHRIRRERPQASRVREFHGMSSRLVRAMPSLIFTAVLEDNCTSVTCAICLEDYSVGEKL 248

Query: 248 RILPCKHEFHITCIDSWLTTRKKFCPICKRDICSPT------EETPLLS 290
           RILPC+H+FH  C+DSWLT+ + FCP+CKRD  + T      E TPLLS
Sbjct: 249 RILPCRHKFHAFCVDSWLTSWRTFCPVCKRDARANTSGPPASESTPLLS 297



>gi|403416948|emb|CCM03648.1| predicted protein [Fibroporia radiculosa]
          Length = 428

 Score =  133 bits (334), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 96/340 (28%), Positives = 148/340 (43%), Gaps = 89/340 (26%)

Query: 27  FVVDATIVVV--ATNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEA-------------- 70
           +  D T+ VV  +  VT+  R A+FG  L D+ LLGY++ +    A              
Sbjct: 45  WASDGTVSVVDRSPPVTFLARPASFGSEL-DDPLLGYVIPLSSFTAPCVYNTTADTSSPL 103

Query: 71  --NNQKGCSKL-----KRKAPTEQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKN- 122
             +  +GC  L         P E WIALV+RG C F+EK R  Q  GA AVVVG +  N 
Sbjct: 104 RPDPVQGCPDLCALGSHEPDPAESWIALVQRGGCPFVEKARQAQRLGAKAVVVGGDSDNP 163

Query: 123 -GLITMYATGDTSDVNIPSVFIAQTEYKDLRSSSLKPVEVH----------LVKDNLLQW 171
             L+ MY+  D+SDV I + FI   +Y +L S        H            + +  +W
Sbjct: 164 DALLNMYSERDSSDVTIAATFIKYWDYAELSSLIHASNTTHSGLKTLSLLLSTQYSAWEW 223

Query: 172 --PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVVGNLATKIFFESKRQEN 229
             P++  +++++L P+++     ++           D AP+ +V NL  ++F  +  +++
Sbjct: 224 YSPIITFVVILLL-PSLLTFITLIVHRLRAARAAQRDRAPESIVHNLPWRVFTGAGWEKH 282

Query: 230 EPQ--------------------------------------------------ECAICLE 239
           EP                                                   ECAICLE
Sbjct: 283 EPPYMPSPDSAPRSGTQNTDPEQGLPCSGPQMLNNPSTSHDCEQLPSWVDEQVECAICLE 342

Query: 240 DYADGDELRILPCKHEFHITCIDSWLTTRKKFCPICKRDI 279
            +  GD +R+LPC H FH++ +D WL  +KK CP+CK D+
Sbjct: 343 MFVKGDHVRVLPCYHMFHMSEVDEWLIHKKKLCPVCKMDV 382



>gi|222624258|gb|EEE58390.1| hypothetical protein OsJ_09552 [Oryza sativa Japonica Group]
          Length = 471

 Score =  132 bits (333), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 91/277 (32%), Positives = 144/277 (51%), Gaps = 29/277 (10%)

Query: 36  VATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKA---PTEQWIA 90
           + TN+T  + D  A+F P +   G  G + + E ++A     CS L  KA   P   + A
Sbjct: 1   MGTNLTLSFDDVEASFAPGVKGSGFEGVVYTAEPLDA-----CSPLTSKAEKGPPSPF-A 54

Query: 91  LVERGQCTFIEKVRNMQASGAIAVVVGDNEKNG-LITMYATGDTSDVNIPSVFIAQTEYK 149
           L+ RG CTF EKV+N Q +G  A +V DNE +G LI+M   G +  ++I +VFI++   +
Sbjct: 55  LIIRGGCTFDEKVKNAQDAGFKAAIVYDNENSGVLISM--AGSSGGIHIYAVFISKASGE 112

Query: 150 DLRS-SSLKPVEVHLVKD-NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXX------ 201
            L+  S    VEV ++       W ++ +  + +L+ + ++   + +             
Sbjct: 113 VLKKFSGHTDVEVWILPAFENSAWSIMAISFISLLAMSAVLATCFFVRRHHIRRDRPRIP 172

Query: 202 -XXXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITC 260
                     Q+V  + + IF + +        CAICLEDY  G++LR+LPC+H+FH  C
Sbjct: 173 EAREFHGMSSQLVKAMPSLIFTKVQEDNCTSSMCAICLEDYNVGEKLRVLPCRHKFHAAC 232

Query: 261 IDSWLTTRKKFCPICKRDICS------PTEETPLLSN 291
           +D WLTT + FCP+CKRD  +       +E TPLLS+
Sbjct: 233 VDLWLTTWRTFCPVCKRDASTGIPDPPASETTPLLSS 269



>gi|116790621|gb|ABK25681.1| unknown [Picea sitchensis]
          Length = 486

 Score =  132 bits (332), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 90/277 (32%), Positives = 138/277 (49%), Gaps = 22/277 (7%)

Query: 30  DATIVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQ 87
            A +V++  N++  + D  A F P +   G  G L   E  +A     C++L  KA   +
Sbjct: 30  SANVVLIGNNISQSFDDIEANFAPAIRGPGACGVLQLAEPFDA-----CTQLTNKAVPRE 84

Query: 88  WI----ALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNG-LITMYATGDTSDVNIPSVF 142
            +    AL+ RG CTF +KVRN QA+G  A +V +NE +  L++M   G++  V I +VF
Sbjct: 85  GVYASFALIIRGTCTFEKKVRNAQAAGFSAAIVYNNEDSSDLVSM--AGNSDGVTIHAVF 142

Query: 143 IAQTEYKDLRSSSLKP-VEVHLVKD-NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXX 200
           +++   + L   +  P VE  LV       W ++ +  + +L+   ++   + +      
Sbjct: 143 VSKVAGEMLLKHAGDPNVEFWLVPSYENTAWSVMAIAFISLLAICAVLATCFFVRRHRLR 202

Query: 201 XXXXXDIAPQ------QVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKH 254
                    +      ++V  L + IF          + CAICLEDY  GD+LRILPC H
Sbjct: 203 HVGLRSRVREFHGMSGRLVKALPSMIFSSVVDDNCTSETCAICLEDYKAGDKLRILPCHH 262

Query: 255 EFHITCIDSWLTTRKKFCPICKRDICSPTEETPLLSN 291
           +FH+ CIDSWLT  + FCP+CKRD    T E P   N
Sbjct: 263 KFHLLCIDSWLTMWRTFCPVCKRDARISTGEPPASEN 299



>gi|168020812|ref|XP_001762936.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162685748|gb|EDQ72141.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 286

 Score =  132 bits (331), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 94/290 (32%), Positives = 152/290 (52%), Gaps = 40/290 (13%)

Query: 28  VVDATIVVVATNVTYQ--DRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT 85
           V  A I++  +N ++   D  A+F PR+   G++G L +   ++A     CS L   +  
Sbjct: 10  VNSAVILLTESNESWSFPDTEASFSPRIPTTGIVGVLHASNPLDA-----CSPLTNVSRQ 64

Query: 86  EQWI----ALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNG-LITMYATGDTSDVNIPS 140
            Q +     LVERG C F  KV N Q +G  AV++ +N+ +  L+TM  +G ++D++  S
Sbjct: 65  GQTLFSDFLLVERGVCNFEVKVWNAQEAGFEAVIIYNNQNDHELVTM--SGSSNDIHAYS 122

Query: 141 VFIAQT------EYKDLRSSSLKPVEVHLVKDNLLQWPLLDVIIVVILS-PTVMMIFIYV 193
           VF+++       +Y D + ++   +      +N   W ++ V  + +L+  +V++ F +V
Sbjct: 123 VFVSKVTGEFLLKYADDKGATCYIMPAF---ENT-AWSVMAVSFISLLAVSSVLVTFFFV 178

Query: 194 LWXXXXXXXXXXDIAPQQVVG-------NLATKIFFESKRQENEPQECAICLEDYADGDE 246
                          P++  G        L + +F   +  +   + CAICLEDY  G++
Sbjct: 179 --RQHRIQHLSARFLPKEPAGMSVKEVNTLPSFVFKHIEDGKGTSETCAICLEDYVAGEK 236

Query: 247 LRILPCKHEFHITCIDSWLTTRKKFCPICKRDICS------PTEETPLLS 290
           LR+LPC+HEFH+ CID WLTTRK FCP+CKRD  S       TE TPLL+
Sbjct: 237 LRLLPCQHEFHLDCIDQWLTTRKPFCPVCKRDAQSKVDKPVATETTPLLA 286



>gi|502118717|ref|XP_004496378.1| PREDICTED: E3 ubiquitin-protein ligase RNF13-like isoform X1 [Cicer
           arietinum]
 gi|502118720|ref|XP_004496379.1| PREDICTED: E3 ubiquitin-protein ligase RNF13-like isoform X2 [Cicer
           arietinum]
          Length = 442

 Score =  131 bits (330), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 85/280 (30%), Positives = 142/280 (50%), Gaps = 27/280 (9%)

Query: 31  ATIVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQW 88
           + +V++  N+T  + D  A F P +   G  G L   E ++A     C++L  KA     
Sbjct: 22  SKVVLIGNNITLSFDDIEANFAPSVKGSGEYGVLFLAEPLDA-----CTELTNKAKQLSN 76

Query: 89  IA----LVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIA 144
           ++    L+ RG C+F EKVR  Q +G  A +V DNE  G++   A G+++ + I +VF++
Sbjct: 77  VSSPFVLMIRGGCSFEEKVRMAQNAGYTAAIVYDNEDGGVLVAMA-GNSAGIRIHAVFVS 135

Query: 145 QTEYKDL-RSSSLKPVEVHLVKD-NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXX---- 198
           +   + L + + L  VE  L+       W ++ +  + +L+ + ++   + +        
Sbjct: 136 KASGEILHKYTGLTNVETWLIPTFENSAWSIMAISFISLLAMSAVLATCFFVRRHRIRRE 195

Query: 199 ---XXXXXXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHE 255
                          ++V  + + IF  +       + CAICLEDY  G++LRILPC H+
Sbjct: 196 RPRASHVREFHGMSSRLVKAMPSLIFTSALEDNCTSRTCAICLEDYCVGEKLRILPCCHK 255

Query: 256 FHITCIDSWLTTRKKFCPICKRDICS------PTEETPLL 289
           FH  C+DSWLT+ + FCP+CKRD  +      P+E TPLL
Sbjct: 256 FHAACVDSWLTSWRTFCPVCKRDARTGLSDPPPSESTPLL 295



>gi|389744752|gb|EIM85934.1| hypothetical protein STEHIDRAFT_58731 [Stereum hirsutum FP-91666
           SS1]
          Length = 446

 Score =  131 bits (329), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 97/337 (28%), Positives = 146/337 (43%), Gaps = 88/337 (26%)

Query: 32  TIVVVATNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEA--------------------N 71
           +IV  +  VT+  R AAFG  L D  LLGY++ +                         +
Sbjct: 54  SIVDRSPAVTFLSRPAAFGAELNDP-LLGYVIPLNSFTTPCIHGSDVSTTSFNLPNTHLS 112

Query: 72  NQKGCSKL-----KRKAPTEQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNE------ 120
              GC KL           E WIALV+RGQC F++K R  Q  GA AVVVG ++      
Sbjct: 113 PNLGCPKLCILGDNIPEKGESWIALVQRGQCQFVDKAREAQRLGARAVVVGGDDPDFGGN 172

Query: 121 KNGLITMYATGDTSDVNIPSVFIAQTEYKDLRS---------SSLKPVEVHLVKDNLLQW 171
            + L+ MY+ GD+SDV IP+ F+  ++Y +L +         + LK + + LV      W
Sbjct: 173 PDTLVNMYSPGDSSDVKIPATFVKYSDYVELSALIAASNTSHNGLKTLSL-LVSSEFSAW 231

Query: 172 PLLDVIIVVILS---PTVMMIFIYVLWXXXXXXXXXXDIAPQQVVGNLATKIFF------ 222
                ++  +     P+ +     ++           D AP+ +V +L  +++       
Sbjct: 232 QWYSPLLTFLTLLLVPSSLTFLTLLIHRIRLARAAQRDRAPEDIVHSLPWRVWTGTGWEK 291

Query: 223 ------------------------ESKR-------QENEPQ------ECAICLEDYADGD 245
                                   ES R       ++ +P       ECAICLE++  GD
Sbjct: 292 HAGTVPAQDLDPASSRDDDAVERGESHRVPPQQIEEDEDPAWFQSQVECAICLEEFVKGD 351

Query: 246 ELRILPCKHEFHITCIDSWLTTRKKFCPICKRDICSP 282
            +R+LPCKH FH+  +D WL  RKK CP+CK D+  P
Sbjct: 352 RVRVLPCKHIFHLDEVDVWLIERKKLCPVCKADVTQP 388



>gi|224146378|ref|XP_002325986.1| predicted protein [Populus trichocarpa]
 gi|222862861|gb|EEF00368.1| predicted protein [Populus trichocarpa]
          Length = 437

 Score =  130 bits (327), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 83/274 (30%), Positives = 137/274 (50%), Gaps = 22/274 (8%)

Query: 29  VDATIVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT- 85
               ++++  NVT  + D  A F P +   G  G L   E I+A     CS L  +A   
Sbjct: 18  ASGNVLLIGNNVTMAFDDIEANFAPAIKGSGECGVLYLAEPIDA-----CSDLTNQAEKG 72

Query: 86  ---EQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVF 142
                   L+ R  C+F +KVR  Q +G  A ++ DNE+  L+ M   G+++ V IP+VF
Sbjct: 73  SNCSSPFVLIIREGCSFEDKVRRAQKAGYKAAIIYDNEEGILVAM--AGNSAGVTIPAVF 130

Query: 143 IAQTEYKDLRS-SSLKPVEVHLVKD-NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXX 200
           +++T  + L+  + L  +E+ ++       W ++ +  + +L+ + ++   + +      
Sbjct: 131 VSKTSGETLKKYAGLTDLELWIIPSFENSAWSIMAISFISLLAMSAVLATCFFVRRHRIR 190

Query: 201 XXXXXDIAPQQVVG------NLATKIFFESKRQEN-EPQECAICLEDYADGDELRILPCK 253
                    ++  G           + F S  ++N     CAICLEDY  G++LRILPC+
Sbjct: 191 RERPRSSRVREFHGMSSRLVKAMPSLTFTSALEDNCTSTTCAICLEDYTVGEKLRILPCR 250

Query: 254 HEFHITCIDSWLTTRKKFCPICKRDICSPTEETP 287
           H+FH  C+DSWLTT + FCP+CKRD  + T E P
Sbjct: 251 HKFHAFCVDSWLTTWRTFCPVCKRDARTSTGEPP 284



>gi|508725329|gb|EOY17226.1| Protease-associated RING/U-box zinc finger family protein
           [Theobroma cacao]
          Length = 487

 Score =  130 bits (327), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 82/278 (29%), Positives = 142/278 (51%), Gaps = 21/278 (7%)

Query: 25  SNFVVDATIVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRK 82
           ++++  A++V++  NVT  + D  A F P +   G  G L   E ++A     CS L  K
Sbjct: 59  ASWMTSASVVLIGKNVTLSFDDIEANFAPAIEGSGECGVLYLAEPLDA-----CSDLSNK 113

Query: 83  ----APTEQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNI 138
               +      ALV RG+C+F EKVR +Q +G  A +V DN+ +G++   A G  + + I
Sbjct: 114 VEEVSNVTSPFALVIRGRCSFDEKVRRVQKAGFKAAIVYDNDDDGILVAMA-GTAAGIKI 172

Query: 139 PSVFIAQTEYKDLRS-SSLKPVEVHLVKD-NLLQWPLLDVIIVVILSPTVMMIFIYVLWX 196
            +VF+++   + L+  +     E+ L+       W ++ +  + +L+ + ++   + +  
Sbjct: 173 NAVFVSKASGEILKKYAGCTDTELWLIPSFENSAWSIMAISFISLLAMSAVLATCFFVRR 232

Query: 197 XXXXXXXXXDI-------APQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRI 249
                               +++V  + + +F          + CAICLEDY  G++LRI
Sbjct: 233 HRIRRERPQSSRVREFHGMSRRLVKAMPSLVFTAVLEDNCTSRTCAICLEDYTMGEKLRI 292

Query: 250 LPCKHEFHITCIDSWLTTRKKFCPICKRDICSPTEETP 287
           LPC+H+FH  C+DSWLTT + FCP+CKRD  + T + P
Sbjct: 293 LPCRHKFHAFCVDSWLTTWRTFCPVCKRDARTSTGDPP 330



>gi|357144351|ref|XP_003573261.1| PREDICTED: E3 ubiquitin-protein ligase RNF167-like [Brachypodium
           distachyon]
          Length = 483

 Score =  129 bits (325), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 88/281 (31%), Positives = 148/281 (52%), Gaps = 31/281 (11%)

Query: 33  IVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWI- 89
           +V++A N T  + D  A+F P +  +G+ G + +VE  +A     C  L  + P E  + 
Sbjct: 29  VVLMANNKTLSFNDVEASFTPAVEGKGVNGVIYTVEPRDA-----CGPLINR-PDEGPVS 82

Query: 90  --ALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTE 147
             AL+ RG C F +KVRN Q +G  A +V DN+ NG++   A G +S + I +VF+++  
Sbjct: 83  PFALIIRGGCQFDDKVRNAQDAGFKAAIVYDNKDNGVLVSMA-GSSSGIRIYAVFVSKAS 141

Query: 148 YKDLRSSSLKPVEVHL----VKDNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXX 203
            + L+  S +  +  L     +DN   W ++ +    +L+ + ++   + +         
Sbjct: 142 GEVLKKYSGQ-SDAQLWIISTQDNA-AWSIMAISFTALLAMSAVLATCFFVRRHQIRRDR 199

Query: 204 XXDIAPQ-------QVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEF 256
               A +       Q+V  + + IF + +        CAICLEDY+ G+++R+LPC+H+F
Sbjct: 200 ALIPAAREFHGMSSQLVKAMPSLIFTKVQEDNCTSSTCAICLEDYSVGEKIRVLPCRHKF 259

Query: 257 HITCIDSWLTTRKKFCPICKRDICSPT------EETPLLSN 291
           H  C+D WLT+ + FCP+CKRD  + T      E TPLLS+
Sbjct: 260 HAACVDLWLTSWRTFCPVCKRDANAGTPNLPASETTPLLSS 300



>gi|242074888|ref|XP_002447380.1| hypothetical protein SORBIDRAFT_06g034040 [Sorghum bicolor]
 gi|241938563|gb|EES11708.1| hypothetical protein SORBIDRAFT_06g034040 [Sorghum bicolor]
          Length = 501

 Score =  129 bits (323), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 93/286 (32%), Positives = 146/286 (51%), Gaps = 27/286 (9%)

Query: 31  ATIVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRK---APT 85
           A +V++  N+T  + D  A+F P +   G+ G + + E + A     CS L  K    P 
Sbjct: 22  ANVVLMGNNLTLSFDDIEASFSPGVKGSGVSGVVYASEPLNA-----CSPLTIKTVNGPP 76

Query: 86  EQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQ 145
             + AL+ RG CTF EKV+N Q +G  A +V DN+ +G++   A G +S ++I +VF+++
Sbjct: 77  SPF-ALIIRGGCTFDEKVKNAQDAGFKAAIVYDNKNSGVLVSMA-GSSSGIHIYAVFVSK 134

Query: 146 TEYKDLRS-SSLKPVEVHLVKD-NLLQWPLLDVIIVVILSPTVMM---IFIYVLWXXXXX 200
              + L+  S    VEV ++       W ++ +  V +L+   ++    F+         
Sbjct: 135 ASGEVLKKFSGNMDVEVWILPTFENSAWSIMAISFVSLLAMCAVLGTCFFVRRHRIRREH 194

Query: 201 XXXXXDI----APQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEF 256
                D        Q+V  + + IF + +        CAICL DY  G++LR+LPC+H+F
Sbjct: 195 PRIAEDREFHGMSSQLVKAIPSLIFTKVQEDNCTSSMCAICLADYNVGEKLRVLPCRHKF 254

Query: 257 HITCIDSWLTTRKKFCPICKRDICS------PTEETPLLSNHEPTP 296
           H  C+D WLT+ + FCPICKRD  S       TE TPLLS+    P
Sbjct: 255 HAACVDLWLTSWRTFCPICKRDARSGASEVVATEATPLLSSAARLP 300



>gi|225470792|ref|XP_002269731.1| PREDICTED: E3 ubiquitin-protein ligase RNF167-like [Vitis vinifera]
          Length = 446

 Score =  128 bits (322), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 83/280 (29%), Positives = 144/280 (51%), Gaps = 18/280 (6%)

Query: 28  VVDATIVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT 85
           V  A +V++  NVT  + D  A F   +   G  G L   E ++A +    +  K +  +
Sbjct: 20  VAFANVVLIGNNVTLSFDDIQANFAKPVKGSGECGILYVAEPLDACSPLTNAVEKVEGAS 79

Query: 86  EQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQ 145
             ++ L+ RG C F +KVRN Q +G  A +V DNE  G++   A G+++ + I +VF+++
Sbjct: 80  SPFV-LIVRGGCGFEDKVRNAQKAGFAAAIVYDNEDGGVLVAMA-GNSAGIKIHAVFVSK 137

Query: 146 TEYKDLRSSSLKP-VEVHLVKD-NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXX 203
                L++ +  P +E+ ++       W ++ +  + +L+ + ++   + +         
Sbjct: 138 ASGMVLQTYAGSPDMELWIIPSFENSAWSIMAISFISLLAMSAVLATCFFVRRHRIRRQR 197

Query: 204 XX-------DIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEF 256
                         ++V  + + IF          + CAICLEDY  G++LRILPC+H+F
Sbjct: 198 PRVSRVREFHGMSSRLVKAMPSLIFTTVLEDNCTSRTCAICLEDYNVGEKLRILPCRHKF 257

Query: 257 HITCIDSWLTTRKKFCPICKRDICS-----PTEETPLLSN 291
           H  C+DSWLT+ + FCP+CKRD  +     P+E TPLLS+
Sbjct: 258 HAFCVDSWLTSWRTFCPVCKRDARTSTGDPPSESTPLLSS 297



>gi|296081075|emb|CBI18269.3| unnamed protein product [Vitis vinifera]
          Length = 424

 Score =  128 bits (322), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 83/280 (29%), Positives = 144/280 (51%), Gaps = 18/280 (6%)

Query: 28  VVDATIVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT 85
           V  A +V++  NVT  + D  A F   +   G  G L   E ++A +    +  K +  +
Sbjct: 4   VAFANVVLIGNNVTLSFDDIQANFAKPVKGSGECGILYVAEPLDACSPLTNAVEKVEGAS 63

Query: 86  EQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQ 145
             ++ L+ RG C F +KVRN Q +G  A +V DNE  G++   A G+++ + I +VF+++
Sbjct: 64  SPFV-LIVRGGCGFEDKVRNAQKAGFAAAIVYDNEDGGVLVAMA-GNSAGIKIHAVFVSK 121

Query: 146 TEYKDLRSSSLKP-VEVHLVKD-NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXX 203
                L++ +  P +E+ ++       W ++ +  + +L+ + ++   + +         
Sbjct: 122 ASGMVLQTYAGSPDMELWIIPSFENSAWSIMAISFISLLAMSAVLATCFFVRRHRIRRQR 181

Query: 204 XX-------DIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEF 256
                         ++V  + + IF          + CAICLEDY  G++LRILPC+H+F
Sbjct: 182 PRVSRVREFHGMSSRLVKAMPSLIFTTVLEDNCTSRTCAICLEDYNVGEKLRILPCRHKF 241

Query: 257 HITCIDSWLTTRKKFCPICKRDICS-----PTEETPLLSN 291
           H  C+DSWLT+ + FCP+CKRD  +     P+E TPLLS+
Sbjct: 242 HAFCVDSWLTSWRTFCPVCKRDARTSTGDPPSESTPLLSS 281



>gi|91095001|ref|XP_969305.1| PREDICTED: similar to zinc finger protein [Tribolium castaneum]
 gi|270015391|gb|EFA11839.1| hypothetical protein TcasGA2_TC002100 [Tribolium castaneum]
          Length = 386

 Score =  128 bits (322), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 86/253 (33%), Positives = 130/253 (51%), Gaps = 27/253 (10%)

Query: 42  YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAP------TEQWIALVERG 95
           ++D  A+FG +L+D  + G LV+     A+   GC+   +  P      T +WI L+ R 
Sbjct: 34  FEDVPASFGKKLSDGVVRGVLVN-----ADPPDGCTSALKPPPKDVENETGRWIVLMPRY 88

Query: 96  Q----CTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDL 151
                C+F +KVR  Q +G  AVVV +   N L+ M A  DT  +NIPSVF++++    L
Sbjct: 89  NDVLNCSFEQKVRMGQGAGYDAVVVHNVHSNQLVPMSAKNDTG-INIPSVFVSESSGSTL 147

Query: 152 RSSSLKPVEVHLVKD----NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDI 207
           +S    P    ++      N+    L+   IVV +   VM+IF+ V             +
Sbjct: 148 KSIYANPQYFIVITGESPFNIQTHLLIPFAIVVGICFIVMIIFLVVKCIKDRRRQRRHRL 207

Query: 208 APQQVVGNLATKIFFESKRQENEPQE-CAICLEDYADGDELRILPCKHEFHITCIDSWLT 266
            P   +  +        K Q+ +P E CAICL+DY +G++LR+LPC H +H  CID WLT
Sbjct: 208 -PTSTLNKIPI-----CKYQKGDPYETCAICLDDYIEGEKLRVLPCNHVYHTKCIDPWLT 261

Query: 267 TRKKFCPICKRDI 279
             ++ CPICKR +
Sbjct: 262 KNRRVCPICKRKV 274



>gi|302822236|ref|XP_002992777.1| hypothetical protein SELMODRAFT_47510 [Selaginella moellendorffii]
 gi|300139422|gb|EFJ06163.1| hypothetical protein SELMODRAFT_47510 [Selaginella moellendorffii]
          Length = 256

 Score =  128 bits (321), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 81/220 (36%), Positives = 121/220 (55%), Gaps = 22/220 (10%)

Query: 89  IALVERGQCTFIEKVRNMQASGAIAVVVGDNEK-NGLITMYATGDTSDVNIPSVFIAQTE 147
            A+VERG C F EK+ N Q +G  AV+V +NE+ + LI+M  +G + DV IP+VF++++ 
Sbjct: 41  FAIVERGGCKFDEKILNAQDAGFSAVIVYNNEEGHDLISM--SGSSDDVRIPAVFVSKSA 98

Query: 148 YKDLRSSSLKPVEVH---LVKDNLLQWPLLDVIIVVILSPT-VMMIFIYV-------LWX 196
            + L   S K +      L       W ++ V  + +L+ T V+  F++V       L  
Sbjct: 99  GETLLEYS-KQIGARCYILPAIENTAWSVMAVSFISLLAVTAVLTTFLFVRRYRLRHLGS 157

Query: 197 XXXXXXXXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEF 256
                     ++ ++V   L T IF      +     CAICLEDY  G++LR+LPC H+F
Sbjct: 158 RLLLLRDSYGMSAREVKA-LPTVIFKCLGDGQGTSDTCAICLEDYESGEKLRVLPCHHDF 216

Query: 257 HITCIDSWLTTRKKFCPICKRDICS------PTEETPLLS 290
           H  C+D WLTTR+ FCP+CKRD  +      P+E TPLL+
Sbjct: 217 HAACVDQWLTTRRPFCPVCKRDAHNKNEEPPPSESTPLLA 256



>gi|15219930|ref|NP_173681.1| Protease-associated (PA) RING/U-box zinc finger family protein
           [Arabidopsis thaliana]
 gi|332192147|gb|AEE30268.1| protease-associated RING/U-box zinc finger-containing protein
           [Arabidopsis thaliana]
          Length = 422

 Score =  127 bits (318), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 94/287 (32%), Positives = 142/287 (49%), Gaps = 29/287 (10%)

Query: 26  NFVVDA-TIVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRK 82
           ++VVDA  +++V +N+T  + D  A F P +T     G +   E + A     C  L+ K
Sbjct: 17  SYVVDAGQVILVDSNITRSFVDMEADFSPSVTTVET-GVVYVAEPLNA-----CRNLRNK 70

Query: 83  APTEQW----IALVERGQCTFIEKVRNMQASGAIAVVVGDN-EKNGLITMYATGDTSDVN 137
                +    + L+ RG C+F  KVRN Q SG  A +V DN ++N L  M   GD+  + 
Sbjct: 71  PEQSPYGTSPLVLIIRGGCSFEYKVRNAQRSGFKAAIVYDNVDRNFLSAM--GGDSDGIK 128

Query: 138 IPSVFIAQTEYKDLRS-SSLKPVEVHLVKDNLLQ--WPLLDVIIVV----ILSPTVMMIF 190
           I +VF+ +   + L+  +  + +EV LV  N     W L   I ++    I    V  +F
Sbjct: 129 IQAVFVMKRAGEMLKKYAGSEEMEVMLVPPNTEDSVWSLYASIALILSLAIFCVMVTCVF 188

Query: 191 IYVLWXXXXXXXXXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRIL 250
            Y             +   ++ V  + +  F  +K        CAICLEDY  GD+LR+L
Sbjct: 189 FYRYCSTIRNSTSQFNGMCRRTVKAMPSVTFTCAKIDNTTGFSCAICLEDYIVGDKLRVL 248

Query: 251 PCKHEFHITCIDSWLTTRKKFCPICKRDICS------PTEETPLLSN 291
           PC H+FH+ C+DSWL + + FCP+CKRD  +       TE TP LS+
Sbjct: 249 PCSHKFHVACVDSWLISWRTFCPVCKRDARTTADEPLATESTPFLSS 295



>gi|460392451|ref|XP_004241829.1| PREDICTED: E3 ubiquitin-protein ligase RNF13-like [Solanum
           lycopersicum]
          Length = 441

 Score =  126 bits (317), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 83/281 (29%), Positives = 135/281 (48%), Gaps = 25/281 (8%)

Query: 31  ATIVVVATN--VTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRK-APTEQ 87
            +++++  N  ++++D  A F P     G  G L   E ++A     CS L  K  PT  
Sbjct: 22  GSVILIGNNRTLSFEDIEANFAPSPKGSGKCGRLYIAEPLDA-----CSTLTNKIEPTNN 76

Query: 88  W----IALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFI 143
           +      L+ RG C+F +KVR  QA+G  A ++ D+    +I M   G ++ V I +VFI
Sbjct: 77  FTKEPFVLIIRGGCSFEDKVRKAQAAGFKAAIIYDSGYGDIIAM--AGTSAGVKILAVFI 134

Query: 144 AQTEYKDLRSSSLKPVEVHLVKD-NLLQWPLLDVIIVVILSPTVMMIFIYVLWXX----- 197
           ++   + L   +    EV L+       W ++    + +LS + ++   + +        
Sbjct: 135 SKASGEALTQYAGSDTEVWLIPSLENSAWSIMATSFISLLSMSAVLAMCFFVRRHHIRRE 194

Query: 198 --XXXXXXXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHE 255
                          ++V  + + IF       +    CAICLEDY  GD+LRILPC+H+
Sbjct: 195 RPRASRVREFHGISSRLVKAMPSLIFTSVVEDNSTSVTCAICLEDYTAGDKLRILPCRHK 254

Query: 256 FHITCIDSWLTTRKKFCPICKRDICSPTEETPLLSNHEPTP 296
           FH  C+D+WLT+ + FCP+CKRD  + T + P     E TP
Sbjct: 255 FHTMCVDAWLTSWRTFCPVCKRDARTSTGDPPA---SESTP 292



>gi|384484953|gb|EIE77133.1| hypothetical protein RO3G_01837 [Rhizopus delemar RA 99-880]
          Length = 150

 Score =  126 bits (316), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 74/195 (37%), Positives = 96/195 (49%), Gaps = 56/195 (28%)

Query: 106 MQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYK---DLRSSSLKPVEVH 162
           MQ SGAIAVVVGD   NG +TMYA GDTS+++IPSVF+AQ +Y+   +L +     + + 
Sbjct: 1   MQESGAIAVVVGDRHFNGWVTMYAPGDTSNIHIPSVFVAQYQYRSLLNLLAYKNNSLLIE 60

Query: 163 LVKDNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVVGNLATKIFF 222
           +  D+LL WPLLD++++V+LSP VMM FIY+ W          D+AP Q V  L T IF 
Sbjct: 61  IAGDDLLAWPLLDMLLIVVLSPAVMMFFIYLTWQLRQRQHKQNDMAPSQFVAKLPTYIF- 119

Query: 223 ESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCPICKRDICS- 281
                                                        R++ CPICK D C  
Sbjct: 120 ---------------------------------------------RREKCPICKFDTCQK 134

Query: 282 ------PTEETPLLS 290
                 P E TPLLS
Sbjct: 135 PNDKSRPNERTPLLS 149



>gi|460409963|ref|XP_004250405.1| PREDICTED: E3 ubiquitin-protein ligase RNF13-like [Solanum
           lycopersicum]
          Length = 444

 Score =  126 bits (316), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 81/275 (29%), Positives = 138/275 (50%), Gaps = 23/275 (8%)

Query: 29  VDATIVVVATN--VTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKA--- 83
           V   +V+V  N  ++++D  A F P +   G  G L   E ++A     CS L  K    
Sbjct: 20  VLGNVVLVGKNETLSFEDIEANFAPSVRGSGKCGILYVAEPLDA-----CSTLTNKVEPV 74

Query: 84  --PTEQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSV 141
              T     L+ RG C+F +KVR  QA+G+ A ++ ++E   L+ M   G+++ V IP+V
Sbjct: 75  KNSTHDLFLLIIRGGCSFEDKVRQAQAAGSKAAIIYNDEYGDLVAM--AGNSAGVQIPAV 132

Query: 142 FIAQTEYKDL-RSSSLKPVEVHLVKD-NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXX 199
           F+++   + + + +    VEV ++       W ++ +  + +L+ + ++   + +     
Sbjct: 133 FVSRVSGEKMTKYAGDIDVEVWIIPSFENSAWSIMAISFISLLAMSAVLATCFFVRRHRI 192

Query: 200 XXXXXXDIAPQQVVG------NLATKIFFESKRQEN-EPQECAICLEDYADGDELRILPC 252
                     ++  G           + F S  ++N     CAICLEDY  GD+LRILPC
Sbjct: 193 RRDRPRASRFREFHGMSSHLVKAMPSLIFTSVLEDNCTSVTCAICLEDYIVGDKLRILPC 252

Query: 253 KHEFHITCIDSWLTTRKKFCPICKRDICSPTEETP 287
           +H+FH  C+D+WLT+ + FCP+CKRD  +   E P
Sbjct: 253 RHKFHAMCVDAWLTSWRTFCPVCKRDARTSNGEPP 287



>gi|195343973|ref|XP_002038565.1| GM10894 [Drosophila sechellia]
 gi|194133586|gb|EDW55102.1| GM10894 [Drosophila sechellia]
          Length = 537

 Score =  125 bits (315), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 82/254 (32%), Positives = 124/254 (48%), Gaps = 21/254 (8%)

Query: 42  YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKA-----PTEQWIALVERGQ 96
           + D  A FGP L   GL  Y+V           GC  L R       P+ +++ALV RG+
Sbjct: 42  FNDLPAQFGPHLPSNGLKVYVVPAR----RPYYGCDSLDRPPHLNYPPSAKFVALVARGE 97

Query: 97  CTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLRSSSL 156
           C F  K+R  Q +   AV+V +NE + L  M A   T  + IPSVF+  T  K L ++  
Sbjct: 98  CVFERKIRVAQNASYSAVIVYNNESDDLEQMSADNQTG-IRIPSVFVGHTTGKAL-ATYF 155

Query: 157 KPVEVHLVKDNLLQWPL-LDVIIVVILSPTVMMIFI----YVLWX-XXXXXXXXXDIAPQ 210
            P  V ++ D L   P  ++  +++  S  + M FI    Y+++              P+
Sbjct: 156 TPDVVLIINDEL---PFNINTQLILPFSILIGMCFIIMVIYMIYKCIREQRRLRRHRLPK 212

Query: 211 QVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKK 270
            ++  L   + +      N+   C ICLED+ + D+LR+LPC H +H  CID WLT  ++
Sbjct: 213 SMLKKLPV-LRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRR 271

Query: 271 FCPICKRDICSPTE 284
            CPICKR + +  E
Sbjct: 272 VCPICKRKVFTKGE 285



>gi|511008479|gb|EPB89744.1| hypothetical protein HMPREF1544_03407 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 168

 Score =  125 bits (314), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 100/152 (65%), Gaps = 12/152 (7%)

Query: 33  IVVVATNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIALV 92
           IV+V++N T+ D+ AAFGPRLT  G+LG L+   +    +++GC  L   +  + WIA+V
Sbjct: 20  IVIVSSNDTHLDKPAAFGPRLTKHGVLGNLI---LAPTESKQGC--LPCASQGKNWIAIV 74

Query: 93  ERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATG-DTSDVNIPSVFIAQTEY--- 148
           ERG C+F+EKVR++QASGAIAV++GD   NG ITMYAT  D SDV IPSV++AQ ++   
Sbjct: 75  ERGGCSFVEKVRSLQASGAIAVIIGDRHYNGWITMYATDTDASDVVIPSVYVAQYQFLSL 134

Query: 149 -KDLRSSSLKPVEVHLVKDNLLQWPLLDVIIV 179
            + L+      V + + K+ L  W   D +IV
Sbjct: 135 IQHLQDKQNSSVIIRITKNELFTW--YDTLIV 164



>gi|218192160|gb|EEC74587.1| hypothetical protein OsI_10167 [Oryza sativa Indica Group]
          Length = 478

 Score =  125 bits (313), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 90/297 (30%), Positives = 144/297 (48%), Gaps = 47/297 (15%)

Query: 36  VATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKA---PTEQWIA 90
           + TN+T  + D  A+F P +   G  G + + E ++A     CS L  KA   P   + A
Sbjct: 1   MGTNLTLSFDDVEASFAPGVKGSGFEGVVYTAEPLDA-----CSPLTSKAEKGPPSPF-A 54

Query: 91  LVERGQCTFIEKVRNMQASGAIAVVVGDNEKNG---------------LITMYAT----- 130
           L+ RG CTF EKV+N Q +G  A +V DNE +G               ++  Y T     
Sbjct: 55  LIIRGGCTFDEKVKNAQDAGFKAAIVYDNENSGVLISIHLALFRLWGHMVLHYLTLKFTV 114

Query: 131 -GDTSDVNIPSVFIAQTEYKDLRS-SSLKPVEVHLVKD-NLLQWPLLDVIIVVILSPTVM 187
            G +  ++I +VFI++   + L+  S    VEV ++       W ++ +  + +L+ + +
Sbjct: 115 AGSSGGIHIYAVFISKASGEVLKKFSGHTDVEVWILPAFENSAWSIMAISFISLLAMSAV 174

Query: 188 MIFIYVLWXXXXXX-------XXXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLED 240
           +   + +                       Q+V  + + IF + +        CAICLED
Sbjct: 175 LATCFFVRRHHIRRDRPRIPEAREFHGMSSQLVKAMPSLIFTKVQEDNCTSSMCAICLED 234

Query: 241 YADGDELRILPCKHEFHITCIDSWLTTRKKFCPICKRDICS------PTEETPLLSN 291
           Y  G++LR+LPC+H+FH  C+D WLTT + FCP+CKRD  +       +E TPLLS+
Sbjct: 235 YKVGEKLRVLPCRHKFHAACVDLWLTTWRTFCPVCKRDASTGIPDPPASETTPLLSS 291



>gi|413917979|gb|AFW57911.1| putative protease-associated RING zinc finger domain family protein
           [Zea mays]
          Length = 296

 Score =  124 bits (311), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 84/252 (33%), Positives = 126/252 (50%), Gaps = 18/252 (7%)

Query: 39  NVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLK----RKAPTEQWIALVER 94
           + T+ D  A FGPR++ +G+ G L + +  EA     C  +K    R+    +   L+ R
Sbjct: 48  SFTFLDAPARFGPRVSGDGICGSLRAADPAEA-----CETIKDRGGRRGAGRKAFVLIAR 102

Query: 95  GQCTFIEKVRNMQASGAIA-VVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLRS 153
           G C+F EKVR  Q +G  A +V  D EK  L +M   G++  ++IP++F+++   + L+ 
Sbjct: 103 GNCSFEEKVRAAQQAGFDASIVYDDEEKASLYSM--VGESDGIHIPAIFVSKMAGETLKK 160

Query: 154 SSLKPVEVHLVKDNLLQWP-----LLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIA 208
            +    E   +  ++ +       +  V +VVI+S     +F                  
Sbjct: 161 FARGEDEECCINSSMDETAGTVLVMSFVSLVVIMSVLASFLFARNCRLLRHGVDNHPPYV 220

Query: 209 PQQVVGNLATKIFFESKRQENEPQE-CAICLEDYADGDELRILPCKHEFHITCIDSWLTT 267
            +QVV       +      E+  QE CAICLEDY +GD LR LPCKHEFH  CIDSWLT 
Sbjct: 221 KKQVVEKFPCSAYSAPCSSEDNFQEACAICLEDYNNGDMLRHLPCKHEFHKICIDSWLTK 280

Query: 268 RKKFCPICKRDI 279
              FCPICK ++
Sbjct: 281 WGIFCPICKLEV 292



>gi|226502198|ref|NP_001143559.1| uncharacterized protein LOC100276255 precursor [Zea mays]
 gi|195622502|gb|ACG33081.1| hypothetical protein [Zea mays]
          Length = 276

 Score =  124 bits (311), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 84/252 (33%), Positives = 126/252 (50%), Gaps = 18/252 (7%)

Query: 39  NVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLK----RKAPTEQWIALVER 94
           + T+ D  A FGPR++ +G+ G L + +  EA     C  +K    R+    +   L+ R
Sbjct: 28  SFTFLDAPARFGPRVSGDGICGSLRAADPAEA-----CETIKDRGGRRGAGRKAFVLIAR 82

Query: 95  GQCTFIEKVRNMQASGAIA-VVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLRS 153
           G C+F EKVR  Q +G  A +V  D EK  L +M   G++  ++IP++F+++   + L+ 
Sbjct: 83  GNCSFEEKVRAAQQAGFDASIVYDDEEKASLYSM--VGESDGIHIPAIFVSKMAGETLKK 140

Query: 154 SSLKPVEVHLVKDNLLQWP-----LLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIA 208
            +    E   +  ++ +       +  V +VVI+S     +F                  
Sbjct: 141 FARGEDEECCINSSMDETAGTVLVMSFVSLVVIMSVLASFLFARNCRLLRHGVDNHPPYV 200

Query: 209 PQQVVGNLATKIFFESKRQENEPQE-CAICLEDYADGDELRILPCKHEFHITCIDSWLTT 267
            +QVV       +      E+  QE CAICLEDY +GD LR LPCKHEFH  CIDSWLT 
Sbjct: 201 KKQVVEKFPCSAYSAPCSSEDNFQEACAICLEDYNNGDMLRHLPCKHEFHKICIDSWLTK 260

Query: 268 RKKFCPICKRDI 279
              FCPICK ++
Sbjct: 261 WGIFCPICKLEV 272



>gi|195502293|ref|XP_002098159.1| GE10219 [Drosophila yakuba]
 gi|194184260|gb|EDW97871.1| GE10219 [Drosophila yakuba]
          Length = 537

 Score =  124 bits (310), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 84/255 (32%), Positives = 128/255 (50%), Gaps = 23/255 (9%)

Query: 42  YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKA-----PTEQWIALVERG- 95
           + D  A FGP L   GL  Y+V           GC  L R       P+ +++ALV RG 
Sbjct: 42  FNDLPAQFGPHLPSNGLKVYVVPAR----RPYYGCDSLDRPPHLNYPPSAKFVALVSRGG 97

Query: 96  QCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLRSSS 155
           +CTF  KVR  Q +   AV+V +NE + L  M A  + +++ IPSVF+  T  K L ++ 
Sbjct: 98  ECTFERKVRVAQNASYSAVIVYNNEGDDLEQMSAD-NITNIRIPSVFVGHTTGKAL-ATY 155

Query: 156 LKPVEVHLVKDNLLQWPL-LDVIIVVILSPTVMMIFI----YVLWX-XXXXXXXXXDIAP 209
             P  V ++ D L   P  ++  +++  S  + M FI    Y+++              P
Sbjct: 156 FTPDVVLIINDEL---PFNINTQLILPFSILIGMCFIIMVIYMIYKCIREQRRLRRHRLP 212

Query: 210 QQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRK 269
           + ++  L   +   +K   N+   C ICLED+ + D+LR+LPC H +H  CID WLT  +
Sbjct: 213 KSMLKKLP--VLRYTKNNANKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENR 270

Query: 270 KFCPICKRDICSPTE 284
           + CPICKR + +  E
Sbjct: 271 RVCPICKRKVFTKGE 285



>gi|505779208|ref|XP_004603253.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 [Sorex araneus]
          Length = 382

 Score =  124 bits (310), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 82/250 (32%), Positives = 128/250 (51%), Gaps = 22/250 (8%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLK----RKAPTEQWIALVERGQ 96
           T+ D  A FG RL  EGL G+LVS     +  +  C  +     R   +  +I L+ R  
Sbjct: 47  TFDDLPARFGYRLPAEGLKGFLVS-----SRPENACEPIAPPPLRDNSSSAFIVLIRRLD 101

Query: 97  CTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTS---DVNIPSVFIAQTEYKDLRS 153
           C F  KV N Q +G  A +V + + +GLI+M  + D      ++IPSVFI ++    L+ 
Sbjct: 102 CNFDVKVLNAQRAGYKAAIVHNVDSDGLISM-GSNDIDVLKKIDIPSVFIGESSANSLKD 160

Query: 154 --SSLKPVEVHLVKDNLL--QWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAP 209
             S  K   V LV +  L  ++ L+  +I+V +   +++IF+   +           +  
Sbjct: 161 EFSYEKGGHVILVPEFSLPLEYYLIPFLIIVGICLVLIVIFMITKFVQDRHRARRNRLRK 220

Query: 210 QQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRK 269
            Q+      K+     ++ +E   CAICL++Y DGD+LRILPC H +H  C+D WLT  K
Sbjct: 221 DQL-----KKLPIHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTK 275

Query: 270 KFCPICKRDI 279
           K CP+CK+ +
Sbjct: 276 KTCPVCKQKV 285



>gi|24644599|ref|NP_649653.1| CG10277, isoform A [Drosophila melanogaster]
 gi|24644601|ref|NP_731079.1| CG10277, isoform B [Drosophila melanogaster]
 gi|24644603|ref|NP_731080.1| CG10277, isoform C [Drosophila melanogaster]
 gi|161078064|ref|NP_001097695.1| CG10277, isoform D [Drosophila melanogaster]
 gi|7298919|gb|AAF54124.1| CG10277, isoform A [Drosophila melanogaster]
 gi|23170661|gb|AAN13375.1| CG10277, isoform B [Drosophila melanogaster]
 gi|23170662|gb|AAN13376.1| CG10277, isoform C [Drosophila melanogaster]
 gi|158030174|gb|ABW08609.1| CG10277, isoform D [Drosophila melanogaster]
 gi|372810444|gb|AEX98014.1| FI17865p1 [Drosophila melanogaster]
          Length = 536

 Score =  124 bits (310), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 79/252 (31%), Positives = 126/252 (50%), Gaps = 17/252 (6%)

Query: 42  YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKA-----PTEQWIALVERGQ 96
           + D  A FGP L   GL  Y+V           GC  L R       P+ +++ALV RG+
Sbjct: 42  FNDLPAQFGPNLPSNGLKVYVVPAR----RPYYGCDSLDRPPHLKYPPSAKFVALVARGE 97

Query: 97  CTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLRSSSL 156
           C F  K+R  Q +   AV+V +NE + L  M A   T  + IPSVF+  T  K L  ++ 
Sbjct: 98  CVFERKIRVAQNASYSAVIVYNNEGDDLEQMSAENITG-IRIPSVFVGHTTGKAL--ATY 154

Query: 157 KPVEVHLVKDNLLQWPLLDVIIV---VILSPTVMMIFIYVLWX-XXXXXXXXXDIAPQQV 212
              EV L+ ++ L + +   +I+   +++    +++ IY+++              P+ +
Sbjct: 155 FTTEVVLIINDELPFNINTQLILPFSILIGMCFIIMVIYMIYKCIREQRRLRRHRLPKSM 214

Query: 213 VGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFC 272
           +  L   + +      N+   C ICLED+ + D+LR+LPC H +H  CID WLT  ++ C
Sbjct: 215 LKKLPV-LRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRRVC 273

Query: 273 PICKRDICSPTE 284
           PICKR + +  E
Sbjct: 274 PICKRKVFTKGE 285



>gi|195568735|ref|XP_002102369.1| GD19873 [Drosophila simulans]
 gi|194198296|gb|EDX11872.1| GD19873 [Drosophila simulans]
          Length = 537

 Score =  123 bits (308), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 78/252 (30%), Positives = 125/252 (49%), Gaps = 17/252 (6%)

Query: 42  YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKA-----PTEQWIALVERGQ 96
           + D  A FGP L   GL  Y+V           GC  L R       P+ +++ALV RG+
Sbjct: 42  FNDLPAQFGPHLPSNGLKVYVVPAR----RPYYGCDSLDRPPHLNYPPSAKFVALVARGE 97

Query: 97  CTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLRSSSL 156
           C F  K+R  Q +   AV+V +NE + L  M A   T  + IPSVF+  T  K L +   
Sbjct: 98  CVFERKIRVAQNASYSAVIVYNNEGDDLEQMSADNQTG-IRIPSVFVGHTTGKALATYFT 156

Query: 157 KPVEVHLVKDNLLQWPLLDVIIV---VILSPTVMMIFIYVLWX-XXXXXXXXXDIAPQQV 212
              +V L+ ++ L + +   +I+   +++    +++ IY+++              P+ +
Sbjct: 157 N--DVVLIINDELPFNINTQLILPFSILIGMCFIIMVIYMIYKCIREQRRLRRHRLPKSM 214

Query: 213 VGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFC 272
           +  L   + +      N+   C ICLED+ + D+LR+LPC H +H  CID WLT  ++ C
Sbjct: 215 LKKLPV-LRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRRVC 273

Query: 273 PICKRDICSPTE 284
           PICKR + +  E
Sbjct: 274 PICKRKVFTKGE 285



>gi|194899051|ref|XP_001979076.1| GG13423 [Drosophila erecta]
 gi|190650779|gb|EDV48034.1| GG13423 [Drosophila erecta]
          Length = 538

 Score =  123 bits (308), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 83/250 (33%), Positives = 126/250 (50%), Gaps = 22/250 (8%)

Query: 47  AAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKA-----PTEQWIALVERG-QCTFI 100
           A FGP+L   GL  Y+V           GC  L+R       P+ +++ALV RG +CTF 
Sbjct: 47  AQFGPQLPSNGLKVYVVPAR----RPYYGCDSLERPPHLNYPPSAKFVALVSRGGECTFE 102

Query: 101 EKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLRSSSLKPVE 160
            KVR  Q +   AV+V +NE + L  M A  + S + IPSVF+  T  K L ++   P  
Sbjct: 103 RKVRVAQNASYSAVIVYNNEGDDLEQMSAD-NVSSIRIPSVFVGHTSGKAL-ATYFTPEV 160

Query: 161 VHLVKDNLLQWPL-LDVIIVVILSPTVMMIFI----YVLWX-XXXXXXXXXDIAPQQVVG 214
           V ++ D L   P  ++  +++  S  + M FI    Y+++              P+ ++ 
Sbjct: 161 VLIINDEL---PFNINTQLILPFSILIGMCFIIMVIYMIYKCIREQRRMRRHRLPKSMLK 217

Query: 215 NLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCPI 274
            L   + +      N+   C ICLED+ + D+LR+LPC H +H  CID WLT  ++ CPI
Sbjct: 218 KLPV-LRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRRVCPI 276

Query: 275 CKRDICSPTE 284
           CKR + +  E
Sbjct: 277 CKRKVFTKGE 286



>gi|482573466|gb|EOA37653.1| hypothetical protein CARUB_v10012186mg [Capsella rubella]
          Length = 430

 Score =  123 bits (308), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 87/265 (32%), Positives = 132/265 (49%), Gaps = 15/265 (5%)

Query: 33  IVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEA-NNQKGCSKLKRKAPTEQWI 89
           I+V + N T  + D  A+F P L +    G +   E ++A  N +  +K +++A      
Sbjct: 26  ILVDSNNNTRSFVDMEASFSP-LVNTVKAGVVYVAEPLDACGNMR--NKPEQRANGTSPF 82

Query: 90  ALVERGQCTFIEKVRNMQASGAIAVVVGDN-EKNGLITMYATGDTSDVNIPSVFIAQTEY 148
            L+ RG C+F  KVRN Q SG  A +V DN + N L  M   GD+  + I +VF+     
Sbjct: 83  VLIRRGGCSFEYKVRNAQRSGFKAAIVYDNVDSNFLFPM--GGDSDGIQIQAVFVRNAAG 140

Query: 149 KDLRS-SSLKPVEVHLVKDNLLQWPLLDVIIVVILSPTVMMIF-----IYVLWXXXXXXX 202
           + L+  + L   EV LV D+      L   I ++LS  +  +      +Y          
Sbjct: 141 ETLKKYAGLAETEVMLVPDSKDSLWSLCATIALLLSLAMCGVMAACVCVYRCCTPHSNSI 200

Query: 203 XXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCID 262
              +   + +V  + +  F  +K        CAICLEDY  GD+LR+LPC H+FH+ C+D
Sbjct: 201 SQFNGMSRGMVKEMPSVTFTCAKDDTTTGSSCAICLEDYNVGDKLRVLPCGHKFHVACVD 260

Query: 263 SWLTTRKKFCPICKRDICSPTEETP 287
           SWL + + FCP+CKRD    T+E P
Sbjct: 261 SWLISWRTFCPVCKRDAKRSTDEPP 285



>gi|297850724|ref|XP_002893243.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gi|297339085|gb|EFH69502.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
          Length = 426

 Score =  123 bits (308), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 91/286 (31%), Positives = 143/286 (50%), Gaps = 28/286 (9%)

Query: 26  NFVVDA-TIVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRK 82
           ++VVDA  ++++ +N+T  +    A F P +T     G +   E + A     C  L+ K
Sbjct: 17  SYVVDAGQVILMNSNITRSFVGIEADFSPLVTTVET-GVVYVAEPLNA-----CRNLRNK 70

Query: 83  ---APT-EQWIALVERGQCTFIEKVRNMQASGAIAVVVGDN-EKNGLITMYATGDTSDVN 137
              +P       L+ RG C+F  KVRN Q SG  A +V DN ++  L  M   GD+  + 
Sbjct: 71  PEQSPNGTSPFVLIIRGGCSFEYKVRNAQRSGFKAAIVYDNVDRKFLFAM--GGDSEGIK 128

Query: 138 IPSVFIAQTEYKDLRS-SSLKPVEVHLVKDN-----LLQWPLLDVIIVVILSPTVMMIFI 191
           I +VF+ +T  + L+  + L   EV L+ ++      L   +  ++++ I       IF 
Sbjct: 129 IQAVFVTKTAGEILKKYAGLAETEVMLISNSEDSVWSLYASIALILLLAIFCVMAACIFF 188

Query: 192 YVLWXXXXXXXXXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILP 251
           Y             +    ++V  + +  F  +K        CAICLEDY  GD+LR+LP
Sbjct: 189 YRYCTTLRNSTSQFNGMCCKMVNAMPSVTFTYAKIDNTTGFSCAICLEDYIVGDKLRVLP 248

Query: 252 CKHEFHITCIDSWLTTRKKFCPICKRDICSP------TEETPLLSN 291
           C H+FH++C+DSWL + + FCP+CKRD  +       TE TPLLS+
Sbjct: 249 CSHKFHVSCVDSWLISWRTFCPVCKRDARTSADEPPATESTPLLSS 294



>gi|482570971|gb|EOA35159.1| hypothetical protein CARUB_v10020298mg [Capsella rubella]
          Length = 446

 Score =  122 bits (307), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 78/272 (28%), Positives = 136/272 (50%), Gaps = 14/272 (5%)

Query: 28  VVDATIVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT 85
           +  A ++++  N+T  + D  A F P +   G +G +   E ++A  Q   +K ++ +  
Sbjct: 17  LASAKVILMRNNITLSFDDIEANFAPSVKGTGEIGVVYVAEPLDAC-QNLMNKPEQSSNG 75

Query: 86  EQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQ 145
                L+ RG C+F +KVR  Q +G  A ++ D+E  G +   A G++  + I +VF+ +
Sbjct: 76  TSPFVLIVRGGCSFEDKVRKAQRAGFKAAIIYDSEDRGTLIAMA-GNSGGIKIHAVFVTK 134

Query: 146 TEYKDLRSSSLKP-VEVHLVKD-NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXX 203
              + L+ S+  P  +V L+       W ++ V  + +L+ + ++   + +         
Sbjct: 135 ETGEALKESAGFPDTKVWLIPSFENSAWSIMAVSFISLLAMSAVLATCFFVRRHRIRRRT 194

Query: 204 XXDIA--------PQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHE 255
               +         +++V  + T IF            CAICLEDY  GD+LR+LPC H+
Sbjct: 195 ASRSSRVREFHGMSRRLVKAMPTLIFSSFHEDNTTAFTCAICLEDYNVGDKLRLLPCCHK 254

Query: 256 FHITCIDSWLTTRKKFCPICKRDICSPTEETP 287
           FH  C+DSWLT+ + FCP+CKRD  + T E P
Sbjct: 255 FHAECVDSWLTSWRTFCPVCKRDARTSTGEPP 286



>gi|22330577|ref|NP_177343.2| protease-associated and C3HC4-type RING finger domain-containing
           protein [Arabidopsis thaliana]
 gi|17529200|gb|AAL38826.1| unknown protein [Arabidopsis thaliana]
 gi|22136866|gb|AAM91777.1| unknown protein [Arabidopsis thaliana]
 gi|332197139|gb|AEE35260.1| protease-associated and C3HC4-type RING finger domain-containing
           protein [Arabidopsis thaliana]
          Length = 448

 Score =  122 bits (306), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 78/271 (28%), Positives = 135/271 (49%), Gaps = 13/271 (4%)

Query: 28  VVDATIVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT 85
           +  + ++++  N+T  + D  A F P +   G +G +   E ++A  Q   +K ++ +  
Sbjct: 17  LASSKVILMRNNITLSFDDIEANFAPSVKGTGEIGVVYVAEPLDAC-QNLMNKPEQSSNE 75

Query: 86  EQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQ 145
                L+ RG C+F EKVR  Q +G  A ++ DNE  G +   A G++  + I +VF+ +
Sbjct: 76  TSPFVLIVRGGCSFEEKVRKAQRAGFKAAIIYDNEDRGTLIAMA-GNSGGIRIHAVFVTK 134

Query: 146 TEYKDLRSSSLKP-VEVHLVKD-NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXX 203
              + L+  +  P  +V L+       W ++ V  + +L+ + ++   + +         
Sbjct: 135 ETGEVLKEYAGFPDTKVWLIPSFENSAWSIMAVSFISLLAMSAVLATCFFVRRHRIRRRT 194

Query: 204 XXDIAPQQVVG------NLATKIFFESKRQENEPQ-ECAICLEDYADGDELRILPCKHEF 256
                 ++  G           + F S  ++N     CAICLEDY  GD+LR+LPC H+F
Sbjct: 195 SRSSRVREFHGMSRRLVKAMPSLIFSSFHEDNTTAFTCAICLEDYTVGDKLRLLPCCHKF 254

Query: 257 HITCIDSWLTTRKKFCPICKRDICSPTEETP 287
           H  C+DSWLT+ + FCP+CKRD  + T E P
Sbjct: 255 HAACVDSWLTSWRTFCPVCKRDARTSTGEPP 285



>gi|195995595|ref|XP_002107666.1| hypothetical protein TRIADDRAFT_63462 [Trichoplax adhaerens]
 gi|190588442|gb|EDV28464.1| hypothetical protein TRIADDRAFT_63462 [Trichoplax adhaerens]
          Length = 288

 Score =  122 bits (306), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 84/277 (30%), Positives = 139/277 (50%), Gaps = 27/277 (9%)

Query: 31  ATIVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQ- 87
           A + VV+ N +  + D  A FGP +++ GL G  V    ++     GCS ++R  P +  
Sbjct: 22  ADVSVVSGNFSQSFNDIRADFGPSVSEAGLSGRGVIAHPLD-----GCSPIRR-PPNDLT 75

Query: 88  -WIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQT 146
            + A+++RG C F  KV + Q +   AV+V ++  + L  M     T+ +NIPSVFI   
Sbjct: 76  FYFAIIKRGSCHFDLKVYHAQNANYKAVIVYNDLSDRLEKMDGKNYTNRINIPSVFIGNA 135

Query: 147 E----YKDLRSSSLKPVEVHLVKDNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXX 202
                 K ++  S   + ++   +    +  +   IV+ +S  +M + +           
Sbjct: 136 SGVQLLKTIKRDSGALINIYPEYNFPWDFYFIPFAIVICISFLIMSLILVCKCREMCIAR 195

Query: 203 XXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCID 262
               +A   +      ++     ++ +E   CAICL++Y +G++LRILPCKH +H  CID
Sbjct: 196 RETRLARANL-----NRLKVVKFKKGDEYDVCAICLDEYNEGEKLRILPCKHAYHCKCID 250

Query: 263 SWLTTRKKFCPICK-------RDIC-SPTEETPLLSN 291
            WLT  K+ CP+CK       RD C +P+E TPLL+N
Sbjct: 251 PWLTDNKRECPVCKRRVNLSARDDCENPSENTPLLAN 287



>gi|50550311|ref|XP_502628.1| YALI0D09735p [Yarrowia lipolytica]
 gi|49648496|emb|CAG80816.1| YALI0D09735p [Yarrowia lipolytica CLIB122]
          Length = 474

 Score =  122 bits (306), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 88/274 (32%), Positives = 129/274 (47%), Gaps = 59/274 (21%)

Query: 68  IEANNQKGCSKLKRKAPTEQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKN-GLIT 126
           IE      C   K +  T++ IALV RG C+F +KV  +Q   A AV+VGDN+ N GL+T
Sbjct: 208 IEVVGGDACGSGKHRNLTDK-IALVMRGGCSFYDKVLTIQGWNAKAVIVGDNQYNRGLVT 266

Query: 127 MYATGDTSDVNIPSVFIAQTEYKDLRSSSLKPVEVHLVKDNLLQWPLLDVIIVVILSPTV 186
           MY+T DT    +P++F+++  ++ L +      EV ++       P LD I+ +++SP  
Sbjct: 267 MYSTNDTDMCQVPAMFVSRASFELLSTED----EVSIIPGPSAT-PALDTILFLLISPIC 321

Query: 187 MMIFIYVLWXXXXXXXXXXDIAPQQVVGNLATKIFF---------ESKRQEN-------- 229
            +  IY++             AP++ V  L  +++            K Q N        
Sbjct: 322 SLSIIYLMVSVHRYFTQLTRRAPKRAVKQLPVRVWMGQGVHSPTVRGKTQGNNSSSGVLE 381

Query: 230 --EP--------------------------QECAICLEDYADGDELRI--LPCKHEFHIT 259
             EP                           EC ICLE++  G E R+  LPC H+FH  
Sbjct: 382 SVEPTSTAAAALEDSPEPPSTHSDKVWVSSDECIICLEEFTVG-ESRVMQLPCGHDFHEE 440

Query: 260 CIDSWLTTRKKFCPICKRDI----CSPTEETPLL 289
           CI  WLTT+++ CPICK DI     SP E TPL+
Sbjct: 441 CIQRWLTTQQRTCPICKHDITQPMSSPGETTPLV 474



>gi|357168387|ref|XP_003581622.1| PREDICTED: E3 ubiquitin-protein ligase RNF13-like [Brachypodium
           distachyon]
          Length = 270

 Score =  122 bits (306), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 80/247 (32%), Positives = 126/247 (51%), Gaps = 15/247 (6%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTE-QWIALVERGQCTF 99
           ++ D  A FGPR++ +G+ G L S     A+    C+ +K  A +  +   LV RG C+F
Sbjct: 27  SFLDAPARFGPRVSGDGICGSLRS-----ADPSDACTPIKNSAGSGGRAFVLVVRGNCSF 81

Query: 100 IEKVRNMQASGAIAVVVGDNE-KNGLITMYATGDTSDVNIPSVFIAQTEYKDLRSSSLKP 158
            +KVR  Q +G  AVVV D+E K  L +M   GD+  ++IP+VF+++   + L+  +   
Sbjct: 82  EDKVREAQRAGFNAVVVYDDEEKASLYSM--VGDSEGIHIPAVFLSKMAGETLKKFARGE 139

Query: 159 -----VEVHLVKDNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVV 213
                +E  + +       +  V +VVI+S     +F                   + VV
Sbjct: 140 DSECCIESSMDETAGTVLVMSFVSLVVIISVLASFLFARNCRLLRHGVDNRPPYIKKHVV 199

Query: 214 GNLATKIFFESKRQENEPQE-CAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFC 272
             L   ++       +  ++ CAICLEDY +GD LR+LPC+HEFH  C+D WLT    FC
Sbjct: 200 DKLPCLVYKAPCSSGSTSEDACAICLEDYDNGDMLRLLPCRHEFHTVCVDPWLTKWGTFC 259

Query: 273 PICKRDI 279
           P+CK ++
Sbjct: 260 PVCKLEV 266



>gi|224104529|ref|XP_002333929.1| predicted protein [Populus trichocarpa]
 gi|222839169|gb|EEE77520.1| predicted protein [Populus trichocarpa]
          Length = 461

 Score =  122 bits (305), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 88/289 (30%), Positives = 138/289 (47%), Gaps = 33/289 (11%)

Query: 29  VDATIVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAP-- 84
             A +V++  NVT  + D  A F P +   G  G L   E I+A     C+ L  KA   
Sbjct: 18  ASANVVLIGNNVTMAFNDIEANFAPAIKGSGECGVLSLAEPIDA-----CTDLTNKAEKG 72

Query: 85  --TEQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYA-------TGDTSD 135
             +     L+ RG C+F  KVR  Q +G  A +V DNE+  L+            G++  
Sbjct: 73  LNSSSPYVLIIRGGCSFEHKVRRAQKAGFKAAIVFDNEEGVLVASKTFSYVKIVAGNSVG 132

Query: 136 VNIPSVFIAQTEYKDL-RSSSLKPVEVHLVKD-NLLQWPLLDVIIVVILSPTVMMIFIYV 193
           V I +VF+++   + L + + L  +E+ L+       W ++ +  + +L+ + ++   + 
Sbjct: 133 VKIHAVFVSKKSGETLTKYAGLTGLELWLIPSFENSAWSIMAISFISLLAMSAVLATCFF 192

Query: 194 LWXXXXXXXXXXDIAPQQVVG------NLATKIFFESKRQEN-EPQECAICLEDYADGDE 246
           +               ++  G           + F S  ++N     CAICLEDY  G++
Sbjct: 193 IRRHRIRREHSHSSRVREFHGMSSRLVKAMPSLTFTSVLEDNCTSTTCAICLEDYTVGEK 252

Query: 247 LRILPCKHEFHITCIDSWLTTRKKFCPICKRDICSPT------EETPLL 289
           LRILPC+H+FH  C+DSWLTT + FCP+CKRD  + T      E TPLL
Sbjct: 253 LRILPCRHKFHAFCVDSWLTTWRTFCPVCKRDARTSTGDPPASESTPLL 301



>gi|148222567|ref|NP_001083709.1| ring finger protein 13 precursor [Xenopus laevis]
 gi|39645071|gb|AAH63734.1| MGC68556 protein [Xenopus laevis]
          Length = 381

 Score =  121 bits (304), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 78/246 (31%), Positives = 128/246 (52%), Gaps = 13/246 (5%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIALVERGQCTFI 100
           T+ D  A FG RL  +GL GYLV+ +   A        + R   +  +I L++R +C F 
Sbjct: 46  TFDDLPARFGYRLPGDGLKGYLVTAKPDNACQPISPPPVLRDNASSVFIVLIKRLECNFD 105

Query: 101 EKVRNMQASGAIAVVVGDNEKNGLITMYATGDT---SDVNIPSVFIAQTEYKDLRSSSL- 156
            KV N Q +G  A VV + + + LI+M  + D      ++IPSVFI ++  + L+     
Sbjct: 106 LKVLNAQKAGYKAAVVYNVDSDDLISM-GSNDVDILKQIDIPSVFIGESSARSLKEDFAW 164

Query: 157 -KPVEVHLVKDNLL--QWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVV 213
            K   + LV D  L  ++ L+  +I+V +   +++IF+   +           +   Q+ 
Sbjct: 165 EKGGYIVLVPDLTLPLEYYLIPFLIIVGICLVLIVIFMITKFVQDRHRARRNRLRKDQL- 223

Query: 214 GNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCP 273
                K+     ++ +E   CA+CL++Y +GD+LRILPC H +H  C+D WLT  KK CP
Sbjct: 224 ----KKLPIHKFKKGDEYDVCAVCLDEYEEGDKLRILPCSHAYHCKCVDPWLTKTKKTCP 279

Query: 274 ICKRDI 279
           +CK+ +
Sbjct: 280 VCKQKV 285



>gi|482573150|gb|EOA37337.1| hypothetical protein CARUB_v10011046mg [Capsella rubella]
          Length = 348

 Score =  121 bits (304), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 84/271 (30%), Positives = 134/271 (49%), Gaps = 23/271 (8%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
           T +++ D  A F P +   G  G+L + E I+A     CS LK  A       +   L+E
Sbjct: 29  TILSFDDVEATFTPIVGSSGECGFLYAAEPIDA-----CSDLKNTAEKGSNYRRSYVLIE 83

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLRS 153
           RG C+F  KVR  Q +G  A +V  N+    + ++  G++S V+I  V + +   + L+ 
Sbjct: 84  RGGCSFEVKVRKAQEAGYKAAIV-YNDAYDEVLVHMVGNSSGVDIHGVLVTRASGEVLKG 142

Query: 154 SSLKP-VEVHLVKD-NLLQWPLLDVIIVVILSPTVMM-IFIYVLWXXXXXXXXXX----D 206
            + +  +E+ L+       W +L +  V +   TV++  + YV                 
Sbjct: 143 YAGRTEMELWLIPGLGTSSWSILAITFVSLFIVTVVLATYFYVRRRRSVIILSRGGRGFS 202

Query: 207 IAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLT 266
             P  +V  + T++F       +    CAIC++DY  GD+LRILPC+H+FH  CIDSWL 
Sbjct: 203 CVPCNLVQRIPTEVFSGVFEVGSTSITCAICIDDYCIGDKLRILPCQHKFHAVCIDSWLG 262

Query: 267 TRKKFCPICKRDICS------PTEETPLLSN 291
             + FCP+CK D+ +       +E+TPLLS 
Sbjct: 263 RWRYFCPVCKHDVRAAKSDPPASEQTPLLST 293



>gi|297839045|ref|XP_002887404.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gi|297333245|gb|EFH63663.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
          Length = 448

 Score =  121 bits (303), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 78/271 (28%), Positives = 135/271 (49%), Gaps = 13/271 (4%)

Query: 28  VVDATIVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT 85
           +  + ++++  N+T  + D  A F P +   G +G +   E ++A  Q   +K ++ +  
Sbjct: 17  LASSKVILMRNNITLSFDDIEANFAPSVKGTGEIGLVYVAEPLDAC-QNLMNKPEQSSNE 75

Query: 86  EQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQ 145
                L+ RG C+F EKVR  Q +G  A ++ DNE  G +   A G++  + I +VF+ +
Sbjct: 76  TSPFVLIVRGGCSFEEKVRKAQRAGFKAAIIFDNEDRGTLIAMA-GNSGGIKIHAVFVTK 134

Query: 146 TEYKDLRSSSLKP-VEVHLVKD-NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXX 203
              + L+  +  P  +V L+       W ++ V  + +L+ + ++   + +         
Sbjct: 135 ETGEVLKDYAGFPDTKVWLIPSFENSAWSIMAVSFISLLAMSAVLATCFFVRRHRIRRRT 194

Query: 204 XXDIAPQQVVG------NLATKIFFESKRQENEPQ-ECAICLEDYADGDELRILPCKHEF 256
                 ++  G           + F S  ++N     CAICLEDY  GD+LR+LPC H+F
Sbjct: 195 SRSSRVREFHGMSRRLVKAMPSLIFSSFHEDNTTAFTCAICLEDYIVGDKLRLLPCCHKF 254

Query: 257 HITCIDSWLTTRKKFCPICKRDICSPTEETP 287
           H  C+DSWLT+ + FCP+CKRD  + T E P
Sbjct: 255 HAACVDSWLTSWRTFCPVCKRDARTNTGEPP 285



>gi|498980323|ref|XP_004529322.1| PREDICTED: uncharacterized protein LOC101460492 isoform X1
           [Ceratitis capitata]
 gi|498980327|ref|XP_004529323.1| PREDICTED: uncharacterized protein LOC101460492 isoform X2
           [Ceratitis capitata]
 gi|498980331|ref|XP_004529324.1| PREDICTED: uncharacterized protein LOC101460492 isoform X3
           [Ceratitis capitata]
 gi|498980335|ref|XP_004529325.1| PREDICTED: uncharacterized protein LOC101460492 isoform X4
           [Ceratitis capitata]
          Length = 593

 Score =  121 bits (303), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 81/251 (32%), Positives = 130/251 (51%), Gaps = 22/251 (8%)

Query: 42  YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTE------QWIALVERG 95
           Y D  A FGP L   G+  + +      A ++ GC +L      E      +++ +++RG
Sbjct: 52  YNDLPAQFGPPLPANGIKVFAIPA----AKDEYGCERLAVPPREEGYPKNAKFVVIIKRG 107

Query: 96  ---QCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLR 152
               CTF  KVRN QASG  AV+V +N+ + L  M A+ ++S + IPSVF+  T   +L 
Sbjct: 108 GGANCTFERKVRNGQASGYDAVIVYNNDGDDLEQMSAS-NSSGIYIPSVFVGHTTGLNL- 165

Query: 153 SSSLKPVEVHLVKDNLLQWPLLDVII----VVILSPTVMMIFIYVLWXXXXXXXXXXDIA 208
             +    +V LV ++ L + +   +I    ++I    ++M+F  +               
Sbjct: 166 -MTFFTTDVILVINDELPFNINTQLILPFSILIGLCFLIMVFYMIYKCVREERRLRRHRL 224

Query: 209 PQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTR 268
           P+ ++  L   I   +K  +     C ICLE++A+GD+LR+LPCKH +H  CID WLT  
Sbjct: 225 PKNMLKKLP--ILKYTKNCDLSQDTCVICLEEFAEGDKLRVLPCKHPYHSHCIDPWLTEN 282

Query: 269 KKFCPICKRDI 279
           ++ CPICKR +
Sbjct: 283 RRVCPICKRKV 293



>gi|498980339|ref|XP_004529326.1| PREDICTED: uncharacterized protein LOC101460492 isoform X5
           [Ceratitis capitata]
          Length = 587

 Score =  121 bits (303), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 81/251 (32%), Positives = 130/251 (51%), Gaps = 22/251 (8%)

Query: 42  YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTE------QWIALVERG 95
           Y D  A FGP L   G+  + +      A ++ GC +L      E      +++ +++RG
Sbjct: 46  YNDLPAQFGPPLPANGIKVFAIPA----AKDEYGCERLAVPPREEGYPKNAKFVVIIKRG 101

Query: 96  ---QCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLR 152
               CTF  KVRN QASG  AV+V +N+ + L  M A+ ++S + IPSVF+  T   +L 
Sbjct: 102 GGANCTFERKVRNGQASGYDAVIVYNNDGDDLEQMSAS-NSSGIYIPSVFVGHTTGLNL- 159

Query: 153 SSSLKPVEVHLVKDNLLQWPLLDVII----VVILSPTVMMIFIYVLWXXXXXXXXXXDIA 208
             +    +V LV ++ L + +   +I    ++I    ++M+F  +               
Sbjct: 160 -MTFFTTDVILVINDELPFNINTQLILPFSILIGLCFLIMVFYMIYKCVREERRLRRHRL 218

Query: 209 PQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTR 268
           P+ ++  L   I   +K  +     C ICLE++A+GD+LR+LPCKH +H  CID WLT  
Sbjct: 219 PKNMLKKLP--ILKYTKNCDLSQDTCVICLEEFAEGDKLRVLPCKHPYHSHCIDPWLTEN 276

Query: 269 KKFCPICKRDI 279
           ++ CPICKR +
Sbjct: 277 RRVCPICKRKV 287



>gi|6942149|gb|AAF32326.1|AF218808_1 ReMembR-H2 protein JR702 [Arabidopsis thaliana]
          Length = 444

 Score =  121 bits (303), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 77/271 (28%), Positives = 134/271 (49%), Gaps = 13/271 (4%)

Query: 28  VVDATIVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT 85
           +  + ++++  N+T  + D  A   P +   G +G +   E ++A  Q   +K ++ +  
Sbjct: 13  LASSKVILMRNNITLSFDDIEANIAPSVKGTGEIGVVYVAEXLDAC-QNLMNKXEQSSNE 71

Query: 86  EQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQ 145
                L+ RG C+F EKVR  Q +G  A ++ DNE  G +   A G++  + I +VF+ +
Sbjct: 72  TSPFVLIVRGGCSFEEKVRKAQRAGFKAAIIYDNEDRGTLIAMA-GNSGGIRIHAVFVTK 130

Query: 146 TEYKDLRSSSLKP-VEVHLVKD-NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXX 203
              + L+  +  P  +V L+       W ++ V  + +L+ + ++   + +         
Sbjct: 131 ETGEVLKEYAGFPDTKVWLIPSFENSAWSIMAVSFISLLAMSAVLATCFFVRRHRIRRRT 190

Query: 204 XXDIAPQQVVG------NLATKIFFESKRQENEPQ-ECAICLEDYADGDELRILPCKHEF 256
                 ++  G           + F S  ++N     CAICLEDY  GD+LR+LPC H+F
Sbjct: 191 SRSSRVREFHGMSRRLVKAMPSLIFSSFHEDNTTAFTCAICLEDYTVGDKLRLLPCCHKF 250

Query: 257 HITCIDSWLTTRKKFCPICKRDICSPTEETP 287
           H  C+DSWLT+ + FCP+CKRD  + T E P
Sbjct: 251 HAACVDSWLTSWRTFCPVCKRDARTSTGEPP 281



>gi|56118680|ref|NP_001008015.1| ring finger protein 13 precursor [Xenopus (Silurana) tropicalis]
 gi|51704075|gb|AAH80893.1| ring finger protein 13 [Xenopus (Silurana) tropicalis]
          Length = 383

 Score =  120 bits (302), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 82/252 (32%), Positives = 132/252 (52%), Gaps = 15/252 (5%)

Query: 37  ATNV--TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIALVER 94
           A NV  T+ D  A FG RL  +GL GY+V+ +   A        L R   +  +I L++R
Sbjct: 41  ADNVSRTFDDLPARFGYRLPSDGLKGYIVTAKPENACQPISPPPLLRDNTSSVFIVLIKR 100

Query: 95  GQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDT---SDVNIPSVFIAQTEYKDL 151
            +C F  KV N Q +G  A VV + + + LI+M  + D      ++IPSVFI ++  + L
Sbjct: 101 LECNFDLKVLNAQKAGFKAAVVYNVDSDDLISM-GSNDVDILKQIDIPSVFIGESSARFL 159

Query: 152 RS--SSLKPVEVHLVKDNLL--QWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDI 207
           +   S  K   + LV D  L  ++ L+  +I+V +   +++IF+   +           +
Sbjct: 160 KEEFSWEKGGYIVLVPDLTLPLEYYLIPFLIIVGICLVLIVIFMITKFVQDRHRARRNRL 219

Query: 208 APQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTT 267
              Q+      K+     ++ +E   CA+CL++Y +GD+LRILPC H +H  C+D WLT 
Sbjct: 220 RKDQL-----KKLPIHKFKKGDEYDVCAVCLDEYEEGDKLRILPCSHAYHCKCVDPWLTK 274

Query: 268 RKKFCPICKRDI 279
            KK CP+CK+ +
Sbjct: 275 TKKTCPVCKQKV 286



>gi|321465867|gb|EFX76866.1| hypothetical protein DAPPUDRAFT_306061 [Daphnia pulex]
          Length = 408

 Score =  120 bits (302), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 87/273 (31%), Positives = 136/273 (49%), Gaps = 26/273 (9%)

Query: 27  FVVDATIVVVA--TNVT---YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKL-- 79
           +VV+A ++V++  TN T   +    A FG  L  +GL+G +V      AN Q  C+ +  
Sbjct: 24  WVVEADVLVISLDTNSTVNAFPSLPANFGKVLPFDGLIGCVVI-----ANPQNACNTIDP 78

Query: 80  --KRKAPTEQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVN 137
             K    +++W  L+ R  C F++KVR  Q +   A ++  N  + LI   A  D  D+ 
Sbjct: 79  PPKNSNCSDKWFVLIRRYDCNFVDKVRAAQNANYDAAIIY-NVGSNLIEPMAGEDDDDII 137

Query: 138 IPSVFIAQTEYKDLRSSSLKPVEVHLVKDNLLQWPL----LDVIIVVILSPTVMMIFIYV 193
           IP+VFI Q +   ++S         L+  N L + L    L   IVV +   +M++F+ +
Sbjct: 138 IPAVFIGQDDGLKIQSFYQYYDGYMLLLTNELPFNLNSYLLPFAIVVAICFAIMVVFMLI 197

Query: 194 LWXXXXXXXXXXDIAPQQVVGNLATKIFFESKRQENEPQE-CAICLEDYADGDELRILPC 252
                        +    +      K    +K ++ +P + CAICLEDY DGD+LRILPC
Sbjct: 198 KCVKERRRSRRIRLPSSSL------KTIPTNKFKKGDPYDTCAICLEDYVDGDKLRILPC 251

Query: 253 KHEFHITCIDSWLTTRKKFCPICKRDICSPTEE 285
            H +H  CID WLT  ++ CP+CKR + +  E 
Sbjct: 252 SHAYHTKCIDPWLTRNRRVCPVCKRRVIARGEH 284



>gi|197245355|ref|NP_001127781.1| ring finger protein 13 [Nasonia vitripennis]
          Length = 469

 Score =  120 bits (301), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 82/255 (32%), Positives = 127/255 (49%), Gaps = 23/255 (9%)

Query: 42  YQDRIAAFGPRLTDEGLLGYLVSVEMIEA-NNQKGCSKLKRKAPTEQWIALVERGQCTFI 100
           ++D  A FG  +  EG+ G ++  +  +A ++ K       K     WI L+ R  C+F 
Sbjct: 43  FRDLPARFGGMIPAEGIKGIVIYADPPQACHDIKSPPTNNTKYSGNNWIVLIARQNCSFE 102

Query: 101 EKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLRSSSLKPVE 160
           +K+RN Q +G  A +V +   N L  M A  D++++ IPSVF+++        S LK V 
Sbjct: 103 DKIRNAQKAGYDAAIVHNVNSNELEPMSAK-DSTNITIPSVFVSE-----FTGSLLKEVY 156

Query: 161 VH------LVKD---NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQ 211
           ++      L+ D   N+    LL   IVV +   VM+IF+ V             +    
Sbjct: 157 LYDEGYFVLINDLPLNINTHLLLPFAIVVGICFLVMVIFMVVRCIKDRRRQRRHRLP--- 213

Query: 212 VVGNLATKIFFESKRQENEPQE-CAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKK 270
              N + K     K  + +P E CAICLEDY + ++LR+LPC H +H  CID WLT  ++
Sbjct: 214 ---NSSLKKIPTHKYTKGDPYETCAICLEDYVENEKLRVLPCAHAYHTKCIDPWLTKNRR 270

Query: 271 FCPICKRDICSPTEE 285
            CP+CKR + +  E 
Sbjct: 271 VCPVCKRKVFAADER 285



>gi|12324534|gb|AAG52220.1|AC021665_3 unknown protein; 70660-72219 [Arabidopsis thaliana]
          Length = 424

 Score =  120 bits (301), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 76/257 (29%), Positives = 128/257 (49%), Gaps = 11/257 (4%)

Query: 40  VTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIALVERGQCTF 99
           +++ D  A F P +   G +G +   E ++A  Q   +K ++ +       L+ RG C+F
Sbjct: 7   LSFDDIEANFAPSVKGTGEIGVVYVAEPLDAC-QNLMNKPEQSSNETSPFVLIVRGGCSF 65

Query: 100 IEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLRSSSLKP- 158
            EKVR  Q +G  A ++ DNE  G +   A G++  + I +VF+ +   + L+  +  P 
Sbjct: 66  EEKVRKAQRAGFKAAIIYDNEDRGTLIAMA-GNSGGIRIHAVFVTKETGEVLKEYAGFPD 124

Query: 159 VEVHLVKD-NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVVG--- 214
            +V L+       W ++ V  + +L+ + ++   + +               ++  G   
Sbjct: 125 TKVWLIPSFENSAWSIMAVSFISLLAMSAVLATCFFVRRHRIRRRTSRSSRVREFHGMSR 184

Query: 215 ---NLATKIFFESKRQENEPQ-ECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKK 270
                   + F S  ++N     CAICLEDY  GD+LR+LPC H+FH  C+DSWLT+ + 
Sbjct: 185 RLVKAMPSLIFSSFHEDNTTAFTCAICLEDYTVGDKLRLLPCCHKFHAACVDSWLTSWRT 244

Query: 271 FCPICKRDICSPTEETP 287
           FCP+CKRD  + T E P
Sbjct: 245 FCPVCKRDARTSTGEPP 261



>gi|395533607|ref|XP_003768847.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 [Sarcophilus
           harrisii]
          Length = 417

 Score =  120 bits (300), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 87/252 (34%), Positives = 124/252 (49%), Gaps = 20/252 (7%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLK----RKAPTEQWIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+    CS +       A    +IAL+ 
Sbjct: 115 ASMDFADLPALFGASLSQEGLQGFLV-----EAHPANACSPINPPPLAPANGSAFIALLR 169

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVF+ +T  + L
Sbjct: 170 RFDCNFDLKVLNAQKAGYRAAVVYNVNSNELLNMVWNSEEIQQQIWIPSVFVGETSSEYL 229

Query: 152 RSSSL--KPVEVHLVKDNL--LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDI 207
           RS  +  K   V LV DN   L + L+    VV L    M   + V             +
Sbjct: 230 RSLFVYDKGARVLLVPDNTFPLGYYLIPFTGVVGLLVLAMGAVLVVRCIQHRKRLQRNRL 289

Query: 208 APQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTT 267
           + +Q+      +I   + ++ +E   CAICLE+Y DGD+LRILPC H +H  C+D WLT 
Sbjct: 290 SKEQL-----KQIPTHNYQKGDEYDVCAICLEEYEDGDKLRILPCAHAYHSHCVDPWLTQ 344

Query: 268 RKKFCPICKRDI 279
            +K CPICK+ +
Sbjct: 345 TRKTCPICKQPV 356



>gi|224061170|ref|XP_002189845.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 [Taeniopygia guttata]
          Length = 381

 Score =  119 bits (299), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 79/250 (31%), Positives = 127/250 (50%), Gaps = 22/250 (8%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLK----RKAPTEQWIALVERGQ 96
           T+ D  A FG RL  EGL G+L     I +  +  C  +     R   +  +I L+ R +
Sbjct: 47  TFDDLPARFGYRLPAEGLKGFL-----INSKPENACEPIAPPPLRDNSSGAFIVLIRRLE 101

Query: 97  CTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDT---SDVNIPSVFIAQTEYKDLRS 153
           C F  KV N Q +G  A +V + + + LI+M  + D      ++IPSVFI +T    L+ 
Sbjct: 102 CNFDVKVLNAQRAGYKAAIVHNVDSDDLISM-GSNDIEVLKKIDIPSVFIGETSANSLKE 160

Query: 154 SSLKPVEVHLV---KDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAP 209
                   H+V   + +L L++ L+  +I+V +   +++IF+   +           +  
Sbjct: 161 EFTYEKGGHIVLIPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLRK 220

Query: 210 QQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRK 269
            Q+      K+     ++ +E   CAICL++Y DGD+LRILPC H +H  C+D WLT  K
Sbjct: 221 DQL-----KKLPVHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTK 275

Query: 270 KFCPICKRDI 279
           K CP+CK+ +
Sbjct: 276 KTCPVCKQKV 285



>gi|426218145|ref|XP_004003310.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 [Ovis aries]
          Length = 380

 Score =  119 bits (298), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 127/250 (50%), Gaps = 22/250 (8%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLK----RKAPTEQWIALVERGQ 96
           T+ D  A FG RL  EGL G+L     I +  +  C  +     R   +  +I L+ R  
Sbjct: 47  TFDDLPARFGYRLPAEGLKGFL-----INSKPENACEPIVPPPVRDNSSGTFIVLIRRLD 101

Query: 97  CTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDT---SDVNIPSVFIAQTEYKDLRS 153
           C F EKV N Q +G  A +V + + + LI+M  + D      ++IPSVFI ++    L+ 
Sbjct: 102 CNFDEKVLNAQRAGYKAAIVHNVDSDDLISM-GSNDIEVLKKIDIPSVFIGESSANSLKD 160

Query: 154 SSLKPVEVHLV---KDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAP 209
                   H++   + +L L++ L+  +I+V +   +++IF+   +           +  
Sbjct: 161 EFTYEKGGHIILVPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLRK 220

Query: 210 QQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRK 269
            Q+      K+     ++ +E   CAICL++Y DGD+LRILPC H +H  C+D WLT  K
Sbjct: 221 DQL-----KKLPVHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTK 275

Query: 270 KFCPICKRDI 279
           K CP+CK+ +
Sbjct: 276 KTCPVCKQKV 285



>gi|115497538|ref|NP_001069610.1| E3 ubiquitin-protein ligase RNF13 precursor [Bos taurus]
 gi|122143536|sp|Q0VD51.1|RNF13_BOVIN RecName: Full=E3 ubiquitin-protein ligase RNF13; AltName: Full=RING
           finger protein 13; Flags: Precursor
 gi|111308417|gb|AAI19834.1| Ring finger protein 13 [Bos taurus]
 gi|296491071|tpg|DAA33154.1| TPA: ring finger protein 13 [Bos taurus]
 gi|440896858|gb|ELR48673.1| E3 ubiquitin-protein ligase RNF13 [Bos grunniens mutus]
          Length = 380

 Score =  119 bits (298), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 127/250 (50%), Gaps = 22/250 (8%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLK----RKAPTEQWIALVERGQ 96
           T+ D  A FG RL  EGL G+L     I +  +  C  +     R   +  +I L+ R  
Sbjct: 47  TFDDLPARFGYRLPAEGLKGFL-----INSKPENACEPIVPPPVRDNSSGTFIVLIRRLD 101

Query: 97  CTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDT---SDVNIPSVFIAQTEYKDLRS 153
           C F EKV N Q +G  A +V + + + LI+M  + D      ++IPSVFI ++    L+ 
Sbjct: 102 CNFDEKVLNAQRAGYKAAIVHNVDSDDLISM-GSNDIEVLKKIDIPSVFIGESSANSLKD 160

Query: 154 SSLKPVEVHLV---KDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAP 209
                   H++   + +L L++ L+  +I+V +   +++IF+   +           +  
Sbjct: 161 EFTYEKGGHIILVPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLRK 220

Query: 210 QQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRK 269
            Q+      K+     ++ +E   CAICL++Y DGD+LRILPC H +H  C+D WLT  K
Sbjct: 221 DQL-----KKLPVHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTK 275

Query: 270 KFCPICKRDI 279
           K CP+CK+ +
Sbjct: 276 KTCPVCKQKV 285



>gi|466050393|ref|XP_004278227.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 [Orcinus orca]
          Length = 381

 Score =  119 bits (298), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 127/250 (50%), Gaps = 22/250 (8%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKL----KRKAPTEQWIALVERGQ 96
           T+ D  A FG RL  EGL G+L     I +  +  C  +     R   +  +I L+ R  
Sbjct: 47  TFDDLPARFGYRLPAEGLKGFL-----INSKPENACEPIVPPPLRDNSSGTFIVLIRRLD 101

Query: 97  CTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDT---SDVNIPSVFIAQTEYKDLRS 153
           C F EKV N Q +G  A +V + + + LI+M  + D      ++IPSVFI ++    L+ 
Sbjct: 102 CNFDEKVLNAQRAGYKAAIVHNVDSDDLISM-GSNDIEVLKKIDIPSVFIGESSANSLKD 160

Query: 154 SSLKPVEVHLV---KDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAP 209
                   H++   + +L L++ L+  +I+V +   +++IF+   +           +  
Sbjct: 161 EFTYEKGGHIILVPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLRK 220

Query: 210 QQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRK 269
            Q+      K+     ++ +E   CAICL++Y DGD+LRILPC H +H  C+D WLT  K
Sbjct: 221 DQL-----KKLPIHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTK 275

Query: 270 KFCPICKRDI 279
           K CP+CK+ +
Sbjct: 276 KTCPVCKQKV 285



>gi|462421382|gb|EMJ25645.1| hypothetical protein PRUPE_ppa022081mg, partial [Prunus persica]
          Length = 349

 Score =  119 bits (298), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 74/251 (29%), Positives = 124/251 (49%), Gaps = 19/251 (7%)

Query: 50  GPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVERGQCTFIEKVRN 105
            P +   G  G L   E ++A     CS L  K            L+ RG C+F EKVR 
Sbjct: 6   APAIKGSGECGVLYLAEPVDA-----CSTLTNKVEKGTNYSSPFVLLIRGGCSFEEKVRR 60

Query: 106 MQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLRS-SSLKPVEVHLV 164
            Q +G  A +V DNE  G++   A G+++ + I +VF+++   + L+  + L  +E+ L+
Sbjct: 61  AQKAGFKAAIVYDNEDGGVLVSMA-GNSAGIKIHAVFVSKASGEVLKKYAGLTNMELWLI 119

Query: 165 KD-NLLQWPLLDVIIVVILSPTVMMIFIYVLWXX-------XXXXXXXXDIAPQQVVGNL 216
                  W ++ +  + +L+ + ++   + +                       ++V  +
Sbjct: 120 ASFENSAWSIMAISFISLLAMSAVLATCFFVRRHRIRRERPQASRVREFHGMSSRLVKAM 179

Query: 217 ATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCPICK 276
            + IF          + CAICLEDY+ G++LRILPC+H+FH  C+DSWLT+ + FCP+CK
Sbjct: 180 PSLIFTAVLEDNCTSRTCAICLEDYSVGEKLRILPCRHKFHAFCVDSWLTSWRTFCPVCK 239

Query: 277 RDICSPTEETP 287
           RD  + T + P
Sbjct: 240 RDARANTSDPP 250



>gi|507954017|ref|XP_004684781.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 [Condylura cristata]
          Length = 349

 Score =  119 bits (297), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 85/255 (33%), Positives = 126/255 (49%), Gaps = 27/255 (10%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRK--APTEQ--WIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+    CS +     AP     +IAL+ 
Sbjct: 34  ASMDFADLPALFGAALSQEGLQGFLV-----EAHPANACSPIAPPPLAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +T  + L
Sbjct: 89  RYDCNFDVKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGETSSEYL 148

Query: 152 RSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           R+  +  K  +V LV DN         P   ++ +++L+  V+MI   V           
Sbjct: 149 RTRYVYEKGAQVLLVPDNSFPLGYYLIPFTGIVGLLVLAMGVVMI---VRCIQHRKRLQR 205

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
             +  +Q+      K       Q+++   CAICL++Y DGD+LR+LPC H +H  C+D W
Sbjct: 206 NRLTKEQL------KQIPTHDYQKDQYDVCAICLDEYEDGDKLRVLPCAHAYHCRCVDPW 259

Query: 265 LTTRKKFCPICKRDI 279
           LT  +K CPICK+ +
Sbjct: 260 LTQTRKTCPICKQPV 274



>gi|2746335|gb|AAC03770.1| RING zinc finger protein [Mus musculus]
          Length = 381

 Score =  119 bits (297), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 78/241 (32%), Positives = 123/241 (51%), Gaps = 4/241 (1%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIALVERGQCTFI 100
           T++D  A FG RL  EGL G+L++ +   A        LK  + +  +I L+ R  C F 
Sbjct: 47  TFEDLPARFGYRLPAEGLKGFLINSKPENACEPIVPPPLKDNS-SGTFIVLIRRLDCNFD 105

Query: 101 EKVRNMQASGAIAVVVGDNEKNGLITMYATG-DT-SDVNIPSVFIAQTEYKDLRSSSLKP 158
            KV N Q +G  A +V + + + LI+M +   DT   ++IPSVFI ++    L+      
Sbjct: 106 IKVLNAQRAGYKAAIVHNVDSDDLISMGSNDIDTLKKIDIPSVFIGESSANSLKDEFTYE 165

Query: 159 VEVHLVKDNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVVGNLAT 218
              H++    L  PL   +I  ++   + +I I V++               ++  +   
Sbjct: 166 KGGHIILVPELSLPLEYYLIPFLIIVGICLILI-VIFMITKFVQDRHRNRRNRLRKDQLK 224

Query: 219 KIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCPICKRD 278
           K+     ++ +E   CAICLE+Y DGD+LRILPC H +H  C+D WLT  KK CP+CK+ 
Sbjct: 225 KLPVHKFKKGDEYDVCAICLEEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVCKQK 284

Query: 279 I 279
           +
Sbjct: 285 V 285



>gi|74191108|dbj|BAE39388.1| unnamed protein product [Mus musculus]
          Length = 381

 Score =  119 bits (297), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 78/241 (32%), Positives = 123/241 (51%), Gaps = 4/241 (1%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIALVERGQCTFI 100
           T++D  A FG RL  EGL G+L++ +   A        LK  + +  +I L+ R  C F 
Sbjct: 47  TFEDLPARFGYRLPAEGLKGFLINSKPENACEPIVPPPLKDNS-SGTFIVLIRRLDCNFD 105

Query: 101 EKVRNMQASGAIAVVVGDNEKNGLITMYATG-DT-SDVNIPSVFIAQTEYKDLRSSSLKP 158
            KV N Q +G  A +V + + + LI+M +   DT   ++IPSVFI ++    L+      
Sbjct: 106 IKVLNAQRAGYKAAIVHNVDSDDLISMGSNDIDTLKKIDIPSVFIGESSANSLKDEFTYE 165

Query: 159 VEVHLVKDNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVVGNLAT 218
              H++    L  PL   +I  ++   + +I I V++               ++  +   
Sbjct: 166 KGGHIILVPELSLPLEYYLIPFLIIVGICLILI-VIFMITKFVQDRHRNRRNRLRKDQLK 224

Query: 219 KIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCPICKRD 278
           K+     ++ +E   CAICLE+Y DGD+LRILPC H +H  C+D WLT  KK CP+CK+ 
Sbjct: 225 KLPVHKIKKGDEYDVCAICLEEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVCKQK 284

Query: 279 I 279
           +
Sbjct: 285 V 285



>gi|164663850|ref|NP_001106884.1| E3 ubiquitin-protein ligase RNF13 isoform a precursor [Mus
           musculus]
 gi|341941985|sp|O54965.2|RNF13_MOUSE RecName: Full=E3 ubiquitin-protein ligase RNF13; AltName: Full=RING
           finger protein 13; Flags: Precursor
 gi|34849794|gb|AAH58182.1| Rnf13 protein [Mus musculus]
 gi|74192298|dbj|BAE34334.1| unnamed protein product [Mus musculus]
 gi|148703375|gb|EDL35322.1| ring finger protein 13, isoform CRA_b [Mus musculus]
 gi|148703379|gb|EDL35326.1| ring finger protein 13, isoform CRA_b [Mus musculus]
          Length = 381

 Score =  119 bits (297), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 78/241 (32%), Positives = 123/241 (51%), Gaps = 4/241 (1%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIALVERGQCTFI 100
           T++D  A FG RL  EGL G+L++ +   A        LK  + +  +I L+ R  C F 
Sbjct: 47  TFEDLPARFGYRLPAEGLKGFLINSKPENACEPIVPPPLKDNS-SGTFIVLIRRLDCNFD 105

Query: 101 EKVRNMQASGAIAVVVGDNEKNGLITMYATG-DT-SDVNIPSVFIAQTEYKDLRSSSLKP 158
            KV N Q +G  A +V + + + LI+M +   DT   ++IPSVFI ++    L+      
Sbjct: 106 IKVLNAQRAGYKAAIVHNVDSDDLISMGSNDIDTLKKIDIPSVFIGESSANSLKDEFTYE 165

Query: 159 VEVHLVKDNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVVGNLAT 218
              H++    L  PL   +I  ++   + +I I V++               ++  +   
Sbjct: 166 KGGHIILVPELSLPLEYYLIPFLIIVGICLILI-VIFMITKFVQDRHRNRRNRLRKDQLK 224

Query: 219 KIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCPICKRD 278
           K+     ++ +E   CAICLE+Y DGD+LRILPC H +H  C+D WLT  KK CP+CK+ 
Sbjct: 225 KLPVHKFKKGDEYDVCAICLEEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVCKQK 284

Query: 279 I 279
           +
Sbjct: 285 V 285



>gi|507566568|ref|XP_004666928.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 [Jaculus jaculus]
          Length = 347

 Score =  118 bits (296), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 79/253 (31%), Positives = 124/253 (49%), Gaps = 24/253 (9%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQ--WIALVERG 95
            ++ + D  A FG  L++EGL G+LV     EA+ +  CS +    P     +IAL+ R 
Sbjct: 34  ASMDFADLPALFGASLSEEGLQGFLV-----EAHPENACSPIAPPPPVNGSVFIALLRRF 88

Query: 96  QCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDLRS 153
            C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + LR+
Sbjct: 89  DCNFDVKVLNAQKAGYAAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSAEYLRA 148

Query: 154 SSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXD 206
             +  K   V LV DN         P   ++ +++L+   +MI   +             
Sbjct: 149 LFVYEKGARVLLVPDNSFPLGYYLIPFTGIVGLLVLAMGAVMIVRCI--------QHRKR 200

Query: 207 IAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLT 266
           +   ++      +I     ++ ++   CAICL++Y DGD+LR+LPC H +H  C+D WLT
Sbjct: 201 LQRNRLTKEQLKQIPTHDYQKGDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPWLT 260

Query: 267 TRKKFCPICKRDI 279
             +K CPICK+ +
Sbjct: 261 QTRKTCPICKQPV 273



>gi|512892941|ref|XP_004923057.1| PREDICTED: E3 ubiquitin-protein ligase RNF13-like [Bombyx mori]
          Length = 396

 Score =  118 bits (296), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 88/275 (32%), Positives = 128/275 (46%), Gaps = 22/275 (8%)

Query: 20  FIARWSNFVVDATIVVVATNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKL 79
           F A   N +V    +  A    ++D  A+FG  L  EGL G LV     E     GC+ L
Sbjct: 13  FTAVCCNIIVYTQTIPHAIMEEFRDIPASFGEELPPEGLRGLLV-----EGVPADGCTAL 67

Query: 80  KR----KAPTEQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSD 135
            +     + T +WI LV R  C+F  K+RN QA+G    +V +   + L  M A  +   
Sbjct: 68  DKPPVVDSFTGKWIVLVARYNCSFEVKIRNAQAAGFDCAIVHNVNSSDLEKMSAK-NPEG 126

Query: 136 VNIPSVFIAQTEYKDLRSSSLKPVEVHLVKDNLLQWP-----LLDVIIVVILSPTVMMIF 190
           + IPSVF++      L +         ++ +  L +      LL   IVV+L   V+ IF
Sbjct: 127 IVIPSVFVSDVAGDILAAEYQYNAGFFIMVNGDLPFNINTHLLLPFAIVVVLCLLVIFIF 186

Query: 191 IYVLWXXXXXXXXXXDIAPQQVVGNLATKIFFESKRQENEPQE-CAICLEDYADGDELRI 249
           + V                +  + + A       K  + +P + CAICL+DY +GD LR+
Sbjct: 187 MIVKCIKDRRRAR------RHRLPHRALSKIPTCKFSKGDPYDTCAICLDDYQEGDRLRV 240

Query: 250 LPCKHEFHITCIDSWLTTRKKFCPICKRDICSPTE 284
           LPC H +H  CID WLT  K+ CP+CKR + S  E
Sbjct: 241 LPCAHAYHSACIDPWLTQNKRVCPVCKRRVVSAGE 275



>gi|334323435|ref|XP_001371033.2| PREDICTED: e3 ubiquitin-protein ligase RNF167-like [Monodelphis
           domestica]
          Length = 337

 Score =  118 bits (296), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 86/252 (34%), Positives = 124/252 (49%), Gaps = 20/252 (7%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRK--APTEQ--WIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+    CS +     AP     +IAL+ 
Sbjct: 34  ASMDFADLPALFGASLSQEGLQGFLV-----EAHPANACSPINPPPLAPANGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVF+ +T  + L
Sbjct: 89  RFDCNFDLKVLNAQRAGYRAAVVYNVNSNELLNMVWNSEEIQQQIWIPSVFVGETSSEYL 148

Query: 152 RSSSL--KPVEVHLVKDNL--LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDI 207
           RS  +  K   V LV DN   L + L+    +V L    M   + V             +
Sbjct: 149 RSLFVYDKGARVLLVPDNTFPLGYYLIPFTGIVGLLVLAMGAVLVVRCIQHRKRLQRNRL 208

Query: 208 APQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTT 267
           + +Q+      +I     ++ +E   CAICLE+Y DGD+LR+LPC H +H  C+D WLT 
Sbjct: 209 SKEQL-----KQIPTHDYQKGDEYDVCAICLEEYEDGDKLRVLPCAHAYHSHCVDPWLTQ 263

Query: 268 RKKFCPICKRDI 279
            +K CPICK+ +
Sbjct: 264 TRKTCPICKQPV 275



>gi|350591630|ref|XP_003358656.2| PREDICTED: E3 ubiquitin-protein ligase RNF13-like [Sus scrofa]
          Length = 381

 Score =  118 bits (296), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 78/246 (31%), Positives = 128/246 (52%), Gaps = 14/246 (5%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIALVERGQCTFI 100
           T+ D  A FG RL  EGL G+L++ +   A        LK  + +  +I L+ R  C F 
Sbjct: 47  TFDDLPARFGYRLPAEGLKGFLINSKPENACEPIVPPPLKDNS-SGTFIVLIRRLDCNFD 105

Query: 101 EKVRNMQASGAIAVVVGDNEKNGLITMYATGDT---SDVNIPSVFIAQTEYKDLRSSSLK 157
           EKV N Q +G  A +V + + + LI+M  + D      ++IPSVFI ++    L+     
Sbjct: 106 EKVLNAQRAGYKAAIVHNVDSDDLISM-GSNDIEVLKKIDIPSVFIGESSANSLKDEFTY 164

Query: 158 PVEVHLV---KDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVV 213
               H++   + +L L++ L+  +I+V +   +++IF+   +           +   Q+ 
Sbjct: 165 EKGGHIILVPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLRKDQL- 223

Query: 214 GNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCP 273
                K+     ++ +E   CAICL++Y DGD+LRILPC H +H  C+D WLT  KK CP
Sbjct: 224 ----KKLPIHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCP 279

Query: 274 ICKRDI 279
           +CK+ +
Sbjct: 280 VCKQKV 285



>gi|512874366|ref|XP_004893417.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 isoform X1
           [Heterocephalus glaber]
 gi|512874370|ref|XP_004893418.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 isoform X2
           [Heterocephalus glaber]
 gi|512943933|ref|XP_004834497.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 isoform X1
           [Heterocephalus glaber]
 gi|512943935|ref|XP_004834498.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 isoform X2
           [Heterocephalus glaber]
 gi|351705693|gb|EHB08612.1| RING finger protein 13 [Heterocephalus glaber]
          Length = 381

 Score =  118 bits (296), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 77/250 (30%), Positives = 126/250 (50%), Gaps = 22/250 (8%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLK----RKAPTEQWIALVERGQ 96
           T+ D  A FG RL  EGL G+L     I +  +  C  +     +   +  +I L+ R  
Sbjct: 47  TFDDLPARFGYRLPAEGLKGFL-----INSKPENACEPIVPPPVKDNSSGTFIVLIRRLD 101

Query: 97  CTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTS---DVNIPSVFIAQTEYKDLRS 153
           C F  KV N Q +G  A +V + + + LI+M  + D      ++IPSVFI ++    L+ 
Sbjct: 102 CNFDIKVLNAQRAGYKAAIVHNVDSDDLISM-GSNDIDVLKKIDIPSVFIGESSANSLKD 160

Query: 154 SSLKPVEVHLV---KDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAP 209
                   H++   + NL L++ L+  +I+V +   +++IF+   +           +  
Sbjct: 161 EFTYEKGGHIILVPEFNLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLGK 220

Query: 210 QQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRK 269
            Q+      K+     ++ +E   CAICL++Y DGD+LRILPC H +H  C+D WLT  K
Sbjct: 221 DQL-----KKLPVHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTK 275

Query: 270 KFCPICKRDI 279
           K CP+CK+ +
Sbjct: 276 KTCPVCKQKV 285



>gi|354499654|ref|XP_003511923.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 [Cricetulus griseus]
 gi|344256164|gb|EGW12268.1| RING finger protein 13 [Cricetulus griseus]
          Length = 380

 Score =  118 bits (295), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 78/242 (32%), Positives = 121/242 (50%), Gaps = 6/242 (2%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIALVERGQCTFI 100
           T++D  A FG RL  EGL G+LV+ +   A        LK  + +  +I L+ R  C F 
Sbjct: 47  TFEDLPARFGYRLPAEGLKGFLVNSKPENACEPIVPPPLKDNS-SSTFIVLIRRLDCNFD 105

Query: 101 EKVRNMQASGAIAVVVGDNEKNGLITMYATGDTS---DVNIPSVFIAQTEYKDLRSSSLK 157
            KV N Q +G  A +V + + + LI+M  + D      ++IPSVFI +     L+     
Sbjct: 106 IKVLNAQRAGYKAAIVHNVDSDDLISM-GSNDIDVLKKIDIPSVFIGEASANSLKDEFTY 164

Query: 158 PVEVHLVKDNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVVGNLA 217
               H++    L  PL   +I  ++   + +I I V++               ++  +  
Sbjct: 165 EKGGHVILVPELSLPLEYYLIPFLIIVGICLILI-VIFMITKFVQDRHRNRRNRLRKDQL 223

Query: 218 TKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCPICKR 277
            K+     ++ +E   CAICLE+Y DGD+LRILPC H +H  C+D WLT  KK CP+CK+
Sbjct: 224 KKLPVHKFKKGDEYDVCAICLEEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVCKQ 283

Query: 278 DI 279
            +
Sbjct: 284 KV 285



>gi|395527967|ref|XP_003766107.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 [Sarcophilus harrisii]
          Length = 382

 Score =  118 bits (295), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 77/245 (31%), Positives = 126/245 (51%), Gaps = 12/245 (4%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIALVERGQCTFI 100
           T+ D  A FG RL  EGL G+L++ +   A        LK  + +  +I L+ R  C F 
Sbjct: 47  TFDDLPARFGYRLPTEGLKGFLINSKPENACEPIAPPPLKDNS-SSAFIVLIRRLDCNFD 105

Query: 101 EKVRNMQASGAIAVVVGDNEKNGLITMYAT--GDTSDVNIPSVFIAQTEYKDLRSSSLKP 158
            KV + Q +G  A +V + + + LI+M +   G    ++IPSVFI +     L+      
Sbjct: 106 IKVLHAQKAGYKAAIVHNVDSDDLISMGSNDIGILKKIDIPSVFIGEASANSLKDEFTYE 165

Query: 159 VEVHLV---KDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVVG 214
              H+V   + +L L++ L+  +I+V +   +++IF+   +           +   Q+  
Sbjct: 166 KGGHIVLVPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLRKDQL-- 223

Query: 215 NLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCPI 274
               K+     ++ +E   CAICL++Y DGD+LRILPC H +H  C+D WLT  KK CP+
Sbjct: 224 ---KKLPIHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCPV 280

Query: 275 CKRDI 279
           CK+ +
Sbjct: 281 CKQKV 285



>gi|440909106|gb|ELR59052.1| E3 ubiquitin-protein ligase RNF167, partial [Bos grunniens mutus]
          Length = 327

 Score =  118 bits (295), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 82/252 (32%), Positives = 123/252 (48%), Gaps = 20/252 (7%)

Query: 39  NVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQ----WIALVER 94
           ++ + D  A FG  L+ EGL G+LV     EA     CS +    P       +IAL+ R
Sbjct: 32  SMEFADLPALFGAALSPEGLKGFLV-----EAQPANACSPIAPPPPARANGSVFIALLRR 86

Query: 95  GQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDLR 152
             C F  KV + Q +G  A VV +   N L+ M  + +     + IPSVFI++   K LR
Sbjct: 87  FDCKFDLKVLHAQKAGYGAAVVHNVNSNELLNMVGSNEEVQQQIWIPSVFISEKSSKYLR 146

Query: 153 SSSL--KPVEVHLVKDNLLQWPLLDVIIVVILSPTVMMI--FIYVLWXXXXXXXXXXDIA 208
           +  +  +  +V LV DN        ++   IL+  ++     + V W           + 
Sbjct: 147 AFFIYQQGAQVLLVPDNGFLSTYFFILFYGILAMLILGTGAIVIVHWIHFQKQRWRNLLT 206

Query: 209 PQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTR 268
            +Q+      +I     R+ +    CAICL++Y DGD+LR+LPC H +H  C+D WLT  
Sbjct: 207 KEQL-----KQIPTHDYRRGDRYDVCAICLDEYEDGDKLRVLPCAHAYHCRCVDPWLTQT 261

Query: 269 KKFCPICKRDIC 280
           KK CPICK+ +C
Sbjct: 262 KKTCPICKQPVC 273



>gi|157821373|ref|NP_001102914.1| E3 ubiquitin-protein ligase RNF13 precursor [Rattus norvegicus]
 gi|81884214|sp|Q66HG0.1|RNF13_RAT RecName: Full=E3 ubiquitin-protein ligase RNF13; AltName: Full=RING
           finger protein 13; Flags: Precursor
 gi|51859285|gb|AAH81881.1| Similar to ring finger protein 13 [Rattus norvegicus]
 gi|149064725|gb|EDM14876.1| rCG50011, isoform CRA_b [Rattus norvegicus]
 gi|149064726|gb|EDM14877.1| rCG50011, isoform CRA_b [Rattus norvegicus]
          Length = 380

 Score =  117 bits (294), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 77/242 (31%), Positives = 122/242 (50%), Gaps = 6/242 (2%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIALVERGQCTFI 100
           T++D  A FG RL  EGL G+L++ +   A        LK  + +  +I L+ R  C F 
Sbjct: 47  TFEDLPARFGYRLPAEGLKGFLINSKPENACEPIVPPPLKDNS-SGTFIVLIRRLDCNFD 105

Query: 101 EKVRNMQASGAIAVVVGDNEKNGLITMYATGDTS---DVNIPSVFIAQTEYKDLRSSSLK 157
            KV N Q +G  A +V + + + LI+M  + D      ++IPSVFI ++    L+     
Sbjct: 106 IKVLNAQRAGYKAAIVHNVDSDDLISM-GSNDIDILKKIDIPSVFIGESSANSLKDEFTY 164

Query: 158 PVEVHLVKDNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVVGNLA 217
               H++    L  PL   +I  ++   + +I I V++               ++  +  
Sbjct: 165 EKGGHVILVPELSLPLEYYLIPFLIIVGICLILI-VIFMITKFVQDRHRNRRNRLRKDQL 223

Query: 218 TKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCPICKR 277
            K+     ++ +E   CAICLE+Y DGD+LRILPC H +H  C+D WLT  KK CP+CK+
Sbjct: 224 KKLPVHKFKKGDEYDVCAICLEEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCPVCKQ 283

Query: 278 DI 279
            +
Sbjct: 284 KV 285



>gi|326513248|dbj|BAK06864.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 277

 Score =  117 bits (294), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 79/249 (31%), Positives = 128/249 (51%), Gaps = 17/249 (6%)

Query: 40  VTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIA--LVERGQC 97
            T+ D  A FGPR+T +G+ G L + +  +A     C+ + R AP    +A  L+ RG C
Sbjct: 33  ATFLDAPARFGPRVTSDGICGSLRAADPADA-----CTPV-RAAPGSGGMAFVLIARGNC 86

Query: 98  TFIEKVRNMQASGAIAVVVGDNE-KNGLITMYATGDTSDVNIPSVFIAQTEYKDLRSSSL 156
           +F  KVR  Q +G  A +V D+E K  L +M   GD   ++IP+VF+++   + L+  + 
Sbjct: 87  SFEGKVRAAQLAGFDAALVHDDEDKASLYSM--VGDPEGIHIPAVFVSKMAGQTLKKFAR 144

Query: 157 KPVEVHLVKDNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXX-XXXXXXXDIAP----QQ 211
                  +  ++ +     +++  +    ++ +    L+           D  P    + 
Sbjct: 145 GEDGECCINSSMDETAGTVLVMSFVSLVVIISVVASFLFARNCRLLRHGVDNHPPCIKKH 204

Query: 212 VVGNLATKIFFESKRQENEPQE-CAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKK 270
           VV  + + ++       N  +E CAICLEDY +GD LR+LPCKHEFH+ CID WLT    
Sbjct: 205 VVEKIPSLVYKAPCSSGNNCEEACAICLEDYDNGDMLRLLPCKHEFHVECIDPWLTKWGT 264

Query: 271 FCPICKRDI 279
           FCP+CK ++
Sbjct: 265 FCPVCKLEV 273



>gi|126338112|ref|XP_001363895.1| PREDICTED: e3 ubiquitin-protein ligase RNF13 [Monodelphis
           domestica]
          Length = 382

 Score =  117 bits (294), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 77/245 (31%), Positives = 126/245 (51%), Gaps = 12/245 (4%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIALVERGQCTFI 100
           T+ D  A FG RL  EGL G+L++ +   A        LK  + +  +I L+ R  C F 
Sbjct: 47  TFDDLPARFGYRLPAEGLKGFLINSKPENACEPIAPPPLKDNS-SSAFIVLIRRLDCNFD 105

Query: 101 EKVRNMQASGAIAVVVGDNEKNGLITMYAT--GDTSDVNIPSVFIAQTEYKDLRSSSLKP 158
            KV + Q +G  A +V + + + LI+M +   G    ++IPSVFI +     L+      
Sbjct: 106 IKVLHAQKAGFKAAIVHNVDSDDLISMGSNDIGILKKIDIPSVFIGEASANSLKDEFTYE 165

Query: 159 VEVHLV---KDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVVG 214
              H+V   + +L L++ L+  +I+V +   +++IF+   +           +   Q+  
Sbjct: 166 KGGHIVLVPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLRKDQL-- 223

Query: 215 NLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCPI 274
               K+     ++ +E   CAICL++Y DGD+LRILPC H +H  C+D WLT  KK CP+
Sbjct: 224 ---KKLPIHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCPV 280

Query: 275 CKRDI 279
           CK+ +
Sbjct: 281 CKQKV 285



>gi|145340038|ref|NP_192694.2| protease-associated (PA) RING/U-box zinc finger-containing protein
           [Arabidopsis thaliana]
 gi|110737791|dbj|BAF00834.1| hypothetical protein [Arabidopsis thaliana]
 gi|332657365|gb|AEE82765.1| protease-associated (PA) RING/U-box zinc finger-containing protein
           [Arabidopsis thaliana]
          Length = 448

 Score =  117 bits (294), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 83/285 (29%), Positives = 135/285 (47%), Gaps = 29/285 (10%)

Query: 29  VDATIVVV--ATNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKL------K 80
           V A ++++  +T++++ D  A F P +      G L   E ++A     CS L      K
Sbjct: 18  VSAKVLLIGNSTSLSFDDVEATFTPMIKRSDQGGVLYVAEPLDA-----CSDLVNTVNVK 72

Query: 81  RKAPTEQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPS 140
                     L+ RG C+F +K+RN Q +G  A +V D E  G +   A G+ S V I  
Sbjct: 73  NGTTVSPPYVLIIRGGCSFEDKIRNAQKAGYKAAIVYDYEDFGFLVSMA-GNPSGVLIYG 131

Query: 141 VFIAQTEYKDLRSSSLKP-VEVHLVKD-NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXX 198
            F+++   + L+  + +   EV L+       W ++ +  + +L+ + ++   + +    
Sbjct: 132 TFVSKATGEVLKEYAGRTDFEVWLMPSFETSAWSIMAISFISLLAMSAVLATCFFVRRHR 191

Query: 199 XXXXXXXDI-------APQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILP 251
                   +        P+ ++  + T IF     +      C ICLE+Y  GD+LRILP
Sbjct: 192 VRRRRILALNGNDFHRMPKSMIIRMPTTIFNGICDEATTSILCCICLENYEKGDKLRILP 251

Query: 252 CKHEFHITCIDSWLTTRKKFCPICKRDICS------PTEETPLLS 290
           C H+FH+ C+D WL  RK FCP+CKRD  S      P+E TP LS
Sbjct: 252 CHHKFHVACVDLWLGQRKSFCPVCKRDARSISTDKPPSEHTPFLS 296



>gi|326926239|ref|XP_003209310.1| PREDICTED: e3 ubiquitin-protein ligase RNF13-like [Meleagris
           gallopavo]
          Length = 381

 Score =  117 bits (294), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 126/250 (50%), Gaps = 22/250 (8%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLK----RKAPTEQWIALVERGQ 96
           T+ D  A FG RL  EGL G+L     I +  +  C  +     R   +  +I L+ R +
Sbjct: 47  TFDDLPARFGYRLPAEGLKGFL-----INSKPENACEPIAPPPLRDNSSTAFIVLIRRLE 101

Query: 97  CTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDT---SDVNIPSVFIAQTEYKDLRS 153
           C F  KV N Q +G  A +V + + + LI+M  + D      ++IPSVFI +     L+ 
Sbjct: 102 CNFDIKVLNAQRAGYKAAIVHNVDSDDLISM-GSNDIEILKKIDIPSVFIGEASANSLKE 160

Query: 154 SSLKPVEVHLV---KDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAP 209
                   H+V   + +L L++ L+  +I+V +   +++IF+   +           +  
Sbjct: 161 EFTYEKGGHVVLIPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLRK 220

Query: 210 QQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRK 269
            Q+      K+     ++ +E   CAICL++Y DGD+LRILPC H +H  C+D WLT  K
Sbjct: 221 DQL-----KKLPIHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTK 275

Query: 270 KFCPICKRDI 279
           K CP+CK+ +
Sbjct: 276 KTCPVCKQKV 285



>gi|327266890|ref|XP_003218236.1| PREDICTED: e3 ubiquitin-protein ligase RNF13-like [Anolis
           carolinensis]
          Length = 384

 Score =  117 bits (293), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 78/246 (31%), Positives = 128/246 (52%), Gaps = 14/246 (5%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIALVERGQCTFI 100
           T+ D  A FG RL  EGL G+L++ +   A        LK  + + ++I L+ R  C F 
Sbjct: 47  TFDDLPARFGYRLPTEGLKGFLINSKPENACEPITPPPLKDNS-SHEFIVLIRRLDCNFD 105

Query: 101 EKVRNMQASGAIAVVVGDNEKNGLITMYATGDT---SDVNIPSVFIAQTEYKDLRSSSLK 157
            KV N Q +G  A +V + + + L++M  + D      ++IPSVFI ++  K L      
Sbjct: 106 IKVLNAQRAGYKAAIVHNVDSDELLSM-GSQDIDVLKKIDIPSVFIGESSAKSLTEEFTY 164

Query: 158 PVEVHLV---KDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVV 213
               H+V   + +L L++ L+  +I+V +   +++IF+   +           +   Q+ 
Sbjct: 165 EKGGHIVLIPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLQKDQL- 223

Query: 214 GNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCP 273
                K+     ++ +E   CAICL++Y DGD+LRILPC H +H  C+D WLT  KK CP
Sbjct: 224 ----KKLPVHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCP 279

Query: 274 ICKRDI 279
           +CK+ +
Sbjct: 280 VCKQKV 285



>gi|45382515|ref|NP_990686.1| E3 ubiquitin-protein ligase RNF13 precursor [Gallus gallus]
 gi|21362882|sp|Q90972.1|RNF13_CHICK RecName: Full=E3 ubiquitin-protein ligase RNF13; AltName:
           Full=C-RZF; AltName: Full=RING finger protein 13; Flags:
           Precursor
 gi|1321818|emb|CAA64725.1| RING zinc finger protein [Gallus gallus]
 gi|60116919|gb|AAX14391.1| RING finger protein 13 [Gallus gallus]
 gi|1589724|prf||2211437A RING finger protein
          Length = 381

 Score =  117 bits (293), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 126/250 (50%), Gaps = 22/250 (8%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLK----RKAPTEQWIALVERGQ 96
           T+ D  A FG RL  EGL G+L     I +  +  C  +     R   +  +I L+ R +
Sbjct: 47  TFDDLPARFGYRLPAEGLKGFL-----INSKPENACEPIAPPPLRDNSSTAFIVLIRRLE 101

Query: 97  CTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDT---SDVNIPSVFIAQTEYKDLRS 153
           C F  KV N Q +G  A +V + + + LI+M  + D      ++IPSVFI +     L+ 
Sbjct: 102 CNFDIKVLNAQRAGYKAAIVHNVDSDDLISM-GSNDIEILKKIDIPSVFIGEASANSLKE 160

Query: 154 SSLKPVEVHLV---KDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAP 209
                   H+V   + +L L++ L+  +I+V +   +++IF+   +           +  
Sbjct: 161 EFTYEKGGHVVLIPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLRK 220

Query: 210 QQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRK 269
            Q+      K+     ++ +E   CAICL++Y DGD+LRILPC H +H  C+D WLT  K
Sbjct: 221 DQL-----KKLPVHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTK 275

Query: 270 KFCPICKRDI 279
           K CP+CK+ +
Sbjct: 276 KTCPVCKQKV 285



>gi|470105429|ref|XP_004289086.1| PREDICTED: E3 ubiquitin-protein ligase RNF133-like [Fragaria vesca
           subsp. vesca]
          Length = 515

 Score =  117 bits (293), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 82/262 (31%), Positives = 131/262 (50%), Gaps = 22/262 (8%)

Query: 31  ATIVVVATNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLK---RKAPTEQ 87
           AT+V    ++ + D  A F  R+   G  G L + + + A     CS L+   R   TE+
Sbjct: 26  ATVVYKPLSMAFADLPAKFAVRVNSSGACGALANADPLNA-----CSPLRNGRRSNETEK 80

Query: 88  W-IALVERGQCTFIEKVRNMQASG-AIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQ 145
              AL+ RG+CTF +K++N Q +G A A+V  D + + LI+M   G+  +  I +VF+++
Sbjct: 81  ARFALIVRGECTFKDKIQNAQNAGFAAAIVYDDKDGSDLISMMINGE--NTTIHAVFVSK 138

Query: 146 TEYKDLRSSSLKPVE----VHLVKDNLLQWPLLDVII---VVILSPTVMMIFIYVLWXXX 198
              + L+  +             K+    W +L +     +VIL   ++ +F    W   
Sbjct: 139 ATGELLKEHAHDEEGECCIFPFAKET--AWTVLAISFLSFIVILGILLIALFAPRHWLYS 196

Query: 199 XXXXXXXDIAPQQVVGNLATKIFFESKRQENEPQE-CAICLEDYADGDELRILPCKHEFH 257
                       +VV  L    F  ++  E   +E CAICLE+Y DG+ L++LPC+HEFH
Sbjct: 197 QGRNQLPKSVDTKVVEALPCFTFSSARLGECHSEETCAICLENYKDGEILKVLPCQHEFH 256

Query: 258 ITCIDSWLTTRKKFCPICKRDI 279
            +C+DSWLT     CP+CK D+
Sbjct: 257 SSCVDSWLTKWGSCCPVCKHDM 278



>gi|301778327|ref|XP_002924579.1| PREDICTED: e3 ubiquitin-protein ligase RNF167-like [Ailuropoda
           melanoleuca]
          Length = 353

 Score =  117 bits (292), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 86/255 (33%), Positives = 124/255 (48%), Gaps = 26/255 (10%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQ-------WIA 90
            ++ + D  A FG  L+ EGL G+LV     EA     CS +   AP  Q       +IA
Sbjct: 34  NSMDFADLPALFGSALSHEGLQGFLV-----EAQPANACSPV---APPPQATVNGSVFIA 85

Query: 91  LVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEY 148
           L+ R  C F  KV N+Q +G  A VV +   N L+ M    +     + IPSVFI +   
Sbjct: 86  LLRRFDCNFDLKVLNVQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSS 145

Query: 149 KDLRSSSL--KPVEVHLVKDN--LLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           K LR+  +  K  +V LV DN  LL + L+    VV L    M   +   +         
Sbjct: 146 KYLRALFVYEKGAQVLLVPDNNFLLGYCLILFTGVVGLLILAMGAGLIARFIQHQKQLQM 205

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
             +  +Q+      +I     ++ ++   CAICL +Y DGD+LR+LPC H +H  C+D W
Sbjct: 206 NRLTKEQL-----KRIPIHDYQKGDQYDVCAICLAEYEDGDKLRVLPCAHAYHSRCVDPW 260

Query: 265 LTTRKKFCPICKRDI 279
           LT  +K CPICK+ +
Sbjct: 261 LTQTRKTCPICKQPV 275



>gi|281342946|gb|EFB18530.1| hypothetical protein PANDA_013950 [Ailuropoda melanoleuca]
          Length = 345

 Score =  117 bits (292), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 86/255 (33%), Positives = 124/255 (48%), Gaps = 26/255 (10%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQ-------WIA 90
            ++ + D  A FG  L+ EGL G+LV     EA     CS +   AP  Q       +IA
Sbjct: 34  NSMDFADLPALFGSALSHEGLQGFLV-----EAQPANACSPV---APPPQATVNGSVFIA 85

Query: 91  LVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEY 148
           L+ R  C F  KV N+Q +G  A VV +   N L+ M    +     + IPSVFI +   
Sbjct: 86  LLRRFDCNFDLKVLNVQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSS 145

Query: 149 KDLRSSSL--KPVEVHLVKDN--LLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           K LR+  +  K  +V LV DN  LL + L+    VV L    M   +   +         
Sbjct: 146 KYLRALFVYEKGAQVLLVPDNNFLLGYCLILFTGVVGLLILAMGAGLIARFIQHQKQLQM 205

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
             +  +Q+      +I     ++ ++   CAICL +Y DGD+LR+LPC H +H  C+D W
Sbjct: 206 NRLTKEQL-----KRIPIHDYQKGDQYDVCAICLAEYEDGDKLRVLPCAHAYHSRCVDPW 260

Query: 265 LTTRKKFCPICKRDI 279
           LT  +K CPICK+ +
Sbjct: 261 LTQTRKTCPICKQPV 275



>gi|507543957|ref|XP_004655961.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 [Jaculus jaculus]
          Length = 380

 Score =  117 bits (292), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 78/246 (31%), Positives = 120/246 (48%), Gaps = 14/246 (5%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKL----KRKAPTEQWIALVERGQ 96
           T++D  A FG RL  EGL G+L     I +  +  C  +         T  +I L+ R  
Sbjct: 47  TFEDLPARFGYRLPAEGLKGFL-----INSKPENACEPIVPPPLTDNSTGSFIVLIRRLD 101

Query: 97  CTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTS---DVNIPSVFIAQTEYKDLRS 153
           C F  KV N Q +G  A VV + + + LI+M  + D      ++IPSVFI ++    L+ 
Sbjct: 102 CNFDIKVLNAQRAGYRAAVVHNVDSDDLISM-GSNDIDVLKKIDIPSVFIGESAANSLKD 160

Query: 154 SSLKPVEVHLVKDNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVV 213
                   H+V    L  PL   +I  ++   + +I I V++               ++ 
Sbjct: 161 EFTYEKGGHIVLVPELSLPLEYYLIPFLIIVGICLILI-VIFMITKFVQDRHRARRNRLR 219

Query: 214 GNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCP 273
            +   K+     ++ +E   CAICL++Y DGD+LRILPC H +H  C+D WLT  KK CP
Sbjct: 220 KDQLKKLPVHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCP 279

Query: 274 ICKRDI 279
           +CK+ +
Sbjct: 280 VCKQKV 285



>gi|296475697|tpg|DAA17812.1| TPA: ring finger protein 167-like [Bos taurus]
          Length = 353

 Score =  117 bits (292), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 81/252 (32%), Positives = 124/252 (49%), Gaps = 20/252 (7%)

Query: 39  NVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQ----WIALVER 94
           ++ + D  A FG  L+ EGL G+LV     EA     CS +    P +     +IAL+ R
Sbjct: 35  SMEFADLPALFGAALSPEGLKGFLV-----EAQPANACSPIAPPPPAQANGSVFIALLRR 89

Query: 95  GQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDLR 152
             C F  KV + Q +G  A VV +   N L+ M  + +     + IPSVFI++   + LR
Sbjct: 90  FDCKFDLKVLHAQKAGYGAAVVHNVNSNELLNMVGSNEEVQQQIWIPSVFISEKSSQYLR 149

Query: 153 SSSL--KPVEVHLVKDNLLQWPLLDVIIVVILSPTVMMI--FIYVLWXXXXXXXXXXDIA 208
           +  +  +  +V LV DN        ++   IL+  ++     + V W           + 
Sbjct: 150 AFFIYQQGAQVLLVPDNGFLSTYFFILFYGILAMLILGTGAIVIVHWIHFQKQRWRNLLT 209

Query: 209 PQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTR 268
            +Q+      +I     R+ +    CAICL++Y DGD+LR+LPC H +H  C+D WLT  
Sbjct: 210 KEQL-----KQIPTHDYRRGDRYDVCAICLDEYEDGDKLRVLPCAHAYHCRCVDPWLTQT 264

Query: 269 KKFCPICKRDIC 280
           KK CPICK+ +C
Sbjct: 265 KKTCPICKQPVC 276



>gi|504177104|ref|XP_004597757.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 [Ochotona princeps]
          Length = 380

 Score =  116 bits (291), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 78/246 (31%), Positives = 127/246 (51%), Gaps = 14/246 (5%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIALVERGQCTFI 100
           T+ D  A FG RL  EGL G+L++ +   A        LK  + +  +I L+ R  C F 
Sbjct: 47  TFDDLPARFGYRLPTEGLKGFLINSKPENACEPIVPPPLKDNS-SSAFIVLIRRFDCNFD 105

Query: 101 EKVRNMQASGAIAVVVGDNEKNGLITMYATGDTS---DVNIPSVFIAQTEYKDLRSSSLK 157
            KV N Q +G  A +V + + + LI+M  + D      ++IPSVFI ++    L+     
Sbjct: 106 IKVLNAQRAGYKAAIVHNVDSDDLISM-GSNDIDVLKKIDIPSVFIGESSANSLKDEFTY 164

Query: 158 PVEVHLV---KDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVV 213
               H+V   + +L L++ L+  +I+V +   +++IF+   +           +   Q+ 
Sbjct: 165 EKGGHIVLVPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLRKDQL- 223

Query: 214 GNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCP 273
                K+     ++ +E   CAICL++Y DGD+LRILPC H +H  C+D WLT  KK CP
Sbjct: 224 ----KKLPIHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCP 279

Query: 274 ICKRDI 279
           +CK+ +
Sbjct: 280 VCKQKV 285



>gi|194221716|ref|XP_001491239.2| PREDICTED: e3 ubiquitin-protein ligase RNF13 [Equus caballus]
          Length = 381

 Score =  116 bits (291), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 76/249 (30%), Positives = 126/249 (50%), Gaps = 20/249 (8%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKL----KRKAPTEQWIALVERGQ 96
           T+ D  A FG RL  EGL G+L     I +  +  C  +     R   +  +I L+ R  
Sbjct: 47  TFDDLPARFGYRLPAEGLKGFL-----INSKPENACEPIVPPPLRDNSSGTFIVLIRRLD 101

Query: 97  CTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDT--SDVNIPSVFIAQTEYKDLRS- 153
           C F  KV N Q +G  A +V + + + LI+M +  +     ++IPSVFI ++    L+  
Sbjct: 102 CNFDVKVLNAQRAGYKAAIVHNVDSDDLISMGSNDNDVLKKIDIPSVFIGESSANSLKDE 161

Query: 154 -SSLKPVEVHLVKDNLL--QWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQ 210
            +  K   + LV +  L  ++ L+  +I+V +   +++IF+   +           +   
Sbjct: 162 FTYEKGGHILLVPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLRKD 221

Query: 211 QVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKK 270
           Q+      K+     ++ +E   CAICL++Y DGD+LR+LPC H +H  C+D WLT  KK
Sbjct: 222 QL-----KKLPVHKFKKGDEYDVCAICLDEYEDGDKLRVLPCSHAYHCKCVDPWLTKTKK 276

Query: 271 FCPICKRDI 279
            CP+CK+ +
Sbjct: 277 TCPVCKQKV 285



>gi|390178696|ref|XP_001359240.3| GA10212, partial [Drosophila pseudoobscura pseudoobscura]
 gi|388859553|gb|EAL28385.3| GA10212, partial [Drosophila pseudoobscura pseudoobscura]
          Length = 503

 Score =  116 bits (291), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 82/264 (31%), Positives = 131/264 (49%), Gaps = 19/264 (7%)

Query: 42  YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKA-----PTEQWIALVERGQ 96
           + D  A FGP L   GL  Y+V        +  GC  L R          +++AL+ RG 
Sbjct: 29  FNDLPAQFGPLLPPNGLKVYVVPA----MPHSYGCDTLSRPPHLLYPSAAKFVALISRGG 84

Query: 97  -CTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLRSSS 155
            CTF  KVR  Q +   AV+V +NE + L  M A  + S ++IPSVF+  T  K L ++ 
Sbjct: 85  GCTFETKVRMAQNASYSAVIVYNNEGDDLEQMSAD-NQSGIHIPSVFVGHTTGKAL-ATY 142

Query: 156 LKPVEVHLVKD----NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQ 211
             P  V ++ D    N+    +L   I++ L   +M+I++ +               P+ 
Sbjct: 143 FTPEVVLIINDELPFNINTQLILPFSILIGLCFLIMVIYM-IYKCIREQRRLRRHRLPKS 201

Query: 212 VVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKF 271
           ++  L  + + ++    N+   C ICL+++ + D+LR+LPC H +H  CID WLT  ++ 
Sbjct: 202 MLKKLPVRRYTKNN-TNNKYDTCVICLDEFVEDDKLRVLPCSHPYHTHCIDPWLTENRRV 260

Query: 272 CPICKRDICSPTEETPLLSNHEPT 295
           CPICKR + +   ET    N +P+
Sbjct: 261 CPICKRKVFT-KGETRASRNRQPS 283



>gi|28076963|ref|NP_081721.1| E3 ubiquitin-protein ligase RNF167 precursor [Mus musculus]
 gi|81879674|sp|Q91XF4.1|RN167_MOUSE RecName: Full=E3 ubiquitin-protein ligase RNF167; AltName:
           Full=RING finger protein 167; Flags: Precursor
 gi|14789737|gb|AAH10777.1| Ring finger protein 167 [Mus musculus]
 gi|148680647|gb|EDL12594.1| ring finger protein 167, isoform CRA_d [Mus musculus]
          Length = 347

 Score =  116 bits (290), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 84/252 (33%), Positives = 123/252 (48%), Gaps = 20/252 (7%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKR--KAPTEQ--WIALVE 93
            ++ + D  A FG  L+DEGL G+LV     EA+ +  C  +     AP     +IAL+ 
Sbjct: 34  ASMDFADLPALFGATLSDEGLQGFLV-----EAHPENACGPIAPPPSAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSAEYL 148

Query: 152 RSSSL--KPVEVHLVKDNL--LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDI 207
           R+  +  K   V LV DN   L + L+    +V L    M   + V             +
Sbjct: 149 RALFVYEKGARVLLVPDNSFPLGYYLIPFTGIVGLLVLAMGTVLIVRCIQHRKRLQRNRL 208

Query: 208 APQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTT 267
             +Q+      +I     ++ +E   CAICL++Y DGD+LR+LPC H +H  C+D WLT 
Sbjct: 209 TKEQL-----KQIPTHDYQKGDEYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPWLTQ 263

Query: 268 RKKFCPICKRDI 279
            +K CPICK+ +
Sbjct: 264 TRKTCPICKQPV 275



>gi|380017760|ref|XP_003692814.1| PREDICTED: E3 ubiquitin-protein ligase RNF13-like [Apis florea]
          Length = 448

 Score =  116 bits (290), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 80/253 (31%), Positives = 128/253 (50%), Gaps = 21/253 (8%)

Query: 42  YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTE----QWIALVERGQC 97
           ++D  A FG  +  EG+ G +V  E   A     C +++    +      WIAL+ R  C
Sbjct: 43  FRDMPARFGGLIPSEGIKGMVVYAEPPTA-----CHEIQGPPNSTSYIGNWIALIARYNC 97

Query: 98  TFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLRSSSL- 156
           +F  KVR  Q +G  AV++ +   N L  M A  D + + IPSVF+++     ++ + L 
Sbjct: 98  SFERKVRMAQKAGYDAVIIHNVNSNKLEPMLAK-DPTGIIIPSVFVSEITGLIIKENYLY 156

Query: 157 KPVEVHLVKDNL---LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVV 213
             +   L+ D+    +   LL   IVV +   +M+IF+ V                +  +
Sbjct: 157 DELYFVLINDDTPFNITHLLLPFAIVVGICFLIMVIFMIVRCIKDRRRQQ------RHRL 210

Query: 214 GNLATKIFFESKRQENEPQE-CAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFC 272
            N + K     K  + +P E CAICL+DYA+G++LR+LPC H +H  CID WLT  ++ C
Sbjct: 211 PNSSLKKIPTHKYTKGDPYETCAICLDDYAEGEKLRVLPCAHAYHTKCIDPWLTKNRRVC 270

Query: 273 PICKRDICSPTEE 285
           P+CKR + +  E+
Sbjct: 271 PVCKRKVFAADEQ 283



>gi|403265778|ref|XP_003925091.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 [Saimiri boliviensis
           boliviensis]
          Length = 381

 Score =  115 bits (289), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 77/250 (30%), Positives = 126/250 (50%), Gaps = 22/250 (8%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLK----RKAPTEQWIALVERGQ 96
           T+ D  A FG RL  EGL G+L     I +  +  C  +     +   +  +I L+ R  
Sbjct: 47  TFDDLPARFGYRLPAEGLKGFL-----INSKPENACEPIVPPPVKDNSSGTFIVLIRRLD 101

Query: 97  CTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDT---SDVNIPSVFIAQTEYKDLRS 153
           C F  KV N Q +G  A +V + + + LI+M  + D      ++IPSVFI ++    L+ 
Sbjct: 102 CNFDIKVLNAQRAGYKAAIVHNVDSDDLISM-GSNDIEILKKIDIPSVFIGESSANSLKD 160

Query: 154 SSLKPVEVHLV---KDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAP 209
                   HL+   + +L L++ L+  +I+V +   +++IF+   +           +  
Sbjct: 161 EFTYEKGGHLILVPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLRK 220

Query: 210 QQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRK 269
            Q+      K+     ++ +E   CAICL++Y DGD+LRILPC H +H  C+D WLT  K
Sbjct: 221 DQL-----KKLPIHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTK 275

Query: 270 KFCPICKRDI 279
           K CP+CK+ +
Sbjct: 276 KTCPVCKQKV 285



>gi|74180382|dbj|BAE32356.1| unnamed protein product [Mus musculus]
          Length = 347

 Score =  115 bits (289), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 84/252 (33%), Positives = 123/252 (48%), Gaps = 20/252 (7%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKR--KAPTEQ--WIALVE 93
            ++ + D  A FG  L+DEGL G+LV     EA+ +  C  +     AP     +IAL+ 
Sbjct: 34  ASMDFADLPALFGATLSDEGLQGFLV-----EAHPENACGPIAPPPSAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSAEYL 148

Query: 152 RSSSL--KPVEVHLVKDNL--LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDI 207
           R+  +  K   V LV DN   L + L+    +V L    M   + V             +
Sbjct: 149 RALFVYEKGARVLLVPDNSFPLGYYLIPFTGIVGLLVLAMGTVLIVRCIQHRKRLQRNRL 208

Query: 208 APQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTT 267
             +Q+      +I     ++ +E   CAICL++Y DGD+LR+LPC H +H  C+D WLT 
Sbjct: 209 TKEQL-----KQIPTHDYQKGDEYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPWLTQ 263

Query: 268 RKKFCPICKRDI 279
            +K CPICK+ +
Sbjct: 264 TRKTCPICKQPV 275



>gi|472358022|ref|XP_004398637.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 [Odobenus rosmarus
           divergens]
          Length = 348

 Score =  115 bits (289), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 83/252 (32%), Positives = 122/252 (48%), Gaps = 20/252 (7%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQ----WIALVE 93
           T++ + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 34  TSMDFADLPALFGAALSQEGLQGFLV-----EAHPANACSPIAPPPPARVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 148

Query: 152 RSSSL--KPVEVHLVKDNL--LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDI 207
           R+  +  K   V LV DN   L + L+    +V L    M   + V             +
Sbjct: 149 RALFVYEKGARVLLVPDNSFPLGYYLIPFTGIVGLLVLAMGAVMVVRCIQHRKRLQRNRL 208

Query: 208 APQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTT 267
             +Q+      +I     ++ ++   CAICL++Y DGD+LR+LPC H +H  C+D WLT 
Sbjct: 209 TKEQL-----KQIPTHDYQKGDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPWLTQ 263

Query: 268 RKKFCPICKRDI 279
            +K CPICK+ +
Sbjct: 264 TRKTCPICKQPV 275



>gi|402861239|ref|XP_003895008.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 isoform 1 [Papio
           anubis]
 gi|402861241|ref|XP_003895009.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 isoform 2 [Papio
           anubis]
          Length = 381

 Score =  115 bits (289), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 77/250 (30%), Positives = 126/250 (50%), Gaps = 22/250 (8%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLK----RKAPTEQWIALVERGQ 96
           T+ D  A FG RL  EGL G+L     I +  +  C  +     +   +  +I L+ R  
Sbjct: 47  TFDDLPARFGYRLPAEGLKGFL-----INSKPENACEPIVPPPVKDNSSGAFIVLIRRLD 101

Query: 97  CTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDT---SDVNIPSVFIAQTEYKDLRS 153
           C F  KV N Q +G  A +V + + + LI+M  + D      ++IPSVFI ++    L+ 
Sbjct: 102 CNFDIKVLNAQRAGYKAAIVHNVDSDDLISM-GSNDIEVLKKIDIPSVFIGESSANSLKD 160

Query: 154 SSLKPVEVHLV---KDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAP 209
                   HL+   + +L L++ L+  +I+V +   +++IF+   +           +  
Sbjct: 161 EFTYEKGGHLILVPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLRK 220

Query: 210 QQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRK 269
            Q+      K+     ++ +E   CAICL++Y DGD+LRILPC H +H  C+D WLT  K
Sbjct: 221 DQL-----KKLPVHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTK 275

Query: 270 KFCPICKRDI 279
           K CP+CK+ +
Sbjct: 276 KTCPVCKQKV 285



>gi|355746972|gb|EHH51586.1| hypothetical protein EGM_10995 [Macaca fascicularis]
          Length = 381

 Score =  115 bits (289), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 77/250 (30%), Positives = 126/250 (50%), Gaps = 22/250 (8%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLK----RKAPTEQWIALVERGQ 96
           T+ D  A FG RL  EGL G+L     I +  +  C  +     +   +  +I L+ R  
Sbjct: 47  TFDDLPARFGYRLPAEGLKGFL-----INSKPENACEPIVPPPVKDNSSGAFIVLIRRLD 101

Query: 97  CTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDT---SDVNIPSVFIAQTEYKDLRS 153
           C F  KV N Q +G  A +V + + + LI+M  + D      ++IPSVFI ++    L+ 
Sbjct: 102 CNFDIKVLNAQRAGYKAAIVHNVDSDDLISM-GSNDIEVLKKIDIPSVFIGESSANSLKD 160

Query: 154 SSLKPVEVHLV---KDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAP 209
                   HL+   + +L L++ L+  +I+V +   +++IF+   +           +  
Sbjct: 161 EFTYEKGGHLILVPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLRK 220

Query: 210 QQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRK 269
            Q+      K+     ++ +E   CAICL++Y DGD+LRILPC H +H  C+D WLT  K
Sbjct: 221 DQL-----KKLPVHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTK 275

Query: 270 KFCPICKRDI 279
           K CP+CK+ +
Sbjct: 276 KTCPVCKQKV 285



>gi|6005864|ref|NP_009213.1| E3 ubiquitin-protein ligase RNF13 [Homo sapiens]
 gi|34577087|ref|NP_899237.1| E3 ubiquitin-protein ligase RNF13 [Homo sapiens]
 gi|197101023|ref|NP_001125196.1| E3 ubiquitin-protein ligase RNF13 precursor [Pongo abelii]
 gi|114589798|ref|XP_530652.2| PREDICTED: E3 ubiquitin-protein ligase RNF13 isoform 10 [Pan
           troglodytes]
 gi|114589802|ref|XP_001142115.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 isoform 9 [Pan
           troglodytes]
 gi|332214389|ref|XP_003256319.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 isoform 1 [Nomascus
           leucogenys]
 gi|332214391|ref|XP_003256320.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 isoform 2 [Nomascus
           leucogenys]
 gi|397512369|ref|XP_003826520.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 [Pan paniscus]
 gi|426342508|ref|XP_004037884.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 isoform 1 [Gorilla
           gorilla gorilla]
 gi|426342510|ref|XP_004037885.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 isoform 2 [Gorilla
           gorilla gorilla]
 gi|21362880|sp|O43567.1|RNF13_HUMAN RecName: Full=E3 ubiquitin-protein ligase RNF13; AltName: Full=RING
           finger protein 13; Flags: Precursor
 gi|75042231|sp|Q5RCV8.1|RNF13_PONAB RecName: Full=E3 ubiquitin-protein ligase RNF13; AltName: Full=RING
           finger protein 13; Flags: Precursor
 gi|2746333|gb|AAC03769.1| RING zinc finger protein [Homo sapiens]
 gi|3387925|gb|AAC28641.1| RING zinc finger protein RZF [Homo sapiens]
 gi|14602541|gb|AAH09781.1| Ring finger protein 13 [Homo sapiens]
 gi|14602579|gb|AAH09803.1| Ring finger protein 13 [Homo sapiens]
 gi|48145725|emb|CAG33085.1| RNF13 [Homo sapiens]
 gi|55727286|emb|CAH90399.1| hypothetical protein [Pongo abelii]
 gi|119599265|gb|EAW78859.1| ring finger protein 13, isoform CRA_b [Homo sapiens]
 gi|119599267|gb|EAW78861.1| ring finger protein 13, isoform CRA_b [Homo sapiens]
 gi|119599269|gb|EAW78863.1| ring finger protein 13, isoform CRA_b [Homo sapiens]
 gi|167773739|gb|ABZ92304.1| ring finger protein 13 [synthetic construct]
 gi|189053849|dbj|BAG36109.1| unnamed protein product [Homo sapiens]
 gi|193786879|dbj|BAG52202.1| unnamed protein product [Homo sapiens]
 gi|306921283|dbj|BAJ17721.1| ring finger protein 13 [synthetic construct]
 gi|325463911|gb|ADZ15726.1| ring finger protein 13 [synthetic construct]
          Length = 381

 Score =  115 bits (289), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 77/250 (30%), Positives = 126/250 (50%), Gaps = 22/250 (8%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLK----RKAPTEQWIALVERGQ 96
           T+ D  A FG RL  EGL G+L     I +  +  C  +     +   +  +I L+ R  
Sbjct: 47  TFDDLPARFGYRLPAEGLKGFL-----INSKPENACEPIVPPPVKDNSSGTFIVLIRRLD 101

Query: 97  CTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDT---SDVNIPSVFIAQTEYKDLRS 153
           C F  KV N Q +G  A +V + + + LI+M  + D      ++IPSVFI ++    L+ 
Sbjct: 102 CNFDIKVLNAQRAGYKAAIVHNVDSDDLISM-GSNDIEVLKKIDIPSVFIGESSANSLKD 160

Query: 154 SSLKPVEVHLV---KDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAP 209
                   HL+   + +L L++ L+  +I+V +   +++IF+   +           +  
Sbjct: 161 EFTYEKGGHLILVPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLRK 220

Query: 210 QQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRK 269
            Q+      K+     ++ +E   CAICL++Y DGD+LRILPC H +H  C+D WLT  K
Sbjct: 221 DQL-----KKLPVHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTK 275

Query: 270 KFCPICKRDI 279
           K CP+CK+ +
Sbjct: 276 KTCPVCKQKV 285



>gi|344288944|ref|XP_003416206.1| PREDICTED: E3 ubiquitin-protein ligase RNF13-like [Loxodonta
           africana]
          Length = 381

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 78/246 (31%), Positives = 127/246 (51%), Gaps = 14/246 (5%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIALVERGQCTFI 100
           T+ D  A FG RL  EGL G+L++ +   A        LK  + +  +I L+ R  C F 
Sbjct: 47  TFDDLPARFGYRLPAEGLKGFLINSKPENACEPIVPPPLKDNS-SGTFIVLIRRLDCNFD 105

Query: 101 EKVRNMQASGAIAVVVGDNEKNGLITMYATGDT---SDVNIPSVFIAQTEYKDLRSSSLK 157
            KV N Q +G  A +V + + + LI+M  + D      ++IPSVFI ++    L+     
Sbjct: 106 VKVLNAQRAGFKAAIVHNVDSDDLISM-GSNDIEVLKKIDIPSVFIGESSANSLKDEFTY 164

Query: 158 PVEVHLV---KDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVV 213
               H+V   + +L L++ L+  +I+V +   +++IF+   +           +   Q+ 
Sbjct: 165 EKGGHIVLVPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLRKDQL- 223

Query: 214 GNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCP 273
                K+     ++ +E   CAICL++Y DGD+LRILPC H +H  C+D WLT  KK CP
Sbjct: 224 ----KKLPIHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCP 279

Query: 274 ICKRDI 279
           +CK+ +
Sbjct: 280 VCKQKV 285



>gi|488566568|ref|XP_004472943.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 isoform 1 [Dasypus
           novemcinctus]
          Length = 381

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 77/246 (31%), Positives = 128/246 (52%), Gaps = 14/246 (5%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIALVERGQCTFI 100
           T+ D  A FG RL  EGL G+L++ +   A        LK  + +  +I L+ R  C F 
Sbjct: 47  TFDDLPARFGYRLPAEGLKGFLINSKPENACEPIVPPPLKDNS-SGTFIVLIRRLDCNFD 105

Query: 101 EKVRNMQASGAIAVVVGDNEKNGLITMYATGDTS---DVNIPSVFIAQTEYKDLRSSSLK 157
            KV N Q +G  A +V + + + LI+M  + D      ++IPSVFI ++    L+   + 
Sbjct: 106 IKVLNAQRAGFKAAIVHNVDSDELISM-GSNDIDVLKKIDIPSVFIGESSANSLKDEFIY 164

Query: 158 PVEVHLV---KDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVV 213
               H++   + +L L++ L+  +I+V +   +++IF+   +           +   Q+ 
Sbjct: 165 EKGGHIILVPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLRKDQL- 223

Query: 214 GNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCP 273
                K+     ++ +E   CAICL++Y DGD+LRILPC H +H  C+D WLT  KK CP
Sbjct: 224 ----KKLPIHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCP 279

Query: 274 ICKRDI 279
           +CK+ +
Sbjct: 280 VCKQKV 285



>gi|410971206|ref|XP_003992063.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 [Felis catus]
          Length = 381

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 78/246 (31%), Positives = 127/246 (51%), Gaps = 14/246 (5%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIALVERGQCTFI 100
           T+ D  A FG RL  EGL G+L++ +   A        LK  + +  +I L+ R  C F 
Sbjct: 47  TFDDLPARFGYRLPAEGLKGFLINSKPENACEPIVPPPLKDNS-SGTFIVLIRRLDCNFD 105

Query: 101 EKVRNMQASGAIAVVVGDNEKNGLITMYATGDTS---DVNIPSVFIAQTEYKDLRSSSLK 157
            KV N Q +G  A +V + + + LI+M  + D      ++IPSVFI ++    L+     
Sbjct: 106 VKVLNAQRAGYKAAIVHNVDSDDLISM-GSNDIDVLKKIDIPSVFIGESSANSLKDEFTY 164

Query: 158 PVEVHLV---KDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVV 213
               H+V   + +L L++ L+  +I+V +   +++IF+   +           +   Q+ 
Sbjct: 165 EKGGHIVLVPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLRKDQL- 223

Query: 214 GNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCP 273
                K+     ++ +E   CAICL++Y DGD+LRILPC H +H  C+D WLT  KK CP
Sbjct: 224 ----KKLPVHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCP 279

Query: 274 ICKRDI 279
           +CK+ +
Sbjct: 280 VCKQKV 285



>gi|390356491|ref|XP_796758.3| PREDICTED: E3 ubiquitin-protein ligase RNF13-like
           [Strongylocentrotus purpuratus]
          Length = 402

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 85/288 (29%), Positives = 130/288 (45%), Gaps = 30/288 (10%)

Query: 28  VVDATIVVVATN-----VTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRK 82
           ++  T  V+AT+       +Q   AAFG    D  + G LV    IEA        L   
Sbjct: 30  IMQITADVIATSQHNDTTAFQSVTAAFG-SPPDGQMQGLLVVANPIEACGPIQVPPLLPN 88

Query: 83  APTEQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVF 142
             T  + AL++RG C F +KV N Q +  +  +V ++E N L TM  +     + IPSVF
Sbjct: 89  V-TGVYFALIKRGSCNFDKKVYNAQQARYMGAIVYNDEGNVLTTMSGSQYNKLIYIPSVF 147

Query: 143 IAQTEYKDLRSSSLKPVEVHLVKDNLL--QWPLLDVIIVVILSPTVMMIFIYVLWXXXXX 200
           + +   + L+  +      H+V   LL  + P L    +  +S T   +  + ++     
Sbjct: 148 VGKDSGETLQGMNYS-TGYHVV---LLATESPSLGFYFLPFISVTSTCLLFFAMYAIAKY 203

Query: 201 XXXXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITC 260
                     ++  +   K+  +     +E   CAICL+DY +G +LRILPC H +H  C
Sbjct: 204 VRDQRRQRKARLSRDHLKKLPIKXXSSGDEYDICAICLDDYEEGQKLRILPCNHAYHCKC 263

Query: 261 IDSWLTTRKKFCPICKRDIC-----------------SPTEETPLLSN 291
           ID WLT  ++ CPICKR +                  +P E TPLLS+
Sbjct: 264 IDPWLTNNRRTCPICKRKVIPPGMADSDEESDSEAGDAPNENTPLLSS 311



>gi|296227840|ref|XP_002759543.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 [Callithrix jacchus]
          Length = 381

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 77/250 (30%), Positives = 126/250 (50%), Gaps = 22/250 (8%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLK----RKAPTEQWIALVERGQ 96
           T+ D  A FG RL  EGL G+L     I +  +  C  +     +   +  +I L+ R  
Sbjct: 47  TFDDLPARFGYRLPAEGLKGFL-----INSKPENACEPIVPPPVKDNSSGTFIVLIRRLD 101

Query: 97  CTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDT---SDVNIPSVFIAQTEYKDLRS 153
           C F  KV N Q +G  A +V + + + LI+M  + D      ++IPSVFI ++    L+ 
Sbjct: 102 CNFDIKVLNAQRAGYKAAIVHNVDSDDLISM-GSNDIEILKKIDIPSVFIGESSANSLKD 160

Query: 154 SSLKPVEVHLV---KDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAP 209
                   HL+   + +L L++ L+  +I+V +   +++IF+   +           +  
Sbjct: 161 EFTYDKGGHLILVPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLRK 220

Query: 210 QQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRK 269
            Q+      K+     ++ +E   CAICL++Y DGD+LRILPC H +H  C+D WLT  K
Sbjct: 221 DQL-----KKLPVHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTK 275

Query: 270 KFCPICKRDI 279
           K CP+CK+ +
Sbjct: 276 KTCPVCKQKV 285



>gi|194744271|ref|XP_001954618.1| GF18360 [Drosophila ananassae]
 gi|190627655|gb|EDV43179.1| GF18360 [Drosophila ananassae]
          Length = 547

 Score =  115 bits (288), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 79/243 (32%), Positives = 123/243 (50%), Gaps = 17/243 (6%)

Query: 47  AAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKR----KAPT-EQWIALVERG-QCTFI 100
           A FGP+L   G+  ++V     ++     C  L R      PT  +++AL+ RG +CTF 
Sbjct: 47  AQFGPQLASNGIKVFVVPPIPTQS---YACDHLSRPPHLNYPTGAKFVALISRGGECTFE 103

Query: 101 EKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLRSSSLKPVE 160
            KVR  Q +   AV+V +NE + L  M A   T  ++IPSVF+  T  K L +S   P  
Sbjct: 104 RKVRVAQNASYSAVIVYNNEGDDLEQMSADNRTG-IHIPSVFVGHTSGKAL-ASYFTPEV 161

Query: 161 VHLVKD----NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVVGNL 216
           V ++ D    N+    +L   I++ L   +M+I++ +               P+ ++  L
Sbjct: 162 VLIINDELPFNINTQLILPFSILIGLCFIIMVIYM-IYKCIREQRRLRRHRLPKSMLKKL 220

Query: 217 ATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCPICK 276
              + +      N+   C ICLED+ + D+LR+LPC H +H  CID WLT  ++ CPICK
Sbjct: 221 PV-LRYTKNNVNNKYDTCVICLEDFVEDDKLRVLPCSHPYHTHCIDPWLTENRRVCPICK 279

Query: 277 RDI 279
           R +
Sbjct: 280 RKV 282



>gi|259155278|ref|NP_001158881.1| E3 ubiquitin-protein ligase RNF167 precursor [Salmo salar]
 gi|223647828|gb|ACN10672.1| E3 ubiquitin-protein ligase RNF167 precursor [Salmo salar]
          Length = 403

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 78/282 (27%), Positives = 127/282 (45%), Gaps = 28/282 (9%)

Query: 16  AHCPFIARWSNFVVDATIVVVATNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKG 75
           AH    A +SN           TN+ ++D  A FG  L  EGL+G LV     E+    G
Sbjct: 27  AHAYIYAHYSNM----------TNMLFEDLPAFFGSSLPKEGLMGVLV-----ESRPLNG 71

Query: 76  CSKLKR----------KAPTEQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLI 125
           C+ ++              T  +I L+ R  C F  KV + Q +G  A +V +     L+
Sbjct: 72  CTPIEPPPPRPTSSDPNTTTTNYIVLIRRYDCNFDIKVLHAQQAGFSAAIVHNMYSETLL 131

Query: 126 TMYATGDT--SDVNIPSVFIAQTEYKDLRSSSLKPVEVHLVKDNLLQWPLLDVIIVVILS 183
            M  + +T   ++ IPSVF +    + LR+  +     +++      +PL    ++    
Sbjct: 132 NMNYSNETIAEEIEIPSVFTSYYASQILRTFIIPEQGAYVILKPEFAFPL-SYYLIPFTG 190

Query: 184 PTVMMIFIYVLWXXXXXXXXXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYAD 243
              M+I + V+            +   ++      +I      + +E   CAICL++Y +
Sbjct: 191 IVGMIILVMVVILIVRCVQYRKRMRKYRLTKEQLKRIPIHKFTKGDEYDVCAICLDEYEE 250

Query: 244 GDELRILPCKHEFHITCIDSWLTTRKKFCPICKRDICSPTEE 285
           GD+LR+LPC H +H  C+D WLT  KK CP+CK+ +  P  E
Sbjct: 251 GDKLRVLPCSHAYHSKCVDPWLTGTKKTCPVCKQRVTRPNPE 292



>gi|511868782|ref|XP_004755584.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 isoform X1 [Mustela
           putorius furo]
 gi|511868784|ref|XP_004755585.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 isoform X2 [Mustela
           putorius furo]
 gi|511868787|ref|XP_004755586.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 isoform X3 [Mustela
           putorius furo]
 gi|511868790|ref|XP_004755587.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 isoform X4 [Mustela
           putorius furo]
 gi|511868793|ref|XP_004755588.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 isoform X5 [Mustela
           putorius furo]
 gi|511959067|ref|XP_004797781.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 isoform X1 [Mustela
           putorius furo]
 gi|511959069|ref|XP_004797782.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 isoform X2 [Mustela
           putorius furo]
 gi|511959071|ref|XP_004797783.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 isoform X3 [Mustela
           putorius furo]
 gi|511959073|ref|XP_004797784.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 isoform X4 [Mustela
           putorius furo]
 gi|511959075|ref|XP_004797785.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 isoform X5 [Mustela
           putorius furo]
          Length = 381

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 77/246 (31%), Positives = 127/246 (51%), Gaps = 14/246 (5%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIALVERGQCTFI 100
           T+ D  A FG RL  EGL G+L++ +   A        LK  + +  +I L+ R  C F 
Sbjct: 47  TFDDLPARFGYRLPAEGLKGFLINSKPENACEPIVPPPLKDNS-SGTFIVLIRRLDCNFD 105

Query: 101 EKVRNMQASGAIAVVVGDNEKNGLITMYATGDTS---DVNIPSVFIAQTEYKDLRSSSLK 157
            KV N Q +G  A +V + + + LI+M  + D      ++IPSVFI ++    L+     
Sbjct: 106 VKVLNAQRAGYKAAIVHNVDSDDLISM-GSNDIDVLKKIDIPSVFIGESSANSLKDEFTY 164

Query: 158 PVEVHLV---KDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVV 213
               H++   + +L L++ L+  +I+V +   +++IF+   +           +   Q+ 
Sbjct: 165 EKGGHIILVPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLRKDQL- 223

Query: 214 GNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCP 273
                K+     ++ +E   CAICL++Y DGD+LRILPC H +H  C+D WLT  KK CP
Sbjct: 224 ----KKLPVHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCP 279

Query: 274 ICKRDI 279
           +CK+ +
Sbjct: 280 VCKQKV 285



>gi|472371151|ref|XP_004405079.1| PREDICTED: E3 ubiquitin-protein ligase RNF13, partial [Odobenus
           rosmarus divergens]
          Length = 343

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 77/246 (31%), Positives = 127/246 (51%), Gaps = 14/246 (5%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIALVERGQCTFI 100
           T+ D  A FG RL  EGL G+L++ +   A        LK  + +  +I L+ R  C F 
Sbjct: 9   TFDDLPARFGYRLPAEGLKGFLINSKPENACEPIVPPPLKDNS-SGTFIVLIRRLDCNFD 67

Query: 101 EKVRNMQASGAIAVVVGDNEKNGLITMYATGDTS---DVNIPSVFIAQTEYKDLRSSSLK 157
            KV N Q +G  A +V + + + LI+M  + D      ++IPSVFI ++    L+     
Sbjct: 68  VKVLNAQRAGYKAAIVHNVDSDDLISM-GSNDIDVLKKIDIPSVFIGESSANSLKDEFTY 126

Query: 158 PVEVHLV---KDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVV 213
               H++   + +L L++ L+  +I+V +   +++IF+   +           +   Q+ 
Sbjct: 127 EKGGHIILVPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLRKDQL- 185

Query: 214 GNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCP 273
                K+     ++ +E   CAICL++Y DGD+LRILPC H +H  C+D WLT  KK CP
Sbjct: 186 ----KKLPIHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCP 241

Query: 274 ICKRDI 279
           +CK+ +
Sbjct: 242 VCKQKV 247



>gi|410921626|ref|XP_003974284.1| PREDICTED: E3 ubiquitin-protein ligase RNF13-like [Takifugu
           rubripes]
          Length = 379

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 74/249 (29%), Positives = 128/249 (51%), Gaps = 21/249 (8%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLK---RKAPTEQWIALVERGQC 97
           +++D  A FG RL  EGL G+L+      A  +  C  ++   R   T  +I L++R +C
Sbjct: 47  SFEDLPARFGYRLPTEGLKGFLIG-----ARPENACEPIEPPPRDNLTGAFIVLIKRFEC 101

Query: 98  TFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD---TSDVNIPSVFIAQTEYKDLRSS 154
            F  KV N Q +G  A +V +   + LI+M  + D      ++IPSVF+++     L+  
Sbjct: 102 NFDVKVLNAQKAGYRAAIVHNVNSDDLISM-GSNDLDIMKQIDIPSVFVSEETANSLKED 160

Query: 155 SL--KPVEVHLVKDNLL--QWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQ 210
            +  K   V L+ D  L  ++ L+  +I+V +   ++++F+   +           +   
Sbjct: 161 YIYDKGGHVVLMPDFSLPLEYYLIPFLIIVGICLILIVVFMITKFVQDRRRARRSRLHKD 220

Query: 211 QVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKK 270
           Q+      K+     ++ +    CAICL++Y +GD+LR+LPC H +H  C+D WLT  KK
Sbjct: 221 QL-----KKLPIHKYKKGDSYDVCAICLDEYEEGDKLRVLPCSHAYHSKCVDPWLTKTKK 275

Query: 271 FCPICKRDI 279
            CP+CK+ +
Sbjct: 276 TCPVCKQKV 284



>gi|297813379|ref|XP_002874573.1| peptidase/ protein binding protein [Arabidopsis lyrata subsp.
           lyrata]
 gi|297320410|gb|EFH50832.1| peptidase/ protein binding protein [Arabidopsis lyrata subsp.
           lyrata]
          Length = 448

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 83/286 (29%), Positives = 136/286 (47%), Gaps = 29/286 (10%)

Query: 28  VVDATIVVVA--TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKL------ 79
           +V A I+++   T++++ D  A F P +      G L   E ++A     CS L      
Sbjct: 17  LVSAKILLIGKNTSLSFDDIEANFTPMIKRSDQGGVLYVAEPLDA-----CSDLVNTVNV 71

Query: 80  KRKAPTEQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIP 139
           K  +       L+ RG C+F EK+RN Q +G  A +V D E  G +   A G+ S V I 
Sbjct: 72  KNGSSVPPPYVLIIRGGCSFEEKIRNAQKAGYKAAIVYDYEDYGFLVSMA-GNPSGVLIY 130

Query: 140 SVFIAQTEYKDL-RSSSLKPVEVHLVKD-NLLQWPLLDVIIVVILSPTVMMIFIYVLWXX 197
             F+++   + L + +     EV L+       W ++ +  + +L+ + ++   + +   
Sbjct: 131 GTFVSKATGEVLTQYAGRTDFEVWLMPSFETSAWSIMAISFISLLAMSAVLATCFFVRRH 190

Query: 198 XXXXXXXXDI-------APQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRIL 250
                    +         + ++  + T IF     + +    CAIC+EDY  GD+LRIL
Sbjct: 191 RVRRRRILALNGNDFPRMAKNMLKRMPTTIFKGVCDEASTSISCAICIEDYRIGDKLRIL 250

Query: 251 PCKHEFHITCIDSWLTTRKKFCPICKRDICS------PTEETPLLS 290
           PC H+FH+ C+D WL  R+ FCP+CKRD  S       +E TPLL+
Sbjct: 251 PCHHKFHVGCVDLWLGQRRSFCPVCKRDARSISIDMPASEHTPLLT 296



>gi|478258630|gb|ENN78680.1| hypothetical protein YQE_04852, partial [Dendroctonus ponderosae]
          Length = 415

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 84/255 (32%), Positives = 126/255 (49%), Gaps = 23/255 (9%)

Query: 42  YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT--EQW---IALVER-- 94
           + D  ++FG  L+D  + G +V+     A     C++  + AP+    W   I LV R  
Sbjct: 35  FVDAPSSFGADLSDGPVRGAIVN-----AIPSHACNESLKPAPSGKRSWRADILLVPRYT 89

Query: 95  --GQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLR 152
               CTF  KVR  Q  G  A++V +   N L+ M A   T  + IPSVF++Q+    L 
Sbjct: 90  SEANCTFERKVRMAQLKGYNAIIVYNVGSNELVPMSAKNSTG-ITIPSVFVSQSSGVMLT 148

Query: 153 SSSLKPVEVHLVKD---NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAP 209
             +     V +  D   N+    L+   IVV +   VM++F+ V +           + P
Sbjct: 149 GYANWDYIVVITADTPFNIQTHLLIPFAIVVGICMVVMIVFMIVKYIKDRRRQRRYRL-P 207

Query: 210 QQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRK 269
           +  +  + T  F +  R E     CAICLEDY +G++LR+LPC H +H+ CID WLT  K
Sbjct: 208 KSQLNKIPTCKFQKGDRYET----CAICLEDYIEGEKLRVLPCNHVYHMKCIDPWLTKNK 263

Query: 270 KFCPICKRDICSPTE 284
           + CPICKR + +  E
Sbjct: 264 RVCPICKRKVFAHDE 278



>gi|148231430|ref|NP_001087597.1| ring finger protein 167 precursor [Xenopus laevis]
 gi|51513472|gb|AAH80409.1| MGC86297 protein [Xenopus laevis]
          Length = 341

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 78/247 (31%), Positives = 120/247 (48%), Gaps = 19/247 (7%)

Query: 42  YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKL---KRKAPTEQWIALVERGQCT 98
           + D  A FGP L  +G+ G LV     EA     CS +      A    ++AL+ R  C 
Sbjct: 41  FDDLPALFGPSLPIDGMKGSLV-----EAVPSNACSPILPPPSLANGTSFVALIRRYDCN 95

Query: 99  FIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDT--SDVNIPSVFIAQTEYKDL--RSS 154
           F  KV + Q +G  A +V +     L+ M    +T  + ++IPSVFI Q   + L    S
Sbjct: 96  FDTKVLHAQLAGYRAAIVHNVGSELLLHMSKNNETLSNHIHIPSVFIGQRSSRSLLINFS 155

Query: 155 SLKPVEVHLVKDNL--LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQV 212
                 ++L+ D    L + L+  I+VV     +M I + V             ++ +Q+
Sbjct: 156 YYNNSHIYLMPDYYFSLGYYLIPFIVVVSAFIIIMCIVMVVRCVQYRKRMRRNRLSKEQL 215

Query: 213 VGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFC 272
                 KI     ++ ++   CAICLE+Y +GD+LR+LPC H +H +C+D WLT  KK C
Sbjct: 216 -----NKIPIHKFKKGDDYDVCAICLEEYEEGDKLRVLPCSHAYHSSCVDPWLTKTKKSC 270

Query: 273 PICKRDI 279
           P+CK  +
Sbjct: 271 PVCKNRV 277



>gi|291399975|ref|XP_002716309.1| PREDICTED: ring finger protein 13 [Oryctolagus cuniculus]
          Length = 381

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 77/246 (31%), Positives = 126/246 (51%), Gaps = 14/246 (5%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIALVERGQCTFI 100
           T+ D  A FG RL  EGL G+L++ +   A        LK  + +  +I L+ R  C F 
Sbjct: 47  TFDDLPARFGYRLPAEGLKGFLINSKPENACEPIVPPPLKDNS-SSTFIVLIRRFDCNFD 105

Query: 101 EKVRNMQASGAIAVVVGDNEKNGLITMYATGDTS---DVNIPSVFIAQTEYKDLRSSSLK 157
            KV N Q +G  A +V + + + LI M  + D      ++IPSVFI ++    L+     
Sbjct: 106 IKVLNAQRAGYKAAIVHNVDSDDLIGM-GSNDIDVLKKIDIPSVFIGESSANSLKDEFTY 164

Query: 158 PVEVHLV---KDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVV 213
               H++   + +L L++ L+  +I+V +   +++IF+   +           +   Q+ 
Sbjct: 165 EKGGHIILVPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRSRLRKDQL- 223

Query: 214 GNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCP 273
                K+     ++ +E   CAICL++Y DGD+LRILPC H +H  C+D WLT  KK CP
Sbjct: 224 ----KKLPIHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCP 279

Query: 274 ICKRDI 279
           +CK+ +
Sbjct: 280 VCKQKV 285



>gi|512908556|ref|XP_004901371.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 isoform X5
           [Heterocephalus glaber]
 gi|512991188|ref|XP_004857361.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 isoform X3
           [Heterocephalus glaber]
 gi|351710636|gb|EHB13555.1| E3 ubiquitin-protein ligase RNF167 [Heterocephalus glaber]
          Length = 350

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 77/253 (30%), Positives = 123/253 (48%), Gaps = 24/253 (9%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQ--WIALVERG 95
            ++ + D  A FG  L+ EGL G+LV     EA+ +  C+ +    P     +IAL+ R 
Sbjct: 34  ASMDFADLPALFGATLSQEGLQGFLV-----EAHPENACTPIAPPPPVNGSVFIALLRRF 88

Query: 96  QCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDLRS 153
            C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + LR+
Sbjct: 89  DCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSAEYLRA 148

Query: 154 SSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXD 206
             +  K   V LV DN         P   ++ +++L+   +M+   +             
Sbjct: 149 LFVYEKGARVLLVPDNSFPLGYYLIPFSGIVGLLVLAMGAVMVVRCI--------QHRKR 200

Query: 207 IAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLT 266
           +   ++      +I     ++ ++   CAICL++Y DGD+LR+LPC H +H  C+D WLT
Sbjct: 201 LQRNRLTKEQLKQIPTHDYQKGDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPWLT 260

Query: 267 TRKKFCPICKRDI 279
             +K CPICK+ +
Sbjct: 261 QTRKTCPICKQPV 273



>gi|57103676|ref|XP_534303.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 isoform 1 [Canis lupus
           familiaris]
          Length = 381

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 77/246 (31%), Positives = 127/246 (51%), Gaps = 14/246 (5%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIALVERGQCTFI 100
           T+ D  A FG RL  EGL G+L++ +   A        LK  + +  +I L+ R  C F 
Sbjct: 47  TFDDLPARFGYRLPAEGLKGFLINSKPENACEPIVPPPLKDNS-SGTFIVLIRRLDCNFD 105

Query: 101 EKVRNMQASGAIAVVVGDNEKNGLITMYATGDTS---DVNIPSVFIAQTEYKDLRSSSLK 157
            KV N Q +G  A +V + + + LI+M  + D      ++IPSVFI ++    L+     
Sbjct: 106 IKVLNAQRAGYKAAIVHNVDSDDLISM-GSNDIDVLKKIDIPSVFIGESSANSLKDEFTY 164

Query: 158 PVEVHLV---KDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVV 213
               H++   + +L L++ L+  +I+V +   +++IF+   +           +   Q+ 
Sbjct: 165 EKGGHIILVPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLRKDQL- 223

Query: 214 GNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCP 273
                K+     ++ +E   CAICL++Y DGD+LRILPC H +H  C+D WLT  KK CP
Sbjct: 224 ----KKLPVHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCP 279

Query: 274 ICKRDI 279
           +CK+ +
Sbjct: 280 VCKQKV 285



>gi|328786465|ref|XP_391835.4| PREDICTED: e3 ubiquitin-protein ligase RNF13-like [Apis mellifera]
          Length = 448

 Score =  114 bits (286), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 79/253 (31%), Positives = 128/253 (50%), Gaps = 21/253 (8%)

Query: 42  YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTE----QWIALVERGQC 97
           ++D  A FG  +  EG+ G +V  E   A     C +++    +      WI+L+ R  C
Sbjct: 43  FRDMPARFGGLIPSEGIKGMVVYAEPPTA-----CHEIQGPPNSTSYIGNWISLIARYNC 97

Query: 98  TFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLRSSSL- 156
           +F  KVR  Q +G  AV++ +   N L  M A  D + + IPSVF+++     ++ + L 
Sbjct: 98  SFERKVRMAQKAGYDAVIIHNVNSNKLEPMLAK-DPTGIIIPSVFVSEITGLIIKENYLY 156

Query: 157 KPVEVHLVKDNL---LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVV 213
             +   L+ D+    +   LL   IVV +   +M+IF+ V                +  +
Sbjct: 157 DELYFVLINDDSPFNITHLLLPFAIVVGICFLIMVIFMIVRCIKDRRRQQ------RHRL 210

Query: 214 GNLATKIFFESKRQENEPQE-CAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFC 272
            N + K     K  + +P E CAICL+DYA+G++LR+LPC H +H  CID WLT  ++ C
Sbjct: 211 PNSSLKKIPTHKYTKGDPYETCAICLDDYAEGEKLRVLPCAHAYHTKCIDPWLTKNRRVC 270

Query: 273 PICKRDICSPTEE 285
           P+CKR + +  E+
Sbjct: 271 PVCKRKVFAADEQ 283



>gi|195392144|ref|XP_002054719.1| GJ24605 [Drosophila virilis]
 gi|194152805|gb|EDW68239.1| GJ24605 [Drosophila virilis]
          Length = 544

 Score =  114 bits (286), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 84/272 (30%), Positives = 132/272 (48%), Gaps = 22/272 (8%)

Query: 28  VVDATIVVVATNVT-----YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRK 82
           VVDA ++V     T     + D  A FGP +    L  ++V  E    NN  GC  LK  
Sbjct: 24  VVDAHVLVYRRTTTQLIEEFNDLPATFGPLIVGNNLRVFVVPHE---TNNAYGCDNLKPP 80

Query: 83  APT-----EQWIALVERG-QCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDV 136
             T      +++A+V RG  CTF  KVR  Q +   AV++ +NE + L  M A  + S +
Sbjct: 81  PRTGYPIGAKFVAIVSRGGDCTFERKVRVAQNATYYAVIIYNNEGDELEQMTA-NNASGI 139

Query: 137 NIPSVFIAQTEYKDLRSSSLKPVEVHLVKD----NLLQWPLLDVIIVVILSPTVMMIFIY 192
           +I SVF+  T  K L S    P  V ++ D    N+    +L   I++ L   +M++++ 
Sbjct: 140 HIASVFVGLTTGKTLLSF-FTPEVVLIINDELPFNINTQLILPFSILIALCFLIMIVYM- 197

Query: 193 VLWXXXXXXXXXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPC 252
           +               P+ ++  +   + +       + + C ICLED+ + D+LR+LPC
Sbjct: 198 IYKCIREQRRLRRYRLPKSMLKKIPV-LRYTKNNTTIKYETCVICLEDFVEDDKLRVLPC 256

Query: 253 KHEFHITCIDSWLTTRKKFCPICKRDICSPTE 284
            H +H  CID WLT  ++ CPICKR + +  E
Sbjct: 257 SHPYHSHCIDPWLTENRRVCPICKRKVFTKGE 288



>gi|301776154|ref|XP_002923497.1| PREDICTED: RING finger protein 13-like [Ailuropoda melanoleuca]
 gi|281353739|gb|EFB29323.1| hypothetical protein PANDA_012636 [Ailuropoda melanoleuca]
          Length = 381

 Score =  114 bits (285), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 76/246 (30%), Positives = 127/246 (51%), Gaps = 14/246 (5%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIALVERGQCTFI 100
           T+ D  A FG RL  EGL G+L++ +   A        LK  + +  +I L+ R  C F 
Sbjct: 47  TFDDLPARFGYRLPAEGLKGFLINSKPENACEPIVPPPLKDNS-SGTFIVLIRRLDCNFD 105

Query: 101 EKVRNMQASGAIAVVVGDNEKNGLITMYATGDTS---DVNIPSVFIAQTEYKDLRSSSLK 157
            KV N Q +G  A +V + + + LI+M  + D      ++IPSVF+ ++    L+     
Sbjct: 106 VKVLNAQRAGYKAAIVHNVDSDDLISM-GSNDIDVLKKIDIPSVFVGESSANSLKDEFTY 164

Query: 158 PVEVHLV---KDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVV 213
               H++   + +L L++ L+  +I+V +   +++IF+   +           +   Q+ 
Sbjct: 165 EKGGHIILVPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLRKDQL- 223

Query: 214 GNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCP 273
                K+     ++ +E   CAICL++Y DGD+LRILPC H +H  C+D WLT  KK CP
Sbjct: 224 ----KKLPVHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCP 279

Query: 274 ICKRDI 279
           +CK+ +
Sbjct: 280 VCKQKV 285



>gi|15239276|ref|NP_201417.1| receptor homology-transmembrane-ring H2 domain protein 1
           [Arabidopsis thaliana]
 gi|6942147|gb|AAF32325.1|AF218807_1 ReMembR-H2 protein JR700 [Arabidopsis thaliana]
 gi|10177131|dbj|BAB10421.1| ReMembR-H2 protein JR700 [Arabidopsis thaliana]
 gi|14334832|gb|AAK59594.1| putative ReMembR-H2 protein JR700 [Arabidopsis thaliana]
 gi|15293205|gb|AAK93713.1| putative ReMembR-H2 protein JR700 [Arabidopsis thaliana]
 gi|332010784|gb|AED98167.1| receptor homology-transmembrane-ring H2 domain protein 1
           [Arabidopsis thaliana]
          Length = 310

 Score =  114 bits (285), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 86/283 (30%), Positives = 132/283 (46%), Gaps = 34/283 (12%)

Query: 31  ATIVVVATNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQW-- 88
           AT+V+ + + ++ D  A F   +T  G+ G L   + ++     GCS L   A +  W  
Sbjct: 25  ATVVLNSISASFADLPAKFDGSVTKNGICGALYVADPLD-----GCSPLLHAAAS-NWTQ 78

Query: 89  -----IALVERGQCTFIEKVRNMQASGAIAVVVGDNEKN-GLITMYATGDTSDVNIPSVF 142
                 AL+ RG+C+F +K+ N Q SG  AV+V DN  N  LI M    +  D+ + +VF
Sbjct: 79  HRTTKFALIIRGECSFEDKLLNAQNSGFQAVIVYDNIDNEDLIVMKV--NPQDITVDAVF 136

Query: 143 IAQTEYKDLRSSS--------LKPVEVHLVKDNLLQWPLLDV-IIVVILSPTVMMIFIYV 193
           ++    + LR  +        L P       D    W +L +    ++L  T ++I  + 
Sbjct: 137 VSNVAGEILRKYARGRDGECCLNP------PDRGSAWTVLAISFFSLLLIVTFLLIAFFA 190

Query: 194 --LWXXXXXXXXXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILP 251
              W               ++V  L    F +S   +   + CAICLEDY  G+ LR+LP
Sbjct: 191 PRHWTQWRGRHTRTIRLDAKLVHTLPCFTFTDSAHHK-AGETCAICLEDYRFGESLRLLP 249

Query: 252 CKHEFHITCIDSWLTTRKKFCPICKRDICSPTEETPLLSNHEP 294
           C+H FH+ CIDSWLT     CP+CK DI + T  + +     P
Sbjct: 250 CQHAFHLNCIDSWLTKWGTSCPVCKHDIRTETMSSEVHKRESP 292



>gi|511881184|ref|XP_004760488.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 isoform X1 [Mustela
           putorius furo]
 gi|511881186|ref|XP_004760489.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 isoform X2 [Mustela
           putorius furo]
 gi|511972562|ref|XP_004804290.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 isoform X4 [Mustela
           putorius furo]
          Length = 376

 Score =  114 bits (285), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 83/252 (32%), Positives = 120/252 (47%), Gaps = 20/252 (7%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA     CS +    P       +IAL+ 
Sbjct: 60  ASMDFADLPALFGASLSQEGLQGFLV-----EAQPANACSLIAPPPPAPVNGSVFIALLR 114

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 115 RFDCNFDLKVLNAQKAGYGAAVVHNVGSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 174

Query: 152 RSSSL--KPVEVHLVKDNL--LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDI 207
           R+  +  K   V LV DN   L + L+    +V L    M   + V             +
Sbjct: 175 RALFVYEKGARVLLVPDNSFPLGYYLIPFTGIVGLLVLAMGAVMVVRCIQHRKRLQRNRL 234

Query: 208 APQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTT 267
             +Q+      +I     R+ ++   CAICL++Y DGD+LR+LPC H +H  C+D WLT 
Sbjct: 235 TKEQL-----RQIPTHDYRKGDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPWLTQ 289

Query: 268 RKKFCPICKRDI 279
            +K CPICK+ +
Sbjct: 290 TRKTCPICKQPV 301



>gi|511881188|ref|XP_004760490.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 isoform X3 [Mustela
           putorius furo]
 gi|511972564|ref|XP_004804291.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 isoform X5 [Mustela
           putorius furo]
          Length = 350

 Score =  114 bits (285), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 83/252 (32%), Positives = 120/252 (47%), Gaps = 20/252 (7%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA     CS +    P       +IAL+ 
Sbjct: 34  ASMDFADLPALFGASLSQEGLQGFLV-----EAQPANACSLIAPPPPAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFDCNFDLKVLNAQKAGYGAAVVHNVGSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 148

Query: 152 RSSSL--KPVEVHLVKDNL--LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDI 207
           R+  +  K   V LV DN   L + L+    +V L    M   + V             +
Sbjct: 149 RALFVYEKGARVLLVPDNSFPLGYYLIPFTGIVGLLVLAMGAVMVVRCIQHRKRLQRNRL 208

Query: 208 APQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTT 267
             +Q+      +I     R+ ++   CAICL++Y DGD+LR+LPC H +H  C+D WLT 
Sbjct: 209 TKEQL-----RQIPTHDYRKGDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPWLTQ 263

Query: 268 RKKFCPICKRDI 279
            +K CPICK+ +
Sbjct: 264 TRKTCPICKQPV 275



>gi|392565946|gb|EIW59122.1| hypothetical protein TRAVEDRAFT_64333, partial [Trametes versicolor
           FP-101664 SS1]
          Length = 443

 Score =  114 bits (285), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 105/345 (30%), Positives = 149/345 (43%), Gaps = 87/345 (25%)

Query: 24  WS-NFVVDATIVVV--ATNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEA------NNQK 74
           WS  +  D T+ VV  + +VT+  R A+FG  LTD  LLGY++ +    A      +N  
Sbjct: 38  WSWAWASDGTVSVVDRSPSVTFPARPASFGLELTDP-LLGYVIPLSAFTAPCPYDPDNST 96

Query: 75  ------------GCSKL-----KRKAPTEQWIALVERGQCTFIEKVRNMQASGAIAVVVG 117
                       GC +L          T+ WIALV+RG C F+EK R  Q  GA AVVVG
Sbjct: 97  SRRHSFDPDAVFGCPELCTIGNHEPETTDTWIALVQRGGCPFVEKARQAQKLGARAVVVG 156

Query: 118 DNEKN--GLITMYATGDTSDVNIPSVFIAQTEYKDLR---------SSSLKPVEVHLVKD 166
            +  N   L+ M++  D SDV I + +I   +Y  L           S LK + + L  +
Sbjct: 157 GDRDNPDALLNMFSERDASDVTIAATYIKYWDYVQLSHMIAVSNTTHSGLKTLSLLLNTE 216

Query: 167 -NLLQWPLLDVIIVVILSPTVMMIFIYVL-WXXXXXXXXXXDIAPQQVVGNLATKIFFES 224
            +  +W    +  ++IL    ++ FI +L            D AP+ VV NL  + +  +
Sbjct: 217 YSAWEWYSPIITFIIILLLPSLLTFITLLIHRVRAARAAQRDRAPESVVHNLPWREWTGT 276

Query: 225 KRQENEP---------------------------------------QECAICLEDYADGD 245
             +++EP                                        ECAICLE +  GD
Sbjct: 277 GWEKHEPTSDPAEPSSTPDPDLERGPDAPVASTSHDLPLPAWVEEQMECAICLEMFVKGD 336

Query: 246 ELRILPCKHEFHITCIDSWLTTRKKF--------CPICKRDICSP 282
            +R+LPC H FHI  ID WL  +KK         CPICK D+  P
Sbjct: 337 RVRVLPCYHLFHIAEIDEWLIHKKKLHGAHESPQCPICKADVTQP 381



>gi|507698743|ref|XP_004643968.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 [Octodon degus]
          Length = 381

 Score =  114 bits (284), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 75/250 (30%), Positives = 124/250 (49%), Gaps = 22/250 (8%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLK----RKAPTEQWIALVERGQ 96
           T+ D  A FG R   EGL G+L     I +  +  C  +     +   +  +I L+ R  
Sbjct: 47  TFDDLPAKFGYRPPAEGLKGFL-----INSKPENACEPIMPPPVKDNSSATFIVLIRRLD 101

Query: 97  CTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTS---DVNIPSVFIAQTEYKDLRS 153
           C F  KV N Q +G  A +V + +   LI+M  + D      ++IPSVFI ++    L+ 
Sbjct: 102 CNFDIKVLNAQQAGYKAAIVHNVDSEDLISM-GSNDIDVLKKIDIPSVFIGESSANSLKD 160

Query: 154 SSLKPVEVHLV---KDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAP 209
                   H++   + +L L++ L+  +I+V +   +++IF+   +           +  
Sbjct: 161 EFTYEKGGHIILVPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLGK 220

Query: 210 QQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRK 269
            Q+      K+     ++ +E   CAICL++Y DGD+LRILPC H +H  C+D WLT  K
Sbjct: 221 DQL-----KKLPVHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTK 275

Query: 270 KFCPICKRDI 279
           K CP+CK+ +
Sbjct: 276 KTCPVCKQKV 285



>gi|348535847|ref|XP_003455409.1| PREDICTED: E3 ubiquitin-protein ligase RNF13-like [Oreochromis
           niloticus]
          Length = 381

 Score =  114 bits (284), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 75/248 (30%), Positives = 119/248 (47%), Gaps = 19/248 (7%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLK---RKAPTEQWIALVERGQC 97
           T+ D  A FG RL  +GL G+L+      A  +  C  ++   ++  T  +I L++R +C
Sbjct: 47  TFDDLPARFGYRLPSDGLKGFLIG-----ARPENACEPIEPPPKENLTGNFIVLIKRFEC 101

Query: 98  TFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNI------PSVFIAQTEYKDL 151
            F  KV N Q +G  A +V + E + LI M     ++DV+I      PSVF+ +     L
Sbjct: 102 NFDIKVLNAQKAGYKAAIVHNVESDDLIGM----GSNDVDIMKQLVIPSVFVGEETANTL 157

Query: 152 RSSSLKPVEVHLVKDNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQ 211
           +   +     H+V       PL   +I  ++   + +I I V                + 
Sbjct: 158 KEDYMYDKGGHVVLLPDFSLPLEYYLIPFLIIVGICLILIVVFMITKFVQDRHRARRSRL 217

Query: 212 VVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKF 271
               L      + K+ +N    CAICL++Y +GD+LR+LPC H +H  C+D WLT  KK 
Sbjct: 218 RKDQLKKLPIHKYKKGDNY-DVCAICLDEYEEGDKLRVLPCSHAYHSKCVDPWLTKTKKT 276

Query: 272 CPICKRDI 279
           CP+CK+ +
Sbjct: 277 CPVCKQKV 284



>gi|499022509|ref|XP_004562021.1| PREDICTED: E3 ubiquitin-protein ligase RNF13-like [Maylandia zebra]
          Length = 381

 Score =  114 bits (284), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 75/248 (30%), Positives = 119/248 (47%), Gaps = 19/248 (7%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLK---RKAPTEQWIALVERGQC 97
           T+ D  A FG RL  +GL G+L+      A  +  C  ++   ++  T  +I L++R +C
Sbjct: 47  TFDDLPARFGYRLPSDGLKGFLIG-----ARPENACEPIEPPPKENLTGNFIVLIKRFEC 101

Query: 98  TFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNI------PSVFIAQTEYKDL 151
            F  KV N Q +G  A +V + E + LI M     ++DV+I      PSVF+ +     L
Sbjct: 102 NFDIKVLNAQKAGYKAAIVHNVESDDLIGM----GSNDVDIMKQLVIPSVFVGEETANTL 157

Query: 152 RSSSLKPVEVHLVKDNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQ 211
           +   +     H+V       PL   +I  ++   + +I I V                + 
Sbjct: 158 KEDYMYDKGGHVVLLPDFSLPLEYYLIPFLIIVGICLILIVVFMITKFVQDRHRARRSRL 217

Query: 212 VVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKF 271
               L      + K+ +N    CAICL++Y +GD+LR+LPC H +H  C+D WLT  KK 
Sbjct: 218 RKDQLKKLPIHKYKKGDNY-DVCAICLDEYEEGDKLRVLPCSHAYHSKCVDPWLTKTKKT 276

Query: 272 CPICKRDI 279
           CP+CK+ +
Sbjct: 277 CPVCKQKV 284



>gi|56605798|ref|NP_001008362.1| E3 ubiquitin-protein ligase RNF167 precursor [Rattus norvegicus]
 gi|81889873|sp|Q5XIL0.1|RN167_RAT RecName: Full=E3 ubiquitin-protein ligase RNF167; AltName:
           Full=RING finger protein 167; Flags: Precursor
 gi|54035557|gb|AAH83670.1| Ring finger protein 167 [Rattus norvegicus]
 gi|149053216|gb|EDM05033.1| ring finger protein 167, isoform CRA_c [Rattus norvegicus]
          Length = 349

 Score =  113 bits (283), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 84/252 (33%), Positives = 122/252 (48%), Gaps = 20/252 (7%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
            ++ + D  A FG  L+DEGL G+LV     EA+ +  CS +            +IAL+ 
Sbjct: 34  ASMDFADLPALFGATLSDEGLQGFLV-----EAHPENACSPIAPPPSAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSAEYL 148

Query: 152 RSSSL--KPVEVHLVKDNL--LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDI 207
           R+  +  K   V LV DN   L + L+    +V L    M   + V             +
Sbjct: 149 RALFVYEKGARVLLVPDNSFPLGYYLIPFTGIVGLLVLAMGTVLIVRCIQHRKRLQRNRL 208

Query: 208 APQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTT 267
             +Q+      +I     ++ +E   CAICL++Y DGD+LRILPC H +H  C+D WLT 
Sbjct: 209 TKEQL-----KQIPTHDYQKGDEYDVCAICLDEYEDGDKLRILPCAHAYHSRCVDPWLTQ 263

Query: 268 RKKFCPICKRDI 279
            +K CPICK+ +
Sbjct: 264 TRKTCPICKQPV 275



>gi|195454215|ref|XP_002074140.1| GK12779 [Drosophila willistoni]
 gi|194170225|gb|EDW85126.1| GK12779 [Drosophila willistoni]
          Length = 545

 Score =  113 bits (283), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 74/252 (29%), Positives = 129/252 (51%), Gaps = 18/252 (7%)

Query: 43  QDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKA-----PTEQWIALVERG-Q 96
            D  A FG  L   GL  ++V  E     +   C KL +       P  ++++L+ RG  
Sbjct: 43  NDLPAQFGGNLPPNGLKVFVVPAEP----SSFACDKLNKPPRTIYPPNAKFVSLISRGGA 98

Query: 97  CTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLRSSSL 156
           CTF +KVR  Q++G  AV+V +NE + L  M A   T  + IP+VF+  T  K L  +SL
Sbjct: 99  CTFEKKVRVAQSAGYFAVIVYNNEGDDLEQMSADNSTG-IYIPAVFVGHTSGKFL--ASL 155

Query: 157 KPVEVHLVKDNLLQWPLLDVIIV---VILSPTVMMIFIYVLWX-XXXXXXXXXDIAPQQV 212
              ++ ++ ++ L + +   +I+   +++    +++ IY+++              P+ +
Sbjct: 156 VSTDIVVIINDELPFNINTQLILPFSILIGLCFLIMVIYMIYKCIREQRRQRRHRLPKSM 215

Query: 213 VGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFC 272
           +  L   + +      N+   C ICLE++ + D+LR+LPC H +H  CID WLT  ++ C
Sbjct: 216 LKKLPI-LRYTKNSVNNKYDTCVICLEEFVEDDKLRVLPCSHPYHTHCIDPWLTENRRVC 274

Query: 273 PICKRDICSPTE 284
           P+CKR + +  E
Sbjct: 275 PMCKRKVFTKGE 286



>gi|449271045|gb|EMC81660.1| RING finger protein 13 [Columba livia]
          Length = 390

 Score =  113 bits (283), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 78/255 (30%), Positives = 126/255 (49%), Gaps = 23/255 (9%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLK----RKAPTEQWIALVERGQ 96
           T+ D  A FG RL  EGL G+L     I +  +  C  +     R   +  +I L+ R +
Sbjct: 47  TFDDLPARFGYRLPAEGLKGFL-----INSKPENACEPIAPPPLRDNSSSAFIVLIRRLE 101

Query: 97  CTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDT---SDVNIPSVFIAQTEYKDLRS 153
           C F  KV N Q +G  A +V + + + LI+M  + D      ++IPSVFI +     L+ 
Sbjct: 102 CNFDIKVLNAQRAGYKAAIVHNVDSDDLISM-GSNDIEILKKIDIPSVFIGEASANSLKE 160

Query: 154 SSLKPVEVHLV---KDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAP 209
                   H+V   + +L L++ L+  +I+V +   +++IF+   +           +  
Sbjct: 161 EFTYEKGGHVVLIPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARKNRLRK 220

Query: 210 QQVVGNLATKIFFESK-----RQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
            Q+   +    F + +        +E   CAICL++Y DGD+LRILPC H +H  C+D W
Sbjct: 221 DQL-KKIPVHKFKKGEWIILCLSRDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPW 279

Query: 265 LTTRKKFCPICKRDI 279
           LT  KK CP+CK+ +
Sbjct: 280 LTKTKKTCPVCKQKV 294



>gi|507927419|ref|XP_004674965.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 [Condylura cristata]
          Length = 381

 Score =  113 bits (282), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 76/246 (30%), Positives = 127/246 (51%), Gaps = 14/246 (5%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIALVERGQCTFI 100
           T+ D  A FG RL  EGL G+L++ +   A        LK  + +  +I L+ R  C F 
Sbjct: 47  TFDDLPARFGYRLPAEGLKGFLINSKPENACEPIVPPPLKDNS-SGTFIVLIRRLDCNFD 105

Query: 101 EKVRNMQASGAIAVVVGDNEKNGLITMYATGDTS---DVNIPSVFIAQTEYKDLRSSSLK 157
            KV + Q +G  A +V + + + LI+M  + D      ++IPSVFI ++    L+     
Sbjct: 106 IKVLHAQKAGYKAAIVHNVDSDDLISM-GSNDIDVLKKIDIPSVFIGESSANSLKDDFTY 164

Query: 158 PVEVHLV---KDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVV 213
               H++   + +L L++ L+  +I+V +   +++IF+   +           +   Q+ 
Sbjct: 165 DKGGHIILVPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLRKDQL- 223

Query: 214 GNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCP 273
                K+     ++ +E   CAICL++Y DGD+LRILPC H +H  C+D WLT  KK CP
Sbjct: 224 ----KKLPIHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCP 279

Query: 274 ICKRDI 279
           +CK+ +
Sbjct: 280 VCKQKV 285



>gi|213512162|ref|NP_001135282.1| ring finger protein 13 [Salmo salar]
 gi|209155986|gb|ACI34225.1| RING finger protein 13 [Salmo salar]
          Length = 380

 Score =  113 bits (282), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 73/246 (29%), Positives = 116/246 (47%), Gaps = 14/246 (5%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLK----RKAPTEQWIALVERGQ 96
           T+ D  A FG RL  +GL G+L+      A     C  +     R   T  +I L++R  
Sbjct: 47  TFDDLPARFGYRLPSDGLKGFLIG-----ARPANACEPIDPPPIRDNLTGAFIVLIKRFD 101

Query: 97  CTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTS---DVNIPSVFIAQTEYKDLRS 153
           C F  KV N Q +G  + +V + + + LI+M  + D      ++IPSVF+++     L+ 
Sbjct: 102 CNFDIKVLNAQKAGYKSAIVHNVDSDDLISM-GSNDLDILKQIDIPSVFVSEETANSLKE 160

Query: 154 SSLKPVEVHLVKDNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVV 213
                   H+V       PL   +I  +++  + +I I V                +   
Sbjct: 161 DYTYDKGGHVVLMPDFSLPLEYYLIPFLITVGICLILIVVFMITKFVQDRHRARRSRLRK 220

Query: 214 GNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCP 273
             L  K+     ++ +    CAICL++Y DGD+LR+LPC H +H  C+D WLT  KK CP
Sbjct: 221 DQLK-KLPIHKYKKGDVYDVCAICLDEYEDGDQLRVLPCSHAYHSKCVDPWLTKTKKTCP 279

Query: 274 ICKRDI 279
           +CK+ +
Sbjct: 280 VCKQKV 285



>gi|42573810|ref|NP_975001.1| receptor homology-transmembrane-ring H2 domain protein 1
           [Arabidopsis thaliana]
 gi|332010783|gb|AED98166.1| receptor homology-transmembrane-ring H2 domain protein 1
           [Arabidopsis thaliana]
          Length = 290

 Score =  113 bits (282), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 85/278 (30%), Positives = 132/278 (47%), Gaps = 34/278 (12%)

Query: 31  ATIVVVATNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQW-- 88
           AT+V+ + + ++ D  A F   +T  G+ G L   + ++     GCS L   A +  W  
Sbjct: 25  ATVVLNSISASFADLPAKFDGSVTKNGICGALYVADPLD-----GCSPLLHAAAS-NWTQ 78

Query: 89  -----IALVERGQCTFIEKVRNMQASGAIAVVVGDNEKN-GLITMYATGDTSDVNIPSVF 142
                 AL+ RG+C+F +K+ N Q SG  AV+V DN  N  LI M    +  D+ + +VF
Sbjct: 79  HRTTKFALIIRGECSFEDKLLNAQNSGFQAVIVYDNIDNEDLIVMKV--NPQDITVDAVF 136

Query: 143 IAQTEYKDLRSSS--------LKPVEVHLVKDNLLQWPLLDV-IIVVILSPTVMMIFIYV 193
           ++    + LR  +        L P       D    W +L +    ++L  T ++I  + 
Sbjct: 137 VSNVAGEILRKYARGRDGECCLNP------PDRGSAWTVLAISFFSLLLIVTFLLIAFFA 190

Query: 194 --LWXXXXXXXXXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILP 251
              W               ++V  L    F +S   +   + CAICLEDY  G+ LR+LP
Sbjct: 191 PRHWTQWRGRHTRTIRLDAKLVHTLPCFTFTDSAHHK-AGETCAICLEDYRFGESLRLLP 249

Query: 252 CKHEFHITCIDSWLTTRKKFCPICKRDICSPTEETPLL 289
           C+H FH+ CIDSWLT     CP+CK DI + T  + ++
Sbjct: 250 CQHAFHLNCIDSWLTKWGTSCPVCKHDIRTETMSSEVI 287



>gi|482556272|gb|EOA20464.1| hypothetical protein CARUB_v10000777mg, partial [Capsella rubella]
          Length = 503

 Score =  113 bits (282), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 78/274 (28%), Positives = 130/274 (47%), Gaps = 27/274 (9%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIA------L 91
           T++++ D  + F P +      G L   E ++A     CS L          +      L
Sbjct: 86  TSLSFDDIESNFTPMIKRSDQGGVLYVAEPLDA-----CSDLVNTVTVVNGTSVSPPYVL 140

Query: 92  VERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDL 151
           + RG C+F EK+RN+Q +G  A +V D E  G +   A G+ S V I   F+++   + L
Sbjct: 141 IIRGGCSFEEKIRNVQKAGYKAAIVYDYEDYGFLVSMA-GNPSGVLIYGTFVSKATGETL 199

Query: 152 RSSSLKP-VEVHLVKD-NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIA- 208
           +  + +   EV L+       W ++ +  + +L+ + ++   + +            ++ 
Sbjct: 200 KGYAGRTDFEVWLMPSFETSAWSIMAISFISLLAMSAVLATCFFVRRHRVRRRRILSLSG 259

Query: 209 ------PQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCID 262
                  + ++  +   IF     + +    CAIC+EDY  GD+LRILPC H+FH+ C+D
Sbjct: 260 SDFPRMAKNLLRRMPITIFNGVCDEASTSISCAICIEDYRIGDKLRILPCHHKFHVGCVD 319

Query: 263 SWLTTRKKFCPICKRDICS------PTEETPLLS 290
            WL  R+ FCP+CKRD  S       +E TPLLS
Sbjct: 320 LWLGQRRSFCPVCKRDARSISIDMPASEHTPLLS 353



>gi|471371280|ref|XP_004376148.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 [Trichechus manatus
           latirostris]
          Length = 352

 Score =  113 bits (282), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 86/259 (33%), Positives = 125/259 (48%), Gaps = 21/259 (8%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
           T++ + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 34  TSMDFADLPALFGATLSQEGLQGFLV-----EAHPANACSPIAPPPPAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 148

Query: 152 RSSSL--KPVEVHLVKDNL--LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDI 207
           R+  +  K   V LV DN   L + L+    +V L    M   + V             +
Sbjct: 149 RALFVYEKGARVLLVPDNSFPLGYYLIPFTGIVGLLVLAMAAVMVVRCIQHRKRLQRNRL 208

Query: 208 APQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTT 267
             +Q+      +I     ++ ++   CAICL++Y DGD+LR+LPC H +H  C+D WLT 
Sbjct: 209 TKEQL-----KQIPTHEYQKGDQYDVCAICLDEYEDGDKLRVLPCSHAYHSRCVDPWLTQ 263

Query: 268 RKKFCPICKRDIC-SPTEE 285
            +K CPICK+ +   P EE
Sbjct: 264 TRKTCPICKQPVHRGPGEE 282



>gi|465992973|ref|XP_004267040.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 [Orcinus orca]
          Length = 349

 Score =  112 bits (281), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 82/255 (32%), Positives = 124/255 (48%), Gaps = 26/255 (10%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 34  ASMDFADLPALFGAALSQEGLQGFLV-----EAHPDNACSPIAPPPPAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 148

Query: 152 RSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           R+  +  K   V LV DN         P   ++ +++L+   +MI   V           
Sbjct: 149 RALFVYEKGARVLLVPDNSFPLGYYLIPFTGIVGLLVLAMGAVMI---VRCIQHRKRLQR 205

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
             +  +Q+      +I     ++ ++   CAICL++Y DGD+LR+LPC H +HI C+D W
Sbjct: 206 NRLTKEQL-----KQIPTHDYQKGDQYDVCAICLDEYEDGDKLRVLPCAHAYHIRCVDPW 260

Query: 265 LTTRKKFCPICKRDI 279
           LT  +K CPICK+ +
Sbjct: 261 LTQTRKTCPICKQPV 275



>gi|348581670|ref|XP_003476600.1| PREDICTED: E3 ubiquitin-protein ligase RNF13-like [Cavia porcellus]
          Length = 396

 Score =  112 bits (281), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 75/250 (30%), Positives = 124/250 (49%), Gaps = 22/250 (8%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLK----RKAPTEQWIALVERGQ 96
           T+ D  A FG R   EGL G+L     I +  +  C  +     +   +  +I L+ R  
Sbjct: 62  TFDDLPAKFGYRPPAEGLKGFL-----INSKPENACEPIMPPPVKDNSSGTFIVLIRRLD 116

Query: 97  CTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTS---DVNIPSVFIAQTEYKDLRS 153
           C F  KV N Q +G  A +V + +   LI+M  + D      ++IPSVFI ++    L+ 
Sbjct: 117 CNFDIKVLNAQRAGYKAAIVHNVDSEDLISM-GSNDIDVLKKIDIPSVFIGESSANSLKD 175

Query: 154 SSLKPVEVHLV---KDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAP 209
                   H++   + +L L++ L+  +I+V +   +++IF+   +           +  
Sbjct: 176 EFTYEKGGHIILVPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLGK 235

Query: 210 QQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRK 269
            Q+      K+     ++ +E   CAICL++Y DGD+LRILPC H +H  C+D WLT  K
Sbjct: 236 DQL-----KKLPVHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTK 290

Query: 270 KFCPICKRDI 279
           K CP+CK+ +
Sbjct: 291 KTCPVCKQKV 300



>gi|507704770|ref|XP_004716190.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 [Echinops telfairi]
          Length = 349

 Score =  112 bits (281), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 83/262 (31%), Positives = 125/262 (47%), Gaps = 27/262 (10%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 34  ASMDFADLPARFGASLSQEGLQGFLV-----EAHPANACSPIAPPPPAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFNCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 148

Query: 152 RSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           R+  +  K   V LV DN         P   ++ +++L+   +MI   V           
Sbjct: 149 RALFVYEKGARVLLVPDNTFPLGYYLIPFTGIVGLLVLAMGAVMIVRCV--------QHR 200

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
             +   ++      +I     ++ ++   CAICL++Y DGD+LR+LPC H +H  C+D W
Sbjct: 201 KRLQRNRLTKEQLKQIPTHDYQKGDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPW 260

Query: 265 LTTRKKFCPICKRDIC-SPTEE 285
           LT  +K CPICK+ +   P EE
Sbjct: 261 LTQTRKTCPICKQPVHRGPGEE 282



>gi|116283986|gb|AAH17878.1| RNF13 protein [Homo sapiens]
          Length = 291

 Score =  112 bits (281), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 76/246 (30%), Positives = 123/246 (50%), Gaps = 22/246 (8%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLK----RKAPTEQWIALVERGQ 96
           T+ D  A FG RL  EGL G+L     I +  +  C  +     +   +  +I L+ R  
Sbjct: 47  TFDDLPARFGYRLPAEGLKGFL-----INSKPENACEPIVPPPVKDNSSGTFIVLIRRLD 101

Query: 97  CTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDT---SDVNIPSVFIAQTEYKDLRS 153
           C F  KV N Q +G  A +V + + + LI+M  + D      ++IPSVFI ++    L+ 
Sbjct: 102 CNFDIKVLNAQRAGYKAAIVHNVDSDDLISM-GSNDIEVLKKIDIPSVFIGESSANSLKD 160

Query: 154 SSLKPVEVHLV---KDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAP 209
                   HL+   + +L L++ L+  +I+V +   +++IF+   +           +  
Sbjct: 161 EFTYEKGGHLILVPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLRK 220

Query: 210 QQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRK 269
            Q+      K+     ++ +E   CAICL++Y DGD+LRILPC H +H  C+D WLT  K
Sbjct: 221 DQL-----KKLPVHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTK 275

Query: 270 KFCPIC 275
           K CP+C
Sbjct: 276 KTCPVC 281



>gi|42562538|ref|NP_174800.2| protease-associated and C3HC4-type RING finger domain-containing
           protein [Arabidopsis thaliana]
 gi|332193699|gb|AEE31820.1| protease-associated and C3HC4-type RING finger domain-containing
           protein [Arabidopsis thaliana]
          Length = 318

 Score =  112 bits (281), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 75/287 (26%), Positives = 144/287 (50%), Gaps = 23/287 (8%)

Query: 28  VVDATIVVVATN--VTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT 85
           +  A +V++  N  +++ D  A F P + + G  G L   E +EA +       KR    
Sbjct: 17  LASAKVVLIGKNTILSFDDVEATFTPIVRNSGECGILYVAEPLEACSDITNMAEKRSKYR 76

Query: 86  EQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQ 145
             ++ L+  G C+F EKVR  Q +G  A +V ++  + L+   A G++S V+I  + + +
Sbjct: 77  SSYV-LIVLGGCSFEEKVRKAQKAGYKAAIVYNDGYDELLVPMA-GNSSGVDIHGLLVTR 134

Query: 146 TEYKDLRS-SSLKPVEVHLVKD-NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXX 203
              + L+  +    +++ L+    +  W ++ +  + +L+ + ++   +V+         
Sbjct: 135 ASGEVLKGYADQDEMKLWLIPGFGISSWSIMGITFISLLAMSAILATCFVVRRHQIRQSV 194

Query: 204 X--------XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHE 255
                        P+ ++ ++ T+++     + +    CAIC++DY  G++LRILPCKH+
Sbjct: 195 RDLPHGGQGLSCMPRDLLQSMPTEVYSGVLEESSTSVTCAICIDDYCVGEKLRILPCKHK 254

Query: 256 FHITCIDSWLTTRKKFCPICKR------DICSPTEETPLLSNHEPTP 296
           +H  CIDSWL   + FCP+CK+      D+   +E TPL+S   P+P
Sbjct: 255 YHAVCIDSWLGRCRSFCPVCKQNPRTGNDVPPASETTPLIS---PSP 298



>gi|507670860|ref|XP_004708697.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 [Echinops telfairi]
          Length = 408

 Score =  112 bits (281), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 127/246 (51%), Gaps = 14/246 (5%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIALVERGQCTFI 100
           T++D  A FG RL  EGL G+L++ +   A        LK  + +  +I L+ R  C F 
Sbjct: 78  TFEDLPARFGYRLPAEGLKGFLINSKPENACEPIVPPPLKDNS-SGTFIVLIRRLDCNFD 136

Query: 101 EKVRNMQASGAIAVVVGDNEKNGLITMYATGDTS---DVNIPSVFIAQTEYKDLRSSSLK 157
            KV N Q +G  A +V + +   LI+M  + D      ++IPSVFI ++    L+   + 
Sbjct: 137 VKVLNAQRAGFKAAIVHNVDSQDLISM-GSNDLDVLKKIDIPSVFIGESSANSLKDEFIY 195

Query: 158 PVEVHLV---KDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVV 213
               H++   +  L L++ L+  +I+V +   +++IF+   +           +   Q+ 
Sbjct: 196 EKGGHIILVPEFTLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLRKDQL- 254

Query: 214 GNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCP 273
                K+     ++ +E   CAICL++Y +GD+LRILPC H +H  C+D WLT  +K CP
Sbjct: 255 ----KKLPIHKFKKGDEYDVCAICLDEYEEGDKLRILPCSHAYHCKCVDPWLTKTRKTCP 310

Query: 274 ICKRDI 279
           +CK+ +
Sbjct: 311 VCKQKV 316



>gi|478489879|ref|XP_004419314.1| PREDICTED: E3 ubiquitin-protein ligase RNF13 [Ceratotherium simum
           simum]
          Length = 381

 Score =  112 bits (281), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 76/246 (30%), Positives = 126/246 (51%), Gaps = 14/246 (5%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIALVERGQCTFI 100
           T+ D  A FG R   EGL G+L++ +   A        LK  + +  +I L+ R  C F 
Sbjct: 47  TFDDLPARFGYRPPAEGLKGFLINSKPENACEPIVPPPLKDNS-SATFIVLIRRLDCNFD 105

Query: 101 EKVRNMQASGAIAVVVGDNEKNGLITMYATGDTS---DVNIPSVFIAQTEYKDLRSSSLK 157
            KV N Q +G  A +V + + + LI+M  + D      ++IPSVFI ++    L+     
Sbjct: 106 VKVLNAQRAGYKAAIVHNVDSDDLISM-GSNDIDVLKKIDIPSVFIGESSANSLKDEFTY 164

Query: 158 PVEVHLV---KDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVV 213
               H++   + +L L++ L+  +I+V +   +++IF+   +           +   Q+ 
Sbjct: 165 EKGGHIILVPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLRKDQL- 223

Query: 214 GNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCP 273
                K+     ++ +E   CAICL++Y DGD+LRILPC H +H  C+D WLT  KK CP
Sbjct: 224 ----KKLPIHKFKKGDEYDVCAICLDEYEDGDKLRILPCSHAYHCKCVDPWLTKTKKTCP 279

Query: 274 ICKRDI 279
           +CK+ +
Sbjct: 280 VCKQKV 285



>gi|344290093|ref|XP_003416773.1| PREDICTED: E3 ubiquitin-protein ligase RNF167-like [Loxodonta
           africana]
          Length = 349

 Score =  112 bits (281), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 80/255 (31%), Positives = 123/255 (48%), Gaps = 26/255 (10%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
           T++ + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 34  TSMDFADLPALFGAALSQEGLQGFLV-----EAHPANACSPIAPPPPAPVNGSIFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 148

Query: 152 RSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           R+  +  K   V LV DN         P   ++ +++L+   +MI   +           
Sbjct: 149 RALFVYEKGARVLLVPDNTFPLGYYLIPFTGIVGLLVLAMGAVMIVRCI--------QHR 200

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
             +   ++      +I     ++ ++   CAICL++Y DGD+LR+LPC H +H  C+D W
Sbjct: 201 KRLQRNRLTKEQLKQIPTHDYQKGDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPW 260

Query: 265 LTTRKKFCPICKRDI 279
           LT  +K CPICK+ +
Sbjct: 261 LTQTRKTCPICKQPV 275



>gi|444722982|gb|ELW63654.1| E3 ubiquitin-protein ligase RNF167 [Tupaia chinensis]
          Length = 320

 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 82/263 (31%), Positives = 125/263 (47%), Gaps = 30/263 (11%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
           T + + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 34  TTMDFADLPALFGATLSQEGLQGFLV-----EAHPDNACSPIAPPPPAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 148

Query: 152 RSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           R+  +  K  +V LV DN         P   ++ +++L+   +MI   +           
Sbjct: 149 RALFVYEKGAQVLLVPDNSFPLGYYLIPFTGIVGLLVLAMGAVMIVRCI--------QHR 200

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
             +   ++      +I     ++ ++   CAICL++Y DGD+LR+LPC H +H  C+D W
Sbjct: 201 KRLQRNRLTKEQLKQIPTHDYQKGDQYDVCAICLDEYEDGDKLRVLPCTHAYHCRCVDPW 260

Query: 265 LTTRKKFCPICKRDICSPTEETP 287
           LT  +K CPICK+    P   +P
Sbjct: 261 LTQTRKTCPICKQ----PVHRSP 279



>gi|508698927|gb|EOX90823.1| Receptor region transmembrane domain ring H2 motif protein 1,
           putative isoform 1 [Theobroma cacao]
          Length = 288

 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 78/276 (28%), Positives = 139/276 (50%), Gaps = 45/276 (16%)

Query: 28  VVDATIVVVATNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQ 87
           +  +T+V+   ++++ D  A F   + + G+ G L   + ++A     C+ L+ +  + +
Sbjct: 19  LASSTVVLKPFSLSFTDLPAKFARGMNNSGVCGALEVADPLDA-----CTPLRNEFSSNR 73

Query: 88  W----IALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFI 143
                +AL+ RG C+F EK+RN Q  G  A +V D ++NG   +Y   +   + + +VF+
Sbjct: 74  TDPVKLALIIRGDCSFEEKIRNAQRGGFSAAIVYD-DRNGGNLVYMMMNPKGIEVQAVFV 132

Query: 144 AQTE---YKDLRSSSLKPVEVHLVKDNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXX 200
           +++     KD     +    ++  + N   W    V  +  LS  V+ +F+ + +     
Sbjct: 133 SKSAGEFLKDHAKGEMGECCIY-AQQNGRAWT---VFAICFLSLVVIAVFLVIAF----- 183

Query: 201 XXXXXDIAPQQV--------VGNLATKIF-------FESKR--QENEPQECAICLEDYAD 243
                 IAP+ +        V ++ TK+        F S R  Q    + CAICLEDY D
Sbjct: 184 ------IAPRSLSNWRGRNSVRSVDTKMVEALPRVTFSSARLSQCCTGETCAICLEDYED 237

Query: 244 GDELRILPCKHEFHITCIDSWLTTRKKFCPICKRDI 279
           G+ L++LPC+H+FH +C++SWLT    FCP+CK D+
Sbjct: 238 GEILKVLPCQHDFHSSCVESWLTKWGTFCPVCKLDM 273



>gi|499026378|ref|XP_004563932.1| PREDICTED: E3 ubiquitin-protein ligase RNF167-like isoform X1
           [Maylandia zebra]
 gi|499026380|ref|XP_004563933.1| PREDICTED: E3 ubiquitin-protein ligase RNF167-like isoform X2
           [Maylandia zebra]
 gi|499026382|ref|XP_004563934.1| PREDICTED: E3 ubiquitin-protein ligase RNF167-like isoform X3
           [Maylandia zebra]
 gi|499026384|ref|XP_004563935.1| PREDICTED: E3 ubiquitin-protein ligase RNF167-like isoform X4
           [Maylandia zebra]
          Length = 397

 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 77/261 (29%), Positives = 124/261 (47%), Gaps = 16/261 (6%)

Query: 30  DATIVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEAN---NQKGCSKLKRKAP 84
           DA I    +N+T  + DRIA FG  L  +G++G LV+     A    +          A 
Sbjct: 30  DAYIYAHYSNITKTFDDRIALFGSALPKDGIMGVLVASHPANACTTIDPPPPLPPSFNAT 89

Query: 85  TEQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDT--SDVNIPSVF 142
           T +++ L++R  C F  KV N Q +G  A +V +     L+ M  + +T    +NIPSVF
Sbjct: 90  TTKFVVLIKRYDCNFDIKVLNAQQAGYDAAIVHNIYSEILLNMNYSNETIAEQINIPSVF 149

Query: 143 IAQTEYKDLRSSSLKPVEVHLVKDNLLQWPLLDVII----VVILSPTVMMIFIYVLWXXX 198
            +      LR+  +     +++      +PL   +I    VV L   VM +         
Sbjct: 150 ASYYASHILRNYIIPEQGAYVILKPDFPFPLSYYLIPFTGVVCLIILVMSVVFITRCVQY 209

Query: 199 XXXXXXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHI 258
                   ++ +Q+      +I      + ++   CAICL++Y +GD+LR+LPC H +H 
Sbjct: 210 RKRLRKNRLSKEQL-----KRIPIHKFSKGDDYDVCAICLDEYEEGDKLRVLPCSHAYHC 264

Query: 259 TCIDSWLTTRKKFCPICKRDI 279
            C+D WLT  KK CP+CK+ +
Sbjct: 265 KCVDPWLTQTKKTCPVCKQRV 285



>gi|470623922|ref|XP_004319545.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 [Tursiops truncatus]
          Length = 314

 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 82/251 (32%), Positives = 122/251 (48%), Gaps = 26/251 (10%)

Query: 42  YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVERGQC 97
           + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ R  C
Sbjct: 3   FADLPALFGAALSQEGLQGFLV-----EAHPDNACSPIAPPPPAPVNGSVFIALLRRFDC 57

Query: 98  TFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDLRSSS 155
            F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + LR+  
Sbjct: 58  NFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYLRALF 117

Query: 156 L--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIA 208
           +  K   V LV DN         P   ++ +++L+   +MI   V             + 
Sbjct: 118 VYEKGARVLLVPDNSFPLGYYLIPFTGIVGLLVLAMGAVMI---VRCIQHRKRLQRNRLT 174

Query: 209 PQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTR 268
            +Q+      +I     ++ ++   CAICL++Y DGD+LR+LPC H +HI C+D WLT  
Sbjct: 175 KEQL-----KQIPTHDYQKGDQYDVCAICLDEYEDGDKLRVLPCAHAYHIRCVDPWLTQT 229

Query: 269 KKFCPICKRDI 279
           +K CPICK+ +
Sbjct: 230 RKTCPICKQPV 240



>gi|488510401|ref|XP_004447288.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 isoform 3 [Dasypus
           novemcinctus]
 gi|488510403|ref|XP_004447289.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 isoform 4 [Dasypus
           novemcinctus]
          Length = 352

 Score =  112 bits (279), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 79/255 (30%), Positives = 123/255 (48%), Gaps = 26/255 (10%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 34  ASMDFADLPALFGATLSQEGLQGFLV-----EAHPANACSPIAPPPPAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFDCNFDLKVLNAQKAGYAAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 148

Query: 152 RSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           R+  +  K  +V LV DN         P   ++ +++L+   +MI   +           
Sbjct: 149 RALFIYEKGAQVLLVPDNSFPLGYYLIPFTGIVGLLVLAMGAVMIVRCI--------QHQ 200

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
             +   ++      +I     ++ ++   CAICL++Y DGD+LR+LPC H +H  C+D W
Sbjct: 201 KRLQRNRLTKEQLKQIPTHDYQKGDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPW 260

Query: 265 LTTRKKFCPICKRDI 279
           LT  +K CPICK+ +
Sbjct: 261 LTQTRKTCPICKQPV 275



>gi|507616467|ref|XP_004623701.1| PREDICTED: E3 ubiquitin-protein ligase RNF13-like [Octodon degus]
          Length = 381

 Score =  112 bits (279), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 74/250 (29%), Positives = 124/250 (49%), Gaps = 22/250 (8%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLK----RKAPTEQWIALVERGQ 96
           T+ D  A FG R   EGL G+L     I +  +  C  +     +   +  +I L+ R  
Sbjct: 47  TFDDLPAKFGYRPPAEGLKGFL-----INSKPENACEPIMPPPVKDNSSATFIVLIRRLD 101

Query: 97  CTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTS---DVNIPSVFIAQTEYKDLRS 153
           C F  KV N Q +G  A +V + +   LI+M  + D      ++IPSVFI ++    L+ 
Sbjct: 102 CNFDIKVLNAQQAGYKAAIVHNVDSEDLISM-GSNDIDVLKKIDIPSVFIGESSANSLKD 160

Query: 154 SSLKPVEVHLV---KDNL-LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAP 209
                   H++   + +L L++ L+  +I+V +   +++IF+   +           +  
Sbjct: 161 EFTYEKGGHIILVPEFSLPLEYYLIPFLIIVGICLILIVIFMITKFVQDRHRARRNRLGK 220

Query: 210 QQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRK 269
            Q+      K+     ++ +E   CAICL++Y DG++LRILPC H +H  C+D WLT  K
Sbjct: 221 DQL-----KKLPVHKFKKGDEYDVCAICLDEYEDGEKLRILPCSHAYHCKCVDPWLTKTK 275

Query: 270 KFCPICKRDI 279
           K CP+CK+ +
Sbjct: 276 KTCPVCKQKV 285



>gi|157167913|ref|XP_001662900.1| zinc finger protein [Aedes aegypti]
 gi|108881517|gb|EAT45742.1| AAEL003009-PA [Aedes aegypti]
          Length = 593

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 73/252 (28%), Positives = 121/252 (48%), Gaps = 17/252 (6%)

Query: 42  YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTE---------QWIALV 92
           ++D  A FG  + + G     + V  + A    GCS++    P E         ++  ++
Sbjct: 62  FRDFPATFGGDIPESG-----IKVRAVRAVPYDGCSEMV--GPPENVTAIGVPVRFAVII 114

Query: 93  ERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLR 152
            R  C+F EKVRN Q +G +AV+V +   N L  M A     D+ IPSVFI ++    + 
Sbjct: 115 ARYNCSFEEKVRNAQRAGYVAVIVHNVGSNDLERMSAN-HAEDIVIPSVFIGESNGVYII 173

Query: 153 SSSLKPVEVHLVKDNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQV 212
            S L P+   L+  + + + + + +I+       +   I V +           +   ++
Sbjct: 174 ESFLYPLPYALIITDDIPFNINNNLIIPFAIVVGLCFIIMVCFMIIRCIRERRRMMRHRL 233

Query: 213 VGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFC 272
             ++  KI      +  +   CAICL+DY D + LR+LPC H +H+ CID WLT  ++ C
Sbjct: 234 PNSVLRKIPIVKFAKGMQYDTCAICLDDYVDNERLRVLPCHHAYHVKCIDPWLTKNRRVC 293

Query: 273 PICKRDICSPTE 284
           PICKR + +  E
Sbjct: 294 PICKRKVLARGE 305



>gi|507674127|ref|XP_004638392.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 isoform X1 [Octodon
           degus]
          Length = 347

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 82/255 (32%), Positives = 124/255 (48%), Gaps = 26/255 (10%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+ +  CS +    P       +IAL+ 
Sbjct: 34  ASMDFADLPALFGATLSQEGLQGFLV-----EAHPENACSPIAPPPPAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSAEYL 148

Query: 152 RSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           R+  +  K   V LV DN         P   ++ +++L+   +MI   V           
Sbjct: 149 RALFVYEKGARVLLVPDNSFPLGYYLIPFTGIVGLLVLAMGAVMI---VRCIQHRKRLQR 205

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
             +  +Q+      +I     ++ ++   CAICL++Y DGD+LRILPC H +H  C+D W
Sbjct: 206 NRLTKEQL-----KQIPTHDYQKGDQYDVCAICLDEYEDGDKLRILPCAHAYHSHCVDPW 260

Query: 265 LTTRKKFCPICKRDI 279
           LT  +K CPICK+ +
Sbjct: 261 LTQTRKTCPICKQPV 275



>gi|504170640|ref|XP_004594911.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 [Ochotona princeps]
          Length = 350

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 79/255 (30%), Positives = 123/255 (48%), Gaps = 26/255 (10%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQ----WIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 34  ASMDFADLPALFGATLSQEGLQGFLV-----EAHPDNACSPIAPPPPAPANGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 148

Query: 152 RSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           R+  +  K  +V LV DN         P   ++ +++L+   +MI   +           
Sbjct: 149 RTLFVYEKGAQVLLVPDNSFPLGYYLIPFTGIVGLLVLAMGAVMIVRCI--------QHR 200

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
             +   ++      +I     ++ ++   CAICL++Y DGD+LR+LPC H +H  C+D W
Sbjct: 201 KRLQRNRLTKEQLKQIPTHDYQKGDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPW 260

Query: 265 LTTRKKFCPICKRDI 279
           LT  +K CPICK+ +
Sbjct: 261 LTQTRKTCPICKQPV 275



>gi|403279778|ref|XP_003931422.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 [Saimiri boliviensis
           boliviensis]
          Length = 350

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 82/255 (32%), Positives = 123/255 (48%), Gaps = 26/255 (10%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 34  ASMDFADLPALFGATLSQEGLQGFLV-----EAHPDNACSPIAPPPPAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RYDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 148

Query: 152 RSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           R+  +  K   V LV DN         P   ++ +++L+   +MI   V           
Sbjct: 149 RALFVYEKGARVLLVPDNTFPLGYYLIPFTGIVGLLVLAMGAVMI---VRCIQHRKRLQR 205

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
             +  +Q+      +I     ++ ++   CAICL++Y DGD+LRILPC H +H  C+D W
Sbjct: 206 NRLTKEQL-----KQIPTHDYQKGDQYDVCAICLDEYEDGDKLRILPCAHAYHSRCVDPW 260

Query: 265 LTTRKKFCPICKRDI 279
           LT  +K CPICK+ +
Sbjct: 261 LTQTRKTCPICKQPV 275



>gi|297271673|ref|XP_001099111.2| PREDICTED: e3 ubiquitin-protein ligase RNF167-like isoform 13
           [Macaca mulatta]
          Length = 349

 Score =  111 bits (278), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 82/255 (32%), Positives = 122/255 (47%), Gaps = 27/255 (10%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 34  ASMDFADLPALFGATLSQEGLQGFLV-----EAHPDNACSPIAPPPPAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 148

Query: 152 RSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           R+  +  K   V LV DN         P   ++ +++L+   +MI   V           
Sbjct: 149 RALFVYEKGARVLLVPDNTFPLGYYLIPFTGIVGLLVLAMGAVMI---VRCIQHRKRLQR 205

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
             +  +Q+      K       Q+++   CAICL++Y DGD+LR+LPC H +H  C+D W
Sbjct: 206 NRLTKEQL------KQIPTHDYQKDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPW 259

Query: 265 LTTRKKFCPICKRDI 279
           LT  +K CPICK+ +
Sbjct: 260 LTQTRKTCPICKQPV 274



>gi|470320334|ref|XP_004348782.1| hypothetical protein CAOG_02032 [Capsaspora owczarzaki ATCC 30864]
 gi|320167108|gb|EFW44007.1| hypothetical protein CAOG_02032 [Capsaspora owczarzaki ATCC 30864]
          Length = 346

 Score =  111 bits (277), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 80/244 (32%), Positives = 122/244 (50%), Gaps = 31/244 (12%)

Query: 74  KGCSKLKRKAP-TEQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD 132
           +GCS +K  A  T  W  LV+RG C+F  K    Q +GA AV++ D+    LI M   G 
Sbjct: 76  RGCSPIKPPANFTGSWAVLVQRGNCSFSAKAFAAQRAGAAAVIIFDDVDEDLIEM---GG 132

Query: 133 TSDVNIPSVFIAQ------TEYKDLRSSSLKPVEVHLVKDNLLQWPLLDVIIVVILSPTV 186
            SDV I +VFI++       EY + + S+   V +    D    WP   +  ++++  T 
Sbjct: 133 DSDVAIVAVFISRDDGELLQEYAEQQGST---VTIWQNDDIFGVWPTFVLPFMIMMLVTA 189

Query: 187 MMIFIYVLWXXXXXXXXXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDE 246
            +  +Y+++           + P+ +   + T+ +  S  Q+ EP  CA+C+E++A G+ 
Sbjct: 190 SIYGVYLVYRHRRMLRANRMLEPEVIT--IPTRPYKMSADQQ-EPDTCAVCIEEFAVGEN 246

Query: 247 LRILPCKHEFHITCIDSWLTTRKKFCPICKRD----------ICSPT-----EETPLLSN 291
           LR+LPC H FH  CI  WLT ++  CPICKRD          + +PT     E TPLL  
Sbjct: 247 LRVLPCNHLFHDACIVPWLTQQRSTCPICKRDVRTGRSSGAGVSTPTVMVAGERTPLLRG 306

Query: 292 HEPT 295
              T
Sbjct: 307 STST 310



>gi|350423449|ref|XP_003493486.1| PREDICTED: E3 ubiquitin-protein ligase RNF13-like [Bombus
           impatiens]
          Length = 450

 Score =  111 bits (277), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 79/253 (31%), Positives = 125/253 (49%), Gaps = 21/253 (8%)

Query: 42  YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQ----WIALVERGQC 97
           ++D  A FG  +  EG+ G +V  E   A     C +++    T      W+ L+ R  C
Sbjct: 43  FRDIPARFGGLIPSEGIKGMVVYAEPPTA-----CHEIQGPPNTTNYNGNWVILIARYNC 97

Query: 98  TFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLRSSSL- 156
           +F  K+R  Q +G  AV++ +   N L  M A  D   + IPSVF+++     ++ + L 
Sbjct: 98  SFERKIRMAQKAGYDAVIIHNVNSNKLEPMQAR-DPVGILIPSVFVSEITGLIIKENYLY 156

Query: 157 KPVEVHLVKDNL---LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVV 213
             +   L+ D+    +   LL   IVV +   VM+IF+ V             +      
Sbjct: 157 DELYFVLINDDTPFNITHLLLPFAIVVGICFLVMVIFMIVRCIKDRRRQRRHRLP----- 211

Query: 214 GNLATKIFFESKRQENEPQE-CAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFC 272
            N + K     K  + +P E CAICL+DYA+G++LR+LPC H +H  CID WLT  ++ C
Sbjct: 212 -NSSLKKIPTHKYTKGDPYETCAICLDDYAEGEKLRVLPCAHAYHTKCIDPWLTKNRRVC 270

Query: 273 PICKRDICSPTEE 285
           P+CKR + +  E+
Sbjct: 271 PVCKRKVFAADEQ 283



>gi|297797773|ref|XP_002866771.1| hypothetical protein ARALYDRAFT_497000 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297312606|gb|EFH43030.1| hypothetical protein ARALYDRAFT_497000 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 308

 Score =  111 bits (277), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 84/266 (31%), Positives = 130/266 (48%), Gaps = 22/266 (8%)

Query: 31  ATIVVVATNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQW-- 88
           AT+V+ + + ++ D  A F   +T  G+ G L   + ++     GCS L   A +  W  
Sbjct: 25  ATVVLNSISASFADLPAKFDGSVTKNGICGALYVADPLD-----GCSPLLHAAAS-NWTQ 78

Query: 89  -----IALVERGQCTFIEKVRNMQASGAIAVVVGDNEKN-GLITMYATGDTSDVNIPSVF 142
                 AL+ RG+C+F +K+ N Q SG  AV+V DN  N  LI M    +  D+ + +VF
Sbjct: 79  QSTTKFALIIRGECSFEDKLLNAQNSGFQAVIVYDNIDNEDLIVMKV--NPQDITVDAVF 136

Query: 143 IAQTEYKDLRSSSL-KPVEVHLVK-DNLLQWPLLDV-IIVVILSPTVMMIFIYV--LWXX 197
           ++    + LR  +  +  E  L        W +L +    ++L  T ++I  +    W  
Sbjct: 137 VSNVAGEILRKYARGRDGECCLYPPTKGSAWTVLAISFFSLLLIVTFLLIAFFAPRHWTQ 196

Query: 198 XXXXXXXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFH 257
                        ++V  L    F +S   +   + CAICLEDY  G+ LR+LPC+H FH
Sbjct: 197 WRGRHNRTIRLDAKLVHTLPCFTFTDSAHHK-AGETCAICLEDYRFGESLRLLPCQHAFH 255

Query: 258 ITCIDSWLTTRKKFCPICKRDICSPT 283
           ++CIDSWLT     CP+CK DI + T
Sbjct: 256 LSCIDSWLTKWGTSCPVCKHDIRTET 281



>gi|302564261|ref|NP_001181030.1| E3 ubiquitin-protein ligase RNF167 [Macaca mulatta]
 gi|109112890|ref|XP_001098005.1| PREDICTED: e3 ubiquitin-protein ligase RNF167-like isoform 4
           [Macaca mulatta]
          Length = 350

 Score =  111 bits (277), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 81/255 (31%), Positives = 123/255 (48%), Gaps = 26/255 (10%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 34  ASMDFADLPALFGATLSQEGLQGFLV-----EAHPDNACSPIAPPPPAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 148

Query: 152 RSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           R+  +  K   V LV DN         P   ++ +++L+   +MI   V           
Sbjct: 149 RALFVYEKGARVLLVPDNTFPLGYYLIPFTGIVGLLVLAMGAVMI---VRCIQHRKRLQR 205

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
             +  +Q+      +I     ++ ++   CAICL++Y DGD+LR+LPC H +H  C+D W
Sbjct: 206 NRLTKEQL-----KQIPTHDYQKGDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPW 260

Query: 265 LTTRKKFCPICKRDI 279
           LT  +K CPICK+ +
Sbjct: 261 LTQTRKTCPICKQPV 275



>gi|347967041|ref|XP_321026.4| AGAP002028-PA [Anopheles gambiae str. PEST]
 gi|333469786|gb|EAA01411.4| AGAP002028-PA [Anopheles gambiae str. PEST]
          Length = 615

 Score =  111 bits (277), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 76/245 (31%), Positives = 122/245 (49%), Gaps = 19/245 (7%)

Query: 42  YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAP--TEQWIALVERGQCTF 99
           ++D  A FG  + D GL      V    A+   GC+++ R AP  T ++  ++ R  C+F
Sbjct: 71  FRDLPATFGGEIPDSGL-----KVLADRADPPDGCTEM-RPAPNITSKFAVVIARYNCSF 124

Query: 100 IEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLRSSSLKPV 159
             KVRN Q +G   V+V +   N L  M A     D+ IPSVF+ ++  + +  + L   
Sbjct: 125 EVKVRNAQQAGYAMVIVHNVGSNDLEHMSAN-HPQDLLIPSVFVGESAGRSIIEAYLYDH 183

Query: 160 EVHLVKD-----NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVVG 214
           +  LV       N+    ++   IVV L   +M++F+ +             + P +V+ 
Sbjct: 184 DYALVITDDIPFNISNNLIIPFAIVVGLCFIIMVLFMIIRCIRERRRRMRHRL-PARVLR 242

Query: 215 NLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCPI 274
            +    F +  R +     CAICLED+ + + LR+LPC+H +H  CID WLT  ++ CPI
Sbjct: 243 KIGIVKFAKGMRFDT----CAICLEDFVENERLRVLPCRHAYHAICIDPWLTKNRRVCPI 298

Query: 275 CKRDI 279
           CKR +
Sbjct: 299 CKRRV 303



>gi|355568125|gb|EHH24406.1| E3 ubiquitin-protein ligase RNF167 [Macaca mulatta]
 gi|355753650|gb|EHH57615.1| E3 ubiquitin-protein ligase RNF167 [Macaca fascicularis]
          Length = 350

 Score =  111 bits (277), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 81/255 (31%), Positives = 123/255 (48%), Gaps = 26/255 (10%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 34  ASMDFADLPALFGATLSQEGLQGFLV-----EAHPDNACSPIAPPPPAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 148

Query: 152 RSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           R+  +  K   V LV DN         P   ++ +++L+   +MI   V           
Sbjct: 149 RALFVYEKGARVLLVPDNTFPLGYYLIPFTGIVGLLVLAMGAVMI---VRCIQHRKRLQR 205

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
             +  +Q+      +I     ++ ++   CAICL++Y DGD+LR+LPC H +H  C+D W
Sbjct: 206 NRLTKEQL-----KQIPTHDYQKGDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPW 260

Query: 265 LTTRKKFCPICKRDI 279
           LT  +K CPICK+ +
Sbjct: 261 LTQTRKTCPICKQPV 275



>gi|507674133|ref|XP_004638393.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 isoform X2 [Octodon
           degus]
          Length = 311

 Score =  111 bits (277), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 83/253 (32%), Positives = 122/253 (48%), Gaps = 27/253 (10%)

Query: 40  VTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVERG 95
           + + D  A FG  L+ EGL G+LV     EA+ +  CS +    P       +IAL+ R 
Sbjct: 1   MDFADLPALFGATLSQEGLQGFLV-----EAHPENACSPIAPPPPAPVNGSVFIALLRRF 55

Query: 96  QCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDLRS 153
            C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + LR+
Sbjct: 56  DCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSAEYLRA 115

Query: 154 SSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXD 206
             +  K   V LV DN         P   ++ +++L+   +MI   V             
Sbjct: 116 LFVYEKGARVLLVPDNSFPLGYYLIPFTGIVGLLVLAMGAVMI---VRCIQHRKRLQRNR 172

Query: 207 IAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLT 266
           +  +Q+      K       Q+++   CAICL++Y DGD+LRILPC H +H  C+D WLT
Sbjct: 173 LTKEQL------KQIPTHDYQKDQYDVCAICLDEYEDGDKLRILPCAHAYHSHCVDPWLT 226

Query: 267 TRKKFCPICKRDI 279
             +K CPICK+ +
Sbjct: 227 QTRKTCPICKQPV 239



>gi|441662317|ref|XP_003277933.2| PREDICTED: E3 ubiquitin-protein ligase RNF167 [Nomascus leucogenys]
          Length = 351

 Score =  111 bits (277), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 81/255 (31%), Positives = 123/255 (48%), Gaps = 26/255 (10%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 34  ASMDFADLPALFGATLSQEGLQGFLV-----EAHPDNACSPIAPPPPAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 148

Query: 152 RSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           R+  +  K   V LV DN         P   ++ +++L+   +MI   V           
Sbjct: 149 RALFVYEKGARVLLVPDNTFPLGYYLIPFTGIVGLLVLAMGAVMI---VRCIQHRKRLQR 205

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
             +  +Q+      +I     ++ ++   CAICL++Y DGD+LR+LPC H +H  C+D W
Sbjct: 206 NRLTKEQL-----KQIPTHDYQKGDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPW 260

Query: 265 LTTRKKFCPICKRDI 279
           LT  +K CPICK+ +
Sbjct: 261 LTQTRKTCPICKQPV 275



>gi|348560880|ref|XP_003466241.1| PREDICTED: E3 ubiquitin-protein ligase RNF167-like [Cavia
           porcellus]
          Length = 352

 Score =  111 bits (277), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 82/255 (32%), Positives = 125/255 (49%), Gaps = 26/255 (10%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQ----WIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+ +  CS +    PT      +IAL+ 
Sbjct: 34  ASMDFADLPALFGATLSQEGLQGFLV-----EAHPENACSPIAPPPPTPGNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSAEYL 148

Query: 152 RSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           R+  +  K   V LV DN         P   ++ +++L+   +MI   V           
Sbjct: 149 RALFVYEKGARVLLVPDNGFPLGYYLIPFTGIVGLLVLAMGTVMI---VRCIQHRKRLQR 205

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
             +  +Q+      +I     ++ ++   CAICL++Y DGD+LR+LPC H +H  C+D W
Sbjct: 206 NRLTKEQL-----KQIPTHDYQKGDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPW 260

Query: 265 LTTRKKFCPICKRDI 279
           LT  +K CPICK+ +
Sbjct: 261 LTQTRKTCPICKQPV 275



>gi|402898398|ref|XP_003912210.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 [Papio anubis]
          Length = 351

 Score =  111 bits (277), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 81/255 (31%), Positives = 123/255 (48%), Gaps = 26/255 (10%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 34  ASMDFADLPALFGATLSQEGLQGFLV-----EAHPDNACSPIAPPPPAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 148

Query: 152 RSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           R+  +  K   V LV DN         P   ++ +++L+   +MI   V           
Sbjct: 149 RALFVYEKGARVLLVPDNTFPLGYYLIPFTGIVGLLVLAMGAVMI---VRCIQHRKRLQR 205

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
             +  +Q+      +I     ++ ++   CAICL++Y DGD+LR+LPC H +H  C+D W
Sbjct: 206 NRLTKEQL-----KQIPTHDYQKGDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPW 260

Query: 265 LTTRKKFCPICKRDI 279
           LT  +K CPICK+ +
Sbjct: 261 LTQTRKTCPICKQPV 275



>gi|395748403|ref|XP_002826927.2| PREDICTED: E3 ubiquitin-protein ligase RNF167 isoform 1 [Pongo
           abelii]
          Length = 351

 Score =  110 bits (276), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 81/255 (31%), Positives = 123/255 (48%), Gaps = 26/255 (10%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 34  ASMDFADLPALFGATLSQEGLQGFLV-----EAHPDNACSPIAPPPPAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 148

Query: 152 RSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           R+  +  K   V LV DN         P   ++ +++L+   +MI   V           
Sbjct: 149 RALFVYEKGARVLLVPDNTFPLGYYLIPFTGIVGLLVLAMGAVMI---VRCIQHRKRLQR 205

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
             +  +Q+      +I     ++ ++   CAICL++Y DGD+LR+LPC H +H  C+D W
Sbjct: 206 NRLTKEQL-----KQIPTHDYQKGDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPW 260

Query: 265 LTTRKKFCPICKRDI 279
           LT  +K CPICK+ +
Sbjct: 261 LTQTRKTCPICKQPV 275



>gi|397477750|ref|XP_003810232.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 [Pan paniscus]
 gi|426383681|ref|XP_004058407.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 [Gorilla gorilla
           gorilla]
          Length = 351

 Score =  110 bits (276), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 79/255 (30%), Positives = 121/255 (47%), Gaps = 26/255 (10%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 34  ASMDFADLPALFGATLSQEGLQGFLV-----EAHPDNACSPIAPPPPAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 148

Query: 152 RSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           R+  +  K   V LV DN         P   ++ +++L+   +MI               
Sbjct: 149 RALFVYEKGARVLLVPDNTFPLGYYLIPFTGIVGLLVLAMGAVMI--------ARCIQHR 200

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
             +   ++      +I     ++ ++   CAICL++Y DGD+LR+LPC H +H  C+D W
Sbjct: 201 KRLQRNRLTKEQLKQIPTHDYQKGDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPW 260

Query: 265 LTTRKKFCPICKRDI 279
           LT  +K CPICK+ +
Sbjct: 261 LTQTRKTCPICKQPV 275



>gi|114665884|ref|XP_001164101.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 isoform 16 [Pan
           troglodytes]
          Length = 351

 Score =  110 bits (276), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 79/255 (30%), Positives = 121/255 (47%), Gaps = 26/255 (10%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 34  ASMDFADLPALFGATLSQEGLQGFLV-----EAHPDNACSPIAPPPPAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 148

Query: 152 RSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           R+  +  K   V LV DN         P   ++ +++L+   +MI               
Sbjct: 149 RALFVYEKGARVLLVPDNTFPLGYYLIPFTGIVGLLVLAMGAVMI--------ARCIQHR 200

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
             +   ++      +I     ++ ++   CAICL++Y DGD+LR+LPC H +H  C+D W
Sbjct: 201 KRLQRNRLTKEQLKQIPTHDYQKGDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPW 260

Query: 265 LTTRKKFCPICKRDI 279
           LT  +K CPICK+ +
Sbjct: 261 LTQTRKTCPICKQPV 275



>gi|395836652|ref|XP_003791267.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 [Otolemur garnettii]
          Length = 355

 Score =  110 bits (276), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 78/255 (30%), Positives = 123/255 (48%), Gaps = 26/255 (10%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 34  ASMDFADLPALFGATLSQEGLQGFLV-----EAHPDNACSPIAPPPPAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A +V +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFDCNFDLKVLNAQKAGYGAAIVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 148

Query: 152 RSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           R+  +  K  +V LV DN         P   ++ +++L+   +MI   +           
Sbjct: 149 RALFVYEKGAQVLLVPDNSFPLGYYLIPFTGIVGLLVLAMGAVMIVRCI--------QHR 200

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
             +   ++      +I     ++ ++   CAICL++Y DGD+LR+LPC H +H  C+D W
Sbjct: 201 KRLQRNRLTKEQLKQIPTHDYQKGDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPW 260

Query: 265 LTTRKKFCPICKRDI 279
           LT  +K CPICK+ +
Sbjct: 261 LTQTRKTCPICKQPV 275



>gi|462398407|gb|EMJ04075.1| hypothetical protein PRUPE_ppa015768mg, partial [Prunus persica]
          Length = 282

 Score =  110 bits (276), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 77/262 (29%), Positives = 129/262 (49%), Gaps = 16/262 (6%)

Query: 28  VVDATIVVVATNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLK---RKAP 84
           +  A +V+      + D  A F   +   G+ G L+  + ++A     CS L+   R   
Sbjct: 19  LTSAIVVLKPFAREFSDLPAKFAIAVNSSGICGALLISDPLDA-----CSSLRNGLRPNE 73

Query: 85  TEQ-WIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFI 143
           T++   AL+ RG+C F +KV+N Q +G    +V D+   G + +Y   ++++V I +VF+
Sbjct: 74  TDKTRFALIVRGECAFKDKVQNAQNAGFRGAIVYDDRDKGKL-VYMMIESANVTIHAVFV 132

Query: 144 AQTEYKDLRSSSLKPVEVHLVK--DNLLQWPLLDVIIV---VILSPTVMMIFIYVLWXXX 198
           ++   + L+  +L       +    N   W +L +  +   VIL   ++ IF    W   
Sbjct: 133 SKASGEVLKEHALGEEGECCIFPFQNETAWTVLAISFISFLVILGILIIAIFGPRHWLYS 192

Query: 199 XXXXXXXDIAPQQVVGNLATKIFFESKRQENEPQE-CAICLEDYADGDELRILPCKHEFH 257
                       ++V  L    F  +   E   +E CAICLE+Y D + L++LPC+HEFH
Sbjct: 193 QGRNQLPKSVDTKIVEALPCFTFSSTGLGECHSEETCAICLENYKDEEILKVLPCQHEFH 252

Query: 258 ITCIDSWLTTRKKFCPICKRDI 279
            +C+DSWLT    FCP+CK D+
Sbjct: 253 SSCVDSWLTKWGTFCPVCKHDM 274



>gi|340720205|ref|XP_003398532.1| PREDICTED: e3 ubiquitin-protein ligase RNF13-like [Bombus
           terrestris]
          Length = 450

 Score =  110 bits (276), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 79/251 (31%), Positives = 126/251 (50%), Gaps = 17/251 (6%)

Query: 42  YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQ-KGCSKLKRKAPTEQWIALVERGQCTFI 100
           ++D  A FG  +  EG+ G +V  E   A ++ +G   +        W+ L+ R  C+F 
Sbjct: 43  FRDVPAKFGGLIPSEGIKGMVVYAEPPTACHEIQGPPNITNY--NGNWVILIARYNCSFE 100

Query: 101 EKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLRSSSLKPVE 160
            K+R  Q +G  AV++ +   N L  M A  D   + IPSVF+++     ++ + L   E
Sbjct: 101 RKIRMAQKAGYDAVIIHNVNSNILEPMQAR-DPVGILIPSVFVSEITGLIIKENYLYD-E 158

Query: 161 VHLVKDN-----LLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVVGN 215
           ++ V+ N      +   LL   IVV +   VM+IF+ V             +       N
Sbjct: 159 LYFVQINDDTPFNIAHLLLPFAIVVGICFLVMVIFMIVRCIKDRRRQRRHRLP------N 212

Query: 216 LATKIFFESKRQENEPQE-CAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCPI 274
            + K     K  + +P E CAICL+DYA+G++LR+LPC H +H  CID WLT  ++ CP+
Sbjct: 213 SSLKKIPTHKYTKGDPYETCAICLDDYAEGEKLRVLPCAHAYHTKCIDPWLTKNRRVCPV 272

Query: 275 CKRDICSPTEE 285
           CKR + +  E+
Sbjct: 273 CKRKVFAADEQ 283



>gi|291405221|ref|XP_002718877.1| PREDICTED: ring finger protein 167 [Oryctolagus cuniculus]
          Length = 354

 Score =  110 bits (276), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 81/255 (31%), Positives = 123/255 (48%), Gaps = 26/255 (10%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 34  ASMDFADLPALFGASLSQEGLQGFLV-----EAHPDNACSPIAPPPPAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 148

Query: 152 RSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           R+  +  K   V LV DN         P   ++ +++L+   +MI   V           
Sbjct: 149 RALFVYEKGARVLLVPDNSFPLGYYLIPFTGIVGLLVLAMGAVMI---VRCIQHRKRLQR 205

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
             +  +Q+      +I     ++ ++   CAICL++Y DGD+LR+LPC H +H  C+D W
Sbjct: 206 NRLTKEQL-----RQIPTHDYQKGDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPW 260

Query: 265 LTTRKKFCPICKRDI 279
           LT  +K CPICK+ +
Sbjct: 261 LTQTRKTCPICKQPV 275



>gi|311268237|ref|XP_003131954.1| PREDICTED: E3 ubiquitin-protein ligase RNF167-like [Sus scrofa]
          Length = 350

 Score =  110 bits (276), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 81/255 (31%), Positives = 122/255 (47%), Gaps = 26/255 (10%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 34  ASMDFADLPALFGAALSQEGLQGFLV-----EAHPDNACSPIAPPPPAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSQYL 148

Query: 152 RSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           R+  +  K   V LV DN         P   ++ +++L+   +MI   V           
Sbjct: 149 RALFVYEKGARVLLVPDNSFPLGYYLIPFTGIVGLLVLAMGAVMI---VRCIQHRKRLQR 205

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
             +  +Q+      +I     ++ ++   CAICL++Y DGD LR+LPC H +H  C+D W
Sbjct: 206 NRLTKEQL-----KQIPTHDYQKGDQYDVCAICLDEYEDGDRLRVLPCAHAYHSRCVDPW 260

Query: 265 LTTRKKFCPICKRDI 279
           LT  +K CPICK+ +
Sbjct: 261 LTQTRKTCPICKQPV 275



>gi|149724219|ref|XP_001504799.1| PREDICTED: e3 ubiquitin-protein ligase RNF167-like [Equus caballus]
          Length = 352

 Score =  110 bits (275), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 81/255 (31%), Positives = 123/255 (48%), Gaps = 26/255 (10%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 34  ASMDFADLPALFGAALSQEGLQGFLV-----EAHPANACSPIAPPPPAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 148

Query: 152 RSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           R+  +  K   V LV DN         P   ++ +++L+   +MI   V           
Sbjct: 149 RALFVYEKGARVLLVPDNSFPLGYYLIPFTGIVGLLVLAMGAVMI---VRCIQHRKRLQR 205

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
             +  +Q+      +I     ++ ++   CAICL++Y DGD+LR+LPC H +H  C+D W
Sbjct: 206 NRLTKEQL-----KQIPTHDYQKGDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPW 260

Query: 265 LTTRKKFCPICKRDI 279
           LT  +K CPICK+ +
Sbjct: 261 LTQTRKTCPICKQPV 275



>gi|343959710|dbj|BAK63712.1| RING finger protein 167 precursor [Pan troglodytes]
          Length = 350

 Score =  110 bits (275), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 80/255 (31%), Positives = 121/255 (47%), Gaps = 27/255 (10%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 34  ASMDFADLPALFGATLSQEGLQGFLV-----EAHPDNACSPIAPPPPAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 148

Query: 152 RSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           R+  +  K   V LV DN         P   ++ +++L+   +MI   +           
Sbjct: 149 RALFVYEKGARVLLVPDNTFPLGYYLIPFTGIVGLLVLAMGAVMIARCIQHRKRLQRNRL 208

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
                +Q+  +           Q+++   CAICL++Y DGD+LR+LPC H +H  C+D W
Sbjct: 209 TKEQLKQIPTH---------DYQKDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPW 259

Query: 265 LTTRKKFCPICKRDI 279
           LT  +K CPICK+ +
Sbjct: 260 LTQTRKTCPICKQPV 274



>gi|225431110|ref|XP_002265670.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 [Vitis vinifera]
          Length = 294

 Score =  110 bits (275), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 77/270 (28%), Positives = 132/270 (48%), Gaps = 22/270 (8%)

Query: 31  ATIVVVATNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQW-- 88
           A + + + + ++ D  A F   +   G+ G L   + +EA     CS L  +  +++   
Sbjct: 25  AIVHLKSLSASFIDAPARFAVSVNSTGICGALHLADPLEA-----CSSLLNRFRSQEIDT 79

Query: 89  --IALVERGQCTFIEKVRNMQASGAIAVVVGDN-EKNGLITMYATGDTSDVNIPSVFIAQ 145
              AL+ RG+C F +KVRN Q +G  AV+V D+ +K  L++M   G++  + +P+VF+++
Sbjct: 80  IKFALIIRGKCAFEDKVRNAQDAGFHAVIVYDDRDKGNLVSM--IGNSQGIWVPAVFVSK 137

Query: 146 TEYKDLRSSSLKPVEVHLVKDNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXX 205
              + L+  +        + +         V+++  +S  V+   +   +          
Sbjct: 138 AAGETLKIYAQGQEGECCIINPSFPESAWTVMVISFISLLVIATVVLTFFLTRNRRLNQR 197

Query: 206 DIAPQQ--VVGNLATKIFFESKRQENEPQ---ECAICLEDYADGDELRILPCKHEFHITC 260
              P +  V   L   +   +  Q  E +    C+ICLEDY DG+ LR+LPC+HEFH +C
Sbjct: 198 GTNPHRPSVDAKLVEVLPCFTFSQACECRVGDTCSICLEDYKDGERLRVLPCQHEFHASC 257

Query: 261 IDSWLTTRKKFCPICKRDI-----CSPTEE 285
           +DSWLT    FCP+CK D+     CS   E
Sbjct: 258 VDSWLTKWGTFCPVCKYDLSTDATCSKVNE 287



>gi|354469677|ref|XP_003497252.1| PREDICTED: E3 ubiquitin-protein ligase RNF167-like [Cricetulus
           griseus]
 gi|344237838|gb|EGV93941.1| E3 ubiquitin-protein ligase RNF167 [Cricetulus griseus]
          Length = 349

 Score =  110 bits (275), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 81/252 (32%), Positives = 122/252 (48%), Gaps = 20/252 (7%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
            ++ + D  A FG  L++EGL G+LV     EA+ +  CS +            +IAL+ 
Sbjct: 34  ASMDFADLPALFGAALSEEGLQGFLV-----EAHPENACSPIAPPPSAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFDCNFDLKVLNAQKAGYGAAVVHNVHSNELLNMVWNSEEIQQQIWIPSVFIGERSAEYL 148

Query: 152 RSSSL--KPVEVHLVKDNL--LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDI 207
           R+  +  K   V LV DN   L + L+    +V L    M   + V             +
Sbjct: 149 RALFVYEKGARVLLVPDNSFPLGYYLIPFTGIVGLLVLAMGAVLVVRCIQHRKRLQQNRL 208

Query: 208 APQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTT 267
             +Q+      +I     ++ ++   CAICL++Y DGD+LR+LPC H +H  C+D WLT 
Sbjct: 209 TKEQL-----KQIPTHEYQKGDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPWLTQ 263

Query: 268 RKKFCPICKRDI 279
            +K CPICK+ +
Sbjct: 264 TRKTCPICKQPV 275



>gi|14149702|ref|NP_056343.1| E3 ubiquitin-protein ligase RNF167 precursor [Homo sapiens]
 gi|74733620|sp|Q9H6Y7.1|RN167_HUMAN RecName: Full=E3 ubiquitin-protein ligase RNF167; AltName:
           Full=RING finger protein 167; AltName: Full=RING105;
           Flags: Precursor
 gi|10437824|dbj|BAB15113.1| unnamed protein product [Homo sapiens]
 gi|14603365|gb|AAH10139.1| Ring finger protein 167 [Homo sapiens]
 gi|48146797|emb|CAG33621.1| DKFZP566H073 [Homo sapiens]
 gi|119610791|gb|EAW90385.1| ring finger protein 167, isoform CRA_a [Homo sapiens]
 gi|119610793|gb|EAW90387.1| ring finger protein 167, isoform CRA_a [Homo sapiens]
 gi|119610794|gb|EAW90388.1| ring finger protein 167, isoform CRA_a [Homo sapiens]
          Length = 350

 Score =  110 bits (275), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 79/255 (30%), Positives = 121/255 (47%), Gaps = 26/255 (10%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 34  ASMDFADLPALFGATLSQEGLQGFLV-----EAHPDNACSPIAPPPPAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 148

Query: 152 RSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           R+  +  K   V LV DN         P   ++ +++L+   +MI               
Sbjct: 149 RALFVYEKGARVLLVPDNTFPLGYYLIPFTGIVGLLVLAMGAVMI--------ARCIQHR 200

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
             +   ++      +I     ++ ++   CAICL++Y DGD+LR+LPC H +H  C+D W
Sbjct: 201 KRLQRNRLTKEQLKQIPTHDYQKGDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPW 260

Query: 265 LTTRKKFCPICKRDI 279
           LT  +K CPICK+ +
Sbjct: 261 LTQTRKTCPICKQPV 275



>gi|332021533|gb|EGI61898.1| RING finger protein 13 [Acromyrmex echinatior]
          Length = 446

 Score =  110 bits (275), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 77/253 (30%), Positives = 124/253 (49%), Gaps = 21/253 (8%)

Query: 42  YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLK---RKAPTEQWIALVERGQCT 98
           ++D  A FG  ++ EG+ G +V      A+    C K++       T  WIAL+ R  C+
Sbjct: 42  FRDMPAKFGGIISPEGIKGMVVY-----ADPPTACHKIQAPPNNNTTGNWIALIRRYNCS 96

Query: 99  FIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLRSSSLKP 158
           F  K+R  Q +G  A ++ +   N L  M A  D   + IPSVF+ +     ++ + L  
Sbjct: 97  FEIKIRMAQEAGYDAAIIHNVNSNELEPMSAK-DPVGILIPSVFVGEITGLVIKDNYLYN 155

Query: 159 VEVHLVKDNLLQWP-----LLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVV 213
               +V ++ L +      LL   IVV +   +++IF+ V             +      
Sbjct: 156 QGYFVVINDDLPFNINTHLLLPFAIVVGICFLIIVIFMIVRCIKDRRRQRRHRLP----- 210

Query: 214 GNLATKIFFESKRQENEPQE-CAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFC 272
            N + K     K  + +P E CAICL+DY +G++LR+LPC H +H  CID WLT  ++ C
Sbjct: 211 -NSSLKKIPIHKYTKGDPYETCAICLDDYVEGEKLRVLPCAHAYHSKCIDPWLTKNRRVC 269

Query: 273 PICKRDICSPTEE 285
           P+CKR + +  E+
Sbjct: 270 PVCKRKVFAADEQ 282



>gi|296202306|ref|XP_002806882.1| PREDICTED: LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase RNF167
           [Callithrix jacchus]
          Length = 352

 Score =  110 bits (275), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 83/252 (32%), Positives = 121/252 (48%), Gaps = 20/252 (7%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 34  ASMDFADLPALFGATLSQEGLQGFLV-----EAHPDNACSPIAPPPPAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RYDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 148

Query: 152 RSSSL--KPVEVHLVKDNL--LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDI 207
           R+  +  K   V LV DN   L + L+    +V L    M   + V             +
Sbjct: 149 RALFVYEKGDRVLLVPDNTFPLGYYLIPFTGIVGLLXLAMGAVMIVRCIQHRKRLQRNRL 208

Query: 208 APQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTT 267
             +Q+      +I     ++ ++   CAICL++Y DGD+LRILPC H +H  C+D WLT 
Sbjct: 209 TKEQL-----KQIPTHDYQKGDQYDVCAICLDEYEDGDKLRILPCAHAYHSRCVDPWLTQ 263

Query: 268 RKKFCPICKRDI 279
            +K CPICK+ +
Sbjct: 264 TRKTCPICKQPV 275



>gi|426237410|ref|XP_004012654.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 [Ovis aries]
          Length = 349

 Score =  110 bits (275), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 79/255 (30%), Positives = 122/255 (47%), Gaps = 26/255 (10%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 34  ASMDFADLPALFGAALSQEGLQGFLV-----EAHPDNACSPIAPPPPAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 148

Query: 152 RSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           R+  +  K   V LV DN         P   ++ +++L+   +MI   +           
Sbjct: 149 RALFVYEKGARVLLVPDNSFPLGYYLIPFTGIVGLLVLAMGAVMIVRCI--------QHR 200

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
             +   ++      +I     ++ ++   CAICL++Y DGD+LR+LPC H +H  C+D W
Sbjct: 201 KRLQRNRLTKEQLKQIPTHDYQKGDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPW 260

Query: 265 LTTRKKFCPICKRDI 279
           LT  +K CPICK+ +
Sbjct: 261 LTQTRKTCPICKQPV 275



>gi|126323242|ref|XP_001375947.1| PREDICTED: zinc/RING finger protein 4-like [Monodelphis domestica]
          Length = 348

 Score =  110 bits (274), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 79/258 (30%), Positives = 120/258 (46%), Gaps = 15/258 (5%)

Query: 37  ATNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQW---IALVE 93
           A+ V + D  A FG  L+ +G+ GYL     IEA     C  ++    +      IALV 
Sbjct: 36  ASVVDFSDAPALFGAPLSKDGVRGYL-----IEAQPPNACQPIESPTLSNHSLGSIALVR 90

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  CTF  KV + Q +G  AV+V +   N L+ M    D     + IPSVF+++   KDL
Sbjct: 91  RFDCTFDLKVLHAQQAGYKAVIVHNVHSNDLVNMVHVYDDIRQQIEIPSVFVSEATSKDL 150

Query: 152 RSSSLKPVEVH-LVKDNLLQWPLLDVIIVVILS---PTVMMIFIYVLWXXXXXXXXXXDI 207
           R         H L+  NL Q+P +D    + +S     +M + I  L             
Sbjct: 151 RVILCGNKGAHVLLLPNLRQYPEVDCHPALSISWVLGRMMTLLIVTLIITRKVWLYCWQW 210

Query: 208 APQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTT 267
             Q +V    ++     +    +   CAICL++Y +GD+LR+LPC H +H  CI+ W + 
Sbjct: 211 REQSIVTKTPSRKKTHMRPFPRQNDVCAICLDEYEEGDQLRVLPCTHMYHYKCINPWFSQ 270

Query: 268 RK-KFCPICKRDICSPTE 284
              + CP+CK+ +    E
Sbjct: 271 ALCRSCPVCKQPVIGAEE 288



>gi|21739864|emb|CAD38958.1| hypothetical protein [Homo sapiens]
 gi|119610792|gb|EAW90386.1| ring finger protein 167, isoform CRA_b [Homo sapiens]
          Length = 349

 Score =  110 bits (274), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 80/255 (31%), Positives = 124/255 (48%), Gaps = 27/255 (10%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 34  ASMDFADLPALFGATLSQEGLQGFLV-----EAHPDNACSPIAPPPPAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 148

Query: 152 RSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           R+  +  K   V LV DN         P   ++ +++L+   +MI   +           
Sbjct: 149 RALFVYEKGARVLLVPDNTFPLGYYLIPFTGIVGLLVLAMGAVMIARCI----QHRKRLQ 204

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
            +   ++ +  + T  +     Q+++   CAICL++Y DGD+LR+LPC H +H  C+D W
Sbjct: 205 RNRLTKEQLKQIPTHDY-----QKDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPW 259

Query: 265 LTTRKKFCPICKRDI 279
           LT  +K CPICK+ +
Sbjct: 260 LTQTRKTCPICKQPV 274



>gi|478518069|ref|XP_004433265.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 [Ceratotherium simum
           simum]
          Length = 359

 Score =  110 bits (274), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 81/255 (31%), Positives = 123/255 (48%), Gaps = 26/255 (10%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 40  ASMDFADLPALFGAALSQEGLQGFLV-----EAHPANACSPIAPPPPAPVNGSVFIALLR 94

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 95  RFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 154

Query: 152 RSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           R+  +  K   V LV DN         P   ++ +++L+   +MI   V           
Sbjct: 155 RALFVYEKGARVLLVPDNNFPLGYYLIPFTGIVGLLVLAMGAVMI---VRCIQHRKRLQR 211

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
             +  +Q+      +I     ++ ++   CAICL++Y DGD+LR+LPC H +H  C+D W
Sbjct: 212 NRLTKEQL-----KQIPTHDYQKGDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPW 266

Query: 265 LTTRKKFCPICKRDI 279
           LT  +K CPICK+ +
Sbjct: 267 LTQTRKTCPICKQPV 281



>gi|383863227|ref|XP_003707083.1| PREDICTED: E3 ubiquitin-protein ligase RNF167-like [Megachile
           rotundata]
          Length = 451

 Score =  110 bits (274), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 79/253 (31%), Positives = 125/253 (49%), Gaps = 21/253 (8%)

Query: 42  YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAP----TEQWIALVERGQC 97
           ++D  A FG  +  EG+ G +V      A+    C +++           WIAL+ R  C
Sbjct: 43  FRDLPARFGGLIPSEGIKGMVVY-----ADPPTACREIQGPPNITNYNGNWIALIARYNC 97

Query: 98  TFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLRSSSL- 156
           +F  KVR  Q +G  A ++ +   N L  M A  D   + IPSVF+++     ++ + L 
Sbjct: 98  SFEIKVRMAQKAGYDAAIIHNVNSNELEPMSAE-DPVGIFIPSVFVSEITGLIIKENYLY 156

Query: 157 KPVEVHLVKDNL---LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVV 213
             +   L+ D+    +   LL   IVV +   VM+IF+ V                +  +
Sbjct: 157 DQLYFVLINDDATFNITHLLLPFAIVVGICFLVMVIFMIVRCIKDRRRQQ------RHRL 210

Query: 214 GNLATKIFFESKRQENEPQE-CAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFC 272
            N + K     K  + +P E CAICL+DYA+G++LR+LPC H +H  CID WLT  ++ C
Sbjct: 211 PNSSLKKIPTHKYTKGDPYETCAICLDDYAEGEKLRVLPCAHAYHTKCIDPWLTENRRVC 270

Query: 273 PICKRDICSPTEE 285
           P+CKR + +  E+
Sbjct: 271 PVCKRKVFAADEQ 283



>gi|164453037|ref|NP_001069873.2| E3 ubiquitin-protein ligase RNF167 [Bos taurus]
 gi|440897071|gb|ELR48843.1| E3 ubiquitin-protein ligase RNF167 [Bos grunniens mutus]
          Length = 349

 Score =  110 bits (274), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 79/255 (30%), Positives = 122/255 (47%), Gaps = 26/255 (10%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 34  ASMDFADLPALFGAALSQEGLQGFLV-----EAHPDNACSPIAPPPPAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 148

Query: 152 RSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           R+  +  K   V LV DN         P   ++ +++L+   +MI   +           
Sbjct: 149 RALFVYEKGARVLLVPDNSFPLGYYLIPFTGIVGLLVLAMGAVMIVRCI--------QHR 200

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
             +   ++      +I     ++ ++   CAICL++Y DGD+LR+LPC H +H  C+D W
Sbjct: 201 KRLQRNRLTKEQLKQIPTHDYQKGDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPW 260

Query: 265 LTTRKKFCPICKRDI 279
           LT  +K CPICK+ +
Sbjct: 261 LTQTRKTCPICKQPV 275



>gi|297734999|emb|CBI17361.3| unnamed protein product [Vitis vinifera]
          Length = 352

 Score =  110 bits (274), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 78/271 (28%), Positives = 136/271 (50%), Gaps = 24/271 (8%)

Query: 31  ATIVVVATNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQW-- 88
           A + + + + ++ D  A F   +   G+ G L   + +EA     CS L  +  +++   
Sbjct: 83  AIVHLKSLSASFIDAPARFAVSVNSTGICGALHLADPLEA-----CSSLLNRFRSQEIDT 137

Query: 89  --IALVERGQCTFIEKVRNMQASGAIAVVVGDN-EKNGLITMYATGDTSDVNIPSVFIAQ 145
              AL+ RG+C F +KVRN Q +G  AV+V D+ +K  L++M   G++  + +P+VF+++
Sbjct: 138 IKFALIIRGKCAFEDKVRNAQDAGFHAVIVYDDRDKGNLVSM--IGNSQGIWVPAVFVSK 195

Query: 146 TEYKDLR-SSSLKPVEVHLVKDNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
              + L+  +  +  E  ++  +  +     V+++  +S  V+   +   +         
Sbjct: 196 AAGETLKIYAQGQEGECCIINPSFPE-SAWTVMVISFISLLVIATVVLTFFLTRNRRLNQ 254

Query: 205 XDIAPQQ--VVGNLATKIFFESKRQENEPQ---ECAICLEDYADGDELRILPCKHEFHIT 259
               P +  V   L   +   +  Q  E +    C+ICLEDY DG+ LR+LPC+HEFH +
Sbjct: 255 RGTNPHRPSVDAKLVEVLPCFTFSQACECRVGDTCSICLEDYKDGERLRVLPCQHEFHAS 314

Query: 260 CIDSWLTTRKKFCPICKRDI-----CSPTEE 285
           C+DSWLT    FCP+CK D+     CS   E
Sbjct: 315 CVDSWLTKWGTFCPVCKYDLSTDATCSKVNE 345



>gi|4884104|emb|CAB43253.1| hypothetical protein [Homo sapiens]
          Length = 324

 Score =  110 bits (274), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 80/255 (31%), Positives = 121/255 (47%), Gaps = 27/255 (10%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 9   ASMDFADLPALFGATLSQEGLQGFLV-----EAHPDNACSPIAPPPPAPVNGSVFIALLR 63

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 64  RFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 123

Query: 152 RSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           R+  +  K   V LV DN         P   ++ +++L+   +MI   +           
Sbjct: 124 RALFVYEKGARVLLVPDNTFPLGYYLIPFTGIVGLLVLAMGAVMIARCIQHRKRLQRNRL 183

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
                +Q+  +           Q+++   CAICL++Y DGD+LR+LPC H +H  C+D W
Sbjct: 184 TKEQLKQIPTH---------DYQKDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPW 234

Query: 265 LTTRKKFCPICKRDI 279
           LT  +K CPICK+ +
Sbjct: 235 LTQTRKTCPICKQPV 249



>gi|307190473|gb|EFN74498.1| RING finger protein 13 [Camponotus floridanus]
          Length = 449

 Score =  109 bits (273), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 77/254 (30%), Positives = 122/254 (48%), Gaps = 22/254 (8%)

Query: 42  YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTE----QWIALVERGQC 97
           ++D  A FG  +  EG+ G  V      AN    C +++           WI L+ R  C
Sbjct: 43  FRDMPAKFGGIIPSEGIKGMAVY-----ANPANACQEIQGPPNNTDYHGNWIVLIRRYNC 97

Query: 98  TFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLRSSSLK 157
           +F  KVRN Q +   AV+V +   N L  M A  D + ++IP+VF+       ++ + L 
Sbjct: 98  SFEVKVRNAQKAKYNAVIVHNVNSNELEPMSAK-DNTGISIPAVFVGDVTGLVIKENYLY 156

Query: 158 PVEVHLVKDNLLQWP-----LLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQV 212
                L+ ++ L +      LL   IVV +   +++IF+ V             +     
Sbjct: 157 DQSYFLLINDDLPFNINTHLLLPFAIVVGICFLIIVIFMIVRCIKDRRRQRRHRLP---- 212

Query: 213 VGNLATKIFFESKRQENEPQE-CAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKF 271
             N + K     K  + +P E CAICL+DY +G++LR+LPC H +H  CID WLT  ++ 
Sbjct: 213 --NSSLKKIPIHKYTKGDPYETCAICLDDYVEGEKLRVLPCAHAYHSKCIDPWLTKNRRV 270

Query: 272 CPICKRDICSPTEE 285
           CP+CKR + +  E+
Sbjct: 271 CPVCKRKVFAADEQ 284



>gi|410979837|ref|XP_003996287.1| PREDICTED: E3 ubiquitin-protein ligase RNF167, partial [Felis
           catus]
          Length = 342

 Score =  109 bits (273), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 80/255 (31%), Positives = 121/255 (47%), Gaps = 26/255 (10%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 26  ASMDFADLPALFGAALSQEGLQGFLV-----EAHPANACSPIAPPPPAPVNGSVFIALLR 80

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 81  RFDCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 140

Query: 152 RSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           R+  +  K   V LV DN         P   ++ +++L+   +MI   V           
Sbjct: 141 RTLFVYEKGARVLLVPDNSFPLGYYLIPFTGIVGLLVLAMGAVMIVRCV--------QHR 192

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
             +   ++      +I     ++ ++   CAICL++Y DGD LR+LPC H +H  C+D W
Sbjct: 193 KRLQRNRLTKEQLKQIPTHDYQKGDQYDVCAICLDEYEDGDRLRVLPCAHAYHSRCVDPW 252

Query: 265 LTTRKKFCPICKRDI 279
           LT  +K CPICK+ +
Sbjct: 253 LTQTRKTCPICKQPV 267



>gi|328768378|gb|EGF78424.1| hypothetical protein BATDEDRAFT_26439 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 443

 Score =  109 bits (272), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 55/122 (45%), Positives = 71/122 (58%), Gaps = 5/122 (4%)

Query: 173 LLDVIIVVILS---PTVMMIFIYVLWXXXXXXXXXXDIAPQQVVGNLATKIFFESKRQEN 229
           ++D+IIV I+S   P V+M FIY +W                 +  L  K++F SKR EN
Sbjct: 288 IMDIIIVTIMSALCPIVIMFFIYSIWLLLQFNMRQKSTISVLDLSRLPIKVYFNSKRHEN 347

Query: 230 EPQECAICLEDYADGDELRIL-PCKHEFHITCIDSWLTTRKKFCPICKRDICSPTEETPL 288
           +P  CAICLED+ D D LR L  C+HEFH +CID WL    K CP CK++I    E TPL
Sbjct: 348 DPTTCAICLEDFVDEDTLRTLVTCRHEFHASCIDPWLRYYSKLCPTCKQEILL-NENTPL 406

Query: 289 LS 290
           L+
Sbjct: 407 LA 408



 Score =  105 bits (261), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 78/127 (61%), Gaps = 16/127 (12%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQK-GCSKLKRKA------------- 83
           TN +Y DR AAFG  +   GL+G L+ V  I++ + + GC  +  ++             
Sbjct: 51  TNTSYPDRGAAFGSLIGPTGLVGILIPVNAIDSKHSRSGCKPISFESVPPLTQAQLSFNL 110

Query: 84  -PTEQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNG-LITMYATGDTSDVNIPSV 141
             +  WIALVERG+C+F +KVR MQ SGA AV++GDN   G LITMY+ G+ SD+ +PSV
Sbjct: 111 HSSAHWIALVERGECSFADKVRAMQQSGASAVIIGDNSFFGDLITMYSQGNVSDIVVPSV 170

Query: 142 FIAQTEY 148
           FI++  Y
Sbjct: 171 FISKPSY 177



>gi|168028812|ref|XP_001766921.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162681900|gb|EDQ68323.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 302

 Score =  108 bits (271), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 85/272 (31%), Positives = 130/272 (47%), Gaps = 45/272 (16%)

Query: 47  AAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIA---LVERGQCTFIEKV 103
           AAF   + DEG+ G L       AN    C+ LK   P  + +    ++ RG C F +KV
Sbjct: 3   AAFARPVPDEGVTGILHV-----ANPLDACAPLKNHIPEGEPLVPFVVISRGTCNFDKKV 57

Query: 104 RNMQASGAIAVVVGD--NEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLRSSSLKPVEV 161
           +N Q +G  A +V +  +  + +ITM  +G   D++I +VF++    + L  +       
Sbjct: 58  KNAQVAGFQAAIVYNTMDFTDEMITM--SGSAEDIDIYAVFVSWNTGQALLGA------- 108

Query: 162 HLVKDN----LLQ-------WPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQ 210
             V DN     LQ       W ++ V  + +L+ + ++   + +            ++ +
Sbjct: 109 --VGDNNVTCTLQAAAEDTAWSIMAVSSISLLAVSAVLSTFFFVRRHRLRHLGSRFLSRE 166

Query: 211 ------QVVGNLATKIFFESKRQENEPQE-CAICLEDYADGDELRILPCKHEFHITCIDS 263
                 + V  L T IF ++        E CAICLEDY  G +LR LPC H+FH+ CID 
Sbjct: 167 PSGMNARDVQALPTFIFEDAGGDGAATGETCAICLEDYESGQKLRHLPCDHDFHVGCIDQ 226

Query: 264 WLTTRKKFCPICKRDIC------SPTEETPLL 289
           WL TR+ FCPICK+D        + TE TPLL
Sbjct: 227 WLLTRRPFCPICKQDANAAPRHQAATETTPLL 258



>gi|195038609|ref|XP_001990749.1| GH19534 [Drosophila grimshawi]
 gi|193894945|gb|EDV93811.1| GH19534 [Drosophila grimshawi]
          Length = 534

 Score =  108 bits (270), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 80/254 (31%), Positives = 124/254 (48%), Gaps = 18/254 (7%)

Query: 42  YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLK-----RKAPT-EQWIALVERG 95
           + D  + FGP +    L  + V  E   A    GC  L         PT  +++A+V RG
Sbjct: 28  FNDLPSTFGPSIVGNNLRVFAVPPEPKYA---FGCDYLNLPPRNSDYPTGAKFVAIVSRG 84

Query: 96  -QCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLRSS 154
             CTF  KVR  Q +   AV++ +NE + L  M A  + S + IPSVF+ QT  K L S 
Sbjct: 85  GDCTFERKVRVAQNATYFAVIIYNNEGDELEQMTAN-NASGIYIPSVFVGQTTGKTLLSF 143

Query: 155 SLKPVEVHLVKD----NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQ 210
           S  P  V ++ D    N+    +L   I++ L   VM++++ +               P+
Sbjct: 144 S-TPGLVLIINDELPFNINTQLILPFSILIALCFLVMIVYM-IYRCIREQRRLRRYRLPK 201

Query: 211 QVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKK 270
            ++  +   + +       + + C ICL+D+ + D+LR+LPC H +H  CID WLT  ++
Sbjct: 202 SMLKKIPV-LRYTKNNTRIKYETCVICLDDFVEDDKLRVLPCSHPYHSHCIDPWLTENRR 260

Query: 271 FCPICKRDICSPTE 284
            CPICKR + S  E
Sbjct: 261 VCPICKRKVFSKGE 274



>gi|224133660|ref|XP_002327649.1| predicted protein [Populus trichocarpa]
 gi|222836734|gb|EEE75127.1| predicted protein [Populus trichocarpa]
          Length = 311

 Score =  108 bits (270), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/258 (28%), Positives = 127/258 (49%), Gaps = 14/258 (5%)

Query: 30  DATIVVVATNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQ-- 87
            AT+++  +++++ D  A     L    + G L       AN    CS L+ +    +  
Sbjct: 22  SATVLIKPSSISFPDLPAKSALSLNGSSVCGSLHV-----ANPLDACSPLRNRFEFNESG 76

Query: 88  WIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTE 147
             AL+ RG+C F +K++N Q++G  A +V D++ N  + +Y   +   + + +VF+ +  
Sbjct: 77  RFALIVRGECAFEDKIKNAQSAGFRAAIVFDDKDNRNL-IYMMVNPEGIKVHAVFVTKYA 135

Query: 148 YKDLRSSSL-KPVEVHLVKDNL-LQWPLLDVIIVVILSPTVMMIFIYVL---WXXXXXXX 202
            + L+  +  K  E  +        W +L + ++ ++    ++I ++V    W       
Sbjct: 136 GEILKDRARGKEGECCIYSSRTDAAWTVLAISLISVVVILGLLILVFVTPRHWLHWQRTN 195

Query: 203 XXXDIAPQQVVGNLATKIFFE-SKRQENEPQECAICLEDYADGDELRILPCKHEFHITCI 261
                   ++V  L    F   S  Q +  + CAICLEDY DG+ L++LPC HEFH TC+
Sbjct: 196 NRCKSVDSKMVEALPCFTFRNASLSQCHVGETCAICLEDYKDGEVLKVLPCHHEFHSTCV 255

Query: 262 DSWLTTRKKFCPICKRDI 279
           DSWLT    FCP+CK D+
Sbjct: 256 DSWLTKWGTFCPVCKLDM 273



>gi|195109971|ref|XP_001999555.1| GI23012 [Drosophila mojavensis]
 gi|193916149|gb|EDW15016.1| GI23012 [Drosophila mojavensis]
          Length = 544

 Score =  108 bits (270), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 77/264 (29%), Positives = 135/264 (51%), Gaps = 18/264 (6%)

Query: 42  YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKL----KRKAPT-EQWIALVERG- 95
           + D  A+FGP + D  L  ++V  +     +  GC+ L    +   P   +++A++ RG 
Sbjct: 46  FNDLPASFGPPIVDNNLRVFVVPHD---PKDPYGCNNLSNPPRYSYPNGAKFVAILSRGG 102

Query: 96  QCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLRSSS 155
            CTF  KVR  Q +   AV++ +NE + L  M A  + S +NIPSVF+  T  K L S  
Sbjct: 103 NCTFERKVRVAQEATYSAVIIYNNEGDELEQMTA-NNKSGINIPSVFVGITTGKTLLS-- 159

Query: 156 LKPVEVHLVKDNLLQWPLLDVIIV---VILSPTVMMIFIYVLWX-XXXXXXXXXDIAPQQ 211
               EV L+ ++ L + +   +I+   ++++   +++ +Y+++              P+ 
Sbjct: 160 FFTPEVVLIINDELPFNINTQLILPFSILIALCFLILIVYMIYKCIREQRRLRRHRLPKS 219

Query: 212 VVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKF 271
            +  +   + +       + + C ICLED+ + D+LR+LPC H +H  CID WLT  ++ 
Sbjct: 220 TLRKIPV-LRYTKNNTTIKYETCVICLEDFVEDDKLRVLPCSHPYHSHCIDPWLTENRRV 278

Query: 272 CPICKRDICSPTEETPLLSNHEPT 295
           CPICKR + +   ET    N +P+
Sbjct: 279 CPICKRKVFT-KGETRASRNRQPS 301



>gi|7267651|emb|CAB78079.1| putative protein [Arabidopsis thaliana]
          Length = 431

 Score =  108 bits (269), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 79/284 (27%), Positives = 130/284 (45%), Gaps = 44/284 (15%)

Query: 29  VDATIVVV--ATNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKL------K 80
           V A ++++  +T++++ D  A F P +      G L   E ++A     CS L      K
Sbjct: 18  VSAKVLLIGNSTSLSFDDVEATFTPMIKRSDQGGVLYVAEPLDA-----CSDLVNTVNVK 72

Query: 81  RKAPTEQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPS 140
                     L+ RG C+F +K+RN Q +G  A +V D E  G + +  TG+     +  
Sbjct: 73  NGTTVSPPYVLIIRGGCSFEDKIRNAQKAGYKAAIVYDYEDFGFL-VSTTGE-----VLK 126

Query: 141 VFIAQTEYKDLRSSSLKPVEVHLVKD-NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXX 199
            +  +T++           EV L+       W ++ +  + +L+ + ++   + +     
Sbjct: 127 EYAGRTDF-----------EVWLMPSFETSAWSIMAISFISLLAMSAVLATCFFVRRHRV 175

Query: 200 XXXXXXDI-------APQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPC 252
                  +        P+ ++  + T IF     +      C ICLE+Y  GD+LRILPC
Sbjct: 176 RRRRILALNGNDFHRMPKSMIIRMPTTIFNGICDEATTSILCCICLENYEKGDKLRILPC 235

Query: 253 KHEFHITCIDSWLTTRKKFCPICKRDICS------PTEETPLLS 290
            H+FH+ C+D WL  RK FCP+CKRD  S      P+E TP LS
Sbjct: 236 HHKFHVACVDLWLGQRKSFCPVCKRDARSISTDKPPSEHTPFLS 279



>gi|8778343|gb|AAF79351.1|AC007887_10 F15O4.19 [Arabidopsis thaliana]
          Length = 565

 Score =  108 bits (269), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 73/287 (25%), Positives = 142/287 (49%), Gaps = 25/287 (8%)

Query: 28  VVDATIVVVATN--VTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT 85
           +  A +V++  N  +++ D  A F P + + G  G L   E +EA +       KR    
Sbjct: 17  LASAKVVLIGKNTILSFDDVEATFTPIVRNSGECGILYVAEPLEACSDITNMAEKRSKYR 76

Query: 86  EQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQ 145
             ++ L+  G C+F EKVR  Q +G  A +V ++  + L+      ++S V+I  + + +
Sbjct: 77  SSYV-LIVLGGCSFEEKVRKAQKAGYKAAIVYNDGYDELLV---PRNSSGVDIHGLLVTR 132

Query: 146 TEYKDLRS-SSLKPVEVHLVKD-NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXX 203
              + L+  +    +++ L+    +  W ++ +  + +L+ + ++   +V+         
Sbjct: 133 ASGEVLKGYADQDEMKLWLIPGFGISSWSIMGITFISLLAMSAILATCFVVRRHQIRQSV 192

Query: 204 X--------XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHE 255
                        P+ ++ ++ T+++     + +    CAIC++DY  G++LRILPCKH+
Sbjct: 193 RDLPHGGQGLSCMPRDLLQSMPTEVYSGVLEESSTSVTCAICIDDYCVGEKLRILPCKHK 252

Query: 256 FHITCIDSWLTTRKKFCPICKR------DICSPTEETPLLSNHEPTP 296
           +H  CIDSWL   + FCP+CK+      D+   +E TPL+S   P+P
Sbjct: 253 YHAVCIDSWLGRCRSFCPVCKQNPRTGNDVPPASETTPLIS---PSP 296



>gi|297852010|ref|XP_002893886.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gi|297339728|gb|EFH70145.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
          Length = 318

 Score =  107 bits (268), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 79/294 (26%), Positives = 144/294 (48%), Gaps = 37/294 (12%)

Query: 28  VVDATIVVVATN--VTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT 85
           +  A +V++  N  ++++   A F P +   G  G L + E ++A     CS L   A  
Sbjct: 17  LASAKVVLIGENTILSFEYVEATFTPIVRRSGEYGSLYAAEPLDA-----CSDLTNMAEK 71

Query: 86  ----EQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSV 141
                    L+ RG C+F EKV   Q +G  A +V +N  + L+      ++S V+I  +
Sbjct: 72  GSRFRSSYVLIVRGGCSFEEKVIKAQKAGYKAAIVYNNGYDELLV---PRNSSGVHIHGL 128

Query: 142 FIAQTEYKDLRSSSLKP-VEVHLVKD-NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXX 199
            + +   + L+  S +  +E+ L+    +  W ++ +  + +L+ + ++   +V +    
Sbjct: 129 LVTRASGEVLKGYSGRSEMELWLIPGFGISLWSIMCITFISLLTISAVLATCFV-FHMHR 187

Query: 200 XXXXXXDI-----------APQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELR 248
                 D+            P+ ++ ++ T+++     + +    CAIC++DY  G++L+
Sbjct: 188 IRRSVRDLHLPYGGQGLSRMPRNLLQSMPTEVYTGVLEESSTSVTCAICIDDYCVGEKLK 247

Query: 249 ILPCKHEFHITCIDSWLTTRKKFCPICKR------DICSPTEETPLLSNHEPTP 296
           ILPCKH+FH  CIDSWL   + FCP+CKR      D+   +E TPLLS   P+P
Sbjct: 248 ILPCKHKFHAVCIDSWLGHCRSFCPVCKRMPRTGNDVPPASETTPLLS---PSP 298



>gi|41351101|gb|AAH65620.1| Ring finger protein 13 [Danio rerio]
          Length = 377

 Score =  107 bits (268), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 72/250 (28%), Positives = 124/250 (49%), Gaps = 22/250 (8%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKL----KRKAPTEQWIALVERGQ 96
            + D  A FG RL  EGL G+L+      A  +  C  +    +R+  +  +I L+ R  
Sbjct: 47  NFDDLPARFGYRLPSEGLKGFLIG-----ARPENACVPIEPPPQRENLSSAFIVLIRRFD 101

Query: 97  CTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTS---DVNIPSVFIAQTEYKDLRS 153
           C F  KV + Q +G  A +V + + + LI+M  + D      ++IPSVFI +     L+ 
Sbjct: 102 CNFDIKVLHAQKAGYKAAIVHNVDSDDLISM-GSEDLDILKQIDIPSVFIGEEAANSLKE 160

Query: 154 SSL--KPVEVHLVKDNLL--QWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAP 209
             +  K   V L+ D  L  ++ L+  +I+V +   ++++F+   +           +  
Sbjct: 161 DYIYEKGGHVILMPDFSLPLEYYLIPFLIIVGICLILIVVFMITKFVQDRHRARRSRLRK 220

Query: 210 QQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRK 269
            Q+      K+     ++ +    CAICL++Y +G+ LR+LPC H +H  C+D WLT  K
Sbjct: 221 DQL-----KKLPIHKFKKGDSYDVCAICLDEYEEGERLRVLPCSHAYHCKCVDPWLTKTK 275

Query: 270 KFCPICKRDI 279
           K CP+CK+ +
Sbjct: 276 KTCPVCKQKV 285



>gi|148233415|ref|NP_001079892.1| uncharacterized protein LOC379582 precursor [Xenopus laevis]
 gi|33416723|gb|AAH56113.1| MGC69137 protein [Xenopus laevis]
          Length = 336

 Score =  107 bits (268), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 79/247 (31%), Positives = 121/247 (48%), Gaps = 19/247 (7%)

Query: 42  YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKL---KRKAPTEQWIALVERGQCT 98
           + D  A FGP L+ +G+ G LV     EA    GCS +      A    +I L+ R  C 
Sbjct: 44  FDDLPALFGPSLSIDGMKGSLV-----EAVPSNGCSPILPPPTLANDTSFIVLIRRYDCH 98

Query: 99  FIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTS--DVNIPSVFIAQTEYKDLRS--S 154
           F  KV + Q +G  A +V +   + L+ M    +T+   + IPSVF  +T    L +  S
Sbjct: 99  FDTKVLHAQLAGYAAAIVHNVGSDSLLHMSRNDETTWRHITIPSVFTGETAGNSLLANFS 158

Query: 155 SLKPVEVHLVKDNL--LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQV 212
                 ++L+ D    L + ++  I+VV L   VM I + V             ++ +Q+
Sbjct: 159 FYNNSHIYLMPDYSFSLGYYIIPFIVVVSLVIVVMCIIMVVRCVQYRKRIRRNRLSKEQL 218

Query: 213 VGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFC 272
                 KI     ++ +    CAICLE+Y +GD+LR+LPC H +H +C+D WLT  KK C
Sbjct: 219 -----KKIPIHKFKKGDHYDVCAICLEEYEEGDKLRVLPCSHAYHSSCVDPWLTKTKKSC 273

Query: 273 PICKRDI 279
           P+CK  +
Sbjct: 274 PVCKNRV 280



>gi|41054856|ref|NP_957338.1| ring finger protein 13 [Danio rerio]
 gi|27881904|gb|AAH44449.1| Ring finger protein 13 [Danio rerio]
          Length = 377

 Score =  107 bits (268), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 72/250 (28%), Positives = 124/250 (49%), Gaps = 22/250 (8%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKL----KRKAPTEQWIALVERGQ 96
            + D  A FG RL  EGL G+L+      A  +  C  +    +R+  +  +I L+ R  
Sbjct: 47  NFDDLPARFGYRLPSEGLKGFLIG-----ARPENACVPIEPPPQRENLSSAFIVLIRRFD 101

Query: 97  CTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTS---DVNIPSVFIAQTEYKDLRS 153
           C F  KV + Q +G  A +V + + + LI+M  + D      ++IPSVFI +     L+ 
Sbjct: 102 CNFDIKVLHAQKAGYKAAIVHNVDSDDLISM-GSEDLDILKQIDIPSVFIGEEAANSLKE 160

Query: 154 SSL--KPVEVHLVKDNLL--QWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAP 209
             +  K   V L+ D  L  ++ L+  +I+V +   ++++F+   +           +  
Sbjct: 161 DYIYEKGGHVILMPDFSLPLEYYLIPFLIIVGICLILIVVFMITKFVQDRHRARRSRLRK 220

Query: 210 QQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRK 269
            Q+      K+     ++ +    CAICL++Y +G+ LR+LPC H +H  C+D WLT  K
Sbjct: 221 DQL-----KKLPIHKFKKGDSYDVCAICLDEYEEGERLRVLPCSHAYHCKCVDPWLTKTK 275

Query: 270 KFCPICKRDI 279
           K CP+CK+ +
Sbjct: 276 KTCPVCKQKV 285



>gi|322782489|gb|EFZ10438.1| hypothetical protein SINV_04750 [Solenopsis invicta]
          Length = 447

 Score =  107 bits (268), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 80/256 (31%), Positives = 124/256 (48%), Gaps = 26/256 (10%)

Query: 42  YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAP------TEQWIALVERG 95
           ++D  A FG  +  EGL G +V      A+    C K++  AP         WI L+ R 
Sbjct: 43  FRDLPARFGGIIPPEGLKGMVVY-----ADPPTACRKIQ--APPNDTNYNSNWIVLIRRY 95

Query: 96  QCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLRSSS 155
            C+F  KVR  Q +G  A ++ +   N L  M A  D   + IPSVF++      ++ + 
Sbjct: 96  NCSFEIKVRMAQEAGYDAAIIHNVNSNELEPMSAK-DPVGITIPSVFVSDITGVVIKENY 154

Query: 156 L-KPVEVHLVKD----NLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQ 210
           L   +   L+ D    N+    LL   IVV +   +++IF+ V             + P 
Sbjct: 155 LYDQLYFILINDDTPFNINTHLLLPFAIVVGICFLIIVIFMIVRCIKDRRRQRRHRL-PS 213

Query: 211 QVVGNLATKIFFESKRQENEPQE-CAICLEDYADGDELRILPCKHEFHITCIDSWLTTRK 269
             +  + T      K  + +P E CAICL+DY +G++LR+LPC H +H  CID WLT  +
Sbjct: 214 SSLKKIPTH-----KYTKGDPYETCAICLDDYIEGEKLRVLPCAHAYHSKCIDPWLTKNR 268

Query: 270 KFCPICKRDICSPTEE 285
           + CP+CKR + +  E+
Sbjct: 269 RVCPVCKRKVFAADEQ 284



>gi|432854518|ref|XP_004067940.1| PREDICTED: E3 ubiquitin-protein ligase RNF13-like [Oryzias latipes]
          Length = 375

 Score =  107 bits (268), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 78/268 (29%), Positives = 128/268 (47%), Gaps = 26/268 (9%)

Query: 41  TYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAP---TEQWIALVERGQC 97
            + D  A FG RL  +GL G+L+      A  +  C  ++       T  +I L++R  C
Sbjct: 47  NFDDMPARFGFRLPSDGLKGFLIG-----ARPENACEPIEPPPSDNLTGAFIVLIKRFDC 101

Query: 98  TFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVN---IPSVFIAQTEYKDLRSS 154
            F  KV N Q +G  A +V + + + LI+M  + D   V    IPSVF++      L+  
Sbjct: 102 NFDVKVLNAQKAGYKAAIVHNVDSDDLISM-GSNDLDVVKQIVIPSVFVSSEAANTLKGD 160

Query: 155 SL--KPVEVHLVKDNLL--QWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQ 210
            +  K   V L+ D  L  ++ LL  +++V +   ++ +F+               +   
Sbjct: 161 YMYDKGGHVVLIPDFSLPLEYYLLPFLLIVAICLILIAVFMITKAVQDCRKAWKSRLRKD 220

Query: 211 QVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKK 270
           Q+      K+     ++ +    CAICL++Y +GD+LR+LPC H +H  C+D WLT  KK
Sbjct: 221 QL-----KKLPIHKYQKGDSYDVCAICLDEYEEGDKLRVLPCSHAYHSKCVDPWLTKTKK 275

Query: 271 FCPICKRDIC-----SPTEETPLLSNHE 293
            CP+CK+ +      S +EE+    N E
Sbjct: 276 TCPVCKQKVVPSQGDSDSEESSPEDNEE 303



>gi|170050247|ref|XP_001859945.1| zinc finger protein [Culex quinquefasciatus]
 gi|167871919|gb|EDS35302.1| zinc finger protein [Culex quinquefasciatus]
          Length = 564

 Score =  107 bits (268), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 72/250 (28%), Positives = 122/250 (48%), Gaps = 17/250 (6%)

Query: 42  YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLK---RKAPTEQWIALVERGQCT 98
           ++D  A FG  + + GL      V  + +N   GC++L          ++  ++ R  C+
Sbjct: 44  FRDFPATFGSEIPESGL-----KVRAVRSNPTDGCTELDPPPENVTLSRFAVIIARYNCS 98

Query: 99  FIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLRSSSLKP 158
           F +K+RN Q +G  AV+V +   N L  M A     D+ IPSVFI ++    +  S L P
Sbjct: 99  FEDKIRNAQKAGYAAVIVHNVGSNDLERMSAN-HAEDILIPSVFIGESNGIYIIESFLYP 157

Query: 159 VEVHLVKDNLLQWPLLDVIIV----VILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVVG 214
           +   L+  + + + + + +I+    V+    ++MI   ++              P  V+ 
Sbjct: 158 LPYALIITDDIPFNINNNLIIPFAIVVGLCFIIMICFMIIRCIRERRRQLRHRLPNSVLR 217

Query: 215 NLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCPI 274
            +    F +  + +     CAICL+DY D + LR+LPC H +H+ CID WLT  ++ CPI
Sbjct: 218 KIPIVKFAKGMQYDT----CAICLDDYVDNERLRVLPCHHAYHVKCIDPWLTKNRRVCPI 273

Query: 275 CKRDICSPTE 284
           CKR + +  E
Sbjct: 274 CKRKVFARGE 283



>gi|301787345|ref|XP_002929081.1| PREDICTED: e3 ubiquitin-protein ligase RNF167-like [Ailuropoda
           melanoleuca]
          Length = 350

 Score =  106 bits (265), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 76/255 (29%), Positives = 123/255 (48%), Gaps = 26/255 (10%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 34  ASMDFADLPALFGAALSQEGLQGFLV-----EAHPANACSPIAPPPPAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   + L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFDCNFDLKVLNAQKAGYGAAVVHNVNSDELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 148

Query: 152 RSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           R+  +  K   V LV D+         P   ++ +++L+   +M+   +           
Sbjct: 149 RALFVYEKGARVLLVPDSSFPLGYYVIPFTGIVGLLVLAMAAVMVVRCI--------QHR 200

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
             +   ++  +   +I     ++ ++   CAICL++Y DGD+LR+LPC H +H  C+D W
Sbjct: 201 KRLQRNRLTKDQLKQIPTHDYQKGDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPW 260

Query: 265 LTTRKKFCPICKRDI 279
           LT  +K CPICK+ +
Sbjct: 261 LTQTRKTCPICKQPV 275



>gi|505788740|ref|XP_004605274.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 [Sorex araneus]
          Length = 293

 Score =  106 bits (265), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 80/248 (32%), Positives = 119/248 (47%), Gaps = 20/248 (8%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQ----WIALVE 93
            ++ + D  A FG  L+ +GL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 34  ASMDFADLPALFGAALSQDGLQGFLV-----EAHPANACSPIAPPPPAPANGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C+F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + L
Sbjct: 89  RYDCSFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 148

Query: 152 RSSSL--KPVEVHLVKDNL--LQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDI 207
           R+  +  K  +V LV D+   L + L+    +V L    M   + V             +
Sbjct: 149 RALFVYEKGAQVLLVPDSSFPLGYYLIPFTGIVGLLVLAMGAVMMVRCIQHRKRLQRNRL 208

Query: 208 APQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTT 267
             +Q+      +I     R+ ++   C ICL++Y DGD+LRILPC H +H  C+D WLT 
Sbjct: 209 TKEQL-----KQIPTHDYRKGDQYDVCVICLDEYEDGDKLRILPCAHAYHSRCVDPWLTQ 263

Query: 268 RKKFCPIC 275
            +K CPIC
Sbjct: 264 TRKTCPIC 271



>gi|281343329|gb|EFB18913.1| hypothetical protein PANDA_019185 [Ailuropoda melanoleuca]
          Length = 344

 Score =  106 bits (264), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 76/255 (29%), Positives = 123/255 (48%), Gaps = 26/255 (10%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 34  ASMDFADLPALFGAALSQEGLQGFLV-----EAHPANACSPIAPPPPAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDL 151
           R  C F  KV N Q +G  A VV +   + L+ M    +     + IPSVFI +   + L
Sbjct: 89  RFDCNFDLKVLNAQKAGYGAAVVHNVNSDELLNMVWNSEEIQQQIWIPSVFIGERSSEYL 148

Query: 152 RSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           R+  +  K   V LV D+         P   ++ +++L+   +M+   +           
Sbjct: 149 RALFVYEKGARVLLVPDSSFPLGYYVIPFTGIVGLLVLAMAAVMVVRCI--------QHR 200

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
             +   ++  +   +I     ++ ++   CAICL++Y DGD+LR+LPC H +H  C+D W
Sbjct: 201 KRLQRNRLTKDQLKQIPTHDYQKGDQYDVCAICLDEYEDGDKLRVLPCAHAYHSRCVDPW 260

Query: 265 LTTRKKFCPICKRDI 279
           LT  +K CPICK+ +
Sbjct: 261 LTQTRKTCPICKQPV 275



>gi|432102022|gb|ELK29842.1| Zinc/RING finger protein 4 [Myotis davidii]
          Length = 360

 Score =  106 bits (264), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 85/294 (28%), Positives = 133/294 (45%), Gaps = 35/294 (11%)

Query: 28  VVDATIVVVATNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQ 87
           VV A +   A+ V + D  A FG  L  EG+ GYL     +EA     C  ++R  P   
Sbjct: 29  VVRAVLDGNASTVDFADLPAMFGAPLAPEGVRGYL-----MEAKPANACHPIERPPPVGN 83

Query: 88  W----IALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDT--SDVNIPSV 141
                I L+ R  CTF  KV + Q +G  A +V +   + L+ M    +     ++IP+V
Sbjct: 84  GSLGAIVLIRRYDCTFDLKVLHAQQAGFKAAIVHNVFSDDLVRMAHVYEALRHQISIPAV 143

Query: 142 FIAQTEYKDLR--SSSLKPVEVHLVKDNLLQWPLLDVIIVVILS------PTVMMIFIYV 193
           F+++   +DLR      K  +V L+  N  Q P LD   V+ +S        ++M   ++
Sbjct: 144 FVSEAAAQDLRVIMCCDKSAQV-LLLPNYPQCPDLDCHPVLAISWVLGRTLALLMSTFFI 202

Query: 194 LWXXXXXXXXXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCK 253
           L              P  V      +    +  + N+   CAICL++Y +G++L+ILPC 
Sbjct: 203 LRHLGSWLWSRWAYGPAAVKEPACRRAQVRTFTRLND--VCAICLDEYQEGEQLKILPCS 260

Query: 254 HEFHITCIDSWLT-TRKKFCPICKRDICSPT------------EETPLLSNHEP 294
           H +H  CID W +   ++ CP+CK+ + S              EE  LL +H P
Sbjct: 261 HTYHCKCIDPWFSQAAQRACPVCKQSVASTEDSSDSTIDSFCDEEPALLGHHAP 314



>gi|482550564|gb|EOA14758.1| hypothetical protein CARUB_v10028055mg [Capsella rubella]
          Length = 305

 Score =  105 bits (263), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 79/262 (30%), Positives = 128/262 (48%), Gaps = 20/262 (7%)

Query: 31  ATIVVVATNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIA 90
           AT+V+ + + ++ D  A F   +T  G+ G L   + ++     GCS L     T++  A
Sbjct: 26  ATVVLNSISASFPDLPAKFEGSVTKNGICGALYVADPLD-----GCSPLVHNNLTQEKFA 80

Query: 91  LVERGQCTFIEKVRNMQASGAIAVVVGDNEKN-GLITMYATGDTSDVNIPSVFIAQTEYK 149
           L+ RG+C+F +K+ + Q SG  AV+V DN  N  L+ M    +  D+ + +VF++    +
Sbjct: 81  LIIRGECSFEDKLLHAQNSGFRAVIVYDNIDNQDLVVMKV--NPQDITVDAVFVSNVAGE 138

Query: 150 DL-RSSSLKPVEVHLVK-DNLLQWPLLDVIIVVILSPTVMMIFI------YVLWXXXXXX 201
            L + +  +  E  L        W +L +    +L     ++        +  W      
Sbjct: 139 ILSKYARGRDGECCLYPPSKGSAWTVLAISFFSLLLILTFLLLAFFAPRHWTQWRGSHFR 198

Query: 202 XXXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCI 261
               D    ++V +L +  F +S   +     C ICLEDY  G+ LR+LPC+H FH++CI
Sbjct: 199 TIRVD---AKLVHSLPSFPFTDSSHHK-AGDTCPICLEDYTSGETLRLLPCQHAFHLSCI 254

Query: 262 DSWLTTRKKFCPICKRDICSPT 283
           DSWLT     CP+CK DI S T
Sbjct: 255 DSWLTKWGTSCPVCKHDIRSDT 276



>gi|148908683|gb|ABR17449.1| unknown [Picea sitchensis]
          Length = 469

 Score =  104 bits (260), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 76/264 (28%), Positives = 130/264 (49%), Gaps = 23/264 (8%)

Query: 31  ATIVVVATNVTYQ--DRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQW 88
           A ++++  ++++   D  A+F   +   G+ G L   E  +A     CS+L  K  + + 
Sbjct: 29  ANVILIGNSMSFSFDDTEASFVVAMKGSGICGVLQVAEPSDA-----CSQLSNKNVSGEG 83

Query: 89  ----IALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNG-LITMYATGDTSDVNIPSVFI 143
                 L++RG+C+F  KV+  Q +G  A ++ +NE +  L+TM   G++  + I +VF+
Sbjct: 84  ANSPFVLIQRGKCSFETKVQIAQDAGFKAAIIYNNEDSSDLVTM--RGNSKGITIYAVFV 141

Query: 144 AQTE----YKDLRSSSLKPVEVHLVKDNLLQWPLLDVIIVVILSPTVMM-IFI--YVLWX 196
           ++       K    S+++   +  +K+      ++    +V ++  + M IF+  Y L  
Sbjct: 142 SEAAGHVLLKYAGDSNMECWIIPSLKNTSWSAMVISFASLVAMAAVLAMCIFVRKYRLQQ 201

Query: 197 XXXXXXXXXDIAPQQV--VGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKH 254
                     +       V  L + IF          + CAICLEDY  G++LR+LPC H
Sbjct: 202 VRHGLLHLDQLNGMSFLQVKALPSLIFNSVSGNNCTSETCAICLEDYTAGEKLRVLPCCH 261

Query: 255 EFHITCIDSWLTTRKKFCPICKRD 278
            FH  CIDSWLT  + FCP+CKRD
Sbjct: 262 RFHALCIDSWLTMWRTFCPVCKRD 285



>gi|148703376|gb|EDL35323.1| ring finger protein 13, isoform CRA_c [Mus musculus]
          Length = 354

 Score =  104 bits (260), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 63/194 (32%), Positives = 100/194 (51%), Gaps = 3/194 (1%)

Query: 88  WIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATG-DT-SDVNIPSVFIAQ 145
           +I L+ R  C F  KV N Q +G  A +V + + + LI+M +   DT   ++IPSVFI +
Sbjct: 66  FIVLIRRLDCNFDIKVLNAQRAGYKAAIVHNVDSDDLISMGSNDIDTLKKIDIPSVFIGE 125

Query: 146 TEYKDLRSSSLKPVEVHLVKDNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXX 205
           +    L+         H++    L  PL   +I  ++   + +I I V++          
Sbjct: 126 SSANSLKDEFTYEKGGHIILVPELSLPLEYYLIPFLIIVGICLILI-VIFMITKFVQDRH 184

Query: 206 DIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWL 265
                ++  +   K+     ++ +E   CAICLE+Y DGD+LRILPC H +H  C+D WL
Sbjct: 185 RNRRNRLRKDQLKKLPVHKFKKGDEYDVCAICLEEYEDGDKLRILPCSHAYHCKCVDPWL 244

Query: 266 TTRKKFCPICKRDI 279
           T  KK CP+CK+ +
Sbjct: 245 TKTKKTCPVCKQKV 258



>gi|507696250|ref|XP_004643365.1| PREDICTED: RING finger protein 148 [Octodon degus]
          Length = 303

 Score =  103 bits (258), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 79/264 (29%), Positives = 119/264 (45%), Gaps = 29/264 (10%)

Query: 39  NVTYQ--DRIAAFGPRLTDEGLLGYLVSVEMIEAN-------NQKGCSKL---KRKAPTE 86
           N+T+Q  +RI +    L + G+ G    +E +          NQ  C+ L    R    E
Sbjct: 43  NITFQVGNRIIS---ELGESGVFGNHSPLERVSGAVVLPDGWNQNACNPLTNFSRPEQAE 99

Query: 87  QWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQT 146
            W+AL+ERG CTF  K+      GA  V++ +    G   ++        NI +V I   
Sbjct: 100 SWLALIERGGCTFTHKINVAAEKGAQGVIIYNYPGTG-NKVFPMSHQGTENIVAVMIGNL 158

Query: 147 EYKDLRSSSLKPVEVHLVKD-NLLQWPLLD---VIIVVILSPTVMMIFIYVLWXX----- 197
           +  +L     K V V+++ +   +  P L    + +   LS T+  IF+Y  W       
Sbjct: 159 KGMELLHLIRKGVYVNIIIEVGRVHMPWLSQCIMFLFTFLSTTIAYIFLYCAWRSGMPIY 218

Query: 198 XXXXXXXXDIAPQQVVGNLATKIFFESKRQENEPQE--CAICLEDYADGDELRILPCKHE 255
                     + ++ VG L  ++  E  + E +P E  C IC + Y   D +RIL CKH 
Sbjct: 219 SARRRRQVKASVKKAVGQLQLRVLTEGDK-EVDPHEDTCVICFDVYKPQDVVRILTCKHF 277

Query: 256 FHITCIDSWLTTRKKFCPICKRDI 279
           FH TCID WL  R+  CP+CK DI
Sbjct: 278 FHKTCIDPWLLARRT-CPMCKCDI 300



>gi|410915606|ref|XP_003971278.1| PREDICTED: E3 ubiquitin-protein ligase RNF167-like [Takifugu
           rubripes]
          Length = 409

 Score =  103 bits (258), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 69/260 (26%), Positives = 124/260 (47%), Gaps = 19/260 (7%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTE--------QWI 89
           T++ ++D  A FG  L  +GL+G LV    +      GC+ +    P          + I
Sbjct: 40  TSMLFEDLPALFGAELPKDGLMGVLVVSRPL-----NGCTPIDPPPPLSPMFDLNITKSI 94

Query: 90  ALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDT--SDVNIPSVFIAQTE 147
           AL+ R  C F  KV + Q +G  A ++ +   + L+ M  + +T   ++ IPSVF +   
Sbjct: 95  ALIRRYDCNFDLKVLHAQQAGYSAAIIHNMYSDILLHMDYSNETIAKEILIPSVFTSYYA 154

Query: 148 YKDLRSSSLKPVEVHLVKDNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDI 207
            + ++++ +     +++      +PL    ++       M+I +  +            I
Sbjct: 155 AQSIKNAIIPEHGAYVILKPEFSFPL-SYYLIPFTGVVGMIILVMCVVMTIRCIQYRKRI 213

Query: 208 APQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTT 267
              ++      +I     R+ ++   CAICL+DY +GD+LR+LPC H +H  C+D WLT 
Sbjct: 214 RKNRLSKEQLKRIPIHKFRKGDDYDVCAICLDDYEEGDKLRVLPCSHAYHCKCVDPWLTK 273

Query: 268 RKKFCPICKRDICSPTEETP 287
            KK CP+CK+ +   T++ P
Sbjct: 274 TKKTCPVCKQRV---TQKNP 290



>gi|168027185|ref|XP_001766111.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162682754|gb|EDQ69170.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 286

 Score =  103 bits (257), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 80/244 (32%), Positives = 115/244 (47%), Gaps = 31/244 (12%)

Query: 70  ANNQKGCSKLKRKAPTEQWI---ALVERGQCTFIEKVRNMQASGAIAVVVGDNEK--NGL 124
           AN    C+ LK   P  + +    ++ RG C F +KVRN Q +G  A +V +     + L
Sbjct: 9   ANPLDACTPLKNDIPKGERLPPFVVISRGTCNFDKKVRNAQKAGFQAAIVYNTIDFIDEL 68

Query: 125 ITMYATGDTSDVNIPSVFIAQTEYKDL-------RSSSLKPVEVHLVKDNLLQWPLLDVI 177
           +T   + +  D++I +VF++    + L        + +L P     VKDN     +   I
Sbjct: 69  VTSKHSDE--DIDIYAVFVSWITGQALLGAVGENNTCTLLPA----VKDNAWSITVFSSI 122

Query: 178 IVVILSPTVMMIFIYVL-----WXXXXXXXXXXDIAPQQVVGNLATKIFFESKRQENEPQ 232
             + +S  V+  F +V                      + V  L T +F  +   E    
Sbjct: 123 TFLAVS-AVLSTFFFVRRDRLRGLGSRLLSRELSRMDARDVDALPTFVFKGAGSDEAGTG 181

Query: 233 E-CAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCPICKRDIC------SPTEE 285
           E CAICLEDY  G++LR LPC H+FH+ CID WL TRK FCPICK+D        + TE 
Sbjct: 182 ETCAICLEDYESGEKLRHLPCHHDFHVGCIDQWLLTRKPFCPICKQDANVTPAYPAATET 241

Query: 286 TPLL 289
           TPLL
Sbjct: 242 TPLL 245



>gi|242005538|ref|XP_002423621.1| sperizin, RING finger protein, putative [Pediculus humanus
           corporis]
 gi|212506781|gb|EEB10883.1| sperizin, RING finger protein, putative [Pediculus humanus
           corporis]
          Length = 387

 Score =  103 bits (257), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 69/225 (30%), Positives = 111/225 (49%), Gaps = 29/225 (12%)

Query: 87  QWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQT 146
           +WI L+ R  C F  KVRN Q +G  A +V  N  + ++   A  + + + IPS+FI+  
Sbjct: 111 KWIVLIRRYGCEFEIKVRNAQIAGYDAAIV-HNVNSSVLKPMAADNPNMIRIPSIFIS-- 167

Query: 147 EYKDLRSSSLKPVEVHLVKDNLLQWPLLDVI-------IVVILSPTVMMIFIYVLWXXXX 199
                 S +   ++++ + DN     + D I       +++I S  +   F  +L+    
Sbjct: 168 ------SDAGLLIKMNYLYDNGYYILITDDIPFNFTSQLLIIFSVLIGFCFFVILFFLIV 221

Query: 200 XXXXXXDIAPQQVVGNLATKIFFESKRQENEPQE-CAICLEDYADGDELRILPCKHEFHI 258
                     +  +   + K     K ++N+P E CAICLE+Y + D+LR+LPC H +H 
Sbjct: 222 KYFKDRRRQRRYCLPKSSLKKITVHKFKKNDPYEICAICLEEYVENDKLRVLPCSHAYHS 281

Query: 259 TCIDSWLTTRKKFCPICKR----------DICSPTEE--TPLLSN 291
            CID WLT +++ CP+CKR          D  S TE+  TPL+ N
Sbjct: 282 KCIDPWLTKKRRVCPVCKRKVFASGETVADFDSETEDETTPLVRN 326



>gi|149064727|gb|EDM14878.1| rCG50011, isoform CRA_c [Rattus norvegicus]
          Length = 353

 Score =  103 bits (256), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 62/195 (31%), Positives = 99/195 (50%), Gaps = 5/195 (2%)

Query: 88  WIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTS---DVNIPSVFIA 144
           +I L+ R  C F  KV N Q +G  A +V + + + LI+M  + D      ++IPSVFI 
Sbjct: 66  FIVLIRRLDCNFDIKVLNAQRAGYKAAIVHNVDSDDLISM-GSNDIDILKKIDIPSVFIG 124

Query: 145 QTEYKDLRSSSLKPVEVHLVKDNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXX 204
           ++    L+         H++    L  PL   +I  ++   + +I I V++         
Sbjct: 125 ESSANSLKDEFTYEKGGHVILVPELSLPLEYYLIPFLIIVGICLILI-VIFMITKFVQDR 183

Query: 205 XDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSW 264
                 ++  +   K+     ++ +E   CAICLE+Y DGD+LRILPC H +H  C+D W
Sbjct: 184 HRNRRNRLRKDQLKKLPVHKFKKGDEYDVCAICLEEYEDGDKLRILPCSHAYHCKCVDPW 243

Query: 265 LTTRKKFCPICKRDI 279
           LT  KK CP+CK+ +
Sbjct: 244 LTKTKKTCPVCKQKV 258



>gi|395844712|ref|XP_003795099.1| PREDICTED: LOW QUALITY PROTEIN: zinc/RING finger protein 4-like
           [Otolemur garnettii]
          Length = 614

 Score =  103 bits (256), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 84/297 (28%), Positives = 132/297 (44%), Gaps = 38/297 (12%)

Query: 25  SNFVVDATIVVVATNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAP 84
           S  VV A +   A+ V + D  A FG  L  EG+ GYL     +EA     C  ++   P
Sbjct: 263 SQAVVRAVLEDNASTVDFADLPALFGVPLAPEGVRGYL-----MEAKPANACQPIEGPQP 317

Query: 85  TEQ---WIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIP 139
             +    I L+ R  C+F  KV + Q +G  A +V +   + L+ M    +   S + IP
Sbjct: 318 GNRSLGAIVLIRRYDCSFDLKVLHAQRAGFEAAIVHNVRSDDLVRMAHVYEDLRSQIAIP 377

Query: 140 SVFIAQTEYKDLR-------SSSLKPVEVHLVKDNLLQWPLLDVIIVVILSPTVMMIFIY 192
           SVF+ +   +DLR       S+ +  +  H    +L   P+L V  V+  +  ++M   +
Sbjct: 378 SVFVGEAASQDLRVIVRCDKSAHVLLLPNHPPCPDLDCHPVLAVSWVLGRTLALVMSVTF 437

Query: 193 VL---WXXXXXXXXXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRI 249
           VL   W           +           + F  ++R +     CAICL++Y +GD+L+I
Sbjct: 438 VLRRLWLWVRAWWTRGPVVKTPTCQKAQVRTF--TRRND----LCAICLDEYEEGDQLKI 491

Query: 250 LPCKHEFHITCIDSWLT-TRKKFCPICKRDIC-----------SPTEETPLLSNHEP 294
           LPC H +H  CID W     ++ CP+CK+ +            S  +E P L  H P
Sbjct: 492 LPCSHTYHCKCIDPWFAQATRRSCPVCKQSVAGTEDGSDSTADSFCDEDPSLPGHRP 548



>gi|431893955|gb|ELK03761.1| E3 ubiquitin-protein ligase RNF167 [Pteropus alecto]
          Length = 361

 Score =  102 bits (255), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 86/284 (30%), Positives = 127/284 (44%), Gaps = 42/284 (14%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPT----EQWIALVE 93
            ++ + D  A FG  L+ EGL G+LV     EA+    CS +    P       +IAL+ 
Sbjct: 34  ASMDFADLPALFGAALSQEGLQGFLV-----EAHPANACSPIAPPPPAPVNGSVFIALLR 88

Query: 94  RGQCTFIEKVR------------NMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIP 139
           R  C F  KV             N Q +G  A VV +   N L+ M    +     + IP
Sbjct: 89  RFDCNFDLKVAEYGVGAGKLRVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIP 148

Query: 140 SVFIAQTEYKDLRSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIY 192
           SVFI +   + LR+  +  K   V LV DN         P   ++ +++L+   +MI   
Sbjct: 149 SVFIGERSSEYLRALFVYEKGARVLLVPDNSFPLGYYLIPFTGIVGLLVLAMGAVMI--- 205

Query: 193 VLWXXXXXXXXXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPC 252
           V             +  +Q+      +I     ++ ++   CAICL++Y DGD+LR+LPC
Sbjct: 206 VRCIQHRKRLQRNRLTKEQL-----KQIPTHDYQKGDQYDVCAICLDEYEDGDKLRVLPC 260

Query: 253 KHEFHITCIDSWLTTRKKFCPICKRDICSPTEETPLLSNHEPTP 296
            H +H  C+D WLT  +K CPICK+    P    P     E TP
Sbjct: 261 AHAYHSRCVDPWLTQTRKTCPICKQ----PVHRGPGDEEQEETP 300



>gi|326668275|ref|XP_002662262.2| PREDICTED: e3 ubiquitin-protein ligase RNF167-like [Danio rerio]
          Length = 401

 Score =  102 bits (254), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 74/259 (28%), Positives = 122/259 (47%), Gaps = 18/259 (6%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKR--KAPTE-------QW 88
           T++ ++D  A FG  L  +GL+G L     IEA  Q  C+ +     +PT        ++
Sbjct: 37  TSMLFEDLPALFGSALPKDGLMGVL-----IEARPQNACTPIDPPPASPTPADPNSTTKY 91

Query: 89  IALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDT--SDVNIPSVFIAQT 146
           I L+ R  C F  KV + Q +G  A +V +   N L+ M  + +T   +++IPSVF +  
Sbjct: 92  IVLIRRYDCNFDVKVYHAQQAGYSAAIVHNMYSNSLLNMGYSNETIAEEISIPSVFTSFF 151

Query: 147 EYKDLRSSSLKPVEVHLVKDNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXD 206
             + L    +     ++V      +PL    ++       M+I + V+            
Sbjct: 152 ASQMLHKI-IPEKGAYVVLKPEFSFPL-SYYLIPFTGVVCMIIIVMVIIMIVRCVQHRKR 209

Query: 207 IAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLT 266
           +   ++      KI      + +    CAICL++Y +GD+LR+LPC H +H  C+D WLT
Sbjct: 210 LRKNRLSKEQLKKIPIHKFNKGDSYDVCAICLDEYEEGDKLRVLPCSHAYHSRCVDPWLT 269

Query: 267 TRKKFCPICKRDICSPTEE 285
             KK CP+CK+ +  P  E
Sbjct: 270 QTKKTCPVCKQRVTRPNPE 288



>gi|459173360|ref|XP_002121719.2| PREDICTED: E3 ubiquitin-protein ligase RNF13 [Ciona intestinalis]
          Length = 432

 Score =  102 bits (254), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 79/269 (29%), Positives = 135/269 (50%), Gaps = 33/269 (12%)

Query: 34  VVVAT---NVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLK-RKAPTEQ 87
           VVVA    N+T  + D  A FG  +  +GL G L++ E ++A     C  +K R  P   
Sbjct: 23  VVVAYDRFNITEQFSDYPAEFGTSVGPDGLDGILMAAEPLDA-----CKPVKERPYPAST 77

Query: 88  WI--------ALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVN 137
           ++        ALV RG C F  KV N Q +   +V+V ++  N ++ M        + + 
Sbjct: 78  FMPNITFNAFALVIRGGCDFALKVLNAQKAHYNSVIVYNDVSNDIVRMNTNQPDIANQIV 137

Query: 138 IPSVFIAQTEYKDLRSSSL---KPVEVHLVKDN----LLQWPLLDVIIVVILSPTVMMIF 190
           IPSVF+       L  + L   K + +  +        L++ ++  + V+     V+++F
Sbjct: 138 IPSVFVGNDAGIILSQNYLYNNKNIPIIKITGGESPFSLEYYIIPFVTVLATCIVVLLLF 197

Query: 191 IYVLWXXXXXXXXXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRIL 250
           ++V +           ++ ++ +  + TK F    ++ +E   CAICL+DY +GD LRIL
Sbjct: 198 MFVRYLRDRRRQRRNRLS-RRRLKQIPTKQF----KKGDEYDVCAICLDDYEEGDTLRIL 252

Query: 251 PCKHEFHITCIDSWLTTRKKFCPICKRDI 279
           PC+H +H  C+D WLT+ ++ CP+CKR +
Sbjct: 253 PCQHAYHCKCVDPWLTSSRRVCPLCKRRV 281



>gi|168009680|ref|XP_001757533.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162691227|gb|EDQ77590.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 308

 Score =  102 bits (253), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 85/266 (31%), Positives = 126/266 (47%), Gaps = 40/266 (15%)

Query: 50  GPRLTDEGLLGYLVSVEMIEANNQKGCSKL-------KRKAPTEQWIALVERGQCTFIEK 102
            PR+   G+ G L +   ++A     CS L       K  AP      LV+RG C F  K
Sbjct: 3   APRVPTAGVGGVLYASNPLDA-----CSPLLNVSTPGKGSAPA---FLLVQRGVCNFEIK 54

Query: 103 VRNMQASGAIAVVV-GDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKD---LRSSSLKP 158
           VR  Q +G  AV+V  D +   L+T       + VNI +  +  ++Y     L+ +    
Sbjct: 55  VRLAQEAGFAAVIVYNDQDDRELVTR------NPVNIHAYAVFVSKYSGEFLLKYAGDVG 108

Query: 159 VEVHLVK--DNLLQWPLLDVIIVVILS-PTVMMIFIYVL---WXXXXXXXXXXDIAPQQV 212
              H++   +N   W ++ V  + +L+  +V+  F +V               + A   V
Sbjct: 109 ATCHIMPAFENT-AWSVMAVSFISLLAVSSVLATFFFVRQHRLRHLSARYLLREPAGMSV 167

Query: 213 --VGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKK 270
             V  L + IF   +  +   + C +CLEDY  G+ LR+LPC+HEFH+ CID WLT RK 
Sbjct: 168 KEVNALPSLIFKCVEDGKCTSETCVVCLEDYIPGERLRLLPCQHEFHLDCIDQWLTLRKP 227

Query: 271 FCPICKRDICS------PTEETPLLS 290
           FCP+CKRD  S       TE TPL++
Sbjct: 228 FCPVCKRDAQSQVHEPVATETTPLMA 253



>gi|432899466|ref|XP_004076572.1| PREDICTED: E3 ubiquitin-protein ligase RNF167-like [Oryzias
           latipes]
          Length = 395

 Score =  101 bits (252), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 74/262 (28%), Positives = 124/262 (47%), Gaps = 19/262 (7%)

Query: 31  ATIVVVATNVT---YQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAP--- 84
           A I V + N++   ++D  A FG R+   GL G LV  +   AN   GC+ +    P   
Sbjct: 31  AYIYVNSKNMSSMLFEDLPALFGARVPTGGLTGLLVPSQ--PAN---GCAAMNPPPPLPS 85

Query: 85  -----TEQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDT--SDVN 137
                T +++AL++R  C F  KV + Q +G  A ++ +   + L+ M  + DT    + 
Sbjct: 86  SFDANTTKFVALIKRYDCNFDIKVFHAQQAGYSAAIIHNMYSDTLLNMNYSNDTIAEQIE 145

Query: 138 IPSVFIAQTEYKDLRSSSLKPVEVHLVKDNLLQWPLLDVIIVVILSPTVMMIFIYVLWXX 197
           IPSVF +    + LR+       V++       +PL    ++       M+I +  +   
Sbjct: 146 IPSVFTSYYASEILRTYLFPEHVVYVTLKPEFAFPL-SYYLIPFTGVVGMIIIVMCVIMI 204

Query: 198 XXXXXXXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFH 257
                    I   ++      +I      + ++   CAICL++Y +GD+LR+LPC H +H
Sbjct: 205 IRCVQYRKRIRKNRLTKEQLKRIPTHRFTKGDDYDVCAICLDEYEEGDKLRVLPCSHAYH 264

Query: 258 ITCIDSWLTTRKKFCPICKRDI 279
             C+D WLT  KK CP+CK+ +
Sbjct: 265 CKCVDPWLTQTKKTCPVCKQRV 286



>gi|512908552|ref|XP_004901370.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 isoform X4
           [Heterocephalus glaber]
          Length = 376

 Score =  100 bits (250), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 79/279 (28%), Positives = 124/279 (44%), Gaps = 50/279 (17%)

Query: 38  TNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQ--WIALVERG 95
            ++ + D  A FG  L+ EGL G+LV     EA+ +  C+ +    P     +IAL+ R 
Sbjct: 34  ASMDFADLPALFGATLSQEGLQGFLV-----EAHPENACTPIAPPPPVNGSVFIALLRRF 88

Query: 96  QCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQTEYKDLRS 153
            C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +   + LR+
Sbjct: 89  DCNFDLKVLNAQKAGYGAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGERSAEYLRA 148

Query: 154 SSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXD 206
             +  K   V LV DN         P   ++ +++L+   +M+   V             
Sbjct: 149 LFVYEKGARVLLVPDNSFPLGYYLIPFSGIVGLLVLAMGAVMV---VRCIQHRKRLQRNR 205

Query: 207 IAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKH------------ 254
           +  +Q+      +I     ++ ++   CAICL++Y DGD+LR+LPC H            
Sbjct: 206 LTKEQL-----KQIPTHDYQKGDQYDVCAICLDEYEDGDKLRVLPCAHGEAFTACAHALT 260

Query: 255 --------------EFHITCIDSWLTTRKKFCPICKRDI 279
                          +H  C+D WLT  +K CPICK+ +
Sbjct: 261 PPTGTRYFTSFFFAAYHSRCVDPWLTQTRKTCPICKQPV 299



>gi|472351686|ref|XP_004395525.1| PREDICTED: LOW QUALITY PROTEIN: zinc/RING finger protein 4-like
           [Odobenus rosmarus divergens]
          Length = 517

 Score =  100 bits (250), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 81/273 (29%), Positives = 125/273 (45%), Gaps = 27/273 (9%)

Query: 25  SNFVVDATIVVVATNVTYQDRIAAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAP 84
           S  VV A +   A+ V + D  A FG  L  EG+ GYL     +EA     C  ++   P
Sbjct: 185 SEAVVRAVLDGNASTVDFADLPALFGVPLAPEGVRGYL-----MEAKPANACHPIEGPRP 239

Query: 85  TEQ---WIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIP 139
                  I L+ R  CTF  KV + Q +G  A +V +   + L+ M    +     + IP
Sbjct: 240 GNGSLGAIVLIRRYDCTFDLKVLHAQRAGFEAAIVHNVRSDELVRMAHVYEDLRRQIAIP 299

Query: 140 SVFIAQTEYKDLR--SSSLKPVEVHLVKD-----NLLQWPLLDVIIVV---ILSPTVMMI 189
           SVF+ +   +DLR  +   K   V L+ D     +L   P+L V  V+   +   T  ++
Sbjct: 300 SVFVGEAASQDLRVIARCDKAAHVLLLPDYPPCPDLDCHPVLAVSWVLGRALALLTAAVV 359

Query: 190 FIYVLWXXXXXXXXXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRI 249
            +  LW            A  Q       + F  ++R +     CAICL++Y +GD+L+I
Sbjct: 360 VLRQLWNWLWAWWSRGPEAKPQACQKAQVRTF--TRRND----LCAICLDEYEEGDQLKI 413

Query: 250 LPCKHEFHITCIDSWLT-TRKKFCPICKRDICS 281
           LPC H +H  CID W +   ++ CP+CK+ +  
Sbjct: 414 LPCSHTYHCKCIDPWFSQAARRSCPVCKQSVAG 446



>gi|432091227|gb|ELK24432.1| RING finger protein 148 [Myotis davidii]
          Length = 303

 Score =  100 bits (249), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 77/265 (29%), Positives = 117/265 (44%), Gaps = 31/265 (11%)

Query: 39  NVTYQ--DRI-------AAFGPRLTDEGLLGYLVSVEMIEANNQKGCSKLKRKAPTEQWI 89
           N+T+Q  +RI         FG     E + G +V  E    N     +   R  P + W+
Sbjct: 43  NITFQVGNRIISELGESGVFGNHSPLERVAGAVVLPEGWNLNACHSLTNFSRPQPEDSWL 102

Query: 90  ALVERGQCTFIEKVRNMQASGAIAVVV----GDNEKNGLITMYATGDTSDVNIPSVFIAQ 145
           AL+ERG CTF  K+      GA  V++    G   K   ++ + TG+T      +V I  
Sbjct: 103 ALIERGGCTFTHKINVAAEKGANGVIIYNYPGTGNKVFPMSHHGTGNTV-----AVMIGN 157

Query: 146 TEYKDLRSSSLKPVEVHLVKD-NLLQWPLLDVIIVVI---LSPTVMMIFIYVLWX----- 196
            +  +L     K V V +V +   +  P L   ++ +   L+PTV  +F+Y  W      
Sbjct: 158 LKGLELLHLIQKGVYVTIVIEVGRMHMPWLSYYVMSLFTFLAPTVAYLFLYCAWRPRAPN 217

Query: 197 XXXXXXXXXDIAPQQVVGNLATKIFFESKRQENEPQE--CAICLEDYADGDELRILPCKH 254
                        ++ +  L  ++  E  + E +P E  C +C + Y   D +RIL CKH
Sbjct: 218 SSTRRRRQIKANVKKAIAQLPLRVLREGDK-ELDPNEHSCVVCFDTYKPQDAVRILTCKH 276

Query: 255 EFHITCIDSWLTTRKKFCPICKRDI 279
            FH  CID WL  R+  CP+CK DI
Sbjct: 277 FFHKACIDPWLLARRT-CPMCKCDI 300



>gi|256084210|ref|XP_002578324.1| zinc finger protein [Schistosoma mansoni]
 gi|360043414|emb|CCD78827.1| putative zinc finger protein [Schistosoma mansoni]
          Length = 411

 Score =  100 bits (249), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 65/243 (26%), Positives = 120/243 (49%), Gaps = 11/243 (4%)

Query: 42  YQDRIAAFGPRLTDEG--LLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIALVERGQCTF 99
           ++D  A FG R   +G  +LG +   E ++    +          T  +I+L++RG C+F
Sbjct: 36  FEDSEALFG-RAVSQGSLILGRIHVSEPLDGCIDRIPKPKNASNSTLPYISLIKRGNCSF 94

Query: 100 IEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLRSS---SL 156
           ++K    +  G IA V+ ++  +    M     +++V+IP+V +  ++ + L +    S 
Sbjct: 95  VDKATAAEKGGYIAAVIFNDADDSTFPM-GYNSSTNVSIPAVMVGLSDGELLLNKYWESR 153

Query: 157 KPVEVHLVKDNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVVGNL 216
             VE+       +   L+ +I  +++S  V +   Y +              P + +  +
Sbjct: 154 YFVEILPTHRRSILLYLIPLITCLLIS-VVALSVAYGIRFLNRYRRRYRYCLPAKELRKI 212

Query: 217 ATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCPICK 276
              +F    +  +E + CAICLEDY DG++LR+LPC+H +H  C+D WL  R+  CPICK
Sbjct: 213 PETLF---TKDSSEFETCAICLEDYKDGNKLRVLPCRHAYHSKCVDPWLLKRRGVCPICK 269

Query: 277 RDI 279
           + +
Sbjct: 270 KKV 272



>gi|507549664|ref|XP_004658645.1| PREDICTED: RING finger protein 148 [Jaculus jaculus]
          Length = 303

 Score =  100 bits (249), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 77/269 (28%), Positives = 121/269 (44%), Gaps = 33/269 (12%)

Query: 39  NVTYQ--DRIAAFGPRLTDEGLLGYLVSVEMI-------EANNQKGCSKL---KRKAPTE 86
           N+T+Q  +RI +    L + GL G    +E +       E  NQ  C+ L    R    +
Sbjct: 43  NITFQVGNRIIS---ELGESGLFGNHSPLERVSGAVVLPEGWNQNACNPLTNFSRPDQAD 99

Query: 87  QWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQT 146
            W+AL+ERG CTF  K+      GA  V++ +    G   ++        NI +V I   
Sbjct: 100 SWLALIERGGCTFTHKINVAAEKGANGVIIYNYPGTG-NKVFPMSHQGTENIVAVMIGNL 158

Query: 147 EYKDLRSSSLKPVEVHLVKD-NLLQWPLLDVIIV---VILSPTVMMIFIYVLW------- 195
           +  +L     K V V ++ +   +  P L   ++    +L+ T+  +F+Y  W       
Sbjct: 159 KGMELLQLIQKGVYVTVIIEVGRMHMPWLSHYVMSLFTLLAATIAYLFLYCAWRPQVPNS 218

Query: 196 XXXXXXXXXXDIAPQQVVGNLATKIFFESKRQENEPQE--CAICLEDYADGDELRILPCK 253
                     D+  ++ +G L  ++  E  + E  P E  C +CL+ Y   D +RIL CK
Sbjct: 219 STRRQRQTKADV--KKAIGQLQLRVLKEGDK-ELHPNEDNCVVCLDTYRPHDVIRILSCK 275

Query: 254 HEFHITCIDSWLTTRKKFCPICKRDICSP 282
           H FH TCID WL   +  CP+CK D+  P
Sbjct: 276 HFFHKTCIDPWLLAHRT-CPMCKCDVLKP 303



>gi|256084206|ref|XP_002578322.1| zinc finger protein [Schistosoma mansoni]
 gi|360043413|emb|CCD78826.1| putative zinc finger protein [Schistosoma mansoni]
          Length = 455

 Score =  100 bits (248), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 65/243 (26%), Positives = 120/243 (49%), Gaps = 11/243 (4%)

Query: 42  YQDRIAAFGPRLTDEG--LLGYLVSVEMIEANNQKGCSKLKRKAPTEQWIALVERGQCTF 99
           ++D  A FG R   +G  +LG +   E ++    +          T  +I+L++RG C+F
Sbjct: 36  FEDSEALFG-RAVSQGSLILGRIHVSEPLDGCIDRIPKPKNASNSTLPYISLIKRGNCSF 94

Query: 100 IEKVRNMQASGAIAVVVGDNEKNGLITMYATGDTSDVNIPSVFIAQTEYKDLRSS---SL 156
           ++K    +  G IA V+ ++  +    M     +++V+IP+V +  ++ + L +    S 
Sbjct: 95  VDKATAAEKGGYIAAVIFNDADDSTFPM-GYNSSTNVSIPAVMVGLSDGELLLNKYWESR 153

Query: 157 KPVEVHLVKDNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXXXXXXXXDIAPQQVVGNL 216
             VE+       +   L+ +I  +++S  V +   Y +              P + +  +
Sbjct: 154 YFVEILPTHRRSILLYLIPLITCLLIS-VVALSVAYGIRFLNRYRRRYRYCLPAKELRKI 212

Query: 217 ATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHITCIDSWLTTRKKFCPICK 276
              +F    +  +E + CAICLEDY DG++LR+LPC+H +H  C+D WL  R+  CPICK
Sbjct: 213 PETLF---TKDSSEFETCAICLEDYKDGNKLRVLPCRHAYHSKCVDPWLLKRRGVCPICK 269

Query: 277 RDI 279
           + +
Sbjct: 270 KKV 272



>gi|348538752|ref|XP_003456854.1| PREDICTED: E3 ubiquitin-protein ligase RNF167-like [Oreochromis
           niloticus]
          Length = 387

 Score = 99.8 bits (247), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 73/260 (28%), Positives = 121/260 (46%), Gaps = 25/260 (9%)

Query: 30  DATIVVVATNVT--YQDRIAAFGPRLTDEGLLGYLVSVEMIEAN---NQKGCSKLKRKAP 84
           DA I    +N+T  ++DR A FG  L  +G++G LV+     A    +          A 
Sbjct: 30  DAYIYAHYSNITNLFEDRPALFGSGLPKDGIMGVLVASHPANACTTIDPPPPLPPSFNAT 89

Query: 85  TEQWIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITM-YATGD----TSDVNIP 139
           T +++ L++R  C F  KV N Q +G  A +V +     L+ M Y+ G+           
Sbjct: 90  TTKFVVLIKRYDCNFDIKVLNAQQAGYDAAIVHNVYSEILLNMNYSNGNYFLQKQTHFYF 149

Query: 140 SVFIAQTEYKDLRSSSLKPVEVHLVKDNLLQWPLLDVIIVVILSPTVMMIFIYVLWXXXX 199
            +F+A   Y  LR     P+  +L+           V+ ++IL  +V+ I   V +    
Sbjct: 150 FLFLACRAYVILRPEFPFPLSYYLIL-------FAGVVCMIILVMSVIFIIRCVQYRKR- 201

Query: 200 XXXXXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHIT 259
                  +   ++      +I      + ++   CAICL++Y +GD+LR+LPC H +H  
Sbjct: 202 -------LRKNRLSKEQLKRIPIHKFSKGDDYDVCAICLDEYEEGDKLRVLPCSHAYHCK 254

Query: 260 CIDSWLTTRKKFCPICKRDI 279
           C+D WLT  KK CP+CK+ +
Sbjct: 255 CVDPWLTQTKKTCPVCKQRV 274



>gi|488510399|ref|XP_004447287.1| PREDICTED: E3 ubiquitin-protein ligase RNF167 isoform 2 [Dasypus
           novemcinctus]
          Length = 364

 Score = 99.4 bits (246), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 63/201 (31%), Positives = 100/201 (49%), Gaps = 17/201 (8%)

Query: 88  WIALVERGQCTFIEKVRNMQASGAIAVVVGDNEKNGLITMYATGD--TSDVNIPSVFIAQ 145
           +IAL+ R  C F  KV N Q +G  A VV +   N L+ M    +     + IPSVFI +
Sbjct: 95  FIALLRRFDCNFDLKVLNAQKAGYAAAVVHNVNSNELLNMVWNSEEIQQQIWIPSVFIGE 154

Query: 146 TEYKDLRSSSL--KPVEVHLVKDNLLQW-----PLLDVIIVVILSPTVMMIFIYVLWXXX 198
              + LR+  +  K  +V LV DN         P   ++ +++L+   +MI   +     
Sbjct: 155 RSSEYLRALFIYEKGAQVLLVPDNSFPLGYYLIPFTGIVGLLVLAMGAVMIVRCI----- 209

Query: 199 XXXXXXXDIAPQQVVGNLATKIFFESKRQENEPQECAICLEDYADGDELRILPCKHEFHI 258
                   +   ++      +I     ++ ++   CAICL++Y DGD+LR+LPC H +H 
Sbjct: 210 ---QHQKRLQRNRLTKEQLKQIPTHDYQKGDQYDVCAICLDEYEDGDKLRVLPCAHAYHS 266

Query: 259 TCIDSWLTTRKKFCPICKRDI 279
            C+D WLT  +K CPICK+ +
Sbjct: 267 RCVDPWLTQTRKTCPICKQPV 287