BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10215_c0_seq1-m.85 complete 114-521(-) 136 (-)
         (135 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|384493573|gb|EIE84064.1| hypothetical protein RO3G_08769 [Rhi...   168   5e-40   Rhizopus delemar RA 99-880
gi|384499002|gb|EIE89493.1| hypothetical protein RO3G_14204 [Rhi...   166   1e-39   Rhizopus delemar RA 99-880
gi|353227362|emb|CCA77872.1| related to Fe/S cluster assembly pr...   166   2e-39   Serendipita indica DSM 11827
gi|393247897|gb|EJD55404.1| hypothetical protein AURDEDRAFT_1097...   164   7e-39   Auricularia subglabra TFB-10046 SS5
gi|378734343|gb|EHY60802.1| Fe-S cluster assembly protein SufA [...   163   2e-38   Exophiala dermatitidis NIH/UT8656
gi|393218961|gb|EJD04449.1| hypothetical protein FOMMEDRAFT_8319...   162   3e-38   Fomitiporia mediterranea MF3/22
gi|367055856|ref|XP_003658306.1| hypothetical protein THITE_2124...   161   5e-38   Thielavia terrestris NRRL 8126
gi|403415144|emb|CCM01844.1| predicted protein [Fibroporia radic...   160   9e-38   Fibroporia radiculosa
gi|402087414|gb|EJT82312.1| iron sulfur assembly protein 1 [Gaeu...   160   1e-37   Gaeumannomyces graminis var. tritici R3-111a-1
gi|511001920|gb|EPB83375.1| hypothetical protein HMPREF1544_0990...   160   1e-37   Mucor circinelloides f. circinelloides 1006PhL
gi|302498837|ref|XP_003011415.1| hypothetical protein ARB_02265 ...   160   1e-37   Arthroderma benhamiae CBS 112371
gi|299755861|ref|XP_001828932.2| iron sulfur assembly protein 1 ...   160   1e-37   Coprinopsis cinerea okayama7#130
gi|358366375|dbj|GAA82996.1| iron sulfur assembly protein 1 [Asp...   160   1e-37   Aspergillus kawachii IFO 4308
gi|296808263|ref|XP_002844470.1| iron sulfur assembly protein 1 ...   160   1e-37   Arthroderma otae CBS 113480
gi|512193645|gb|EPE09402.1| iron sulfur assembly protein 1 [Ophi...   160   1e-37   Ophiostoma piceae UAMH 11346
gi|392572128|gb|EIW65300.1| hypothetical protein TRAVEDRAFT_2614...   160   2e-37   Trametes versicolor FP-101664 SS1
gi|326480948|gb|EGE04958.1| hypothetical protein TEQG_08677 [Tri...   159   2e-37   Trichophyton equinum CBS 127.97
gi|242769736|ref|XP_002341832.1| iron-sulfur cluster assembly ac...   159   2e-37   Talaromyces stipitatus ATCC 10500
gi|169771539|ref|XP_001820239.1| iron-sulfur assembly protein 1 ...   159   2e-37   Aspergillus oryzae RIB40
gi|340515564|gb|EGR45817.1| predicted protein [Trichoderma reese...   159   2e-37   Trichoderma reesei QM6a
gi|46138745|ref|XP_391063.1| hypothetical protein FG10887.1 [Fus...   159   2e-37   
gi|345565104|gb|EGX48059.1| hypothetical protein AOL_s00081g163 ...   159   3e-37   Arthrobotrys oligospora ATCC 24927
gi|471562918|gb|EMR64325.1| putative iron sulfur assembly protei...   159   3e-37   Eutypa lata UCREL1
gi|170085345|ref|XP_001873896.1| predicted protein [Laccaria bic...   159   3e-37   Laccaria bicolor S238N-H82
gi|70993822|ref|XP_751758.1| iron-sulfur cluster assembly access...   159   3e-37   Aspergillus fumigatus Af293
gi|159125322|gb|EDP50439.1| iron-sulfur cluster assembly accesso...   159   3e-37   Aspergillus fumigatus A1163
gi|145258180|ref|XP_001401965.1| iron-sulfur assembly protein 1 ...   158   4e-37   Aspergillus niger CBS 513.88
gi|115391347|ref|XP_001213178.1| iron sulfur assembly protein 1 ...   158   4e-37   Aspergillus terreus NIH2624
gi|295669196|ref|XP_002795146.1| iron-binding protein iscA [Para...   158   4e-37   
gi|485920530|gb|EOD46536.1| putative iron-sulfur cluster assembl...   158   4e-37   Neofusicoccum parvum UCRNP2
gi|212542107|ref|XP_002151208.1| iron-sulfur cluster assembly ac...   158   5e-37   Talaromyces marneffei ATCC 18224
gi|440637671|gb|ELR07590.1| hypothetical protein GMDG_02638 [Geo...   158   5e-37   Pseudogymnoascus destructans 20631-21
gi|358389050|gb|EHK26643.1| hypothetical protein TRIVIDRAFT_1204...   158   6e-37   Trichoderma virens Gv29-8
gi|388851352|emb|CCF54937.1| related to ISA1-Fe/S cluster assemb...   157   6e-37   Ustilago hordei
gi|320594059|gb|EFX06462.1| iron-sulfur cluster assembly accesso...   157   7e-37   Grosmannia clavigera kw1407
gi|350632414|gb|EHA20782.1| hypothetical protein ASPNIDRAFT_1275...   157   7e-37   Aspergillus niger ATCC 1015
gi|226290008|gb|EEH45492.1| iron-binding protein iscA [Paracocci...   157   8e-37   Paracoccidioides brasiliensis Pb18
gi|342882202|gb|EGU82930.1| hypothetical protein FOXB_06483 [Fus...   157   8e-37   Fusarium oxysporum Fo5176
gi|367036112|ref|XP_003667338.1| hypothetical protein MYCTH_2313...   157   8e-37   Myceliophthora thermophila ATCC 42464
gi|336258749|ref|XP_003344182.1| hypothetical protein SMAC_08113...   157   1e-36   Sordaria macrospora k-hell
gi|310800418|gb|EFQ35311.1| iron-sulfur cluster assembly accesso...   157   1e-36   Colletotrichum graminicola M1.001
gi|475676255|gb|EMT73289.1| Iron-sulfur assembly protein 1 [Fusa...   156   1e-36   Fusarium oxysporum f. sp. cubense race 4
gi|358396150|gb|EHK45537.1| hypothetical protein TRIATDRAFT_1512...   156   1e-36   Trichoderma atroviride IMI 206040
gi|302899051|ref|XP_003047968.1| hypothetical protein NECHADRAFT...   156   2e-36   Nectria haematococca mpVI 77-13-4
gi|327295258|ref|XP_003232324.1| iron sulfur assembly protein [T...   156   2e-36   Trichophyton rubrum CBS 118892
gi|259487334|tpe|CBF85927.1| TPA: iron-sulfur cluster assembly a...   156   2e-36   Aspergillus nidulans FGSC A4
gi|303311467|ref|XP_003065745.1| Iron-sulfur cluster assembly ac...   155   3e-36   Coccidioides posadasii C735 delta SOWgp
gi|501304618|dbj|GAC93918.1| hypothetical protein PHSY_001486 [P...   155   3e-36   Pseudozyma hubeiensis SY62
gi|171677201|ref|XP_001903552.1| hypothetical protein [Podospora...   155   3e-36   Podospora anserina S mat+
gi|407924947|gb|EKG17970.1| FeS cluster biogenesis [Macrophomina...   155   3e-36   Macrophomina phaseolina MS6
gi|341038415|gb|EGS23407.1| putative iron sulfur assembly protei...   155   3e-36   Chaetomium thermophilum var. thermophilum DSM 1495
gi|119194195|ref|XP_001247701.1| hypothetical protein CIMG_01472...   155   4e-36   Coccidioides immitis RS
gi|443895611|dbj|GAC72957.1| fe-s cluster biosynthesis protein I...   155   4e-36   Moesziomyces antarcticus T-34
gi|343426694|emb|CBQ70222.1| related to ISA1-Fe/S cluster assemb...   155   4e-36   Sporisorium reilianum SRZ2
gi|389642549|ref|XP_003718907.1| iron sulfur assembly protein 1 ...   155   4e-36   Magnaporthe oryzae 70-15
gi|389751427|gb|EIM92500.1| hypothetical protein STEHIDRAFT_1175...   155   4e-36   Stereum hirsutum FP-91666 SS1
gi|296422409|ref|XP_002840753.1| hypothetical protein [Tuber mel...   154   5e-36   Tuber melanosporum Mel28
gi|472586539|gb|EMS24058.1| iron-sulfur cluster assembly protein...   154   6e-36   Rhodotorula toruloides NP11
gi|449550394|gb|EMD41358.1| hypothetical protein CERSUDRAFT_7901...   153   1e-35   Gelatoporia subvermispora B
gi|399172271|emb|CCE26956.1| related to Fe/S cluster assembly pr...   153   1e-35   Claviceps purpurea 20.1
gi|255947932|ref|XP_002564733.1| Pc22g07080 [Penicillium chrysog...   153   1e-35   Penicillium rubens Wisconsin 54-1255
gi|358056751|dbj|GAA97414.1| hypothetical protein E5Q_04092 [Mix...   153   2e-35   Mixia osmundae IAM 14324
gi|425766277|gb|EKV04901.1| Iron-sulfur cluster assembly accesso...   153   2e-35   Penicillium digitatum PHI26
gi|440464761|gb|ELQ34129.1| DNA-dependent ATPase MGS1 [Magnaport...   152   2e-35   Magnaporthe oryzae Y34
gi|346978933|gb|EGY22385.1| iron sulfur assembly protein [Vertic...   152   2e-35   Verticillium dahliae VdLs.17
gi|449299207|gb|EMC95221.1| hypothetical protein BAUCODRAFT_7278...   152   2e-35   Baudoinia panamericana UAMH 10762
gi|477533214|gb|ENH84804.1| iron-sulfur cluster assembly accesso...   152   3e-35   Colletotrichum orbiculare MAFF 240422
gi|346324995|gb|EGX94592.1| iron sulfur assembly protein 1 [Cord...   152   3e-35   Cordyceps militaris CM01
gi|390603813|gb|EIN13204.1| hypothetical protein PUNSTDRAFT_5950...   152   3e-35   Punctularia strigosozonata HHB-11173 SS5
gi|452989696|gb|EME89451.1| hypothetical protein MYCFIDRAFT_1218...   152   4e-35   Cercospora fijiensis CIRAD86
gi|448119739|ref|XP_004203805.1| Piso0_000825 [Millerozyma farin...   151   4e-35   Millerozyma farinosa CBS 7064
gi|344300188|gb|EGW30528.1| hypothetical protein SPAPADRAFT_6336...   151   5e-35   Spathaspora passalidarum NRRL Y-27907
gi|254565285|ref|XP_002489753.1| Mitochondrial matrix protein in...   151   5e-35   Komagataella phaffii GS115
gi|511005814|gb|EPB87142.1| hypothetical protein HMPREF1544_0606...   151   6e-35   Mucor circinelloides f. circinelloides 1006PhL
gi|406863934|gb|EKD16980.1| iron sulfur assembly protein 1 [Mars...   150   8e-35   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|255727102|ref|XP_002548477.1| hypothetical protein CTRG_02774...   150   9e-35   Candida tropicalis MYA-3404
gi|225682593|gb|EEH20877.1| iron sulfur assembly protein [Paraco...   150   9e-35   
gi|400597316|gb|EJP65049.1| iron-sulfur cluster assembly accesso...   150   1e-34   Beauveria bassiana ARSEF 2860
gi|241956608|ref|XP_002421024.1| iron sulfur assembly protein, p...   150   1e-34   Candida dubliniensis CD36
gi|154287670|ref|XP_001544630.1| iron-binding protein iscA [Ajel...   150   1e-34   Histoplasma capsulatum NAm1
gi|395326134|gb|EJF58547.1| hypothetical protein DICSQDRAFT_6685...   150   1e-34   Dichomitus squalens LYAD-421 SS1
gi|327263395|ref|XP_003216505.1| PREDICTED: iron-sulfur cluster ...   150   1e-34   Anolis carolinensis [Carolina anole]
gi|255714939|ref|XP_002553751.1| KLTH0E06182p [Lachancea thermot...   149   2e-34   Lachancea thermotolerans CBS 6340
gi|430811500|emb|CCJ31034.1| unnamed protein product [Pneumocyst...   149   3e-34   Pneumocystis jirovecii
gi|50288207|ref|XP_446532.1| hypothetical protein [Candida glabr...   149   3e-34   Candida glabrata CBS 138
gi|164423381|ref|XP_963568.2| hypothetical protein NCU08707 [Neu...   149   4e-34   
gi|260950671|ref|XP_002619632.1| hypothetical protein CLUG_00791...   148   4e-34   Clavispora lusitaniae ATCC 42720
gi|238883113|gb|EEQ46751.1| hypothetical protein CAWG_05116 [Can...   148   4e-34   Candida albicans WO-1
gi|68473290|ref|XP_719203.1| hypothetical protein CaO19.12967 [C...   148   4e-34   Candida albicans SC5314
gi|409050892|gb|EKM60368.1| hypothetical protein PHACADRAFT_2462...   148   4e-34   Phanerochaete carnosa HHB-10118-sp
gi|398409374|ref|XP_003856152.1| hypothetical protein MYCGRDRAFT...   148   4e-34   Zymoseptoria tritici IPO323
gi|336468052|gb|EGO56215.1| hypothetical protein NEUTE1DRAFT_130...   148   4e-34   Neurospora tetrasperma FGSC 2508
gi|336378309|gb|EGO19467.1| hypothetical protein SERLADRAFT_4789...   148   4e-34   Serpula lacrymans var. lacrymans S7.9
gi|50311733|ref|XP_455894.1| hypothetical protein [Kluyveromyces...   148   5e-34   Kluyveromyces lactis NRRL Y-1140
gi|320583425|gb|EFW97638.1| iron sulfur assembly-related protein...   148   5e-34   
gi|261199912|ref|XP_002626357.1| iron-binding protein iscA [Ajel...   148   6e-34   Blastomyces gilchristii SLH14081
gi|440902050|gb|ELR52895.1| Iron-sulfur cluster assembly 1-like ...   148   6e-34   Bos mutus
gi|327350430|gb|EGE79287.1| iron-binding protein iscA [Ajellomyc...   148   6e-34   Blastomyces dermatitidis ATCC 18188
gi|401840344|gb|EJT43201.1| ISA1-like protein [Saccharomyces kud...   147   6e-34   Saccharomyces kudriavzevii IFO 1802
gi|354543033|emb|CCE39751.1| hypothetical protein CPAR2_601710 [...   147   7e-34   Candida parapsilosis
gi|448533387|ref|XP_003870625.1| Isa1 protein [Candida orthopsil...   147   8e-34   Candida orthopsilosis Co 90-125
gi|239607955|gb|EEQ84942.1| iron-binding protein iscA [Ajellomyc...   147   8e-34   Blastomyces dermatitidis ER-3
gi|146420893|ref|XP_001486399.1| hypothetical protein PGUG_02070...   147   9e-34   Meyerozyma guilliermondii ATCC 6260
gi|190345989|gb|EDK37972.2| hypothetical protein PGUG_02070 [Mey...   147   9e-34   Meyerozyma guilliermondii ATCC 6260
gi|367015378|ref|XP_003682188.1| hypothetical protein TDEL_0F016...   147   9e-34   Torulaspora delbrueckii
gi|254578016|ref|XP_002494994.1| ZYRO0B00968p [Zygosaccharomyces...   147   1e-33   Zygosaccharomyces rouxii CBS 732
gi|365759568|gb|EHN01350.1| Isa1p [Saccharomyces cerevisiae x Sa...   147   1e-33   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gi|513033868|gb|AGO13834.1| AaceriAGL033Cp [Saccharomycetaceae s...   147   1e-33   Saccharomycetaceae sp. 'Ashbya aceri'
gi|392597020|gb|EIW86342.1| hypothetical protein CONPUDRAFT_4588...   147   1e-33   Coniophora puteana RWD-64-598 SS2
gi|470319974|gb|EMR11570.1| hypothetical protein PNEG_00014 [Pne...   146   2e-33   Pneumocystis murina B123
gi|448117310|ref|XP_004203224.1| Piso0_000825 [Millerozyma farin...   146   2e-33   Millerozyma farinosa CBS 7064
gi|21740005|emb|CAD39021.1| hypothetical protein [Homo sapiens]       146   2e-33   Homo sapiens [man]
gi|459372827|gb|EMG50195.1| Iron sulfur assembly protein, putati...   146   2e-33   Candida maltosa Xu316
gi|426362148|ref|XP_004048242.1| PREDICTED: iron-sulfur cluster ...   145   2e-33   Gorilla gorilla gorilla [lowland gorilla]
gi|335296332|ref|XP_003357750.1| PREDICTED: iron-sulfur cluster ...   145   3e-33   Sus scrofa [pigs]
gi|397470237|ref|XP_003806735.1| PREDICTED: iron-sulfur cluster ...   145   3e-33   Pan paniscus [bonobo]
gi|332260003|ref|XP_003279075.1| PREDICTED: iron-sulfur cluster ...   145   3e-33   Nomascus leucogenys [White-cheeked Gibbon]
gi|224088740|ref|XP_002194930.1| PREDICTED: iron-sulfur cluster ...   145   4e-33   Taeniopygia guttata
gi|507933744|ref|XP_004678106.1| PREDICTED: iron-sulfur cluster ...   145   4e-33   
gi|164660828|ref|XP_001731537.1| hypothetical protein MGL_1720 [...   145   4e-33   Malassezia globosa CBS 7966
gi|45201063|ref|NP_986633.1| AGL033Cp [Ashbya gossypii ATCC 1089...   145   4e-33   Eremothecium gossypii ATCC 10895
gi|256271954|gb|EEU06973.1| Isa1p [Saccharomyces cerevisiae JAY291]   145   5e-33   Saccharomyces cerevisiae JAY291
gi|355567540|gb|EHH23881.1| hypothetical protein EGK_07441 [Maca...   145   5e-33   Macaca mulatta [rhesus macaque]
gi|432109013|gb|ELK33483.1| Iron-sulfur cluster assembly 1 like ...   144   5e-33   Myotis davidii
gi|351696759|gb|EHA99677.1| Iron-sulfur cluster assembly 1-like ...   144   6e-33   Heterocephalus glaber [naked mole rat]
gi|156840885|ref|XP_001643820.1| hypothetical protein Kpol_1044p...   144   6e-33   Vanderwaltozyma polyspora DSM 70294
gi|507958989|ref|XP_004686487.1| PREDICTED: iron-sulfur cluster ...   144   6e-33   Condylura cristata
gi|507577748|ref|XP_004672398.1| PREDICTED: iron-sulfur cluster ...   144   6e-33   Jaculus jaculus
gi|504137429|ref|XP_004581174.1| PREDICTED: iron-sulfur cluster ...   144   6e-33   Ochotona princeps [southern American pika]
gi|156366241|ref|XP_001627048.1| predicted protein [Nematostella...   144   6e-33   Nematostella vectensis
gi|348578683|ref|XP_003475112.1| PREDICTED: iron-sulfur cluster ...   144   6e-33   Cavia porcellus [guinea pig]
gi|512199692|gb|EPE28525.1| HesB-like protein [Glarea lozoyensis...   144   6e-33   Glarea lozoyensis ATCC 20868
gi|149580480|ref|XP_001511499.1| PREDICTED: iron-sulfur cluster ...   144   7e-33   Ornithorhynchus anatinus [duck-billed platypus]
gi|52426768|ref|NP_112202.2| iron-sulfur cluster assembly 1 homo...   144   7e-33   Homo sapiens [man]
gi|12584843|gb|AAG59854.1|AF284752_1 GK004 [Homo sapiens]             144   7e-33   Homo sapiens [man]
gi|345785981|ref|XP_849435.2| PREDICTED: iron-sulfur cluster ass...   144   8e-33   Canis lupus familiaris [dogs]
gi|453088204|gb|EMF16244.1| hypothetical protein SEPMUDRAFT_1218...   144   8e-33   Sphaerulina musiva SO2202
gi|465796536|emb|CCV00728.1| unnamed protein product [Malassezia...   144   9e-33   Malassezia sympodialis ATCC 42132
gi|505764010|ref|XP_004600163.1| PREDICTED: iron-sulfur cluster ...   144   9e-33   Sorex araneus [Eurasian shrew]
gi|296189815|ref|XP_002742931.1| PREDICTED: iron-sulfur cluster ...   144   1e-32   Callithrix jacchus [common marmoset]
gi|395859980|ref|XP_003802298.1| PREDICTED: uncharacterized prot...   144   1e-32   
gi|366986945|ref|XP_003673239.1| hypothetical protein NCAS_0A029...   144   1e-32   Naumovozyma castellii CBS 4309
gi|466074281|ref|XP_004283103.1| PREDICTED: uncharacterized prot...   143   1e-32   
gi|148700701|gb|EDL32648.1| mCG50313 [Mus musculus]                   143   1e-32   Mus musculus [mouse]
gi|126333881|ref|XP_001362457.1| PREDICTED: iron-sulfur cluster ...   143   1e-32   Monodelphis domestica
gi|31745170|ref|NP_853657.1| iron-sulfur cluster assembly 1 homo...   143   1e-32   Rattus norvegicus [brown rat]
gi|430727945|ref|NP_001258865.1| iron-sulfur cluster assembly 1 ...   143   1e-32   Gallus gallus [bantam]
gi|395514278|ref|XP_003761346.1| PREDICTED: iron-sulfur cluster ...   143   1e-32   Sarcophilus harrisii
gi|401624761|gb|EJS42809.1| isa1p [Saccharomyces arboricola H-6]      143   1e-32   Saccharomyces arboricola H-6
gi|50553450|ref|XP_504136.1| YALI0E19206p [Yarrowia lipolytica] ...   143   1e-32   Yarrowia lipolytica CLIB122
gi|21312189|ref|NP_081197.1| iron-sulfur cluster assembly 1 homo...   143   2e-32   Mus musculus [mouse]
gi|328771838|gb|EGF81877.1| hypothetical protein BATDEDRAFT_1034...   143   2e-32   Batrachochytrium dendrobatidis JAM81
gi|426219881|ref|XP_004004146.1| PREDICTED: iron-sulfur cluster ...   143   2e-32   
gi|403300963|ref|XP_003941181.1| PREDICTED: iron-sulfur cluster ...   142   2e-32   Saimiri boliviensis boliviensis
gi|126135146|ref|XP_001384097.1| Iron Sulfur Assembly [Scheffers...   142   2e-32   Scheffersomyces stipitis CBS 6054
gi|507698242|ref|XP_004714659.1| PREDICTED: iron-sulfur cluster ...   142   3e-32   Echinops telfairi [lesser hedgehog tenrec]
gi|471395005|ref|XP_004381374.1| PREDICTED: iron-sulfur cluster ...   142   3e-32   Trichechus manatus latirostris
gi|323308153|gb|EGA61404.1| Isa1p [Saccharomyces cerevisiae Fost...   142   3e-32   Saccharomyces cerevisiae FostersO
gi|301758436|ref|XP_002915054.1| PREDICTED: iron-sulfur cluster ...   142   3e-32   
gi|332821405|ref|XP_003310762.1| PREDICTED: iron-sulfur cluster ...   142   3e-32   
gi|365764268|gb|EHN05792.1| Isa1p [Saccharomyces cerevisiae x Sa...   142   3e-32   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gi|149236257|ref|XP_001524006.1| hypothetical protein LELG_04819...   142   3e-32   Lodderomyces elongisporus NRRL YB-4239
gi|323347592|gb|EGA81859.1| Isa1p [Saccharomyces cerevisiae Lalv...   142   4e-32   Saccharomyces cerevisiae Lalvin QA23
gi|151941143|gb|EDN59521.1| iron sulfur assembly-related protein...   142   4e-32   Saccharomyces cerevisiae YJM789
gi|402871171|ref|XP_003899554.1| PREDICTED: iron-sulfur cluster ...   142   4e-32   Papio anubis [Doguera baboon]
gi|330913198|ref|XP_003296224.1| hypothetical protein PTT_05470 ...   142   4e-32   Pyrenophora teres f. teres 0-1
gi|323303936|gb|EGA57716.1| Isa1p [Saccharomyces cerevisiae Fost...   142   4e-32   Saccharomyces cerevisiae FostersB
gi|397514491|ref|XP_003827518.1| PREDICTED: iron-sulfur cluster ...   142   4e-32   
gi|6323001|ref|NP_013073.1| Isa1p [Saccharomyces cerevisiae S288...   141   4e-32   Saccharomyces cerevisiae S288c
gi|363755464|ref|XP_003647947.1| hypothetical protein Ecym_7292 ...   141   5e-32   Eremothecium cymbalariae DBVPG#7215
gi|323332598|gb|EGA74005.1| Isa1p [Saccharomyces cerevisiae AWRI...   141   5e-32   Saccharomyces cerevisiae AWRI796
gi|367006097|ref|XP_003687780.1| hypothetical protein TPHA_0K021...   141   7e-32   Tetrapisispora phaffii CBS 4417
gi|189200376|ref|XP_001936525.1| iron sulfur assembly protein 1 ...   140   8e-32   Pyrenophora tritici-repentis Pt-1C-BFP
gi|452003672|gb|EMD96129.1| hypothetical protein COCHEDRAFT_1127...   140   8e-32   Bipolaris maydis C5
gi|451855851|gb|EMD69142.1| hypothetical protein COCSADRAFT_7579...   140   9e-32   Bipolaris sorokiniana ND90Pr
gi|302698621|ref|XP_003038989.1| hypothetical protein SCHCODRAFT...   140   9e-32   Schizophyllum commune H4-8
gi|301610979|ref|XP_002935018.1| PREDICTED: iron-sulfur cluster ...   140   1e-31   Xenopus tropicalis [western clawed frog]
gi|354481338|ref|XP_003502858.1| PREDICTED: iron-sulfur cluster ...   140   1e-31   Cricetulus griseus [Chinese hamsters]
gi|482814470|gb|EOA91148.1| hypothetical protein SETTUDRAFT_1586...   140   2e-31   Setosphaeria turcica Et28A
gi|406602914|emb|CCH45578.1| putative iron-sulfur cluster insert...   140   2e-31   Wickerhamomyces ciferrii
gi|410035684|ref|XP_003949943.1| PREDICTED: uncharacterized prot...   140   2e-31   
gi|169624826|ref|XP_001805818.1| hypothetical protein SNOG_15677...   139   2e-31   Parastagonospora nodorum SN15
gi|50286831|ref|XP_445845.1| hypothetical protein [Candida glabr...   139   2e-31   Candida glabrata CBS 138
gi|294654557|ref|XP_456615.2| DEHA2A06710p [Debaryomyces hanseni...   139   2e-31   Debaryomyces hansenii CBS767
gi|426337146|ref|XP_004032584.1| PREDICTED: uncharacterized prot...   139   2e-31   Gorilla gorilla gorilla [lowland gorilla]
gi|441663485|ref|XP_004091682.1| PREDICTED: LOW QUALITY PROTEIN:...   139   3e-31   
gi|410929973|ref|XP_003978373.1| PREDICTED: iron-sulfur cluster ...   138   5e-31   
gi|302658416|ref|XP_003020912.1| hypothetical protein TRV_04988 ...   138   5e-31   Trichophyton verrucosum HKI 0517
gi|67523035|ref|XP_659578.1| hypothetical protein AN1974.2 [Aspe...   138   6e-31   Aspergillus nidulans FGSC A4
gi|47226595|emb|CAG08611.1| unnamed protein product [Tetraodon n...   138   6e-31   Tetraodon nigroviridis
gi|365986414|ref|XP_003670039.1| hypothetical protein NDAI_0D048...   138   6e-31   Naumovozyma dairenensis CBS 421
gi|410080862|ref|XP_003958011.1| hypothetical protein KAFR_0F027...   137   6e-31   Kazachstania africana CBS 2517
gi|408390581|gb|EKJ69973.1| hypothetical protein FPSE_09818 [Fus...   137   9e-31   Fusarium pseudograminearum CS3096
gi|119500384|ref|XP_001266949.1| iron-sulfur assembly protein [N...   137   1e-30   Aspergillus fischeri NRRL 181
gi|395735852|ref|XP_003776652.1| PREDICTED: iron-sulfur cluster ...   137   1e-30   
gi|385305375|gb|EIF49356.1| iron sulfur assembly [Dekkera bruxel...   137   1e-30   Brettanomyces bruxellensis AWRI1499
gi|488587229|ref|XP_004478942.1| PREDICTED: iron-sulfur cluster ...   136   2e-30   
gi|505756091|gb|EOR00272.1| Iron-sulfur assembly protein 1 [Wall...   136   2e-30   Wallemia ichthyophaga EXF-994
gi|432873315|ref|XP_004072190.1| PREDICTED: iron-sulfur cluster ...   136   2e-30   Oryzias latipes [Japanese rice fish]
gi|68448477|ref|NP_001020349.1| iron-sulfur cluster assembly 1 h...   135   3e-30   Danio rerio [leopard danio]
gi|403217596|emb|CCK72090.1| hypothetical protein KNAG_0I03060 [...   135   3e-30   Kazachstania naganishii CBS 8797
gi|66559527|ref|XP_624993.1| PREDICTED: iron-sulfur cluster asse...   135   4e-30   Apis mellifera [European honey bee]
gi|119605300|gb|EAW84894.1| hCG2041197 [Homo sapiens]                 135   4e-30   Homo sapiens [man]
gi|380028797|ref|XP_003698073.1| PREDICTED: LOW QUALITY PROTEIN:...   135   4e-30   Apis florea [dwarf honeybee]
gi|221115690|ref|XP_002155514.1| PREDICTED: iron-sulfur cluster ...   135   5e-30   Hydra vulgaris
gi|402218918|gb|EJT98993.1| hypothetical protein DACRYDRAFT_5688...   135   5e-30   Dacryopinax primogenitus
gi|58267804|ref|XP_571058.1| iron ion transport-related protein ...   134   6e-30   Cryptococcus neoformans var. neoformans JEC21
gi|344229891|gb|EGV61776.1| hypothetical protein CANTEDRAFT_1152...   134   6e-30   Candida tenuis ATCC 10573
gi|321259375|ref|XP_003194408.1| iron ion transport-related prot...   134   7e-30   Cryptococcus gattii WM276
gi|405120918|gb|AFR95688.1| iron sulfur assembly protein 1 [Cryp...   134   7e-30   
gi|500251831|gb|EON95702.1| putative iron sulfur assembly protei...   134   1e-29   Phaeoacremonium minimum UCRPA7
gi|392574162|gb|EIW67299.1| hypothetical protein TREMEDRAFT_7221...   133   2e-29   Tremella mesenterica DSM 1558
gi|401882612|gb|EJT46864.1| iron ion transport-related protein [...   133   2e-29   Trichosporon asahii var. asahii CBS 2479
gi|170033040|ref|XP_001844387.1| conserved hypothetical protein ...   132   2e-29   Culex quinquefasciatus
gi|307207446|gb|EFN85161.1| Iron-sulfur cluster assembly 1-like ...   132   3e-29   Harpegnathos saltator
gi|403158251|ref|XP_003307566.2| hypothetical protein PGTG_00516...   131   6e-29   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|308454527|ref|XP_003089882.1| hypothetical protein CRE_21045 ...   131   7e-29   Caenorhabditis remanei
gi|354494623|ref|XP_003509436.1| PREDICTED: iron-sulfur cluster ...   131   7e-29   
gi|31206473|ref|XP_312196.1| AGAP002730-PA [Anopheles gambiae st...   131   7e-29   Anopheles gambiae str. PEST
gi|444320143|ref|XP_004180728.1| hypothetical protein TBLA_0E015...   131   8e-29   Tetrapisispora blattae CBS 6284
gi|341895461|gb|EGT51396.1| hypothetical protein CAEBREN_11160 [...   130   8e-29   Caenorhabditis brenneri
gi|401885145|gb|EJT49272.1| cytochrome P450 [Trichosporon asahii...   130   8e-29   Trichosporon asahii var. asahii CBS 2479
gi|390476616|ref|XP_003735152.1| PREDICTED: iron-sulfur cluster ...   130   1e-28   
gi|395750821|ref|XP_003779160.1| PREDICTED: iron-sulfur cluster ...   130   1e-28   
gi|512907435|ref|XP_004926440.1| PREDICTED: iron-sulfur cluster ...   130   1e-28   Bombyx mori [silk moth]
gi|338719520|ref|XP_003364017.1| PREDICTED: iron-sulfur cluster ...   130   1e-28   
gi|91091584|ref|XP_968263.1| PREDICTED: similar to conserved hyp...   130   1e-28   Tribolium castaneum [rust-red flour beetle]
gi|311274080|ref|XP_003134180.1| PREDICTED: iron-sulfur cluster ...   130   2e-28   
gi|350414906|ref|XP_003490464.1| PREDICTED: iron-sulfur cluster ...   130   2e-28   Bombus impatiens
gi|157134795|ref|XP_001656446.1| hypothetical protein AaeL_AAEL0...   129   2e-28   Aedes aegypti
gi|321454597|gb|EFX65762.1| hypothetical protein DAPPUDRAFT_3035...   129   2e-28   Daphnia pulex
gi|322692279|gb|EFY84208.1| iron sulfur assembly protein 1 [Meta...   129   2e-28   Metarhizium acridum CQMa 102
gi|494827648|gb|EON64573.1| hypothetical protein W97_03806 [Coni...   129   2e-28   Coniosporium apollinis CBS 100218
gi|195133108|ref|XP_002010981.1| GI16259 [Drosophila mojavensis]...   129   2e-28   Drosophila mojavensis
gi|498968811|ref|XP_004546998.1| PREDICTED: iron-sulfur cluster ...   129   3e-28   Maylandia zebra
gi|195164087|ref|XP_002022880.1| GL16489 [Drosophila persimilis]...   129   3e-28   Drosophila persimilis
gi|25146411|ref|NP_741696.1| Protein Y39B6A.3, isoform a [Caenor...   129   3e-28   Caenorhabditis elegans [roundworm]
gi|121707787|ref|XP_001271941.1| conserved membrane protein, put...   129   3e-28   Aspergillus clavatus NRRL 1
gi|315043036|ref|XP_003170894.1| hypothetical protein MGYG_06884...   129   3e-28   Microsporum gypseum CBS 118893
gi|213408130|ref|XP_002174836.1| iron sulfur assembly protein [S...   129   4e-28   Schizosaccharomyces japonicus yFS275
gi|406694583|gb|EKC97907.1| cytochrome P450 [Trichosporon asahii...   128   4e-28   Trichosporon asahii var. asahii CBS 8904
gi|322709855|gb|EFZ01430.1| iron sulfur assembly protein 1 [Meta...   128   6e-28   
gi|193209025|ref|NP_001123038.1| Protein Y39B6A.3, isoform b [Ca...   127   7e-28   Caenorhabditis elegans [roundworm]
gi|340720545|ref|XP_003398695.1| PREDICTED: iron-sulfur cluster ...   127   7e-28   
gi|47226594|emb|CAG08610.1| unnamed protein product [Tetraodon n...   127   7e-28   Tetraodon nigroviridis
gi|290561206|gb|ADD38005.1| Iron-sulfur cluster assembly 1 homol...   127   7e-28   Lepeophtheirus salmonis
gi|344271172|ref|XP_003407415.1| PREDICTED: iron-sulfur cluster ...   127   7e-28   
gi|260788975|ref|XP_002589524.1| hypothetical protein BRAFLDRAFT...   127   8e-28   Branchiostoma floridae
gi|194768925|ref|XP_001966561.1| GF21925 [Drosophila ananassae] ...   127   9e-28   Drosophila ananassae
gi|322795676|gb|EFZ18355.1| hypothetical protein SINV_04847 [Sol...   127   1e-27   Solenopsis invicta [imported red fire ant]
gi|391338466|ref|XP_003743579.1| PREDICTED: iron-sulfur cluster ...   126   2e-27   Metaseiulus occidentalis
gi|307190801|gb|EFN74670.1| Iron-sulfur cluster assembly 1-like ...   126   2e-27   Camponotus floridanus
gi|24642263|ref|NP_573062.1| lethal (1) G0136, isoform A [Drosop...   126   2e-27   Drosophila melanogaster
gi|195448473|ref|XP_002071673.1| GK25017 [Drosophila willistoni]...   126   2e-27   Drosophila willistoni
gi|312080094|ref|XP_003142454.1| hypothetical protein LOAG_06870...   126   2e-27   Loa loa
gi|242008035|ref|XP_002424818.1| hes-B, putative [Pediculus huma...   125   3e-27   Pediculus humanus corporis [human body lice]
gi|156537934|ref|XP_001608294.1| PREDICTED: iron-sulfur cluster ...   125   3e-27   Nasonia vitripennis
gi|405950155|gb|EKC18158.1| Iron-sulfur cluster assembly 1-like ...   125   3e-27   Crassostrea gigas
gi|449275512|gb|EMC84354.1| Iron-sulfur cluster assembly 1 like ...   125   3e-27   Columba livia [carrier pigeon]
gi|195045788|ref|XP_001992036.1| GH24545 [Drosophila grimshawi] ...   125   3e-27   Drosophila grimshawi
gi|195566952|ref|XP_002107039.1| GD17232 [Drosophila simulans] >...   125   5e-27   
gi|470362129|ref|XP_004365268.1| ATP synthase subunit delta [Cap...   125   5e-27   Capsaspora owczarzaki ATCC 30864
gi|478255532|gb|ENN75749.1| hypothetical protein YQE_07709, part...   124   6e-27   Dendroctonus ponderosae
gi|225710790|gb|ACO11241.1| Iron-sulfur cluster assembly 1 homol...   124   6e-27   Caligus rogercresseyi
gi|340379737|ref|XP_003388382.1| PREDICTED: iron-sulfur cluster ...   124   6e-27   Amphimedon queenslandica
gi|326473949|gb|EGD97958.1| iron sulfur assembly protein [Tricho...   124   6e-27   Trichophyton tonsurans CBS 112818
gi|156030726|ref|XP_001584689.1| hypothetical protein SS1G_14302...   124   6e-27   Sclerotinia sclerotiorum 1980 UF-70
gi|154299637|ref|XP_001550237.1| hypothetical protein BC1G_10781...   124   1e-26   Botrytis cinerea B05.10
gi|195396973|ref|XP_002057103.1| GJ16900 [Drosophila virilis] >g...   124   1e-26   Drosophila virilis
gi|268567329|ref|XP_002647772.1| Hypothetical protein CBG20529 [...   124   1e-26   Caenorhabditis briggsae
gi|170594738|ref|XP_001902112.1| Iron-sulfur cluster assembly ac...   123   1e-26   Brugia malayi [agent of lymphatic filariasis]
gi|470505206|ref|XP_004348543.1| iron sulfur assembly protein 1,...   123   1e-26   Acanthamoeba castellanii str. Neff
gi|241251061|ref|XP_002403434.1| iron-sulfur protein Isa2, putat...   123   2e-26   Ixodes scapularis [blacklegged tick]
gi|225711762|gb|ACO11727.1| Iron-sulfur cluster assembly 1 homol...   123   2e-26   Caligus rogercresseyi
gi|332374118|gb|AEE62200.1| unknown [Dendroctonus ponderosae]         123   2e-26   Dendroctonus ponderosae
gi|19075612|ref|NP_588112.1| mitochondrial iron-sulfur protein I...   123   2e-26   Schizosaccharomyces pombe 972h-
gi|443732979|gb|ELU17523.1| hypothetical protein CAPTEDRAFT_1503...   122   2e-26   Capitella teleta
gi|442616464|ref|NP_001259579.1| lethal (1) G0136, isoform B [Dr...   122   3e-26   Drosophila melanogaster
gi|443921963|gb|ELU41484.1| iron-sulfur cluster biosynthesis dom...   122   3e-26   Rhizoctonia solani AG-1 IA
gi|240849547|ref|NP_001155651.1| iron-sulfur cluster assembly 1 ...   122   3e-26   
gi|294464585|gb|ADE77802.1| unknown [Picea sitchensis]                122   4e-26   
gi|511888387|ref|XP_004763941.1| PREDICTED: iron-sulfur cluster ...   121   5e-26   
gi|498931721|ref|XP_004519215.1| PREDICTED: iron-sulfur cluster ...   121   6e-26   
gi|72069971|ref|XP_798918.1| PREDICTED: iron-sulfur cluster asse...   121   8e-26   
gi|345482499|ref|XP_003424609.1| PREDICTED: iron-sulfur cluster ...   120   1e-25   
gi|406990244|gb|EKE09923.1| hypothetical protein ACD_16C00100G00...   120   1e-25   
gi|159479100|ref|XP_001697636.1| iron-sulfur cluster assembly pr...   120   1e-25   
gi|410929989|ref|XP_003978381.1| PREDICTED: iron-sulfur cluster ...   120   2e-25   
gi|495535443|ref|WP_008260022.1| hypothetical protein [Brevundim...   119   2e-25   
gi|396463695|ref|XP_003836458.1| similar to iron-sulfur cluster ...   119   2e-25   
gi|221234871|ref|YP_002517307.1| HesB protein family [Caulobacte...   119   2e-25   
gi|356572554|ref|XP_003554433.1| PREDICTED: iron-sulfur assembly...   119   4e-25   
gi|302781833|ref|XP_002972690.1| hypothetical protein SELMODRAFT...   118   6e-25   
gi|168011755|ref|XP_001758568.1| predicted protein [Physcomitrel...   117   8e-25   
gi|460409070|ref|XP_004249963.1| PREDICTED: iron-sulfur assembly...   117   9e-25   
gi|297719515|ref|NP_001172119.1| Os01g0105800 [Oryza sativa Japo...   117   1e-24   
gi|357134859|ref|XP_003569033.1| PREDICTED: iron-sulfur assembly...   117   1e-24   
gi|307104394|gb|EFN52648.1| hypothetical protein CHLNCDRAFT_1499...   117   1e-24   
gi|452847159|gb|EME49091.1| hypothetical protein DOTSEDRAFT_8455...   117   1e-24   
gi|225559955|gb|EEH08237.1| iron-sulfur assembly protein 1 [Ajel...   117   1e-24   
gi|494942747|ref|WP_007668775.1| hypothetical protein [Caulobact...   116   2e-24   
gi|363808122|ref|NP_001241965.1| uncharacterized protein LOC1007...   116   2e-24   
gi|83312125|ref|YP_422389.1| hypothetical protein amb3026 [Magne...   116   2e-24   
gi|223948961|gb|ACN28564.1| unknown [Zea mays] >gi|414876721|tpg...   116   2e-24   
gi|90424332|ref|YP_532702.1| hypothetical protein RPC_2835 [Rhod...   116   2e-24   
gi|167646557|ref|YP_001684220.1| iron-sulfur cluster assembly ac...   116   2e-24   
gi|508783483|gb|EOY30739.1| Iron-sulfur cluster biosynthesis fam...   116   3e-24   
gi|413947106|gb|AFW79755.1| HESB-like domain-containing protein ...   115   3e-24   
gi|508783481|gb|EOY30737.1| Iron-sulfur cluster biosynthesis fam...   115   3e-24   
gi|295689535|ref|YP_003593228.1| iron-sulfur cluster assembly ac...   115   3e-24   
gi|304321538|ref|YP_003855181.1| HesB/YadR/YfhF [Parvularcula be...   115   3e-24   
gi|225440900|ref|XP_002282752.1| PREDICTED: iron-sulfur assembly...   115   3e-24   
gi|388580070|gb|EIM20388.1| hypothetical protein WALSEDRAFT_2084...   115   3e-24   
gi|115488590|ref|NP_001066782.1| Os12g0485500 [Oryza sativa Japo...   115   4e-24   
gi|226494025|ref|NP_001147131.1| HESB-like domain-containing pro...   115   4e-24   
gi|226532810|ref|NP_001149194.1| HESB-like domain-containing pro...   115   4e-24   
gi|291233939|ref|XP_002736905.1| PREDICTED: HESB like domain con...   115   4e-24   
gi|462398275|gb|EMJ03943.1| hypothetical protein PRUPE_ppa013203...   115   5e-24   
gi|483515946|gb|EOB03000.1| Iron-sulfur cluster assembly 1-like ...   115   5e-24   
gi|470134303|ref|XP_004302994.1| PREDICTED: iron-sulfur assembly...   115   5e-24   
gi|242052391|ref|XP_002455341.1| hypothetical protein SORBIDRAFT...   115   5e-24   
gi|449512791|ref|XP_004164140.1| PREDICTED: iron-sulfur assembly...   115   6e-24   
gi|444707948|gb|ELW49087.1| Iron-sulfur cluster assembly 1 like ...   114   6e-24   
gi|298291341|ref|YP_003693280.1| iron-sulfur cluster assembly ac...   114   6e-24   
gi|15227614|ref|NP_181168.1| Iron-sulfur assembly protein IscA-l...   114   6e-24   
gi|281337738|gb|EFB13322.1| hypothetical protein PANDA_003016 [A...   114   6e-24   
gi|15227287|ref|NP_179262.1| Iron-sulphur cluster biosynthesis f...   114   7e-24   
gi|224110166|ref|XP_002315435.1| predicted protein [Populus tric...   114   7e-24   
gi|444705974|gb|ELW47350.1| Iron-sulfur cluster assembly 1 like ...   114   7e-24   
gi|384244958|gb|EIE18454.1| iron-sulfur cluster assembly protein...   114   7e-24   
gi|226507382|ref|NP_001148392.1| HESB-like domain-containing pro...   114   7e-24   
gi|144899511|emb|CAM76375.1| HesB/YadR/YfhF [Magnetospirillum gr...   114   7e-24   
gi|303279456|ref|XP_003059021.1| predicted protein [Micromonas p...   114   7e-24   
gi|91205760|ref|YP_538115.1| Iron-sulfur cluster assembly access...   114   7e-24   
gi|297832260|ref|XP_002884012.1| hypothetical protein ARALYDRAFT...   114   7e-24   
gi|255575681|ref|XP_002528740.1| iron-sulfur cluster assembly pr...   114   7e-24   
gi|482567493|gb|EOA31682.1| hypothetical protein CARUB_v10014886...   114   8e-24   
gi|209484093|gb|ACI47521.1| iron-sulfer cluster scaffold protein...   114   8e-24   
gi|495855277|ref|WP_008579856.1| hypothetical protein [Rickettsi...   114   8e-24   
gi|449434502|ref|XP_004135035.1| PREDICTED: iron-sulfur assembly...   114   8e-24   
gi|241068515|ref|XP_002408456.1| iron-sulfur protein Isa2, putat...   114   8e-24   
gi|482572115|gb|EOA36302.1| hypothetical protein CARUB_v10010609...   114   9e-24   
gi|502111353|ref|XP_004494031.1| PREDICTED: iron-sulfur assembly...   114   9e-24   
gi|116205433|ref|XP_001228527.1| hypothetical protein CHGG_10600...   114   1e-23   
gi|495894694|ref|WP_008619273.1| hypothetical protein [Magnetosp...   114   1e-23   
gi|224097616|ref|XP_002311012.1| predicted protein [Populus tric...   114   1e-23   
gi|21805702|gb|AAM76757.1| hypothetical protein [Arabidopsis tha...   114   1e-23   
gi|466061984|ref|XP_004280559.1| PREDICTED: LOW QUALITY PROTEIN:...   114   1e-23   
gi|294901574|ref|XP_002777419.1| iron-sulfur cluster assembly pr...   114   1e-23   
gi|490752968|ref|WP_004615275.1| Iron-sulfur cluster assembly ac...   114   1e-23   
gi|379712485|ref|YP_005300824.1| iron-sulfur cluster assembly ac...   114   1e-23   
gi|357153106|ref|XP_003576340.1| PREDICTED: iron-sulfur assembly...   114   1e-23   
gi|349934300|dbj|GAA29266.1| iron-sulfur cluster assembly protei...   113   1e-23   
gi|146340504|ref|YP_001205552.1| Iron-sulfur cluster assembly pr...   113   1e-23   
gi|157828603|ref|YP_001494845.1| Iron-sulfur cluster assembly ac...   113   1e-23   
gi|218187351|gb|EEC69778.1| hypothetical protein OsI_00048 [Oryz...   113   1e-23   
gi|488814626|ref|WP_002727032.1| hypothetical protein [Phaeospir...   113   1e-23   
gi|426258844|ref|XP_004023014.1| PREDICTED: iron-sulfur cluster ...   113   2e-23   
gi|497553213|ref|WP_009867411.1| COG0316: Uncharacterized conser...   113   2e-23   
gi|508783482|gb|EOY30738.1| Iron-sulfur cluster biosynthesis fam...   113   2e-23   
gi|158425233|ref|YP_001526525.1| HesB protein [Azorhizobium caul...   113   2e-23   
gi|494950635|ref|WP_007676663.1| hypothetical protein [alpha pro...   113   2e-23   
gi|383482331|ref|YP_005391245.1| iron-sulfur cluster assembly ac...   113   2e-23   
gi|302383285|ref|YP_003819108.1| iron-sulfur cluster assembly ac...   113   2e-23   
gi|255560329|ref|XP_002521181.1| iron-sulfur cluster assembly pr...   113   2e-23   
gi|209963822|ref|YP_002296737.1| Iron-sulfur cluster assembly ac...   113   2e-23   
gi|308807080|ref|XP_003080851.1| iron-sulfur cluster assembly pr...   113   2e-23   
gi|496248099|ref|WP_008961484.1| hypothetical protein [Bradyrhiz...   113   2e-23   
gi|256079122|ref|XP_002575839.1| hypothetical protein [Schistoso...   112   2e-23   
gi|498108115|ref|WP_010422271.1| hypothetical protein [Rickettsi...   112   2e-23   
gi|294948968|ref|XP_002785986.1| iron-sulfur cluster assembly pr...   112   2e-23   
gi|496318763|ref|WP_009027941.1| hypothetical protein [Bradyrhiz...   112   2e-23   
gi|383312744|ref|YP_005365545.1| iron-sulfur cluster assembly ac...   112   2e-23   
gi|459290128|ref|YP_007513285.1| iron-sulfur cluster assembly pr...   112   3e-23   
gi|493663539|ref|WP_006614813.1| hypothetical protein [Bradyrhiz...   112   3e-23   
gi|148255362|ref|YP_001239947.1| Iron-sulfur cluster assembly pr...   112   4e-23   
gi|51473669|ref|YP_067426.1| iron-binding protein IscA/HesB [Ric...   112   4e-23   
gi|392377264|ref|YP_004984423.1| putative FeS cluster assembly p...   112   4e-23   
gi|71083448|ref|YP_266167.1| hesB protein [Candidatus Pelagibact...   112   4e-23   
gi|494055071|ref|WP_006997168.1| hypothetical protein [Candidatu...   112   4e-23   
gi|297704261|ref|XP_002829034.1| PREDICTED: iron-sulfur cluster ...   112   4e-23   
gi|302846196|ref|XP_002954635.1| hypothetical protein VOLCADRAFT...   112   5e-23   
gi|470108078|ref|XP_004290362.1| PREDICTED: iron-sulfur assembly...   112   5e-23   
gi|406705921|ref|YP_006756274.1| Iron-sulfur cluster assembly ac...   112   5e-23   
gi|157803650|ref|YP_001492199.1| Iron-sulfur cluster assembly ac...   111   6e-23   
gi|496257850|ref|WP_008971235.1| hypothetical protein [Bradyrhiz...   111   6e-23   
gi|67459235|ref|YP_246859.1| Iron-sulfur cluster assembly access...   111   6e-23   
gi|449019836|dbj|BAM83238.1| probable iron-sulfur cluster assemb...   111   6e-23   
gi|15604345|ref|NP_220861.1| HESB protein (hesB2) [Rickettsia pr...   111   7e-23   
gi|332026999|gb|EGI67095.1| Iron-sulfur cluster assembly 1-like ...   111   7e-23   
gi|197105178|ref|YP_002130555.1| HesB/YadR/YfhF family protein [...   111   8e-23   
gi|157825851|ref|YP_001493571.1| Iron-sulfur cluster assembly ac...   110   9e-23   
gi|29841436|gb|AAP06468.1| similar to CG8198 gene product in Dro...   110   1e-22   
gi|383481691|ref|YP_005390606.1| iron-sulfur cluster assembly ac...   110   1e-22   
gi|170717818|ref|YP_001783509.1| iron-sulfur cluster assembly pr...   110   1e-22   
gi|15892651|ref|NP_360365.1| hesB protein [Rickettsia conorii st...   110   2e-22   
gi|494681739|ref|WP_007439073.1| iron-binding protein IscA [Acet...   110   2e-22   
gi|288961960|ref|YP_003452270.1| hypothetical protein AZL_c04330...   110   2e-22   
gi|489259141|ref|WP_003167042.1| iron-sulfur cluster assembly ac...   110   2e-22   
gi|495821190|ref|WP_008545769.1| hypothetical protein [Candidatu...   110   2e-22   
gi|115524968|ref|YP_781879.1| iron-sulfur cluster assembly acces...   109   2e-22   
gi|497523599|ref|WP_009837797.1| iron-sulfur cluster assembly pr...   109   3e-22   
gi|496697828|ref|WP_009339371.1| hypothetical protein [Afipia sp...   109   3e-22   
gi|154248533|ref|YP_001419491.1| iron-sulfur cluster assembly ac...   109   3e-22   
gi|16126101|ref|NP_420665.1| HesB/YadR/YfhF family protein [Caul...   109   3e-22   
gi|497485336|ref|WP_009799534.1| hypothetical protein [Nitrobact...   108   3e-22   
gi|489256916|ref|WP_003164846.1| hypothetical protein [Brevundim...   108   3e-22   
gi|374293757|ref|YP_005040780.1| putative FeS cluster assembly p...   108   3e-22   
gi|412994119|emb|CCO14630.1| predicted protein [Bathycoccus pras...   108   4e-22   
gi|114327983|ref|YP_745140.1| hesB protein family protein [Granu...   108   4e-22   
gi|494883779|ref|WP_007609828.1| hypothetical protein [Bradyrhiz...   108   4e-22   
gi|157964661|ref|YP_001499485.1| Iron-sulfur cluster assembly ac...   108   4e-22   
gi|338737943|ref|YP_004674905.1| iron-sulfur cluster assembly ac...   108   4e-22   
gi|488799546|ref|WP_002711952.1| iron-sulfur cluster assembly ac...   108   4e-22   
gi|37678941|ref|NP_933550.1| hypothetical protein VV0757 [Vibrio...   108   5e-22   
gi|452818889|gb|EME26039.1| iron-sulfur cluster assembly accesso...   108   5e-22   
gi|334184259|ref|NP_001189536.1| Iron-sulphur cluster biosynthes...   108   6e-22   
gi|379713734|ref|YP_005302072.1| iron-sulfur cluster assembly ac...   108   6e-22   
gi|145349948|ref|XP_001419388.1| predicted protein [Ostreococcus...   107   7e-22   
gi|75675851|ref|YP_318272.1| HesB/YadR/YfhF [Nitrobacter winogra...   107   7e-22   
gi|497422310|ref|WP_009736508.1| hypothetical protein [Bradyrhiz...   107   7e-22   
gi|255082211|ref|XP_002508324.1| predicted protein [Micromonas s...   107   8e-22   
gi|501754508|emb|CCG82079.1| Iron-sulfur assembly protein [Taphr...   107   8e-22   
gi|316934374|ref|YP_004109356.1| iron-sulfur cluster assembly ac...   107   9e-22   
gi|39935536|ref|NP_947812.1| hypothetical protein RPA2470 [Rhodo...   107   1e-21   
gi|344245011|gb|EGW01115.1| Terminal uridylyltransferase 7 [Cric...   107   1e-21   
gi|407691989|ref|YP_006816778.1| iron-binding protein IscA [Acti...   107   1e-21   
gi|497159624|ref|WP_009490953.1| hypothetical protein [Microvirg...   107   1e-21   
gi|492879219|ref|WP_006020413.1| iron-sulfur cluster assembly ac...   107   2e-21   
gi|113460429|ref|YP_718491.1| HesB-family protein [Haemophilus s...   107   2e-21   
gi|490885830|ref|WP_004747799.1| iron-sulfur cluster assembly pr...   106   2e-21   
gi|294886607|ref|XP_002771782.1| iron-sulfur cluster assembly pr...   106   2e-21   
gi|488577590|ref|YP_007915237.1| iron-sulfur cluster assembly ac...   106   2e-21   
gi|313229240|emb|CBY23826.1| unnamed protein product [Oikopleura...   106   2e-21   
gi|485644025|gb|EOD37983.1| iron-sulfur cluster assembly protein...   106   2e-21   
gi|497985911|ref|WP_010300067.1| hypothetical protein [Candidatu...   106   2e-21   
gi|118353659|ref|XP_001010095.1| Iron-sulfur cluster assembly ac...   106   2e-21   
gi|491524090|ref|WP_005381717.1| iron-sulfur cluster assembly pr...   106   2e-21   
gi|220923249|ref|YP_002498551.1| FeS assembly scaffold SufA [Met...   106   2e-21   
gi|126208405|ref|YP_001053630.1| iron-binding protein IscA [Acti...   106   2e-21   
gi|152978542|ref|YP_001344171.1| iron-sulfur cluster assembly pr...   106   2e-21   
gi|495768183|ref|WP_008492762.1| iron-binding protein IscA [Acid...   106   3e-21   
gi|395740612|ref|XP_002819961.2| PREDICTED: uncharacterized prot...   105   3e-21   
gi|92117846|ref|YP_577575.1| HesB/YadR/YfhF [Nitrobacter hamburg...   105   3e-21   
gi|262395127|ref|YP_003286981.1| iron binding protein IscA for i...   105   3e-21   
gi|491619250|ref|WP_005476800.1| iron-sulfur cluster assembly pr...   105   3e-21   
gi|384219151|ref|YP_005610317.1| hypothetical protein BJ6T_54740...   105   3e-21   
gi|196008961|ref|XP_002114346.1| expressed hypothetical protein ...   105   3e-21   
gi|86750105|ref|YP_486601.1| HesB/YadR/YfhF [Rhodopseudomonas pa...   105   3e-21   
gi|494017497|ref|WP_006959829.1| iron-sulfur cluster assembly pr...   105   3e-21   
gi|163853381|ref|YP_001641424.1| FeS assembly scaffold SufA [Met...   105   4e-21   
gi|495356669|ref|WP_008081390.1| iron-sulfur cluster assembly pr...   105   4e-21   
gi|218708631|ref|YP_002416252.1| HesB family protein [Vibrio spl...   105   4e-21   
gi|495793163|ref|WP_008517742.1| hypothetical protein [alpha pro...   105   4e-21   
gi|496229334|ref|WP_008943369.1| hypothetical protein [Oceanibac...   105   5e-21   
gi|170742453|ref|YP_001771108.1| FeS assembly scaffold SufA [Met...   105   5e-21   
gi|328862638|gb|EGG11739.1| hypothetical protein MELLADRAFT_7077...   105   5e-21   
gi|188583651|ref|YP_001927096.1| iron-sulfur cluster assembly ac...   105   5e-21   
gi|297271192|ref|XP_001082365.2| PREDICTED: iron-sulfur cluster ...   105   5e-21   
gi|384261454|ref|YP_005416640.1| HesB/YadR/YfhF [Rhodospirillum ...   105   5e-21   
gi|389874825|ref|YP_006374181.1| Iron-sulfur assembly protein [T...   105   5e-21   
gi|300023859|ref|YP_003756470.1| iron-sulfur cluster assembly ac...   105   6e-21   
gi|383772184|ref|YP_005451250.1| HesB/YadR/YfhF [Bradyrhizobium ...   105   6e-21   
gi|403369383|gb|EJY84536.1| Iron-sulfur cluster assembly accesso...   104   6e-21   
gi|291383478|ref|XP_002708296.1| PREDICTED: HESB like domain con...   104   6e-21   
gi|426384596|ref|XP_004058846.1| PREDICTED: iron-sulfur cluster ...   104   7e-21   
gi|383501604|ref|YP_005414963.1| iron-sulfur cluster assembly ac...   104   7e-21   
gi|494061206|ref|WP_007003288.1| iron-sulfur cluster assembly pr...   104   7e-21   
gi|498247732|ref|WP_010561888.1| iron-sulfur cluster assembly pr...   104   7e-21   
gi|162148824|ref|YP_001603285.1| iron-binding protein iscA [Gluc...   104   7e-21   
gi|301093476|ref|XP_002997584.1| iron-sulfur cluster assembly pr...   104   7e-21   
gi|117620083|ref|YP_856285.1| iron-sulfur cluster assembly prote...   104   7e-21   
gi|498126363|ref|WP_010440519.1| iron-sulfur cluster assembly pr...   104   8e-21   
gi|281208989|gb|EFA83164.1| iron-sulfur cluster assembly protein...   104   8e-21   
gi|492969209|ref|WP_006072581.1| iron-sulfur cluster assembly pr...   104   9e-21   
gi|491986982|ref|WP_005706573.1| iron-sulfur cluster assembly pr...   104   9e-21   
gi|488803632|ref|WP_002716038.1| FeS assembly scaffold SufA [Afi...   104   9e-21   
gi|402584119|gb|EJW78061.1| hypothetical protein WUBG_11028, par...   104   9e-21   
gi|388516433|gb|AFK46278.1| unknown [Medicago truncatula]             104   1e-20   
gi|57335889|emb|CAH25346.1| Fe-S assembly protein 1 [Guillardia ...   103   1e-20   
gi|490536810|ref|WP_004401967.1| iron-sulfur cluster assembly pr...   103   1e-20   
gi|33152208|ref|NP_873561.1| hesB family protein [Haemophilus du...   103   1e-20   
gi|490723216|ref|WP_004585773.1| Fe-S cluster assembly/activatio...   103   1e-20   
gi|495556571|ref|WP_008281150.1| HesB iron-sulfur cluster assemb...   103   1e-20   
gi|91976933|ref|YP_569592.1| FeS assembly scaffold SufA [Rhodops...   103   1e-20   
gi|127513243|ref|YP_001094440.1| iron-sulfur cluster assembly pr...   103   1e-20   
gi|491776049|ref|WP_005592828.1| iron-sulfur cluster assembly pr...   103   1e-20   
gi|336124886|ref|YP_004566934.1| IscA [Vibrio anguillarum 775] >...   103   1e-20   
gi|326509429|dbj|BAJ91631.1| predicted protein [Hordeum vulgare ...   103   2e-20   
gi|497288197|ref|WP_009602414.1| iron-sulfur cluster assembly pr...   103   2e-20   
gi|471227409|ref|XP_004034618.1| iron-sulfur cluster assembly, p...   103   2e-20   
gi|209885132|ref|YP_002288989.1| iron-sulfur cluster assembly ac...   103   2e-20   
gi|422293831|gb|EKU21131.1| iron-sulfur protein [Nannochloropsis...   103   2e-20   
gi|490547870|ref|WP_004412994.1| iron-sulfur cluster assembly pr...   103   2e-20   
gi|27363904|ref|NP_759432.1| iron-sulfur cluster assembly protei...   103   2e-20   
gi|491441982|ref|WP_005299772.1| iron-sulfur cluster assembly pr...   103   2e-20   
gi|258542732|ref|YP_003188165.1| iron-sulfur (Fe-S) cluster asse...   103   2e-20   
gi|495498089|ref|WP_008222745.1| iron-sulfur cluster assembly pr...   103   2e-20   
gi|498351554|ref|WP_010665710.1| iron-sulfur cluster assembly ac...   103   2e-20   
gi|334345656|ref|YP_004554208.1| iron-sulfur cluster assembly ac...   103   2e-20   


>gi|384493573|gb|EIE84064.1| hypothetical protein RO3G_08769 [Rhizopus delemar RA 99-880]
          Length = 135

 Score =  168 bits (425), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 104/135 (77%), Gaps = 1/135 (0%)

Query: 1   MTAATAIRSMALKMAEASVAASRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKN 60
           M     ++ +A +  + S A+SR  R++KAA+TLTP+AV+RL+ L EGP PK +RV V+ 
Sbjct: 1   MPIGAIVKQVAAESLKTSNASSRL-RLRKAALTLTPAAVSRLKDLTEGPTPKYLRVGVRQ 59

Query: 61  KGCAGQSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNN 120
           KGC+G SY+LE+T  KG+ DEIV QDGVTVLV+ K+L  ++GSEMD+V+D+LS  FVFNN
Sbjct: 60  KGCSGNSYILEFTDTKGKFDEIVNQDGVTVLVDSKALITVLGSEMDFVQDKLSEHFVFNN 119

Query: 121 PNVKENCGCGESFSV 135
           PNVK  CGCGESF++
Sbjct: 120 PNVKGTCGCGESFAI 134



>gi|384499002|gb|EIE89493.1| hypothetical protein RO3G_14204 [Rhizopus delemar RA 99-880]
          Length = 135

 Score =  166 bits (421), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 75/135 (55%), Positives = 102/135 (75%), Gaps = 1/135 (0%)

Query: 1   MTAATAIRSMALKMAEASVAASRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKN 60
           M     ++ +A +  + S A+SR  R++KAA+TLTP+A+ RL+ L +GP PK +RV V+ 
Sbjct: 1   MPIGAIVKQVATESLKTSAASSRL-RLRKAALTLTPAAITRLKNLTDGPTPKYLRVGVRQ 59

Query: 61  KGCAGQSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNN 120
           KGC+G SY LE+T  KG+ DEIV QDGVTVLV+ K+L  ++GSEMD+V+D+LS  FVFNN
Sbjct: 60  KGCSGNSYTLEFTDAKGKFDEIVNQDGVTVLVDSKALITVLGSEMDFVQDKLSEHFVFNN 119

Query: 121 PNVKENCGCGESFSV 135
           PNVK  CGCGESF++
Sbjct: 120 PNVKGTCGCGESFAI 134



>gi|353227362|emb|CCA77872.1| related to Fe/S cluster assembly protein ISA1 [Piriformospora
           indica DSM 11827]
          Length = 228

 Score =  166 bits (420), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 92/112 (82%)

Query: 24  KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIV 83
           K R  KAAM+LTP AV+RLR L+ GP+P+ IRV V+NKGCAG SY LEY  + G+ DE V
Sbjct: 113 KLRASKAAMSLTPEAVSRLRSLLSGPNPQYIRVGVRNKGCAGMSYHLEYVDKPGKFDERV 172

Query: 84  KQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           +QDGVTVL++ K+LF +IGSEMD+V+D+LSSKF F NPN+K+ CGCGESF+V
Sbjct: 173 EQDGVTVLIDSKALFSIIGSEMDWVEDKLSSKFAFKNPNIKDACGCGESFTV 224



>gi|393247897|gb|EJD55404.1| hypothetical protein AURDEDRAFT_109739 [Auricularia delicata
           TFB-10046 SS5]
          Length = 153

 Score =  164 bits (415), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 71/110 (64%), Positives = 91/110 (82%)

Query: 26  RVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQ 85
           R  KAAM+LTP+AV+RLR L++GP P+LIRV V+NKGCAG SY LEY  + G+ DE+V+Q
Sbjct: 44  RPTKAAMSLTPTAVDRLRGLLQGPHPQLIRVGVRNKGCAGMSYHLEYVDQPGKFDEVVEQ 103

Query: 86  DGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           DGV VL++ K+LF +IGSEMD+ +D LSSKF F NPNVK+ CGCGESF++
Sbjct: 104 DGVKVLIDSKALFSIIGSEMDWTEDDLSSKFTFRNPNVKDACGCGESFNI 153



>gi|378734343|gb|EHY60802.1| Fe-S cluster assembly protein SufA [Exophiala dermatitidis
           NIH/UT8656]
          Length = 259

 Score =  163 bits (412), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 71/125 (56%), Positives = 99/125 (79%), Gaps = 2/125 (1%)

Query: 13  KMAEASVAASRKGRVQ--KAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVL 70
           K  EA  A  R+ R++  KAAMT++PSA+  LR+L++ P+PK+IRV VKN+GC+G +Y L
Sbjct: 134 KTEEAKSAKPRRSRLRPRKAAMTISPSALEHLRELLDQPNPKMIRVGVKNRGCSGLAYHL 193

Query: 71  EYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCG 130
           E+  + G  DE+V+QDGV VL++ K+LF +IGSEMD+ +D+LS++FVFNNPN+ E CGCG
Sbjct: 194 EFVDKPGPFDEVVEQDGVKVLIDSKALFSIIGSEMDWKEDKLSARFVFNNPNITEQCGCG 253

Query: 131 ESFSV 135
           ESFSV
Sbjct: 254 ESFSV 258



>gi|393218961|gb|EJD04449.1| hypothetical protein FOMMEDRAFT_83195 [Fomitiporia mediterranea
           MF3/22]
          Length = 157

 Score =  162 bits (409), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 71/108 (65%), Positives = 89/108 (82%)

Query: 28  QKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQDG 87
           +KAA+TLTP AV RLR L+ GP P+LIR+ V+NKGCAG SY LEY ++    DEIV+QDG
Sbjct: 48  RKAALTLTPGAVQRLRALLSGPHPQLIRIGVRNKGCAGMSYHLEYVEKPSPFDEIVEQDG 107

Query: 88  VTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           V VL++ K+LF +IGSEMD+V+DRLS+KF F NPNVK+ CGCGESFS+
Sbjct: 108 VRVLIDSKALFSIIGSEMDWVEDRLSAKFAFKNPNVKDACGCGESFSI 155



>gi|367055856|ref|XP_003658306.1| hypothetical protein THITE_2124867 [Thielavia terrestris NRRL 8126]
 gi|347005572|gb|AEO71970.1| hypothetical protein THITE_2124867 [Thielavia terrestris NRRL 8126]
          Length = 277

 Score =  161 bits (408), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 96/129 (74%), Gaps = 2/129 (1%)

Query: 9   SMALKMAEASVAASRKG--RVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQ 66
           + A+  AE   AA  +   R +KAAM LTP+AV RLR L++ P+PKLIRV V+N+GC+G 
Sbjct: 149 AQAVSAAETKPAARARPKLRARKAAMKLTPAAVERLRALLDQPEPKLIRVGVRNRGCSGL 208

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           +Y LEY    G  DE V+QDGV VL++ K+LF +IGSEMD+V+D+LS +FVF NPN+KE 
Sbjct: 209 AYNLEYVDRPGAFDEAVEQDGVRVLIDSKALFSIIGSEMDWVEDKLSQRFVFRNPNIKEQ 268

Query: 127 CGCGESFSV 135
           CGCGESF V
Sbjct: 269 CGCGESFLV 277



>gi|403415144|emb|CCM01844.1| predicted protein [Fibroporia radiculosa]
          Length = 254

 Score =  160 bits (406), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 68/110 (61%), Positives = 91/110 (82%)

Query: 26  RVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQ 85
           +  KAA+TLTP+AV+RLR L+ GP P+LIR+ V+NKGCAG SY L+Y ++ G+ DE+V+Q
Sbjct: 143 KATKAAITLTPTAVDRLRALINGPVPRLIRIGVRNKGCAGLSYHLDYVEQPGKFDEVVEQ 202

Query: 86  DGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           DGV VL++ K+LF +IGSEMD+ +D LS+KF F NPN+K+ CGCGESFSV
Sbjct: 203 DGVKVLIDSKALFSIIGSEMDWHEDALSAKFAFKNPNIKDACGCGESFSV 252



>gi|402087414|gb|EJT82312.1| iron sulfur assembly protein 1 [Gaeumannomyces graminis var.
           tritici R3-111a-1]
          Length = 267

 Score =  160 bits (405), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 71/119 (59%), Positives = 94/119 (78%), Gaps = 3/119 (2%)

Query: 20  AASRKGRVQ---KAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEK 76
           AA R  R++   KAAM LTP+AV +LR L++GPDPKLI+V V+N+GC+G +Y LEY  + 
Sbjct: 149 AAKRPSRLRAPRKAAMRLTPAAVEQLRALLDGPDPKLIKVGVRNRGCSGLAYHLEYVDQP 208

Query: 77  GQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           G  DE V+QDGV VL++ K+LF +IGSEMD+++D+LS +FVF NPN+KE CGCGESF V
Sbjct: 209 GAFDETVEQDGVRVLIDSKALFSIIGSEMDWIEDKLSQRFVFRNPNIKEECGCGESFMV 267



>gi|511001920|gb|EPB83375.1| hypothetical protein HMPREF1544_09908 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 134

 Score =  160 bits (404), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 92/114 (80%)

Query: 22  SRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDE 81
           S + R++KAA+TLTP+AV+RL+ L EGP P+ +RV VK KGC+G SY L++T  KG+ DE
Sbjct: 21  SSRLRLRKAALTLTPAAVSRLKTLTEGPTPQYLRVGVKQKGCSGNSYDLQFTDSKGKFDE 80

Query: 82  IVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           IV QDGVTVLV+ K+L  ++GSEMD+V+D+LS  FVFNNPN K  CGCGESF+V
Sbjct: 81  IVNQDGVTVLVDSKALITVLGSEMDFVQDKLSEHFVFNNPNAKGTCGCGESFAV 134



>gi|302498837|ref|XP_003011415.1| hypothetical protein ARB_02265 [Arthroderma benhamiae CBS 112371]
 gi|291174966|gb|EFE30775.1| hypothetical protein ARB_02265 [Arthroderma benhamiae CBS 112371]
          Length = 251

 Score =  160 bits (404), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 73/136 (53%), Positives = 103/136 (75%), Gaps = 6/136 (4%)

Query: 6   AIRSMALKMAEASVAASR------KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVK 59
           A +S  +  +EA+ + ++      K R +KAA++LTP+A+++LR LV  PDPKLIR+ VK
Sbjct: 116 AQKSQPVSSSEATPSETKAKPRKSKLRARKAAVSLTPTALSKLRDLVSQPDPKLIRIGVK 175

Query: 60  NKGCAGQSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFN 119
           N+GC+G SY LEY ++    DE+V+QDGV VL++ K+LF +IGSEMD+ +D LSS+FVFN
Sbjct: 176 NRGCSGLSYHLEYVEKPAPFDEVVEQDGVKVLIDSKALFSIIGSEMDWHEDPLSSRFVFN 235

Query: 120 NPNVKENCGCGESFSV 135
           NPN+K+ CGCGESF V
Sbjct: 236 NPNIKDECGCGESFMV 251



>gi|299755861|ref|XP_001828932.2| iron sulfur assembly protein 1 [Coprinopsis cinerea okayama7#130]
 gi|298411414|gb|EAU92939.2| iron sulfur assembly protein 1 [Coprinopsis cinerea okayama7#130]
          Length = 218

 Score =  160 bits (404), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 69/112 (61%), Positives = 89/112 (79%)

Query: 24  KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIV 83
           K R  KAA+T+TP AV R+R L+  P P+LIR+ V+NKGCAG SY LEY  + G+ DE+V
Sbjct: 105 KLRSTKAALTMTPGAVERIRMLLNSPTPQLIRIGVRNKGCAGMSYHLEYVDKPGKFDEVV 164

Query: 84  KQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           +QDGV VL++ K+LF +IGSEMD+ +D LSSKFVF NPN+K+ CGCGESF+V
Sbjct: 165 EQDGVRVLIDSKALFSIIGSEMDWKEDALSSKFVFKNPNIKDACGCGESFTV 216



>gi|358366375|dbj|GAA82996.1| iron sulfur assembly protein 1 [Aspergillus kawachii IFO 4308]
          Length = 247

 Score =  160 bits (404), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 70/113 (61%), Positives = 91/113 (80%)

Query: 23  RKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEI 82
           RK R +KAAM LTP A+ +LR+L+  PDPKLIRV VKN+GC+G +Y LEY ++ G  DE+
Sbjct: 135 RKLRARKAAMKLTPVAIEQLRKLLSQPDPKLIRVGVKNRGCSGLAYHLEYVEKPGAFDEV 194

Query: 83  VKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           V+QDGV VL++ K+LF +IGSEMD+ +D+LS +FVF NPN+KE CGCGESF V
Sbjct: 195 VEQDGVKVLIDSKALFSIIGSEMDWQEDKLSRRFVFRNPNIKEECGCGESFMV 247



>gi|296808263|ref|XP_002844470.1| iron sulfur assembly protein 1 [Arthroderma otae CBS 113480]
 gi|238843953|gb|EEQ33615.1| iron sulfur assembly protein 1 [Arthroderma otae CBS 113480]
          Length = 254

 Score =  160 bits (404), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 69/112 (61%), Positives = 92/112 (82%)

Query: 24  KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIV 83
           K R +KAA++LTP+A+++LR LV  PDPKLIR+ VKN+GC+G SY LEY ++    DE+V
Sbjct: 143 KLRARKAAVSLTPTALSKLRDLVSQPDPKLIRIGVKNRGCSGLSYHLEYVEKPAPFDEVV 202

Query: 84  KQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           +QDGV VL++ K+LF +IGSEMD+ +D LSS+FVFNNPN+K+ CGCGESF V
Sbjct: 203 EQDGVKVLIDSKALFSIIGSEMDWHEDPLSSRFVFNNPNIKDECGCGESFMV 254



>gi|512193645|gb|EPE09402.1| iron sulfur assembly protein 1 [Ophiostoma piceae UAMH 11346]
          Length = 354

 Score =  160 bits (404), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 92/108 (85%)

Query: 28  QKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQDG 87
           +KAAM LTP+AV ++R+L+EGP+PKLI+V V+N+GC+G +Y LEY ++ G  DE+V+QDG
Sbjct: 247 RKAAMKLTPAAVEQVRELLEGPEPKLIKVGVRNRGCSGLAYNLEYVEKPGAFDELVEQDG 306

Query: 88  VTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           V VLV+ K+LF +IGSEMD+V+D+L+ +FVF NPN+KE CGCGESF V
Sbjct: 307 VRVLVDSKALFSIIGSEMDWVEDKLNQRFVFRNPNIKEQCGCGESFMV 354



>gi|392572128|gb|EIW65300.1| hypothetical protein TRAVEDRAFT_26140 [Trametes versicolor
           FP-101664 SS1]
          Length = 191

 Score =  160 bits (404), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 69/112 (61%), Positives = 92/112 (82%)

Query: 24  KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIV 83
           K R QKAA+TLTP+AV RLR L++ P P++IR+ V+NKGCAG SY LEY ++ G+ DE+V
Sbjct: 78  KIRAQKAAITLTPTAVERLRNLLKSPTPQMIRIGVRNKGCAGLSYHLEYVEKAGKFDEVV 137

Query: 84  KQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           +QDGV VL++ K+LF +IGSEMD+ +D LS+KF F NPN+K+ CGCGESF+V
Sbjct: 138 EQDGVKVLIDSKALFSIIGSEMDWKEDALSAKFAFKNPNIKDACGCGESFTV 189



>gi|326480948|gb|EGE04958.1| hypothetical protein TEQG_08677 [Trichophyton equinum CBS 127.97]
          Length = 252

 Score =  159 bits (403), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 69/112 (61%), Positives = 92/112 (82%)

Query: 24  KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIV 83
           K R +KAA++LTP+A+++LR LV  PDPKLIR+ VKN+GC+G SY LEY ++    DE+V
Sbjct: 141 KLRARKAAVSLTPTALSKLRDLVSQPDPKLIRIGVKNRGCSGLSYHLEYVEKPAPFDEVV 200

Query: 84  KQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           +QDGV VL++ K+LF +IGSEMD+ +D LSS+FVFNNPN+K+ CGCGESF V
Sbjct: 201 EQDGVKVLIDSKALFSIIGSEMDWHEDPLSSRFVFNNPNIKDECGCGESFMV 252



>gi|242769736|ref|XP_002341832.1| iron-sulfur cluster assembly accessory protein Isa1, putative
           [Talaromyces stipitatus ATCC 10500]
 gi|218725028|gb|EED24445.1| iron-sulfur cluster assembly accessory protein Isa1, putative
           [Talaromyces stipitatus ATCC 10500]
          Length = 240

 Score =  159 bits (403), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 68/110 (61%), Positives = 91/110 (82%)

Query: 26  RVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQ 85
           R +KAAMTLTP+AV++LR ++  PDPK+IRV VKN+GC+G +Y LEY  + G+ DE+V+Q
Sbjct: 131 RPRKAAMTLTPTAVSQLRSMLSQPDPKMIRVGVKNRGCSGLAYNLEYVDKPGKFDEVVEQ 190

Query: 86  DGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           DGV VL++ K+LF +IGSEMD+ +D+LS +FVF NPN+KE CGCGESF V
Sbjct: 191 DGVKVLIDSKALFSIIGSEMDWHEDKLSQRFVFRNPNIKEQCGCGESFMV 240



>gi|169771539|ref|XP_001820239.1| iron-sulfur assembly protein 1 [Aspergillus oryzae RIB40]
 gi|238485886|ref|XP_002374181.1| iron-sulfur cluster assembly accessory protein Isa1, putative
           [Aspergillus flavus NRRL3357]
 gi|83768098|dbj|BAE58237.1| unnamed protein product [Aspergillus oryzae RIB40]
 gi|220699060|gb|EED55399.1| iron-sulfur cluster assembly accessory protein Isa1, putative
           [Aspergillus flavus NRRL3357]
 gi|391871703|gb|EIT80860.1| iron-sulfur assembly protein [Aspergillus oryzae 3.042]
          Length = 237

 Score =  159 bits (402), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 92/113 (81%)

Query: 23  RKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEI 82
           RK R +KAAM LTP A+ +LR+L+  PDPKLIRV VKN+GC+G +Y LEY ++ G  DE+
Sbjct: 125 RKLRARKAAMKLTPEAIVQLRKLLSQPDPKLIRVGVKNRGCSGLAYHLEYVEKPGTFDEV 184

Query: 83  VKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           V+QDGV VL++ K+LF +IGSEMD+ +D+LS +F+F NPN+KE+CGCGESF V
Sbjct: 185 VEQDGVKVLIDSKALFSIIGSEMDWQEDKLSRRFIFKNPNIKESCGCGESFMV 237



>gi|340515564|gb|EGR45817.1| predicted protein [Trichoderma reesei QM6a]
          Length = 237

 Score =  159 bits (402), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 69/112 (61%), Positives = 89/112 (79%)

Query: 24  KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIV 83
           K R +KAAM LTP+AV +LR L+  PDPKLI+V V+N+GC+G +Y LEY  + G  DE+V
Sbjct: 126 KLRARKAAMKLTPAAVEQLRSLLNQPDPKLIKVGVRNRGCSGLAYQLEYVDKPGAFDELV 185

Query: 84  KQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           +QDGV VL++ K+LF +IGSEMD+ +D+LS KFVF NPN+KE CGCGESF V
Sbjct: 186 EQDGVKVLIDSKALFSIIGSEMDWAEDKLSQKFVFKNPNIKEQCGCGESFMV 237



>gi|46138745|ref|XP_391063.1| hypothetical protein FG10887.1 [Fusarium graminearum PH-1]
          Length = 239

 Score =  159 bits (402), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 74/135 (54%), Positives = 102/135 (75%), Gaps = 1/135 (0%)

Query: 2   TAATAIRSMALKMAEASVAASR-KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKN 60
           T+A+A +   ++  +   A  R K R +KAAM LTPSAV +LR+L++ P+PKLI+V V+N
Sbjct: 105 TSASAPKLNEMEAQKPKAARPRSKLRPRKAAMKLTPSAVEQLRELLDQPEPKLIKVGVRN 164

Query: 61  KGCAGQSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNN 120
           +GC+G +Y LEY  + G  DE V+QDGV VL++ K+LF +IGSEMDYV+D+L+ +FVF N
Sbjct: 165 RGCSGLAYHLEYVDKPGAFDETVEQDGVKVLIDSKALFSIIGSEMDYVEDKLNQRFVFKN 224

Query: 121 PNVKENCGCGESFSV 135
           PN+KE CGCGESF V
Sbjct: 225 PNIKEECGCGESFMV 239



>gi|345565104|gb|EGX48059.1| hypothetical protein AOL_s00081g163 [Arthrobotrys oligospora ATCC
           24927]
          Length = 271

 Score =  159 bits (402), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 91/116 (78%)

Query: 20  AASRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQH 79
              RK R +KAAMTLTP AV+ +R L +   PKLIRV VKNKGC+G +Y LEY +  G+ 
Sbjct: 151 PTPRKLRPRKAAMTLTPLAVDHIRSLTQQTPPKLIRVGVKNKGCSGLAYNLEYIESPGKF 210

Query: 80  DEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           DE+V+Q+GV V ++ K+LF +IGSEMD+V+DRLS++FVFNNPN+KE CGCGESF V
Sbjct: 211 DEVVEQEGVKVYIDSKALFSIIGSEMDWVEDRLSARFVFNNPNIKEECGCGESFMV 266



>gi|471562918|gb|EMR64325.1| putative iron sulfur assembly protein 1 protein [Eutypa lata
           UCREL1]
          Length = 267

 Score =  159 bits (401), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 73/139 (52%), Positives = 102/139 (73%), Gaps = 5/139 (3%)

Query: 2   TAATAIRSMALKMAEA-----SVAASRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRV 56
           +AATA+   A+   EA     + A  RK R +KAA+ LTPSAV +LR  ++ P+P+LI++
Sbjct: 129 SAATAVGPTAIPETEAQKPKPAAAPRRKLRPRKAALKLTPSAVEQLRARLDQPEPQLIKI 188

Query: 57  AVKNKGCAGQSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKF 116
            V+N+GC+G +Y LEY  + G  DE V QDGV VL++ K+LF +IGSEMD+V+D+L+ +F
Sbjct: 189 GVRNRGCSGLAYHLEYVDKPGPFDEEVDQDGVKVLIDSKALFSIIGSEMDWVEDKLNERF 248

Query: 117 VFNNPNVKENCGCGESFSV 135
           VF+NPN+KE CGCGESF V
Sbjct: 249 VFHNPNIKEECGCGESFMV 267



>gi|170085345|ref|XP_001873896.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164651448|gb|EDR15688.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 198

 Score =  159 bits (401), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 69/112 (61%), Positives = 91/112 (81%)

Query: 24  KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIV 83
           K R  KAA+T+TP AV+R+R L+ GP P+LIR+ V+NKGCAG SY LEY +  G+ DE+V
Sbjct: 85  KIRATKAALTMTPLAVSRIRALLGGPTPQLIRIGVRNKGCAGLSYHLEYVEHPGKFDEVV 144

Query: 84  KQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           +QDGV VL++ K+LF +IGS+MD+ +D LSSKFVF NPN+K+ CGCGESF+V
Sbjct: 145 EQDGVRVLIDSKALFSIIGSQMDWQEDNLSSKFVFKNPNIKDACGCGESFNV 196



>gi|70993822|ref|XP_751758.1| iron-sulfur cluster assembly accessory protein Isa1 [Aspergillus
           fumigatus Af293]
 gi|66849392|gb|EAL89720.1| iron-sulfur cluster assembly accessory protein Isa1, putative
           [Aspergillus fumigatus Af293]
          Length = 228

 Score =  159 bits (401), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 71/113 (62%), Positives = 90/113 (79%)

Query: 23  RKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEI 82
           RK R +KAAM LTP AV +LR+L+  PDPK IRV VKN+GC+G +Y LEY ++ G  DE+
Sbjct: 116 RKLRARKAAMKLTPLAVEQLRKLLSQPDPKFIRVGVKNRGCSGLAYHLEYVEKPGAFDEV 175

Query: 83  VKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           V+QDGV VL++ K+LF +IGSEMD+ +D+LS KFVF NPN+KE CGCGESF V
Sbjct: 176 VEQDGVKVLIDSKALFSIIGSEMDWQEDKLSRKFVFRNPNIKEQCGCGESFMV 228



>gi|159125322|gb|EDP50439.1| iron-sulfur cluster assembly accessory protein Isa1, putative
           [Aspergillus fumigatus A1163]
          Length = 228

 Score =  159 bits (401), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 71/113 (62%), Positives = 90/113 (79%)

Query: 23  RKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEI 82
           RK R +KAAM LTP AV +LR+L+  PDPK IRV VKN+GC+G +Y LEY ++ G  DE+
Sbjct: 116 RKLRARKAAMKLTPLAVEQLRKLLSQPDPKFIRVGVKNRGCSGLAYHLEYVEKPGAFDEV 175

Query: 83  VKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           V+QDGV VL++ K+LF +IGSEMD+ +D+LS KFVF NPN+KE CGCGESF V
Sbjct: 176 VEQDGVKVLIDSKALFSIIGSEMDWQEDKLSRKFVFRNPNIKEQCGCGESFMV 228



>gi|145258180|ref|XP_001401965.1| iron-sulfur assembly protein 1 [Aspergillus niger CBS 513.88]
 gi|134074570|emb|CAK38863.1| unnamed protein product [Aspergillus niger]
          Length = 247

 Score =  158 bits (400), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 70/121 (57%), Positives = 94/121 (77%)

Query: 15  AEASVAASRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTK 74
           A+ +    RK R +KAAM LTP A+ +LR+L+  P+PKLIRV VKN+GC+G +Y LEY +
Sbjct: 127 AKPTEKPRRKLRARKAAMKLTPVAIEQLRKLLTQPNPKLIRVGVKNRGCSGLAYHLEYVE 186

Query: 75  EKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFS 134
           + G  DE+V+QDGV VL++ K+LF +IGSEMD+ +D+LS +FVF NPN+KE CGCGESF 
Sbjct: 187 KPGTFDEVVEQDGVKVLIDSKALFSIIGSEMDWQEDKLSRRFVFRNPNIKEQCGCGESFM 246

Query: 135 V 135
           V
Sbjct: 247 V 247



>gi|115391347|ref|XP_001213178.1| iron sulfur assembly protein 1 [Aspergillus terreus NIH2624]
 gi|114194102|gb|EAU35802.1| iron sulfur assembly protein 1 [Aspergillus terreus NIH2624]
          Length = 244

 Score =  158 bits (400), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 96/127 (75%), Gaps = 3/127 (2%)

Query: 9   SMALKMAEASVAASRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSY 68
           S A K AE      RK R +KAAM LTP AV +LR+L+  P+PK+IRV VKN+GC+G +Y
Sbjct: 121 STAAKPAEK---PRRKLRPRKAAMKLTPVAVEQLRKLLSQPEPKMIRVGVKNRGCSGLAY 177

Query: 69  VLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCG 128
            LEY ++ G  DE+V+QDGV VL++ K+LF +IGSEMD+ +D+LS +FVF NPN+KE CG
Sbjct: 178 HLEYVEKPGMFDEVVEQDGVKVLIDSKALFSIIGSEMDWQEDKLSRRFVFRNPNIKEQCG 237

Query: 129 CGESFSV 135
           CGESF V
Sbjct: 238 CGESFMV 244



>gi|295669196|ref|XP_002795146.1| iron-binding protein iscA [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226285080|gb|EEH40646.1| iron-binding protein iscA [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 260

 Score =  158 bits (400), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 69/117 (58%), Positives = 95/117 (81%), Gaps = 2/117 (1%)

Query: 21  ASRKGRVQ--KAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQ 78
           A+R+ R++  KAA+T+TP AV+ LR+L++ PDPKLIRV VKN+GC+G SY LEY  +   
Sbjct: 144 AARRSRLKARKAALTITPEAVSHLRKLIDQPDPKLIRVGVKNRGCSGLSYNLEYVDKPAP 203

Query: 79  HDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
            DE+V+QDGV +LV+ K+LF +IGSEMD+ +D+L+S+FVF NPN+K+ CGCGESF V
Sbjct: 204 FDEVVEQDGVKILVDSKALFSIIGSEMDWQEDKLASRFVFKNPNIKDQCGCGESFMV 260



>gi|485920530|gb|EOD46536.1| putative iron-sulfur cluster assembly accessory protein
           [Neofusicoccum parvum UCRNP2]
          Length = 214

 Score =  158 bits (400), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 69/112 (61%), Positives = 92/112 (82%)

Query: 24  KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIV 83
           K + +KAAMTLTPSAV+ LR+L++ PDPKLIRV  KNKGC+G +Y LEY  + G+ D+ V
Sbjct: 102 KFKAKKAAMTLTPSAVSALRELLDSPDPKLIRVGTKNKGCSGLAYHLEYVDKPGKFDDAV 161

Query: 84  KQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           +QDGV VL++ K+L  ++GSEMD+V+D+LS +FVF NPN+ E+CGCGESFSV
Sbjct: 162 EQDGVKVLIDSKALIHILGSEMDWVEDKLSRRFVFRNPNITESCGCGESFSV 213



>gi|212542107|ref|XP_002151208.1| iron-sulfur cluster assembly accessory protein Isa1, putative
           [Talaromyces marneffei ATCC 18224]
 gi|210066115|gb|EEA20208.1| iron-sulfur cluster assembly accessory protein Isa1, putative
           [Talaromyces marneffei ATCC 18224]
          Length = 240

 Score =  158 bits (399), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 67/110 (60%), Positives = 91/110 (82%)

Query: 26  RVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQ 85
           R +KAAMTLTP+AV++L+ ++  PDPK+IRV VKN+GC+G +Y LEY  + G+ DE+V+Q
Sbjct: 131 RPRKAAMTLTPTAVSQLQSMLSQPDPKMIRVGVKNRGCSGLAYSLEYVDKPGKFDEVVEQ 190

Query: 86  DGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           DGV VL++ K+LF +IGSEMD+ +D+LS +FVF NPN+KE CGCGESF V
Sbjct: 191 DGVKVLIDSKALFSIIGSEMDWHEDKLSQRFVFRNPNIKEQCGCGESFMV 240



>gi|440637671|gb|ELR07590.1| hypothetical protein GMDG_02638 [Geomyces destructans 20631-21]
          Length = 256

 Score =  158 bits (399), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 90/114 (78%)

Query: 22  SRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDE 81
           SR    +KAA+TLTPSA+ ++R L+  P+PKLIRV VKN+GC+G SY LEY  + G  DE
Sbjct: 143 SRLRAARKAAITLTPSAIQQIRNLLSQPEPKLIRVGVKNRGCSGLSYNLEYVDKAGAFDE 202

Query: 82  IVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
            V+QDGV VL++ K+LF +IGSEMDYV+D+LS +FVF NPN+K+ CGCGESF V
Sbjct: 203 TVEQDGVKVLIDSKALFSIIGSEMDYVEDKLSERFVFKNPNIKDECGCGESFMV 256



>gi|358389050|gb|EHK26643.1| hypothetical protein TRIVIDRAFT_120437, partial [Trichoderma virens
           Gv29-8]
          Length = 217

 Score =  158 bits (399), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 69/112 (61%), Positives = 89/112 (79%)

Query: 24  KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIV 83
           K R +KAAM LTP+AV +LR L+  PDPKLI+V V+N+GC+G +Y LEY  + G  DE+V
Sbjct: 106 KLRARKAAMKLTPAAVEQLRALLNQPDPKLIKVGVRNRGCSGLAYQLEYVDKPGAFDEMV 165

Query: 84  KQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           +QDGV VL++ K+LF +IGSEMD+ +D+LS KFVF NPN+KE CGCGESF V
Sbjct: 166 EQDGVKVLIDSKALFSIIGSEMDWAEDKLSQKFVFKNPNIKEQCGCGESFMV 217



>gi|388851352|emb|CCF54937.1| related to ISA1-Fe/S cluster assembly protein [Ustilago hordei]
          Length = 346

 Score =  157 bits (398), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 89/113 (78%), Gaps = 3/113 (2%)

Query: 24  KGRVQKAAMTLTPSAVNRLRQLVEGPD-PKLIRVAVKNKGCAGQSYVLEYTK--EKGQHD 80
           K R + AA+ LTP+AV RLR L+E    PKLIRV V+NKGCAG SY LEY K  E G+ D
Sbjct: 232 KFRSRTAALKLTPTAVLRLRALMESESGPKLIRVGVRNKGCAGMSYHLEYVKPEEAGRFD 291

Query: 81  EIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESF 133
           E VKQDGV VL++ K+LF +IGSEMD+ +DRLS+KFVFNNPNVKE CGCGESF
Sbjct: 292 ERVKQDGVEVLIDSKALFSIIGSEMDWQEDRLSAKFVFNNPNVKEACGCGESF 344



>gi|320594059|gb|EFX06462.1| iron-sulfur cluster assembly accessory protein [Grosmannia
           clavigera kw1407]
          Length = 184

 Score =  157 bits (398), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 90/108 (83%)

Query: 28  QKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQDG 87
           +KAAM LTP+AV ++R L+EGPDPKL++V V+N+GC+G +Y LEY  + G  DE+V+QDG
Sbjct: 77  RKAAMHLTPAAVEQIRALLEGPDPKLLKVGVRNRGCSGLAYNLEYVGKPGAFDELVEQDG 136

Query: 88  VTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           V VLV+ K+LF +IGSEMD+V+D+L+ +FVF NPN+KE CGCGESF V
Sbjct: 137 VRVLVDSKALFSIIGSEMDWVEDKLNQRFVFRNPNIKEQCGCGESFMV 184



>gi|350632414|gb|EHA20782.1| hypothetical protein ASPNIDRAFT_127502 [Aspergillus niger ATCC
           1015]
          Length = 216

 Score =  157 bits (398), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 70/121 (57%), Positives = 94/121 (77%)

Query: 15  AEASVAASRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTK 74
           A+ +    RK R +KAAM LTP A+ +LR+L+  P+PKLIRV VKN+GC+G +Y LEY +
Sbjct: 96  AKPTEKPRRKLRARKAAMKLTPVAIEQLRKLLSQPNPKLIRVGVKNRGCSGLAYHLEYVE 155

Query: 75  EKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFS 134
           + G  DE+V+QDGV VL++ K+LF +IGSEMD+ +D+LS +FVF NPN+KE CGCGESF 
Sbjct: 156 KPGTFDEVVEQDGVKVLIDSKALFSIIGSEMDWQEDKLSRRFVFRNPNIKEQCGCGESFM 215

Query: 135 V 135
           V
Sbjct: 216 V 216



>gi|226290008|gb|EEH45492.1| iron-binding protein iscA [Paracoccidioides brasiliensis Pb18]
          Length = 260

 Score =  157 bits (398), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 69/117 (58%), Positives = 95/117 (81%), Gaps = 2/117 (1%)

Query: 21  ASRKGRVQ--KAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQ 78
           A+R+ R++  KAA+T+TP AV+ LR+L++ PDPKLIRV VKN+GC+G SY LEY  +   
Sbjct: 144 AARRSRLKARKAALTITPEAVSHLRKLIDQPDPKLIRVGVKNRGCSGLSYNLEYVDKPAP 203

Query: 79  HDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
            DE+V+QDGV +LV+ K+LF +IGSEMD+ +D+L+S+FVF NPN+K+ CGCGESF V
Sbjct: 204 FDEVVEQDGVKILVDSKALFSIIGSEMDWQEDKLASRFVFKNPNIKDQCGCGESFMV 260



>gi|342882202|gb|EGU82930.1| hypothetical protein FOXB_06483 [Fusarium oxysporum Fo5176]
 gi|477520859|gb|ENH72984.1| Iron-sulfur assembly protein 1 [Fusarium oxysporum f. sp. cubense
           race 1]
          Length = 228

 Score =  157 bits (397), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 69/112 (61%), Positives = 92/112 (82%)

Query: 24  KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIV 83
           K R +KAAM LTPSAV +LR+L++ P+PKLI+V V+N+GC+G +Y LEY  + G  DE+V
Sbjct: 117 KLRPRKAAMKLTPSAVEQLRELLDQPEPKLIKVGVRNRGCSGLAYNLEYVDKPGAFDEMV 176

Query: 84  KQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           +QDGV VL++ K+LF +IGSEMDYV+D+L+ +FVF NPN+KE CGCGESF V
Sbjct: 177 EQDGVKVLIDSKALFSIIGSEMDYVEDKLNQRFVFKNPNIKEECGCGESFMV 228



>gi|367036112|ref|XP_003667338.1| hypothetical protein MYCTH_2313065 [Myceliophthora thermophila ATCC
           42464]
 gi|347014611|gb|AEO62093.1| hypothetical protein MYCTH_2313065 [Myceliophthora thermophila ATCC
           42464]
          Length = 265

 Score =  157 bits (397), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 67/110 (60%), Positives = 90/110 (81%)

Query: 26  RVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQ 85
           R +KAA+TLTP+AV  LR L++ P+PKLI+V V+N+GC+G +Y LEY ++ G  DE V+Q
Sbjct: 156 RARKAAITLTPAAVEHLRALLDQPEPKLIKVGVRNRGCSGLAYHLEYVEKPGAFDETVEQ 215

Query: 86  DGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           DGV VL++ K+LF +IGSEMD+V+D+LS +FVF NPN+KE CGCGESF V
Sbjct: 216 DGVKVLIDSKALFSIIGSEMDWVEDKLSQRFVFRNPNIKEQCGCGESFMV 265



>gi|336258749|ref|XP_003344182.1| hypothetical protein SMAC_08113 [Sordaria macrospora k-hell]
 gi|380095131|emb|CCC07634.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 250

 Score =  157 bits (397), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 75/135 (55%), Positives = 98/135 (72%), Gaps = 2/135 (1%)

Query: 3   AATAIRSMALKMAEASVA--ASRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKN 60
           AATA  S   +   +  A  ASR    +KAAM LTP+AV  LR +++ PDPKLI+V V+N
Sbjct: 116 AATAQASAPTQPTPSKPAPRASRLRAPRKAAMKLTPAAVEHLRAMLDQPDPKLIKVGVRN 175

Query: 61  KGCAGQSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNN 120
           +GC+G +Y LEY  + G  DE V+QDGV VL++ K+LF +IGSEMD+V+D+LS +FVF N
Sbjct: 176 RGCSGLAYHLEYVDKAGAFDETVEQDGVKVLIDSKALFSIIGSEMDWVEDKLSQRFVFRN 235

Query: 121 PNVKENCGCGESFSV 135
           PN+KE CGCGESF V
Sbjct: 236 PNIKEQCGCGESFMV 250



>gi|310800418|gb|EFQ35311.1| iron-sulfur cluster assembly accessory protein [Glomerella
           graminicola M1.001]
          Length = 247

 Score =  157 bits (396), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 90/113 (79%)

Query: 23  RKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEI 82
           RK R +KAAM L+PSAV +LR L++ P+PKLI+V V+N+GC+G +Y LEY  + G  DE 
Sbjct: 135 RKLRARKAAMKLSPSAVEQLRALLDQPEPKLIKVGVRNRGCSGLAYHLEYVDKPGSFDEE 194

Query: 83  VKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           V QDGV VL++ K+LF +IGSEMD+V+D+LS +FVF NPN+KE CGCGESF V
Sbjct: 195 VVQDGVKVLIDSKALFSIIGSEMDWVEDKLSQRFVFKNPNIKEQCGCGESFMV 247



>gi|475676255|gb|EMT73289.1| Iron-sulfur assembly protein 1 [Fusarium oxysporum f. sp. cubense
           race 4]
          Length = 228

 Score =  156 bits (395), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 69/112 (61%), Positives = 91/112 (81%)

Query: 24  KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIV 83
           K R +KAAM LTPSAV +LR+L++ P+PKLI+V V+N+GC+G +Y LEY  + G  DE V
Sbjct: 117 KLRPRKAAMKLTPSAVEQLRELLDQPEPKLIKVGVRNRGCSGLAYNLEYVDKPGAFDETV 176

Query: 84  KQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           +QDGV VL++ K+LF +IGSEMDYV+D+L+ +FVF NPN+KE CGCGESF V
Sbjct: 177 EQDGVKVLIDSKALFSIIGSEMDYVEDKLNQRFVFKNPNIKEECGCGESFMV 228



>gi|358396150|gb|EHK45537.1| hypothetical protein TRIATDRAFT_151207 [Trichoderma atroviride IMI
           206040]
          Length = 233

 Score =  156 bits (395), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 68/112 (60%), Positives = 89/112 (79%)

Query: 24  KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIV 83
           K R +KAAM LTP+AV++LR L+  PDPKLI+V V+N+GC+G +Y LEY  + G  DE V
Sbjct: 122 KLRPRKAAMKLTPAAVDQLRALLNQPDPKLIKVGVRNRGCSGLAYHLEYVDKPGAFDETV 181

Query: 84  KQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           +QDGV VL++ K+LF +IG+EMD+ +D+LS KFVF NPN+KE CGCGESF V
Sbjct: 182 EQDGVKVLIDSKALFSIIGTEMDWAEDKLSQKFVFKNPNIKEQCGCGESFMV 233



>gi|302899051|ref|XP_003047968.1| hypothetical protein NECHADRAFT_104323 [Nectria haematococca mpVI
           77-13-4]
 gi|256728900|gb|EEU42255.1| hypothetical protein NECHADRAFT_104323 [Nectria haematococca mpVI
           77-13-4]
          Length = 235

 Score =  156 bits (395), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 67/112 (59%), Positives = 90/112 (80%)

Query: 24  KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIV 83
           K R +KAAM LTP+AV +LR+L++ PDPKLI+V V+N+GC+G +Y LEY  + G  DE V
Sbjct: 124 KLRARKAAMKLTPAAVEQLRELLDQPDPKLIKVGVRNRGCSGLAYHLEYVDKPGAFDETV 183

Query: 84  KQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           +QDGV VL++ K+LF +IGSEMD+ +D+L+ +FVF NPN+KE CGCGESF V
Sbjct: 184 EQDGVKVLIDSKALFSIIGSEMDWAEDKLNQRFVFRNPNIKEQCGCGESFMV 235



>gi|327295258|ref|XP_003232324.1| iron sulfur assembly protein [Trichophyton rubrum CBS 118892]
 gi|326465496|gb|EGD90949.1| iron sulfur assembly protein [Trichophyton rubrum CBS 118892]
          Length = 269

 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 67/110 (60%), Positives = 91/110 (82%)

Query: 24  KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIV 83
           K R +KAA++LTP+A+++LR LV  PDPKLIR+ VKN+GC+G SY LEY ++    DE+V
Sbjct: 141 KLRARKAAVSLTPTALSKLRDLVSQPDPKLIRIGVKNRGCSGLSYHLEYVEKPAPFDEVV 200

Query: 84  KQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESF 133
           +QDGV VL++ K+LF +IGSE+D+ +D LSS+FVFNNPN+K+ CGCGESF
Sbjct: 201 EQDGVKVLIDSKALFSIIGSEVDWHEDPLSSRFVFNNPNIKDECGCGESF 250



>gi|259487334|tpe|CBF85927.1| TPA: iron-sulfur cluster assembly accessory protein Isa1, putative
           (AFU_orthologue; AFUA_4G10690) [Aspergillus nidulans
           FGSC A4]
          Length = 242

 Score =  156 bits (394), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 91/113 (80%)

Query: 23  RKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEI 82
           RK R +KAAM LTP AV +LR+L+  P+P+LIRV VKN+GC+G +Y LEY  + G  DE+
Sbjct: 130 RKLRPRKAAMKLTPIAVEQLRKLLSQPEPRLIRVGVKNRGCSGLAYHLEYVDKPGTFDEV 189

Query: 83  VKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           V+QDGV VL++ K+LF +IGSEMD+ +D+LS++FVF NPN+KE CGCGESF V
Sbjct: 190 VEQDGVKVLIDSKALFSIIGSEMDWQEDKLSARFVFRNPNIKEECGCGESFMV 242



>gi|303311467|ref|XP_003065745.1| Iron-sulfur cluster assembly accessory family protein [Coccidioides
           posadasii C735 delta SOWgp]
 gi|240105407|gb|EER23600.1| Iron-sulfur cluster assembly accessory family protein [Coccidioides
           posadasii C735 delta SOWgp]
 gi|320039618|gb|EFW21552.1| iron-sulfur cluster assembly accessory protein Isa1 [Coccidioides
           posadasii str. Silveira]
          Length = 249

 Score =  155 bits (393), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 71/135 (52%), Positives = 99/135 (73%), Gaps = 1/135 (0%)

Query: 2   TAATAIRSMALKMAEASVAASR-KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKN 60
           T   A  +     AEA+    R K R +KAAMTLTP+AV ++R L+  PDPK+IRV VKN
Sbjct: 115 TQTPATPATPPSSAEATKKPRRSKLRPRKAAMTLTPAAVEQIRNLLSQPDPKMIRVGVKN 174

Query: 61  KGCAGQSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNN 120
           +GC+G +Y LE+ ++    DE+V+QDG+ VL++ K+LF +IGSEMD+ +D+L+S+FVF N
Sbjct: 175 RGCSGLAYHLEFVEKPAPFDEVVEQDGIKVLIDSKALFSIIGSEMDWQEDKLASRFVFKN 234

Query: 121 PNVKENCGCGESFSV 135
           PN+K+ CGCGESF V
Sbjct: 235 PNIKDECGCGESFMV 249



>gi|501304618|dbj|GAC93918.1| hypothetical protein PHSY_001486 [Pseudozyma hubeiensis SY62]
          Length = 323

 Score =  155 bits (392), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 76/113 (67%), Positives = 89/113 (78%), Gaps = 3/113 (2%)

Query: 24  KGRVQKAAMTLTPSAVNRLRQLVEGPD-PKLIRVAVKNKGCAGQSYVLEYTK--EKGQHD 80
           K R + AA+ LTP+AV RLR L+E    PKLIRV V+NKGCAG SY LEY K  E G+ D
Sbjct: 209 KFRSRTAALKLTPTAVLRLRGLMESDSGPKLIRVGVRNKGCAGMSYHLEYIKPEEAGRFD 268

Query: 81  EIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESF 133
           E VKQDGV VL++ K+LF +IGSEMD+ +DRLS+KFVFNNPNVKE CGCGESF
Sbjct: 269 ERVKQDGVEVLIDSKALFSIIGSEMDWQEDRLSAKFVFNNPNVKEACGCGESF 321



>gi|171677201|ref|XP_001903552.1| hypothetical protein [Podospora anserina S mat+]
 gi|170936668|emb|CAP61327.1| unnamed protein product [Podospora anserina S mat+]
          Length = 231

 Score =  155 bits (392), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 89/108 (82%)

Query: 28  QKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQDG 87
           +KAAM LTP+AV+ LR L++ PDPKLI+V V+N+GC+G +Y LE+ ++ G  DE V+QDG
Sbjct: 124 RKAAMKLTPAAVDHLRALLDQPDPKLIKVGVRNRGCSGLAYHLEFVEKPGAFDETVEQDG 183

Query: 88  VTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           V VL++ K+LF +IGSEMD+++D+LS +FVF NPN+KE CGCGESF V
Sbjct: 184 VKVLIDSKALFSIIGSEMDWIEDKLSQRFVFRNPNIKEQCGCGESFMV 231



>gi|407924947|gb|EKG17970.1| FeS cluster biogenesis [Macrophomina phaseolina MS6]
          Length = 215

 Score =  155 bits (392), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 68/112 (60%), Positives = 91/112 (81%)

Query: 24  KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIV 83
           K + +KAAMTLTPSAV+ LR+L++ P+PKLIRV  KNKGC+G +Y LEY  + G+ D+ V
Sbjct: 103 KFKPKKAAMTLTPSAVSALRELLDQPEPKLIRVGTKNKGCSGLAYHLEYVDKPGKFDDAV 162

Query: 84  KQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           +QDGV VL++ K+L  ++GSEMD+V+D+LS +FVF NPN+ E CGCGESFSV
Sbjct: 163 EQDGVKVLIDSKALIHILGSEMDWVEDKLSRRFVFRNPNITEQCGCGESFSV 214



>gi|341038415|gb|EGS23407.1| putative iron sulfur assembly protein [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 258

 Score =  155 bits (392), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 68/114 (59%), Positives = 90/114 (78%)

Query: 22  SRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDE 81
           SR    +KAAMTLTP+AV  LR+L+  P+PKLI+V V+N+GC+G +Y LEY  + G  DE
Sbjct: 145 SRLRTPRKAAMTLTPAAVAHLRELLNQPEPKLIKVGVRNRGCSGLAYHLEYVDKPGPFDE 204

Query: 82  IVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           +V+QDGV VL++ K+LF +IGSEMD+V++ LS +FVF NPN+KE CGCGESF V
Sbjct: 205 LVEQDGVKVLIDSKALFSIIGSEMDWVENELSQRFVFRNPNIKEQCGCGESFMV 258



>gi|119194195|ref|XP_001247701.1| hypothetical protein CIMG_01472 [Coccidioides immitis RS]
 gi|392863058|gb|EAS36240.2| iron-sulfur cluster assembly accessory protein [Coccidioides
           immitis RS]
          Length = 249

 Score =  155 bits (392), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 69/122 (56%), Positives = 96/122 (78%), Gaps = 1/122 (0%)

Query: 15  AEASVAASR-KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYT 73
           AEA+    R K R +KAAMTLTP+AV ++R L+  PDPK+IRV VKN+GC+G +Y LE+ 
Sbjct: 128 AEATKKPRRSKLRPRKAAMTLTPAAVEQIRNLLSQPDPKMIRVGVKNRGCSGLAYHLEFV 187

Query: 74  KEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESF 133
           ++    DE+V+QDG+ VL++ K+LF +IGSEMD+ +D+L+S+FVF NPN+K+ CGCGESF
Sbjct: 188 EKPAPFDEVVEQDGIKVLIDSKALFSIIGSEMDWQEDKLASRFVFKNPNIKDECGCGESF 247

Query: 134 SV 135
            V
Sbjct: 248 MV 249



>gi|443895611|dbj|GAC72957.1| fe-s cluster biosynthesis protein ISA1 [Pseudozyma antarctica T-34]
          Length = 330

 Score =  155 bits (392), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 99/137 (72%), Gaps = 6/137 (4%)

Query: 3   AATAIRSMALKMAEASVAASRKG---RVQKAAMTLTPSAVNRLRQLVEGPD-PKLIRVAV 58
           AAT  ++ A        A+S +G   R + AA+ LTP+AV RLR L++    PK+IRV V
Sbjct: 192 AATMPQATAAATPPPKKASSDRGTKFRSRTAALKLTPTAVLRLRALMDSDSGPKMIRVGV 251

Query: 59  KNKGCAGQSYVLEYTK--EKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKF 116
           +NKGCAG SY LEY K  E G+ DE VKQDGV VL++ K+LF +IGSEMD+ +DRLS+KF
Sbjct: 252 RNKGCAGMSYHLEYIKPQEAGRFDERVKQDGVEVLIDSKALFSIIGSEMDWQEDRLSAKF 311

Query: 117 VFNNPNVKENCGCGESF 133
           VFNNPNVKE CGCGESF
Sbjct: 312 VFNNPNVKEACGCGESF 328



>gi|343426694|emb|CBQ70222.1| related to ISA1-Fe/S cluster assembly protein [Sporisorium
           reilianum SRZ2]
          Length = 310

 Score =  155 bits (392), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 82/133 (61%), Positives = 98/133 (73%), Gaps = 9/133 (6%)

Query: 10  MALKMAEAS----VAASR--KGRVQKAAMTLTPSAVNRLRQLVEGPD-PKLIRVAVKNKG 62
           +A  M EAS     +A R  K R + AA+ LTP+AV RLR L+E    PKLIRV V+NKG
Sbjct: 176 VAATMPEASSPKKASADRGTKFRSRTAALKLTPTAVLRLRALMESDSGPKLIRVGVRNKG 235

Query: 63  CAGQSYVLEY--TKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNN 120
           CAG SY LEY   +E G+ DE VKQDGV VL++ K+LF +IGSEMD+ +DRLS+KFVFNN
Sbjct: 236 CAGMSYHLEYITPQEAGRFDERVKQDGVEVLIDSKALFSIIGSEMDWQEDRLSAKFVFNN 295

Query: 121 PNVKENCGCGESF 133
           PNVKE CGCGESF
Sbjct: 296 PNVKEACGCGESF 308



>gi|389642549|ref|XP_003718907.1| iron sulfur assembly protein 1 [Magnaporthe oryzae 70-15]
 gi|351641460|gb|EHA49323.1| iron sulfur assembly protein 1 [Magnaporthe oryzae 70-15]
          Length = 282

 Score =  155 bits (391), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 93/119 (78%), Gaps = 3/119 (2%)

Query: 20  AASRKGRVQ---KAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEK 76
           AA RK R++   KAAM LTP+AV +LR L++ P+PKLI+V V+N+GC+G +Y LE+  + 
Sbjct: 164 AAPRKSRLRAPRKAAMKLTPAAVEQLRTLLDQPEPKLIKVGVRNRGCSGLAYHLEFVDKA 223

Query: 77  GQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           G  DE V+QDGV VL++ K+LF +IGSEMD+++D+LS +F F NPN+KE CGCGESF V
Sbjct: 224 GPFDETVEQDGVKVLIDSKALFSIIGSEMDWIEDKLSQRFFFRNPNIKEECGCGESFMV 282



>gi|389751427|gb|EIM92500.1| hypothetical protein STEHIDRAFT_117503 [Stereum hirsutum FP-91666
           SS1]
          Length = 206

 Score =  155 bits (391), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 88/110 (80%)

Query: 26  RVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQ 85
           R +KAA+++TP+AV RLR L+  P P+LIR+ V+NKGCAG SY LEY  +  + DE+V Q
Sbjct: 95  RARKAALSITPTAVERLRILLHSPTPQLIRIGVRNKGCAGLSYHLEYVDKPSKFDEVVNQ 154

Query: 86  DGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           DGV V+++ K+LF +IGSEMD+ +D LSSKFVF NPN+K+ CGCGESFS+
Sbjct: 155 DGVQVVIDSKALFSIIGSEMDWKEDALSSKFVFKNPNIKDACGCGESFSI 204



>gi|296422409|ref|XP_002840753.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295636976|emb|CAZ84944.1| unnamed protein product [Tuber melanosporum]
          Length = 181

 Score =  154 bits (390), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 90/121 (74%)

Query: 15  AEASVAASRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTK 74
           A  +V   +  R +K+A+TLTPSA   LR L+  P P+LIR+ VKN+GC+G +Y LEY  
Sbjct: 60  APTTVPTKKTLRPRKSAITLTPSATQHLRSLLAQPTPQLIRIGVKNRGCSGLAYHLEYVD 119

Query: 75  EKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFS 134
              + DE V QDGV VL++ K+LF +IGSEMD+V+DR+S++FVF NPN+KE CGCGESFS
Sbjct: 120 RPDKFDEEVVQDGVKVLIDSKALFSIIGSEMDWVEDRISARFVFRNPNIKEQCGCGESFS 179

Query: 135 V 135
           V
Sbjct: 180 V 180



>gi|472586539|gb|EMS24058.1| iron-sulfur cluster assembly protein [Rhodosporidium toruloides
           NP11]
          Length = 190

 Score =  154 bits (390), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 89/110 (80%)

Query: 26  RVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQ 85
           R +KAA+TL+P AV+R+R L++ P PKLIRV V+NKGCAG SY LEY  +  + DE+V+Q
Sbjct: 81  RARKAALTLSPKAVDRIRGLLDQPSPKLIRVGVRNKGCAGMSYHLEYVDKPDKFDEVVEQ 140

Query: 86  DGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           DGV V+++ K+LF +IGSEMD+ +D L ++FVFNNPN+K+ CGCGESF V
Sbjct: 141 DGVKVVIDSKALFSIIGSEMDWQEDALQARFVFNNPNIKDACGCGESFIV 190



>gi|449550394|gb|EMD41358.1| hypothetical protein CERSUDRAFT_79016 [Ceriporiopsis subvermispora
           B]
          Length = 203

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 87/110 (79%)

Query: 26  RVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQ 85
           R  KAA+TLTP+AV RLR L+ GP P+ +R+ VKN+GCAG +Y LEY  +  + DE+V Q
Sbjct: 92  RATKAAITLTPTAVERLRNLINGPHPQHLRIGVKNRGCAGLAYNLEYVDKPAKFDEVVDQ 151

Query: 86  DGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           DGV VL++ ++LF +IGSEMD+ +D LS+KFVF NPN+K+ CGCGESFSV
Sbjct: 152 DGVRVLIDGRALFSVIGSEMDWKEDGLSAKFVFKNPNIKDACGCGESFSV 201



>gi|399172271|emb|CCE26956.1| related to Fe/S cluster assembly protein ISA1 [Claviceps purpurea
           20.1]
          Length = 228

 Score =  153 bits (387), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 88/110 (80%)

Query: 26  RVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQ 85
           R +KAAM LTP+AV +LR +++ P+PKLI+V V+N+GC+G +Y LEY  + G  DE V+Q
Sbjct: 119 RARKAAMKLTPAAVEQLRMMLDQPEPKLIKVGVRNRGCSGLAYHLEYVDKPGTFDETVEQ 178

Query: 86  DGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           DGV VL++ K+LF +IGSEMD+ +D+L+ KFVF NPN+KE CGCGESF V
Sbjct: 179 DGVKVLIDSKALFSIIGSEMDWAEDKLNQKFVFRNPNIKEQCGCGESFMV 228



>gi|255947932|ref|XP_002564733.1| Pc22g07080 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211591750|emb|CAP97996.1| Pc22g07080 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 230

 Score =  153 bits (386), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 92/121 (76%)

Query: 15  AEASVAASRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTK 74
           ++ S    R  R +KAAM L+P AV +LR+L+  P+PK IRV VKN+GC+G +Y LEY +
Sbjct: 110 SKTSPKPRRPLRARKAAMKLSPVAVEQLRKLMAQPEPKFIRVGVKNRGCSGLAYHLEYVE 169

Query: 75  EKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFS 134
           + G+ DE V+QDGV VL++ K+LF +IGSEMD+ +D+LS +FVF NPN+KE CGCGESF 
Sbjct: 170 KPGKFDETVEQDGVKVLIDSKALFSIIGSEMDWQEDKLSRRFVFRNPNIKEECGCGESFM 229

Query: 135 V 135
           V
Sbjct: 230 V 230



>gi|358056751|dbj|GAA97414.1| hypothetical protein E5Q_04092 [Mixia osmundae IAM 14324]
          Length = 221

 Score =  153 bits (386), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 66/114 (57%), Positives = 93/114 (81%), Gaps = 1/114 (0%)

Query: 23  RKGRVQKAAMTLTPSAVNRLRQLVEGPD-PKLIRVAVKNKGCAGQSYVLEYTKEKGQHDE 81
           R+ + ++AA+TLT +AV RL+ L+  P  PK +R++V+NKGCAG +Y LEY  E G+ DE
Sbjct: 108 RQFKARQAALTLTQNAVVRLQDLLSDPSAPKYLRISVRNKGCAGMAYHLEYVDEAGKFDE 167

Query: 82  IVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           +V+QDGV V+++ K+LF +IGSEMD+ +DRLS+KFVFNNPN+K++CGCGESF V
Sbjct: 168 VVQQDGVKVVIDSKALFSIIGSEMDWAEDRLSAKFVFNNPNIKDSCGCGESFLV 221



>gi|425766277|gb|EKV04901.1| Iron-sulfur cluster assembly accessory protein Isa1, putative
           [Penicillium digitatum PHI26]
 gi|425779008|gb|EKV17103.1| Iron-sulfur cluster assembly accessory protein Isa1, putative
           [Penicillium digitatum Pd1]
          Length = 236

 Score =  153 bits (386), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 66/121 (54%), Positives = 91/121 (75%)

Query: 15  AEASVAASRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTK 74
           ++ S    R  R +KAAM L+P A  +LR+L+  P+PK IRV VKN+GC+G +Y LEY  
Sbjct: 116 SKTSAKPRRPLRARKAAMKLSPVATEQLRKLMAQPEPKFIRVGVKNRGCSGLAYHLEYVD 175

Query: 75  EKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFS 134
           + G+ DE+V+QDGV VL++ K+LF +IGSEMD+ +D+LS +F+F NPN+KE CGCGESF 
Sbjct: 176 KPGKFDEVVEQDGVKVLIDSKALFSIIGSEMDWQEDKLSRRFIFRNPNIKEECGCGESFM 235

Query: 135 V 135
           V
Sbjct: 236 V 236



>gi|440464761|gb|ELQ34129.1| DNA-dependent ATPase MGS1 [Magnaporthe oryzae Y34]
 gi|440489195|gb|ELQ68870.1| DNA-dependent ATPase MGS1 [Magnaporthe oryzae P131]
          Length = 877

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 92/117 (78%), Gaps = 3/117 (2%)

Query: 20  AASRKGRVQ---KAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEK 76
           AA RK R++   KAAM LTP+AV +LR L++ P+PKLI+V V+N+GC+G +Y LE+  + 
Sbjct: 164 AAPRKSRLRAPRKAAMKLTPAAVEQLRTLLDQPEPKLIKVGVRNRGCSGLAYHLEFVDKA 223

Query: 77  GQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESF 133
           G  DE V+QDGV VL++ K+LF +IGSEMD+++D+LS +F F NPN+KE CGCGESF
Sbjct: 224 GPFDETVEQDGVKVLIDSKALFSIIGSEMDWIEDKLSQRFFFRNPNIKEECGCGESF 280



>gi|346978933|gb|EGY22385.1| iron sulfur assembly protein [Verticillium dahliae VdLs.17]
          Length = 250

 Score =  152 bits (385), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 67/112 (59%), Positives = 89/112 (79%)

Query: 24  KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIV 83
           K R +KAAM LT +AV +L+ ++EGPDPKLI+V V+N+GC+G +Y LE+  + G  DE V
Sbjct: 139 KLRARKAAMKLTAAAVEQLQAMLEGPDPKLIKVGVRNRGCSGLAYHLEWVDKAGSFDEEV 198

Query: 84  KQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
            QDGV VL++ K+LF +IGSEMD+V+D+LS +FVF NPN+KE CGCGESF V
Sbjct: 199 VQDGVKVLIDSKALFSIIGSEMDWVEDKLSQRFVFKNPNIKEECGCGESFMV 250



>gi|449299207|gb|EMC95221.1| hypothetical protein BAUCODRAFT_72789 [Baudoinia compniacensis UAMH
           10762]
          Length = 253

 Score =  152 bits (384), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 67/112 (59%), Positives = 88/112 (78%)

Query: 24  KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIV 83
           K R +KAAM LTP AV +L++L E P+ KLIRV VKN+GC+G +Y LEY  + G  DE V
Sbjct: 141 KLRPRKAAMNLTPKAVEQLKELFEQPESKLIRVGVKNRGCSGLAYHLEYVDKPGSFDESV 200

Query: 84  KQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           +QDGV VL++ K+LF +IGSEMD+ +D+LS++FVF NPN+ E CGCGESFS+
Sbjct: 201 EQDGVKVLIDSKALFSIIGSEMDWQEDKLSARFVFRNPNITEQCGCGESFSI 252



>gi|477533214|gb|ENH84804.1| iron-sulfur cluster assembly accessory protein [Colletotrichum
           orbiculare MAFF 240422]
          Length = 251

 Score =  152 bits (384), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 88/110 (80%)

Query: 26  RVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQ 85
           R +KAAM LTP+AV +LR L++ P+PKLI+V V+N+GC+G +Y LE+  + G  DE V Q
Sbjct: 142 RARKAAMKLTPAAVEQLRALLDQPEPKLIKVGVRNRGCSGLAYHLEFVDKPGSFDEEVVQ 201

Query: 86  DGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           DGV VL++ K+LF +IGSEMD+V+D+LS +FVF NPN+KE CGCGESF V
Sbjct: 202 DGVKVLIDSKALFSIIGSEMDWVEDKLSQRFVFKNPNIKEECGCGESFMV 251



>gi|346324995|gb|EGX94592.1| iron sulfur assembly protein 1 [Cordyceps militaris CM01]
          Length = 248

 Score =  152 bits (384), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 88/110 (80%)

Query: 24  KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIV 83
           K R +KAAM LTP+AV +LR L++ P+PKLI+V V+N+GC+G +Y LE+  + G  DE V
Sbjct: 133 KLRPRKAAMKLTPAAVEQLRNLLDQPEPKLIKVGVRNRGCSGLAYHLEFVDKPGAFDETV 192

Query: 84  KQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESF 133
           +QDGV VL++ K+LF +IGSEMD+ +D+LS +FVF NPN+KE CGCGESF
Sbjct: 193 EQDGVRVLIDSKALFSIIGSEMDWAEDKLSQRFVFRNPNIKEECGCGESF 242



>gi|390603813|gb|EIN13204.1| hypothetical protein PUNSTDRAFT_59502, partial [Punctularia
           strigosozonata HHB-11173 SS5]
          Length = 102

 Score =  152 bits (383), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 84/101 (83%)

Query: 35  TPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQDGVTVLVEH 94
           TP+AVNRLR L+ GPDP+ +R+ V+NKGCAG SY L+Y  E  + DE+V+QDGV VL++ 
Sbjct: 2   TPAAVNRLRNLISGPDPRHLRIGVRNKGCAGLSYHLDYVTEPAKFDEVVEQDGVKVLIDS 61

Query: 95  KSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           K+LF +IGSEMD+V+D+LSSKF F NPN+K+ CGCGESF+V
Sbjct: 62  KALFSIIGSEMDWVEDKLSSKFAFKNPNIKDACGCGESFTV 102



>gi|452989696|gb|EME89451.1| hypothetical protein MYCFIDRAFT_121871, partial [Pseudocercospora
           fijiensis CIRAD86]
          Length = 232

 Score =  152 bits (383), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 90/112 (80%)

Query: 24  KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIV 83
           K R +KA +TL+P AV +L++L E P+ KLIR+ VKN+GC+G +Y LEY  + G  DE+V
Sbjct: 121 KLRPRKAPITLSPKAVEQLKELFEQPESKLIRIGVKNRGCSGLAYHLEYVDKPGAFDEMV 180

Query: 84  KQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           +QDGV VL++ K+LF +IGSEMD+++D+LS++F+F NPN+ E CGCGESFS+
Sbjct: 181 EQDGVKVLIDSKALFSIIGSEMDWLEDKLSARFIFKNPNITEQCGCGESFSI 232



>gi|448119739|ref|XP_004203805.1| Piso0_000825 [Millerozyma farinosa CBS 7064]
 gi|359384673|emb|CCE78208.1| Piso0_000825 [Millerozyma farinosa CBS 7064]
          Length = 277

 Score =  151 bits (382), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 96/129 (74%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRV---QKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQ 66
           M  K  +A+ A  +K R    +KA ++LTP AV+ LRQL++ P+P+LIR+ V+N+GC+G 
Sbjct: 149 MEKKQQDATTAKPKKRRTLRPRKALISLTPKAVDHLRQLLDQPEPQLIRIGVQNRGCSGL 208

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           +Y LEY  + G+ DE V+QDGV VL++ K+LF ++GSEMD++ D+LSS+F+F NPN K  
Sbjct: 209 TYHLEYVTQPGKFDETVEQDGVKVLIDSKALFSIVGSEMDWIDDKLSSRFIFKNPNSKGT 268

Query: 127 CGCGESFSV 135
           CGCGESF V
Sbjct: 269 CGCGESFMV 277



>gi|344300188|gb|EGW30528.1| hypothetical protein SPAPADRAFT_63362 [Spathaspora passalidarum
           NRRL Y-27907]
          Length = 273

 Score =  151 bits (382), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 65/119 (54%), Positives = 95/119 (79%), Gaps = 3/119 (2%)

Query: 20  AASRKGRV---QKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEK 76
           AA +K RV   +KA +TLTP+AV+ L++L++ P PK+IR+ V+N+GC+G +Y LEY +E 
Sbjct: 155 AAPKKKRVLRPRKALITLTPNAVSHLQRLLDQPTPKMIRIGVRNRGCSGLTYNLEYVEEA 214

Query: 77  GQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           G+ DE+++QDGV VL++ K+LF ++GSEMD++ D+LSS+F+F NPN K  CGCGESF V
Sbjct: 215 GKFDELIEQDGVKVLIDSKALFSIVGSEMDWLDDKLSSRFIFKNPNSKGTCGCGESFMV 273



>gi|254565285|ref|XP_002489753.1| Mitochondrial matrix protein involved in biogenesis of iron-sulfur
           (Fe/S) cluster of Fe/S proteins [Komagataella pastoris
           GS115]
 gi|238029549|emb|CAY67472.1| Mitochondrial matrix protein involved in biogenesis of iron-sulfur
           (Fe/S) cluster of Fe/S proteins [Komagataella pastoris
           GS115]
          Length = 238

 Score =  151 bits (382), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 88/113 (77%)

Query: 23  RKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEI 82
           R  R +KA +TL+PSAV+ LR L + P+PKL R+ V+N+GC+G +Y LEY  E G+ DE+
Sbjct: 126 RALRPRKALITLSPSAVSHLRALSDLPEPKLTRIGVRNRGCSGLTYHLEYVSEPGKFDEL 185

Query: 83  VKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           V+QDGV VL++ K+LF ++GSEMD+V D+LSSKFVF NPN K  CGCGESF V
Sbjct: 186 VEQDGVKVLIDSKALFSIVGSEMDWVDDKLSSKFVFKNPNSKGTCGCGESFMV 238



>gi|511005814|gb|EPB87142.1| hypothetical protein HMPREF1544_06068 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 118

 Score =  151 bits (381), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 94/115 (81%)

Query: 21  ASRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHD 80
            +R+ +++KA +TLT +AV+RL++L  G  P+ +RV VK+KGC+G SY++E+T+ KG+ D
Sbjct: 4   GTRRLKLRKAPLTLTTAAVSRLKELSGGDHPQFLRVGVKSKGCSGHSYMMEFTETKGKFD 63

Query: 81  EIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           EIV Q GVTVLV+ K+L  ++GSEMDYV+D LSS+FVF+NPNVK  CGCGESF+V
Sbjct: 64  EIVDQQGVTVLVDSKALLTVLGSEMDYVEDALSSQFVFHNPNVKGTCGCGESFTV 118



>gi|406863934|gb|EKD16980.1| iron sulfur assembly protein 1 [Marssonina brunnea f. sp.
           'multigermtubi' MB_m1]
          Length = 250

 Score =  150 bits (380), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 67/112 (59%), Positives = 90/112 (80%)

Query: 24  KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIV 83
           K R +KAAM LT  AV +LR+L+  P+PKLI+V VKN+GC+G +Y LEY ++ G  DE V
Sbjct: 139 KLRARKAAMKLTDGAVRQLRELLNQPEPKLIKVGVKNRGCSGLAYHLEYVEKPGMFDEEV 198

Query: 84  KQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           +QDGV VL++ K+LF +IGSEMD+V+D+L+ +FVF+NPN+KE CGCGESF V
Sbjct: 199 EQDGVKVLIDSKALFSIIGSEMDWVEDKLNQRFVFSNPNIKEQCGCGESFMV 250



>gi|255727102|ref|XP_002548477.1| hypothetical protein CTRG_02774 [Candida tropicalis MYA-3404]
 gi|240134401|gb|EER33956.1| hypothetical protein CTRG_02774 [Candida tropicalis MYA-3404]
          Length = 269

 Score =  150 bits (380), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 87/110 (79%)

Query: 26  RVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQ 85
           R +KA +TL+P+AV  LR L+  P+PKLIR+ V+N+GC+G +Y LEY  + G+ DE+V+Q
Sbjct: 160 RPRKALITLSPTAVEHLRALLNQPEPKLIRIGVRNRGCSGLTYNLEYVDKPGKFDELVEQ 219

Query: 86  DGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           DGV VL++ K+LF ++GSEMD++ D+LSSKF+F NPN K  CGCGESF V
Sbjct: 220 DGVKVLIDSKALFSIVGSEMDWLDDKLSSKFIFKNPNSKGTCGCGESFMV 269



>gi|225682593|gb|EEH20877.1| iron sulfur assembly protein [Paracoccidioides brasiliensis Pb03]
          Length = 260

 Score =  150 bits (380), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 93/117 (79%), Gaps = 2/117 (1%)

Query: 21  ASRKGRVQ--KAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQ 78
           A+R+ R++  KAA+T+TP AV+ LR+L+   DPKLIRV VKN+GC+G SY LEY  +   
Sbjct: 144 AARRSRLKARKAALTITPEAVSHLRKLIFFLDPKLIRVGVKNRGCSGLSYNLEYVDKPAP 203

Query: 79  HDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
            DE+V+QDGV +LV+ K+LF +IGSEMD+ +D+L+S+FVF NPN+K+ CGCGESF V
Sbjct: 204 FDEVVEQDGVKILVDSKALFSIIGSEMDWQEDKLASRFVFKNPNIKDQCGCGESFMV 260



>gi|400597316|gb|EJP65049.1| iron-sulfur cluster assembly accessory protein [Beauveria bassiana
           ARSEF 2860]
          Length = 252

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 66/112 (58%), Positives = 88/112 (78%)

Query: 24  KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIV 83
           K R +KAAM LT +AV +LR L++ P+PKLI+V V+N+GC+G +Y LEY  + G  DE V
Sbjct: 141 KLRPRKAAMKLTAAAVEQLRNLLDQPEPKLIKVGVRNRGCSGLAYHLEYVDKPGAFDETV 200

Query: 84  KQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           +QDGV VL++ K+LF +IGSEMD+ +D+LS +FVF NPN+KE CGCGESF V
Sbjct: 201 EQDGVRVLIDSKALFSIIGSEMDWAEDKLSQRFVFRNPNIKEECGCGESFMV 252



>gi|241956608|ref|XP_002421024.1| iron sulfur assembly protein, putative [Candida dubliniensis CD36]
 gi|223644367|emb|CAX41180.1| iron sulfur assembly protein, putative [Candida dubliniensis CD36]
          Length = 265

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 98/138 (71%), Gaps = 3/138 (2%)

Query: 1   MTAATAIRSMALKMAEASVAASRKGRV---QKAAMTLTPSAVNRLRQLVEGPDPKLIRVA 57
           +T+ +A     +K A       +K RV   +KA +TLT SAV  L+ L++ PDPKLIR+ 
Sbjct: 128 ITSTSASVPTEIKSAATPSVTPKKKRVLRPRKALITLTSSAVQHLQGLLDQPDPKLIRIG 187

Query: 58  VKNKGCAGQSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFV 117
           V+N+GC+G +Y LEY  + G+ DE+V+QDGV VL++ K+LF ++GSEMD++ D+LSS+F+
Sbjct: 188 VRNRGCSGLTYNLEYVDKPGKFDELVEQDGVKVLIDSKALFSIVGSEMDWLDDKLSSRFI 247

Query: 118 FNNPNVKENCGCGESFSV 135
           F NPN K  CGCGESF V
Sbjct: 248 FKNPNSKGTCGCGESFMV 265



>gi|154287670|ref|XP_001544630.1| iron-binding protein iscA [Ajellomyces capsulatus NAm1]
 gi|150408271|gb|EDN03812.1| iron-binding protein iscA [Ajellomyces capsulatus NAm1]
          Length = 285

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 86/112 (76%)

Query: 24  KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIV 83
           K + +K AM +TP A+  LRQL + PDPKL+RV VKN+GC+G SY LEY  +    DE+V
Sbjct: 174 KLKARKTAMHITPEAILHLRQLTDQPDPKLVRVGVKNRGCSGLSYHLEYVDKPAPFDEVV 233

Query: 84  KQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           +QDGV +L++ K+LF +IG+EMD+ +D L+S+FVF NPN+K+ CGCGESF V
Sbjct: 234 EQDGVKILIDSKALFSIIGTEMDWQEDSLASRFVFKNPNIKDQCGCGESFMV 285



>gi|395326134|gb|EJF58547.1| hypothetical protein DICSQDRAFT_66853 [Dichomitus squalens LYAD-421
           SS1]
          Length = 191

 Score =  150 bits (379), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 66/112 (58%), Positives = 89/112 (79%)

Query: 24  KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIV 83
           K R ++AA+TLTP AV RLR L++ P P++IR+ VKNKGCAG SY L+Y  +  + DE+V
Sbjct: 79  KIRARQAAITLTPGAVERLRNLLKSPTPQMIRIGVKNKGCAGLSYHLDYVDKPEKFDEVV 138

Query: 84  KQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           +QDGV VL++ K+LF +IGSEMD+ +D LS+KF F NPN+K+ CGCGESF+V
Sbjct: 139 EQDGVKVLIDSKALFSIIGSEMDWKEDGLSAKFAFKNPNIKDACGCGESFTV 190



>gi|327263395|ref|XP_003216505.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Anolis carolinensis]
          Length = 129

 Score =  150 bits (378), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 97/129 (75%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRVQ--KAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQ 66
           MA  M  A+V A  K ++Q  +AA+TLTPSAVN+++QL+ + PD   ++V V+ +GC G 
Sbjct: 1   MASSMVRATVRAVSKRKIQATRAALTLTPSAVNKIKQLLKDKPDHVGVKVGVRTRGCNGL 60

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           SY LEYTK KG  DE V+QDGV V +E K+   L+G+EMDY++D+L+S+FVFNNPN+K  
Sbjct: 61  SYTLEYTKSKGDSDEEVEQDGVKVFIEKKAQLTLLGTEMDYIEDKLTSEFVFNNPNIKGT 120

Query: 127 CGCGESFSV 135
           CGCGESF++
Sbjct: 121 CGCGESFNI 129



>gi|255714939|ref|XP_002553751.1| KLTH0E06182p [Lachancea thermotolerans]
 gi|238935133|emb|CAR23314.1| KLTH0E06182p [Lachancea thermotolerans CBS 6340]
          Length = 267

 Score =  149 bits (377), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 65/113 (57%), Positives = 89/113 (78%)

Query: 23  RKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEI 82
           R+ R +KA ++LTP+AV+ L+ L+  P+PKLIRV VKN+GC+G +Y LEY    G+ DE+
Sbjct: 155 RRLRPRKALISLTPNAVDHLKLLLNQPEPKLIRVGVKNRGCSGLTYDLEYITAPGKFDEV 214

Query: 83  VKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           V+QDGV V+++ K+LF ++GSEMD++ DRLSS+FVF NPN K  CGCGESF V
Sbjct: 215 VEQDGVRVILDSKALFSIVGSEMDWIDDRLSSRFVFKNPNSKGTCGCGESFMV 267



>gi|430811500|emb|CCJ31034.1| unnamed protein product [Pneumocystis jirovecii]
          Length = 184

 Score =  149 bits (376), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 87/108 (80%)

Query: 28  QKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQDG 87
           +KAAMTLTP AV RL++L+  P PK+IR+  K +GCAG SY+LEY  + G+ DE V QDG
Sbjct: 76  RKAAMTLTPRAVKRLKELLNQPQPKMIRIGTKQRGCAGLSYLLEYVDKPGKFDETVIQDG 135

Query: 88  VTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           VT+L+++++LF +IGS+MD+++DRL+++FVF+NPN    CGC +SFSV
Sbjct: 136 VTILIDNRALFTIIGSKMDWIEDRLTARFVFDNPNATSTCGCQQSFSV 183



>gi|50288207|ref|XP_446532.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49525840|emb|CAG59459.1| unnamed protein product [Candida glabrata]
          Length = 250

 Score =  149 bits (375), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 66/128 (51%), Positives = 95/128 (74%), Gaps = 5/128 (3%)

Query: 13  KMAEASVAASRKG-----RVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQS 67
           K +++S  A +KG     R +KA +TL+P A+  L+ L++ P+PKLIRV  KN+GC+G +
Sbjct: 123 KASDSSAPAKKKGKRRILRPRKAVITLSPKAIYHLKALLDEPEPKLIRVGAKNRGCSGLT 182

Query: 68  YVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENC 127
           Y L+Y  E G+ DE+V+QDGV ++++ K+LF ++GSEMD+V D+L+SKFVF NPN K  C
Sbjct: 183 YDLQYITEPGKFDEVVEQDGVKIVIDSKALFSVVGSEMDWVDDKLASKFVFKNPNSKGTC 242

Query: 128 GCGESFSV 135
           GCGESF V
Sbjct: 243 GCGESFMV 250



>gi|164423381|ref|XP_963568.2| hypothetical protein NCU08707 [Neurospora crassa OR74A]
 gi|9453818|emb|CAB99386.1| conserved hypothetical protein [Neurospora crassa]
 gi|157070068|gb|EAA34332.2| hypothetical protein NCU08707 [Neurospora crassa OR74A]
          Length = 261

 Score =  149 bits (375), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 89/115 (77%)

Query: 21  ASRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHD 80
           ASR    +KAA+ LT +AV  LR +++ P+PKLI+V V+N+GC+G +Y LEY  + G  D
Sbjct: 147 ASRLRAPRKAAINLTSAAVEHLRAMLDQPEPKLIKVGVRNRGCSGLAYHLEYVDKAGAFD 206

Query: 81  EIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           E V+QDGV VL++ K+LF +IGSEMD+V+D+LS +FVF NPN+KE CGCGESF V
Sbjct: 207 ETVEQDGVKVLIDSKALFSIIGSEMDWVEDKLSQRFVFRNPNIKEQCGCGESFMV 261



>gi|260950671|ref|XP_002619632.1| hypothetical protein CLUG_00791 [Clavispora lusitaniae ATCC 42720]
 gi|238847204|gb|EEQ36668.1| hypothetical protein CLUG_00791 [Clavispora lusitaniae ATCC 42720]
          Length = 266

 Score =  148 bits (374), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 62/113 (54%), Positives = 89/113 (78%)

Query: 23  RKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEI 82
           R+ R +KA +TL+P AV  LR L++ P+P+LIR+ V+N+GC+G +Y LEY  + G+ DE+
Sbjct: 154 RQLRPRKALITLSPGAVEHLRALLDQPNPQLIRIGVRNRGCSGLTYHLEYVDKPGKFDEL 213

Query: 83  VKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           V+QDGV VL++ K+LF ++GSEMD++ D+LSS+F+F NPN K  CGCGESF V
Sbjct: 214 VEQDGVQVLIDSKALFSIVGSEMDWIDDKLSSRFIFKNPNSKGTCGCGESFMV 266



>gi|238883113|gb|EEQ46751.1| hypothetical protein CAWG_05116 [Candida albicans WO-1]
          Length = 269

 Score =  148 bits (374), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 92/123 (74%), Gaps = 2/123 (1%)

Query: 15  AEASVAASRKG--RVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEY 72
           A  SV   +K   R +KA +TLT SAV  L+ L++ PDPKLIR+ V+N+GC+G +Y LEY
Sbjct: 147 AAPSVTPKKKRVLRPRKALITLTSSAVQHLQGLLDQPDPKLIRIGVRNRGCSGLTYNLEY 206

Query: 73  TKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGES 132
             + G+ DE+V+QDGV VL++ K+LF ++GSEMD++ D+LSS+F+F NPN K  CGCGES
Sbjct: 207 VDKPGKFDELVEQDGVKVLIDSKALFSIVGSEMDWLDDKLSSRFIFKNPNSKGTCGCGES 266

Query: 133 FSV 135
           F V
Sbjct: 267 FMV 269



>gi|68473290|ref|XP_719203.1| hypothetical protein CaO19.12967 [Candida albicans SC5314]
 gi|68473523|ref|XP_719086.1| hypothetical protein CaO19.5521 [Candida albicans SC5314]
 gi|46440887|gb|EAL00188.1| hypothetical protein CaO19.5521 [Candida albicans SC5314]
 gi|46441010|gb|EAL00310.1| hypothetical protein CaO19.12967 [Candida albicans SC5314]
          Length = 269

 Score =  148 bits (374), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 92/123 (74%), Gaps = 2/123 (1%)

Query: 15  AEASVAASRKG--RVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEY 72
           A  SV   +K   R +KA +TLT SAV  L+ L++ PDPKLIR+ V+N+GC+G +Y LEY
Sbjct: 147 AAPSVTPKKKRVLRPRKALITLTSSAVQHLQGLLDQPDPKLIRIGVRNRGCSGLTYNLEY 206

Query: 73  TKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGES 132
             + G+ DE+V+QDGV VL++ K+LF ++GSEMD++ D+LSS+F+F NPN K  CGCGES
Sbjct: 207 VDKPGKFDELVEQDGVKVLIDSKALFSIVGSEMDWLDDKLSSRFIFKNPNSKGTCGCGES 266

Query: 133 FSV 135
           F V
Sbjct: 267 FMV 269



>gi|409050892|gb|EKM60368.1| hypothetical protein PHACADRAFT_246245 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 216

 Score =  148 bits (374), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 86/112 (76%)

Query: 24  KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIV 83
           K R  KAA+ LTP+AV RL+ LV  P  + +R+ V+NKGCAG SY LEY  + G+ DE+V
Sbjct: 103 KIRATKAAIALTPTAVERLKALVNSPTAQYLRIGVRNKGCAGLSYHLEYVDKPGKFDEVV 162

Query: 84  KQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           +QDGV VL++ K+LF +IGSEMD+ +D LS+KF F NPN+K+ CGCGESF+V
Sbjct: 163 EQDGVKVLIDSKALFSIIGSEMDWKEDALSAKFAFKNPNIKDACGCGESFTV 214



>gi|398409374|ref|XP_003856152.1| hypothetical protein MYCGRDRAFT_27852, partial [Zymoseptoria
           tritici IPO323]
 gi|339476037|gb|EGP91128.1| hypothetical protein MYCGRDRAFT_27852 [Zymoseptoria tritici IPO323]
          Length = 216

 Score =  148 bits (374), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 87/110 (79%)

Query: 26  RVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQ 85
           R +KA +TLTP AV +L  L + P+ KLIRV VKN+GC+G +Y LEY ++ G  DE V+Q
Sbjct: 107 RPRKAPITLTPKAVEQLHALFDQPESKLIRVGVKNRGCSGLAYHLEYVEKPGTFDETVEQ 166

Query: 86  DGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           DGV VL++ K+LF +IGSEMD+++D+LS++F+F NPN+ E CGCGESFS+
Sbjct: 167 DGVKVLIDSKALFSIIGSEMDWLEDKLSARFIFRNPNITEQCGCGESFSI 216



>gi|336468052|gb|EGO56215.1| hypothetical protein NEUTE1DRAFT_130247 [Neurospora tetrasperma
           FGSC 2508]
 gi|350289704|gb|EGZ70929.1| hypothetical protein NEUTE2DRAFT_92764 [Neurospora tetrasperma FGSC
           2509]
          Length = 259

 Score =  148 bits (374), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 89/115 (77%)

Query: 21  ASRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHD 80
           ASR    +KAA+ LT +AV  LR +++ P+PKLI+V V+N+GC+G +Y LEY  + G  D
Sbjct: 145 ASRLRAPRKAAINLTSAAVEHLRAMLDQPEPKLIKVGVRNRGCSGLAYHLEYVDKAGAFD 204

Query: 81  EIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           E V+QDGV VL++ K+LF +IGSEMD+V+D+LS +FVF NPN+KE CGCGESF V
Sbjct: 205 ETVEQDGVKVLIDSKALFSIIGSEMDWVEDKLSQRFVFRNPNIKEQCGCGESFMV 259



>gi|336378309|gb|EGO19467.1| hypothetical protein SERLADRAFT_478910 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 209

 Score =  148 bits (374), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 88/112 (78%)

Query: 24  KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIV 83
           K R  KAA+ +T +AV RL+ ++ GP P+LIR+ V+NKGCAG SY L+Y  +  + DE+V
Sbjct: 96  KIRSTKAALMITSNAVQRLQAMLHGPTPQLIRIGVRNKGCAGLSYHLDYVDKPEKFDEVV 155

Query: 84  KQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           +QDGV VL++ K+LF +IGSEMD+ +D LSSKFVF NPN+K+ CGCGESF+V
Sbjct: 156 QQDGVRVLIDSKALFSIIGSEMDWKEDSLSSKFVFKNPNIKDACGCGESFTV 207



>gi|50311733|ref|XP_455894.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49645030|emb|CAG98602.1| KLLA0F18150p [Kluyveromyces lactis]
          Length = 231

 Score =  148 bits (373), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 64/115 (55%), Positives = 91/115 (79%)

Query: 21  ASRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHD 80
           A RK R +KA ++LTP+A++ L+ L++ P+PKLIR+ VKN+GC+G +Y L+Y    G+ D
Sbjct: 117 AKRKLRPRKALISLTPNALSHLKGLLDQPEPKLIRIGVKNRGCSGLTYDLQYITSPGKFD 176

Query: 81  EIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           E+V+QDGV V+++ K+LF ++GSEMD+V D+LSS+FVF NPN K  CGCGESF V
Sbjct: 177 EVVEQDGVKVIIDSKALFSIVGSEMDWVDDKLSSRFVFKNPNSKGTCGCGESFMV 231



>gi|320583425|gb|EFW97638.1| iron sulfur assembly-related protein [Ogataea parapolymorpha DL-1]
          Length = 190

 Score =  148 bits (373), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 65/113 (57%), Positives = 89/113 (78%)

Query: 23  RKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEI 82
           R+ +  K+ +TLTP+A+  L+QL++ PDPKLIR++V+N+GC+G SY LEY     + DE 
Sbjct: 78  RQLKPLKSVITLTPNAILHLKQLMQQPDPKLIRISVRNRGCSGLSYHLEYVSHPEKFDEQ 137

Query: 83  VKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           V+QDGV VL++ K+LF +IGSEMD++ D+LSSKFVF NPN K +CGCGESF V
Sbjct: 138 VEQDGVKVLIDSKALFSIIGSEMDWIDDKLSSKFVFKNPNSKGSCGCGESFMV 190



>gi|261199912|ref|XP_002626357.1| iron-binding protein iscA [Ajellomyces dermatitidis SLH14081]
 gi|239594565|gb|EEQ77146.1| iron-binding protein iscA [Ajellomyces dermatitidis SLH14081]
          Length = 276

 Score =  148 bits (373), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 85/110 (77%)

Query: 26  RVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQ 85
           + +K AM +TP A+  LR+L + PDPKL+RV VKN+GC+G SY LEY  +    DE+V+Q
Sbjct: 167 KARKIAMHITPEAIVHLRRLTDQPDPKLVRVGVKNRGCSGLSYHLEYVDKAAPFDEVVEQ 226

Query: 86  DGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           DGV +L++ K+LF +IGSEMD+ +D L+S+FVF NPN+K+ CGCGESF V
Sbjct: 227 DGVRILIDSKALFSIIGSEMDWQEDSLASRFVFRNPNIKDECGCGESFMV 276



>gi|440902050|gb|ELR52895.1| Iron-sulfur cluster assembly 1-like protein, mitochondrial, partial
           [Bos grunniens mutus]
          Length = 164

 Score =  148 bits (373), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 69/131 (52%), Positives = 92/131 (70%)

Query: 5   TAIRSMALKMAEASVAASRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCA 64
           TA  S +L  A     + RK ++ +A +TLTPSAVN+++QL   P    ++V V+ +GC 
Sbjct: 34  TARMSASLVRATVRAVSKRKLQLTRATLTLTPSAVNKIKQLTSAPRKVGVKVGVRTRGCN 93

Query: 65  GQSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVK 124
           G SY LEYTK KG  DE V QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNPN+K
Sbjct: 94  GLSYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIK 153

Query: 125 ENCGCGESFSV 135
             CGCGESF++
Sbjct: 154 GTCGCGESFNI 164



>gi|327350430|gb|EGE79287.1| iron-binding protein iscA [Ajellomyces dermatitidis ATCC 18188]
          Length = 276

 Score =  148 bits (373), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 85/110 (77%)

Query: 26  RVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQ 85
           + +K AM +TP A+  LR+L + PDPKL+RV VKN+GC+G SY LEY  +    DE+V+Q
Sbjct: 167 KARKIAMHITPEAIVHLRRLTDQPDPKLVRVGVKNRGCSGLSYHLEYVDKAAPFDEVVEQ 226

Query: 86  DGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           DGV +L++ K+LF +IGSEMD+ +D L+S+FVF NPN+K+ CGCGESF V
Sbjct: 227 DGVRILIDSKALFSIIGSEMDWQEDSLASRFVFRNPNIKDECGCGESFMV 276



>gi|401840344|gb|EJT43201.1| ISA1-like protein [Saccharomyces kudriavzevii IFO 1802]
          Length = 249

 Score =  147 bits (372), Expect = 6e-34,   Method: Compositional matrix adjust.
 Identities = 68/132 (51%), Positives = 91/132 (68%)

Query: 4   ATAIRSMALKMAEASVAASRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGC 63
           A A+        EA     RK R  KA +TL+P A+  LR L+  P PKLIRV+ +N+GC
Sbjct: 118 AAAVAKSDCSCTEAPKKRKRKLRPTKALITLSPKAIKHLRGLLAQPKPKLIRVSARNRGC 177

Query: 64  AGQSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNV 123
           +G +Y L+Y  E G+ DE+V+QDGV ++++ K+LF +IGSEMD+V D+L+SKFVF NPN 
Sbjct: 178 SGLTYDLQYITEPGKFDEVVEQDGVKIVIDSKALFSIIGSEMDWVDDKLASKFVFKNPNS 237

Query: 124 KENCGCGESFSV 135
           K  CGCGESF V
Sbjct: 238 KGTCGCGESFMV 249



>gi|354543033|emb|CCE39751.1| hypothetical protein CPAR2_601710 [Candida parapsilosis]
          Length = 292

 Score =  147 bits (372), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 62/113 (54%), Positives = 89/113 (78%)

Query: 23  RKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEI 82
           R  R +KA +TL+P+AV+ L+ L++ P+PKLIR+ V+N+GC+G +Y LEY  + G+ DE 
Sbjct: 180 RTLRPRKALITLSPNAVSHLQALLDQPEPKLIRIGVRNRGCSGLTYNLEYVDKPGKFDET 239

Query: 83  VKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           V+QDGV VL++ K+LF ++GSEMD++ D+LSS+F+F NPN K  CGCGESF V
Sbjct: 240 VEQDGVKVLIDSKALFSIVGSEMDWLDDKLSSRFIFKNPNSKGTCGCGESFMV 292



>gi|448533387|ref|XP_003870625.1| Isa1 protein [Candida orthopsilosis Co 90-125]
 gi|380354980|emb|CCG24496.1| Isa1 protein [Candida orthopsilosis]
          Length = 291

 Score =  147 bits (371), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 62/113 (54%), Positives = 89/113 (78%)

Query: 23  RKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEI 82
           R  R +KA +TL+P+AV+ L+ L++ P+PKLIR+ V+N+GC+G +Y LEY  + G+ DE 
Sbjct: 179 RTLRPRKALITLSPNAVSHLQALLDQPEPKLIRIGVRNRGCSGLTYNLEYVDKPGKFDET 238

Query: 83  VKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           V+QDGV VL++ K+LF ++GSEMD++ D+LSS+F+F NPN K  CGCGESF V
Sbjct: 239 VEQDGVKVLIDSKALFSIVGSEMDWLDDKLSSRFIFKNPNSKGTCGCGESFMV 291



>gi|239607955|gb|EEQ84942.1| iron-binding protein iscA [Ajellomyces dermatitidis ER-3]
          Length = 276

 Score =  147 bits (371), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 85/110 (77%)

Query: 26  RVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQ 85
           + +K AM +TP A+  LR+L + PDPKL+RV VKN+GC+G SY LEY  +    DE+V+Q
Sbjct: 167 KARKIAMHITPEAIVHLRRLTDQPDPKLVRVGVKNRGCSGLSYHLEYVDKAAPFDEVVEQ 226

Query: 86  DGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           DGV +L++ K+LF +IGSEMD+ +D L+S+FVF NPN+K+ CGCGESF V
Sbjct: 227 DGVRILIDSKALFSIIGSEMDWQEDSLASRFVFRNPNIKDECGCGESFMV 276



>gi|146420893|ref|XP_001486399.1| hypothetical protein PGUG_02070 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 264

 Score =  147 bits (371), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 62/113 (54%), Positives = 89/113 (78%)

Query: 23  RKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEI 82
           R  R +KA +TL+PSA+  L+ L++ P+PKLIR+ VKN+GC+G +Y LEY  E G+ DE+
Sbjct: 152 RTLRPRKALITLSPSAIEHLKGLLDQPEPKLIRIGVKNRGCSGLTYHLEYVSEPGKFDEV 211

Query: 83  VKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           V+QDGV V+++ K+LF ++GSEM+++ D+LSS+F+F NPN K  CGCGESF V
Sbjct: 212 VEQDGVKVVIDSKALFSIVGSEMEWLDDKLSSRFIFKNPNSKGTCGCGESFMV 264



>gi|190345989|gb|EDK37972.2| hypothetical protein PGUG_02070 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 264

 Score =  147 bits (371), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 62/113 (54%), Positives = 89/113 (78%)

Query: 23  RKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEI 82
           R  R +KA +TL+PSA+  L+ L++ P+PKLIR+ VKN+GC+G +Y LEY  E G+ DE+
Sbjct: 152 RTLRPRKALITLSPSAIEHLKGLLDQPEPKLIRIGVKNRGCSGLTYHLEYVSEPGKFDEV 211

Query: 83  VKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           V+QDGV V+++ K+LF ++GSEM+++ D+LSS+F+F NPN K  CGCGESF V
Sbjct: 212 VEQDGVKVVIDSKALFSIVGSEMEWLDDKLSSRFIFKNPNSKGTCGCGESFMV 264



>gi|367015378|ref|XP_003682188.1| hypothetical protein TDEL_0F01660 [Torulaspora delbrueckii]
 gi|359749850|emb|CCE92977.1| hypothetical protein TDEL_0F01660 [Torulaspora delbrueckii]
          Length = 246

 Score =  147 bits (371), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 60/110 (54%), Positives = 88/110 (80%)

Query: 26  RVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQ 85
           R +KA +TL+P A++ L+ L++ P+PKLIR+ VKN+GC+G +Y L+Y  + G+ DE+V+Q
Sbjct: 137 RPRKALITLSPKALSHLKSLLDQPEPKLIRIGVKNRGCSGLTYDLQYITQPGKFDEVVEQ 196

Query: 86  DGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           DGV ++++ K+LF ++GSEMD++ DRLSS+FVF NPN K  CGCGESF V
Sbjct: 197 DGVRIIIDSKALFSVVGSEMDWIDDRLSSRFVFKNPNSKGTCGCGESFMV 246



>gi|254578016|ref|XP_002494994.1| ZYRO0B00968p [Zygosaccharomyces rouxii]
 gi|238937884|emb|CAR26061.1| ZYRO0B00968p [Zygosaccharomyces rouxii]
          Length = 255

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 86/108 (79%)

Query: 28  QKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQDG 87
           +KA ++L+P A+  LR L++ P+PKLIR+ V N+GC+G SY L+Y  E G++DEIV+QDG
Sbjct: 148 RKALISLSPRAMTHLRSLLDQPEPKLIRIGVTNRGCSGLSYDLQYITEPGKYDEIVEQDG 207

Query: 88  VTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           + V+V+ K+LF ++GSEMD++ DRLSS+FVF NPN K  CGCGESF V
Sbjct: 208 IKVIVDSKALFSVVGSEMDWIDDRLSSRFVFRNPNSKGTCGCGESFMV 255



>gi|365759568|gb|EHN01350.1| Isa1p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 249

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 68/132 (51%), Positives = 91/132 (68%)

Query: 4   ATAIRSMALKMAEASVAASRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGC 63
           A A+        EA     RK R  KA +TL+P A+  LR L+  P PKLIRV+ +N+GC
Sbjct: 118 AAAVAESDCSCTEAPKKRKRKLRPTKALITLSPKAIKHLRGLLAQPKPKLIRVSARNRGC 177

Query: 64  AGQSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNV 123
           +G +Y L+Y  E G+ DE+V+QDGV ++++ K+LF +IGSEMD+V D+L+SKFVF NPN 
Sbjct: 178 SGLTYDLQYITEPGKFDELVEQDGVKIVIDSKALFSVIGSEMDWVDDKLASKFVFKNPNS 237

Query: 124 KENCGCGESFSV 135
           K  CGCGESF V
Sbjct: 238 KGTCGCGESFMV 249



>gi|513033868|gb|AGO13834.1| AaceriAGL033Cp [Saccharomycetaceae sp. 'Ashbya aceri']
          Length = 274

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 61/113 (53%), Positives = 90/113 (79%)

Query: 23  RKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEI 82
           RK R +KA + L+P+A+  LR L++ P+P+LIR+ V+N+GC+G +Y L+Y KE G+ DE+
Sbjct: 162 RKLRPKKALIKLSPNALVHLRALLDQPEPQLIRIGVRNRGCSGLTYDLQYIKEPGEFDEV 221

Query: 83  VKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           ++QDGV V+++ K+LF ++GSEMD++ D+LSS+FVF NPN K  CGCGESF V
Sbjct: 222 IEQDGVKVVIDSKALFSIVGSEMDWIDDKLSSRFVFKNPNSKGTCGCGESFMV 274



>gi|392597020|gb|EIW86342.1| hypothetical protein CONPUDRAFT_45886, partial [Coniophora puteana
           RWD-64-598 SS2]
          Length = 103

 Score =  147 bits (370), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 82/101 (81%)

Query: 35  TPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQDGVTVLVEH 94
           TP+AV RLR L+ GP P++IR+ V+NKGCAG SY LEY  + G+ DE+V+QDGV VL++ 
Sbjct: 2   TPTAVERLRNLLNGPTPQIIRIGVRNKGCAGLSYHLEYVDKPGKFDEVVEQDGVRVLIDS 61

Query: 95  KSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           K+LF +IGSEMD+  D LSSKFVF NPN+K+ CGCGESF+V
Sbjct: 62  KALFSIIGSEMDWEDDALSSKFVFANPNIKDACGCGESFNV 102



>gi|470319974|gb|EMR11570.1| hypothetical protein PNEG_00014 [Pneumocystis murina B123]
          Length = 184

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 59/108 (54%), Positives = 86/108 (79%)

Query: 28  QKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQDG 87
           +KAAMTLTP AV RL++L+  P+PK+IR+  K KGCAG SY+LEY  E G+ DE + QDG
Sbjct: 76  RKAAMTLTPRAVERLKELLNQPEPKMIRIGTKQKGCAGLSYLLEYVDEPGKFDETIIQDG 135

Query: 88  VTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           V +L+++++LF +IGS+MD+++D+L+++FVF+NPN    CGC  SFS+
Sbjct: 136 VAILIDNRALFTIIGSKMDWIQDKLAARFVFDNPNATSTCGCQGSFSI 183



>gi|448117310|ref|XP_004203224.1| Piso0_000825 [Millerozyma farinosa CBS 7064]
 gi|359384092|emb|CCE78796.1| Piso0_000825 [Millerozyma farinosa CBS 7064]
          Length = 276

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 60/110 (54%), Positives = 88/110 (80%)

Query: 26  RVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQ 85
           R +KA ++L+P A++ LRQL++ P+P+LIR+ V+N+GC+G +Y LEY  + G+ DE V+Q
Sbjct: 167 RPRKALISLSPKAIDHLRQLLDQPEPQLIRIGVQNRGCSGLTYHLEYVTQPGKFDETVEQ 226

Query: 86  DGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           DGV VL++ K+LF ++GSEMD++ D+LSS+F+F NPN K  CGCGESF V
Sbjct: 227 DGVKVLIDSKALFSIVGSEMDWLDDKLSSRFIFKNPNSKGTCGCGESFMV 276



>gi|21740005|emb|CAD39021.1| hypothetical protein [Homo sapiens]
          Length = 149

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 71/134 (52%), Positives = 96/134 (71%), Gaps = 1/134 (0%)

Query: 3   AATAIRSMALKMAEASVAASRKGRVQKAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNK 61
           A TA  S +L  A     + RK +  +AA+TLTPSAVN+++QL+ + P+   ++V V+ +
Sbjct: 16  AGTAKMSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTR 75

Query: 62  GCAGQSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNP 121
           GC G SY LEYTK KG  DE V QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNP
Sbjct: 76  GCNGLSYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNP 135

Query: 122 NVKENCGCGESFSV 135
           N+K  CGCGESF++
Sbjct: 136 NIKGTCGCGESFNI 149



>gi|459372827|gb|EMG50195.1| Iron sulfur assembly protein, putative [Candida maltosa Xu316]
          Length = 251

 Score =  146 bits (368), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 92/123 (74%)

Query: 13  KMAEASVAASRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEY 72
           K+A  +    R  R +KA +TLT SAV  L+ L++ P+PKLIR+ V+N+GC+G +Y LEY
Sbjct: 129 KVATTAPKKKRVLRPRKALITLTSSAVEHLQGLLDQPEPKLIRIGVRNRGCSGLTYNLEY 188

Query: 73  TKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGES 132
             + G+ DE+++QDGV VL++ K+LF ++GSEMD++ D+LSS+F+F NPN K  CGCGES
Sbjct: 189 VDKPGKFDELIEQDGVKVLIDSKALFSIVGSEMDWLDDKLSSRFIFKNPNSKGTCGCGES 248

Query: 133 FSV 135
           F V
Sbjct: 249 FMV 251



>gi|426362148|ref|XP_004048242.1| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial
           [Gorilla gorilla gorilla]
          Length = 176

 Score =  145 bits (367), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 71/134 (52%), Positives = 96/134 (71%), Gaps = 1/134 (0%)

Query: 3   AATAIRSMALKMAEASVAASRKGRVQKAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNK 61
           A TA  S +L  A     + RK +  +AA+TLTPSAVN+++QL+ + P+   ++V V+ +
Sbjct: 43  AGTAKMSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTR 102

Query: 62  GCAGQSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNP 121
           GC G SY LEYTK KG  DE V QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNP
Sbjct: 103 GCNGLSYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNP 162

Query: 122 NVKENCGCGESFSV 135
           N+K  CGCGESF++
Sbjct: 163 NIKGTCGCGESFNI 176



>gi|335296332|ref|XP_003357750.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Sus scrofa]
          Length = 155

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 71/134 (52%), Positives = 96/134 (71%), Gaps = 1/134 (0%)

Query: 3   AATAIRSMALKMAEASVAASRKGRVQKAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNK 61
           A TA  S +L  A     + RK +  +AA+TLTPSAVN+++QL+ + P+   ++V V+ +
Sbjct: 22  AGTAKMSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTR 81

Query: 62  GCAGQSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNP 121
           GC G SY LEYTK KG  DE V QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNP
Sbjct: 82  GCNGLSYTLEYTKTKGDSDEEVVQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNP 141

Query: 122 NVKENCGCGESFSV 135
           N+K  CGCGESF++
Sbjct: 142 NIKGTCGCGESFNI 155



>gi|397470237|ref|XP_003806735.1| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial
           [Pan paniscus]
 gi|119583117|gb|EAW62713.1| HESB like domain containing 2, isoform CRA_b [Homo sapiens]
 gi|194382184|dbj|BAG58847.1| unnamed protein product [Homo sapiens]
          Length = 176

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 71/134 (52%), Positives = 96/134 (71%), Gaps = 1/134 (0%)

Query: 3   AATAIRSMALKMAEASVAASRKGRVQKAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNK 61
           A TA  S +L  A     + RK +  +AA+TLTPSAVN+++QL+ + P+   ++V V+ +
Sbjct: 43  AGTAKMSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTR 102

Query: 62  GCAGQSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNP 121
           GC G SY LEYTK KG  DE V QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNP
Sbjct: 103 GCNGLSYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNP 162

Query: 122 NVKENCGCGESFSV 135
           N+K  CGCGESF++
Sbjct: 163 NIKGTCGCGESFNI 176



>gi|332260003|ref|XP_003279075.1| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial
           [Nomascus leucogenys]
          Length = 176

 Score =  145 bits (367), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 71/134 (52%), Positives = 96/134 (71%), Gaps = 1/134 (0%)

Query: 3   AATAIRSMALKMAEASVAASRKGRVQKAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNK 61
           A TA  S +L  A     + RK +  +AA+TLTPSAVN+++QL+ + P+   ++V V+ +
Sbjct: 43  AGTAKMSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTR 102

Query: 62  GCAGQSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNP 121
           GC G SY LEYTK KG  DE V QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNP
Sbjct: 103 GCNGLSYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNP 162

Query: 122 NVKENCGCGESFSV 135
           N+K  CGCGESF++
Sbjct: 163 NIKGTCGCGESFNI 176



>gi|224088740|ref|XP_002194930.1| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial
           [Taeniopygia guttata]
          Length = 129

 Score =  145 bits (366), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 95/129 (73%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRVQ--KAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQ 66
           MA  +  A+V A  K R+Q  +AA+TLTPSAV ++++L+ + PD   ++V V+ +GC G 
Sbjct: 1   MASSVVRATVRAVSKRRIQATRAALTLTPSAVQKIKELLKDKPDHVGVKVGVRTRGCNGL 60

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           SY LEYTK KG  DE V QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNPN+K  
Sbjct: 61  SYTLEYTKSKGDSDEEVVQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGT 120

Query: 127 CGCGESFSV 135
           CGCGESF++
Sbjct: 121 CGCGESFNI 129



>gi|507933744|ref|XP_004678106.1| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial
           [Condylura cristata]
          Length = 170

 Score =  145 bits (366), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 96/134 (71%), Gaps = 1/134 (0%)

Query: 3   AATAIRSMALKMAEASVAASRKGRVQKAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNK 61
           + TA  S +L  A     + RK +  +AA+TLTPSAVN+++QL+ + P+   ++V V+ +
Sbjct: 37  SGTARMSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPENVGVKVGVRTR 96

Query: 62  GCAGQSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNP 121
           GC G SY LEYTK KG  DE V QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNP
Sbjct: 97  GCNGLSYTLEYTKTKGDSDEEVVQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNP 156

Query: 122 NVKENCGCGESFSV 135
           N+K  CGCGESF++
Sbjct: 157 NIKGTCGCGESFNI 170



>gi|164660828|ref|XP_001731537.1| hypothetical protein MGL_1720 [Malassezia globosa CBS 7966]
 gi|159105437|gb|EDP44323.1| hypothetical protein MGL_1720 [Malassezia globosa CBS 7966]
          Length = 182

 Score =  145 bits (366), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 88/111 (79%), Gaps = 3/111 (2%)

Query: 28  QKAAMTLTPSAVNRLRQLVEGPD-PKLIRVAVKNKGCAGQSYVLEYTK--EKGQHDEIVK 84
           +KAA+ LTP+AV  +R+L+   D PKL+RV V+NKGCAG SY LEY    E+G+ DE V 
Sbjct: 72  KKAAIKLTPTAVEHIRKLLSASDGPKLVRVGVRNKGCAGMSYHLEYVTPGEEGRFDERVM 131

Query: 85  QDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           QDGV VL++ ++LF +IGSEMD+ +DR+S+KFVFNNPN+K+ CGCGESF V
Sbjct: 132 QDGVEVLIDSRALFSIIGSEMDWKEDRMSAKFVFNNPNIKDACGCGESFMV 182



>gi|45201063|ref|NP_986633.1| AGL033Cp [Ashbya gossypii ATCC 10895]
 gi|44985846|gb|AAS54457.1| AGL033Cp [Ashbya gossypii ATCC 10895]
 gi|374109883|gb|AEY98788.1| FAGL033Cp [Ashbya gossypii FDAG1]
          Length = 265

 Score =  145 bits (366), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 89/113 (78%)

Query: 23  RKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEI 82
           RK R +KA + L+P A+  L+ L++ P+P+LIR+ V+N+GC+G +Y L+Y KE G+ DE+
Sbjct: 153 RKLRPKKALIKLSPDALVHLKALLDQPEPQLIRIGVRNRGCSGLTYDLQYIKEPGEFDEV 212

Query: 83  VKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           ++QDGV V+++ K+LF ++GSEMD++ D+LSS+FVF NPN K  CGCGESF V
Sbjct: 213 IEQDGVKVVIDSKALFSIVGSEMDWIDDKLSSRFVFKNPNSKGTCGCGESFMV 265



>gi|256271954|gb|EEU06973.1| Isa1p [Saccharomyces cerevisiae JAY291]
          Length = 250

 Score =  145 bits (365), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 63/113 (55%), Positives = 87/113 (76%)

Query: 23  RKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEI 82
           RK   +KA +TL+P A+  LR L+  P+PKLIRV+ +N+GC+G +Y L+Y  E G+ DE+
Sbjct: 138 RKLMPRKALITLSPKAIKHLRALLAQPEPKLIRVSARNRGCSGLTYDLQYITEPGKFDEV 197

Query: 83  VKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           V+QDGV ++++ K+LF +IGSEMD+V D+L+SKFVF NPN K  CGCGESF V
Sbjct: 198 VEQDGVKIVIDSKALFSIIGSEMDWVDDKLASKFVFKNPNSKGTCGCGESFMV 250



>gi|355567540|gb|EHH23881.1| hypothetical protein EGK_07441 [Macaca mulatta]
          Length = 129

 Score =  145 bits (365), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 97/129 (75%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRVQ--KAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQ 66
           M+  +  A+V A  K ++Q  +AA+TLTPSAVN+++QL+ + P+   ++V V+ +GC G 
Sbjct: 1   MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGL 60

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           SY LEYTK+KG  DE V QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNPN+K  
Sbjct: 61  SYTLEYTKKKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGT 120

Query: 127 CGCGESFSV 135
           CGCGESF++
Sbjct: 121 CGCGESFNI 129



>gi|432109013|gb|ELK33483.1| Iron-sulfur cluster assembly 1 like protein, mitochondrial [Myotis
           davidii]
          Length = 129

 Score =  144 bits (364), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 96/129 (74%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRVQ--KAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQ 66
           M+  +  A+V A  K ++Q  +AA+TLTPSAVN+++QL+ + P+   ++V V+ +GC G 
Sbjct: 1   MSASLVRATVRAVSKRKLQATRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGL 60

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           SY LEYTK KG  DE V QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNPN+K  
Sbjct: 61  SYTLEYTKTKGDSDEEVVQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGT 120

Query: 127 CGCGESFSV 135
           CGCGESF++
Sbjct: 121 CGCGESFNI 129



>gi|351696759|gb|EHA99677.1| Iron-sulfur cluster assembly 1-like protein, mitochondrial, partial
           [Heterocephalus glaber]
          Length = 155

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 71/134 (52%), Positives = 96/134 (71%), Gaps = 1/134 (0%)

Query: 3   AATAIRSMALKMAEASVAASRKGRVQKAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNK 61
           A TA  S +L  A     + RK +  +AA+TLTPSAVN+++QL+ + P+   ++V V+ +
Sbjct: 22  ARTAKMSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGLKVGVRTR 81

Query: 62  GCAGQSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNP 121
           GC G SY LEYTK KG  DE V QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNP
Sbjct: 82  GCNGLSYTLEYTKTKGDSDEEVVQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNP 141

Query: 122 NVKENCGCGESFSV 135
           N+K  CGCGESF++
Sbjct: 142 NIKGTCGCGESFNI 155



>gi|156840885|ref|XP_001643820.1| hypothetical protein Kpol_1044p22 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156114446|gb|EDO15962.1| hypothetical protein Kpol_1044p22 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 253

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 86/110 (78%)

Query: 26  RVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQ 85
           R +KA +TL+P AV  LR L++ P+PKLIR+  +N+GC+G +Y L+Y  E  ++DEIV+Q
Sbjct: 144 RPRKALITLSPKAVTHLRALLDQPEPKLIRIGTRNRGCSGLTYDLQYIAEPEKYDEIVEQ 203

Query: 86  DGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           DGV V+++ K+LF ++GSEMD+V D+L+SKFVF NPN K  CGCGESF V
Sbjct: 204 DGVKVVIDSKALFSVVGSEMDWVDDKLTSKFVFKNPNSKGTCGCGESFMV 253



>gi|507958989|ref|XP_004686487.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Condylura cristata]
          Length = 129

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 96/129 (74%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRVQ--KAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQ 66
           M+  +  A+V A  K ++Q  +AA+TLTPSAVN+++QL+ + P+   ++V V+ +GC G 
Sbjct: 1   MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPENVGVKVGVRTRGCNGL 60

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           SY LEYTK KG  DE V QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNPN+K  
Sbjct: 61  SYTLEYTKTKGDSDEEVVQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGT 120

Query: 127 CGCGESFSV 135
           CGCGESF++
Sbjct: 121 CGCGESFNI 129



>gi|507577748|ref|XP_004672398.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Jaculus jaculus]
          Length = 129

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 96/129 (74%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRVQ--KAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQ 66
           M+  +  A+V A  K ++Q  +AA+TLTPSAVN+++QL+ + P+   ++V V+ +GC G 
Sbjct: 1   MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGL 60

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           SY LEYTK KG  DE V QDGV V +E K+   L+G+EMDY++D+LSS+FVFNNPN+K  
Sbjct: 61  SYTLEYTKTKGDSDEEVVQDGVRVFIEKKAQLTLLGTEMDYIEDKLSSEFVFNNPNIKGT 120

Query: 127 CGCGESFSV 135
           CGCGESF+V
Sbjct: 121 CGCGESFNV 129



>gi|504137429|ref|XP_004581174.1| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial
           [Ochotona princeps]
 gi|431902880|gb|ELK09095.1| Iron-sulfur cluster assembly 1 like protein, mitochondrial
           [Pteropus alecto]
 gi|444732633|gb|ELW72917.1| Iron-sulfur cluster assembly 1 like protein, mitochondrial [Tupaia
           chinensis]
          Length = 129

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 96/129 (74%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRVQ--KAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQ 66
           M+  +  A+V A  K ++Q  +AA+TLTPSAVN+++QL+ + P+   ++V V+ +GC G 
Sbjct: 1   MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGL 60

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           SY LEYTK KG  DE V QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNPN+K  
Sbjct: 61  SYTLEYTKTKGDSDEEVVQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGT 120

Query: 127 CGCGESFSV 135
           CGCGESF++
Sbjct: 121 CGCGESFNI 129



>gi|156366241|ref|XP_001627048.1| predicted protein [Nematostella vectensis]
 gi|156213945|gb|EDO34948.1| predicted protein [Nematostella vectensis]
          Length = 131

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 64/119 (53%), Positives = 91/119 (76%), Gaps = 1/119 (0%)

Query: 18  SVAASRKGRVQKAAMTLTPSAVNRLRQLVEG-PDPKLIRVAVKNKGCAGQSYVLEYTKEK 76
           +V+  RK   +KAA+TLTPSAVN+++ L+   PD   ++V V+ +GC G SY LE+  EK
Sbjct: 13  AVSRQRKFAARKAALTLTPSAVNKVKTLLSSQPDAIALKVGVRQRGCNGLSYTLEFATEK 72

Query: 77  GQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           G+ DE+V QDGV VL++ K+   L+G+EMD+V+D+LSS+FVFNNPN+K  CGCGESF++
Sbjct: 73  GKFDELVTQDGVKVLIDSKAQLSLLGTEMDFVEDKLSSEFVFNNPNIKGTCGCGESFNI 131



>gi|348578683|ref|XP_003475112.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Cavia porcellus]
          Length = 129

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 96/129 (74%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRVQ--KAAMTLTPSAVNRLRQLVEG-PDPKLIRVAVKNKGCAGQ 66
           M+  +  A+V A  K ++Q  +AA+TLTPSAVN+++QL++  P+   ++V V+ +GC G 
Sbjct: 1   MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLQDKPEHVGLKVGVRTRGCNGL 60

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           SY LEYTK KG  DE V QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNPN+K  
Sbjct: 61  SYTLEYTKTKGDSDEEVVQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGT 120

Query: 127 CGCGESFSV 135
           CGCGESF++
Sbjct: 121 CGCGESFNI 129



>gi|512199692|gb|EPE28525.1| HesB-like protein [Glarea lozoyensis ATCC 20868]
          Length = 244

 Score =  144 bits (364), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 92/125 (73%)

Query: 11  ALKMAEASVAASRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVL 70
           A K   A+     K +  KAAM LT +AV++LR + + PD K+I+V VKN+GC+G +Y L
Sbjct: 120 AQKSQPATKPRRYKFKPTKAAMKLTSTAVDQLRAMQDEPDAKIIKVGVKNRGCSGLAYHL 179

Query: 71  EYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCG 130
           EY ++ G  DE+V+QDGV VL++ K+LF ++GSEMD+V+D+L+ +F F NPN+KE CGCG
Sbjct: 180 EYVEKAGPFDEVVEQDGVKVLIDSKALFSIVGSEMDWVEDKLNQRFTFTNPNIKEQCGCG 239

Query: 131 ESFSV 135
           ESF V
Sbjct: 240 ESFMV 244



>gi|149580480|ref|XP_001511499.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Ornithorhynchus anatinus]
          Length = 129

 Score =  144 bits (364), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 96/129 (74%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRVQ--KAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQ 66
           M+  +  A+V A  K ++Q  +AA+TLTPSAVN+++QL+ + P+   ++V V+ +GC G 
Sbjct: 1   MSASLVRATVRAVSKRKLQASRAALTLTPSAVNKIKQLLKDKPENVGVKVGVRTRGCNGL 60

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           SY LEYTK KG  DE V QDG+ V +E K+   L+G+EMDYV+D+LSS+FVFNNPN+K  
Sbjct: 61  SYTLEYTKTKGDSDEEVVQDGIRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGT 120

Query: 127 CGCGESFSV 135
           CGCGESF++
Sbjct: 121 CGCGESFNI 129



>gi|52426768|ref|NP_112202.2| iron-sulfur cluster assembly 1 homolog, mitochondrial precursor
           [Homo sapiens]
 gi|77735891|ref|NP_001029642.1| iron-sulfur cluster assembly 1 homolog, mitochondrial precursor
           [Bos taurus]
 gi|336176094|ref|NP_001229541.1| iron-sulfur cluster assembly 1 homolog [Pan troglodytes]
 gi|402897785|ref|XP_003911925.1| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial
           [Papio anubis]
 gi|74761270|sp|Q9BUE6.1|ISCA1_HUMAN RecName: Full=Iron-sulfur cluster assembly 1 homolog,
           mitochondrial; AltName: Full=HESB-like domain-containing
           protein 2; AltName: Full=Iron-sulfur assembly protein
           IscA; Short=hIscA; Flags: Precursor
 gi|75076012|sp|Q4R5F0.1|ISCA1_MACFA RecName: Full=Iron-sulfur cluster assembly 1 homolog,
           mitochondrial; AltName: Full=HESB-like domain-containing
           protein 2; AltName: Full=Iron-sulfur assembly protein
           IscA; Flags: Precursor
 gi|122140219|sp|Q3SZG8.1|ISCA1_BOVIN RecName: Full=Iron-sulfur cluster assembly 1 homolog,
           mitochondrial; AltName: Full=HESB-like domain-containing
           protein 2; AltName: Full=Iron-sulfur assembly protein
           IscA; Flags: Precursor
 gi|12803679|gb|AAH02675.1| Iron-sulfur cluster assembly 1 homolog (S. cerevisiae) [Homo
           sapiens]
 gi|18025262|gb|AAG40950.1| HesB-like protein [Homo sapiens]
 gi|47940458|gb|AAH71621.1| Iron-sulfur cluster assembly 1 homolog (S. cerevisiae) [Homo
           sapiens]
 gi|67970665|dbj|BAE01675.1| unnamed protein product [Macaca fascicularis]
 gi|74354113|gb|AAI02864.1| Iron-sulfur cluster assembly 1 homolog (S. cerevisiae) [Bos taurus]
 gi|117646260|emb|CAL38597.1| hypothetical protein [synthetic construct]
 gi|193786263|dbj|BAG51546.1| unnamed protein product [Homo sapiens]
 gi|261860792|dbj|BAI46918.1| iron-sulfur cluster assembly 1 homolog [synthetic construct]
 gi|296484504|tpg|DAA26619.1| TPA: iron-sulfur cluster assembly 1 homolog, mitochondrial
           precursor [Bos taurus]
          Length = 129

 Score =  144 bits (364), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 96/129 (74%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRVQ--KAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQ 66
           M+  +  A+V A  K ++Q  +AA+TLTPSAVN+++QL+ + P+   ++V V+ +GC G 
Sbjct: 1   MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGL 60

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           SY LEYTK KG  DE V QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNPN+K  
Sbjct: 61  SYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGT 120

Query: 127 CGCGESFSV 135
           CGCGESF++
Sbjct: 121 CGCGESFNI 129



>gi|12584843|gb|AAG59854.1|AF284752_1 GK004 [Homo sapiens]
          Length = 130

 Score =  144 bits (363), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 96/129 (74%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRVQ--KAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQ 66
           M+  +  A+V A  K ++Q  +AA+TLTPSAVN+++QL+ + P+   ++V V+ +GC G 
Sbjct: 2   MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGL 61

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           SY LEYTK KG  DE V QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNPN+K  
Sbjct: 62  SYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGT 121

Query: 127 CGCGESFSV 135
           CGCGESF++
Sbjct: 122 CGCGESFNI 130



>gi|345785981|ref|XP_849435.2| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial
           isoform 2 [Canis lupus familiaris]
 gi|410978239|ref|XP_003995503.1| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial
           [Felis catus]
 gi|472383348|ref|XP_004411053.1| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial
           [Odobenus rosmarus divergens]
 gi|478533442|ref|XP_004440863.1| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial
           [Ceratotherium simum simum]
 gi|507681008|ref|XP_004639442.1| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial
           [Octodon degus]
 gi|511909502|ref|XP_004774173.1| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial
           isoform X1 [Mustela putorius furo]
 gi|511998098|ref|XP_004816617.1| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial
           isoform X1 [Mustela putorius furo]
 gi|512820613|ref|XP_004879403.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Heterocephalus glaber]
 gi|513002034|ref|XP_004862524.1| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial
           [Heterocephalus glaber]
          Length = 129

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 96/129 (74%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRVQ--KAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQ 66
           M+  +  A+V A  K ++Q  +AA+TLTPSAVN+++QL+ + P+   ++V V+ +GC G 
Sbjct: 1   MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGLKVGVRTRGCNGL 60

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           SY LEYTK KG  DE V QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNPN+K  
Sbjct: 61  SYTLEYTKTKGDSDEEVVQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGT 120

Query: 127 CGCGESFSV 135
           CGCGESF++
Sbjct: 121 CGCGESFNI 129



>gi|453088204|gb|EMF16244.1| hypothetical protein SEPMUDRAFT_121822 [Mycosphaerella populorum
           SO2202]
          Length = 244

 Score =  144 bits (363), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 87/112 (77%)

Query: 24  KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIV 83
           K R +KA + L+  AV +L++L E P+ KLIR+ VKN+GC+G +Y LEY  + G  DE V
Sbjct: 132 KLRPRKAPIKLSAKAVEQLKELFEQPESKLIRIGVKNRGCSGLAYHLEYVDKPGAFDETV 191

Query: 84  KQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           +QDGV VL++ K+LF +IGSEMD+++D+LS++F+F NPN+ E CGCGESFSV
Sbjct: 192 EQDGVKVLIDSKALFSIIGSEMDWLEDKLSARFIFKNPNITEQCGCGESFSV 243



>gi|465796536|emb|CCV00728.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 172

 Score =  144 bits (362), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 88/111 (79%), Gaps = 3/111 (2%)

Query: 28  QKAAMTLTPSAVNRLRQLVEGPD-PKLIRVAVKNKGCAGQSYVLEYTK--EKGQHDEIVK 84
           +KAA+TLTP AV+ +R L+   D PKL+RV V+NKGCAG SY LEY    E+G+ DE V+
Sbjct: 62  KKAALTLTPEAVSHIRALLHASDGPKLLRVGVRNKGCAGMSYHLEYVTPGEEGRFDERVQ 121

Query: 85  QDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           QDGV VL++ ++LF +IGS MD+ +DR+S+KFVFNNPN+K+ CGCGESF V
Sbjct: 122 QDGVEVLIDSRALFSIIGSVMDWQEDRMSAKFVFNNPNIKDACGCGESFMV 172



>gi|505764010|ref|XP_004600163.1| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial
           [Sorex araneus]
          Length = 129

 Score =  144 bits (362), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 96/129 (74%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRVQ--KAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQ 66
           M+  +  A+V A  K ++Q  +AA+TLTPSAVN+++QL+ + P+   ++V V+ +GC G 
Sbjct: 1   MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGLKVGVRTRGCNGL 60

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           SY LEYTK KG  DE V QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNPN+K  
Sbjct: 61  SYTLEYTKTKGDSDEEVFQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGT 120

Query: 127 CGCGESFSV 135
           CGCGESF++
Sbjct: 121 CGCGESFNI 129



>gi|296189815|ref|XP_002742931.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Callithrix jacchus]
          Length = 176

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 96/134 (71%), Gaps = 1/134 (0%)

Query: 3   AATAIRSMALKMAEASVAASRKGRVQKAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNK 61
           A TA  S +L  A     + RK +  +AA+TLTP+AVN+++QL+ + P+   ++V V+ +
Sbjct: 43  AETAKMSASLVRATVRAVSKRKLQPTRAALTLTPAAVNKIKQLLKDKPEHVGVKVGVRTR 102

Query: 62  GCAGQSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNP 121
           GC G SY LEYTK KG  DE V QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNP
Sbjct: 103 GCNGLSYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNP 162

Query: 122 NVKENCGCGESFSV 135
           N+K  CGCGESF++
Sbjct: 163 NIKGTCGCGESFNI 176



>gi|395859980|ref|XP_003802298.1| PREDICTED: uncharacterized protein LOC100947116 [Otolemur
           garnettii]
          Length = 346

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 70/136 (51%), Positives = 96/136 (70%), Gaps = 1/136 (0%)

Query: 1   MTAATAIRSMALKMAEASVAASRKGRVQKAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVK 59
           + A  A  S +L  A     + RK +  +AA+TLTPSAVN+++QL+ + P+   ++V V+
Sbjct: 211 LGAGVAKMSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVR 270

Query: 60  NKGCAGQSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFN 119
            +GC G SY LEYTK KG  DE V QDGV V +E K+   L+G+EMDYV+D+LSS+FVFN
Sbjct: 271 TRGCNGLSYTLEYTKTKGDSDEEVVQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFN 330

Query: 120 NPNVKENCGCGESFSV 135
           NPN+K  CGCGESF++
Sbjct: 331 NPNIKGTCGCGESFNI 346



>gi|366986945|ref|XP_003673239.1| hypothetical protein NCAS_0A02900 [Naumovozyma castellii CBS 4309]
 gi|342299102|emb|CCC66848.1| hypothetical protein NCAS_0A02900 [Naumovozyma castellii CBS 4309]
          Length = 303

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 86/113 (76%)

Query: 23  RKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEI 82
           R  R +KA +TL+P A+  LR L+  P+PK+IRV  +N+GC+G +Y L+Y  E G+ DEI
Sbjct: 191 RTLRPKKAFITLSPKALVHLRALLNQPEPKMIRVGTRNRGCSGTTYDLQYITEPGKFDEI 250

Query: 83  VKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           V+QDGV ++++ K+LF ++GSEMD++ D+L++KFVF NPN K  CGCGESF V
Sbjct: 251 VEQDGVKIVIDSKALFSVVGSEMDWIDDKLAAKFVFKNPNSKGTCGCGESFMV 303



>gi|466074281|ref|XP_004283103.1| PREDICTED: uncharacterized protein LOC101289857 [Orcinus orca]
          Length = 305

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 96/129 (74%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRVQ--KAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQ 66
           M+  +  A+V A  K ++Q  +AA+TLTPSAVN+++QL+ + P+   ++V V+ +GC G 
Sbjct: 177 MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGL 236

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           SY LEYTK KG  DE V QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNPN+K  
Sbjct: 237 SYTLEYTKTKGDSDEEVVQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGT 296

Query: 127 CGCGESFSV 135
           CGCGESF++
Sbjct: 297 CGCGESFNI 305



>gi|148700701|gb|EDL32648.1| mCG50313 [Mus musculus]
          Length = 129

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 95/129 (73%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRVQ--KAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQ 66
           M+  +  A+V A  K ++Q  +AA+TLTPSAVN+++QL+ + P+   ++V V+ +GC G 
Sbjct: 1   MSASLVRATVWAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGLKVGVRTRGCNGL 60

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           SY LEYTK KG  DE V QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNPN+K  
Sbjct: 61  SYSLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGT 120

Query: 127 CGCGESFSV 135
           CGCGESF V
Sbjct: 121 CGCGESFHV 129



>gi|126333881|ref|XP_001362457.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Monodelphis domestica]
          Length = 129

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 95/129 (73%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRVQ--KAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQ 66
           M+  +  A+V A  K ++Q  +AA+TLTPSAVN+++ L+ + P+   +RV V+ +GC G 
Sbjct: 1   MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKHLLKDKPENVGLRVGVRTRGCNGL 60

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           SY LEYTK KG  DE V QDG+ V +E K+   L+G+EMDYV+D+LSS+FVFNNPN+K  
Sbjct: 61  SYTLEYTKTKGDSDEEVVQDGIRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGT 120

Query: 127 CGCGESFSV 135
           CGCGESF++
Sbjct: 121 CGCGESFNI 129



>gi|31745170|ref|NP_853657.1| iron-sulfur cluster assembly 1 homolog, mitochondrial precursor
           [Rattus norvegicus]
 gi|81170640|sp|Q80W96.1|ISCA1_RAT RecName: Full=Iron-sulfur cluster assembly 1 homolog,
           mitochondrial; AltName: Full=HESB-like domain-containing
           protein 2; AltName: Full=Iron-sulfur assembly protein
           IscA; Flags: Precursor
 gi|30269948|gb|AAP29778.1| HesB protein [Rattus norvegicus]
 gi|47482102|gb|AAH70929.1| Iron-sulfur cluster assembly 1 homolog (S. cerevisiae) [Rattus
           norvegicus]
 gi|50926756|gb|AAH78677.1| Iron-sulfur cluster assembly 1 homolog (S. cerevisiae) [Rattus
           norvegicus]
 gi|149039760|gb|EDL93876.1| rCG24212 [Rattus norvegicus]
          Length = 129

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 96/129 (74%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRVQ--KAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQ 66
           M+  +  A+V A  K ++Q  +AA+TLTPSAVN+++QL+ + P+   ++V V+ +GC G 
Sbjct: 1   MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGLKVGVRTRGCNGL 60

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           SY LEYTK KG  DE V QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNPN+K  
Sbjct: 61  SYSLEYTKTKGDADEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGT 120

Query: 127 CGCGESFSV 135
           CGCGESF+V
Sbjct: 121 CGCGESFNV 129



>gi|430727945|ref|NP_001258865.1| iron-sulfur cluster assembly 1 homolog, mitochondrial [Gallus
           gallus]
 gi|81170638|sp|Q5ZJ74.1|ISCA1_CHICK RecName: Full=Iron-sulfur cluster assembly 1 homolog,
           mitochondrial; AltName: Full=HESB-like domain-containing
           protein 2; AltName: Full=Iron-sulfur assembly protein
           IscA; Flags: Precursor
 gi|53133780|emb|CAG32219.1| hypothetical protein RCJMB04_20e4 [Gallus gallus]
          Length = 129

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 95/129 (73%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRVQ--KAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQ 66
           MA  +  A+V A  K ++Q  +AA+TLTPSAV +++QL+ + P+   ++V V+ +GC G 
Sbjct: 1   MASSVVRATVRAVSKRKIQATRAALTLTPSAVQKIKQLLKDQPEHVGVKVGVRTRGCNGL 60

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           SY LEYTK KG  DE V QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNPN+K  
Sbjct: 61  SYTLEYTKSKGDSDEEVVQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGT 120

Query: 127 CGCGESFSV 135
           CGCGESF++
Sbjct: 121 CGCGESFNI 129



>gi|395514278|ref|XP_003761346.1| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial
           [Sarcophilus harrisii]
          Length = 129

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 97/129 (75%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRVQ--KAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQ 66
           M+  +  A+V A  K ++Q  +AA+TLTP+AVN+++QL+ + P+   ++V V+ +GC G 
Sbjct: 1   MSASLVRATVRAVSKRKLQPTRAALTLTPAAVNKIKQLLKDKPENVGLKVGVRTRGCNGL 60

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           SY LEYTK KG+ DE V QDG+ V +E K+   L+G+EMDYV+D+LSS+FVFNNPN+K  
Sbjct: 61  SYTLEYTKTKGESDEEVVQDGIRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGT 120

Query: 127 CGCGESFSV 135
           CGCGESF++
Sbjct: 121 CGCGESFNI 129



>gi|401624761|gb|EJS42809.1| isa1p [Saccharomyces arboricola H-6]
          Length = 250

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 68/132 (51%), Positives = 94/132 (71%)

Query: 4   ATAIRSMALKMAEASVAASRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGC 63
           AT++        EA     RK R +KA +TL+P A+  LR L+  P+PKLIRV+ +N+GC
Sbjct: 119 ATSVAKSDCSCTEAPKKRKRKLRPRKALITLSPKAIKHLRGLLAQPEPKLIRVSARNRGC 178

Query: 64  AGQSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNV 123
           +G +Y L+Y  E G+ DE+V+QDGV ++++ K+LF +IGSEMD+V D+L+SKFVF NPN 
Sbjct: 179 SGLTYDLQYITEPGKFDEVVEQDGVKIVIDSKALFSIIGSEMDWVDDKLASKFVFKNPNS 238

Query: 124 KENCGCGESFSV 135
           K  CGCGESF V
Sbjct: 239 KGTCGCGESFMV 250



>gi|50553450|ref|XP_504136.1| YALI0E19206p [Yarrowia lipolytica]
 gi|49650005|emb|CAG79731.1| YALI0E19206p [Yarrowia lipolytica CLIB122]
          Length = 250

 Score =  143 bits (361), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 61/114 (53%), Positives = 88/114 (77%)

Query: 22  SRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDE 81
           +RK R +KA +TL+P+AV  L+ L++ P+PKLIR+ V+N+GC+G +Y ++Y  +  + DE
Sbjct: 137 TRKLRPRKAVITLSPTAVKHLKDLLDQPEPKLIRIGVRNRGCSGLTYHIDYVDKPAKFDE 196

Query: 82  IVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
            V QDGV VL++ K+LF +IGSEMD++ D+LSS+F+F NPN K  CGCGESF V
Sbjct: 197 EVVQDGVRVLIDSKALFSIIGSEMDWLDDKLSSRFIFRNPNSKGECGCGESFMV 250



>gi|21312189|ref|NP_081197.1| iron-sulfur cluster assembly 1 homolog, mitochondrial precursor
           [Mus musculus]
 gi|81170639|sp|Q9D924.1|ISCA1_MOUSE RecName: Full=Iron-sulfur cluster assembly 1 homolog,
           mitochondrial; AltName: Full=HESB-like domain-containing
           protein 2; AltName: Full=Iron-sulfur assembly protein
           IscA; Flags: Precursor
 gi|12840954|dbj|BAB25025.1| unnamed protein product [Mus musculus]
 gi|17391301|gb|AAH18547.1| Iron-sulfur cluster assembly 1 homolog (S. cerevisiae) [Mus
           musculus]
 gi|26337127|dbj|BAC32248.1| unnamed protein product [Mus musculus]
 gi|26354821|dbj|BAC41037.1| unnamed protein product [Mus musculus]
 gi|55250324|gb|AAH85482.1| Iron-sulfur cluster assembly 1 homolog (S. cerevisiae) [Mus
           musculus]
 gi|74139353|dbj|BAE40820.1| unnamed protein product [Mus musculus]
 gi|74149091|dbj|BAE32196.1| unnamed protein product [Mus musculus]
 gi|148709345|gb|EDL41291.1| HESB like domain containing 2 [Mus musculus]
          Length = 129

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 95/129 (73%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRVQ--KAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQ 66
           M+  +  A+V A  K ++Q  +AA+TLTPSAVN+++QL+ + P+   ++V V+ +GC G 
Sbjct: 1   MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGLKVGVRTRGCNGL 60

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           SY LEYTK KG  DE V QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNPN+K  
Sbjct: 61  SYSLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGT 120

Query: 127 CGCGESFSV 135
           CGCGESF V
Sbjct: 121 CGCGESFHV 129



>gi|328771838|gb|EGF81877.1| hypothetical protein BATDEDRAFT_10349, partial [Batrachochytrium
           dendrobatidis JAM81]
          Length = 102

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 82/100 (82%), Gaps = 1/100 (1%)

Query: 35  TPSAVNRLRQL-VEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQDGVTVLVE 93
           TP+AVNRLR L ++   PKL++V  K KGC+GQ+Y LEY  EK + DE+V QDGV VL++
Sbjct: 1   TPAAVNRLRLLTLDLNGPKLLKVGTKKKGCSGQTYTLEYVTEKSKFDEVVVQDGVQVLID 60

Query: 94  HKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESF 133
            K+LF LIGSEMDYV+D+LS++FVFNNPNVKE CGCG+SF
Sbjct: 61  SKALFSLIGSEMDYVEDKLSAQFVFNNPNVKEMCGCGQSF 100



>gi|426219881|ref|XP_004004146.1| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial
           [Ovis aries]
 gi|426223563|ref|XP_004005944.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Ovis aries]
          Length = 129

 Score =  143 bits (360), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 96/129 (74%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRVQ--KAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQ 66
           M+  +  A+V A  K ++Q  +AA+TLTPSAVN+++QL+ + P+   ++V V+ +GC G 
Sbjct: 1   MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGL 60

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           SY LEYTK KG  DE V QDGV V +E K+   L+G+EMD+V+D+LSS+FVFNNPN+K  
Sbjct: 61  SYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDFVEDKLSSEFVFNNPNIKGT 120

Query: 127 CGCGESFSV 135
           CGCGESF++
Sbjct: 121 CGCGESFNI 129



>gi|403300963|ref|XP_003941181.1| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial
           [Saimiri boliviensis boliviensis]
          Length = 176

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 69/134 (51%), Positives = 95/134 (70%), Gaps = 1/134 (0%)

Query: 3   AATAIRSMALKMAEASVAASRKGRVQKAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNK 61
           A T   S +L  A     + RK +  +AA+TLTP+AVN+++QL+ + P+   ++V V+ +
Sbjct: 43  AGTVKMSASLVRATVRAVSKRKLQPTRAALTLTPAAVNKIKQLLKDKPEHVGVKVGVRTR 102

Query: 62  GCAGQSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNP 121
           GC G SY LEYTK KG  DE V QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNP
Sbjct: 103 GCNGLSYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNP 162

Query: 122 NVKENCGCGESFSV 135
           N+K  CGCGESF++
Sbjct: 163 NIKGTCGCGESFNI 176



>gi|126135146|ref|XP_001384097.1| Iron Sulfur Assembly [Scheffersomyces stipitis CBS 6054]
 gi|126091295|gb|ABN66068.1| Iron Sulfur Assembly, partial [Scheffersomyces stipitis CBS 6054]
          Length = 119

 Score =  142 bits (359), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 88/119 (73%)

Query: 17  ASVAASRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEK 76
            S    R  R +KA +TLT +AV+ L+ L+  P PKLIR+ V+N+GC+G +Y LEY  + 
Sbjct: 1   TSTKKKRVLRPRKALITLTSNAVDHLQALLNQPQPKLIRIGVRNRGCSGLTYNLEYVDQP 60

Query: 77  GQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           G+ DE+++QDGV VL++ K+LF ++GSEMD++ D+LSS+F+F NPN K  CGCGESF V
Sbjct: 61  GKFDELIEQDGVKVLIDSKALFSIVGSEMDWLDDKLSSRFIFKNPNSKGTCGCGESFMV 119



>gi|507698242|ref|XP_004714659.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Echinops telfairi]
          Length = 129

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 96/129 (74%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRVQ--KAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQ 66
           M+  +  A+V A  K ++Q  +AA+TLTPSAV++++QL+ + P+   ++V V+ +GC G 
Sbjct: 1   MSASLVRATVRAVSKRKLQATRAALTLTPSAVHKIKQLLKDKPEHVGLKVGVRTRGCNGL 60

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           SY LEYTK KG  DE V QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNPN+K  
Sbjct: 61  SYTLEYTKTKGDSDEEVVQDGVKVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGT 120

Query: 127 CGCGESFSV 135
           CGCGESF++
Sbjct: 121 CGCGESFNI 129



>gi|471395005|ref|XP_004381374.1| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial
           [Trichechus manatus latirostris]
          Length = 129

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 96/129 (74%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRVQ--KAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQ 66
           M+  +  A+V A  K ++Q  +AA+TLTPSAV++++QL+ + P+   ++V V+ +GC G 
Sbjct: 1   MSASLVRATVRAVSKRKLQPTRAALTLTPSAVHKIKQLLKDKPEHVGVKVGVRTRGCNGL 60

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           SY LEYTK KG  DE V QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNPN+K  
Sbjct: 61  SYTLEYTKTKGDSDEEVVQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGT 120

Query: 127 CGCGESFSV 135
           CGCGESF++
Sbjct: 121 CGCGESFNI 129



>gi|323308153|gb|EGA61404.1| Isa1p [Saccharomyces cerevisiae FostersO]
          Length = 250

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 60/106 (56%), Positives = 83/106 (78%)

Query: 30  AAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQDGVT 89
           A +TL+P A+  LR L+  P+PKLIRV+ +N+GC+G +Y L+Y  E G+ DE+V+QDGV 
Sbjct: 145 ALITLSPKAIKHLRALLAQPEPKLIRVSARNRGCSGLTYDLQYITEPGKFDEVVEQDGVK 204

Query: 90  VLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           ++++ K+LF +IGSEMD+V D+L+SKFVF NPN K  CGCGESF V
Sbjct: 205 IVIDSKALFSIIGSEMDWVDDKLASKFVFKNPNSKGTCGCGESFMV 250



>gi|301758436|ref|XP_002915054.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like, partial [Ailuropoda melanoleuca]
          Length = 126

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 94/125 (75%), Gaps = 3/125 (2%)

Query: 14  MAEASVAASRKGRVQ--KAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQSYVL 70
           +  A+V A  K ++Q  +AA+TLTPSAVN+++QL+ + P+   ++V V+ +GC G SY L
Sbjct: 2   LVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGLKVGVRTRGCNGLSYTL 61

Query: 71  EYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCG 130
           EYTK KG  DE V QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNPN+K  CGCG
Sbjct: 62  EYTKTKGDSDEEVVQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCG 121

Query: 131 ESFSV 135
           ESF++
Sbjct: 122 ESFNI 126



>gi|332821405|ref|XP_003310762.1| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial
           [Pan troglodytes]
          Length = 249

 Score =  142 bits (358), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 95/134 (70%), Gaps = 1/134 (0%)

Query: 3   AATAIRSMALKMAEASVAASRKGRVQKAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNK 61
           A TA  S +L  A A   + RK +  +AA+TLTPSAVN ++QL+ + P+   ++V V+ +
Sbjct: 82  AGTAKMSPSLVRATARAVSKRKLQPTRAALTLTPSAVNTIKQLLKDKPEHVGVKVGVRTR 141

Query: 62  GCAGQSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNP 121
           GC G SY LEYTK KG  D+   QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNP
Sbjct: 142 GCNGLSYTLEYTKTKGDSDKEFIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNP 201

Query: 122 NVKENCGCGESFSV 135
           N+K  CGCGESF++
Sbjct: 202 NIKGTCGCGESFNI 215



>gi|365764268|gb|EHN05792.1| Isa1p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 250

 Score =  142 bits (357), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 60/106 (56%), Positives = 83/106 (78%)

Query: 30  AAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQDGVT 89
           A +TL+P A+  LR L+  P+PKLIRV+ +N+GC+G +Y L+Y  E G+ DE+V+QDGV 
Sbjct: 145 ALITLSPKAIKHLRALLAQPEPKLIRVSARNRGCSGLTYDLQYITEPGKFDEVVEQDGVK 204

Query: 90  VLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           ++++ K+LF +IGSEMD+V D+L+SKFVF NPN K  CGCGESF V
Sbjct: 205 IVIDSKALFSIIGSEMDWVDDKLASKFVFKNPNSKGTCGCGESFMV 250



>gi|149236257|ref|XP_001524006.1| hypothetical protein LELG_04819 [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146452382|gb|EDK46638.1| hypothetical protein LELG_04819 [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 310

 Score =  142 bits (357), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 58/110 (52%), Positives = 86/110 (78%)

Query: 26  RVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQ 85
           + +K  +TLTPSA++ L  L+  P PKLIR+ V+N+GC+G +Y L+Y ++ G+ DE+++Q
Sbjct: 201 KPRKQLITLTPSAISHLEGLMNQPTPKLIRIGVRNRGCSGLTYDLDYVEKPGKFDELIEQ 260

Query: 86  DGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           DGV VL++ K+LF ++GSEMD++ D+LSS+F+F NPN K  CGCGESF V
Sbjct: 261 DGVKVLIDSKALFSIVGSEMDWLDDKLSSRFIFKNPNSKGTCGCGESFMV 310



>gi|323347592|gb|EGA81859.1| Isa1p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 250

 Score =  142 bits (357), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 60/106 (56%), Positives = 83/106 (78%)

Query: 30  AAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQDGVT 89
           A +TL+P A+  LR L+  P+PKLIRV+ +N+GC+G +Y L+Y  E G+ DE+V+QDGV 
Sbjct: 145 ALITLSPKAIKHLRALLAQPEPKLIRVSARNRGCSGLTYDLQYITEPGKFDEVVEQDGVK 204

Query: 90  VLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           ++++ K+LF +IGSEMD+V D+L+SKFVF NPN K  CGCGESF V
Sbjct: 205 IVIDSKALFSIIGSEMDWVDDKLASKFVFKNPNSKGTCGCGESFMV 250



>gi|151941143|gb|EDN59521.1| iron sulfur assembly-related protein [Saccharomyces cerevisiae
           YJM789]
 gi|190406019|gb|EDV09286.1| iron sulfur assembly protein 1 [Saccharomyces cerevisiae RM11-1a]
 gi|259147962|emb|CAY81211.1| Isa1p [Saccharomyces cerevisiae EC1118]
 gi|323336537|gb|EGA77803.1| Isa1p [Saccharomyces cerevisiae Vin13]
 gi|323353875|gb|EGA85728.1| Isa1p [Saccharomyces cerevisiae VL3]
 gi|349579700|dbj|GAA24861.1| K7_Isa1p [Saccharomyces cerevisiae Kyokai no. 7]
          Length = 250

 Score =  142 bits (357), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 60/106 (56%), Positives = 83/106 (78%)

Query: 30  AAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQDGVT 89
           A +TL+P A+  LR L+  P+PKLIRV+ +N+GC+G +Y L+Y  E G+ DE+V+QDGV 
Sbjct: 145 ALITLSPKAIKHLRALLAQPEPKLIRVSARNRGCSGLTYDLQYITEPGKFDEVVEQDGVK 204

Query: 90  VLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           ++++ K+LF +IGSEMD+V D+L+SKFVF NPN K  CGCGESF V
Sbjct: 205 IVIDSKALFSIIGSEMDWVDDKLASKFVFKNPNSKGTCGCGESFMV 250



>gi|402871171|ref|XP_003899554.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Papio anubis]
          Length = 129

 Score =  142 bits (357), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 95/129 (73%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRVQ--KAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQ 66
           M+  +  A+V A  K ++Q  +AA+TLTPSAVN+++QL+ + P+   ++V V+ +GC G 
Sbjct: 1   MSASLVRATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGL 60

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           SY LEYTK KG  DE V QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNPN+K  
Sbjct: 61  SYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGT 120

Query: 127 CGCGESFSV 135
           C CGESF++
Sbjct: 121 CSCGESFNI 129



>gi|330913198|ref|XP_003296224.1| hypothetical protein PTT_05470 [Pyrenophora teres f. teres 0-1]
 gi|311331812|gb|EFQ95675.1| hypothetical protein PTT_05470 [Pyrenophora teres f. teres 0-1]
          Length = 247

 Score =  142 bits (357), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 60/108 (55%), Positives = 85/108 (78%)

Query: 28  QKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQDG 87
           +KA + L+PSAV+ LR+L+E P+PKLIR+  K KGC+G +Y LEY  +    DE V+QDG
Sbjct: 139 RKATIKLSPSAVSHLRKLLELPEPKLIRIGTKAKGCSGLAYHLEYVDKPSPLDEQVEQDG 198

Query: 88  VTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           V VL+++K+L  +IGSEMD+++D+L+ +F+F NPN+ E CGCGESFSV
Sbjct: 199 VKVLIDNKALLNIIGSEMDWLEDKLNERFIFKNPNITEQCGCGESFSV 246



>gi|323303936|gb|EGA57716.1| Isa1p [Saccharomyces cerevisiae FostersB]
          Length = 250

 Score =  142 bits (357), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 60/106 (56%), Positives = 83/106 (78%)

Query: 30  AAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQDGVT 89
           A +TL+P A+  LR L+  P+PKLIRV+ +N+GC+G +Y L+Y  E G+ DE+V+QDGV 
Sbjct: 145 ALITLSPKAIKHLRALLAQPEPKLIRVSARNRGCSGLTYDLQYITEPGKFDEVVEQDGVK 204

Query: 90  VLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           ++++ K+LF +IGSEMD+V D+L+SKFVF NPN K  CGCGESF V
Sbjct: 205 IVIDSKALFSIIGSEMDWVDDKLASKFVFKNPNSKGTCGCGESFMV 250



>gi|397514491|ref|XP_003827518.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Pan paniscus]
          Length = 256

 Score =  142 bits (357), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 95/134 (70%), Gaps = 1/134 (0%)

Query: 3   AATAIRSMALKMAEASVAASRKGRVQKAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNK 61
           A TA  S +L  A A   + RK +  +AA+TLTPSAVN ++QL+ + P+   ++V V+ +
Sbjct: 89  AGTAKMSPSLVRATARAVSKRKLQPTRAALTLTPSAVNTIKQLLKDKPEHVGVKVGVRTR 148

Query: 62  GCAGQSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNP 121
           GC G SY LEYTK KG  D+   QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNP
Sbjct: 149 GCNGLSYTLEYTKTKGDSDKEFIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNP 208

Query: 122 NVKENCGCGESFSV 135
           N+K  CGCGESF++
Sbjct: 209 NIKGTCGCGESFNI 222



>gi|6323001|ref|NP_013073.1| Isa1p [Saccharomyces cerevisiae S288c]
 gi|2495214|sp|Q07821.1|ISA1_YEAST RecName: Full=Iron-sulfur assembly protein 1
 gi|1360208|emb|CAA97476.1| unnamed protein product [Saccharomyces cerevisiae]
 gi|285813397|tpg|DAA09293.1| TPA: Isa1p [Saccharomyces cerevisiae S288c]
 gi|392297793|gb|EIW08892.1| Isa1p [Saccharomyces cerevisiae CEN.PK113-7D]
          Length = 250

 Score =  141 bits (356), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 59/106 (55%), Positives = 83/106 (78%)

Query: 30  AAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQDGVT 89
           A +TL+P A+  LR L+  P+PKLIRV+ +N+GC+G +Y L+Y  E G+ DE+V+QDGV 
Sbjct: 145 ALITLSPKAIKHLRALLAQPEPKLIRVSARNRGCSGLTYDLQYITEPGKFDEVVEQDGVK 204

Query: 90  VLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           ++++ K+LF +IGSEMD++ D+L+SKFVF NPN K  CGCGESF V
Sbjct: 205 IVIDSKALFSIIGSEMDWIDDKLASKFVFKNPNSKGTCGCGESFMV 250



>gi|363755464|ref|XP_003647947.1| hypothetical protein Ecym_7292 [Eremothecium cymbalariae
           DBVPG#7215]
 gi|356891983|gb|AET41130.1| hypothetical protein Ecym_7292 [Eremothecium cymbalariae
           DBVPG#7215]
          Length = 254

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 88/113 (77%)

Query: 23  RKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEI 82
           R+ R +KA +TL+PSA+  L++L++ P+P+L+RV V+N+GC+G  Y L+Y  + G+ DEI
Sbjct: 142 RRLRPRKALLTLSPSAIIHLKRLLDKPEPQLVRVGVRNRGCSGLVYDLQYITKPGKFDEI 201

Query: 83  VKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           V+QDGV ++++ K+LF ++GSEMD+V D L S+F+F NPN K  CGCGESF V
Sbjct: 202 VEQDGVKIVIDSKALFSIVGSEMDWVDDNLQSRFIFKNPNSKGTCGCGESFMV 254



>gi|323332598|gb|EGA74005.1| Isa1p [Saccharomyces cerevisiae AWRI796]
          Length = 250

 Score =  141 bits (356), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 60/106 (56%), Positives = 83/106 (78%)

Query: 30  AAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQDGVT 89
           A +TL+P A+  LR L+  P+PKLIRV+ +N+GC+G +Y L+Y  E G+ DE+V+QDGV 
Sbjct: 145 ALITLSPKAIKHLRALLAQPEPKLIRVSARNRGCSGLTYDLQYITEPGKFDEVVEQDGVK 204

Query: 90  VLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           ++++ K+LF +IGSEMD+V D+L+SKFVF NPN K  CGCGESF V
Sbjct: 205 IVIDSKALFSVIGSEMDWVDDKLASKFVFKNPNSKGTCGCGESFMV 250



>gi|367006097|ref|XP_003687780.1| hypothetical protein TPHA_0K02150 [Tetrapisispora phaffii CBS 4417]
 gi|357526085|emb|CCE65346.1| hypothetical protein TPHA_0K02150 [Tetrapisispora phaffii CBS 4417]
          Length = 271

 Score =  141 bits (355), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 58/114 (50%), Positives = 88/114 (77%)

Query: 22  SRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDE 81
           +R  + +KA +TL+P A++ L++L++ P+PKLIR+  +N+GC+G +Y L+Y  +  + DE
Sbjct: 158 TRTLKPRKALITLSPKAISHLKKLLDQPEPKLIRIGTRNRGCSGLTYDLQYITQPEKFDE 217

Query: 82  IVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           IV+QDGV V+++ K+LF ++GSEMD++ D LSS+FVF NPN K  CGCGESF V
Sbjct: 218 IVEQDGVKVIIDSKALFSVVGSEMDWIDDTLSSRFVFKNPNSKGTCGCGESFMV 271



>gi|189200376|ref|XP_001936525.1| iron sulfur assembly protein 1 [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187983624|gb|EDU49112.1| iron sulfur assembly protein 1 [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 196

 Score =  140 bits (354), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 60/108 (55%), Positives = 84/108 (77%)

Query: 28  QKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQDG 87
           +KA + L+PSAV  LR+L+E P+PKLIR+  K KGC+G +Y LEY  +    DE V+QDG
Sbjct: 88  RKATIKLSPSAVAHLRELLELPEPKLIRIGTKAKGCSGLAYHLEYVDKPSPLDEQVEQDG 147

Query: 88  VTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           V VL+++K+L  +IGSEMD+++D+L+ +F+F NPN+ E CGCGESFSV
Sbjct: 148 VKVLIDNKALLNIIGSEMDWLEDKLNERFIFKNPNITEQCGCGESFSV 195



>gi|452003672|gb|EMD96129.1| hypothetical protein COCHEDRAFT_1127629 [Bipolaris maydis C5]
 gi|477593919|gb|ENI10988.1| hypothetical protein COCC4DRAFT_184335 [Bipolaris maydis ATCC
           48331]
          Length = 247

 Score =  140 bits (354), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 60/108 (55%), Positives = 84/108 (77%)

Query: 28  QKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQDG 87
           +KA + L+PSAV  LR+L+E P+PKLIR+  K KGC+G +Y LEY  +    DE V+QDG
Sbjct: 139 RKATIKLSPSAVAHLRELLELPEPKLIRIGTKAKGCSGLAYHLEYVDKPSPLDEQVEQDG 198

Query: 88  VTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           V VL+++K+L  +IGSEMD+++D+L+ +F+F NPN+ E CGCGESFSV
Sbjct: 199 VKVLIDNKALLNIIGSEMDWLEDKLNERFIFKNPNITEQCGCGESFSV 246



>gi|451855851|gb|EMD69142.1| hypothetical protein COCSADRAFT_75793 [Bipolaris sorokiniana
           ND90Pr]
          Length = 247

 Score =  140 bits (354), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 60/108 (55%), Positives = 84/108 (77%)

Query: 28  QKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQDG 87
           +KA + L+PSAV  LR+L+E P+PKLIR+  K KGC+G +Y LEY  +    DE V+QDG
Sbjct: 139 RKATIKLSPSAVAHLRELLELPEPKLIRIGTKAKGCSGLAYHLEYVDKPSPLDEQVEQDG 198

Query: 88  VTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           V VL+++K+L  +IGSEMD+++D+L+ +F+F NPN+ E CGCGESFSV
Sbjct: 199 VKVLIDNKALLNIIGSEMDWLEDKLNERFIFKNPNITEQCGCGESFSV 246



>gi|302698621|ref|XP_003038989.1| hypothetical protein SCHCODRAFT_34794 [Schizophyllum commune H4-8]
 gi|300112686|gb|EFJ04087.1| hypothetical protein SCHCODRAFT_34794, partial [Schizophyllum
           commune H4-8]
          Length = 119

 Score =  140 bits (354), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 80/101 (79%)

Query: 35  TPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQDGVTVLVEH 94
           +P+AV RLR L + P P+LIR+ V+NKGCAG SY LEY  + G+ DE+V+QDGV VL++ 
Sbjct: 19  SPTAVERLRTLSKSPTPQLIRIGVRNKGCAGMSYHLEYVDKPGRFDEVVEQDGVRVLIDS 78

Query: 95  KSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           K+LF +IGSEMD+ +D LSSKF F NPNV + CGCG+SFSV
Sbjct: 79  KALFSIIGSEMDWKEDALSSKFTFKNPNVVDACGCGDSFSV 119



>gi|301610979|ref|XP_002935018.1| PREDICTED: iron-sulfur cluster assembly 1 homolog, mitochondrial
           [Xenopus (Silurana) tropicalis]
          Length = 129

 Score =  140 bits (353), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 96/129 (74%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRVQ--KAAMTLTPSAVNRLRQLVEG-PDPKLIRVAVKNKGCAGQ 66
           M+  +  A++ A  K ++Q  +AA+TLTP+AVN++++L++  PD   ++VAV+ +GC G 
Sbjct: 1   MSASVVRATIRAVSKRKLQPTRAALTLTPAAVNKVKKLLQDKPDNIGLKVAVRTRGCNGL 60

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           SY LEY K KG  DE V QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNPN+K  
Sbjct: 61  SYYLEYAKSKGPSDEEVVQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGT 120

Query: 127 CGCGESFSV 135
           CGCGESF++
Sbjct: 121 CGCGESFNI 129



>gi|354481338|ref|XP_003502858.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Cricetulus griseus]
 gi|344235713|gb|EGV91816.1| Iron-sulfur cluster assembly 1-like, mitochondrial [Cricetulus
           griseus]
          Length = 129

 Score =  140 bits (352), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 95/129 (73%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRVQ--KAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQ 66
           M+  +  A+V A  K ++Q  +AA+TLTPSAVN+++QL+ + P+   ++V V+ +GC   
Sbjct: 1   MSASLVRATVRAVSKRKLQPTRAAITLTPSAVNKIKQLLKDKPEHVGLKVGVRTRGCNVL 60

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           SY LEYTK KG  DE V QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNPN+K  
Sbjct: 61  SYTLEYTKTKGDSDEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGT 120

Query: 127 CGCGESFSV 135
           CGCGESF++
Sbjct: 121 CGCGESFNI 129



>gi|482814470|gb|EOA91148.1| hypothetical protein SETTUDRAFT_158602 [Setosphaeria turcica Et28A]
          Length = 243

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 59/108 (54%), Positives = 83/108 (76%)

Query: 28  QKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQDG 87
           +KA + L+PSAV  LR+L+E P+PKLIR+  K KGC+G +Y LEY  +    DE V+QDG
Sbjct: 135 RKATIKLSPSAVAHLRELLELPEPKLIRIGTKAKGCSGLAYHLEYVDKPSPLDEQVEQDG 194

Query: 88  VTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
             VL+++K+L  +IGSEMD+++D+L+ +F+F NPN+ E CGCGESFSV
Sbjct: 195 AKVLIDNKALLNIIGSEMDWLEDKLNERFIFKNPNITEQCGCGESFSV 242



>gi|406602914|emb|CCH45578.1| putative iron-sulfur cluster insertion protein [Wickerhamomyces
           ciferrii]
          Length = 246

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 87/113 (76%)

Query: 23  RKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEI 82
           R  + +KA +TL+ +AV  LR L++ P+PKLI++ VKN+GC+G +Y LEY  E  + DE+
Sbjct: 134 RTLKPRKALITLSQTAVQHLRGLLDQPEPKLIKIGVKNRGCSGLTYHLEYISEPNKFDEV 193

Query: 83  VKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           ++QDGV V+++ K+LF ++GSEMD++ D++SS+F+F NPN K  CGCGESF V
Sbjct: 194 IEQDGVKVIIDSKALFSIVGSEMDWLDDKISSRFIFKNPNSKGTCGCGESFMV 246



>gi|410035684|ref|XP_003949943.1| PREDICTED: uncharacterized protein LOC101058624 [Pan troglodytes]
          Length = 463

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 95/129 (73%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRVQ--KAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQ 66
           M   +  A+V A  K ++Q  +AA+TLTPSAVN+++QL+ + P+   ++V V+ +GC G 
Sbjct: 335 MLASLVRATVRAVSKRKMQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGL 394

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           SY LEYTK KG  DE V QDGV VL+E K+   L+G+EM YV+D+LSS+FVFNNPN+K  
Sbjct: 395 SYTLEYTKTKGDSDEEVIQDGVRVLIEKKAQLTLLGTEMCYVEDKLSSEFVFNNPNIKGT 454

Query: 127 CGCGESFSV 135
           CGCGESF++
Sbjct: 455 CGCGESFNI 463



>gi|169624826|ref|XP_001805818.1| hypothetical protein SNOG_15677 [Phaeosphaeria nodorum SN15]
 gi|111055932|gb|EAT77052.1| hypothetical protein SNOG_15677 [Phaeosphaeria nodorum SN15]
          Length = 246

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 59/108 (54%), Positives = 83/108 (76%)

Query: 28  QKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQDG 87
           +KA M L+PSAV  LR+L+  P+PKLIR+  + KGC+G +Y LEY  +    DE V+QDG
Sbjct: 138 RKAVMKLSPSAVAHLRELLNQPEPKLIRIGTRAKGCSGLAYHLEYVDKPNALDEQVEQDG 197

Query: 88  VTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           V VL+++K+L  +IGSEMD+++D+L+ +F+F NPN+ E CGCGESFSV
Sbjct: 198 VKVLIDNKALLNIIGSEMDWLEDKLNERFIFRNPNITEQCGCGESFSV 245



>gi|50286831|ref|XP_445845.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49525151|emb|CAG58764.1| unnamed protein product [Candida glabrata]
          Length = 222

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 67/140 (47%), Positives = 97/140 (69%), Gaps = 8/140 (5%)

Query: 4   ATAIRSMALKMAEAS---VAASRKGR-----VQKAAMTLTPSAVNRLRQLVEGPDPKLIR 55
           + A ++MA+ + E +   +  S KG+       K  ++LTP+AV  LR L + P+PKLIR
Sbjct: 83  SPAAKTMAVPVKERAHEGLKTSNKGKKRRLVPHKQLISLTPAAVAHLRSLCQQPEPKLIR 142

Query: 56  VAVKNKGCAGQSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSK 115
           ++ K++GCAG SY L Y    G+ DE+V+QDGV V+++ K+LF ++GSEMD+V++RL SK
Sbjct: 143 ISAKHRGCAGLSYDLSYIDAPGKFDEVVEQDGVRVVIDSKALFSVVGSEMDWVENRLFSK 202

Query: 116 FVFNNPNVKENCGCGESFSV 135
           FVF NPN K  CGCGESF +
Sbjct: 203 FVFKNPNSKGTCGCGESFMI 222



>gi|294654557|ref|XP_456615.2| DEHA2A06710p [Debaryomyces hansenii CBS767]
 gi|199428975|emb|CAG84571.2| DEHA2A06710p [Debaryomyces hansenii CBS767]
          Length = 275

 Score =  139 bits (351), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 86/113 (76%)

Query: 23  RKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEI 82
           R  R +KA +T + +AV+ L+ L++ P+P+LIR+ V+N+GC+G +Y LEY  E G+ DE 
Sbjct: 163 RTLRPRKALITFSANAVDHLKNLLDQPEPQLIRIGVQNRGCSGLTYNLEYVSEPGKFDEK 222

Query: 83  VKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           V+QDGV V ++ K+LF ++GSEMD++ D+LSS+F+F NPN K  CGCGESF V
Sbjct: 223 VEQDGVKVYIDSKALFSIVGSEMDWLDDKLSSRFIFRNPNSKGTCGCGESFMV 275



>gi|426337146|ref|XP_004032584.1| PREDICTED: uncharacterized protein LOC101129959 [Gorilla gorilla
           gorilla]
          Length = 296

 Score =  139 bits (350), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 72/136 (52%), Positives = 95/136 (69%), Gaps = 7/136 (5%)

Query: 4   ATAIRSMALKMAEASVAASRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKL----IRVAVK 59
           ATA  S +L  A     + RK +   AA+TLTPSAVN+++QL++    KL    ++V V+
Sbjct: 164 ATAKMSASLVRATVRAVSKRKLQPTWAALTLTPSAVNKIKQLLKD---KLEHVGVKVGVR 220

Query: 60  NKGCAGQSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFN 119
            +GC G SY LEYTK KG  DE V QDGV VL+E K+   L+G+EM YV+D+LSS+FVFN
Sbjct: 221 TRGCNGLSYTLEYTKTKGDSDEEVIQDGVRVLIEKKAQLTLLGTEMCYVEDKLSSEFVFN 280

Query: 120 NPNVKENCGCGESFSV 135
           NPN+K  CGCGESF++
Sbjct: 281 NPNIKGTCGCGESFNI 296



>gi|441663485|ref|XP_004091682.1| PREDICTED: LOW QUALITY PROTEIN: iron-sulfur assembly protein 1-like
           [Nomascus leucogenys]
          Length = 304

 Score =  139 bits (349), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 94/126 (74%), Gaps = 3/126 (2%)

Query: 13  KMAEASVAASRKGRVQ--KAAMTLTPSAVNRLRQLVEGPDPKL-IRVAVKNKGCAGQSYV 69
           KM+ + V A  K ++Q  +AA+TLTPSAVN+++QL++     + ++V V+ +GC G SY 
Sbjct: 179 KMSASLVRAXSKRKLQPTRAALTLTPSAVNKIKQLLKDKREHVGVKVGVRTRGCNGLSYA 238

Query: 70  LEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGC 129
           LEYTK KG  DE V QDG+ V +E K+   L+G+EMDYV+D+LSS+FVFNNPN+K  CGC
Sbjct: 239 LEYTKTKGDSDEEVIQDGIRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGICGC 298

Query: 130 GESFSV 135
           GESF++
Sbjct: 299 GESFNI 304



>gi|410929973|ref|XP_003978373.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Takifugu rubripes]
          Length = 129

 Score =  138 bits (348), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 68/129 (52%), Positives = 94/129 (72%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRV--QKAAMTLTPSAVNRLRQLVEG-PDPKLIRVAVKNKGCAGQ 66
           M+  M  A+V A  K ++   +AA+TLTPSAVNR+R L+E  P+   ++V VK +GC G 
Sbjct: 1   MSASMMRATVRAVSKRKIIATRAALTLTPSAVNRIRLLLEDKPEYIGLKVGVKTRGCNGL 60

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           +Y L+YTKEK + DE V QDGV V +E K+   L+G+EMD+V+ +L+S+F+FNNPN+K  
Sbjct: 61  TYTLDYTKEKLKSDEEVLQDGVRVFIEKKAQLTLLGTEMDFVETKLNSEFIFNNPNIKGM 120

Query: 127 CGCGESFSV 135
           CGCGESFSV
Sbjct: 121 CGCGESFSV 129



>gi|302658416|ref|XP_003020912.1| hypothetical protein TRV_04988 [Trichophyton verrucosum HKI 0517]
 gi|291184782|gb|EFE40294.1| hypothetical protein TRV_04988 [Trichophyton verrucosum HKI 0517]
          Length = 249

 Score =  138 bits (347), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 60/100 (60%), Positives = 82/100 (82%)

Query: 24  KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIV 83
           K R +KAA++LTP+A+++LR LV  PDPKLIR+ VKN+GC+G SY LEY ++    DE+V
Sbjct: 141 KLRARKAAVSLTPTALSKLRDLVSQPDPKLIRIGVKNRGCSGLSYHLEYVEKPAPFDEVV 200

Query: 84  KQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNV 123
           +QDGV VL++ K+LF +IGSEMD+ +D LSS+FVFNNPN+
Sbjct: 201 EQDGVKVLIDSKALFSIIGSEMDWHEDPLSSRFVFNNPNI 240



>gi|67523035|ref|XP_659578.1| hypothetical protein AN1974.2 [Aspergillus nidulans FGSC A4]
 gi|40745983|gb|EAA65139.1| hypothetical protein AN1974.2 [Aspergillus nidulans FGSC A4]
          Length = 566

 Score =  138 bits (347), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 61/104 (58%), Positives = 83/104 (79%)

Query: 23  RKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEI 82
           RK R +KAAM LTP AV +LR+L+  P+P+LIRV VKN+GC+G +Y LEY  + G  DE+
Sbjct: 130 RKLRPRKAAMKLTPIAVEQLRKLLSQPEPRLIRVGVKNRGCSGLAYHLEYVDKPGTFDEV 189

Query: 83  VKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           V+QDGV VL++ K+LF +IGSEMD+ +D+LS++FVF NPN+K N
Sbjct: 190 VEQDGVKVLIDSKALFSIIGSEMDWQEDKLSARFVFRNPNIKSN 233



>gi|47226595|emb|CAG08611.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 129

 Score =  138 bits (347), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 94/129 (72%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRV--QKAAMTLTPSAVNRLRQLVEG-PDPKLIRVAVKNKGCAGQ 66
           M+  +  A+V A  K ++   +AA+TLTPSAVNR+R L+E  P+   ++V VK +GC G 
Sbjct: 1   MSASVMRATVRAVSKRKIVATRAALTLTPSAVNRIRLLLEDRPEYIGLKVGVKTRGCNGL 60

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           +Y L+YTKEK + DE V QDGV V +E K+   L+G+EMD+V+ +L+S+F+FNNPN+K  
Sbjct: 61  TYTLDYTKEKHKSDEEVLQDGVRVFIEKKAQLTLLGTEMDFVETKLTSEFIFNNPNIKGT 120

Query: 127 CGCGESFSV 135
           CGCGESFSV
Sbjct: 121 CGCGESFSV 129



>gi|365986414|ref|XP_003670039.1| hypothetical protein NDAI_0D04830 [Naumovozyma dairenensis CBS 421]
 gi|343768808|emb|CCD24796.1| hypothetical protein NDAI_0D04830 [Naumovozyma dairenensis CBS 421]
          Length = 307

 Score =  138 bits (347), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 55/106 (51%), Positives = 83/106 (78%)

Query: 30  AAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQDGVT 89
           A +TL+P A+  L+ L++ P+PK+IRV  +N+GC+G +Y L+Y  E G+ DEIV+QDG+ 
Sbjct: 202 AFITLSPKAIVHLKALMDQPEPKMIRVGTRNRGCSGTTYDLQYITEPGKFDEIVEQDGIK 261

Query: 90  VLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           ++++ K+LF ++GSEMD++ D+L++KFVF NPN K  CGCGESF V
Sbjct: 262 IVIDSKALFSVVGSEMDWIDDKLAAKFVFKNPNSKGTCGCGESFMV 307



>gi|410080862|ref|XP_003958011.1| hypothetical protein KAFR_0F02790 [Kazachstania africana CBS 2517]
 gi|372464598|emb|CCF58876.1| hypothetical protein KAFR_0F02790 [Kazachstania africana CBS 2517]
          Length = 239

 Score =  137 bits (346), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 86/117 (73%), Gaps = 4/117 (3%)

Query: 21  ASRKGR----VQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEK 76
           A RKGR     +   +TL+ +A+  L++L+  PDPKLIR+  KN+GC+G +Y LEY  + 
Sbjct: 121 APRKGRRVLRPKIPLITLSSNAIKHLKKLLNEPDPKLIRIGTKNRGCSGTTYHLEYVTKP 180

Query: 77  GQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESF 133
            + DEI++QDG+ ++++ K+LF +IGSEMD++ D+LSSKF+F NPN K  CGCGESF
Sbjct: 181 EKFDEIIEQDGIKIVIDSKALFSVIGSEMDWLDDKLSSKFIFRNPNAKGTCGCGESF 237



>gi|408390581|gb|EKJ69973.1| hypothetical protein FPSE_09818 [Fusarium pseudograminearum CS3096]
          Length = 235

 Score =  137 bits (345), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 83/101 (82%)

Query: 24  KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIV 83
           K R +KAAM LTPSAV++LR+L++ P+PKLI+V V+N+GC+G +Y LEY  + G  DE V
Sbjct: 128 KLRPRKAAMKLTPSAVDQLRELLDQPEPKLIKVGVRNRGCSGLAYHLEYVDKPGAFDETV 187

Query: 84  KQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVK 124
           +QDGV VL++ K+LF +IGSEMDYV+D+L+ +FVF NPN+K
Sbjct: 188 EQDGVKVLIDSKALFSIIGSEMDYVEDKLNQRFVFKNPNIK 228



>gi|119500384|ref|XP_001266949.1| iron-sulfur assembly protein [Neosartorya fischeri NRRL 181]
 gi|119415114|gb|EAW25052.1| iron-sulfur assembly protein [Neosartorya fischeri NRRL 181]
          Length = 249

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 61/104 (58%), Positives = 82/104 (78%)

Query: 23  RKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEI 82
           RK R +KAAM LTP AV +LR+L+  PDPK IRV VKN+GC+G +Y LEY ++ G  DE+
Sbjct: 133 RKLRARKAAMKLTPLAVEQLRKLLSQPDPKFIRVGVKNRGCSGLAYHLEYVEKPGAFDEV 192

Query: 83  VKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           V+QDGV VL++ K+LF +IGSEMD+ +D+LS KFVF NPN+ ++
Sbjct: 193 VEQDGVKVLIDSKALFSIIGSEMDWQEDKLSRKFVFRNPNISKS 236



>gi|395735852|ref|XP_003776652.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Pongo abelii]
          Length = 192

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 67/129 (51%), Positives = 94/129 (72%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRVQ--KAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQ 66
           M   +  A+V A  K ++Q  +AA+TLTPSAVN+++QL+ + P+   ++V V+ +GC G 
Sbjct: 64  MLASLVRATVQAVSKRKLQPTQAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRARGCNGL 123

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           SY LEYT+ KG  DE V QDGV V +E K+   L+G+E DYV+D+LSS+FVFNNPN+K  
Sbjct: 124 SYTLEYTETKGDSDEEVIQDGVRVFMEKKAQLTLLGTETDYVEDKLSSEFVFNNPNIKGT 183

Query: 127 CGCGESFSV 135
           CGCGESF++
Sbjct: 184 CGCGESFNI 192



>gi|385305375|gb|EIF49356.1| iron sulfur assembly [Dekkera bruxellensis AWRI1499]
          Length = 253

 Score =  137 bits (344), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 95/136 (69%), Gaps = 13/136 (9%)

Query: 13  KMAEASVAASRKGRVQ-------------KAAMTLTPSAVNRLRQLVEGPDPKLIRVAVK 59
           ++AEAS  ++R GR +             KA +TLTP+A+  L++L+  P+PK+IRV+VK
Sbjct: 118 RIAEASGKSTRDGRRRLKRHHRRRKLRPLKAVLTLTPNAILHLKRLMNLPEPKMIRVSVK 177

Query: 60  NKGCAGQSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFN 119
           N+GC+G +Y LEY     + DE V QDGV +LV+ K+LF +IGS+MD+V ++L SKFVF 
Sbjct: 178 NRGCSGLTYHLEYVSGPEKFDEEVNQDGVKILVDSKALFSVIGSQMDWVDNKLXSKFVFK 237

Query: 120 NPNVKENCGCGESFSV 135
           NPN K +CGCGESF V
Sbjct: 238 NPNSKGSCGCGESFMV 253



>gi|488587229|ref|XP_004478942.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Dasypus novemcinctus]
          Length = 129

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 92/129 (71%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRVQKA--AMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQ 66
           M   +  A+V A  K ++Q A  A+TLTPSAVN+++QL+ + P+   ++  V+ +GC G 
Sbjct: 1   MPAPLVPATVRAGSKRKLQPAPAALTLTPSAVNKIKQLLKDKPERVGVKAGVRTRGCNGL 60

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           SY L+YTK KG  DE V QDG  V +E K+   L+G+EMDYV+D+LSS+FVFNNPN+K  
Sbjct: 61  SYTLDYTKTKGDADEEVVQDGDRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGT 120

Query: 127 CGCGESFSV 135
           CGCGESF++
Sbjct: 121 CGCGESFNI 129



>gi|505756091|gb|EOR00272.1| Iron-sulfur assembly protein 1 [Wallemia ichthyophaga EXF-994]
          Length = 209

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 64/109 (58%), Positives = 82/109 (75%), Gaps = 1/109 (0%)

Query: 26  RVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQ 85
           + + AA+ L+ SAV +LR  +     +L+RV VKNKGC+G SY LEY ++  + DE+V+Q
Sbjct: 100 KARSAALQLSQSAVEQLR-FLSSSRGELLRVGVKNKGCSGMSYHLEYVEKPARFDEVVEQ 158

Query: 86  DGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFS 134
           DGV VLV+ K+LF +IGS MD+V DRLSSKFVFNNPNV E CGCGES S
Sbjct: 159 DGVKVLVDSKALFSIIGSTMDWVDDRLSSKFVFNNPNVTETCGCGESMS 207



>gi|432873315|ref|XP_004072190.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Oryzias latipes]
          Length = 129

 Score =  136 bits (342), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 63/129 (48%), Positives = 95/129 (73%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRV--QKAAMTLTPSAVNRLRQLVEG-PDPKLIRVAVKNKGCAGQ 66
           M+  +  A+V A  K ++   +AA+TLTP+AVN++R L++  P+   ++V V+ +GC G 
Sbjct: 1   MSASLVRATVRAVNKRKILPTRAALTLTPAAVNKIRSLLQDKPEYLGLKVGVRTRGCNGL 60

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           +Y L+YTK+K + DE V QDGVTV +E K+   L+G+EMD+V+ +LSS+FVFNNPN+K  
Sbjct: 61  TYTLDYTKQKDKSDEEVLQDGVTVFIEKKAQLTLLGTEMDFVESKLSSEFVFNNPNIKGT 120

Query: 127 CGCGESFSV 135
           CGCGESF++
Sbjct: 121 CGCGESFNI 129



>gi|68448477|ref|NP_001020349.1| iron-sulfur cluster assembly 1 homolog, mitochondrial precursor
           [Danio rerio]
 gi|81170637|sp|Q4QRC6.1|ISCA1_DANRE RecName: Full=Iron-sulfur cluster assembly 1 homolog,
           mitochondrial; AltName: Full=HESB-like domain-containing
           protein 2; AltName: Full=Iron-sulfur assembly protein
           IscA; Flags: Precursor
 gi|67678098|gb|AAH97234.1| Zgc:114185 [Danio rerio]
          Length = 129

 Score =  135 bits (341), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 64/129 (49%), Positives = 95/129 (73%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRV--QKAAMTLTPSAVNRLRQLVEG-PDPKLIRVAVKNKGCAGQ 66
           M+  +A A+V A  + ++   +AA+TLTPSAVN+++QL++  P+   ++V V+ +GC G 
Sbjct: 1   MSASIARATVRAVSRRKILSTRAALTLTPSAVNKVKQLLDNKPEYIGLKVGVRTRGCNGL 60

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           +Y L+YTK K Q DE V QDGV V +E K+   L+G+EMD+V+ +LSS+FVFNNPN+K  
Sbjct: 61  TYTLDYTKNKEQSDEEVLQDGVRVFIEKKAQLTLLGTEMDFVETKLSSEFVFNNPNIKGT 120

Query: 127 CGCGESFSV 135
           CGCGESF++
Sbjct: 121 CGCGESFNI 129



>gi|403217596|emb|CCK72090.1| hypothetical protein KNAG_0I03060 [Kazachstania naganishii CBS
           8797]
          Length = 222

 Score =  135 bits (340), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 87/113 (76%)

Query: 23  RKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEI 82
           R  R +KA ++L+P A+  L+ L++ P+P++IRV+ +N+GC+G +Y L+Y  +  + DE+
Sbjct: 110 RTLRPRKAVISLSPKAIAHLKALLDEPEPRMIRVSTRNRGCSGTTYDLQYVTKPEKFDEV 169

Query: 83  VKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           V+QDG+ ++++ ++LF ++GSEMD++ D+L++KFVF NPN K  CGCGESF V
Sbjct: 170 VEQDGIKIVIDSRALFSVVGSEMDWIDDKLNTKFVFKNPNSKGTCGCGESFMV 222



>gi|66559527|ref|XP_624993.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Apis mellifera]
          Length = 130

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 93/130 (71%), Gaps = 4/130 (3%)

Query: 10  MALKMAEASVAASRKGR---VQKAAMTLTPSAVNRLRQLVEGPDPKL-IRVAVKNKGCAG 65
           MA  M  A+   + KGR     +AA+TLTPSAV ++++L++     + +RV+VK +GC G
Sbjct: 1   MASSMVAAATVRAVKGRKILATRAALTLTPSAVKKIKELLKDKSEFIGLRVSVKQRGCNG 60

Query: 66  QSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKE 125
            SY L+Y KEK + DE V QDGV ++++ K+   L+G+EMDY++ +LSS+F+FNNPN+K 
Sbjct: 61  LSYTLDYAKEKSKLDEEVVQDGVCIMIDKKAQLSLLGTEMDYIETKLSSEFIFNNPNIKG 120

Query: 126 NCGCGESFSV 135
            CGCGESFSV
Sbjct: 121 TCGCGESFSV 130



>gi|119605300|gb|EAW84894.1| hCG2041197 [Homo sapiens]
          Length = 130

 Score =  135 bits (340), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 65/130 (50%), Positives = 95/130 (73%), Gaps = 4/130 (3%)

Query: 10  MALKMAEASVAASRKGRVQ--KAAMTLTPSAVNRLRQLVEGPDPKLI--RVAVKNKGCAG 65
           M+  + +A+V A  K ++Q  +AA+TLTPSAV +++QL++   P+L+  +V V+ + C G
Sbjct: 1   MSASLVQATVQAVSKRKLQPTQAALTLTPSAVTKVKQLLKDSKPELVGVKVGVQTRVCNG 60

Query: 66  QSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKE 125
            SY LEYTK KG  DE V QDGV V ++ K+   ++G+EMDYV+D+LSS+FVFNNPN+K 
Sbjct: 61  LSYTLEYTKTKGDSDEEVIQDGVRVFIKKKAKLTVLGAEMDYVEDKLSSEFVFNNPNIKG 120

Query: 126 NCGCGESFSV 135
            CGC ESF++
Sbjct: 121 TCGCRESFNI 130



>gi|380028797|ref|XP_003698073.1| PREDICTED: LOW QUALITY PROTEIN: iron-sulfur cluster assembly 1
           homolog, mitochondrial-like [Apis florea]
          Length = 130

 Score =  135 bits (339), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 93/130 (71%), Gaps = 4/130 (3%)

Query: 10  MALKMAEASVAASRKGR---VQKAAMTLTPSAVNRLRQLVEGPDPKL-IRVAVKNKGCAG 65
           MA  M  A+   + KGR     +AA+TLTPSAV ++++L++     + +RV+VK +GC G
Sbjct: 1   MASSMVAAATIRAVKGRKILATRAALTLTPSAVKKIKELLKDKSEFIGLRVSVKQRGCNG 60

Query: 66  QSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKE 125
            SY L+Y KEK + DE V QDGV ++++ K+   L+G+EMDY++ +LSS+F+FNNPN+K 
Sbjct: 61  LSYTLDYAKEKSKLDEEVVQDGVCIMIDKKAQLSLLGTEMDYIETKLSSEFIFNNPNIKG 120

Query: 126 NCGCGESFSV 135
            CGCGESFSV
Sbjct: 121 TCGCGESFSV 130



>gi|221115690|ref|XP_002155514.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Hydra magnipapillata]
          Length = 130

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 67/130 (51%), Positives = 94/130 (72%), Gaps = 4/130 (3%)

Query: 10  MALK-MAEASVAASRKG--RVQKAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAG 65
           MALK  A A+V A + G  + +KAA+TLT SAV R+++L+ E P    +R+ V+ +GC G
Sbjct: 1   MALKSAATATVRAVKPGSFKSRKAAITLTSSAVQRVKELLKEKPSSVGLRIGVRERGCNG 60

Query: 66  QSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKE 125
            SY LEY  EK + DE+VKQD V ++++ K+L  LIG+EMDY ++ L+S+FVFNNPN+K 
Sbjct: 61  LSYTLEYATEKNKFDEVVKQDDVQIMIDSKALMSLIGTEMDYSQNLLASEFVFNNPNIKG 120

Query: 126 NCGCGESFSV 135
            CGCGESF +
Sbjct: 121 TCGCGESFHI 130



>gi|402218918|gb|EJT98993.1| hypothetical protein DACRYDRAFT_56885, partial [Dacryopinax sp.
           DJM-731 SS1]
          Length = 108

 Score =  135 bits (339), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 78/101 (77%)

Query: 35  TPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQDGVTVLVEH 94
           T +A+ RLR L++ P P  +R+ V+ KGCAG SY LEY  + G  DE+V+Q+GV VL++ 
Sbjct: 2   TATAIERLRSLLQSPTPTHLRIGVRQKGCAGMSYHLEYVAKPGSFDEVVEQEGVQVLIDS 61

Query: 95  KSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           K+LF +IGSEMD+ +D LSSKFVF NPN+K+ CGCGESF+V
Sbjct: 62  KALFSIIGSEMDWREDLLSSKFVFKNPNIKDACGCGESFNV 102



>gi|58267804|ref|XP_571058.1| iron ion transport-related protein [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|134112309|ref|XP_775130.1| hypothetical protein CNBE4040 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50257782|gb|EAL20483.1| hypothetical protein CNBE4040 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57227292|gb|AAW43751.1| iron ion transport-related protein, putative [Cryptococcus
           neoformans var. neoformans JEC21]
          Length = 215

 Score =  134 bits (338), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 57/110 (51%), Positives = 88/110 (80%), Gaps = 2/110 (1%)

Query: 28  QKAAMTLTPSAVNRLRQLVEGP-DPKLIRVAVKNKGCAGQSYVLEYTKEKG-QHDEIVKQ 85
           Q+ A+T+TP+A++ LR+L+  P +P+L+R++VK++GCAG +Y L+Y    G + DE+V+Q
Sbjct: 104 QRNAITMTPTAISHLRELLASPTEPRLLRISVKSRGCAGMAYHLDYVPPPGGKFDEVVEQ 163

Query: 86  DGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           DGV VL++ K+LF +IGS MD+  +RLS+ FVF+NPNV + CGCGESF++
Sbjct: 164 DGVRVLIDSKALFSIIGSRMDWRDNRLSAGFVFDNPNVVDTCGCGESFNI 213



>gi|344229891|gb|EGV61776.1| hypothetical protein CANTEDRAFT_115221 [Candida tenuis ATCC 10573]
          Length = 292

 Score =  134 bits (338), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 58/110 (52%), Positives = 84/110 (76%)

Query: 26  RVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQ 85
           + +KA +TL+ +AV  L+ L+E P  K IRV V+N+GC+G +Y LEY  E G+ DE+V+Q
Sbjct: 183 KPRKAIITLSENAVTHLKGLMEKPQGKYIRVGVQNRGCSGLTYNLEYVNEAGKFDELVEQ 242

Query: 86  DGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           +GV V ++ K+LF ++GSEMD+++D+LSS+F+F NPN K  CGCGESF V
Sbjct: 243 NGVKVFIDSKALFSIVGSEMDWLEDKLSSRFIFKNPNSKGTCGCGESFMV 292



>gi|321259375|ref|XP_003194408.1| iron ion transport-related protein [Cryptococcus gattii WM276]
 gi|317460879|gb|ADV22621.1| iron ion transport-related protein, putative [Cryptococcus gattii
           WM276]
          Length = 214

 Score =  134 bits (338), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 57/110 (51%), Positives = 88/110 (80%), Gaps = 2/110 (1%)

Query: 28  QKAAMTLTPSAVNRLRQLVEGP-DPKLIRVAVKNKGCAGQSYVLEYTKEKG-QHDEIVKQ 85
           Q+ A+T+TP+A++ LR+L+  P +P+L+R++VK++GCAG +Y L+Y    G + DE+V+Q
Sbjct: 103 QRNAITMTPTAISHLRELLASPTEPRLLRISVKSRGCAGMAYHLDYVPPPGGKFDEVVEQ 162

Query: 86  DGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           DGV VL++ K+LF +IGS MD+  +RLS+ FVF+NPNV + CGCGESF++
Sbjct: 163 DGVRVLIDSKALFSIIGSRMDWRDNRLSAGFVFDNPNVVDTCGCGESFNI 212



>gi|405120918|gb|AFR95688.1| iron sulfur assembly protein 1 [Cryptococcus neoformans var. grubii
           H99]
          Length = 215

 Score =  134 bits (337), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 56/110 (50%), Positives = 88/110 (80%), Gaps = 2/110 (1%)

Query: 28  QKAAMTLTPSAVNRLRQLVEGP-DPKLIRVAVKNKGCAGQSYVLEYTKEKG-QHDEIVKQ 85
           Q+ A+T+TP+A++ LR+L+  P +P+L+R++VK++GCAG +Y L+Y    G + DE+V+Q
Sbjct: 104 QRNAITMTPTAISHLRELLASPTEPRLLRISVKSRGCAGMAYHLDYVPPPGGKFDEVVEQ 163

Query: 86  DGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           DGV VL++ K+LF +IGS MD+  +RLS+ FVF+NPN+ + CGCGESF++
Sbjct: 164 DGVRVLIDSKALFSIIGSRMDWRDNRLSAGFVFDNPNIIDTCGCGESFNI 213



>gi|500251831|gb|EON95702.1| putative iron sulfur assembly protein 1 protein [Togninia minima
           UCRPA7]
          Length = 181

 Score =  134 bits (336), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 79/98 (80%)

Query: 28  QKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQDG 87
           +KAAM LTPSAV+ LR L++ PDPKLI+V V+N+GC+G +Y LEY  + G  DE V+QDG
Sbjct: 80  RKAAMKLTPSAVDHLRALLDQPDPKLIKVGVRNRGCSGLAYHLEYVDKAGAFDETVEQDG 139

Query: 88  VTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKE 125
           V VL++ K+LF +IGSEMD+V+D+L+ +FVF NPN+ E
Sbjct: 140 VKVLIDSKALFSIIGSEMDWVEDKLNQRFVFRNPNISE 177



>gi|392574162|gb|EIW67299.1| hypothetical protein TREMEDRAFT_72210 [Tremella mesenterica DSM
           1558]
          Length = 208

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 60/112 (53%), Positives = 86/112 (76%), Gaps = 2/112 (1%)

Query: 23  RKGRVQKAAMTLTPSAVNRLRQLVEGP-DPKLIRVAVKNKGCAGQSYVLEY-TKEKGQHD 80
           R  + +K A+T+TP+A+ RLR L+  P DPKL+R+ VK++GCAG +Y LEY +   G+ D
Sbjct: 95  RDFKAKKNAITMTPAALTRLRNLLASPSDPKLLRIGVKSRGCAGMAYHLEYVSPPGGRFD 154

Query: 81  EIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGES 132
           E+V+QDGV VL++ K+LF +IGS MD+  +RLS+ F+F+NPNV + CGCGES
Sbjct: 155 EVVEQDGVKVLIDSKALFSIIGSRMDWRDNRLSAGFMFDNPNVVDTCGCGES 206



>gi|401882612|gb|EJT46864.1| iron ion transport-related protein [Trichosporon asahii var. asahii
           CBS 2479]
 gi|406700639|gb|EKD03804.1| iron ion transport-related protein [Trichosporon asahii var. asahii
           CBS 8904]
          Length = 199

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 58/110 (52%), Positives = 83/110 (75%), Gaps = 2/110 (1%)

Query: 28  QKAAMTLTPSAVNRLRQLVEGP-DPKLIRVAVKNKGCAGQSYVLEYTKEKG-QHDEIVKQ 85
           +KAA+T+TP A+ RLR L   P +PKL+R+ VK +GCAG +Y L+Y    G + DE+V+Q
Sbjct: 88  KKAALTMTPEAIERLRALQANPTEPKLLRIGVKTRGCAGMAYHLDYVDPPGGKFDEVVEQ 147

Query: 86  DGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           DGV VL++ K+LF +IGS MD+   +LS+ FVF+NPN+ + CGCGESF++
Sbjct: 148 DGVRVLIDSKALFSIIGSRMDWRDTKLSAGFVFDNPNIVDTCGCGESFNI 197



>gi|170033040|ref|XP_001844387.1| conserved hypothetical protein [Culex quinquefasciatus]
 gi|167873501|gb|EDS36884.1| conserved hypothetical protein [Culex quinquefasciatus]
          Length = 130

 Score =  132 bits (333), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 93/125 (74%), Gaps = 3/125 (2%)

Query: 14  MAEASVAA--SRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKL-IRVAVKNKGCAGQSYVL 70
           +A A+V A  +RK    +AA+TLTP+AVNR++QL++G    + ++V V+ +GC G SY L
Sbjct: 6   VATATVRALKNRKLLPTRAALTLTPAAVNRIKQLLQGKSEYIGLKVGVRQRGCNGLSYTL 65

Query: 71  EYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCG 130
           +Y   K + DE V QDGV VL++ K+   L+G+EMD+V+++LS++FVFNNPN+K  CGCG
Sbjct: 66  DYATTKDKMDEEVVQDGVKVLIDKKAQLSLLGTEMDFVENKLSAEFVFNNPNIKGTCGCG 125

Query: 131 ESFSV 135
           ESFS+
Sbjct: 126 ESFSI 130



>gi|307207446|gb|EFN85161.1| Iron-sulfur cluster assembly 1-like protein, mitochondrial
           [Harpegnathos saltator]
          Length = 130

 Score =  132 bits (332), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 62/125 (49%), Positives = 91/125 (72%), Gaps = 3/125 (2%)

Query: 14  MAEASVAA--SRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKL-IRVAVKNKGCAGQSYVL 70
           +A A++ A   RK    +AA+TLTPSAVN+++++++     + ++V V+ +GC G SY L
Sbjct: 6   IASATIRAVKGRKILATRAALTLTPSAVNKIKEILKDKSEYIALKVGVRQRGCNGLSYTL 65

Query: 71  EYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCG 130
           +Y KEK + DE V QD V + ++ K+   L+G+EMDYV+D+LSS+FVFNNPN+K  CGCG
Sbjct: 66  DYAKEKSKLDEEVVQDDVRIFIDRKAQLSLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCG 125

Query: 131 ESFSV 135
           ESFSV
Sbjct: 126 ESFSV 130



>gi|403158251|ref|XP_003307566.2| hypothetical protein PGTG_00516 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|375163740|gb|EFP74560.2| hypothetical protein PGTG_00516 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 302

 Score =  131 bits (330), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 85/120 (70%), Gaps = 5/120 (4%)

Query: 21  ASRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHD 80
            +R  +  K  + LTP A+  L  L++GP+PKLIR+ VKNKGCAG +Y L+Y  + G+ D
Sbjct: 183 TTRTSKPAKQVINLTPRAIGHLSTLLDGPNPKLIRIGVKNKGCAGMAYNLDYVDQPGKFD 242

Query: 81  EIV---KQDG--VTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           E+V    ++G  + VL++ ++LF +IGS MD+ + +L +KFVF+NPN+KE CGCGESF V
Sbjct: 243 EVVVTKNEEGKEIKVLIDSRALFSIIGSTMDWQESKLGNKFVFDNPNIKEECGCGESFLV 302



>gi|308454527|ref|XP_003089882.1| hypothetical protein CRE_21045 [Caenorhabditis remanei]
 gi|308267972|gb|EFP11925.1| hypothetical protein CRE_21045 [Caenorhabditis remanei]
          Length = 129

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 61/118 (51%), Positives = 84/118 (71%), Gaps = 1/118 (0%)

Query: 19  VAASRKGRVQKAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQSYVLEYTKEKG 77
           V  + K R  +AA+TLT  AVNR+R L+ +  D   +++ V+ KGC G +Y LEY +E+ 
Sbjct: 12  VKGALKLRQTRAALTLTNDAVNRIRVLLAQQNDANALKIGVRQKGCNGLTYTLEYARERQ 71

Query: 78  QHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           + DE V+QDG+ V +E K+   L+GSEMDYV D+LSS+FVF NPN+K  CGCGESFS+
Sbjct: 72  KFDEEVEQDGIKVWIEPKAQLSLLGSEMDYVTDKLSSEFVFRNPNIKGTCGCGESFSI 129



>gi|354494623|ref|XP_003509436.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Cricetulus griseus]
          Length = 110

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 81/103 (78%), Gaps = 1/103 (0%)

Query: 34  LTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQDGVTVLV 92
           LTPSAVN+++QL+ + P+   ++V V+ +GC G SY LEYTK KG  DE V QDG++V +
Sbjct: 8   LTPSAVNKIKQLLKDKPEHVGLKVGVRTRGCNGLSYTLEYTKTKGDSDEEVIQDGMSVFI 67

Query: 93  EHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           E K+   L+G+EMDYV+D+LSS+FVFNNPN+K  CGCGESF++
Sbjct: 68  ERKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI 110



>gi|31206473|ref|XP_312196.1| AGAP002730-PA [Anopheles gambiae str. PEST]
 gi|21295988|gb|EAA08133.1| AGAP002730-PA [Anopheles gambiae str. PEST]
          Length = 130

 Score =  131 bits (329), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 91/125 (72%), Gaps = 3/125 (2%)

Query: 14  MAEASVAA--SRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKL-IRVAVKNKGCAGQSYVL 70
           +A A+V A   RK    +AA++LTP+AVNR++QL+EG +  + ++V V+ +GC G SY L
Sbjct: 6   VATATVRAVKHRKLLPMRAALSLTPAAVNRIKQLLEGKNEFIGLKVGVRQRGCNGLSYTL 65

Query: 71  EYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCG 130
           +Y   K + DE V QDGV VL++ K+   L+G+EMDYV+  LS++FVFNNPN+K  CGCG
Sbjct: 66  DYAATKDKMDEEVVQDGVKVLIDKKAQLSLLGTEMDYVETDLSAEFVFNNPNIKGTCGCG 125

Query: 131 ESFSV 135
           ESFS+
Sbjct: 126 ESFSI 130



>gi|444320143|ref|XP_004180728.1| hypothetical protein TBLA_0E01520 [Tetrapisispora blattae CBS 6284]
 gi|387513771|emb|CCH61209.1| hypothetical protein TBLA_0E01520 [Tetrapisispora blattae CBS 6284]
          Length = 321

 Score =  131 bits (329), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 50/114 (43%), Positives = 86/114 (75%)

Query: 22  SRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDE 81
           +R  + +KA ++L+P A++ L+ L++ P PKLIR+  +N+GC+G +Y L+Y  +  + DE
Sbjct: 208 NRTLKPRKALISLSPKAISHLKTLLDQPTPKLIRIGTRNRGCSGLTYDLKYIDKPDKFDE 267

Query: 82  IVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           +++Q+G+ ++++ K+LF ++GSEMD++ D+L S+FVF NPN K  CGCGESF +
Sbjct: 268 VIEQNGIKIVIDSKALFSVVGSEMDWIDDKLQSRFVFKNPNSKGTCGCGESFMI 321



>gi|341895461|gb|EGT51396.1| hypothetical protein CAEBREN_11160 [Caenorhabditis brenneri]
          Length = 129

 Score =  130 bits (328), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 60/118 (50%), Positives = 84/118 (71%), Gaps = 1/118 (0%)

Query: 19  VAASRKGRVQKAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQSYVLEYTKEKG 77
           V  + K R  +AA+TLT  AVNR+R L+ +  D   +++ V+ KGC G +Y LEY +E+ 
Sbjct: 12  VKGALKARQTRAALTLTNEAVNRIRVLLAQQSDANALKIGVRQKGCNGLTYTLEYAQERQ 71

Query: 78  QHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           + DE V+QDG+ V +E K+   L+GSEMDYV ++LSS+FVF NPN+K  CGCGESFS+
Sbjct: 72  KFDEEVEQDGIKVWIEPKAQLSLLGSEMDYVTNKLSSEFVFRNPNIKGTCGCGESFSI 129



>gi|401885145|gb|EJT49272.1| cytochrome P450 [Trichosporon asahii var. asahii CBS 2479]
          Length = 1336

 Score =  130 bits (328), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 79/107 (73%), Gaps = 1/107 (0%)

Query: 28   QKAAMTLTPSAVNRLRQLVEGP-DPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQD 86
            +KA +T+TP A+ RL  L   P +PK +R+ VK +GCAG +Y L+Y  + G+ DE+V+QD
Sbjct: 1222 KKAPLTMTPEAIKRLEALQANPAEPKFLRIGVKTRGCAGMAYHLDYVPQPGKFDEVVEQD 1281

Query: 87   GVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESF 133
            GV VLV+ K+LF +IGS MD+   +LS+ FVF+NPN+ + CGCGESF
Sbjct: 1282 GVRVLVDSKALFSIIGSRMDWRDTKLSAGFVFDNPNIVDTCGCGESF 1328



>gi|390476616|ref|XP_003735152.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Callithrix jacchus]
          Length = 165

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 65/134 (48%), Positives = 90/134 (67%), Gaps = 1/134 (0%)

Query: 3   AATAIRSMALKMAEASVAASRKGRVQKAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNK 61
           A TA  S +L  A     + RK +  +A +TLTP+AVN+++QL+ + P+   ++  V+ +
Sbjct: 32  AGTAKMSASLVPATVPAVSKRKLQPTRATLTLTPAAVNKIKQLLKDKPEHVGVKGGVRTR 91

Query: 62  GCAGQSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNP 121
           GC G SY  EYTK KG  +E V QDGV V +E K+   L+G EMDYV+D+LSS+FVFNNP
Sbjct: 92  GCNGLSYTPEYTKTKGDSEEEVIQDGVRVFIEKKAQLTLLGIEMDYVEDKLSSEFVFNNP 151

Query: 122 NVKENCGCGESFSV 135
           N+K  CGCG SF +
Sbjct: 152 NIKGTCGCGGSFHI 165



>gi|395750821|ref|XP_003779160.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like, partial [Pongo abelii]
          Length = 153

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 67/135 (49%), Positives = 95/135 (70%), Gaps = 5/135 (3%)

Query: 2   TAATAIRSMALKMAEASVAASRKGRVQKAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKN 60
           +A TA  S +L  A     ++RK +   AA+TLTPSAVN+++QL+ + P+   ++V V+ 
Sbjct: 23  SARTAKMSASLVRATVWAVSNRKLQPTWAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRA 82

Query: 61  KGCAGQSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNN 120
           +GC G SY LEYTK KG  DE++ QDGV V +E K+   L+G EMDYV+++LSS+ VFNN
Sbjct: 83  RGCNGLSYTLEYTKTKGDSDEVI-QDGVRVFIEKKAQLTLLGKEMDYVEEKLSSELVFNN 141

Query: 121 PNVKENCGCGESFSV 135
           PN+K   GCGESF++
Sbjct: 142 PNIK---GCGESFNI 153



>gi|512907435|ref|XP_004926440.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Bombyx mori]
          Length = 131

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 62/127 (48%), Positives = 95/127 (74%), Gaps = 6/127 (4%)

Query: 14  MAEASVAASRKGRV--QKAAMTLTPSAVNRLRQLVEGPDPKL---IRVAVKNKGCAGQSY 68
           +A A+V A +K R+   +AA+ LTPSAV +++++++  + K    ++V V+ +GC G SY
Sbjct: 6   IASATVRAVKK-RILPSRAALVLTPSAVKKVKEIMQKEEAKGYVGLKVGVRQRGCNGLSY 64

Query: 69  VLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCG 128
            L+Y K K + DE VKQDGVT++++ K+   L+G+EMDYV+D+LS++FVFNNPN+K  CG
Sbjct: 65  TLDYAKTKEKLDEEVKQDGVTIIIDKKAQLTLLGTEMDYVEDKLSAEFVFNNPNIKGTCG 124

Query: 129 CGESFSV 135
           CGESFS+
Sbjct: 125 CGESFSI 131



>gi|338719520|ref|XP_003364017.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Equus caballus]
          Length = 140

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 59/102 (57%), Positives = 79/102 (77%), Gaps = 1/102 (0%)

Query: 35  TPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQDGVTVLVE 93
           TPSAVN+++QL+ + P+   ++V V+ +GC G SY LEYTK KG  DE V QDGV V +E
Sbjct: 39  TPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVVQDGVRVFIE 98

Query: 94  HKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
            K+   L+G+EMDYV+D+LSS+FVFNNPN+K  CGCGESF++
Sbjct: 99  KKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI 140



>gi|91091584|ref|XP_968263.1| PREDICTED: similar to conserved hypothetical protein [Tribolium
           castaneum]
 gi|270001035|gb|EEZ97482.1| hypothetical protein TcasGA2_TC011316 [Tribolium castaneum]
          Length = 129

 Score =  130 bits (327), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 92/124 (74%), Gaps = 2/124 (1%)

Query: 14  MAEASVAASRKGRV-QKAAMTLTPSAVNRLRQLVEGPDPKL-IRVAVKNKGCAGQSYVLE 71
           +A A+V A RK     +AA+ LTP+AVNR++++++G D  + +++ VK +GC G SY L+
Sbjct: 6   VATATVRAVRKKLAPTRAALVLTPAAVNRVKEILKGQDNYVGLKIGVKQRGCNGLSYTLD 65

Query: 72  YTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGE 131
           Y  +K + DE V QDGV + ++ K+   L+G+EMDYV+++LSS+FVFNNPN+K  CGCGE
Sbjct: 66  YVDKKDKMDEEVVQDGVRIFIDKKAQLTLLGTEMDYVQNKLSSEFVFNNPNIKGTCGCGE 125

Query: 132 SFSV 135
           SF++
Sbjct: 126 SFNI 129



>gi|311274080|ref|XP_003134180.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Sus scrofa]
          Length = 153

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 64/126 (50%), Positives = 88/126 (69%), Gaps = 2/126 (1%)

Query: 11  ALKMAEASVAASRKGRVQKAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQSYV 69
           +L  A     + RK +   AA+T+TPSA N ++QL+ + P+   ++V V+ +GC G SY 
Sbjct: 4   SLVWATVQSVSKRKLQPTWAALTMTPSA-NEIKQLLRDKPELVGVKVGVRTRGCNGLSYT 62

Query: 70  LEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGC 129
           LEYTK KG  DE V QDGV V +E K+   L+G+EMDYV+D+LSS+FVFNNPN+K   GC
Sbjct: 63  LEYTKTKGDSDEEVVQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNLKGTWGC 122

Query: 130 GESFSV 135
           GESF++
Sbjct: 123 GESFNI 128



>gi|350414906|ref|XP_003490464.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Bombus impatiens]
          Length = 130

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 61/114 (53%), Positives = 86/114 (75%), Gaps = 1/114 (0%)

Query: 23  RKGRVQKAAMTLTPSAVNRLRQLVEGPDPKL-IRVAVKNKGCAGQSYVLEYTKEKGQHDE 81
           RK    +AA+TLT SAV ++++L++  D  + +RV+VK +GC G SY L+Y KEK + DE
Sbjct: 17  RKILATRAALTLTSSAVKKIKELLKDKDEFIGLRVSVKQRGCNGLSYTLDYAKEKCKLDE 76

Query: 82  IVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
            V QDGV ++++ K+   L+G+EMDYV+ +LSS+FVFNNPN+K  CGCGESFSV
Sbjct: 77  EVVQDGVRIMIDKKAQLSLLGTEMDYVETKLSSEFVFNNPNIKGTCGCGESFSV 130



>gi|157134795|ref|XP_001656446.1| hypothetical protein AaeL_AAEL000418 [Aedes aegypti]
 gi|108884323|gb|EAT48548.1| AAEL000418-PA [Aedes aegypti]
          Length = 129

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 63/124 (50%), Positives = 90/124 (72%), Gaps = 2/124 (1%)

Query: 14  MAEASV-AASRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKL-IRVAVKNKGCAGQSYVLE 71
           +A A+V A  RK    +AA++LTPSAV R++QL++G    + ++V V+ +GC G SY L+
Sbjct: 6   VATATVRAVKRKLLPTRAALSLTPSAVARVKQLLDGKSEYIGLKVGVRQRGCNGLSYTLD 65

Query: 72  YTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGE 131
           Y   K + DE V QDGV VL++ K+   L+G+EMDYV+ +LS++FVFNNPN+K  CGCGE
Sbjct: 66  YATTKDKLDEEVVQDGVKVLIDKKAQLSLLGTEMDYVETKLSAEFVFNNPNIKGTCGCGE 125

Query: 132 SFSV 135
           SFS+
Sbjct: 126 SFSI 129



>gi|321454597|gb|EFX65762.1| hypothetical protein DAPPUDRAFT_303520 [Daphnia pulex]
          Length = 130

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 64/124 (51%), Positives = 91/124 (73%), Gaps = 3/124 (2%)

Query: 15  AEASVAA--SRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKL-IRVAVKNKGCAGQSYVLE 71
           A A+V A  +RK    +AA+ LTPSAVN++++L EG +  + +++ VK +GC G SY L+
Sbjct: 7   ASATVRAVKARKPFPTRAALVLTPSAVNQVKKLFEGQNDYIGLKIGVKQRGCNGFSYTLD 66

Query: 72  YTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGE 131
           +  +K + DE V QDGV +LV+ K+   L+G+EMDYV++ LSS+FVFNNPN+K  CGCGE
Sbjct: 67  FASKKEKFDEEVLQDGVRILVDMKAQLHLLGTEMDYVENELSSEFVFNNPNIKGTCGCGE 126

Query: 132 SFSV 135
           SFSV
Sbjct: 127 SFSV 130



>gi|322692279|gb|EFY84208.1| iron sulfur assembly protein 1 [Metarhizium acridum CQMa 102]
          Length = 217

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 80/100 (80%)

Query: 24  KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIV 83
           K R +KAAM LTP+AV +LR +++ P+PKLI+V V+N+GC+G +Y LEY  + G  DE+V
Sbjct: 114 KLRPRKAAMKLTPAAVEQLRSMLDQPEPKLIKVGVRNRGCSGLAYHLEYVDKPGTFDEMV 173

Query: 84  KQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNV 123
           +QDGV VL++ K+LF +IG+EMD+ +D+L+ +FVF NPN+
Sbjct: 174 EQDGVKVLIDSKALFSIIGTEMDWAEDKLNQRFVFKNPNI 213



>gi|494827648|gb|EON64573.1| hypothetical protein W97_03806 [Coniosporium apollinis CBS 100218]
          Length = 252

 Score =  129 bits (325), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 81/100 (81%)

Query: 24  KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIV 83
           K R +KAAMTL+ +AV +L+ L++ P+PKLIRV VKN+GC+G +Y LEY  + G  DE V
Sbjct: 146 KLRPRKAAMTLSSAAVEQLKGLLDQPEPKLIRVGVKNRGCSGLAYHLEYVDKPGAFDEAV 205

Query: 84  KQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNV 123
           +QDGV VLV+ K+LF +IGSEMD+++D+LS++FVF NPN+
Sbjct: 206 EQDGVKVLVDSKALFSIIGSEMDWMEDKLSARFVFKNPNI 245



>gi|195133108|ref|XP_002010981.1| GI16259 [Drosophila mojavensis]
 gi|193906956|gb|EDW05823.1| GI16259 [Drosophila mojavensis]
          Length = 130

 Score =  129 bits (324), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 62/130 (47%), Positives = 90/130 (69%), Gaps = 4/130 (3%)

Query: 10  MALKMAEASVAASRKGR---VQKAAMTLTPSAVNRLRQLVEG-PDPKLIRVAVKNKGCAG 65
           MA ++   +   + KGR     +AA+TLTP+AVNR++ L++  PD   ++V V+ +GC G
Sbjct: 1   MATRVVATATVRAVKGRKLIPTRAALTLTPAAVNRIKSLLQNKPDVIGLKVGVRQRGCNG 60

Query: 66  QSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKE 125
            SY L+Y   K + DE V QDGV V ++ K+   L+G+EMD+V+ +LSS+FVFNNPN+K 
Sbjct: 61  LSYTLDYASTKDKLDEEVVQDGVKVFIDKKAQLSLLGTEMDFVESKLSSEFVFNNPNIKG 120

Query: 126 NCGCGESFSV 135
            CGCGESFS+
Sbjct: 121 TCGCGESFSM 130



>gi|498968811|ref|XP_004546998.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Maylandia zebra]
          Length = 129

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 93/129 (72%), Gaps = 3/129 (2%)

Query: 10  MALKMAEASVAASRKGRV--QKAAMTLTPSAVNRLRQLVEG-PDPKLIRVAVKNKGCAGQ 66
           M+  +  A+V A  K ++   KAA+TLTP+AV+++R L++  P+   ++V V+ +GC G 
Sbjct: 1   MSASVVRATVRAVSKRKILATKAALTLTPAAVSKIRLLLQDRPEYIGLKVGVRTRGCNGL 60

Query: 67  SYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKEN 126
           +Y L+YTKEK + DE V QDGV V +  K+   L+G+EMD+V+ +LSS+FVFNNPN+K  
Sbjct: 61  TYTLDYTKEKEKSDEEVVQDGVRVFIAKKAQLTLLGTEMDFVESKLSSEFVFNNPNIKGT 120

Query: 127 CGCGESFSV 135
           CGCGESF++
Sbjct: 121 CGCGESFNI 129



>gi|195164087|ref|XP_002022880.1| GL16489 [Drosophila persimilis]
 gi|198471618|ref|XP_001355683.2| GA20890 [Drosophila pseudoobscura pseudoobscura]
 gi|194104942|gb|EDW26985.1| GL16489 [Drosophila persimilis]
 gi|198145998|gb|EAL32742.2| GA20890 [Drosophila pseudoobscura pseudoobscura]
          Length = 130

 Score =  129 bits (324), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 62/130 (47%), Positives = 90/130 (69%), Gaps = 4/130 (3%)

Query: 10  MALKMAEASVAASRKGR---VQKAAMTLTPSAVNRLRQLVEG-PDPKLIRVAVKNKGCAG 65
           MA ++   +   + KGR     +AA+TLTP+AVNR++ L++  PD   ++V V+ +GC G
Sbjct: 1   MATRVVATATVRALKGRKLLPTRAALTLTPAAVNRIKTLLQDKPDFIGLKVGVRQRGCNG 60

Query: 66  QSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKE 125
            SY L+Y   K + DE V QDGV V ++ K+   L+G+EMD+V+ +LSS+FVFNNPN+K 
Sbjct: 61  LSYTLDYASSKDKLDEEVVQDGVKVFIDKKAQLSLLGTEMDFVESKLSSEFVFNNPNIKG 120

Query: 126 NCGCGESFSV 135
            CGCGESFS+
Sbjct: 121 TCGCGESFSM 130



>gi|25146411|ref|NP_741696.1| Protein Y39B6A.3, isoform a [Caenorhabditis elegans]
 gi|15209351|emb|CAC51075.1| Protein Y39B6A.3, isoform a [Caenorhabditis elegans]
          Length = 129

 Score =  129 bits (323), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 60/118 (50%), Positives = 84/118 (71%), Gaps = 1/118 (0%)

Query: 19  VAASRKGRVQKAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQSYVLEYTKEKG 77
           +  + K R  +AA+TLT  AV+R+R L+ +  D   +++ V+ KGC G +Y LEY K+K 
Sbjct: 12  IKGALKVRQTRAALTLTNEAVSRIRVLLAQQNDANALKIGVRQKGCNGLTYTLEYAKDKQ 71

Query: 78  QHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           + DE V+QDG+ V +E K+   L+GSEMDYV D+LSS+FVF NPN+K  CGCGESFS+
Sbjct: 72  KFDEEVEQDGIKVWIEPKAQLSLLGSEMDYVTDKLSSEFVFRNPNIKGTCGCGESFSI 129



>gi|121707787|ref|XP_001271941.1| conserved membrane protein, putative [Aspergillus clavatus NRRL 1]
 gi|119400089|gb|EAW10515.1| conserved membrane protein, putative [Aspergillus clavatus NRRL 1]
          Length = 558

 Score =  129 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 60/113 (53%), Positives = 84/113 (74%)

Query: 11  ALKMAEASVAASRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVL 70
           +L  ++++    RK R +KAAM LTP AV +L +L+  PDPK IRV VKN+GC+G +Y L
Sbjct: 121 SLTGSKSAEKPRRKLRARKAAMKLTPIAVEQLHKLLSQPDPKFIRVGVKNRGCSGLAYHL 180

Query: 71  EYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNV 123
           EY  + G  DE+V+QDGV VL++ K+LF +IGSEMD+ +D+LS KF+F NPN+
Sbjct: 181 EYVDKPGAFDEVVEQDGVKVLIDSKALFSIIGSEMDWQEDKLSRKFIFRNPNI 233



>gi|315043036|ref|XP_003170894.1| hypothetical protein MGYG_06884 [Arthroderma gypseum CBS 118893]
 gi|311344683|gb|EFR03886.1| hypothetical protein MGYG_06884 [Arthroderma gypseum CBS 118893]
          Length = 625

 Score =  129 bits (323), Expect = 3e-28,   Method: Composition-based stats.
 Identities = 60/106 (56%), Positives = 86/106 (81%), Gaps = 2/106 (1%)

Query: 20  AASRKGRVQ--KAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKG 77
           A  RK R++  KAA++LTP+A+++LR+L+  PDPKLIR+ VKN+GC+G SY LEY ++  
Sbjct: 134 AKPRKSRLRARKAAVSLTPTALSKLRELLSQPDPKLIRIGVKNRGCSGLSYHLEYVEKPA 193

Query: 78  QHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNV 123
             DE+V+QDGV VL++ K+LF +IGSEMD+ +D LSS+FVF+NPN+
Sbjct: 194 PFDEVVEQDGVKVLIDSKALFSIIGSEMDWHEDPLSSRFVFSNPNI 239



>gi|213408130|ref|XP_002174836.1| iron sulfur assembly protein [Schizosaccharomyces japonicus yFS275]
 gi|212002883|gb|EEB08543.1| iron sulfur assembly protein [Schizosaccharomyces japonicus yFS275]
          Length = 194

 Score =  129 bits (323), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 59/114 (51%), Positives = 83/114 (72%), Gaps = 1/114 (0%)

Query: 20  AASRKGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQH 79
           +A R    +K  +++TP AV++L++L+   D KL+R+ VK KGCAGQSY  EY  +  + 
Sbjct: 77  SARRFNFPRKNVISITPVAVDKLKELLLSQD-KLLRIGVKQKGCAGQSYSFEYVDQPDKF 135

Query: 80  DEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESF 133
           DEIV+QDGV V+V+ ++L ++IGS MD+  D L S+FVF+NPNVK  CGCGESF
Sbjct: 136 DEIVEQDGVRVIVQRRALLQIIGSSMDFKDDDLQSRFVFSNPNVKSTCGCGESF 189



>gi|406694583|gb|EKC97907.1| cytochrome P450 [Trichosporon asahii var. asahii CBS 8904]
          Length = 1469

 Score =  128 bits (322), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 56/108 (51%), Positives = 79/108 (73%), Gaps = 1/108 (0%)

Query: 28   QKAAMTLTPSAVNRLRQLVEGP-DPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQD 86
            +KA +T+TP A+ RL  L   P +PK +R+ VK +GCAG +Y L+Y  + G+ DE+V+QD
Sbjct: 1247 KKAPLTMTPEAIKRLEALQANPAEPKFLRIGVKTRGCAGMAYHLDYVPQPGKFDEVVEQD 1306

Query: 87   GVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFS 134
            GV VLV+ K+LF +IGS MD+   +LS+ FVF+NPN+ + CGCGES S
Sbjct: 1307 GVRVLVDSKALFSIIGSRMDWRDTKLSAGFVFDNPNIVDTCGCGESCS 1354



>gi|322709855|gb|EFZ01430.1| iron sulfur assembly protein 1 [Metarhizium anisopliae ARSEF 23]
          Length = 282

 Score =  128 bits (321), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 80/100 (80%)

Query: 24  KGRVQKAAMTLTPSAVNRLRQLVEGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIV 83
           K R +KAAM LTP+AV +LR +++ P+PK+I+V V+N+GC+G +Y LEY  + G  DE+V
Sbjct: 175 KLRPRKAAMKLTPAAVEQLRSMLDQPEPKIIKVGVRNRGCSGLAYHLEYVDKPGTFDEMV 234

Query: 84  KQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNV 123
           +QDGV VL++ K+LF +IG+EMD+ +D+L+ +FVF NPN+
Sbjct: 235 EQDGVKVLIDSKALFSIIGTEMDWAEDKLNQRFVFKNPNI 274



>gi|193209025|ref|NP_001123038.1| Protein Y39B6A.3, isoform b [Caenorhabditis elegans]
 gi|148473207|emb|CAN86925.1| Protein Y39B6A.3, isoform b [Caenorhabditis elegans]
          Length = 131

 Score =  127 bits (320), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 58/108 (53%), Positives = 80/108 (74%), Gaps = 1/108 (0%)

Query: 29  KAAMTLTPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQDG 87
           +AA+TLT  AV+R+R L+ +  D   +++ V+ KGC G +Y LEY K+K + DE V+QDG
Sbjct: 24  RAALTLTNEAVSRIRVLLAQQNDANALKIGVRQKGCNGLTYTLEYAKDKQKFDEEVEQDG 83

Query: 88  VTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
           + V +E K+   L+GSEMDYV D+LSS+FVF NPN+K  CGCGESFS+
Sbjct: 84  IKVWIEPKAQLSLLGSEMDYVTDKLSSEFVFRNPNIKGTCGCGESFSI 131



>gi|340720545|ref|XP_003398695.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Bombus terrestris]
 gi|340720547|ref|XP_003398696.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Bombus terrestris]
          Length = 130

 Score =  127 bits (320), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 60/114 (52%), Positives = 86/114 (75%), Gaps = 1/114 (0%)

Query: 23  RKGRVQKAAMTLTPSAVNRLRQLVEGPDPKL-IRVAVKNKGCAGQSYVLEYTKEKGQHDE 81
           RK    +AA+TLT SAV ++++L++  +  + +RV+VK +GC G SY L+Y KEK + DE
Sbjct: 17  RKILATRAALTLTSSAVKKIKELLKDKNEFIGLRVSVKQRGCNGLSYTLDYAKEKCKLDE 76

Query: 82  IVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
            V QDGV ++++ K+   L+G+EMDYV+ +LSS+FVFNNPN+K  CGCGESFSV
Sbjct: 77  EVVQDGVRIMIDKKAQLSLLGTEMDYVETKLSSEFVFNNPNIKGTCGCGESFSV 130



>gi|47226594|emb|CAG08610.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 177

 Score =  127 bits (320), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 65/133 (48%), Positives = 94/133 (70%), Gaps = 8/133 (6%)

Query: 11  ALKMAEASVA------ASRKGRV-QKAAMTLTPSAVNRLRQLVEG-PDPKLIRVAVKNKG 62
           ALK+++ S++      A+ K  V  +AA+TLTPSAV R+R L+E  P+   ++V VK +G
Sbjct: 45  ALKLSDDSLSFSVVRSATEKNTVPSRAALTLTPSAVKRIRLLLEDKPEYTGLKVGVKTRG 104

Query: 63  CAGQSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPN 122
           C G +Y L+YTKEK + DE V QDGV V ++ K+   L+G+EMD+V+ +L+S+F+FNNPN
Sbjct: 105 CNGLTYTLDYTKEKHKSDEEVLQDGVRVFIDRKAQLTLLGTEMDFVETKLTSEFIFNNPN 164

Query: 123 VKENCGCGESFSV 135
           +K  CGC ESF V
Sbjct: 165 IKGVCGCRESFYV 177



>gi|290561206|gb|ADD38005.1| Iron-sulfur cluster assembly 1 homolog, mitochondrial
           [Lepeophtheirus salmonis]
          Length = 135

 Score =  127 bits (320), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 63/138 (45%), Positives = 95/138 (68%), Gaps = 7/138 (5%)

Query: 1   MTAATAIRSMALKMAEASVAASRKGRV--QKAAMTLTPSAVNRLRQLVEGPDPKL-IRVA 57
           +++A  IR+ A     A+V + +K  +   +AA+ +TPSAV R+++LVE     + +R+ 
Sbjct: 2   LSSAHFIRTAA----SATVRSVKKRPIIPSRAALVMTPSAVRRIKELVEERHECIGLRIG 57

Query: 58  VKNKGCAGQSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFV 117
           VK +GC G SYVL+Y  +K +HDE V QDGV + ++ K+   ++G+EMDYV   LS++FV
Sbjct: 58  VKQRGCNGMSYVLDYAIQKEKHDEEVIQDGVKIFIDKKAQLSILGTEMDYVDSNLSAEFV 117

Query: 118 FNNPNVKENCGCGESFSV 135
           FNNPN+K  CGCGESFS+
Sbjct: 118 FNNPNIKGTCGCGESFSI 135



>gi|344271172|ref|XP_003407415.1| PREDICTED: iron-sulfur cluster assembly 1 homolog,
           mitochondrial-like [Loxodonta africana]
          Length = 122

 Score =  127 bits (320), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 59/102 (57%), Positives = 78/102 (76%), Gaps = 1/102 (0%)

Query: 35  TPSAVNRLRQLV-EGPDPKLIRVAVKNKGCAGQSYVLEYTKEKGQHDEIVKQDGVTVLVE 93
           TPSAV +++QL+ + P+   ++V V+ +GC G SY LEYTK KG  DE V QDGV V +E
Sbjct: 21  TPSAVQKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTKGDSDEEVVQDGVRVFIE 80

Query: 94  HKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENCGCGESFSV 135
            K+   L+G+EMDYV+D+LSS+FVFNNPN+K  CGCGESF+V
Sbjct: 81  KKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNV 122



>gi|260788975|ref|XP_002589524.1| hypothetical protein BRAFLDRAFT_125211 [Branchiostoma floridae]
 gi|229274702|gb|EEN45535.1| hypothetical protein BRAFLDRAFT_125211 [Branchiostoma floridae]
          Length = 128

 Score =  127 bits (320), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 60/128 (46%), Positives = 92/128 (71%), Gaps = 2/128 (1%)

Query: 10  MALKMAEASVAASRKGRV-QKAAMTLTPSAVNRLRQLVEG-PDPKLIRVAVKNKGCAGQS 67
           MA  ++    AA+R+  + Q+ A+ LT +AV ++R +++  PD   ++V V+ +GC G S
Sbjct: 1   MAGPLSATVRAATRRRLIPQRVALVLTQAAVKKVRTIMDSRPDMIGLKVGVRTRGCNGLS 60

Query: 68  YVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKENC 127
           Y +EY KEK + DE+V QDGVTVL++ K+   L+G+EMDY + +L+S+FVF+NPN+K  C
Sbjct: 61  YTIEYAKEKNKQDEVVVQDGVTVLIDKKAQLTLLGTEMDYQESKLASEFVFHNPNIKGTC 120

Query: 128 GCGESFSV 135
           GCGESFS+
Sbjct: 121 GCGESFSL 128



>gi|194768925|ref|XP_001966561.1| GF21925 [Drosophila ananassae]
 gi|190617325|gb|EDV32849.1| GF21925 [Drosophila ananassae]
          Length = 130

 Score =  127 bits (319), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 61/130 (46%), Positives = 90/130 (69%), Gaps = 4/130 (3%)

Query: 10  MALKMAEASVAASRKGR---VQKAAMTLTPSAVNRLRQLVEG-PDPKLIRVAVKNKGCAG 65
           MA ++   +   + KGR     +AA+TLTP+AV R++ L++  PD   ++V V+ +GC G
Sbjct: 1   MATRVVATATVRAVKGRKLIPTRAALTLTPAAVQRIKTLLQDKPDMVGLKVGVRQRGCNG 60

Query: 66  QSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKE 125
            SY L+Y  +K + DE V QDGV V ++ K+   L+G+EMD+V+ +LSS+FVFNNPN+K 
Sbjct: 61  LSYTLDYASQKDKLDEEVVQDGVKVFIDKKAQLSLLGTEMDFVESKLSSEFVFNNPNIKG 120

Query: 126 NCGCGESFSV 135
            CGCGESFS+
Sbjct: 121 TCGCGESFSM 130



>gi|322795676|gb|EFZ18355.1| hypothetical protein SINV_04847 [Solenopsis invicta]
          Length = 130

 Score =  127 bits (318), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 61/130 (46%), Positives = 91/130 (70%), Gaps = 8/130 (6%)

Query: 14  MAEASVAASR----KGR---VQKAAMTLTPSAVNRLRQLVEGPDPKL-IRVAVKNKGCAG 65
           MA  +VAA+     KGR     +AA+TLTP AV +++++++     + ++V V+ +GC G
Sbjct: 1   MASTTVAAATIRAVKGRKILSTRAALTLTPIAVKKIKEILKDKSEYIGLKVGVRQRGCNG 60

Query: 66  QSYVLEYTKEKGQHDEIVKQDGVTVLVEHKSLFKLIGSEMDYVKDRLSSKFVFNNPNVKE 125
            SY L+Y KEK + DE V QDGV + ++ K+   L+G+EMDY +++LSS+F+FNNPN+K 
Sbjct: 61  LSYTLDYAKEKSKLDEEVIQDGVRIFIDRKAQLSLLGTEMDYTENKLSSEFIFNNPNIKG 120

Query: 126 NCGCGESFSV 135
            CGCGESFSV
Sbjct: 121 TCGCGESFSV 130