BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10216_c0_seq1-m.86 complete 205-1191(+) 329 (+)
         (328 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|511004569|gb|EPB85935.1| CMGC/MAPK protein kinase [Mucor circ...   470   e-130   Mucor circinelloides f. circinelloides 1006PhL
gi|384489766|gb|EIE80988.1| MAP kinase [Rhizopus delemar RA 99-880]   470   e-130   Rhizopus delemar RA 99-880
gi|511008912|gb|EPB90167.1| CMGC/MAPK protein kinase [Mucor circ...   465   e-129   Mucor circinelloides f. circinelloides 1006PhL
gi|384495626|gb|EIE86117.1| MAP kinase [Rhizopus delemar RA 99-880]   418   e-114   Rhizopus delemar RA 99-880
gi|328772948|gb|EGF82985.1| hypothetical protein BATDEDRAFT_3390...   404   e-110   Batrachochytrium dendrobatidis JAM81
gi|328773751|gb|EGF83788.1| hypothetical protein BATDEDRAFT_7947...   395   e-107   Batrachochytrium dendrobatidis JAM81
gi|336385356|gb|EGO26503.1| hypothetical protein SERLADRAFT_4636...   384   e-104   Serpula lacrymans var. lacrymans S7.9
gi|336372550|gb|EGO00889.1| hypothetical protein SERLA73DRAFT_87...   384   e-104   Serpula lacrymans var. lacrymans S7.3
gi|501306417|dbj|GAC95459.1| hypothetical protein PHSY_003035 [P...   384   e-104   Pseudozyma hubeiensis SY62
gi|296417482|ref|XP_002838386.1| hypothetical protein [Tuber mel...   383   e-104   Tuber melanosporum Mel28
gi|323507958|emb|CBQ67829.1| probable mitogen-activated protein ...   383   e-104   Sporisorium reilianum SRZ2
gi|393222510|gb|EJD07994.1| kinase-like protein [Fomitiporia med...   380   e-103   Fomitiporia mediterranea MF3/22
gi|378732004|gb|EHY58463.1| mitogen-activated protein kinase spm...   379   e-103   Exophiala dermatitidis NIH/UT8656
gi|443896308|dbj|GAC73652.1| mitogen-activated protein kinase [P...   379   e-103   Moesziomyces antarcticus T-34
gi|388852163|emb|CCF54169.1| probable mitogen-activated protein ...   378   e-102   Ustilago hordei
gi|392862546|gb|EAS36799.2| mitogen-activated protein kinase spm...   378   e-102   
gi|119195213|ref|XP_001248210.1| hypothetical protein CIMG_01981...   378   e-102   
gi|320034832|gb|EFW16775.1| mitogen-activated protein kinase MKC...   378   e-102   Coccidioides posadasii str. Silveira
gi|303310627|ref|XP_003065325.1| Mitogen-activated protein kinas...   378   e-102   Coccidioides posadasii C735 delta SOWgp
gi|409080374|gb|EKM80734.1| hypothetical protein AGABI1DRAFT_112...   377   e-102   Agaricus bisporus var. burnettii JB137-S8
gi|403417686|emb|CCM04386.1| predicted protein [Fibroporia radic...   377   e-102   Fibroporia radiculosa
gi|449542075|gb|EMD33055.1| hypothetical protein CERSUDRAFT_1181...   377   e-102   Gelatoporia subvermispora B
gi|395330161|gb|EJF62545.1| CMGC/MAPK/ERK protein kinase [Dichom...   377   e-102   Dichomitus squalens LYAD-421 SS1
gi|390603513|gb|EIN12905.1| CMGC/MAPK/ERK protein kinase [Punctu...   377   e-102   Punctularia strigosozonata HHB-11173 SS5
gi|340915022|gb|EGS18363.1| mitogen-activated protein kinase SLT...   375   e-102   Chaetomium thermophilum var. thermophilum DSM 1495
gi|392561389|gb|EIW54571.1| CMGC/MAPK/ERK protein kinase [Tramet...   375   e-102   Trametes versicolor FP-101664 SS1
gi|406602023|emb|CCH46402.1| Mitogen-activated protein kinase SL...   375   e-102   Wickerhamomyces ciferrii
gi|50545801|ref|XP_500439.1| YALI0B02816p [Yarrowia lipolytica] ...   375   e-101   Yarrowia lipolytica CLIB122
gi|392934129|gb|AFM92257.1| mitogen activated protein kinase [Dr...   375   e-101   Drechslerella stenobrocha
gi|4580577|gb|AAD24428.1|U59214_1 MAP protein kinase MPKA [Emeri...   375   e-101   Aspergillus nidulans
gi|425768957|gb|EKV07468.1| hypothetical protein PDIG_73290 [Pen...   374   e-101   Penicillium digitatum PHI26
gi|302680955|ref|XP_003030159.1| hypothetical protein SCHCODRAFT...   374   e-101   Schizophyllum commune H4-8
gi|115389850|ref|XP_001212430.1| mitogen-activated protein kinas...   374   e-101   Aspergillus terreus NIH2624
gi|121708701|ref|XP_001272220.1| MAP kinase MpkA [Aspergillus cl...   374   e-101   Aspergillus clavatus NRRL 1
gi|340514134|gb|EGR44402.1| mitogen activated protein kinase 2 [...   374   e-101   Trichoderma reesei QM6a
gi|259484861|tpe|CBF81444.1| TPA: MAP protein kinase MPKA [Sourc...   374   e-101   Aspergillus nidulans FGSC A4
gi|407919134|gb|EKG12389.1| hypothetical protein MPH_10506 [Macr...   374   e-101   Macrophomina phaseolina MS6
gi|119499844|ref|XP_001266679.1| MAP kinase MpkA [Neosartorya fi...   374   e-101   Aspergillus fischeri NRRL 181
gi|35384078|gb|AAQ84550.1| MAP kinase [Trichoderma atroviride]        374   e-101   Trichoderma atroviride
gi|345562062|gb|EGX45134.1| hypothetical protein AOL_s00173g235 ...   373   e-101   Arthrobotrys oligospora ATCC 24927
gi|358388055|gb|EHK25649.1| mitogen activated protein kinase tmk...   373   e-101   Trichoderma virens Gv29-8
gi|83016541|dbj|BAE53433.1| MAP kinase Mps1 [Trichoderma harzianum]   373   e-101   Trichoderma lixii
gi|342882058|gb|EGU82812.1| hypothetical protein FOXB_06615 [Fus...   373   e-101   Fusarium oxysporum Fo5176
gi|70993224|ref|XP_751459.1| MAP kinase MpkA [Aspergillus fumiga...   373   e-101   Aspergillus fumigatus Af293
gi|224555567|gb|ACN56446.1| pMAP kinase THMK [Trichoderma harzia...   373   e-101   Trichoderma lixii
gi|189313357|gb|ACD88751.1| TmkB [Trichoderma virens]                 373   e-101   Trichoderma virens
gi|358390167|gb|EHK39573.1| mitogen activated protein kinase tmk...   373   e-101   Trichoderma atroviride IMI 206040
gi|471574376|gb|EMR72233.1| putative map kinase protein [Eutypa ...   373   e-101   Eutypa lata UCREL1
gi|145230127|ref|XP_001389372.1| mitogen-activated protein kinas...   373   e-101   Aspergillus niger CBS 513.88
gi|402216600|gb|EJT96685.1| kinase-like protein [Dacryopinax sp....   373   e-101   Dacryopinax primogenitus
gi|212534704|ref|XP_002147508.1| MAP kinase MpkA [Talaromyces ma...   372   e-101   Talaromyces marneffei ATCC 18224
gi|169764447|ref|XP_001816695.1| mitogen-activated protein kinas...   372   e-101   Aspergillus oryzae RIB40
gi|367026121|ref|XP_003662345.1| hypothetical protein MYCTH_2302...   372   e-101   Myceliophthora thermophila ATCC 42464
gi|89279387|gb|ABD67163.1| putative MAP kinase [Fusarium prolife...   372   e-101   Fusarium proliferatum
gi|17978662|gb|AAL50116.1| mitogen-activated protein kinase [Col...   372   e-100   Colletotrichum lagenaria
gi|242790924|ref|XP_002481655.1| MAP kinase MpkA [Talaromyces st...   372   e-100   Talaromyces stipitatus ATCC 10500
gi|255947318|ref|XP_002564426.1| Pc22g03870 [Penicillium chrysog...   372   e-100   Penicillium rubens Wisconsin 54-1255
gi|380089795|emb|CCC12327.1| putative MAK1 protein [Sordaria mac...   371   e-100   Sordaria macrospora k-hell
gi|336268919|ref|XP_003349221.1| MAK1 protein [Sordaria macrospo...   371   e-100   Sordaria macrospora k-hell
gi|389743919|gb|EIM85103.1| CMGC/MAPK/ERK protein kinase [Stereu...   371   e-100   Stereum hirsutum FP-91666 SS1
gi|302913383|ref|XP_003050911.1| predicted protein [Nectria haem...   370   e-100   Nectria haematococca mpVI 77-13-4
gi|380038140|gb|AFD31817.1| MAP kinase [Colletotrichum gloeospor...   370   e-100   Colletotrichum gloeosporioides
gi|336472015|gb|EGO60175.1| mitogen-activated protein kinase MKC...   370   e-100   Neurospora tetrasperma FGSC 2508
gi|380487070|emb|CCF38280.1| hypothetical protein CH063_09413 [C...   370   e-100   Colletotrichum higginsianum
gi|328862985|gb|EGG12085.1| hypothetical protein MELLADRAFT_4668...   370   e-100   Melampsora larici-populina 98AG31
gi|154275466|ref|XP_001538584.1| mitogen-activated protein kinas...   370   e-100   Histoplasma capsulatum NAm1
gi|85089638|ref|XP_958040.1| mitogen-activated protein kinase MK...   370   e-100   
gi|406860678|gb|EKD13735.1| TmkB [Marssonina brunnea f. sp. 'mul...   370   e-100   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|449296349|gb|EMC92369.1| hypothetical protein BAUCODRAFT_2867...   370   e-100   Baudoinia panamericana UAMH 10762
gi|171694455|ref|XP_001912152.1| hypothetical protein [Podospora...   370   e-100   Podospora anserina S mat+
gi|322694102|gb|EFY85941.1| putative MAP kinase [Metarhizium acr...   370   e-100   Metarhizium acridum CQMa 102
gi|330926789|ref|XP_003301614.1| hypothetical protein PTT_13150 ...   370   e-100   Pyrenophora teres f. teres 0-1
gi|402080994|gb|EJT76139.1| CMGC/MAPK protein kinase [Gaeumannom...   369   e-100   Gaeumannomyces graminis var. tritici R3-111a-1
gi|451856883|gb|EMD70174.1| MAPK protein MPS1 [Bipolaris sorokin...   369   e-100   Bipolaris sorokiniana ND90Pr
gi|485921930|gb|EOD47541.1| putative cmgc mapk protein kinase pr...   369   e-100   Neofusicoccum parvum UCRNP2
gi|482811153|gb|EOA87920.1| hypothetical protein SETTUDRAFT_1608...   369   e-100   Setosphaeria turcica Et28A
gi|477589332|gb|ENI06409.1| hypothetical protein COCC4DRAFT_1668...   369   e-100   Bipolaris maydis ATCC 48331
gi|409044016|gb|EKM53498.1| hypothetical protein PHACADRAFT_2599...   369   e-100   Phanerochaete carnosa HHB-10118-sp
gi|310795998|gb|EFQ31459.1| hypothetical protein GLRG_06603 [Glo...   369   e-100   Colletotrichum graminicola M1.001
gi|452983513|gb|EME83271.1| mitogen-activated protein kinase [Ps...   369   e-100   Cercospora fijiensis CIRAD86
gi|255722709|ref|XP_002546289.1| mitogen-activated protein kinas...   369   e-100   Candida tropicalis MYA-3404
gi|46137595|ref|XP_390489.1| hypothetical protein FG10313.1 [Fus...   368   e-99    
gi|440487742|gb|ELQ67517.1| mitogen-activated protein kinase spm...   368   1e-99   Magnaporthe oryzae P131
gi|322710377|gb|EFZ01952.1| putative MAP kinase [Metarhizium ani...   368   1e-99   
gi|408387733|gb|EKJ67443.1| MGV1 [Fusarium pseudograminearum CS3...   368   1e-99   Fusarium pseudograminearum CS3096
gi|258566389|ref|XP_002583939.1| mitogen-activated protein kinas...   368   1e-99   Uncinocarpus reesii 1704
gi|440476003|gb|ELQ44649.1| mitogen-activated protein kinase spm...   368   1e-99   Magnaporthe oryzae Y34
gi|392591508|gb|EIW80836.1| Pkinase-domain-containing protein [C...   368   1e-99   Coniophora puteana RWD-64-598 SS2
gi|389629568|ref|XP_003712437.1| CMGC/MAPK protein kinase [Magna...   368   1e-99   Magnaporthe oryzae 70-15
gi|346977608|gb|EGY21060.1| mitogen-activated protein kinase spm...   368   2e-99   Verticillium dahliae VdLs.17
gi|367039165|ref|XP_003649963.1| hypothetical protein THITE_2149...   367   2e-99   Thielavia terrestris NRRL 8126
gi|261197337|ref|XP_002625071.1| mitogen-activated protein kinas...   367   2e-99   Blastomyces gilchristii SLH14081
gi|302420197|ref|XP_003007929.1| mitogen-activated protein kinas...   367   2e-99   Verticillium alfalfae VaMs.102
gi|396496323|ref|XP_003844717.1| hypothetical protein LEMA_P0002...   367   2e-99   Leptosphaeria maculans JN3
gi|24430320|emb|CAC87145.1| MAP kinase [Claviceps purpurea] >gi|...   367   2e-99   Claviceps purpurea
gi|358803617|gb|AEU60018.1| mitogen-activated protein kinase [Be...   367   2e-99   Beauveria bassiana
gi|116197597|ref|XP_001224610.1| hypothetical protein CHGG_06954...   367   2e-99   Chaetomium globosum CBS 148.51
gi|299751596|ref|XP_001830371.2| CMGC/MAPK/ERK protein kinase [C...   367   2e-99   Coprinopsis cinerea okayama7#130
gi|225682447|gb|EEH20731.1| mitogen-activated protein kinase [Pa...   367   2e-99   
gi|189193119|ref|XP_001932898.1| mitogen-activated protein kinas...   367   2e-99   Pyrenophora tritici-repentis Pt-1C-BFP
gi|240281756|gb|EER45259.1| MAP protein kinase MPKA [Ajellomyces...   367   3e-99   Histoplasma capsulatum H143
gi|295660963|ref|XP_002791037.1| mitogen-activated protein kinas...   367   3e-99   
gi|51860134|gb|AAU11317.1| MAP kinase [Alternaria brassicicola]       366   4e-99   Alternaria brassicicola
gi|494826137|gb|EON63249.1| CMGC/MAPK/ERK1 protein kinase [Conio...   366   4e-99   Coniosporium apollinis CBS 100218
gi|500261890|gb|EOO04179.1| putative map kinase protein [Tognini...   366   5e-99   Phaeoacremonium minimum UCRPA7
gi|459366707|gb|EMG45968.1| Mitogen-activated protein kinase MKC...   366   5e-99   Candida maltosa Xu316
gi|448107573|ref|XP_004205396.1| Piso0_003642 [Millerozyma farin...   366   5e-99   Millerozyma farinosa CBS 7064
gi|285265602|gb|ADC35363.1| SLT2-like MAP kinase protein [Altern...   366   6e-99   Alternaria alternata
gi|346318071|gb|EGX87676.1| Serine/threonine-protein kinase-like...   366   6e-99   Cordyceps militaris CM01
gi|241957798|ref|XP_002421618.1| mitogen-activated protein kinas...   365   7e-99   Candida dubliniensis CD36
gi|284795190|gb|ADB93873.1| mitogen-activated protein kinase [Co...   365   8e-99   Corynespora cassiicola
gi|512186931|gb|EPE02716.1| map kinase [Ophiostoma piceae UAMH 1...   365   8e-99   Ophiostoma piceae UAMH 11346
gi|12407837|gb|AAG53655.1|AF301166_1 MAP kinase-II [Blumeria gra...   365   1e-98   Blumeria graminis [grass mildew]
gi|393239353|gb|EJD46885.1| kinase-like protein [Auricularia del...   365   1e-98   Auricularia subglabra TFB-10046 SS5
gi|451993987|gb|EMD86459.1| hypothetical protein COCHEDRAFT_1024...   365   1e-98   Bipolaris maydis C5
gi|323721370|gb|ADY05334.1| cell wall integrity MAP kinase [Curv...   365   1e-98   Curvularia lunata
gi|225558834|gb|EEH07117.1| mitogen-activated protein kinase [Aj...   365   1e-98   Histoplasma capsulatum G186AR
gi|121483467|gb|ABM54149.1| cell wall integrity MAP kinase [Coch...   365   1e-98   Bipolaris maydis
gi|150866723|ref|XP_001386411.2| hypothetical protein PICST_1824...   364   2e-98   Scheffersomyces stipitis CBS 6054
gi|452844604|gb|EME46538.1| hypothetical protein DOTSEDRAFT_7051...   364   2e-98   Dothistroma septosporum NZE10
gi|505760541|gb|EOR04606.1| Mitogen-activated protein kinase SLT...   363   2e-98   Wallemia ichthyophaga EXF-994
gi|331245135|ref|XP_003335205.1| CMGC/MAPK protein kinase [Pucci...   363   3e-98   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|440631951|gb|ELR01870.1| CMGC/MAPK protein kinase [Geomyces d...   363   3e-98   Pseudogymnoascus destructans 20631-21
gi|320589786|gb|EFX02242.1| mitogen-activated protein kinase mkc...   362   5e-98   Grosmannia clavigera kw1407
gi|170093175|ref|XP_001877809.1| predicted protein [Laccaria bic...   362   6e-98   Laccaria bicolor S238N-H82
gi|302504282|ref|XP_003014100.1| hypothetical protein ARB_07820 ...   362   1e-97   Arthroderma benhamiae CBS 112371
gi|296826076|ref|XP_002850914.1| mitogen-activated protein kinas...   362   1e-97   Arthroderma otae CBS 113480
gi|154310447|ref|XP_001554555.1| hypothetical protein BC1G_07144...   362   1e-97   Botrytis cinerea B05.10
gi|302657072|ref|XP_003020268.1| hypothetical protein TRV_05665 ...   362   1e-97   Trichophyton verrucosum HKI 0517
gi|169605481|ref|XP_001796161.1| hypothetical protein SNOG_05764...   362   1e-97   Parastagonospora nodorum SN15
gi|156056186|ref|XP_001594017.1| hypothetical protein SS1G_05445...   361   1e-97   Sclerotinia sclerotiorum 1980 UF-70
gi|315055017|ref|XP_003176883.1| CMGC/MAPK protein kinase [Arthr...   361   1e-97   Microsporum gypseum CBS 118893
gi|326473155|gb|EGD97164.1| CMGC/MAPK protein kinase [Trichophyt...   361   1e-97   Trichophyton tonsurans CBS 112818
gi|68520473|gb|AAY98511.1| cell wall integrity MAP kinase [Zymos...   361   2e-97   Zymoseptoria tritici
gi|344304354|gb|EGW34603.1| hypothetical protein SPAPADRAFT_6003...   360   2e-97   Spathaspora passalidarum NRRL Y-27907
gi|353241639|emb|CCA73441.1| probable mitogen-activated protein ...   360   2e-97   Serendipita indica DSM 11827
gi|327308308|ref|XP_003238845.1| CMGC/MAPK protein kinase [Trich...   360   2e-97   Trichophyton rubrum CBS 118892
gi|326477998|gb|EGE02008.1| CMGC/MAPK protein kinase [Trichophyt...   360   3e-97   Trichophyton equinum CBS 127.97
gi|471892359|emb|CCO31988.1| hypothetical protein BN14_06040 [Rh...   360   4e-97   Rhizoctonia solani AG-1 IB
gi|465792314|emb|CCU97422.1| MAPK-like protein [Malassezia sympo...   359   6e-97   Malassezia sympodialis ATCC 42132
gi|7385125|gb|AAF61706.1|AF226711_1 MAP kinase [Kluyveromyces la...   359   7e-97   Kluyveromyces lactis
gi|149246025|ref|XP_001527482.1| mitogen-activated protein kinas...   358   9e-97   Lodderomyces elongisporus NRRL YB-4239
gi|50304219|ref|XP_452059.1| hypothetical protein [Kluyveromyces...   358   9e-97   Kluyveromyces lactis NRRL Y-1140
gi|398409100|ref|XP_003856015.1| mitogen-activated protein kinas...   358   9e-97   Zymoseptoria tritici IPO323
gi|453086115|gb|EMF14157.1| SLT2-like MAP kinase protein [Mycosp...   358   1e-96   Sphaerulina musiva SO2202
gi|260944918|ref|XP_002616757.1| hypothetical protein CLUG_03997...   358   1e-96   Clavispora lusitaniae ATCC 42720
gi|190345293|gb|EDK37155.2| hypothetical protein PGUG_01253 [Mey...   358   1e-96   Meyerozyma guilliermondii ATCC 6260
gi|354544732|emb|CCE41457.1| hypothetical protein CPAR2_800090 [...   358   2e-96   Candida parapsilosis
gi|511009403|gb|EPB90647.1| CMGC/MAPK protein kinase [Mucor circ...   358   2e-96   Mucor circinelloides f. circinelloides 1006PhL
gi|254572043|ref|XP_002493131.1| Serine/threonine MAP kinase [Ko...   357   2e-96   Komagataella phaffii GS115
gi|410079779|ref|XP_003957470.1| hypothetical protein KAFR_0E018...   357   2e-96   Kazachstania africana CBS 2517
gi|213409748|ref|XP_002175644.1| mitogen-activated protein kinas...   357   2e-96   Schizosaccharomyces japonicus yFS275
gi|448507836|ref|XP_003865857.1| Mkc1 MAP kinase [Candida orthop...   357   2e-96   Candida orthopsilosis Co 90-125
gi|320583036|gb|EFW97252.1| Serine/threonine MAP kinase [Ogataea...   356   5e-96   
gi|513032580|gb|AGO12572.1| AaceriAER232Cp [Saccharomycetaceae s...   356   6e-96   Saccharomycetaceae sp. 'Ashbya aceri'
gi|344230296|gb|EGV62181.1| hypothetical protein CANTEDRAFT_1090...   356   6e-96   Candida tenuis ATCC 10573
gi|146419238|ref|XP_001485582.1| hypothetical protein PGUG_01253...   355   7e-96   Meyerozyma guilliermondii ATCC 6260
gi|294657798|ref|XP_460098.2| DEHA2E18348p [Debaryomyces hanseni...   355   8e-96   Debaryomyces hansenii CBS767
gi|302308233|ref|NP_985089.2| AER232Cp [Ashbya gossypii ATCC 108...   355   9e-96   Eremothecium gossypii ATCC 10895
gi|363755580|ref|XP_003648005.1| hypothetical protein Ecym_7361 ...   355   1e-95   Eremothecium cymbalariae DBVPG#7215
gi|367014613|ref|XP_003681806.1| hypothetical protein TDEL_0E035...   355   1e-95   Torulaspora delbrueckii
gi|323333344|gb|EGA74741.1| Slt2p [Saccharomyces cerevisiae AWRI...   355   1e-95   Saccharomyces cerevisiae AWRI796
gi|349578580|dbj|GAA23745.1| K7_Slt2p [Saccharomyces cerevisiae ...   354   1e-95   Saccharomyces cerevisiae Kyokai no. 7
gi|323304732|gb|EGA58493.1| Slt2p [Saccharomyces cerevisiae Fost...   354   1e-95   Saccharomyces cerevisiae FostersB
gi|190405815|gb|EDV09082.1| mitogen-activated protein kinase SLT...   354   1e-95   Saccharomyces cerevisiae RM11-1a
gi|151943974|gb|EDN62267.1| serine/threonine MAP kinase [Sacchar...   354   1e-95   Saccharomyces cerevisiae YJM789
gi|6321819|ref|NP_011895.1| Slt2p [Saccharomyces cerevisiae S288...   354   1e-95   Saccharomyces cerevisiae S288c
gi|401625400|gb|EJS43409.1| slt2p [Saccharomyces arboricola H-6]      354   2e-95   Saccharomyces arboricola H-6
gi|323348356|gb|EGA82604.1| Slt2p [Saccharomyces cerevisiae Lalv...   354   2e-95   Saccharomyces cerevisiae Lalvin QA23
gi|299627|gb|AAB26249.1| Mpk1p=mitogen-activated protein kinase ...   354   2e-95   Saccharomyces cerevisiae [brewer's yeast]
gi|392577195|gb|EIW70324.1| hypothetical protein TREMEDRAFT_3810...   353   3e-95   Tremella mesenterica DSM 1558
gi|358060951|dbj|GAA93373.1| hypothetical protein E5Q_00013 [Mix...   353   4e-95   Mixia osmundae IAM 14324
gi|207344745|gb|EDZ71784.1| YHR030Cp-like protein [Saccharomyces...   353   4e-95   Saccharomyces cerevisiae AWRI1631
gi|401838286|gb|EJT41988.1| SLT2-like protein [Saccharomyces kud...   352   8e-95   Saccharomyces kudriavzevii IFO 1802
gi|255718121|ref|XP_002555341.1| KLTH0G06974p [Lachancea thermot...   352   9e-95   Lachancea thermotolerans CBS 6340
gi|366987681|ref|XP_003673607.1| hypothetical protein NCAS_0A066...   352   9e-95   Naumovozyma castellii CBS 4309
gi|50290605|ref|XP_447735.1| hypothetical protein [Candida glabr...   352   1e-94   Candida glabrata CBS 138
gi|365985774|ref|XP_003669719.1| hypothetical protein NDAI_0D016...   352   1e-94   Naumovozyma dairenensis CBS 421
gi|365760382|gb|EHN02106.1| Slt2p [Saccharomyces cerevisiae x Sa...   351   1e-94   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gi|444315363|ref|XP_004178339.1| hypothetical protein TBLA_0A104...   351   2e-94   Tetrapisispora blattae CBS 6284
gi|58271314|ref|XP_572813.1| MAP kinase [Cryptococcus neoformans...   350   2e-94   Cryptococcus neoformans var. neoformans JEC21
gi|170293000|gb|ACB12685.1| mitogen-activated protein kinase 1 [...   350   3e-94   Cryptococcus gattii VGI
gi|405122466|gb|AFR97233.1| CMGC/MAPK/ERK protein kinase [Crypto...   350   3e-94   Cryptococcus neoformans var. grubii H99
gi|321261878|ref|XP_003195658.1| MAP kinase [Cryptococcus gattii...   350   3e-94   Cryptococcus gattii WM276
gi|19112081|ref|NP_595289.1| MAP kinase Pmk1 [Schizosaccharomyce...   350   4e-94   Schizosaccharomyces pombe 972h-
gi|28974309|gb|AAO61669.1| Mpk1 [Cryptococcus neoformans var. ne...   349   6e-94   Cryptococcus neoformans var. neoformans
gi|366999230|ref|XP_003684351.1| hypothetical protein TPHA_0B024...   349   6e-94   Tetrapisispora phaffii CBS 4417
gi|238879512|gb|EEQ43150.1| mitogen-activated protein kinase SLT...   349   7e-94   Candida albicans WO-1
gi|68474614|ref|XP_718680.1| likely protein kinase [Candida albi...   349   7e-94   Candida albicans SC5314
gi|1170963|sp|P43068.1|MKC1_CANAL RecName: Full=Mitogen-activate...   349   7e-94   Candida albicans
gi|401889093|gb|EJT53033.1| MAP kinase [Trichosporon asahii var....   349   8e-94   Trichosporon asahii var. asahii CBS 2479
gi|512199775|gb|EPE28608.1| Protein kinase-like (PK-like) [Glare...   348   8e-94   Glarea lozoyensis ATCC 20868
gi|403218508|emb|CCK72998.1| hypothetical protein KNAG_0M01450 [...   348   8e-94   Kazachstania naganishii CBS 8797
gi|393239470|gb|EJD47002.1| CMGC/MAPK/ERK protein kinase [Auricu...   346   6e-93   Auricularia subglabra TFB-10046 SS5
gi|164658447|ref|XP_001730349.1| hypothetical protein MGL_2731 [...   345   1e-92   Malassezia globosa CBS 7966
gi|254586223|ref|XP_002498679.1| ZYRO0G16082p [Zygosaccharomyces...   345   1e-92   Zygosaccharomyces rouxii CBS 732
gi|323308887|gb|EGA62123.1| Slt2p [Saccharomyces cerevisiae Fost...   343   3e-92   Saccharomyces cerevisiae FostersO
gi|472583105|gb|EMS20759.1| mitogen-activated protein kinase 7 [...   338   1e-90   Rhodotorula toruloides NP11
gi|402216592|gb|EJT96677.1| kinase-like protein [Dacryopinax sp....   338   1e-90   Dacryopinax primogenitus
gi|71003804|ref|XP_756568.1| hypothetical protein UM00421.1 [Ust...   337   3e-90   
gi|388579554|gb|EIM19876.1| kinase-like protein [Wallemia sebi C...   336   5e-90   Wallemia mellicola CBS 633.66
gi|470318033|gb|EMR09712.1| CMGC/MAPK/ERK1 protein kinase [Pneum...   335   1e-89   Pneumocystis murina B123
gi|470318034|gb|EMR09713.1| CMGC/MAPK/ERK1 protein kinase, varia...   334   2e-89   
gi|393222133|gb|EJD07617.1| kinase-like protein [Fomitiporia med...   333   3e-89   Fomitiporia mediterranea MF3/22
gi|74676217|sp|O94737.1|MAPK1_PNECA RecName: Full=Mitogen-activa...   333   4e-89   Pneumocystis carinii
gi|323337264|gb|EGA78517.1| Slt2p [Saccharomyces cerevisiae Vin13]    324   2e-86   Saccharomyces cerevisiae Vin13
gi|389745531|gb|EIM86712.1| kinase-like protein [Stereum hirsutu...   322   1e-85   Stereum hirsutum FP-91666 SS1
gi|390596698|gb|EIN06099.1| Pkinase-domain-containing protein [P...   322   1e-85   Punctularia strigosozonata HHB-11173 SS5
gi|430811227|emb|CCJ31321.1| unnamed protein product [Pneumocyst...   321   2e-85   Pneumocystis jirovecii
gi|170086864|ref|XP_001874655.1| predicted protein [Laccaria bic...   317   3e-84   Laccaria bicolor S238N-H82
gi|361126513|gb|EHK98511.1| putative Mitogen-activated protein k...   317   3e-84   Glarea lozoyensis 74030
gi|426196714|gb|EKV46642.1| hypothetical protein AGABI2DRAFT_223...   315   8e-84   Agaricus bisporus var. bisporus H97
gi|409081475|gb|EKM81834.1| hypothetical protein AGABI1DRAFT_548...   315   8e-84   Agaricus bisporus var. burnettii JB137-S8
gi|392565446|gb|EIW58623.1| kinase-like protein [Trametes versic...   314   2e-83   Trametes versicolor FP-101664 SS1
gi|401885870|gb|EJT49955.1| MAP kinase [Trichosporon asahii var....   314   2e-83   Trichosporon asahii var. asahii CBS 2479
gi|406695737|gb|EKC99039.1| MAP kinase [Trichosporon asahii var....   314   3e-83   Trichosporon asahii var. asahii CBS 8904
gi|402223581|gb|EJU03645.1| Pkinase-domain-containing protein [D...   313   4e-83   Dacryopinax primogenitus
gi|470296739|ref|XP_004345440.1| mitogen-activated kinase 7 [Cap...   313   5e-83   Capsaspora owczarzaki ATCC 30864
gi|365984921|ref|XP_003669293.1| hypothetical protein NDAI_0C039...   313   6e-83   Naumovozyma dairenensis CBS 421
gi|134115006|ref|XP_773801.1| hypothetical protein CNBH2530 [Cry...   310   3e-82   Cryptococcus neoformans var. neoformans B-3501A
gi|58271510|ref|XP_572911.1| MAP kinase [Cryptococcus neoformans...   310   4e-82   Cryptococcus neoformans var. neoformans JEC21
gi|302686956|ref|XP_003033158.1| hypothetical protein SCHCODRAFT...   309   7e-82   Schizophyllum commune H4-8
gi|23452044|gb|AAN32906.1| MAP kinase-like protein [Colletotrich...   307   3e-81   Colletotrichum gloeosporioides f. sp. malvae
gi|118403626|ref|NP_001072332.1| mitogen-activated protein kinas...   306   4e-81   Xenopus tropicalis [western clawed frog]
gi|513237204|ref|XP_003643551.2| PREDICTED: uncharacterized tran...   306   6e-81   
gi|160420257|ref|NP_001086764.1| mitogen-activated protein kinas...   306   6e-81   Xenopus laevis [clawed frog]
gi|82568554|dbj|BAE48519.1| ERK5 [Xenopus laevis]                     306   7e-81   Xenopus laevis [clawed frog]
gi|328766213|gb|EGF76269.1| hypothetical protein BATDEDRAFT_3756...   305   1e-80   Batrachochytrium dendrobatidis JAM81
gi|50553802|ref|XP_504312.1| YALI0E23496p [Yarrowia lipolytica] ...   305   2e-80   Yarrowia lipolytica CLIB122
gi|449546531|gb|EMD37500.1| hypothetical protein CERSUDRAFT_8324...   304   2e-80   Gelatoporia subvermispora B
gi|321262114|ref|XP_003195776.1| MAP kinase [Cryptococcus gattii...   303   3e-80   Cryptococcus gattii WM276
gi|392578872|gb|EIW71999.1| hypothetical protein TREMEDRAFT_2457...   303   4e-80   Tremella mesenterica DSM 1558
gi|255080238|ref|XP_002503699.1| predicted protein [Micromonas s...   301   1e-79   Micromonas commoda
gi|260800250|ref|XP_002595047.1| hypothetical protein BRAFLDRAFT...   299   6e-79   Branchiostoma floridae
gi|499050771|ref|XP_004575902.1| PREDICTED: mitogen-activated pr...   299   7e-79   Maylandia zebra
gi|432924260|ref|XP_004080544.1| PREDICTED: mitogen-activated pr...   299   8e-79   
gi|327278368|ref|XP_003223934.1| PREDICTED: mitogen-activated pr...   298   2e-78   Anolis carolinensis [Carolina anole]
gi|47228192|emb|CAG07587.1| unnamed protein product [Tetraodon n...   298   2e-78   Tetraodon nigroviridis
gi|156382591|ref|XP_001632636.1| predicted protein [Nematostella...   296   4e-78   Nematostella vectensis
gi|348686547|gb|EGZ26362.1| hypothetical protein PHYSODRAFT_3124...   296   5e-78   Phytophthora sojae
gi|195997367|ref|XP_002108552.1| hypothetical protein TRIADDRAFT...   296   5e-78   Trichoplax adhaerens
gi|301103436|ref|XP_002900804.1| sporangia induced mitogen-activ...   296   5e-78   Phytophthora infestans T30-4
gi|325188928|emb|CCA23457.1| sporangia induced mitogenactivated ...   296   7e-78   Albugo laibachii Nc14
gi|410079733|ref|XP_003957447.1| hypothetical protein KAFR_0E015...   295   8e-78   Kazachstania africana CBS 2517
gi|299745216|ref|XP_002910888.1| CMGC/MAPK protein kinase [Copri...   295   1e-77   Coprinopsis cinerea okayama7#130
gi|465953143|gb|EMP25250.1| Mitogen-activated protein kinase 7 [...   295   2e-77   Chelonia mydas [green seaturtle]
gi|470322770|ref|XP_004349328.1| extracellular signal-regulated ...   295   2e-77   
gi|401838088|gb|EJT41875.1| KDX1-like protein [Saccharomyces kud...   294   2e-77   Saccharomyces kudriavzevii IFO 1802
gi|168048183|ref|XP_001776547.1| predicted protein [Physcomitrel...   294   3e-77   Physcomitrella patens
gi|190347165|gb|EDK39391.2| extracellular signal-regulated kinas...   293   3e-77   Meyerozyma guilliermondii ATCC 6260
gi|124294722|gb|ABN03944.1| mitogen-activated protein kinase [Du...   293   4e-77   Dunaliella salina
gi|410895925|ref|XP_003961450.1| PREDICTED: mitogen-activated pr...   293   5e-77   
gi|412990662|emb|CCO18034.1| predicted protein [Bathycoccus pras...   293   5e-77   Bathycoccus prasinos
gi|302767352|ref|XP_002967096.1| hypothetical protein SELMODRAFT...   293   6e-77   Selaginella moellendorffii
gi|387159425|gb|AFJ54625.1| mitogen-activated protein kinase [Du...   293   6e-77   Dunaliella salina
gi|390604773|gb|EIN14164.1| Pkinase-domain-containing protein [P...   292   9e-77   Punctularia strigosozonata HHB-11173 SS5
gi|260947456|ref|XP_002618025.1| hypothetical protein CLUG_01484...   292   1e-76   Clavispora lusitaniae ATCC 42720
gi|303279979|ref|XP_003059282.1| predicted protein [Micromonas p...   291   1e-76   Micromonas pusilla CCMP1545
gi|315139555|gb|ADT80930.1| extracellular signal-regulated kinas...   291   2e-76   Penaeus monodon [giant tiger prawn]
gi|255729176|ref|XP_002549513.1| extracellular signal-regulated ...   291   2e-76   Candida tropicalis MYA-3404
gi|345563327|gb|EGX46330.1| hypothetical protein AOL_s00110g154 ...   290   3e-76   Arthrobotrys oligospora ATCC 24927
gi|325149292|gb|ADY86687.1| mitogen-activated protein kinase [Du...   290   3e-76   Dunaliella salina
gi|344305523|gb|EGW35755.1| extracellular signal-regulated kinas...   290   4e-76   Spathaspora passalidarum NRRL Y-27907
gi|66807963|ref|XP_637704.1| extracellular signal-regulated prot...   290   4e-76   Dictyostelium discoideum AX4
gi|384484572|gb|EIE76752.1| mitogen-activated protein kinase [Rh...   290   5e-76   Rhizopus delemar RA 99-880
gi|168037968|ref|XP_001771474.1| predicted protein [Physcomitrel...   290   5e-76   Physcomitrella patens
gi|254749406|dbj|BAH86598.1| mitogen-activated protein kinase [M...   289   7e-76   Marsupenaeus japonicus
gi|330794750|ref|XP_003285440.1| extracellular signal-regulated ...   289   7e-76   Dictyostelium purpureum
gi|113930697|ref|NP_001013469.2| mitogen-activated protein kinas...   289   8e-76   Danio rerio [leopard danio]
gi|146416277|ref|XP_001484108.1| extracellular signal-regulated ...   288   1e-75   Meyerozyma guilliermondii ATCC 6260
gi|169770233|ref|XP_001819586.1| mitogen-activated protein kinas...   288   1e-75   Aspergillus oryzae RIB40
gi|322422111|gb|ADX01225.1| FPK1 [Fusarium proliferatum]              288   2e-75   Fusarium proliferatum
gi|302754982|ref|XP_002960915.1| mitogen activated protein kinas...   288   2e-75   Selaginella moellendorffii
gi|48843354|dbj|BAD23842.1| extracellular signal regulated prote...   288   2e-75   Cyprinus carpio [carp]
gi|172073072|gb|ACB71392.1| FMK1 [Fusarium verticillioides]           288   2e-75   Fusarium verticillioides
gi|391341207|ref|XP_003744922.1| PREDICTED: mitogen-activated pr...   288   2e-75   Metaseiulus occidentalis
gi|296416447|ref|XP_002837891.1| hypothetical protein [Tuber mel...   288   2e-75   Tuber melanosporum Mel28
gi|150951385|ref|XP_001387701.2| Extracellular signal-regulated ...   287   2e-75   Scheffersomyces stipitis CBS 6054
gi|425768711|gb|EKV07229.1| MAP kinase MpkB [Penicillium digitat...   287   2e-75   Penicillium digitatum PHI26
gi|294657171|ref|XP_459480.2| DEHA2E03586p [Debaryomyces hanseni...   287   3e-75   
gi|389747612|gb|EIM88790.1| mitogen-activated protein kinase [St...   287   3e-75   
gi|70992623|ref|XP_751160.1| MAP kinase MpkB [Aspergillus fumiga...   287   3e-75   
gi|537288|gb|AAA59387.1| extracellular signal-regulated protein ...   287   3e-75   
gi|431914487|gb|ELK15737.1| Mitogen-activated protein kinase 7 [...   287   3e-75   
gi|395836321|ref|XP_003791106.1| PREDICTED: mitogen-activated pr...   287   3e-75   
gi|169851340|ref|XP_001832360.1| CMGC/MAPK protein kinase [Copri...   287   3e-75   
gi|395836319|ref|XP_003791105.1| PREDICTED: mitogen-activated pr...   287   4e-75   
gi|291412866|ref|XP_002722698.1| PREDICTED: mitogen-activated pr...   286   4e-75   
gi|395331880|gb|EJF64260.1| kinase-like protein [Dichomitus squa...   286   4e-75   
gi|327280618|ref|XP_003225049.1| PREDICTED: mitogen-activated pr...   286   4e-75   
gi|297700261|ref|XP_002827174.1| PREDICTED: mitogen-activated pr...   286   4e-75   
gi|205810144|sp|P0C865.1|MK07_RAT RecName: Full=Mitogen-activate...   286   4e-75   
gi|74199112|dbj|BAE33103.1| unnamed protein product [Mus musculus]    286   4e-75   
gi|334332827|ref|XP_001370188.2| PREDICTED: mitogen-activated pr...   286   4e-75   
gi|507713897|ref|XP_004647986.1| PREDICTED: mitogen-activated pr...   286   4e-75   
gi|300796750|ref|NP_001178476.1| mitogen-activated protein kinas...   286   4e-75   
gi|6754634|ref|NP_035971.1| mitogen-activated protein kinase 7 [...   286   5e-75   
gi|507953552|ref|XP_004684617.1| PREDICTED: mitogen-activated pr...   286   5e-75   
gi|5081463|gb|AAD39394.1|AF126159_1 big MAP kinase 1a [Mus muscu...   286   5e-75   
gi|149944747|ref|NP_001092550.1| mitogen-activated protein kinas...   286   5e-75   
gi|5081467|gb|AAD39396.1|AF126161_1 big MAP kinase 1c [Mus muscu...   286   5e-75   
gi|505838735|ref|XP_004612900.1| PREDICTED: mitogen-activated pr...   286   5e-75   
gi|973307|gb|AAA82931.1| BMK1 alpha kinase [Homo sapiens] >gi|97...   286   5e-75   
gi|20986497|ref|NP_002740.2| mitogen-activated protein kinase 7 ...   286   5e-75   
gi|403275177|ref|XP_003929332.1| PREDICTED: mitogen-activated pr...   286   5e-75   
gi|504182691|ref|XP_004599698.1| PREDICTED: mitogen-activated pr...   286   5e-75   
gi|472371364|ref|XP_004405181.1| PREDICTED: mitogen-activated pr...   286   5e-75   
gi|511914607|ref|XP_004776620.1| PREDICTED: mitogen-activated pr...   286   5e-75   
gi|459368243|gb|EMG47026.1| Extracellular signal-regulated kinas...   286   5e-75   
gi|354547147|emb|CCE43880.1| hypothetical protein CPAR2_501060 [...   286   5e-75   
gi|302847608|ref|XP_002955338.1| mitogen-activated protein kinas...   286   5e-75   
gi|397471476|ref|XP_003807317.1| PREDICTED: mitogen-activated pr...   286   5e-75   
gi|121700140|ref|XP_001268335.1| MAP kinase MpkB/Fus3 [Aspergill...   286   5e-75   
gi|426349151|ref|XP_004042177.1| PREDICTED: mitogen-activated pr...   286   5e-75   
gi|119472832|ref|XP_001258423.1| MAP kinase MpkB/Fus3 [Neosartor...   286   5e-75   
gi|344245186|gb|EGW01290.1| Mitogen-activated protein kinase 7 [...   286   5e-75   
gi|117616352|gb|ABK42194.1| Erk5 [synthetic construct]                286   5e-75   
gi|410980017|ref|XP_003996377.1| PREDICTED: mitogen-activated pr...   286   5e-75   
gi|332848315|ref|XP_511332.3| PREDICTED: LOW QUALITY PROTEIN: mi...   286   5e-75   
gi|9836510|dbj|BAB11812.1| ERK1 [Danio rerio]                         286   5e-75   
gi|402899005|ref|XP_003912497.1| PREDICTED: mitogen-activated pr...   286   6e-75   
gi|159484494|ref|XP_001700291.1| mitogen-activated protein kinas...   286   6e-75   
gi|478517681|ref|XP_004433072.1| PREDICTED: mitogen-activated pr...   286   6e-75   
gi|440913074|gb|ELR62578.1| Mitogen-activated protein kinase 7 [...   286   6e-75   
gi|426238903|ref|XP_004013378.1| PREDICTED: LOW QUALITY PROTEIN:...   286   6e-75   
gi|5081465|gb|AAD39395.1|AF126160_1 big MAP kinase 1b [Mus muscu...   286   6e-75   
gi|296201114|ref|XP_002747912.1| PREDICTED: mitogen-activated pr...   286   6e-75   
gi|355568318|gb|EHH24599.1| Mitogen-activated protein kinase 7 [...   286   6e-75   
gi|109113587|ref|XP_001099721.1| PREDICTED: mitogen-activated pr...   286   6e-75   
gi|42725673|gb|AAS38576.1| mitogen activated protein kinase 7 tr...   286   6e-75   
gi|395514334|ref|XP_003761373.1| PREDICTED: mitogen-activated pr...   286   6e-75   
gi|837261|gb|AAA81381.1| ERK5 [Homo sapiens]                          286   6e-75   
gi|391337394|ref|XP_003743054.1| PREDICTED: mitogen-activated pr...   286   6e-75   
gi|345800326|ref|XP_546651.3| PREDICTED: LOW QUALITY PROTEIN: mi...   286   6e-75   
gi|444525415|gb|ELV14022.1| Mitogen-activated protein kinase 7 [...   286   6e-75   
gi|71682495|gb|AAI00399.1| Mapk7 protein [Mus musculus]               286   7e-75   
gi|426349157|ref|XP_004042180.1| PREDICTED: mitogen-activated pr...   286   7e-75   
gi|355753828|gb|EHH57793.1| hypothetical protein EGM_07504 [Maca...   286   7e-75   
gi|20986499|ref|NP_620601.1| mitogen-activated protein kinase 7 ...   286   7e-75   
gi|449802691|pdb|4IC7|A Chain A, Crystal Structure Of The Erk5 K...   286   7e-75   
gi|30585137|gb|AAP36841.1| Homo sapiens mitogen-activated protei...   286   7e-75   
gi|354467903|ref|XP_003496407.1| PREDICTED: mitogen-activated pr...   286   7e-75   
gi|465991927|ref|XP_004266850.1| PREDICTED: mitogen-activated pr...   286   7e-75   
gi|498941318|ref|XP_004521541.1| PREDICTED: mitogen-activated pr...   286   7e-75   
gi|42725686|gb|AAS38577.1| mitogen activated protein kinase 7 tr...   286   7e-75   
gi|10798897|gb|AAG23132.1|AF205375_1 MAP kinase [Botryotinia fuc...   286   7e-75   
gi|488530050|ref|XP_004456799.1| PREDICTED: mitogen-activated pr...   286   7e-75   
gi|33303761|gb|AAQ02394.1| mitogen-activated protein kinase 7, p...   286   7e-75   
gi|41393177|ref|NP_958915.1| mitogen-activated protein kinase 3 ...   286   7e-75   
gi|242211742|ref|XP_002471708.1| mitogen activated protein kinas...   286   7e-75   
gi|1110512|gb|AAA83210.1| MAP kinase, partial [Aplysia californica]   286   7e-75   
gi|193645805|ref|XP_001952106.1| PREDICTED: mitogen-activated pr...   286   7e-75   
gi|477515996|gb|ENH68277.1| Mitogen-activated protein kinase [Fu...   286   8e-75   
gi|115389978|ref|XP_001212494.1| mitogen-activated protein kinas...   286   8e-75   
gi|9858841|gb|AAG01162.1|AF286533_1 mitogen-activated protein ki...   286   8e-75   
gi|344298074|ref|XP_003420719.1| PREDICTED: mitogen-activated pr...   286   8e-75   
gi|46124015|ref|XP_386561.1| hypothetical protein FG06385.1 [Fus...   286   8e-75   
gi|500259770|gb|EOO02532.1| putative mitogen-activated protein k...   286   8e-75   
gi|255946888|ref|XP_002564211.1| Pc22g01670 [Penicillium chrysog...   286   8e-75   
gi|302916269|ref|XP_003051945.1| predicted protein [Nectria haem...   286   8e-75   
gi|322707997|gb|EFY99574.1| mitogen activated protein kinase [Me...   285   9e-75   
gi|31322228|gb|AAO63561.1| mitogen activated protein kinase [Lec...   285   9e-75   
gi|453084764|gb|EMF12808.1| Pkinase-domain-containing protein [M...   285   9e-75   
gi|507708001|ref|XP_004716837.1| PREDICTED: mitogen-activated pr...   285   9e-75   
gi|156039459|ref|XP_001586837.1| mitogen-activated protein kinas...   285   1e-74   
gi|21636306|gb|AAM69918.1|AF452096_1 MAP kinase Tmk1 [Trichoderm...   285   1e-74   
gi|488530052|ref|XP_004456800.1| PREDICTED: mitogen-activated pr...   285   1e-74   
gi|45477412|gb|AAP93199.2| mitogen activated protein kinase [Met...   285   1e-74   
gi|488530048|ref|XP_004456798.1| PREDICTED: mitogen-activated pr...   285   1e-74   
gi|344232373|gb|EGV64252.1| hypothetical protein CANTEDRAFT_1138...   285   1e-74   
gi|112982894|ref|NP_001036921.1| extracellular regulated MAP kin...   285   1e-74   
gi|395323780|gb|EJF56237.1| mitogen-activated protein kinase [Di...   285   1e-74   
gi|322701859|gb|EFY93607.1| mitogen activated protein kinase [Me...   285   1e-74   
gi|395334193|gb|EJF66569.1| mitogen activated protein kinase [Di...   285   1e-74   
gi|344232372|gb|EGV64251.1| Pkinase-domain-containing protein [C...   285   1e-74   
gi|62088802|dbj|BAD92848.1| Mitogen activated protein kinase 7 t...   285   1e-74   
gi|83016539|dbj|BAE53432.1| MAP kinase Pmk1 [Trichoderma harzianum]   285   1e-74   
gi|118343755|ref|NP_001071698.1| mitogen-activated protein kinas...   285   1e-74   
gi|196010964|ref|XP_002115346.1| conserved hypothetical protein ...   285   1e-74   
gi|145241049|ref|XP_001393171.1| mitogen-activated protein kinas...   285   1e-74   
gi|507571038|ref|XP_004669122.1| PREDICTED: mitogen-activated pr...   285   1e-74   
gi|406865730|gb|EKD18771.1| MAP kinase [Marssonina brunnea f. sp...   285   1e-74   
gi|432868513|ref|XP_004071575.1| PREDICTED: mitogen-activated pr...   285   1e-74   
gi|154294387|ref|XP_001547635.1| mitogen-activated protein kinas...   285   1e-74   
gi|507571040|ref|XP_004669123.1| PREDICTED: mitogen-activated pr...   285   1e-74   
gi|471393941|ref|XP_004381041.1| PREDICTED: mitogen-activated pr...   285   1e-74   
gi|513014985|ref|XP_004868836.1| PREDICTED: mitogen-activated pr...   285   2e-74   
gi|169600893|ref|XP_001793869.1| MAP kinase [Phaeosphaeria nodor...   285   2e-74   
gi|145350942|ref|XP_001419851.1| predicted protein [Ostreococcus...   285   2e-74   
gi|351706915|gb|EHB09834.1| Mitogen-activated protein kinase 7 [...   285   2e-74   
gi|512882183|ref|XP_004895408.1| PREDICTED: LOW QUALITY PROTEIN:...   285   2e-74   
gi|513014983|ref|XP_004868835.1| PREDICTED: mitogen-activated pr...   285   2e-74   
gi|351693721|gb|AEQ59237.1| MAP kinase [Curvularia lunata] >gi|3...   285   2e-74   
gi|396499179|ref|XP_003845410.1| similar to mitogen activated pr...   285   2e-74   
gi|320588491|gb|EFX00960.1| mitogen-activated protein kinase [Gr...   285   2e-74   
gi|118345322|gb|AAF12815.2|AF198118_1 mitogen-activated protein ...   285   2e-74   
gi|452981797|gb|EME81557.1| MAP kinase [Pseudocercospora fijiens...   284   2e-74   
gi|448090922|ref|XP_004197193.1| Piso0_004433 [Millerozyma farin...   284   2e-74   
gi|91090442|ref|XP_966833.1| PREDICTED: similar to extracellular...   284   2e-74   
gi|33860247|gb|AAQ54908.1| mitogen activated protein kinase SMK1...   284   2e-74   
gi|513014987|ref|XP_004868837.1| PREDICTED: mitogen-activated pr...   284   2e-74   
gi|40645549|dbj|BAD06585.1| MAP kinase [Candida tropicalis]           284   2e-74   
gi|332265896|ref|XP_003281950.1| PREDICTED: mitogen-activated pr...   284   2e-74   
gi|405944895|pdb|4B99|A Chain A, Crystal Structure Of Mapk7 (erk...   284   2e-74   
gi|308808159|ref|XP_003081390.1| mitogen-activated protein kinas...   284   2e-74   
gi|15147362|gb|AAG53654.2|AF301165_1 MAP kinase-I [Blumeria gram...   284   2e-74   
gi|189091818|ref|XP_001929742.1| hypothetical protein [Podospora...   284   3e-74   
gi|340931855|gb|EGS19388.1| mitogen-activated protein kinase CPK...   284   3e-74   
gi|388854435|emb|CCF52019.1| probable MAP kinase Kpp2 [Ustilago ...   284   3e-74   
gi|443897762|dbj|GAC75101.1| mitogen-activated protein kinase [P...   284   3e-74   
gi|367047403|ref|XP_003654081.1| hypothetical protein THITE_2049...   284   3e-74   
gi|4321114|gb|AAC49521.2| pathogenicity MAP kinase 1 [Magnaporth...   284   3e-74   
gi|58372548|gb|AAW71477.1| mitogen-activated protein kinase [Ver...   284   3e-74   
gi|340518833|gb|EGR49073.1| mitogen activated protein kinase [Tr...   284   3e-74   
gi|53988395|gb|AAV28228.1| mitogen-activated protein kinase [Tri...   284   3e-74   
gi|170099656|ref|XP_001881046.1| mitogen-activated protein kinas...   284   3e-74   
gi|407915827|gb|EKG09339.1| hypothetical protein MPH_13653 [Macr...   283   3e-74   
gi|41688570|sp|Q00859.1|MAPK_FUSSO RecName: Full=Mitogen-activat...   283   3e-74   
gi|23534536|gb|AAN34610.1| MAP kinase TmkA [Trichoderma virens] ...   283   3e-74   
gi|392561996|gb|EIW55177.1| mitogen-activated protein kinase [Tr...   283   3e-74   
gi|346326982|gb|EGX96578.1| mitogen-activated protein kinase [Co...   283   3e-74   
gi|319411667|emb|CBQ73711.1| MAP kinase Kpp2 [Sporisorium reilia...   283   3e-74   
gi|346975675|gb|EGY19127.1| mitogen-activated protein kinase [Ve...   283   3e-74   
gi|501310497|dbj|GAC99257.1| likely protein kinase [Pseudozyma h...   283   3e-74   
gi|501756009|emb|CCG80902.1| MAP kinase MpkB/Fus3 [Taphrina defo...   283   3e-74   
gi|291190448|ref|NP_001167267.1| Mitogen-activated protein kinas...   283   4e-74   
gi|402080159|gb|EJT75304.1| CMGC/MAPK/ERK protein kinase [Gaeuma...   283   4e-74   
gi|5739482|gb|AAD50496.1|AF174649_1 mitogen activated protein ki...   283   4e-74   
gi|12657601|dbj|BAB21569.1| mitogen-activated protein kinase [Co...   283   4e-74   
gi|194379966|dbj|BAG58335.1| unnamed protein product [Homo sapiens]   283   4e-74   
gi|389629044|ref|XP_003712175.1| CMGC/MAPK/ERK protein kinase [M...   283   4e-74   
gi|367032326|ref|XP_003665446.1| hypothetical protein MYCTH_2095...   283   4e-74   
gi|340381920|ref|XP_003389469.1| PREDICTED: hypothetical protein...   283   4e-74   
gi|307107984|gb|EFN56225.1| hypothetical protein CHLNCDRAFT_1450...   283   4e-74   
gi|499019864|ref|XP_004560716.1| PREDICTED: mitogen-activated pr...   283   5e-74   
gi|348533081|ref|XP_003454034.1| PREDICTED: mitogen-activated pr...   283   5e-74   
gi|288812706|gb|ADC54228.1| protein kinase [Corynespora cassiicola]   283   5e-74   
gi|471569850|gb|EMR69124.1| putative mitogen-activated protein k...   283   5e-74   
gi|470252198|ref|XP_004359196.1| extracellular signal-regulated ...   283   5e-74   
gi|340380811|ref|XP_003388915.1| PREDICTED: mitogen-activated pr...   283   5e-74   
gi|440640009|gb|ELR09928.1| CMGC/MAPK protein kinase [Geomyces d...   283   5e-74   
gi|399226872|gb|AFP36302.1| MAP kinase SmkA, partial [Stachybotr...   283   5e-74   
gi|378732018|gb|EHY58477.1| mitogen-activated protein kinase [Ex...   283   5e-74   
gi|444317959|ref|XP_004179637.1| hypothetical protein TBLA_0C031...   283   5e-74   
gi|398396810|ref|XP_003851863.1| mitogen-activated protein kinas...   283   6e-74   
gi|295293385|gb|ADF87942.1| MAP kinase [Eriocheir sinensis]           283   6e-74   
gi|18479080|gb|AAL73403.1| pathogenicity MAP kinase 1 [Fusarium ...   283   6e-74   
gi|7547261|gb|AAA34343.2| protein kinase [Candida albicans]           283   6e-74   
gi|353558797|sp|C4YGK0.1|ERK1_CANAW RecName: Full=Extracellular ...   283   6e-74   
gi|32709397|gb|AAP86959.1| ERK-like protein CpMK2 [Cryphonectria...   283   6e-74   
gi|13430383|gb|AAK25816.1|AF348490_1 MAP kinase [Neurospora cras...   283   6e-74   
gi|154277902|ref|XP_001539783.1| mitogen-activated protein kinas...   283   7e-74   
gi|391341045|ref|XP_003744842.1| PREDICTED: mitogen-activated pr...   282   7e-74   
gi|321258669|ref|XP_003194055.1| mitogen-activated protein kinas...   282   7e-74   
gi|393236220|gb|EJD43770.1| kinase-like protein [Auricularia del...   282   8e-74   
gi|449544529|gb|EMD35502.1| mitogen-activated protein kinase [Ce...   282   8e-74   
gi|260159566|gb|ACX32460.1| mitogen-activated protein kinase [Sc...   282   8e-74   
gi|47551261|ref|NP_999813.1| MAP kinase [Strongylocentrotus purp...   282   8e-74   
gi|51968308|dbj|BAD42855.1| mitogen-activated protein kinase [Bi...   282   8e-74   
gi|325089166|gb|EGC42476.1| mitogen activated protein kinase [Aj...   282   8e-74   
gi|395515876|ref|XP_003762125.1| PREDICTED: mitogen-activated pr...   282   9e-74   
gi|6224710|gb|AAF05913.1|AF178977_1 mitogen-activated protein ki...   282   9e-74   
gi|501292082|dbj|BAN20448.1| extracellular regulated MAP kinase ...   282   9e-74   
gi|111380705|gb|ABH09728.1| FUS3-like protein [Talaromyces marne...   282   1e-73   
gi|392571638|gb|EIW64810.1| mitogen activated protein kinase [Tr...   282   1e-73   
gi|225560880|gb|EEH09161.1| mitogen-activated protein kinase [Aj...   282   1e-73   
gi|68480890|ref|XP_715598.1| likely protein kinase [Candida albi...   282   1e-73   
gi|472580796|gb|EMS18569.1| extracellular signal-regulated kinas...   282   1e-73   
gi|62184237|gb|AAX73416.1| mitogen activated protein kinase 1 [V...   282   1e-73   
gi|353558908|sp|Q5A1D3.2|ERK1_CANAL RecName: Full=Extracellular ...   282   1e-73   
gi|116789860|gb|ABK25416.1| unknown [Picea sitchensis] >gi|14890...   281   1e-73   
gi|336375449|gb|EGO03785.1| hypothetical protein SERLA73DRAFT_17...   281   1e-73   
gi|13620175|emb|CAC36428.1| mitogen activated protein kinase [Fu...   281   1e-73   
gi|149234583|ref|XP_001523171.1| extracellular signal-regulated ...   281   1e-73   
gi|488539841|ref|XP_004461533.1| PREDICTED: mitogen-activated pr...   281   1e-73   
gi|126335546|ref|XP_001364363.1| PREDICTED: mitogen-activated pr...   281   1e-73   
gi|449550790|gb|EMD41754.1| hypothetical protein CERSUDRAFT_4299...   281   1e-73   
gi|119194681|ref|XP_001247944.1| mitogen-activated protein kinas...   281   1e-73   
gi|471901708|emb|CCO29881.1| hypothetical protein BN14_03902 [Rh...   281   1e-73   
gi|58267208|ref|XP_570760.1| mitogen-activated protein (MAP) kin...   281   1e-73   
gi|392589208|gb|EIW78539.1| mitogen-activated protein kinase [Co...   281   1e-73   
gi|405120551|gb|AFR95321.1| CMGC/MAPK/ERK protein kinase [Crypto...   281   1e-73   
gi|58267876|ref|XP_571094.1| Mitogen-activated protein kinase CP...   281   2e-73   
gi|134111545|ref|XP_775308.1| hypothetical protein CNBE0270 [Cry...   281   2e-73   
gi|466003047|ref|XP_004268688.1| PREDICTED: mitogen-activated pr...   281   2e-73   
gi|226289846|gb|EEH45330.1| mitogen-activated protein kinase MKC...   281   2e-73   
gi|443726565|gb|ELU13684.1| hypothetical protein CAPTEDRAFT_9837...   281   2e-73   
gi|67526523|ref|XP_661323.1| hypothetical protein AN3719.2 [Aspe...   281   2e-73   
gi|261203693|ref|XP_002629060.1| mitogen-activated protein kinas...   281   2e-73   
gi|258567994|ref|XP_002584741.1| mitogen-activated protein kinas...   281   2e-73   
gi|405120532|gb|AFR95302.1| CMGC/MAPK/ERK protein kinase [Crypto...   281   2e-73   
gi|331224817|ref|XP_003325080.1| CMGC/MAPK protein kinase [Pucci...   281   2e-73   
gi|239608121|gb|EEQ85108.1| mitogen-activated protein kinase [Aj...   281   2e-73   
gi|440907057|gb|ELR57249.1| Mitogen-activated protein kinase 3, ...   281   2e-73   
gi|154936843|dbj|BAF75365.1| extracellular signal-regulated kina...   281   2e-73   
gi|194400492|gb|ACF61084.1| MAP kinase 1 [Villosiclava virens] >...   281   2e-73   
gi|402222109|gb|EJU02176.1| Pkinase-domain-containing protein [D...   281   2e-73   
gi|466003056|ref|XP_004268690.1| PREDICTED: mitogen-activated pr...   281   2e-73   
gi|444725829|gb|ELW66383.1| Mitogen-activated protein kinase 3 [...   281   2e-73   
gi|225683995|gb|EEH22279.1| mitogen-activated protein kinase [Pa...   281   2e-73   


>gi|511004569|gb|EPB85935.1| CMGC/MAPK protein kinase [Mucor circinelloides f. circinelloides
           1006PhL]
          Length = 432

 Score =  470 bits (1210), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 228/328 (69%), Positives = 262/328 (79%), Gaps = 9/328 (2%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLHQIIRS QPLTDAHFQYF+YQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 106 MEADLHQIIRSGQPLTDAHFQYFVYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 165

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+S++ +HN GFMTEYVATRWYR+PEIMLSFQNYTKAIDMWSVGCIFAEMLGG+
Sbjct: 166 DFGLARGYSENDEHNVGFMTEYVATRWYRSPEIMLSFQNYTKAIDMWSVGCIFAEMLGGR 225

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLFKGRDYVDQLNQILGILGTPDEETL RVGSERAQ+YI SLP+MP IPF  LYP+ANP 
Sbjct: 226 PLFKGRDYVDQLNQILGILGTPDEETLCRVGSERAQVYIRSLPRMPKIPFENLYPRANPM 285

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                    +FDP+ RI V+QALAH YL+AYHDE+DEP H   FDFSFE V+ I+DM++M
Sbjct: 286 AIDLLNKLLEFDPSKRIDVDQALAHPYLSAYHDEDDEPTHNSTFDFSFEVVDSIDDMRRM 345

Query: 241 IAQEVMSFKASKQAALGLNR-----QLGRKSSLSAPDRDSLSXXXXXXXXXXS-MYEYGA 294
           IAQEVMSFKA+K+++   N       L R+ S+SA DR++L+          S   + G 
Sbjct: 346 IAQEVMSFKANKESSDPRNNGNSGTNLKRRESMSAQDRETLAAAQARATLEPSPAADSGL 405

Query: 295 ASQHAAI--PSASMEVDEQLEQELGGLV 320
           A    A+  P+  MEVD+ LE+EL G +
Sbjct: 406 AVAETAVNPPNHHMEVDD-LERELSGAI 432



>gi|384489766|gb|EIE80988.1| MAP kinase [Rhizopus delemar RA 99-880]
          Length = 403

 Score =  470 bits (1209), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 233/326 (71%), Positives = 262/326 (80%), Gaps = 7/326 (2%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLHQIIRS QPLTDAHFQYF+YQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 79  MEADLHQIIRSGQPLTDAHFQYFVYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 138

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+SD+ D+NAGFMTEYVATRWYRAPEIMLSFQ+YTKAIDMWSVGCIFAEMLGG+
Sbjct: 139 DFGLARGYSDNADYNAGFMTEYVATRWYRAPEIMLSFQSYTKAIDMWSVGCIFAEMLGGR 198

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLFKGRDYVDQLNQILGILGTPDEETL RVGSERAQ+YI SLP+MP IPF  LYP+ANP 
Sbjct: 199 PLFKGRDYVDQLNQILGILGTPDEETLCRVGSERAQVYIRSLPRMPRIPFENLYPRANPT 258

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                    +FDP+ RITVE+ALAH YL+AYHDE+DEP H   FDFSFE  + IEDM +M
Sbjct: 259 AIDLLNKLLEFDPSKRITVEEALAHPYLSAYHDEDDEPTHNQTFDFSFEVADSIEDMSRM 318

Query: 241 IAQEVMSFKASKQAALGLNR--QLGRKSSLSAPDRDSLSXXXXXXXXXXSMYEYGAAS-Q 297
           IAQEVMS+KASKQ +L +N    L R+ S+SA DR++L+          S  +   +   
Sbjct: 319 IAQEVMSYKASKQQSLPINTGANLKRRESMSAQDREALAAAQARATQEASHADSSVSGIA 378

Query: 298 HAAI---PSASMEVDEQLEQELGGLV 320
            +A+   P   MEVDE LE+EL G V
Sbjct: 379 ESAVHHRPIRDMEVDE-LERELSGAV 403



>gi|511008912|gb|EPB90167.1| CMGC/MAPK protein kinase [Mucor circinelloides f. circinelloides
           1006PhL]
          Length = 432

 Score =  465 bits (1197), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 238/330 (72%), Positives = 259/330 (78%), Gaps = 15/330 (4%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLHQIIRS QPLTDAHFQYF+YQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 104 MEADLHQIIRSGQPLTDAHFQYFVYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 163

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+S SP+ NAGFMTEYVATRWYRAPEIMLSFQ YTKAIDMWSVGCIFAEMLGG+
Sbjct: 164 DFGLARGYSSSPEGNAGFMTEYVATRWYRAPEIMLSFQKYTKAIDMWSVGCIFAEMLGGR 223

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLFKGRDYVDQLNQILGILGTPDEETL RVGSERAQ+YI SL +MP IPF  LYP+A+P 
Sbjct: 224 PLFKGRDYVDQLNQILGILGTPDEETLCRVGSERAQVYIRSLTRMPKIPFQNLYPRASPL 283

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDPA RITVE+ALAH YL+AYHDE+DEP+H   FDFSFE VE +EDM+KM
Sbjct: 284 AIDLLNKLLTFDPAKRITVEEALAHPYLSAYHDEDDEPSHTQSFDFSFEVVESMEDMRKM 343

Query: 241 IAQEVMSFKASKQAALGLNRQLG-----RKSSLSAPDRDSL--SXXXXXXXXXXSMYEYG 293
           IAQEVM+FKA KQ    L  QLG     RK SLSA DR++L  S          S     
Sbjct: 344 IAQEVMTFKAQKQGLPPL--QLGAANLKRKESLSANDREALERSRDVAKDIDNNSHRNSS 401

Query: 294 AASQHAAIPSA-----SMEVDEQLEQELGG 318
           + +  AA P A     SM+VD  LE+ELGG
Sbjct: 402 SIAASAAAPVAQNRQESMDVDA-LERELGG 430



>gi|384495626|gb|EIE86117.1| MAP kinase [Rhizopus delemar RA 99-880]
          Length = 404

 Score =  418 bits (1074), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 212/326 (65%), Positives = 241/326 (73%), Gaps = 31/326 (9%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLHQIIRS QPLTDAHFQYF+YQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 104 MEADLHQIIRSGQPLTDAHFQYFVYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 163

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+SD+ D+NAGFMTEYVATRWYRAPEIMLSFQ+YTKA                 
Sbjct: 164 DFGLARGYSDNADYNAGFMTEYVATRWYRAPEIMLSFQSYTKA----------------- 206

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
                   VDQLNQILGILGTPDEETLRRVGSERAQ+YI SLP+MP IPF  LYP+ANP 
Sbjct: 207 -------NVDQLNQILGILGTPDEETLRRVGSERAQVYIRSLPRMPRIPFENLYPRANPM 259

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                    +FDP+ RITVE+ALAH YL+AYHDE+DEP H   FDFSFE V+ IEDM +M
Sbjct: 260 AIDLLNKLLEFDPSKRITVEEALAHPYLSAYHDEDDEPTHSQTFDFSFEVVDAIEDMSRM 319

Query: 241 IAQEVMSFKASKQAALGLNR--QLGRKSSLSAPDRDSLSXXXXXXXXXXSMYEYGAAS-Q 297
           IAQEVMS+KASKQ +L +N    L R+ S+SA DR++LS          +  + G +   
Sbjct: 320 IAQEVMSYKASKQPSLPVNTGANLRRRESMSAQDREALSAAQARATQEANDKDSGVSGVA 379

Query: 298 HAAI---PSASMEVDEQLEQELGGLV 320
            +A+   P   MEVDE LE+EL G+V
Sbjct: 380 ESAVHHRPIRDMEVDE-LEKELSGVV 404



>gi|328772948|gb|EGF82985.1| hypothetical protein BATDEDRAFT_33909 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 405

 Score =  404 bits (1039), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 190/268 (70%), Positives = 221/268 (82%), Gaps = 10/268 (3%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEAD+HQIIRSEQPLTDAH+QYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 104 MEADMHQIIRSEQPLTDAHYQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 163

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG  D+ D  +GFMTEYVATRWYRAPEIML+F+NYTKAIDMWSVGCIFAE+LG K
Sbjct: 164 DFGLARGLMDTQD--SGFMTEYVATRWYRAPEIMLAFRNYTKAIDMWSVGCIFAELLGSK 221

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLFKGRDYVDQLNQIL +LGTPD+ETL R+GS+RAQ+YI SLP+MP IPF  LY  A+  
Sbjct: 222 PLFKGRDYVDQLNQILSVLGTPDDETLSRIGSDRAQMYIRSLPQMPKIPFVNLYSSASEL 281

Query: 181 XXX------XXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELI 234
                          KFDPATR+TV++AL H YL AYHD  DEP H+ +FDFSFE VE +
Sbjct: 282 GSVFLHGLEMLEGLLKFDPATRMTVDEALVHPYLEAYHDPGDEPVHDRLFDFSFEIVESM 341

Query: 235 EDMKKMIAQEVMSFKASKQAA--LGLNR 260
           +DM+K+I+ E+  +K S++++  +GL R
Sbjct: 342 DDMRKLISAEIREYKHSQESSSQMGLGR 369



>gi|328773751|gb|EGF83788.1| hypothetical protein BATDEDRAFT_7947 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 355

 Score =  395 bits (1014), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 187/254 (73%), Positives = 203/254 (79%), Gaps = 15/254 (5%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGN------------ 48
           MEADLHQIIRS Q LTDAH+QYFIYQICRGLKYIHSANVLHRDLKPGN            
Sbjct: 96  MEADLHQIIRSAQALTDAHYQYFIYQICRGLKYIHSANVLHRDLKPGNAYRCYVKLFLSC 155

Query: 49  ---LLVNADCELKICDFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAID 105
              LLVNADCELKICDFGLARGFS  PD N GFMTEYVATRWYRAPEIML+F+NYTKAID
Sbjct: 156 LGNLLVNADCELKICDFGLARGFSSEPDVNGGFMTEYVATRWYRAPEIMLAFRNYTKAID 215

Query: 106 MWSVGCIFAEMLGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKM 165
           MWSVGCIFAE+LG KPLFKGRDYVDQLNQIL +LGTPD+ETL R+GSERAQ+YI SLPKM
Sbjct: 216 MWSVGCIFAELLGSKPLFKGRDYVDQLNQILSVLGTPDDETLSRIGSERAQLYIRSLPKM 275

Query: 166 PTIPFSQLYPKANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFD 225
             +P+  LYPKA P           FDPA RITVE+ALAH YL AYHD EDEP H    D
Sbjct: 276 KKVPWINLYPKATPVAIDLLERLLSFDPALRITVEEALAHPYLEAYHDSEDEPVHPSPCD 335

Query: 226 FSFESVELIEDMKK 239
           FSFES++ IE++K+
Sbjct: 336 FSFESIDSIEEIKR 349



>gi|336385356|gb|EGO26503.1| hypothetical protein SERLADRAFT_463646 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 434

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 200/325 (61%), Positives = 222/325 (68%), Gaps = 8/325 (2%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS QPLTDAHFQ F+YQ   GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 105 MEADLHAIIRSGQPLTDAHFQSFLYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 164

Query: 61  DFGLARGFS-----DSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAE 115
           DFGLARG++          N GFMTEYVATRWYRAPEIMLSF NYT AID+WSVGCI AE
Sbjct: 165 DFGLARGYTPGGGASKSAGNQGFMTEYVATRWYRAPEIMLSFANYTTAIDVWSVGCILAE 224

Query: 116 MLGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYP 175
           +LGGKP++KGRDYVDQLNQIL  LGTP E+TLRRVGS RAQ YI SLP  P +PFS LYP
Sbjct: 225 LLGGKPIYKGRDYVDQLNQILHYLGTPSEDTLRRVGSPRAQDYIRSLPIKPRVPFSTLYP 284

Query: 176 KANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIE 235
            ANP           FDPA RI+ EQAL H YL  +HD  DEP  E  FDFSFE  + IE
Sbjct: 285 HANPLAIDLLSQMLCFDPAKRISCEQALNHPYLQVWHDPADEPICESKFDFSFEEEDSIE 344

Query: 236 DMKKMIAQEVMSFKASKQAALGLNRQLGRKSSLSAPDRDSL--SXXXXXXXXXXSMYEYG 293
            MKK+I QEV SF+A  +A      Q+ R+ SL  P RD +  S          +   Y 
Sbjct: 345 GMKKLIVQEVNSFRAEVRAQARAAGQIRRQDSLPIPTRDEIINSPVQEYGPVHGATSGYT 404

Query: 294 AASQHAAIPSASMEVDEQLEQELGG 318
           A S     P    +  E+LE+EL G
Sbjct: 405 APSHRPPTPIMD-DPSEELERELAG 428



>gi|336372550|gb|EGO00889.1| hypothetical protein SERLA73DRAFT_87225 [Serpula lacrymans var.
           lacrymans S7.3]
          Length = 439

 Score =  384 bits (986), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 200/325 (61%), Positives = 222/325 (68%), Gaps = 8/325 (2%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS QPLTDAHFQ F+YQ   GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 110 MEADLHAIIRSGQPLTDAHFQSFLYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 169

Query: 61  DFGLARGFS-----DSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAE 115
           DFGLARG++          N GFMTEYVATRWYRAPEIMLSF NYT AID+WSVGCI AE
Sbjct: 170 DFGLARGYTPGGGASKSAGNQGFMTEYVATRWYRAPEIMLSFANYTTAIDVWSVGCILAE 229

Query: 116 MLGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYP 175
           +LGGKP++KGRDYVDQLNQIL  LGTP E+TLRRVGS RAQ YI SLP  P +PFS LYP
Sbjct: 230 LLGGKPIYKGRDYVDQLNQILHYLGTPSEDTLRRVGSPRAQDYIRSLPIKPRVPFSTLYP 289

Query: 176 KANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIE 235
            ANP           FDPA RI+ EQAL H YL  +HD  DEP  E  FDFSFE  + IE
Sbjct: 290 HANPLAIDLLSQMLCFDPAKRISCEQALNHPYLQVWHDPADEPICESKFDFSFEEEDSIE 349

Query: 236 DMKKMIAQEVMSFKASKQAALGLNRQLGRKSSLSAPDRDSL--SXXXXXXXXXXSMYEYG 293
            MKK+I QEV SF+A  +A      Q+ R+ SL  P RD +  S          +   Y 
Sbjct: 350 GMKKLIVQEVNSFRAEVRAQARAAGQIRRQDSLPIPTRDEIINSPVQEYGPVHGATSGYT 409

Query: 294 AASQHAAIPSASMEVDEQLEQELGG 318
           A S     P    +  E+LE+EL G
Sbjct: 410 APSHRPPTPIMD-DPSEELERELAG 433



>gi|501306417|dbj|GAC95459.1| hypothetical protein PHSY_003035 [Pseudozyma hubeiensis SY62]
          Length = 443

 Score =  384 bits (985), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 186/280 (66%), Positives = 211/280 (75%), Gaps = 4/280 (1%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS QPL+DAHFQ FIYQ   GLKYIHSA+VLHRDLKPGNLLVNADCELKIC
Sbjct: 110 MEADLHAIIRSGQPLSDAHFQSFIYQTLCGLKYIHSASVLHRDLKPGNLLVNADCELKIC 169

Query: 61  DFGLARGFSDSPD----HNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEM 116
           DFGLARGF   P+      AGFMTEYVATRWYRAPEIMLSFQNYT AID+WSVGCI AE+
Sbjct: 170 DFGLARGFETDPELAKQAGAGFMTEYVATRWYRAPEIMLSFQNYTTAIDIWSVGCILAEL 229

Query: 117 LGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPK 176
           LGG+P+FKGRDYVDQLNQIL  LGTP EETLRRVGS RAQ YI SLP  P IPF +LYP+
Sbjct: 230 LGGRPIFKGRDYVDQLNQILHYLGTPSEETLRRVGSPRAQDYIRSLPFQPRIPFQRLYPQ 289

Query: 177 ANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIED 236
           ANP          +FDPA RI+ E+AL H YLA +HD  DEP     FDF FESV+ +E 
Sbjct: 290 ANPLALDLLERMLEFDPAKRISCEEALQHPYLAVWHDPADEPVCPRKFDFGFESVDEVEG 349

Query: 237 MKKMIAQEVMSFKASKQAALGLNRQLGRKSSLSAPDRDSL 276
           MK++I +EV SF+   +    + +Q  R+ SL  P R+ +
Sbjct: 350 MKQLILEEVRSFRTEVRRQARMMQQPKRQESLPIPSREDI 389



>gi|296417482|ref|XP_002838386.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295634316|emb|CAZ82577.1| unnamed protein product [Tuber melanosporum]
          Length = 427

 Score =  383 bits (984), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 189/279 (67%), Positives = 214/279 (76%), Gaps = 8/279 (2%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP MP +PF +L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHYLGTPNEETLNRIGSPRAQEYVRNLPFMPKVPFGRLFPNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP +R++VE AL HSYL  +HD +DEP     FDFSFE V+ I DM+KM
Sbjct: 287 ALDLLNQMLAFDPTSRVSVETALEHSYLQIWHDAQDEPDCPTPFDFSFEVVDEISDMRKM 346

Query: 241 IAQEVMSFKAS------KQAALGLNRQLGRK-SSLSAPD 272
           I  EV  F+A+      + AAL +   LGRK SS+  PD
Sbjct: 347 ILNEVQVFRAAVRNRRVQHAALDI-AALGRKDSSVGIPD 384



>gi|323507958|emb|CBQ67829.1| probable mitogen-activated protein kinase MpkA [Sporisorium
           reilianum SRZ2]
          Length = 446

 Score =  383 bits (983), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 186/280 (66%), Positives = 210/280 (75%), Gaps = 4/280 (1%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS QPL+DAHFQ FIYQ   GLKYIHSA+VLHRDLKPGNLLVNADCELKIC
Sbjct: 110 MEADLHAIIRSGQPLSDAHFQSFIYQTLCGLKYIHSASVLHRDLKPGNLLVNADCELKIC 169

Query: 61  DFGLARGFSDSPD----HNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEM 116
           DFGLARGF   P+      AGFMTEYVATRWYRAPEIMLSFQNYT AID+WSVGCI AE+
Sbjct: 170 DFGLARGFETDPELAKQAGAGFMTEYVATRWYRAPEIMLSFQNYTTAIDIWSVGCILAEL 229

Query: 117 LGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPK 176
           LGG+P+FKGRDYVDQLNQIL  LGTP EETLRRVGS RAQ YI SLP  P IPF +LYP+
Sbjct: 230 LGGRPIFKGRDYVDQLNQILHYLGTPSEETLRRVGSPRAQDYIRSLPFQPRIPFQRLYPQ 289

Query: 177 ANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIED 236
           ANP          +FDPA RI+ E+AL H YLA +HD  DEP     FDF FESV+ +E 
Sbjct: 290 ANPLALDLLERMLEFDPARRISCEEALQHPYLAVWHDPADEPVCPRKFDFGFESVDEVEG 349

Query: 237 MKKMIAQEVMSFKASKQAALGLNRQLGRKSSLSAPDRDSL 276
           MK +I +EV SF+   +    + +Q  R+ SL  P R+ +
Sbjct: 350 MKTLILEEVRSFRTEVRRQARMMQQPRRQESLPIPSREDI 389



>gi|393222510|gb|EJD07994.1| kinase-like protein [Fomitiporia mediterranea MF3/22]
          Length = 440

 Score =  380 bits (977), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 186/283 (65%), Positives = 210/283 (74%), Gaps = 7/283 (2%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH I+RS QPL+DAHFQ F+YQ   GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 105 MEADLHAIVRSGQPLSDAHFQSFLYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 164

Query: 61  DFGLARGFSDSPDHNA-------GFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIF 113
           DFGLARG++     NA       GFMTEYVATRWYRAPEIMLSF NYT AID+WSVGCI 
Sbjct: 165 DFGLARGYTPGGGANAVRGAPNQGFMTEYVATRWYRAPEIMLSFANYTTAIDVWSVGCIL 224

Query: 114 AEMLGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQL 173
           AE+LGGKP+FKGRDYVDQLNQIL  LGTP E+TLRRVGS RAQ YI SLP  P IPF+ L
Sbjct: 225 AELLGGKPIFKGRDYVDQLNQILHYLGTPSEDTLRRVGSPRAQDYIRSLPIKPRIPFTTL 284

Query: 174 YPKANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVEL 233
           YP ANP           FDPA RI+ EQALAH YLA +HD  DEP  E  FDFSFE  + 
Sbjct: 285 YPHANPLALDLLSKMLTFDPAKRISCEQALAHPYLAVWHDPTDEPVCEKKFDFSFEEEDS 344

Query: 234 IEDMKKMIAQEVMSFKASKQAALGLNRQLGRKSSLSAPDRDSL 276
           IE MK++I +EV +F+A  ++      Q+ R+ SL  P R+ +
Sbjct: 345 IEGMKRLIVEEVNTFRALVRSQARAAGQMRRQESLPIPTREEI 387



>gi|378732004|gb|EHY58463.1| mitogen-activated protein kinase spm1 [Exophiala dermatitidis
           NIH/UT8656]
          Length = 412

 Score =  379 bits (974), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 177/249 (71%), Positives = 202/249 (81%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSQDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP MP IPF +L+P+ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQEYVRNLPYMPKIPFQRLFPQANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEPA    FDF+FE V+ +++M+KM
Sbjct: 287 ALDLLDRMLAFDPSSRISVEEALEHRYLHIWHDASDEPACPKTFDFAFEVVDDVQEMRKM 346

Query: 241 IAQEVMSFK 249
           I  EVM F+
Sbjct: 347 ILDEVMRFR 355



>gi|443896308|dbj|GAC73652.1| mitogen-activated protein kinase [Pseudozyma antarctica T-34]
          Length = 447

 Score =  379 bits (973), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 184/281 (65%), Positives = 208/281 (74%), Gaps = 5/281 (1%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS QPL+DAHFQ FIYQ   GLKYIHSA+VLHRDLKPGNLLVNADCELKIC
Sbjct: 110 MEADLHAIIRSGQPLSDAHFQSFIYQTLCGLKYIHSASVLHRDLKPGNLLVNADCELKIC 169

Query: 61  DFGLARGFSDSPD-----HNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAE 115
           DFGLARGF   P+        GFMTEYVATRWYRAPEIMLSFQNYT AID+WSVGCI AE
Sbjct: 170 DFGLARGFETDPELAKQAGAGGFMTEYVATRWYRAPEIMLSFQNYTTAIDIWSVGCILAE 229

Query: 116 MLGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYP 175
           +LGG+P+FKGRDYVDQLNQIL  LGTP EETLRRVGS RAQ YI SLP  P IPF +LYP
Sbjct: 230 LLGGRPIFKGRDYVDQLNQILHYLGTPSEETLRRVGSPRAQDYIRSLPYQPRIPFQRLYP 289

Query: 176 KANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIE 235
           +ANP          +FDPA RI+ E+AL H YLA +HD  DEP     FDF FE+V+ +E
Sbjct: 290 QANPLALDLLERMLEFDPAKRISCEEALQHPYLAVWHDPADEPVCPRKFDFGFEAVDEVE 349

Query: 236 DMKKMIAQEVMSFKASKQAALGLNRQLGRKSSLSAPDRDSL 276
            MK +I  EV SF+   +    + +Q  R+ SL  P R+ +
Sbjct: 350 GMKTLILDEVRSFRTEVRRQARMMQQPKRQESLPIPTREDI 390



>gi|388852163|emb|CCF54169.1| probable mitogen-activated protein kinase MpkA [Ustilago hordei]
          Length = 449

 Score =  378 bits (971), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 184/281 (65%), Positives = 208/281 (74%), Gaps = 5/281 (1%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS QPL+DAHFQ FIYQ   GLKYIH A+VLHRDLKPGNLLVNADCELKIC
Sbjct: 110 MEADLHAIIRSGQPLSDAHFQSFIYQTLCGLKYIHFASVLHRDLKPGNLLVNADCELKIC 169

Query: 61  DFGLARGFSDSPD-----HNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAE 115
           DFGLARGF   P+        GFMTEYVATRWYRAPEIMLSFQNYT AID+WSVGCI AE
Sbjct: 170 DFGLARGFETDPELAKQAGAGGFMTEYVATRWYRAPEIMLSFQNYTTAIDIWSVGCILAE 229

Query: 116 MLGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYP 175
           +L G+P+FKGRDYVDQLNQIL  LGTP EETLRRVGS RAQ YI SLP  P IPF +LYP
Sbjct: 230 LLSGRPIFKGRDYVDQLNQILHYLGTPSEETLRRVGSPRAQDYIRSLPYQPRIPFQRLYP 289

Query: 176 KANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIE 235
           +ANP          +FDPA RI+ E+AL H YLA +HD  DEP     FDF FESV+ +E
Sbjct: 290 QANPLALDLLERMLEFDPAKRISCEEALQHPYLAVWHDPADEPTCPRRFDFGFESVDEVE 349

Query: 236 DMKKMIAQEVMSFKASKQAALGLNRQLGRKSSLSAPDRDSL 276
            MK++I +EV SF+   +    L +Q  R+ SL  P R+ +
Sbjct: 350 GMKQLILEEVRSFRGEVRRQASLAQQPRRQESLPIPTREDI 390



>gi|392862546|gb|EAS36799.2| mitogen-activated protein kinase spm1 [Coccidioides immitis RS]
          Length = 422

 Score =  378 bits (971), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 178/250 (71%), Positives = 199/250 (79%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  PD NAG+MTEYVATRWYRAPEIMLSF +YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSIDPDENAGYMTEYVATRWYRAPEIMLSFPSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETLRR+GS RAQ Y+ +LP M  +PF +L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHYLGTPNEETLRRIGSPRAQDYVRNLPYMQKVPFQRLFPNANPE 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP  +  FDF FE VE + DM+KM
Sbjct: 287 ALDLLDRMLAFDPSSRISVEEALEHPYLQIWHDASDEPTCKTTFDFHFEVVEDVHDMRKM 346

Query: 241 IAQEVMSFKA 250
           I  EVM F+A
Sbjct: 347 ILDEVMRFRA 356



>gi|119195213|ref|XP_001248210.1| hypothetical protein CIMG_01981 [Coccidioides immitis RS]
          Length = 421

 Score =  378 bits (971), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 178/250 (71%), Positives = 199/250 (79%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  PD NAG+MTEYVATRWYRAPEIMLSF +YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSIDPDENAGYMTEYVATRWYRAPEIMLSFPSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETLRR+GS RAQ Y+ +LP M  +PF +L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHYLGTPNEETLRRIGSPRAQDYVRNLPYMQKVPFQRLFPNANPE 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP  +  FDF FE VE + DM+KM
Sbjct: 287 ALDLLDRMLAFDPSSRISVEEALEHPYLQIWHDASDEPTCKTTFDFHFEVVEDVHDMRKM 346

Query: 241 IAQEVMSFKA 250
           I  EVM F+A
Sbjct: 347 ILDEVMRFRA 356



>gi|320034832|gb|EFW16775.1| mitogen-activated protein kinase MKC1 [Coccidioides posadasii str.
           Silveira]
          Length = 422

 Score =  378 bits (970), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 178/250 (71%), Positives = 199/250 (79%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  PD NAG+MTEYVATRWYRAPEIMLSF +YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSIDPDENAGYMTEYVATRWYRAPEIMLSFPSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETLRR+GS RAQ Y+ +LP M  +PF +L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHYLGTPNEETLRRIGSPRAQDYVRNLPYMQKVPFQRLFPNANPE 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP  +  FDF FE VE + DM+KM
Sbjct: 287 ALDLLDRMLAFDPSSRISVEEALEHPYLQIWHDASDEPTCKTTFDFHFEVVEDVHDMRKM 346

Query: 241 IAQEVMSFKA 250
           I  EVM F+A
Sbjct: 347 ILDEVMRFRA 356



>gi|303310627|ref|XP_003065325.1| Mitogen-activated protein kinase SLT2/MPK1 , putative [Coccidioides
           posadasii C735 delta SOWgp]
 gi|240104987|gb|EER23180.1| Mitogen-activated protein kinase SLT2/MPK1 , putative [Coccidioides
           posadasii C735 delta SOWgp]
          Length = 439

 Score =  378 bits (970), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 178/250 (71%), Positives = 199/250 (79%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  PD NAG+MTEYVATRWYRAPEIMLSF +YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSIDPDENAGYMTEYVATRWYRAPEIMLSFPSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETLRR+GS RAQ Y+ +LP M  +PF +L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHYLGTPNEETLRRIGSPRAQDYVRNLPYMQKVPFQRLFPNANPE 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP  +  FDF FE VE + DM+KM
Sbjct: 287 ALDLLDRMLAFDPSSRISVEEALEHPYLQIWHDASDEPTCKTTFDFHFEVVEDVHDMRKM 346

Query: 241 IAQEVMSFKA 250
           I  EVM F+A
Sbjct: 347 ILDEVMRFRA 356



>gi|409080374|gb|EKM80734.1| hypothetical protein AGABI1DRAFT_112477 [Agaricus bisporus var.
           burnettii JB137-S8]
 gi|426197275|gb|EKV47202.1| hypothetical protein AGABI2DRAFT_192446 [Agaricus bisporus var.
           bisporus H97]
          Length = 436

 Score =  377 bits (969), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 185/281 (65%), Positives = 204/281 (72%), Gaps = 5/281 (1%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS QPLTDAHFQ FIYQ   GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 105 MEADLHAIIRSGQPLTDAHFQSFIYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 164

Query: 61  DFGLARGFS-----DSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAE 115
           DFGLARG+S          N GFMTEYVATRWYRAPEIMLSF NYT AID+WS+GCI AE
Sbjct: 165 DFGLARGYSPGGGTSRAAGNQGFMTEYVATRWYRAPEIMLSFANYTTAIDVWSIGCILAE 224

Query: 116 MLGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYP 175
           +LGGKP++KGRDYVDQLNQIL  LGTP EETLRRVGS RAQ YI SLP  P +PFS LYP
Sbjct: 225 LLGGKPIYKGRDYVDQLNQILHYLGTPPEETLRRVGSPRAQDYIRSLPIKPRVPFSTLYP 284

Query: 176 KANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIE 235
           +ANP           FDP  RI  EQAL H Y A +HD  DEP     FDFSFE  + IE
Sbjct: 285 RANPLAIDLLGQMLHFDPIKRIGCEQALNHPYFAVWHDPADEPVCPSTFDFSFEEEDTIE 344

Query: 236 DMKKMIAQEVMSFKASKQAALGLNRQLGRKSSLSAPDRDSL 276
            MKK+I +EV SF+   +     + Q+ R+ SL  P R+ +
Sbjct: 345 GMKKLIVEEVRSFRTEVRNQAKASSQIRRQDSLPIPSREEI 385



>gi|403417686|emb|CCM04386.1| predicted protein [Fibroporia radiculosa]
          Length = 433

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 192/323 (59%), Positives = 220/323 (68%), Gaps = 5/323 (1%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS+QPL+DAHFQ FIYQ   GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 105 MEADLHAIIRSQQPLSDAHFQSFIYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 164

Query: 61  DFGLARGFSDSP----DHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEM 116
           DFGLARG++         N GFMTEYVATRWYRAPEIMLSF NY  AID+WSVGCI AE+
Sbjct: 165 DFGLARGYNAGSAAKSSANQGFMTEYVATRWYRAPEIMLSFANYGPAIDVWSVGCILAEL 224

Query: 117 LGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPK 176
           L GKP+FKGRDYVDQLNQIL  LGTP E+TLRRVGS RAQ YI SLP  P +PF  L+P+
Sbjct: 225 LAGKPIFKGRDYVDQLNQILHYLGTPSEDTLRRVGSPRAQDYIRSLPIKPRVPFQTLFPR 284

Query: 177 ANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIED 236
           ANP          +FDPA RIT EQAL H YLA +HD  DEPA    FDF FE  + IE 
Sbjct: 285 ANPLAIDLLSQLLQFDPAKRITCEQALNHPYLAVWHDPADEPACPTPFDFGFEEEDSIEG 344

Query: 237 MKKMIAQEVMSFKASKQAALGLNRQLGRKSSLSAPDRDSLSXXXXXXXXXXSMYEYGAAS 296
           MK +I +EV +F++  +A      Q+ R+ SL  P R+ +           +    G   
Sbjct: 345 MKHLIVEEVRAFRSEVRAQARAGGQIRRQDSLPMPSREEIMSSPVLENAPANGATSGFTE 404

Query: 297 QHAAIPSASM-EVDEQLEQELGG 318
           Q    PS  M +   +LE+EL G
Sbjct: 405 QTQRPPSPVMDDPSAELERELAG 427



>gi|449542075|gb|EMD33055.1| hypothetical protein CERSUDRAFT_118129 [Ceriporiopsis subvermispora
           B]
          Length = 430

 Score =  377 bits (968), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 197/328 (60%), Positives = 223/328 (67%), Gaps = 18/328 (5%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS+QPL+DAHFQ FIYQ   GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 105 MEADLHAIIRSQQPLSDAHFQSFIYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 164

Query: 61  DFGLARGFSDSPDH-------NAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIF 113
           DFGLARG+S    +       N GFMTEYVATRWYRAPEIMLSF NY  AID+WSVGCI 
Sbjct: 165 DFGLARGYSPGGSNTTRATAANQGFMTEYVATRWYRAPEIMLSFANYGPAIDVWSVGCIL 224

Query: 114 AEMLGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQL 173
           AE+L GKP+FKGRDYVDQLNQIL  LGTP E+TLRRVGS RAQ YI SLP  P +PFS L
Sbjct: 225 AELLAGKPIFKGRDYVDQLNQILHYLGTPSEDTLRRVGSPRAQDYIRSLPIKPRVPFSTL 284

Query: 174 YPKANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVEL 233
           +P+ANP           FDPA RIT EQAL H YLA +HD  DEP     FDF FE  + 
Sbjct: 285 FPRANPLAIDLLSQLLHFDPAKRITCEQALNHPYLAVWHDPADEPVCPTPFDFGFEEEDS 344

Query: 234 IEDMKKMIAQEVMSFKASKQAALGLNRQLGRKSSLSAPDRDSLSXXXXXXXXXXSMYEYG 293
           IE MK++I +EV SF+A  +A      Q+ R+ SL  P R+ +            + E G
Sbjct: 345 IEGMKRLIVEEVHSFRAEVRAQARAAGQIKRQESLPMPTREEI--------LASPILENG 396

Query: 294 A--ASQHAAIPSASM-EVDEQLEQELGG 318
               S  A  PS  M +   +LE+EL G
Sbjct: 397 GGFGSDMARAPSPIMDDPSAELERELAG 424



>gi|395330161|gb|EJF62545.1| CMGC/MAPK/ERK protein kinase [Dichomitus squalens LYAD-421 SS1]
          Length = 437

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 185/283 (65%), Positives = 208/283 (73%), Gaps = 7/283 (2%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS+QPL+DAHFQ FIYQ   GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 105 MEADLHAIIRSQQPLSDAHFQSFIYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 164

Query: 61  DFGLARGFSDSPDHN-------AGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIF 113
           DFGLARG+S S  +N        GFMTEYVATRWYRAPEIMLSF NY  AID+WSVGCI 
Sbjct: 165 DFGLARGYSPSGGNNNARGTANQGFMTEYVATRWYRAPEIMLSFANYGPAIDVWSVGCIL 224

Query: 114 AEMLGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQL 173
           AE+L GKP+FKGRDYVDQLNQIL  LGTP E+TLRRVGS RAQ YI SLP  P +PF+ L
Sbjct: 225 AELLAGKPIFKGRDYVDQLNQILHYLGTPSEDTLRRVGSPRAQDYIRSLPIKPRVPFATL 284

Query: 174 YPKANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVEL 233
           +P+ANP           FDPA RIT EQAL H YLA +HD  DEP     FDF FE  + 
Sbjct: 285 FPRANPLAIDLLSQLLHFDPAKRITCEQALNHPYLAVWHDPADEPVCASPFDFGFEEEDS 344

Query: 234 IEDMKKMIAQEVMSFKASKQAALGLNRQLGRKSSLSAPDRDSL 276
           IE MK++I +EV +F+A  +A      Q+ R+ SL  P RD +
Sbjct: 345 IEGMKRLIVEEVHAFRAEVRAQARAAGQIRRQESLPVPTRDEI 387



>gi|390603513|gb|EIN12905.1| CMGC/MAPK/ERK protein kinase [Punctularia strigosozonata HHB-11173
           SS5]
          Length = 433

 Score =  377 bits (967), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 193/322 (59%), Positives = 217/322 (67%), Gaps = 6/322 (1%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS QPL+DAHFQ F+YQ   GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 105 MEADLHAIIRSGQPLSDAHFQSFLYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 164

Query: 61  DFGLARGFS-----DSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAE 115
           DFGLARG++          N GFMTEYVATRWYRAPEIMLSF NYT AID+WS+GCI AE
Sbjct: 165 DFGLARGYTPGGGASRAAGNQGFMTEYVATRWYRAPEIMLSFANYTTAIDVWSIGCILAE 224

Query: 116 MLGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYP 175
           +LGGKP+FKGRDYVDQLNQIL  LGTP E+TLRRVGS RAQ YI SLP  P IPF  LYP
Sbjct: 225 LLGGKPIFKGRDYVDQLNQILHYLGTPSEDTLRRVGSPRAQDYIRSLPIKPRIPFQNLYP 284

Query: 176 KANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIE 235
            ANP           FDPA RI+ E AL H YL  +HD  DEP  E  FDFSFE  + IE
Sbjct: 285 HANPLAIDLLSKMLCFDPAKRISCEDALKHPYLQVWHDPADEPVCEKKFDFSFEEEDSIE 344

Query: 236 DMKKMIAQEVMSFKASKQAALGLNRQLGRKSSLSAPDRDSLSXXXXXXXXXXSMYEYGAA 295
            MKK+I +EV SF+A  +A      Q+ ++ SL  P RD +           +    G  
Sbjct: 345 GMKKLIVEEVNSFRAEVRAQARAAGQVRKQDSLPIPSRDEIISSPVQEHAPRNGATSGYT 404

Query: 296 SQHAAIPSASM-EVDEQLEQEL 316
              A  P   M +   +LE+EL
Sbjct: 405 GARATAPEPIMDDPSAELEKEL 426



>gi|340915022|gb|EGS18363.1| mitogen-activated protein kinase SLT2/MPK1-like protein [Chaetomium
           thermophilum var. thermophilum DSM 1495]
          Length = 411

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 179/257 (69%), Positives = 200/257 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ N G+MTEYVATRWYRAPEIMLSFQNYTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSVDPEENVGYMTEYVATRWYRAPEIMLSFQNYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP M   PF  L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVRNLPYMAKKPFHTLFPNANPE 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP+ RITVE+ALAH YLA +HD  DEP    +F+F FE+V+ I +M+KM
Sbjct: 287 ALDLLDKMLAFDPSKRITVEEALAHPYLAIWHDPSDEPECPSVFNFDFEAVDDINEMRKM 346

Query: 241 IAQEVMSFKASKQAALG 257
           I  EV  F+   + A G
Sbjct: 347 ILDEVFRFRQLVRTAPG 363



>gi|392561389|gb|EIW54571.1| CMGC/MAPK/ERK protein kinase [Trametes versicolor FP-101664 SS1]
          Length = 438

 Score =  375 bits (964), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 185/283 (65%), Positives = 206/283 (72%), Gaps = 7/283 (2%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS+QPL+DAHFQ FIYQ   GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 105 MEADLHAIIRSQQPLSDAHFQSFIYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 164

Query: 61  DFGLARGFSDSPDH-------NAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIF 113
           DFGLARG+S            N GFMTEYVATRWYRAPEIMLSF NY  AID+WSVGCI 
Sbjct: 165 DFGLARGYSPGSGSSQARGGANQGFMTEYVATRWYRAPEIMLSFANYGPAIDVWSVGCIL 224

Query: 114 AEMLGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQL 173
           AE+L GKP+FKGRDYVDQLNQIL  LGTP E+TLRRVGS RAQ YI SLP  P +PFS L
Sbjct: 225 AELLAGKPIFKGRDYVDQLNQILHYLGTPSEDTLRRVGSPRAQDYIRSLPIKPRVPFSTL 284

Query: 174 YPKANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVEL 233
           +P+ANP           FDPA RIT EQAL H YLA +HD  DEP     FDF FE  + 
Sbjct: 285 FPRANPLAIDLLAQLLHFDPAKRITCEQALNHPYLAVWHDPADEPTCASPFDFGFEEEDS 344

Query: 234 IEDMKKMIAQEVMSFKASKQAALGLNRQLGRKSSLSAPDRDSL 276
           IE MK++I +EV +F+A  +A      Q+ R+ SL  P RD +
Sbjct: 345 IEGMKRLIVEEVHAFRAEVRAQARAAGQIRRQESLPMPSRDEI 387



>gi|406602023|emb|CCH46402.1| Mitogen-activated protein kinase SLT2/MPK1 [Wickerhamomyces
           ciferrii]
          Length = 519

 Score =  375 bits (963), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 176/249 (70%), Positives = 201/249 (80%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQIIRS QPLTDAH+Q FIYQI  GLKYIHSA+VLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDMHQIIRSGQPLTDAHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+S  P+ NAGF+TEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LG K
Sbjct: 167 DFGLARGYSSIPEKNAGFLTEYVATRWYRAPEIMLSFQSYTKAIDIWSVGCILAELLGSK 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+FKG+DYVDQLNQIL I+GTP EETL R+GS+RAQ Y+ SLP MP IPF++LYP ANP 
Sbjct: 227 PIFKGKDYVDQLNQILYIVGTPPEETLTRIGSQRAQDYVRSLPFMPKIPFNKLYPNANPE 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                      DPA RITVE+AL H YL  +HD  DEP     FDF+FE V+ +E M++M
Sbjct: 287 ALDLLDRMLCLDPAKRITVEEALTHPYLKVWHDPADEPICSSKFDFAFEEVDDLEAMRQM 346

Query: 241 IAQEVMSFK 249
           I  EV SF+
Sbjct: 347 ILDEVESFR 355



>gi|50545801|ref|XP_500439.1| YALI0B02816p [Yarrowia lipolytica]
 gi|49646305|emb|CAG82657.1| YALI0B02816p [Yarrowia lipolytica CLIB122]
          Length = 505

 Score =  375 bits (963), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 176/250 (70%), Positives = 199/250 (79%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQIIRS QPLTDAH+Q F+YQI  G+KYIHSA+VLHRDLKPGNLLVNADCELKIC
Sbjct: 108 MECDMHQIIRSGQPLTDAHYQSFVYQILAGVKYIHSADVLHRDLKPGNLLVNADCELKIC 167

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS   + NAGF+TEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGGK
Sbjct: 168 DFGLARGFSSDDEKNAGFLTEYVATRWYRAPEIMLSFQSYTKAIDIWSVGCILAELLGGK 227

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLFKG++YVDQLNQIL  LGTP EETL+R+GS RAQ Y+  LP MP IPFS L+P ANP 
Sbjct: 228 PLFKGKNYVDQLNQILHYLGTPSEETLKRIGSPRAQEYVRGLPFMPKIPFSTLFPTANPE 287

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDPA R+TVE+AL H YL  +HD  DEP     FDFSFE V  +E MK+M
Sbjct: 288 ALDLLEKMLAFDPAERVTVEEALEHPYLKIWHDPRDEPVCPTPFDFSFEEVNDMEAMKQM 347

Query: 241 IAQEVMSFKA 250
           I  EV+ F+A
Sbjct: 348 ILDEVVDFRA 357



>gi|392934129|gb|AFM92257.1| mitogen activated protein kinase [Drechslerella stenobrocha]
          Length = 414

 Score =  375 bits (962), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 183/278 (65%), Positives = 210/278 (75%), Gaps = 7/278 (2%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSTDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS+RAQ Y+ +LP MP IPF +L+  ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHFLGTPNEETLCRIGSQRAQEYVRNLPFMPKIPFQRLFQNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP+ RITVE+AL H YL  +HD  DEP     F+F+FE VE I +MKKM
Sbjct: 287 ALDLLDRMLAFDPSERITVEEALEHRYLQIWHDPSDEPTCPTEFEFAFEVVEEIAEMKKM 346

Query: 241 IAQEVMSFKASKQAALGLNRQLGRKS-SLSAPDRDSLS 277
           I  EV+ F+ +      + +Q G +  S+  PDR  + 
Sbjct: 347 ILDEVIRFRHN------VRKQPGTQDISMQIPDRSDVG 378



>gi|4580577|gb|AAD24428.1|U59214_1 MAP protein kinase MPKA [Emericella nidulans]
          Length = 418

 Score =  375 bits (962), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 174/251 (69%), Positives = 203/251 (80%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAH+Q FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 109 MECDLAAIIRSGQPLTDAHYQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 168

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 169 DFGLARGFSIDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 228

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP MP +PF +L+P ANP 
Sbjct: 229 PFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQEYVRNLPFMPKVPFQRLFPNANPD 288

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YLA +HD  DEP+    FDF FE V+ +++M++M
Sbjct: 289 ALDLLDRMLAFDPSSRISVEEALEHPYLAIWHDASDEPSCPTTFDFHFEVVDDVQEMRRM 348

Query: 241 IAQEVMSFKAS 251
           I +EV+ F+ S
Sbjct: 349 IYEEVVRFRQS 359



>gi|425768957|gb|EKV07468.1| hypothetical protein PDIG_73290 [Penicillium digitatum PHI26]
 gi|425776172|gb|EKV14402.1| hypothetical protein PDIP_43770 [Penicillium digitatum Pd1]
          Length = 440

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 176/251 (70%), Positives = 200/251 (79%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 125 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 184

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 185 DFGLARGFSIDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 244

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP MP + F QL+P+ANP 
Sbjct: 245 PFFKGRDYVDQLNQILHYLGTPNEETLARIGSPRAQEYVRNLPFMPKVAFKQLFPQANPD 304

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP     FDF FE V+ + DM+KM
Sbjct: 305 ALDLLDRMLAFDPSSRISVEEALEHPYLHIWHDASDEPNCPTTFDFHFEVVDEVPDMRKM 364

Query: 241 IAQEVMSFKAS 251
           I  EV+ F+A+
Sbjct: 365 ILDEVIRFRAT 375



>gi|302680955|ref|XP_003030159.1| hypothetical protein SCHCODRAFT_82727 [Schizophyllum commune H4-8]
 gi|300103850|gb|EFI95256.1| hypothetical protein SCHCODRAFT_82727 [Schizophyllum commune H4-8]
          Length = 420

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 184/280 (65%), Positives = 206/280 (73%), Gaps = 4/280 (1%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS QPLTDAHFQ F+YQ   GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 105 MEADLHAIIRSGQPLTDAHFQSFLYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 164

Query: 61  DFGLARGFSD---SPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEML 117
           DFGLARG+S    S  +N GFMTEYVATRWYRAPE+MLSF NYT AID+WS+GCI AE+L
Sbjct: 165 DFGLARGYSSGTGSASNNQGFMTEYVATRWYRAPEVMLSFANYTTAIDVWSIGCILAELL 224

Query: 118 GGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKA 177
           GGKP+FKGRDYVDQLNQIL  LGTP E+TLRRVGS RAQ YI SLP  P +PF+ L+P A
Sbjct: 225 GGKPIFKGRDYVDQLNQILHYLGTPSEDTLRRVGSPRAQDYIRSLPIKPRVPFATLFPHA 284

Query: 178 NPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDM 237
           NP           FDPA RI+ EQAL H Y   +HD  DEP  E  FDF FE  + IE M
Sbjct: 285 NPLAIDLLSKMLCFDPAKRISCEQALNHPYFQVWHDPADEPICEAKFDFGFEEEDSIEGM 344

Query: 238 KKMIAQEVMSFKASKQAALGLNRQLGRK-SSLSAPDRDSL 276
           KK+I +EV  F+A  +A      Q+ R  S+L  P RD +
Sbjct: 345 KKLIIEEVKQFRAEVRAQARAAGQIQRSGSNLGIPSRDEI 384



>gi|115389850|ref|XP_001212430.1| mitogen-activated protein kinase spm1 [Aspergillus terreus NIH2624]
 gi|114194826|gb|EAU36526.1| mitogen-activated protein kinase spm1 [Aspergillus terreus NIH2624]
          Length = 421

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 175/250 (70%), Positives = 200/250 (80%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSIDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP MP IPF +L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQEYVRNLPYMPKIPFQRLFPNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP     FDF FE VE +++M++M
Sbjct: 287 ALDLLDRMLAFDPSSRISVEEALEHPYLHIWHDASDEPTCPTTFDFHFEVVEDVQEMRRM 346

Query: 241 IAQEVMSFKA 250
           I  EV+ F++
Sbjct: 347 IYDEVVRFRS 356



>gi|121708701|ref|XP_001272220.1| MAP kinase MpkA [Aspergillus clavatus NRRL 1]
 gi|119400368|gb|EAW10794.1| MAP kinase MpkA [Aspergillus clavatus NRRL 1]
          Length = 422

 Score =  374 bits (960), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 175/250 (70%), Positives = 199/250 (79%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSIDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP MP +PF +L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQEYVRNLPFMPKVPFQRLFPNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDPA+RI+VE+AL H YL  +HD  DEP     FDF FE V+ +++M+KM
Sbjct: 287 ALDLLDRMLAFDPASRISVEEALEHPYLHIWHDASDEPTCPTTFDFHFEVVDDVQEMRKM 346

Query: 241 IAQEVMSFKA 250
           I  EV+ F+ 
Sbjct: 347 IYDEVVRFRT 356



>gi|340514134|gb|EGR44402.1| mitogen activated protein kinase 2 [Trichoderma reesei QM6a]
          Length = 413

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 181/272 (66%), Positives = 206/272 (75%), Gaps = 1/272 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETLRR+GS RAQ Y+ +LP MP  PF  L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHILGTPNEETLRRIGSPRAQEYVRNLPFMPKKPFPALFPDANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP+ RI+VEQAL H YL  +HD  DEP     F+F FE VE + +M+KM
Sbjct: 287 ALDLLDKMLAFDPSQRISVEQALEHPYLHIWHDASDEPDCPTTFNFDFEVVEDVGEMRKM 346

Query: 241 IAQEVMSFKA-SKQAALGLNRQLGRKSSLSAP 271
           I  EV+ F+   + A    N+  G++  +  P
Sbjct: 347 ILDEVLRFRQLVRTAPASGNQGAGQQIQVPLP 378



>gi|259484861|tpe|CBF81444.1| TPA: MAP protein kinase MPKA [Source:UniProtKB/TrEMBL;Acc:Q9Y7V6]
           [Aspergillus nidulans FGSC A4]
          Length = 330

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 174/251 (69%), Positives = 203/251 (80%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAH+Q FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 21  MECDLAAIIRSGQPLTDAHYQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 80

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 81  DFGLARGFSIDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 140

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP MP +PF +L+P ANP 
Sbjct: 141 PFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQEYVRNLPFMPKVPFQRLFPNANPD 200

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YLA +HD  DEP+    FDF FE V+ +++M++M
Sbjct: 201 ALDLLDRMLAFDPSSRISVEEALEHPYLAIWHDASDEPSCPTTFDFHFEVVDDVQEMRRM 260

Query: 241 IAQEVMSFKAS 251
           I +EV+ F+ S
Sbjct: 261 IYEEVVRFRQS 271



>gi|407919134|gb|EKG12389.1| hypothetical protein MPH_10506 [Macrophomina phaseolina MS6]
          Length = 415

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 179/249 (71%), Positives = 197/249 (79%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGGK
Sbjct: 167 DFGLARGFSMDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGK 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP MP + F+QL+  ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQDYVRNLPYMPKVQFAQLFRNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP+ RI+VE+AL H YL  +HD  DEP+    FDF FE VE I DMKKM
Sbjct: 287 ALDLLDRMLAFDPSQRISVEEALEHRYLHIWHDASDEPSCPTTFDFHFEVVEDIGDMKKM 346

Query: 241 IAQEVMSFK 249
           I QEV  F+
Sbjct: 347 ILQEVQRFR 355



>gi|119499844|ref|XP_001266679.1| MAP kinase MpkA [Neosartorya fischeri NRRL 181]
 gi|119414844|gb|EAW24782.1| MAP kinase MpkA [Neosartorya fischeri NRRL 181]
          Length = 422

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 176/249 (70%), Positives = 199/249 (79%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSIDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP MP IPF +L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQEYVRNLPFMPKIPFQRLFPNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDPA+RI+VE+AL H YL  +HD  DEP     FDF FE V+ +++M+KM
Sbjct: 287 ALDLLDRMLAFDPASRISVEEALEHPYLHIWHDASDEPTCPTTFDFHFEVVDDVQEMRKM 346

Query: 241 IAQEVMSFK 249
           I  EV+ F+
Sbjct: 347 IYDEVVRFR 355



>gi|35384078|gb|AAQ84550.1| MAP kinase [Trichoderma atroviride]
          Length = 413

 Score =  374 bits (959), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 177/249 (71%), Positives = 197/249 (79%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKA+D+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAMDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETLRR+GS RAQ Y+ +LP MP  PF  L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHILGTPNEETLRRIGSPRAQEYVRNLPFMPKKPFPALFPDANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP+ RI+VEQAL H YL  +HD  DEP     F+F FE VE + DM+KM
Sbjct: 287 ALDLLDKMLAFDPSQRISVEQALEHPYLHIWHDASDEPDCPTTFNFDFEVVEDVGDMRKM 346

Query: 241 IAQEVMSFK 249
           I  EV+ F+
Sbjct: 347 ILDEVLRFR 355



>gi|345562062|gb|EGX45134.1| hypothetical protein AOL_s00173g235 [Arthrobotrys oligospora ATCC
           24927]
          Length = 419

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 195/332 (58%), Positives = 230/332 (69%), Gaps = 25/332 (7%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP MP I F++L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHYLGTPNEETLCRIGSPRAQEYVRNLPFMPKIAFNRLFPNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP+ RITVE+AL H YL  +HD  DEP     F F FE VE I++MKKM
Sbjct: 287 ALDLLDKMLAFDPSERITVEKALEHRYLQIWHDPSDEPTCPAEFQFGFEVVEDIQEMKKM 346

Query: 241 IAQEVMSFKASKQAALGLNRQLGRKS-SLSAPDRDSLSXXXXXXXXXXSMYEYG--AASQ 297
           I  EV++F+ + +   G   Q G  + S+  P+R +               +YG  A   
Sbjct: 347 ILDEVVTFRHTVRKPAG---QAGSDTISVGIPERQATG-------------QYGDQAPRP 390

Query: 298 HAA---IPSASMEVDEQLEQELGGLVKENAHH 326
           H A   +P  +  ++ +L    GGL   +A+H
Sbjct: 391 HEAGTYVPDGNAALEAELA---GGLDGRHAYH 419



>gi|358388055|gb|EHK25649.1| mitogen activated protein kinase tmk2 [Trichoderma virens Gv29-8]
          Length = 413

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 177/249 (71%), Positives = 197/249 (79%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETLRR+GS RAQ Y+ +LP MP  PF  L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHILGTPNEETLRRIGSPRAQEYVRNLPFMPKKPFPALFPDANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP+ RI+VEQAL H YL  +HD  DEP     F+F FE VE + +M+KM
Sbjct: 287 ALDLLDKMLAFDPSQRISVEQALEHPYLHIWHDASDEPDCPTTFNFDFEVVEDVGEMRKM 346

Query: 241 IAQEVMSFK 249
           I  EV+ F+
Sbjct: 347 ILDEVLRFR 355



>gi|83016541|dbj|BAE53433.1| MAP kinase Mps1 [Trichoderma harzianum]
          Length = 413

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 177/249 (71%), Positives = 197/249 (79%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETLRR+GS RAQ Y+ +LP MP  PF  L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHILGTPNEETLRRIGSPRAQEYVRNLPFMPKKPFPALFPDANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP+ RI+VEQAL H YL  +HD  DEP     F+F FE VE + +M+KM
Sbjct: 287 ALDLLDKMLAFDPSQRISVEQALEHPYLHIWHDASDEPDCPTTFNFDFEVVEDVGEMRKM 346

Query: 241 IAQEVMSFK 249
           I  EV+ F+
Sbjct: 347 ILDEVLRFR 355



>gi|342882058|gb|EGU82812.1| hypothetical protein FOXB_06615 [Fusarium oxysporum Fo5176]
 gi|475665493|gb|EMT63285.1| Mitogen-activated protein kinase spm1 [Fusarium oxysporum f. sp.
           cubense race 4]
 gi|477515294|gb|ENH67650.1| Mitogen-activated protein kinase spm1 [Fusarium oxysporum f. sp.
           cubense race 1]
          Length = 418

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 179/271 (66%), Positives = 203/271 (74%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP MP  PF  L+P+ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVRNLPFMPKKPFPSLFPQANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VEQAL H YL  +HD  DEP     F+F FE VE +  M+ M
Sbjct: 287 ALDLLDKMLAFDPSSRISVEQALEHPYLHIWHDASDEPDCPTTFNFDFEVVEDVGQMRGM 346

Query: 241 IAQEVMSFKASKQAALGLNRQLGRKSSLSAP 271
           I  EVM F+ + +   G     G ++    P
Sbjct: 347 ILDEVMRFRQTVRTVPGQGGPAGLQNQQGVP 377



>gi|70993224|ref|XP_751459.1| MAP kinase MpkA [Aspergillus fumigatus Af293]
 gi|66849093|gb|EAL89421.1| MAP kinase MpkA [Aspergillus fumigatus Af293]
 gi|159125606|gb|EDP50723.1| MAP kinase MpkA [Aspergillus fumigatus A1163]
          Length = 424

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 176/249 (70%), Positives = 199/249 (79%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSIDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP MP IPF +L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQEYVRNLPFMPKIPFQRLFPNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDPA+RI+VE+AL H YL  +HD  DEP     FDF FE V+ +++M+KM
Sbjct: 287 ALDLLDRMLAFDPASRISVEEALEHPYLHIWHDASDEPTCPTTFDFHFEVVDDVQEMRKM 346

Query: 241 IAQEVMSFK 249
           I  EV+ F+
Sbjct: 347 IYDEVVRFR 355



>gi|224555567|gb|ACN56446.1| pMAP kinase THMK [Trichoderma harzianum]
          Length = 406

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 177/249 (71%), Positives = 197/249 (79%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETLRR+GS RAQ Y+ +LP MP  PF  L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHILGTPNEETLRRIGSPRAQEYVRNLPFMPKKPFPALFPDANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP+ RI+VEQAL H YL  +HD  DEP     F+F FE VE + +M+KM
Sbjct: 287 ALDLLDKMLAFDPSQRISVEQALEHPYLHIWHDASDEPDCPTTFNFDFEVVEDVGEMRKM 346

Query: 241 IAQEVMSFK 249
           I  EV+ F+
Sbjct: 347 ILDEVLRFR 355



>gi|189313357|gb|ACD88751.1| TmkB [Trichoderma virens]
          Length = 413

 Score =  373 bits (958), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 177/249 (71%), Positives = 197/249 (79%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETLRR+GS RAQ Y+ +LP MP  PF  L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHILGTPNEETLRRIGSPRAQEYVRNLPFMPKKPFPALFPDANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP+ RI+VEQAL H YL  +HD  DEP     F+F FE VE + +M+KM
Sbjct: 287 ALDLLDKMLAFDPSQRISVEQALEHPYLHIWHDASDEPDCPTTFNFDFEVVEDVGEMRKM 346

Query: 241 IAQEVMSFK 249
           I  EV+ F+
Sbjct: 347 ILDEVLRFR 355



>gi|358390167|gb|EHK39573.1| mitogen activated protein kinase tmk2 [Trichoderma atroviride IMI
           206040]
          Length = 413

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 177/249 (71%), Positives = 197/249 (79%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETLRR+GS RAQ Y+ +LP MP  PF  L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHILGTPNEETLRRIGSPRAQEYVRNLPFMPKKPFPALFPDANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP+ RI+VEQAL H YL  +HD  DEP     F+F FE VE + +M+KM
Sbjct: 287 ALDLLDKMLAFDPSQRISVEQALEHPYLHIWHDASDEPDCPTTFNFDFEVVEDVGEMRKM 346

Query: 241 IAQEVMSFK 249
           I  EV+ F+
Sbjct: 347 ILDEVLRFR 355



>gi|471574376|gb|EMR72233.1| putative map kinase protein [Eutypa lata UCREL1]
          Length = 423

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 178/259 (68%), Positives = 201/259 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP M   PF QL+P+ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHILGTPNEETLSRIGSSRAQEYVRNLPFMGKKPFPQLFPQANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VEQAL H YL  +HD  DEP     F+F FE ++ + DM+KM
Sbjct: 287 ALDLLDRMLAFDPSSRISVEQALEHPYLQIWHDASDEPDCPTTFNFDFEVLDDVGDMRKM 346

Query: 241 IAQEVMSFKASKQAALGLN 259
           I  EV  F+   + A G N
Sbjct: 347 ILDEVYRFRQLVRTAPGAN 365



>gi|145230127|ref|XP_001389372.1| mitogen-activated protein kinase spm1 [Aspergillus niger CBS
           513.88]
 gi|134055487|emb|CAK44002.1| unnamed protein product [Aspergillus niger]
 gi|350638431|gb|EHA26787.1| mitogen-activated protein kinase [Aspergillus niger ATCC 1015]
 gi|358365399|dbj|GAA82021.1| mitogen-activated protein kinase spm1 [Aspergillus kawachii IFO
           4308]
          Length = 421

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 176/250 (70%), Positives = 198/250 (79%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSIDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP MP IPF +L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQEYVRNLPFMPKIPFQRLFPNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP +RI+VE+AL H YL  +HD  DEP     FDF FE VE +++M+ M
Sbjct: 287 ALDLLDRMLAFDPTSRISVEEALEHPYLHIWHDASDEPTCPTTFDFHFEVVEDVQEMRHM 346

Query: 241 IAQEVMSFKA 250
           I  EV+ F+A
Sbjct: 347 IYDEVVRFRA 356



>gi|402216600|gb|EJT96685.1| kinase-like protein [Dacryopinax sp. DJM-731 SS1]
          Length = 434

 Score =  373 bits (957), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 195/326 (59%), Positives = 219/326 (67%), Gaps = 11/326 (3%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS QPL+DAHFQ FIYQ   GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 106 MEADLHAIIRSGQPLSDAHFQSFIYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 165

Query: 61  DFGLARGFSDSP-------DHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIF 113
           DFGLARG+   P           GFMTEYVATRWYRAPEIMLSF NY  AID+WSVGCIF
Sbjct: 166 DFGLARGWQPGPGTQQHSNKGQQGFMTEYVATRWYRAPEIMLSFANYGPAIDIWSVGCIF 225

Query: 114 AEMLGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQL 173
           AE+LGGKP+FKGRDYVDQLNQIL  LGTP E+TLRRVGS RAQ YI SLP  P IPF  L
Sbjct: 226 AELLGGKPIFKGRDYVDQLNQILHYLGTPSEDTLRRVGSPRAQDYIRSLPIKPRIPFQSL 285

Query: 174 YPKANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVEL 233
           YP ANP           FDPA RI+ E+AL H YLA +HD  DEP     FDF FE V+ 
Sbjct: 286 YPHANPLAIDLLSQMLCFDPAKRISCEKALEHPYLAVWHDTADEPLCSQTFDFGFEEVDD 345

Query: 234 IEDMKKMIAQEVMSFKASKQAALGLNRQLGRKSSLSAPDRDSLSXXXXXXXXXXSMYEYG 293
           +  MK++I +EV SF+A  ++      Q  ++ SL  P RD +           S Y + 
Sbjct: 346 MPGMKQLIIEEVNSFRALVRSQARQQLQARKQDSLPIPSRDDILASPVVENDGTSGYTFP 405

Query: 294 AASQHAAIPSASM--EVDEQLEQELG 317
             S  A  PS  M  E   +L++ELG
Sbjct: 406 HPS--APGPSGGMVEEPGAELDKELG 429



>gi|212534704|ref|XP_002147508.1| MAP kinase MpkA [Talaromyces marneffei ATCC 18224]
 gi|210069907|gb|EEA23997.1| MAP kinase MpkA [Talaromyces marneffei ATCC 18224]
          Length = 420

 Score =  372 bits (956), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 176/250 (70%), Positives = 200/250 (80%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSIDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP EETL R+GS RAQ Y+ +LP MP IPF +L+P+ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHYLGTPAEETLSRIGSPRAQEYVRNLPFMPKIPFQRLFPQANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP+ RI+VE+AL H YL  +HD  DEP+    FDF FE V+ + +M+KM
Sbjct: 287 ALDLLDRMLAFDPSKRISVEEALEHRYLHIWHDASDEPSCPTTFDFHFEVVDDVGEMRKM 346

Query: 241 IAQEVMSFKA 250
           I  EV++F+A
Sbjct: 347 ILDEVINFRA 356



>gi|169764447|ref|XP_001816695.1| mitogen-activated protein kinase spm1 [Aspergillus oryzae RIB40]
 gi|238504304|ref|XP_002383383.1| MAP kinase MpkA [Aspergillus flavus NRRL3357]
 gi|45504120|dbj|BAD12561.1| mitogen-activated protein kinase MpkA [Aspergillus oryzae]
 gi|83764549|dbj|BAE54693.1| unnamed protein product [Aspergillus oryzae RIB40]
 gi|220690854|gb|EED47203.1| MAP kinase MpkA [Aspergillus flavus NRRL3357]
 gi|391869983|gb|EIT79171.1| mitogen-activated protein kinase [Aspergillus oryzae 3.042]
          Length = 423

 Score =  372 bits (956), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 174/249 (69%), Positives = 200/249 (80%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSIDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP MP IPF +L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQEYVRNLPFMPKIPFQRLFPSANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP     FDF FE V+ +++M++M
Sbjct: 287 ALDLLDRMLAFDPSSRISVEEALEHPYLHIWHDASDEPTCPTTFDFHFEVVDDVQEMRRM 346

Query: 241 IAQEVMSFK 249
           I +EV+ F+
Sbjct: 347 IYEEVVRFR 355



>gi|367026121|ref|XP_003662345.1| hypothetical protein MYCTH_2302899 [Myceliophthora thermophila ATCC
           42464]
 gi|347009613|gb|AEO57100.1| hypothetical protein MYCTH_2302899 [Myceliophthora thermophila ATCC
           42464]
          Length = 412

 Score =  372 bits (955), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 175/249 (70%), Positives = 197/249 (79%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQNYTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSIDPEENAGYMTEYVATRWYRAPEIMLSFQNYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP M   PF+QL+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVRNLPYMSKKPFAQLFPNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP  RI+VE+AL H YLA +HD  DEP     F+F FE ++ + +M+KM
Sbjct: 287 ALDLLDRMLAFDPTRRISVEEALEHPYLAIWHDASDEPDCPTTFNFDFEVIDDVNEMRKM 346

Query: 241 IAQEVMSFK 249
           I +EV  F+
Sbjct: 347 ILEEVFRFR 355



>gi|89279387|gb|ABD67163.1| putative MAP kinase [Fusarium proliferatum]
          Length = 418

 Score =  372 bits (954), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 178/271 (65%), Positives = 202/271 (74%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTK ID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKTIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP MP  PF  L+P+ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVRNLPFMPKKPFPSLFPQANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VEQAL H YL  +HD  DEP     F+F FE VE +  M+ M
Sbjct: 287 ALDLLDKMLAFDPSSRISVEQALEHPYLHIWHDASDEPDCPTTFNFDFEVVEDVGQMRGM 346

Query: 241 IAQEVMSFKASKQAALGLNRQLGRKSSLSAP 271
           I  EVM F+ + +   G     G ++    P
Sbjct: 347 ILDEVMRFRQTVRTVPGQGGPAGLQNQQGVP 377



>gi|17978662|gb|AAL50116.1| mitogen-activated protein kinase [Colletotrichum lagenaria]
 gi|477530433|gb|ENH82163.1| map kinase [Colletotrichum orbiculare MAFF 240422]
          Length = 418

 Score =  372 bits (954), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 177/249 (71%), Positives = 198/249 (79%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP MP  PF QL+ +ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVRNLPFMPKKPFPQLFAQANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VEQAL H YL  +HD  DEP     F+F FE VE + DM+KM
Sbjct: 287 ALDLLDRMLAFDPSSRISVEQALEHPYLHIWHDASDEPDCPTTFNFDFEVVEDVGDMRKM 346

Query: 241 IAQEVMSFK 249
           I +EV  F+
Sbjct: 347 ILEEVYRFR 355



>gi|242790924|ref|XP_002481655.1| MAP kinase MpkA [Talaromyces stipitatus ATCC 10500]
 gi|242790927|ref|XP_002481656.1| MAP kinase MpkA [Talaromyces stipitatus ATCC 10500]
 gi|218718243|gb|EED17663.1| MAP kinase MpkA [Talaromyces stipitatus ATCC 10500]
 gi|218718244|gb|EED17664.1| MAP kinase MpkA [Talaromyces stipitatus ATCC 10500]
          Length = 420

 Score =  372 bits (954), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 176/250 (70%), Positives = 200/250 (80%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSIDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP EETL R+GS RAQ Y+ +LP MP IPF +L+P+ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHYLGTPAEETLSRIGSPRAQEYVRNLPFMPKIPFQRLFPQANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP+ RI+VE+AL H YL  +HD  DEP+    FDF FE V+ + +M+KM
Sbjct: 287 ALDLLDRMLAFDPSKRISVEEALEHRYLHIWHDVSDEPSCPTTFDFHFEVVDDVGEMRKM 346

Query: 241 IAQEVMSFKA 250
           I  EV++F+A
Sbjct: 347 ILDEVINFRA 356



>gi|255947318|ref|XP_002564426.1| Pc22g03870 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211591443|emb|CAP97675.1| Pc22g03870 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 422

 Score =  372 bits (954), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 175/251 (69%), Positives = 200/251 (79%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSIDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP MP + F QL+P+ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHYLGTPNEETLARIGSPRAQEYVRNLPFMPKVAFKQLFPQANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP     FDF FE V+ + +M+KM
Sbjct: 287 ALDLLDRMLAFDPSSRISVEEALEHPYLHIWHDASDEPNCPTTFDFHFEVVDEVPEMRKM 346

Query: 241 IAQEVMSFKAS 251
           I  EV+ F+A+
Sbjct: 347 ILDEVIRFRAT 357



>gi|380089795|emb|CCC12327.1| putative MAK1 protein [Sordaria macrospora k-hell]
          Length = 413

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 178/263 (67%), Positives = 201/263 (76%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQNYTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQNYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP MP   F  L+P+ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVRNLPPMPKKSFQALFPQANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP +RI+VE+AL H YLA +HD  DEP     F+F FE V+ + +M+KM
Sbjct: 287 ALDLLDRMLAFDPTSRISVEEALKHPYLAIWHDASDEPDCPTTFNFDFEVVDDVGEMRKM 346

Query: 241 IAQEVMSFKASKQAALGLNRQLG 263
           I  EV  F+   +   G + Q G
Sbjct: 347 ILDEVYRFRQMVRTVPGGHEQGG 369



>gi|336268919|ref|XP_003349221.1| MAK1 protein [Sordaria macrospora k-hell]
          Length = 471

 Score =  371 bits (953), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 178/263 (67%), Positives = 201/263 (76%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQNYTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQNYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP MP   F  L+P+ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVRNLPPMPKKSFQALFPQANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP +RI+VE+AL H YLA +HD  DEP     F+F FE V+ + +M+KM
Sbjct: 287 ALDLLDRMLAFDPTSRISVEEALKHPYLAIWHDASDEPDCPTTFNFDFEVVDDVGEMRKM 346

Query: 241 IAQEVMSFKASKQAALGLNRQLG 263
           I  EV  F+   +   G + Q G
Sbjct: 347 ILDEVYRFRQMVRTVPGGHEQGG 369



>gi|389743919|gb|EIM85103.1| CMGC/MAPK/ERK protein kinase [Stereum hirsutum FP-91666 SS1]
          Length = 427

 Score =  371 bits (952), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 191/319 (59%), Positives = 213/319 (66%), Gaps = 3/319 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS QPL+DAHFQ FIYQ   GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 105 MEADLHAIIRSGQPLSDAHFQSFIYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 164

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGF+       GFMTEYVATRWYRAPEIMLSF NY  AID+WSVGCI AE+L GK
Sbjct: 165 DFGLARGFNQQ--QRQGFMTEYVATRWYRAPEIMLSFANYASAIDVWSVGCILAELLAGK 222

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+FKGRDYVDQLNQIL  LGTP E+TLRRVGS RAQ YI SLP  P +PF QL+P+ANP 
Sbjct: 223 PIFKGRDYVDQLNQILHYLGTPSEDTLRRVGSPRAQDYIRSLPIRPRVPFQQLFPQANPQ 282

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDPA RIT EQAL H YLA +HD  DEP     FDF FE  + IE MKK+
Sbjct: 283 AIDLLSKMLNFDPAKRITCEQALEHPYLAVWHDPSDEPVCPTTFDFDFEEEDSIEGMKKL 342

Query: 241 IAQEVMSFKASKQAALGLNRQLGRKSSLSAPDRDSLSXXXXXXXXXXSMYEYGAASQHAA 300
           I  EV  F+   +A      Q  R+ +L  P  D ++          +    G  S    
Sbjct: 343 IVDEVNLFRQEVRAQARAASQGRRQDTLPIPSHDDIAASPIQEDVPANGATSGYYSGTNT 402

Query: 301 IPSASM-EVDEQLEQELGG 318
             S  M +   +LE+EL G
Sbjct: 403 PSSPVMDDPSAELERELAG 421



>gi|302913383|ref|XP_003050911.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256731849|gb|EEU45198.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 419

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 176/249 (70%), Positives = 196/249 (78%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP MP  PF  L+P+ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVRNLPFMPKKPFPSLFPQANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VEQAL H YL  +HD  DEP     F+F FE VE +  M+ M
Sbjct: 287 ALDLLDKMLAFDPSSRISVEQALEHPYLHIWHDASDEPDCPTTFNFDFEVVEDVGQMRSM 346

Query: 241 IAQEVMSFK 249
           I  EVM F+
Sbjct: 347 ILDEVMRFR 355



>gi|380038140|gb|AFD31817.1| MAP kinase [Colletotrichum gloeosporioides]
 gi|429850666|gb|ELA25920.1| MAP kinase [Colletotrichum gloeosporioides Nara gc5]
          Length = 420

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 176/249 (70%), Positives = 198/249 (79%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP MP  PF  L+P+ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVRNLPFMPKKPFPSLFPQANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VEQAL H YL  +HD  DEP     F+F FE VE + +M+KM
Sbjct: 287 ALDLLDRMLAFDPSSRISVEQALEHPYLHIWHDASDEPDCPTTFNFDFEVVEDVGEMRKM 346

Query: 241 IAQEVMSFK 249
           I +EV  F+
Sbjct: 347 ILEEVYRFR 355



>gi|336472015|gb|EGO60175.1| mitogen-activated protein kinase MKC1 [Neurospora tetrasperma FGSC
           2508]
 gi|350294783|gb|EGZ75868.1| mitogen-activated protein kinase MKC1 [Neurospora tetrasperma FGSC
           2509]
          Length = 443

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 176/249 (70%), Positives = 196/249 (78%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 137 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 196

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQNYTKAID+WSVGCI AE+LGG+
Sbjct: 197 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQNYTKAIDVWSVGCILAELLGGR 256

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP MP   F QL+P+ANP 
Sbjct: 257 PFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVRNLPPMPKKSFQQLFPQANPD 316

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP +RI+VE AL H YLA +HD  DEP     F+F FE V+ + +M+KM
Sbjct: 317 ALDLLDRMLAFDPTSRISVEDALKHPYLAIWHDASDEPDCPTPFNFDFEVVDDVGEMRKM 376

Query: 241 IAQEVMSFK 249
           I  EV  F+
Sbjct: 377 ILDEVFRFR 385



>gi|380487070|emb|CCF38280.1| hypothetical protein CH063_09413 [Colletotrichum higginsianum]
          Length = 463

 Score =  370 bits (951), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 176/249 (70%), Positives = 197/249 (79%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 151 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 210

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 211 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 270

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP MP  PF  L+P+ANP 
Sbjct: 271 PFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVRNLPFMPKKPFPSLFPQANPD 330

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VEQAL H YL  +HD  DEP     F+F FE VE + +M+KM
Sbjct: 331 ALDLLDRMLAFDPSSRISVEQALEHPYLHIWHDASDEPDCPTTFNFDFEVVEDVGEMRKM 390

Query: 241 IAQEVMSFK 249
           I  EV  F+
Sbjct: 391 ILDEVYRFR 399



>gi|328862985|gb|EGG12085.1| hypothetical protein MELLADRAFT_46685 [Melampsora larici-populina
           98AG31]
          Length = 443

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 183/284 (64%), Positives = 206/284 (72%), Gaps = 11/284 (3%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS QPL+DAHFQ FIYQ   GLKYIHSA+VLHRDLKPGNLLVNADCELKIC
Sbjct: 108 MEADLHAIIRSGQPLSDAHFQSFIYQTLCGLKYIHSASVLHRDLKPGNLLVNADCELKIC 167

Query: 61  DFGLARGFSDSPD----HNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEM 116
           DFGLARGF   P      N GFMTEYVATRWYRAPEIMLSFQNYT AIDMWSVGCI AE+
Sbjct: 168 DFGLARGFETDPALAQASNQGFMTEYVATRWYRAPEIMLSFQNYTTAIDMWSVGCILAEL 227

Query: 117 LGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPK 176
           LGG+P+FKGRDYVDQLNQIL  LGTP E+TLRRVGS RAQ YI SLP  P +PF QLYP 
Sbjct: 228 LGGRPIFKGRDYVDQLNQILHYLGTPSEQTLRRVGSPRAQDYIRSLPHKPGVPFDQLYPN 287

Query: 177 ANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIED 236
           ANP           FDP+ RIT  +AL H YLA +HD  DE   +  FDF FE+ +  E 
Sbjct: 288 ANPLALDLLSKLLSFDPSERITCNEALRHPYLAVWHDPADEIDCQERFDFGFEAEDSTEG 347

Query: 237 MKKMIAQEVMSFK------ASKQAALGLNRQLGRKSSLSAPDRD 274
           MK++I +EV SF+      A+ +   G   Q+ R+ +L  P R+
Sbjct: 348 MKRLIVEEVTSFRRMVRPNATSRQNSGQGEQI-RREALPIPSRE 390



>gi|154275466|ref|XP_001538584.1| mitogen-activated protein kinase MKC1 [Ajellomyces capsulatus NAm1]
 gi|150415024|gb|EDN10386.1| mitogen-activated protein kinase MKC1 [Ajellomyces capsulatus NAm1]
          Length = 423

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 175/249 (70%), Positives = 198/249 (79%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  PD NAG+MTEYVATRWYRAPEIMLSF +YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSIDPDENAGYMTEYVATRWYRAPEIMLSFPSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP M  IPF +L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQEYVRNLPYMHKIPFQRLFPNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP+    FDF FE VE + +M+KM
Sbjct: 287 ALDLLDRMLAFDPSSRISVEEALEHRYLHIWHDASDEPSCPTTFDFHFEVVEDVPEMRKM 346

Query: 241 IAQEVMSFK 249
           I +EV+ F+
Sbjct: 347 ILEEVLRFR 355



>gi|85089638|ref|XP_958040.1| mitogen-activated protein kinase MKC1 [Neurospora crassa OR74A]
 gi|28919352|gb|EAA28804.1| mitogen-activated protein kinase MKC1 [Neurospora crassa OR74A]
          Length = 454

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 176/249 (70%), Positives = 196/249 (78%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 148 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 207

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQNYTKAID+WSVGCI AE+LGG+
Sbjct: 208 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQNYTKAIDVWSVGCILAELLGGR 267

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP MP   F QL+P+ANP 
Sbjct: 268 PFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVRNLPPMPKKSFQQLFPQANPD 327

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP +RI+VE AL H YLA +HD  DEP     F+F FE V+ + +M+KM
Sbjct: 328 ALDLLDRMLAFDPTSRISVEDALKHPYLAIWHDASDEPDCPTPFNFDFEVVDDVGEMRKM 387

Query: 241 IAQEVMSFK 249
           I  EV  F+
Sbjct: 388 ILDEVFRFR 396



>gi|406860678|gb|EKD13735.1| TmkB [Marssonina brunnea f. sp. 'multigermtubi' MB_m1]
          Length = 412

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 179/271 (66%), Positives = 203/271 (74%), Gaps = 3/271 (1%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP M   PF  L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVRNLPHMAKRPFPSLFPNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP     F+F FE VE + +M+KM
Sbjct: 287 ALTLLDHMLAFDPSSRISVEEALEHPYLHIWHDASDEPGCPTTFNFDFEVVEDVGEMRKM 346

Query: 241 IAQEVMSFKASKQAALGLNRQLGRKSSLSAP 271
           I +EV  F+   +   G   QLG     + P
Sbjct: 347 ILEEVARFRQHVRIQPG---QLGNTQGPAVP 374



>gi|449296349|gb|EMC92369.1| hypothetical protein BAUCODRAFT_286788 [Baudoinia compniacensis
           UAMH 10762]
          Length = 413

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 177/263 (67%), Positives = 201/263 (76%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 109 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 168

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LG K
Sbjct: 169 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGSK 228

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP E TL R+GS RAQ Y+ +LP M  IPF QL+P+ANP 
Sbjct: 229 PFFKGRDYVDQLNQILHYLGTPSESTLSRIGSPRAQEYVRNLPYMSKIPFQQLFPRANPD 288

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP+ RI VE+AL H YL+ +HD  DEP+    FDF+FE VE + +M++M
Sbjct: 289 ALDLLDRMLAFDPSQRIGVEEALEHRYLSIWHDPSDEPSCPQTFDFAFEVVEDVPEMRQM 348

Query: 241 IAQEVMSFKASKQAALGLNRQLG 263
           I +EV  F+ + +    L  Q G
Sbjct: 349 ILEEVRQFRHAVRTPQHLQYQQG 371



>gi|171694455|ref|XP_001912152.1| hypothetical protein [Podospora anserina S mat+]
 gi|38373930|gb|AAR19206.1| MAP kinase 1 [Podospora anserina]
 gi|170947176|emb|CAP73981.1| unnamed protein product [Podospora anserina S mat+]
          Length = 413

 Score =  370 bits (950), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 175/257 (68%), Positives = 199/257 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQNYTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQNYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP M    F  L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVRNLPFMAKKSFPSLFPNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP+ RI+VE+AL H YLA +HD  DEP     F+F FE ++ + +M+KM
Sbjct: 287 ALDLLDRMLAFDPSRRISVEEALEHPYLAIWHDASDEPDCPTTFNFDFEVIDDVNEMRKM 346

Query: 241 IAQEVMSFKASKQAALG 257
           I  EV++F+A  +   G
Sbjct: 347 ILSEVVNFRAQVRTVPG 363



>gi|322694102|gb|EFY85941.1| putative MAP kinase [Metarhizium acridum CQMa 102]
          Length = 429

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 179/271 (66%), Positives = 205/271 (75%), Gaps = 1/271 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 118 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 177

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 178 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 237

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP MP   F  L+P+ANP 
Sbjct: 238 PFFKGRDYVDQLNQILHILGTPNEETLARIGSPRAQEYVRNLPFMPKKSFPGLFPQANPD 297

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP+TRI+VEQAL H YL  +HD  DEP     F+F FE ++ + +M+++
Sbjct: 298 ALDLLDKMLTFDPSTRISVEQALEHPYLHIWHDASDEPDCPTTFNFDFEVIDDVAEMRRV 357

Query: 241 IAQEVMSFKASKQAALGLNRQLGRKSSLSAP 271
           I  EVM F+   +   G N   G+    SAP
Sbjct: 358 ILDEVMRFRQLVRTVPGSNSMAGQGQP-SAP 387



>gi|330926789|ref|XP_003301614.1| hypothetical protein PTT_13150 [Pyrenophora teres f. teres 0-1]
 gi|311323488|gb|EFQ90287.1| hypothetical protein PTT_13150 [Pyrenophora teres f. teres 0-1]
          Length = 1053

 Score =  370 bits (949), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 176/249 (70%), Positives = 194/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 132 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 191

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGGK
Sbjct: 192 DFGLARGFSMDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGK 251

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP M  I F  L+  ANP 
Sbjct: 252 PFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQDYVRNLPYMQKISFQSLFRNANPD 311

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP+    FDF FE VE I +MKKM
Sbjct: 312 ALDLLDRMLAFDPSSRISVEEALEHRYLQIWHDASDEPSCPTTFDFQFEVVEEIPEMKKM 371

Query: 241 IAQEVMSFK 249
           I  EV  F+
Sbjct: 372 ILDEVSRFR 380



>gi|402080994|gb|EJT76139.1| CMGC/MAPK protein kinase [Gaeumannomyces graminis var. tritici
           R3-111a-1]
          Length = 415

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 177/257 (68%), Positives = 198/257 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP M   PF  L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVRNLPFMAKKPFRSLFPNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VEQAL H YL  +HD  DEP     F+F FE VE + +M+KM
Sbjct: 287 ALDLLDRMLAFDPSSRISVEQALEHPYLQIWHDASDEPDCPTTFNFDFEVVEDVGEMRKM 346

Query: 241 IAQEVMSFKASKQAALG 257
           I  EV  F+   + A G
Sbjct: 347 ILDEVYRFRQMVRTAPG 363



>gi|451856883|gb|EMD70174.1| MAPK protein MPS1 [Bipolaris sorokiniana ND90Pr]
          Length = 1051

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 175/249 (70%), Positives = 194/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 127 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 186

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGGK
Sbjct: 187 DFGLARGFSMDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGK 246

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP M  + F  L+  ANP 
Sbjct: 247 PFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQDYVRNLPYMQKMSFQSLFKNANPD 306

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP+    FDF FE VE I +MKKM
Sbjct: 307 ALDLLDRMLAFDPSSRISVEEALEHRYLQIWHDASDEPSCPTTFDFQFEVVEEIPEMKKM 366

Query: 241 IAQEVMSFK 249
           I  EV  F+
Sbjct: 367 ILDEVSRFR 375



>gi|485921930|gb|EOD47541.1| putative cmgc mapk protein kinase protein [Neofusicoccum parvum
           UCRNP2]
          Length = 416

 Score =  369 bits (948), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 177/249 (71%), Positives = 195/249 (78%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 108 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 167

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGGK
Sbjct: 168 DFGLARGFSMDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGK 227

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP MP + F QL+  ANP 
Sbjct: 228 PFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQDYVRNLPYMPKVSFQQLFRNANPD 287

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP+ RI+VE+AL H YL  +HD  DEP+    FDF FE VE I +MKKM
Sbjct: 288 ALDLLDRMLAFDPSQRISVEEALEHRYLHIWHDASDEPSCPTTFDFHFEVVEDIGEMKKM 347

Query: 241 IAQEVMSFK 249
           I  EV  F+
Sbjct: 348 ILAEVQRFR 356



>gi|482811153|gb|EOA87920.1| hypothetical protein SETTUDRAFT_160827 [Setosphaeria turcica Et28A]
          Length = 1034

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 175/249 (70%), Positives = 194/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 123 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 182

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGGK
Sbjct: 183 DFGLARGFSMDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGK 242

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP M  I F  L+  ANP 
Sbjct: 243 PFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQDYVRNLPYMQKISFQSLFRNANPD 302

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP+    FDF FE VE I +MK+M
Sbjct: 303 ALDLLDRMLAFDPSSRISVEEALEHRYLQIWHDASDEPSCPTTFDFQFEVVEEIPEMKRM 362

Query: 241 IAQEVMSFK 249
           I  EV  F+
Sbjct: 363 ILDEVSRFR 371



>gi|477589332|gb|ENI06409.1| hypothetical protein COCC4DRAFT_166855 [Bipolaris maydis ATCC
           48331]
          Length = 1042

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 175/249 (70%), Positives = 194/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 127 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 186

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGGK
Sbjct: 187 DFGLARGFSMDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGK 246

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP M  + F  L+  ANP 
Sbjct: 247 PFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQDYVRNLPYMQKMSFQSLFKNANPD 306

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP+    FDF FE VE I +MKKM
Sbjct: 307 ALDLLDRMLAFDPSSRISVEEALEHRYLQIWHDASDEPSCPTTFDFQFEVVEEIPEMKKM 366

Query: 241 IAQEVMSFK 249
           I  EV  F+
Sbjct: 367 ILDEVSRFR 375



>gi|409044016|gb|EKM53498.1| hypothetical protein PHACADRAFT_259914 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 436

 Score =  369 bits (947), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 185/284 (65%), Positives = 206/284 (72%), Gaps = 9/284 (3%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS+QPL+DAHFQ FIYQ   GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 111 MEADLHAIIRSQQPLSDAHFQSFIYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 170

Query: 61  DFGLARGFS-------DSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIF 113
           DFGLARG+        +    N GFMTEYVATRWYRAPEIMLSF NY  AID+WSVGCI 
Sbjct: 171 DFGLARGYQPGGGATQNRGAANQGFMTEYVATRWYRAPEIMLSFANYGPAIDVWSVGCIL 230

Query: 114 AEMLGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQL 173
           AE+L GKP+FKGRDYVDQLNQIL  LGTP E+TLRRVGS RAQ YI SLP  P +PFS L
Sbjct: 231 AELLSGKPIFKGRDYVDQLNQILHYLGTPAEDTLRRVGSPRAQDYIRSLPIKPRVPFSTL 290

Query: 174 YPKANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVEL 233
           +P+ANP           FDPA RIT EQAL H YL  +HD  DEP     FDF FE  + 
Sbjct: 291 FPRANPLAIDLLSQLLNFDPAKRITCEQALKHPYLQVWHDPADEPVCPAPFDFGFEEEDS 350

Query: 234 IEDMKKMIAQEVMSFKAS-KQAALGLNRQLGRKSSLSAPDRDSL 276
           IE MK++I +EV SF+   +Q A G   Q+ R+ SL  P R+ L
Sbjct: 351 IEGMKRLIIEEVQSFRVEVRQQARG-GGQIRREDSLPIPTREEL 393



>gi|310795998|gb|EFQ31459.1| hypothetical protein GLRG_06603 [Glomerella graminicola M1.001]
          Length = 419

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 175/249 (70%), Positives = 196/249 (78%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP MP   F  L+P+ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVRNLPFMPKKAFPSLFPQANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VEQAL H YL  +HD  DEP     F+F FE VE + +M+KM
Sbjct: 287 ALDLLDRMLAFDPSSRISVEQALEHPYLQIWHDASDEPDCPTTFNFDFEVVEDVGEMRKM 346

Query: 241 IAQEVMSFK 249
           I  EV  F+
Sbjct: 347 ILDEVYRFR 355



>gi|452983513|gb|EME83271.1| mitogen-activated protein kinase [Pseudocercospora fijiensis
           CIRAD86]
          Length = 415

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 175/251 (69%), Positives = 197/251 (78%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 109 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 168

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LG K
Sbjct: 169 DFGLARGFSIDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGSK 228

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP E TL R+GS RAQ Y+ +LP M  IPF QL+P+ANP 
Sbjct: 229 PFFKGRDYVDQLNQILHYLGTPSESTLSRIGSPRAQEYVRNLPYMSKIPFQQLFPRANPD 288

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP+ RI+VE+AL H YLA +HD  DEP     FDF FE V+ +++M++M
Sbjct: 289 ALDLLDRMLAFDPSQRISVEEALEHRYLAIWHDASDEPPCPTTFDFGFEVVDDVQEMRQM 348

Query: 241 IAQEVMSFKAS 251
           I  EV +F+ S
Sbjct: 349 ILAEVKAFRHS 359



>gi|255722709|ref|XP_002546289.1| mitogen-activated protein kinase MKC1 [Candida tropicalis MYA-3404]
 gi|240136778|gb|EER36331.1| mitogen-activated protein kinase MKC1 [Candida tropicalis MYA-3404]
          Length = 516

 Score =  369 bits (946), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 171/250 (68%), Positives = 201/250 (80%), Gaps = 1/250 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQIIRS QPLTD+H+Q FIYQ+  GLKYIHSA+VLHRDLKPGNLLVNADCELKIC
Sbjct: 142 MECDMHQIIRSGQPLTDSHYQSFIYQVLCGLKYIHSADVLHRDLKPGNLLVNADCELKIC 201

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS++PD NAGFMTEYVATRWYRAPEIMLSF NYTKAID+WSVGCI AE+LGGK
Sbjct: 202 DFGLARGFSENPDENAGFMTEYVATRWYRAPEIMLSFTNYTKAIDIWSVGCILAELLGGK 261

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+F+G+DYVDQLNQIL ILGTP E TL+R+GS RAQ Y+ SLP M  + + QL+P ANP 
Sbjct: 262 PIFRGKDYVDQLNQILMILGTPPESTLQRIGSHRAQNYVRSLPIMRKVSYKQLFPDANPL 321

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDF-SFESVELIEDMKK 239
                      DP  RI+VE+AL+H YL  +HD  DEP  +  FDF SFE+V+ +EDM+ 
Sbjct: 322 ALDLLEKMLTLDPHERISVEEALSHKYLEVWHDPRDEPECQVKFDFKSFETVDGLEDMRS 381

Query: 240 MIAQEVMSFK 249
           +I  EV +F+
Sbjct: 382 LIIDEVKNFR 391



>gi|46137595|ref|XP_390489.1| hypothetical protein FG10313.1 [Fusarium graminearum PH-1]
 gi|20153214|gb|AAM13670.1|AF492766_1 MAP kinase [Fusarium graminearum]
          Length = 416

 Score =  368 bits (945), Expect = e-99,   Method: Compositional matrix adjust.
 Identities = 175/251 (69%), Positives = 196/251 (78%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP MP  PF  L+P+ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVRNLPFMPKKPFPSLFPQANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VEQAL H YL  +HD  DEP     F+F FE VE +  M+ M
Sbjct: 287 ALDLLDKMLAFDPSSRISVEQALEHPYLQIWHDASDEPDCPTTFNFDFEVVEDVGQMRGM 346

Query: 241 IAQEVMSFKAS 251
           I  EV  F+ +
Sbjct: 347 ILDEVQRFRQN 357



>gi|440487742|gb|ELQ67517.1| mitogen-activated protein kinase spm1 [Magnaporthe oryzae P131]
          Length = 550

 Score =  368 bits (945), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 177/257 (68%), Positives = 198/257 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 93  MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 152

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 153 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 212

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP M   PF  L+P ANP 
Sbjct: 213 PFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVRNLPFMAKKPFPTLFPNANPD 272

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VEQAL H YL  +HD  DEP     F+F FE VE + +M+KM
Sbjct: 273 ALDLLDRMLAFDPSSRISVEQALEHPYLHIWHDASDEPDCPTTFNFDFEVVEDVGEMRKM 332

Query: 241 IAQEVMSFKASKQAALG 257
           I  EV  F+   + A G
Sbjct: 333 ILDEVYRFRQLVRTAPG 349



>gi|322710377|gb|EFZ01952.1| putative MAP kinase [Metarhizium anisopliae ARSEF 23]
          Length = 430

 Score =  368 bits (945), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 178/271 (65%), Positives = 205/271 (75%), Gaps = 1/271 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 119 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 178

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 179 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 238

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP MP   F  L+P+ANP 
Sbjct: 239 PFFKGRDYVDQLNQILHILGTPNEETLARIGSPRAQEYVRNLPFMPKKSFPGLFPQANPD 298

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VEQAL H YL  +HD  DEP     F+F FE ++ + +M+++
Sbjct: 299 ALDLLDKMLTFDPSSRISVEQALEHPYLHIWHDASDEPDCPTTFNFDFEVIDDVGEMRRV 358

Query: 241 IAQEVMSFKASKQAALGLNRQLGRKSSLSAP 271
           I  EVM F+   +   G N   G+    SAP
Sbjct: 359 ILDEVMRFRQLVRTVPGSNSMAGQGQP-SAP 388



>gi|408387733|gb|EKJ67443.1| MGV1 [Fusarium pseudograminearum CS3096]
          Length = 416

 Score =  368 bits (945), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 175/251 (69%), Positives = 196/251 (78%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP MP  PF  L+P+ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVRNLPFMPKKPFPSLFPQANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VEQAL H YL  +HD  DEP     F+F FE VE +  M+ M
Sbjct: 287 ALDLLDKMLAFDPSSRISVEQALEHPYLQIWHDASDEPDCPTTFNFDFEVVEDVGQMRGM 346

Query: 241 IAQEVMSFKAS 251
           I  EV  F+ +
Sbjct: 347 ILDEVQRFRQN 357



>gi|258566389|ref|XP_002583939.1| mitogen-activated protein kinase MKC1 [Uncinocarpus reesii 1704]
 gi|237907640|gb|EEP82041.1| mitogen-activated protein kinase MKC1 [Uncinocarpus reesii 1704]
          Length = 422

 Score =  368 bits (945), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 179/280 (63%), Positives = 210/280 (75%), Gaps = 6/280 (2%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  PD NAG+MTEYVATRWYRAPEIMLSF +YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSMDPDENAGYMTEYVATRWYRAPEIMLSFPSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQILG LGTP+E+TLRR+GS RAQ Y+ +LP M  + F +L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILGYLGTPNEDTLRRIGSPRAQDYVRNLPYMQKVSFQRLFPNANPE 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDF-SFESVELIEDMKK 239
                     FDP++RI+VE+AL H YL  +HD  DEP  +  FDF  FE VE + +M+K
Sbjct: 287 ALDLLDRMLAFDPSSRISVEEALEHPYLQIWHDASDEPVCKIPFDFLHFEVVEDVHEMRK 346

Query: 240 MIAQEVMSFKA-----SKQAALGLNRQLGRKSSLSAPDRD 274
           MI  EV+ F+A       Q    L +   +++S+  P+ +
Sbjct: 347 MILDEVVGFRAHVRQTHPQVGSALPQSASQQTSVPIPEEN 386



>gi|440476003|gb|ELQ44649.1| mitogen-activated protein kinase spm1 [Magnaporthe oryzae Y34]
          Length = 401

 Score =  368 bits (945), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 177/257 (68%), Positives = 198/257 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 93  MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 152

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 153 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 212

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP M   PF  L+P ANP 
Sbjct: 213 PFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVRNLPFMAKKPFPTLFPNANPD 272

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VEQAL H YL  +HD  DEP     F+F FE VE + +M+KM
Sbjct: 273 ALDLLDRMLAFDPSSRISVEQALEHPYLHIWHDASDEPDCPTTFNFDFEVVEDVGEMRKM 332

Query: 241 IAQEVMSFKASKQAALG 257
           I  EV  F+   + A G
Sbjct: 333 ILDEVYRFRQLVRTAPG 349



>gi|392591508|gb|EIW80836.1| Pkinase-domain-containing protein [Coniophora puteana RWD-64-598
           SS2]
          Length = 440

 Score =  368 bits (945), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 181/272 (66%), Positives = 201/272 (73%), Gaps = 5/272 (1%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS QPLTDAHFQ F+YQ   GLKYIHS+NVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MEADLHAIIRSGQPLTDAHFQSFLYQTLCGLKYIHSSNVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFS-----DSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAE 115
           DFGLARG+S      +   N GFMTEYVATRWYRAPEIMLSF NYT AID+WS+GCI AE
Sbjct: 167 DFGLARGYSPGGGASASAGNQGFMTEYVATRWYRAPEIMLSFANYTTAIDVWSIGCILAE 226

Query: 116 MLGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYP 175
           +LGGKP+FKGRDYVDQLNQIL  LGTP E+TLRRVGS RAQ YI SLP  P +PFS LYP
Sbjct: 227 LLGGKPIFKGRDYVDQLNQILHYLGTPSEDTLRRVGSPRAQDYIRSLPIKPRVPFSTLYP 286

Query: 176 KANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIE 235
            ANP           FDPA RI+ EQAL H YL  +HD  DEP  E  FDFSFE  + I+
Sbjct: 287 NANPLAIDLLGQMLCFDPARRISCEQALNHPYLQVWHDPADEPVCEQKFDFSFEEEDSID 346

Query: 236 DMKKMIAQEVMSFKASKQAALGLNRQLGRKSS 267
            MKK+I +EV  F+A  +       Q+ R+ S
Sbjct: 347 GMKKLIVEEVRDFRAEVRHQARGGSQMRRQDS 378



>gi|389629568|ref|XP_003712437.1| CMGC/MAPK protein kinase [Magnaporthe oryzae 70-15]
 gi|2465400|gb|AAC63682.1| MAP kinase Mps1 [Magnaporthe grisea]
 gi|351644769|gb|EHA52630.1| CMGC/MAPK protein kinase [Magnaporthe oryzae 70-15]
          Length = 415

 Score =  368 bits (944), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 177/257 (68%), Positives = 198/257 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP M   PF  L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVRNLPFMAKKPFPTLFPNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VEQAL H YL  +HD  DEP     F+F FE VE + +M+KM
Sbjct: 287 ALDLLDRMLAFDPSSRISVEQALEHPYLHIWHDASDEPDCPTTFNFDFEVVEDVGEMRKM 346

Query: 241 IAQEVMSFKASKQAALG 257
           I  EV  F+   + A G
Sbjct: 347 ILDEVYRFRQLVRTAPG 363



>gi|346977608|gb|EGY21060.1| mitogen-activated protein kinase spm1 [Verticillium dahliae
           VdLs.17]
          Length = 418

 Score =  368 bits (944), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 174/249 (69%), Positives = 199/249 (79%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP M   PF QL+P+ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVRNLPFMAKKPFPQLFPQANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+V+QAL H YL  +HD  DEP  +  F+F FE V+ + +M+KM
Sbjct: 287 ALDLLDRMLAFDPSSRISVDQALEHPYLHIWHDASDEPDCKTTFNFDFEVVDDVGEMRKM 346

Query: 241 IAQEVMSFK 249
           I +EV  F+
Sbjct: 347 ILEEVYRFR 355



>gi|367039165|ref|XP_003649963.1| hypothetical protein THITE_2149193 [Thielavia terrestris NRRL 8126]
 gi|346997224|gb|AEO63627.1| hypothetical protein THITE_2149193 [Thielavia terrestris NRRL 8126]
          Length = 413

 Score =  367 bits (943), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 176/257 (68%), Positives = 196/257 (76%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQNYTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSIDPEENAGYMTEYVATRWYRAPEIMLSFQNYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP M    F  L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVRNLPYMAKKSFPSLFPNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP+ RI+VE AL H YLA +HD  DEP     F+F FE +E + +M+KM
Sbjct: 287 ALDLLDRMLAFDPSRRISVEAALEHPYLAIWHDASDEPDCPSTFNFDFEVIEDVNEMRKM 346

Query: 241 IAQEVMSFKASKQAALG 257
           I  EV  F+   + A G
Sbjct: 347 ILDEVFRFRQLVRTAPG 363



>gi|261197337|ref|XP_002625071.1| mitogen-activated protein kinase MKC1 [Ajellomyces dermatitidis
           SLH14081]
 gi|239595701|gb|EEQ78282.1| mitogen-activated protein kinase MKC1 [Ajellomyces dermatitidis
           SLH14081]
 gi|239606694|gb|EEQ83681.1| mitogen-activated protein kinase MKC1 [Ajellomyces dermatitidis
           ER-3]
 gi|327354994|gb|EGE83851.1| mitogen-activated protein kinase [Ajellomyces dermatitidis ATCC
           18188]
          Length = 423

 Score =  367 bits (943), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 174/249 (69%), Positives = 197/249 (79%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  PD NAG+MTEYVATRWYRAPEIMLSF +YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSIDPDENAGYMTEYVATRWYRAPEIMLSFPSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP M  IPF +L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQEYVRNLPYMHKIPFQRLFPNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP+    FDF FE V+ + +M+KM
Sbjct: 287 ALDLLDRMLAFDPSSRISVEEALEHRYLHIWHDASDEPSCPTTFDFHFEVVDDVPEMRKM 346

Query: 241 IAQEVMSFK 249
           I  EV+ F+
Sbjct: 347 ILDEVLRFR 355



>gi|302420197|ref|XP_003007929.1| mitogen-activated protein kinase spm1 [Verticillium albo-atrum
           VaMs.102]
 gi|261353580|gb|EEY16008.1| mitogen-activated protein kinase spm1 [Verticillium albo-atrum
           VaMs.102]
          Length = 410

 Score =  367 bits (943), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 174/249 (69%), Positives = 199/249 (79%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 99  MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 158

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 159 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 218

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP M   PF QL+P+ANP 
Sbjct: 219 PFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVRNLPFMTKKPFPQLFPQANPD 278

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+V+QAL H YL  +HD  DEP  +  F+F FE V+ + +M+KM
Sbjct: 279 ALDLLDRMLAFDPSSRISVDQALEHPYLHIWHDASDEPDCKTTFNFDFEVVDDVGEMRKM 338

Query: 241 IAQEVMSFK 249
           I +EV  F+
Sbjct: 339 ILEEVYRFR 347



>gi|396496323|ref|XP_003844717.1| hypothetical protein LEMA_P000250.1 [Leptosphaeria maculans JN3]
 gi|312221298|emb|CBY01238.1| hypothetical protein LEMA_P000250.1 [Leptosphaeria maculans JN3]
          Length = 610

 Score =  367 bits (943), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 177/249 (71%), Positives = 194/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 300 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 359

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGGK
Sbjct: 360 DFGLARGFSMDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGK 419

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP M  I F  L+  ANP 
Sbjct: 420 PFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQDYVRNLPYMAKISFQSLFRNANPD 479

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP+    FDF FE VE I DMKKM
Sbjct: 480 ALDLLDRMLAFDPSSRISVEEALEHRYLHIWHDASDEPSCPTTFDFQFEVVEEINDMKKM 539

Query: 241 IAQEVMSFK 249
           I  EV  F+
Sbjct: 540 ILAEVNRFR 548



>gi|24430320|emb|CAC87145.1| MAP kinase [Claviceps purpurea]
 gi|399171132|emb|CCE28226.1| MAP kinase [Claviceps purpurea 20.1]
          Length = 416

 Score =  367 bits (943), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 173/270 (64%), Positives = 205/270 (75%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILSGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LG +
Sbjct: 167 DFGLARGFSADPEQNAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGSR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL +LGTP+EETL R+GS RAQ Y+ +LP MP   F+ L+P+ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHVLGTPNEETLSRIGSPRAQEYVRNLPVMPKKNFATLFPQANPH 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VEQAL H YL  +HD  DEP    +F+F FE ++ + +M+K+
Sbjct: 287 ALDLLDKMLAFDPSSRISVEQALEHPYLQVWHDPADEPNCPTIFNFDFEVLDDVGEMRKV 346

Query: 241 IAQEVMSFKASKQAALGLNRQLGRKSSLSA 270
           I  EV+ F+   + A       G+  + +A
Sbjct: 347 ILDEVIRFRQMVRTASSAEPTTGQAQTAAA 376



>gi|358803617|gb|AEU60018.1| mitogen-activated protein kinase [Beauveria bassiana]
 gi|358803643|gb|AEU60019.1| mitogen-activated protein kinase [Beauveria bassiana]
 gi|400599863|gb|EJP67554.1| putative MAP kinase [Beauveria bassiana ARSEF 2860]
          Length = 418

 Score =  367 bits (943), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 174/249 (69%), Positives = 195/249 (78%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P  NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSVDPQENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP MP   F  L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVRNLPFMPKRSFPSLFPNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP     F+F FE VE + +M++M
Sbjct: 287 ALDLLDKMLAFDPSSRISVEEALEHPYLHIWHDASDEPDCPTTFNFDFEVVEEVPEMRRM 346

Query: 241 IAQEVMSFK 249
           I  EVM F+
Sbjct: 347 ILDEVMRFR 355



>gi|116197597|ref|XP_001224610.1| hypothetical protein CHGG_06954 [Chaetomium globosum CBS 148.51]
 gi|88178233|gb|EAQ85701.1| hypothetical protein CHGG_06954 [Chaetomium globosum CBS 148.51]
          Length = 410

 Score =  367 bits (943), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 177/271 (65%), Positives = 199/271 (73%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQNYTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSIDPEENAGYMTEYVATRWYRAPEIMLSFQNYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP M    F  L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVRNLPYMAKKSFPSLFPNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP  RI+VE+AL H YLA +HD  DEP     F+F FE ++ + +M+KM
Sbjct: 287 ALDLLDRMLAFDPTRRISVEEALQHPYLAIWHDASDEPDCPATFNFDFEVIDEVSEMRKM 346

Query: 241 IAQEVMSFKASKQAALGLNRQLGRKSSLSAP 271
           I  EV  F+   +   G   Q G   +   P
Sbjct: 347 ILDEVFHFRQLVRMVPGSGNQGGNMPAPQVP 377



>gi|299751596|ref|XP_001830371.2| CMGC/MAPK/ERK protein kinase [Coprinopsis cinerea okayama7#130]
 gi|298409446|gb|EAU91518.2| CMGC/MAPK/ERK protein kinase [Coprinopsis cinerea okayama7#130]
          Length = 438

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 183/285 (64%), Positives = 209/285 (73%), Gaps = 9/285 (3%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS QPLTDAHFQ FIYQ   GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 105 MEADLHAIIRSGQPLTDAHFQSFIYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 164

Query: 61  DFGLARGFSDSPDH-----NAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAE 115
           DFGLARG++          N GFMTEYVATRWYRAPEIMLSF NY+ AID+WSVGCI AE
Sbjct: 165 DFGLARGYTPGSGTSRAAGNQGFMTEYVATRWYRAPEIMLSFANYSTAIDVWSVGCILAE 224

Query: 116 MLGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYP 175
           +LGG+P+FKGRDYVDQLNQIL  LGTP E+TLRRVGS RAQ YI SLP  P I FS L+P
Sbjct: 225 LLGGRPIFKGRDYVDQLNQILHYLGTPSEDTLRRVGSPRAQDYIRSLPIRPRISFSTLFP 284

Query: 176 KANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIE 235
           +ANP           FDPA RI+ E+AL H YLA +HD  DEP  + +FDFSFE  + IE
Sbjct: 285 QANPLAIDLLSRMLCFDPARRISCEEALNHPYLAVWHDPADEPNCDSIFDFSFEEEDSIE 344

Query: 236 DMKKMIAQEVMSFKASKQAALGLNRQLGRKS----SLSAPDRDSL 276
            MK++I +EV +F+A  +A    + Q  R +    +L  P RD +
Sbjct: 345 GMKRLIVEEVNNFRAEVRAQARGSAQNHRSTKDSDNLGIPSRDEI 389



>gi|225682447|gb|EEH20731.1| mitogen-activated protein kinase [Paracoccidioides brasiliensis
           Pb03]
          Length = 401

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 173/249 (69%), Positives = 197/249 (79%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 84  MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 143

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  PD NAG+MTEYVATRWYRAPEIMLSF +YTKAID+WSVGCI AE+LGG+
Sbjct: 144 DFGLARGFSIDPDENAGYMTEYVATRWYRAPEIMLSFPSYTKAIDVWSVGCILAELLGGR 203

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP M  IPF +L+P ANP 
Sbjct: 204 PFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQEYVRNLPFMHKIPFQRLFPSANPD 263

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP+    FDF FE V+ + +M++M
Sbjct: 264 ALDLLDRMLAFDPSSRISVEEALEHRYLHIWHDATDEPSCPTTFDFHFEVVDDVPEMRRM 323

Query: 241 IAQEVMSFK 249
           I  EV+ F+
Sbjct: 324 ILDEVVRFR 332



>gi|189193119|ref|XP_001932898.1| mitogen-activated protein kinase 11 [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187978462|gb|EDU45088.1| mitogen-activated protein kinase 11 [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 392

 Score =  367 bits (942), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 176/249 (70%), Positives = 194/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 83  MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 142

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGGK
Sbjct: 143 DFGLARGFSMDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGK 202

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP M  I F  L+  ANP 
Sbjct: 203 PFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQDYVRNLPYMQKISFQSLFRNANPD 262

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP+    FDF FE VE I +MKKM
Sbjct: 263 ALDLLDRMLAFDPSSRISVEEALEHRYLQIWHDASDEPSCPTTFDFQFEVVEEIPEMKKM 322

Query: 241 IAQEVMSFK 249
           I  EV  F+
Sbjct: 323 ILDEVSRFR 331



>gi|240281756|gb|EER45259.1| MAP protein kinase MPKA [Ajellomyces capsulatus H143]
          Length = 421

 Score =  367 bits (941), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 174/249 (69%), Positives = 197/249 (79%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 105 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 164

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  PD NAG+MTEYVATRWYRAPEIMLSF +YTKAID+WSVGCI AE+LGG+
Sbjct: 165 DFGLARGFSIDPDENAGYMTEYVATRWYRAPEIMLSFPSYTKAIDVWSVGCILAELLGGR 224

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRD VDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP M  IPF +L+P ANP 
Sbjct: 225 PFFKGRDCVDQLNQILHYLGTPNEETLSRIGSPRAQEYVRNLPYMHKIPFQRLFPNANPD 284

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP+    FDF FE VE + +M+KM
Sbjct: 285 ALDLLDRMLAFDPSSRISVEEALEHRYLHIWHDASDEPSCPTTFDFHFEVVEDVPEMRKM 344

Query: 241 IAQEVMSFK 249
           I +EV+ F+
Sbjct: 345 ILEEVLRFR 353



>gi|295660963|ref|XP_002791037.1| mitogen-activated protein kinase MKC1 [Paracoccidioides sp.
           'lutzii' Pb01]
 gi|226280964|gb|EEH36530.1| mitogen-activated protein kinase MKC1 [Paracoccidioides sp.
           'lutzii' Pb01]
          Length = 431

 Score =  367 bits (941), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 173/249 (69%), Positives = 197/249 (79%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 114 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 173

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  PD NAG+MTEYVATRWYRAPEIMLSF +YTKAID+WSVGCI AE+LGG+
Sbjct: 174 DFGLARGFSIDPDENAGYMTEYVATRWYRAPEIMLSFPSYTKAIDVWSVGCILAELLGGR 233

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP M  IPF +L+P ANP 
Sbjct: 234 PFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQEYVRNLPFMHKIPFQRLFPSANPD 293

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP+    FDF FE V+ + +M++M
Sbjct: 294 ALDLLDRMLAFDPSSRISVEEALEHRYLHIWHDATDEPSCPTTFDFHFEVVDDVPEMRRM 353

Query: 241 IAQEVMSFK 249
           I  EV+ F+
Sbjct: 354 ILDEVVRFR 362



>gi|51860134|gb|AAU11317.1| MAP kinase [Alternaria brassicicola]
          Length = 416

 Score =  366 bits (940), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 176/249 (70%), Positives = 194/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGGK
Sbjct: 167 DFGLARGFSMDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGK 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP M  I F  L+  ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQDYVRNLPYMQKISFQSLFKNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP+    FDF FE VE I +MKKM
Sbjct: 287 ALDLLDRMLAFDPSSRISVEEALEHRYLQIWHDASDEPSCPTTFDFQFEVVEEIPEMKKM 346

Query: 241 IAQEVMSFK 249
           I  EV  F+
Sbjct: 347 ILDEVSRFR 355



>gi|494826137|gb|EON63249.1| CMGC/MAPK/ERK1 protein kinase [Coniosporium apollinis CBS 100218]
          Length = 419

 Score =  366 bits (940), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 177/254 (69%), Positives = 197/254 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGGK
Sbjct: 167 DFGLARGFSMDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGK 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP M  + F+ L+  ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQEYVRNLPYMQKVSFTSLFRSANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEPA    FDF FE VE I +MKKM
Sbjct: 287 ALDLLDRMLAFDPSSRISVEEALEHRYLQIWHDASDEPACPTTFDFHFEVVEDIGEMKKM 346

Query: 241 IAQEVMSFKASKQA 254
           I  EV  F+   +A
Sbjct: 347 ILAEVHRFRQMVRA 360



>gi|500261890|gb|EOO04179.1| putative map kinase protein [Togninia minima UCRPA7]
          Length = 417

 Score =  366 bits (940), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 175/260 (67%), Positives = 200/260 (76%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP M   PF  L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVRNLPFMAKKPFPSLFPNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+V+QAL H YL  +HD  DEP     F+F FE V+ + +M+KM
Sbjct: 287 ALDLLDRMLAFDPSSRISVDQALEHPYLHIWHDASDEPDCPTTFNFDFEVVDDVGEMRKM 346

Query: 241 IAQEVMSFKASKQAALGLNR 260
           I +EV  F+   +   G N+
Sbjct: 347 ILEEVYRFRQIVRTVPGSNQ 366



>gi|459366707|gb|EMG45968.1| Mitogen-activated protein kinase MKC1 [Candida maltosa Xu316]
          Length = 523

 Score =  366 bits (939), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 171/250 (68%), Positives = 199/250 (79%), Gaps = 1/250 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQIIRS QPLTD+H+Q FIYQ+  GLKYIHSA+VLHRDLKPGNLLVNADCELKIC
Sbjct: 143 MECDMHQIIRSGQPLTDSHYQSFIYQVLCGLKYIHSADVLHRDLKPGNLLVNADCELKIC 202

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS++PD NAGFMTEYVATRWYRAPEIMLSF NYTKAID+WSVGCI AE+LGGK
Sbjct: 203 DFGLARGFSENPDENAGFMTEYVATRWYRAPEIMLSFTNYTKAIDIWSVGCILAELLGGK 262

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+F+G+DYVDQLNQIL ILGTP E TL+R+GS RAQ Y+ SLP M  + + QL+P ANP 
Sbjct: 263 PIFRGKDYVDQLNQILMILGTPPESTLQRIGSHRAQNYVRSLPIMRKVSYKQLFPDANPL 322

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDF-SFESVELIEDMKK 239
                      DP  RITV++AL H YL  +HD  DEP  +  FDF SFE+V  ++DMK 
Sbjct: 323 ALDLLEKMLTLDPHERITVDEALRHKYLEVWHDPRDEPECQVKFDFKSFENVNGLDDMKS 382

Query: 240 MIAQEVMSFK 249
           +I  EV +F+
Sbjct: 383 LIIDEVKNFR 392



>gi|448107573|ref|XP_004205396.1| Piso0_003642 [Millerozyma farinosa CBS 7064]
 gi|448110557|ref|XP_004201660.1| Piso0_003642 [Millerozyma farinosa CBS 7064]
 gi|359382451|emb|CCE81288.1| Piso0_003642 [Millerozyma farinosa CBS 7064]
 gi|359383216|emb|CCE80523.1| Piso0_003642 [Millerozyma farinosa CBS 7064]
          Length = 494

 Score =  366 bits (939), Expect = 5e-99,   Method: Compositional matrix adjust.
 Identities = 170/250 (68%), Positives = 200/250 (80%), Gaps = 1/250 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQIIRS QPLTD+H+Q+FIYQ   GLKYIHSA+VLHRDLKPGNLLVNADCELKIC
Sbjct: 117 MECDMHQIIRSGQPLTDSHYQFFIYQTLCGLKYIHSADVLHRDLKPGNLLVNADCELKIC 176

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS+ P+HN GFMTEYVATRWYRAPEIMLSF NYTKAID+WSVGCI AE+LGGK
Sbjct: 177 DFGLARGFSEIPEHNVGFMTEYVATRWYRAPEIMLSFTNYTKAIDVWSVGCILAELLGGK 236

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLF+G+DYVDQLNQIL +LGTP E TL ++GS RAQ Y+ SLP M  +PFS+L+  ANP 
Sbjct: 237 PLFRGKDYVDQLNQILLVLGTPSESTLTKIGSVRAQNYVRSLPFMKKVPFSKLFTSANPL 296

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDF-SFESVELIEDMKK 239
                      DP  RI+VE+AL H YLA +HD +DEP  +  FDF SFE+++ +  MK+
Sbjct: 297 ALDLLEKMLTLDPYERISVEEALNHPYLAVWHDPQDEPECQVKFDFKSFETIDDMTAMKE 356

Query: 240 MIAQEVMSFK 249
           +I  EV SF+
Sbjct: 357 LIINEVKSFR 366



>gi|285265602|gb|ADC35363.1| SLT2-like MAP kinase protein [Alternaria alternata]
          Length = 416

 Score =  366 bits (939), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 176/249 (70%), Positives = 194/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGGK
Sbjct: 167 DFGLARGFSMDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGK 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP M  I F  L+  ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQDYVRNLPYMQKISFQSLFRNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP+    FDF FE VE I +MKKM
Sbjct: 287 ALDLLDRMLAFDPSSRISVEEALEHRYLQIWHDASDEPSCPTTFDFQFEVVEEIPEMKKM 346

Query: 241 IAQEVMSFK 249
           I  EV  F+
Sbjct: 347 ILDEVSRFR 355



>gi|346318071|gb|EGX87676.1| Serine/threonine-protein kinase-like domain [Cordyceps militaris
           CM01]
          Length = 416

 Score =  366 bits (939), Expect = 6e-99,   Method: Compositional matrix adjust.
 Identities = 174/249 (69%), Positives = 193/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P  NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSVDPQENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP MP   F  L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVRNLPFMPKRSFPSLFPNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP+ RI+VEQAL H YL  +HD  DEP     F+F FE VE + +M++M
Sbjct: 287 ALDLLDKMLAFDPSARISVEQALEHPYLHIWHDASDEPDCPTTFNFDFEVVEEVPEMRRM 346

Query: 241 IAQEVMSFK 249
           I  EV  F+
Sbjct: 347 ILDEVARFR 355



>gi|241957798|ref|XP_002421618.1| mitogen-activated protein kinase, putative [Candida dubliniensis
           CD36]
 gi|223644963|emb|CAX39555.1| mitogen-activated protein kinase, putative [Candida dubliniensis
           CD36]
          Length = 509

 Score =  365 bits (938), Expect = 7e-99,   Method: Compositional matrix adjust.
 Identities = 170/250 (68%), Positives = 200/250 (80%), Gaps = 1/250 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQIIRS QPLTD+H+Q FIYQ+  GLKYIHSA+VLHRDLKPGNLLVNADCELKIC
Sbjct: 132 MECDMHQIIRSGQPLTDSHYQSFIYQVLCGLKYIHSADVLHRDLKPGNLLVNADCELKIC 191

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS++PD NAGFMTEYVATRWYRAPEIMLSF NYTKAID+WSVGCI AE+LGGK
Sbjct: 192 DFGLARGFSENPDENAGFMTEYVATRWYRAPEIMLSFTNYTKAIDIWSVGCILAELLGGK 251

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLF+G+DYVDQLNQIL ILGTP E TL+R+GS RAQ Y+ SLP M  + + QL+P ANP 
Sbjct: 252 PLFRGKDYVDQLNQILMILGTPPESTLQRIGSHRAQNYVRSLPIMRKVSYKQLFPDANPL 311

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDF-SFESVELIEDMKK 239
                      DP  RI+VE AL+H YL  +HD  DEP  +  FDF SFE+V+ +++M+ 
Sbjct: 312 ALDLLEKMLTLDPHERISVEDALSHKYLEVWHDPRDEPECQVKFDFKSFETVDGLDEMRS 371

Query: 240 MIAQEVMSFK 249
           +I  EV +F+
Sbjct: 372 LIIDEVKNFR 381



>gi|284795190|gb|ADB93873.1| mitogen-activated protein kinase [Corynespora cassiicola]
          Length = 417

 Score =  365 bits (938), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 175/249 (70%), Positives = 196/249 (78%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGGK
Sbjct: 167 DFGLARGFSMDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGK 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP M  + F+ L+ +ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQEYVRNLPYMQKVSFASLFRQANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP+    FDF FE VE I +MKKM
Sbjct: 287 ALDLLDRMLAFDPSSRISVEEALEHRYLHIWHDASDEPSCPTTFDFHFEVVEDIAEMKKM 346

Query: 241 IAQEVMSFK 249
           I  EV  F+
Sbjct: 347 ILAEVNRFR 355



>gi|512186931|gb|EPE02716.1| map kinase [Ophiostoma piceae UAMH 11346]
          Length = 417

 Score =  365 bits (938), Expect = 8e-99,   Method: Compositional matrix adjust.
 Identities = 174/249 (69%), Positives = 194/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LG +
Sbjct: 167 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGSR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+E TL R+GS RAQ Y+ +LP  P  PF  L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILQILGTPNEVTLARIGSSRAQEYVRNLPFKPKQPFPALFPHANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP     F+F FE VE +EDM+KM
Sbjct: 287 ALDLLDRMLAFDPSSRISVEEALEHHYLQIWHDASDEPDCPTTFNFDFEVVEEVEDMRKM 346

Query: 241 IAQEVMSFK 249
           I  EV  F+
Sbjct: 347 ILDEVYRFR 355



>gi|12407837|gb|AAG53655.1|AF301166_1 MAP kinase-II [Blumeria graminis]
          Length = 410

 Score =  365 bits (937), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 171/258 (66%), Positives = 199/258 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKY+HSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYVHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL +LGTP+EETL R+GS RAQ Y+ +LP M   PF+Q++P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHVLGTPNEETLARIGSPRAQEYVRNLPFMAKRPFAQIFPNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDPA+RI+VE+AL H +L  +HD  DEP     F+F FE  + + +M+KM
Sbjct: 287 ALDLLNRMLAFDPASRISVEEALEHPFLQIWHDVSDEPCCPTTFNFDFEVTDDVGEMRKM 346

Query: 241 IAQEVMSFKASKQAALGL 258
           I  EV  F+   +   G+
Sbjct: 347 ILDEVARFRHHVRVQPGM 364



>gi|393239353|gb|EJD46885.1| kinase-like protein [Auricularia delicata TFB-10046 SS5]
          Length = 435

 Score =  365 bits (937), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 174/248 (70%), Positives = 194/248 (78%), Gaps = 2/248 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS QPL+DAHFQ F+YQ   GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 105 MEADLHAIIRSGQPLSDAHFQSFLYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 164

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLAR  SDS  + +GFMTEYVATRWYRAPEIMLS+ NYT +ID+WS+GCI AE+LGGK
Sbjct: 165 DFGLAR--SDSSSNGSGFMTEYVATRWYRAPEIMLSYANYTTSIDVWSIGCILAELLGGK 222

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+FKGRDYVDQLNQIL +LGTP E+TLRRVGS RAQ YI SLP  P IPF+ LYP ANP 
Sbjct: 223 PIFKGRDYVDQLNQILHLLGTPTEDTLRRVGSPRAQDYIRSLPIKPRIPFATLYPHANPL 282

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDPA RI+ +QAL H YLA +HD  DEP     FDF FE  + +E MKK+
Sbjct: 283 AIDLLGQMLNFDPAKRISCDQALTHPYLAVWHDPNDEPVCPRKFDFGFEEEDSMEGMKKL 342

Query: 241 IAQEVMSF 248
           I +EV SF
Sbjct: 343 IVEEVNSF 350



>gi|451993987|gb|EMD86459.1| hypothetical protein COCHEDRAFT_1024088 [Bipolaris maydis C5]
          Length = 416

 Score =  365 bits (936), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 175/249 (70%), Positives = 194/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGGK
Sbjct: 167 DFGLARGFSMDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGK 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP M  + F  L+  ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQDYVRNLPYMQKMSFQSLFKNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP+    FDF FE VE I +MKKM
Sbjct: 287 ALDLLDRMLAFDPSSRISVEEALEHRYLQIWHDASDEPSCPTTFDFQFEVVEEIPEMKKM 346

Query: 241 IAQEVMSFK 249
           I  EV  F+
Sbjct: 347 ILDEVSRFR 355



>gi|323721370|gb|ADY05334.1| cell wall integrity MAP kinase [Curvularia lunata]
          Length = 416

 Score =  365 bits (936), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 175/249 (70%), Positives = 194/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGGK
Sbjct: 167 DFGLARGFSMDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGK 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP M  I F  L+  ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQDYVRNLPYMQKISFQSLFKTANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP+    FDF FE VE I +MK+M
Sbjct: 287 ALDLLDRMLAFDPSSRISVEEALEHRYLQIWHDASDEPSCPTTFDFQFEVVEEIPEMKRM 346

Query: 241 IAQEVMSFK 249
           I  EV  F+
Sbjct: 347 ILDEVSRFR 355



>gi|225558834|gb|EEH07117.1| mitogen-activated protein kinase [Ajellomyces capsulatus G186AR]
 gi|325087902|gb|EGC41212.1| mitogen-activated protein kinase [Ajellomyces capsulatus H88]
          Length = 413

 Score =  365 bits (936), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 173/244 (70%), Positives = 194/244 (79%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  PD NAG+MTEYVATRWYRAPEIMLSF +YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSIDPDENAGYMTEYVATRWYRAPEIMLSFPSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP M  IPF +L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQEYVRNLPYMHKIPFQRLFPNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP+    FDF FE VE + +M+KM
Sbjct: 287 ALDLLDRMLAFDPSSRISVEEALEHRYLHIWHDASDEPSCPTTFDFHFEVVEDVPEMRKM 346

Query: 241 IAQE 244
           I +E
Sbjct: 347 ILEE 350



>gi|121483467|gb|ABM54149.1| cell wall integrity MAP kinase [Cochliobolus heterostrophus]
          Length = 417

 Score =  365 bits (936), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 175/249 (70%), Positives = 194/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 108 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 167

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGGK
Sbjct: 168 DFGLARGFSMDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGK 227

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP M  + F  L+  ANP 
Sbjct: 228 PFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQDYVRNLPYMQKMSFQSLFKNANPD 287

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP+    FDF FE VE I +MKKM
Sbjct: 288 ALDLLDRMLAFDPSSRISVEEALEHRYLQIWHDASDEPSCPTTFDFQFEVVEEIPEMKKM 347

Query: 241 IAQEVMSFK 249
           I  EV  F+
Sbjct: 348 ILDEVSRFR 356



>gi|150866723|ref|XP_001386411.2| hypothetical protein PICST_18249 [Scheffersomyces stipitis CBS
           6054]
 gi|149387979|gb|ABN68382.2| predicted protein [Scheffersomyces stipitis CBS 6054]
          Length = 517

 Score =  364 bits (935), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 167/250 (66%), Positives = 203/250 (81%), Gaps = 1/250 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQIIRS QPLTD+H+Q FIYQ+  GLKYIHSA+VLHRDLKPGNLLVNADCELKIC
Sbjct: 129 MECDMHQIIRSGQPLTDSHYQSFIYQVLCGLKYIHSADVLHRDLKPGNLLVNADCELKIC 188

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS++P+ NAG+MTEYVATRWYRAPEIMLSF NY+KAID+WSVGCI AE+LGGK
Sbjct: 189 DFGLARGFSENPEQNAGYMTEYVATRWYRAPEIMLSFTNYSKAIDIWSVGCILAELLGGK 248

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLF+G+DYVDQLNQIL +LGTP E TL ++GS RAQ Y+ SLP M  + +S+L+P ANP 
Sbjct: 249 PLFRGKDYVDQLNQILLVLGTPKEATLTKIGSVRAQNYVRSLPLMKKVSYSELFPNANPL 308

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDF-SFESVELIEDMKK 239
                      DP  RI+VE+AL+H YLA +HD +DEP  +  F+F SFE+V+ ++DMK+
Sbjct: 309 ALDLLEKMLTLDPFERISVEEALSHPYLAVWHDPQDEPECQVKFNFKSFETVDNMDDMKQ 368

Query: 240 MIAQEVMSFK 249
           +I  EV  F+
Sbjct: 369 LIIDEVKKFR 378



>gi|452844604|gb|EME46538.1| hypothetical protein DOTSEDRAFT_70517 [Dothistroma septosporum
           NZE10]
          Length = 418

 Score =  364 bits (935), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 173/254 (68%), Positives = 198/254 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSA+VLHRDLKPGNLLVNADCELKI 
Sbjct: 109 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSASVLHRDLKPGNLLVNADCELKIA 168

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LG K
Sbjct: 169 DFGLARGFSIDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGSK 228

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP E TL R+GS RAQ Y+ +LP M  IPF QL+P+ANP 
Sbjct: 229 PFFKGRDYVDQLNQILHYLGTPSESTLSRIGSPRAQEYVRNLPYMSKIPFQQLFPRANPD 288

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP+ R+ VE+AL H YL+ +HD  DEP     FDF+FE V+ + DM++M
Sbjct: 289 ALDLLDRMLAFDPSQRVGVEEALEHRYLSIWHDASDEPNCPTPFDFTFEVVDEVPDMRQM 348

Query: 241 IAQEVMSFKASKQA 254
           I QEV +F+ + +A
Sbjct: 349 ILQEVRTFRQAVRA 362



>gi|505760541|gb|EOR04606.1| Mitogen-activated protein kinase SLT2/MPK1 [Wallemia ichthyophaga
            EXF-994]
          Length = 1128

 Score =  363 bits (933), Expect = 2e-98,   Method: Compositional matrix adjust.
 Identities = 171/263 (65%), Positives = 195/263 (74%), Gaps = 5/263 (1%)

Query: 1    MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
            MEADLH IIRS Q LTD H+Q F+YQ   GLKYIHSA+V+HRDLKPGNLLVNADCELKIC
Sbjct: 775  MEADLHAIIRSGQALTDQHYQSFVYQTLCGLKYIHSADVIHRDLKPGNLLVNADCELKIC 834

Query: 61   DFGLARGFSDSP-----DHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAE 115
            DFGLARG+   P       +AGFMTEYVATRWYRAPEIMLSF NY+ +ID+WSVGCI AE
Sbjct: 835  DFGLARGYQSDPLRAGLAGSAGFMTEYVATRWYRAPEIMLSFANYSTSIDIWSVGCILAE 894

Query: 116  MLGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYP 175
            +LGG+P+FKGRDYVDQLNQIL +LGTP EETLRRVGS RA  YI SLP  P IPF ++YP
Sbjct: 895  LLGGRPIFKGRDYVDQLNQILHVLGTPSEETLRRVGSPRAVEYIRSLPIKPRIPFERIYP 954

Query: 176  KANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIE 235
            KANP           FDPA RIT E+AL H YLA +HD  DEP+    FDF FE  +  E
Sbjct: 955  KANPLALDLLSKMLTFDPAKRITCEEALKHPYLAVWHDPSDEPSCRERFDFGFEVEDSPE 1014

Query: 236  DMKKMIAQEVMSFKASKQAALGL 258
             M+ +I  EV SF+   +  LG+
Sbjct: 1015 GMRNLIVDEVKSFRKKVRTPLGV 1037



>gi|331245135|ref|XP_003335205.1| CMGC/MAPK protein kinase [Puccinia graminis f. sp. tritici CRL
           75-36-700-3]
 gi|309314195|gb|EFP90786.1| CMGC/MAPK protein kinase [Puccinia graminis f. sp. tritici CRL
           75-36-700-3]
          Length = 493

 Score =  363 bits (933), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 178/255 (69%), Positives = 193/255 (75%), Gaps = 4/255 (1%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS QPLTDAHFQ FIYQ   GLKYIHSA+VLHRDLKPGNLLVNADCELKIC
Sbjct: 110 MEADLHAIIRSGQPLTDAHFQSFIYQTLCGLKYIHSASVLHRDLKPGNLLVNADCELKIC 169

Query: 61  DFGLARGFSDSPD----HNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEM 116
           DFGLARGF   P      N GFMTEYVATRWYRAPEIMLSFQNYT AIDMWSVGCI AE+
Sbjct: 170 DFGLARGFETDPALAQATNQGFMTEYVATRWYRAPEIMLSFQNYTTAIDMWSVGCILAEL 229

Query: 117 LGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPK 176
           LGG+P+FKGRDYVDQLNQIL  LGTP E TLRRVGS RAQ YI SLP    + F++LYP 
Sbjct: 230 LGGRPIFKGRDYVDQLNQILNYLGTPSETTLRRVGSPRAQDYIRSLPYKQGVSFAELYPG 289

Query: 177 ANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIED 236
           ANP           FDP+ RIT  QAL H YL  +HD EDE   +  FDFSFES +  E 
Sbjct: 290 ANPEGLDLLSKLLAFDPSERITCNQALRHPYLKVWHDPEDEIDIKEKFDFSFESEDSTEG 349

Query: 237 MKKMIAQEVMSFKAS 251
           MK++I  EV+SF+ S
Sbjct: 350 MKQLIINEVVSFRQS 364



>gi|440631951|gb|ELR01870.1| CMGC/MAPK protein kinase [Geomyces destructans 20631-21]
          Length = 419

 Score =  363 bits (933), Expect = 3e-98,   Method: Compositional matrix adjust.
 Identities = 173/250 (69%), Positives = 195/250 (78%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 109 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 168

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 169 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 228

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP M    FS L+P ANP 
Sbjct: 229 PFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVRNLPYMAKRQFSHLFPNANPD 288

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE AL H YL  +HD  DEP     F+F FE VE + +++K+
Sbjct: 289 ALDLLNHMLAFDPSSRISVETALEHPYLHIWHDASDEPGCPMTFNFDFEVVEDVGELRKL 348

Query: 241 IAQEVMSFKA 250
           I  EV  F+A
Sbjct: 349 ILDEVAMFRA 358



>gi|320589786|gb|EFX02242.1| mitogen-activated protein kinase mkc1 [Grosmannia clavigera kw1407]
          Length = 417

 Score =  362 bits (930), Expect = 5e-98,   Method: Compositional matrix adjust.
 Identities = 171/249 (68%), Positives = 194/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LG +
Sbjct: 167 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGSR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+E+TL R+GS RAQ Y+ +LP M    F  L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILQILGTPNEQTLSRIGSSRAQEYVRNLPFMAKRSFQSLFPSANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RITVEQAL H YL  +HD  DEP     F+F FE V+ +++M++M
Sbjct: 287 ALDLLDRMLAFDPSSRITVEQALEHPYLQIWHDASDEPDCPATFNFDFEVVDDVDEMRRM 346

Query: 241 IAQEVMSFK 249
           I  EV  F+
Sbjct: 347 ILNEVYRFR 355



>gi|170093175|ref|XP_001877809.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164647668|gb|EDR11912.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 376

 Score =  362 bits (930), Expect = 6e-98,   Method: Compositional matrix adjust.
 Identities = 178/270 (65%), Positives = 200/270 (74%), Gaps = 5/270 (1%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS QPLTDAHFQ F+YQ   GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 105 MEADLHAIIRSGQPLTDAHFQSFLYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 164

Query: 61  DFGLARGFS-----DSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAE 115
           DFGLARG++          N GFMTEYVATRWYRAPEIMLSF NY+ AID+WSVGCI AE
Sbjct: 165 DFGLARGYTPGGGTSKAAGNQGFMTEYVATRWYRAPEIMLSFANYSTAIDVWSVGCILAE 224

Query: 116 MLGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYP 175
           +LGGKP++KGRDYVDQLNQIL  LGTP E+TLRRVGS RAQ YI SLP  P +PFS L+P
Sbjct: 225 LLGGKPIYKGRDYVDQLNQILHYLGTPSEDTLRRVGSPRAQDYIRSLPIKPRVPFSTLFP 284

Query: 176 KANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIE 235
            ANP           FDPA RI+ EQAL H YL  +HD  DEP  +  FDF FE  + I+
Sbjct: 285 HANPLAIDLLSQMLCFDPAKRISCEQALNHPYLQVWHDPADEPVCDTKFDFGFEEEDSID 344

Query: 236 DMKKMIAQEVMSFKASKQAALGLNRQLGRK 265
            MKK+I +EV SF+A  +A      Q+ R+
Sbjct: 345 GMKKLIIEEVNSFRAEVRAQARAAGQIRRQ 374



>gi|302504282|ref|XP_003014100.1| hypothetical protein ARB_07820 [Arthroderma benhamiae CBS 112371]
 gi|291177667|gb|EFE33460.1| hypothetical protein ARB_07820 [Arthroderma benhamiae CBS 112371]
          Length = 446

 Score =  362 bits (928), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 172/249 (69%), Positives = 195/249 (78%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 133 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 192

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  PD NAG+MTEYVATRWYRAPEIMLSF +YTKAID+WSVGCI AE+LGG+
Sbjct: 193 DFGLARGFSIDPDENAGYMTEYVATRWYRAPEIMLSFPSYTKAIDVWSVGCILAELLGGR 252

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP EETL R+GS RAQ Y+ +LP M   PF++L+P ANP 
Sbjct: 253 PFFKGRDYVDQLNQILHYLGTPTEETLCRIGSPRAQEYVRNLPYMHKQPFARLFPNANPD 312

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP     FDF FE V+ +++M++M
Sbjct: 313 ALDLLDRMLAFDPSSRISVEEALEHRYLHIWHDASDEPNCPTPFDFHFEVVDDVQEMRRM 372

Query: 241 IAQEVMSFK 249
           I  EV  F+
Sbjct: 373 ILNEVQRFR 381



>gi|296826076|ref|XP_002850914.1| mitogen-activated protein kinase spm1 [Arthroderma otae CBS 113480]
 gi|238838468|gb|EEQ28130.1| mitogen-activated protein kinase spm1 [Arthroderma otae CBS 113480]
          Length = 421

 Score =  362 bits (928), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 172/249 (69%), Positives = 195/249 (78%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  PD NAG+MTEYVATRWYRAPEIMLSF +YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSIDPDENAGYMTEYVATRWYRAPEIMLSFPSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP EETL R+GS RAQ Y+ +LP M   PF++L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHYLGTPSEETLCRIGSPRAQEYVRNLPHMHKQPFARLFPNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP     FDF FE V+ +++M++M
Sbjct: 287 ALDLLDRMLAFDPSSRISVEEALEHRYLHIWHDASDEPNCPTPFDFHFEVVDDVQEMRRM 346

Query: 241 IAQEVMSFK 249
           I  EV  F+
Sbjct: 347 ILNEVQRFR 355



>gi|154310447|ref|XP_001554555.1| hypothetical protein BC1G_07144 [Botryotinia fuckeliana B05.10]
 gi|116008299|gb|ABJ51957.1| Bmp3 [Botryotinia fuckeliana]
 gi|347828757|emb|CCD44454.1| BMP3, mitogen-activated protein kinase [Botryotinia fuckeliana T4]
 gi|472244110|gb|EMR88739.1| putative cmgc mapk protein kinase protein [Botryotinia fuckeliana
           BcDW1]
          Length = 413

 Score =  362 bits (928), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 171/249 (68%), Positives = 194/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  I+RS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIVRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP M   PF  L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVRNLPYMAKRPFPTLFPNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI VE AL H YL  +HD  DEP     F+F FE VE + +++K+
Sbjct: 287 ALDLLDHMLAFDPSSRIDVETALEHPYLHIWHDASDEPGCPTTFNFDFEVVEDVGEIRKL 346

Query: 241 IAQEVMSFK 249
           I +EV  F+
Sbjct: 347 ILEEVHRFR 355



>gi|302657072|ref|XP_003020268.1| hypothetical protein TRV_05665 [Trichophyton verrucosum HKI 0517]
 gi|291184082|gb|EFE39650.1| hypothetical protein TRV_05665 [Trichophyton verrucosum HKI 0517]
          Length = 453

 Score =  362 bits (928), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 172/249 (69%), Positives = 195/249 (78%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 140 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 199

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  PD NAG+MTEYVATRWYRAPEIMLSF +YTKAID+WSVGCI AE+LGG+
Sbjct: 200 DFGLARGFSIDPDENAGYMTEYVATRWYRAPEIMLSFPSYTKAIDVWSVGCILAELLGGR 259

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP EETL R+GS RAQ Y+ +LP M   PF++L+P ANP 
Sbjct: 260 PFFKGRDYVDQLNQILHYLGTPTEETLCRIGSPRAQEYVRNLPYMHKQPFARLFPNANPD 319

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP     FDF FE V+ +++M++M
Sbjct: 320 ALDLLDRMLAFDPSSRISVEEALEHRYLHIWHDASDEPNCPTPFDFHFEVVDDVQEMRRM 379

Query: 241 IAQEVMSFK 249
           I  EV  F+
Sbjct: 380 ILNEVQRFR 388



>gi|169605481|ref|XP_001796161.1| hypothetical protein SNOG_05764 [Phaeosphaeria nodorum SN15]
 gi|160706771|gb|EAT86828.2| hypothetical protein SNOG_05764 [Phaeosphaeria nodorum SN15]
          Length = 332

 Score =  362 bits (928), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 175/249 (70%), Positives = 192/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 19  MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 78

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGGK
Sbjct: 79  DFGLARGFSMDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGK 138

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP+EETL R+GS RAQ Y+ +LP M  I F  L+  ANP 
Sbjct: 139 PFFKGRDYVDQLNQILHYLGTPNEETLSRIGSPRAQDYVRNLPFMQKISFQSLFRNANPD 198

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP     FDF FE VE I +MK M
Sbjct: 199 ALDLLDRMLAFDPSSRISVEEALEHRYLQIWHDASDEPTCPTTFDFQFEVVEEIPEMKTM 258

Query: 241 IAQEVMSFK 249
           I  EV  F+
Sbjct: 259 ILAEVNRFR 267



>gi|156056186|ref|XP_001594017.1| hypothetical protein SS1G_05445 [Sclerotinia sclerotiorum 1980]
 gi|154703229|gb|EDO02968.1| hypothetical protein SS1G_05445 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 413

 Score =  361 bits (927), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 175/271 (64%), Positives = 201/271 (74%), Gaps = 3/271 (1%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  I+RS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIVRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILGTP+EETL R+GS RAQ Y+ +LP M   PF  L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHILGTPNEETLSRIGSPRAQEYVRNLPYMAKRPFPTLFPNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI VE AL H YL  +HD  DEP     F+F FE VE + +++K+
Sbjct: 287 ALDLLDHMLAFDPSSRIDVETALEHPYLHIWHDASDEPGCPTTFNFDFEVVEDVGEIRKL 346

Query: 241 IAQEVMSFKASKQAALGLNRQLGRKSSLSAP 271
           I +EV  F+   +   G   Q G+ +    P
Sbjct: 347 ILEEVHRFRQHVRVQPG---QQGQSNGPQVP 374



>gi|315055017|ref|XP_003176883.1| CMGC/MAPK protein kinase [Arthroderma gypseum CBS 118893]
 gi|311338729|gb|EFQ97931.1| CMGC/MAPK protein kinase [Arthroderma gypseum CBS 118893]
          Length = 420

 Score =  361 bits (927), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 172/249 (69%), Positives = 195/249 (78%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  PD NAG+MTEYVATRWYRAPEIMLSF +YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSIDPDENAGYMTEYVATRWYRAPEIMLSFPSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP EETL R+GS RAQ Y+ +LP M   PF++L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHYLGTPSEETLCRIGSPRAQEYVRNLPHMHKQPFARLFPNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP     FDF FE V+ +++M++M
Sbjct: 287 ALDLLDRMLAFDPSSRISVEEALEHRYLHIWHDASDEPNCPTPFDFHFEVVDDVQEMRRM 346

Query: 241 IAQEVMSFK 249
           I  EV  F+
Sbjct: 347 ILNEVQRFR 355



>gi|326473155|gb|EGD97164.1| CMGC/MAPK protein kinase [Trichophyton tonsurans CBS 112818]
          Length = 444

 Score =  361 bits (927), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 172/249 (69%), Positives = 194/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 131 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 190

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  PD NAG+MTEYVATRWYRAPEIMLSF +YTKAID+WSVGCI AE+LGG+
Sbjct: 191 DFGLARGFSIDPDENAGYMTEYVATRWYRAPEIMLSFPSYTKAIDVWSVGCILAELLGGR 250

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP EETL R+GS RAQ Y+ +LP M   PF +L+P ANP 
Sbjct: 251 PFFKGRDYVDQLNQILHYLGTPTEETLCRIGSPRAQEYVRNLPYMHKQPFDRLFPNANPD 310

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP     FDF FE V+ +++M++M
Sbjct: 311 ALHLLDRMLAFDPSSRISVEEALEHRYLHIWHDASDEPNCPTPFDFHFEVVDDVQEMRRM 370

Query: 241 IAQEVMSFK 249
           I  EV  F+
Sbjct: 371 ILNEVQRFR 379



>gi|68520473|gb|AAY98511.1| cell wall integrity MAP kinase [Zymoseptoria tritici]
          Length = 414

 Score =  361 bits (926), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 174/254 (68%), Positives = 194/254 (76%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LG K
Sbjct: 167 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGSK 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP E TL R+GS RAQ Y+ +LP M  IPF  L+  ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHYLGTPSESTLARIGSPRAQEYVRNLPYMQKIPFHTLFRNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP+ RI V++AL H YL+ +HD  DEP     FDF FE VE + +M++M
Sbjct: 287 ALDLLDRMLAFDPSQRIDVDEALEHRYLSIWHDASDEPNCPTTFDFGFEVVEEVPEMRQM 346

Query: 241 IAQEVMSFKASKQA 254
           I QEV  F+ S +A
Sbjct: 347 ILQEVRQFRQSVRA 360



>gi|344304354|gb|EGW34603.1| hypothetical protein SPAPADRAFT_60035 [Spathaspora passalidarum
           NRRL Y-27907]
          Length = 417

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 167/246 (67%), Positives = 198/246 (80%), Gaps = 1/246 (0%)

Query: 5   LHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGL 64
           +HQIIRS QPLTD+H+Q FIYQ+  GLKYIHSA+VLHRDLKPGNLLVNADCELKICDFGL
Sbjct: 1   MHQIIRSGQPLTDSHYQSFIYQVLCGLKYIHSADVLHRDLKPGNLLVNADCELKICDFGL 60

Query: 65  ARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGKPLFK 124
           ARGFS++P+ N+GFMTEYVATRWYRAPEIMLSF +YTKAID+WSVGCI AE+LGGKP+F+
Sbjct: 61  ARGFSENPEQNSGFMTEYVATRWYRAPEIMLSFSSYTKAIDIWSVGCILAELLGGKPIFR 120

Query: 125 GRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPXXXXX 184
           G+DYVDQLNQIL ILGTP E TL R+GS RAQ Y+ SLP M  + + QL+P ANP     
Sbjct: 121 GKDYVDQLNQILLILGTPPEATLTRIGSHRAQNYVRSLPIMRKVSYKQLFPNANPLALDL 180

Query: 185 XXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDF-SFESVELIEDMKKMIAQ 243
                  DP+ RI+VE AL H YL  +HD  DEP  +  FDF SFE+V+ IEDMK++I +
Sbjct: 181 LEKMLALDPSERISVEDALNHPYLEVWHDPRDEPECQVKFDFKSFETVDSIEDMKQLIIE 240

Query: 244 EVMSFK 249
           EV +F+
Sbjct: 241 EVKNFR 246



>gi|353241639|emb|CCA73441.1| probable mitogen-activated protein kinase MpkA [Piriformospora
           indica DSM 11827]
          Length = 441

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 177/287 (61%), Positives = 203/287 (70%), Gaps = 12/287 (4%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS QPL+DAHFQ F+YQ   GLKYIHSANVLHRDLKPGN+L+NADCELKIC
Sbjct: 109 MEADLHAIIRSGQPLSDAHFQSFMYQTLCGLKYIHSANVLHRDLKPGNILLNADCELKIC 168

Query: 61  DFGLARGFSDSPDHN-----------AGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSV 109
           DFGLARG++  P  N           AGFMTEYVATRWYRAPEIMLSF NY+ +ID+WSV
Sbjct: 169 DFGLARGYT-PPGQNPGTASSKAAGSAGFMTEYVATRWYRAPEIMLSFANYSTSIDIWSV 227

Query: 110 GCIFAEMLGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIP 169
           GCI AE LGGKP+F+GRDYVDQL+QIL  LGTP E+ LRRVGS RAQ YI SLP  P +P
Sbjct: 228 GCILAECLGGKPIFRGRDYVDQLSQILNCLGTPKEDALRRVGSPRAQDYIRSLPIKPRVP 287

Query: 170 FSQLYPKANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFE 229
           F QLYP ANP           FDPA RI+ E AL H YL+ +HD  DEP  E  FDF FE
Sbjct: 288 FQQLYPHANPLAIDLLGQMLCFDPAQRISCEDALNHPYLSVWHDPMDEPVCEKKFDFGFE 347

Query: 230 SVELIEDMKKMIAQEVMSFKASKQAALGLNRQLGRKSSLSAPDRDSL 276
             + IE MKK+I +EVM F+   +A         R+ +L  P R+ +
Sbjct: 348 EEDTIEGMKKLIVEEVMQFRQEVRAQSRGGAGARRQDTLPIPSREEI 394



>gi|327308308|ref|XP_003238845.1| CMGC/MAPK protein kinase [Trichophyton rubrum CBS 118892]
 gi|326459101|gb|EGD84554.1| CMGC/MAPK protein kinase [Trichophyton rubrum CBS 118892]
          Length = 420

 Score =  360 bits (925), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 172/249 (69%), Positives = 195/249 (78%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  PD NAG+MTEYVATRWYRAPEIMLSF +YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSIDPDENAGYMTEYVATRWYRAPEIMLSFPSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP EETL R+GS RAQ Y+ +LP M   PF++L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHYLGTPTEETLCRIGSPRAQEYVRNLPYMHKQPFARLFPNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP     FDF FE V+ +++M++M
Sbjct: 287 ALDLLDRMLAFDPSSRISVEEALEHRYLHIWHDASDEPNCPTPFDFHFEVVDDVQEMRRM 346

Query: 241 IAQEVMSFK 249
           I  EV  F+
Sbjct: 347 ILNEVQRFR 355



>gi|326477998|gb|EGE02008.1| CMGC/MAPK protein kinase [Trichophyton equinum CBS 127.97]
          Length = 420

 Score =  360 bits (924), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 172/249 (69%), Positives = 194/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  PD NAG+MTEYVATRWYRAPEIMLSF +YTKAID+WSVGCI AE+LGG+
Sbjct: 167 DFGLARGFSIDPDENAGYMTEYVATRWYRAPEIMLSFPSYTKAIDVWSVGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP EETL R+GS RAQ Y+ +LP M   PF +L+P ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHYLGTPTEETLCRIGSPRAQEYVRNLPYMHKQPFDRLFPNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP++RI+VE+AL H YL  +HD  DEP     FDF FE V+ +++M++M
Sbjct: 287 ALHLLDRMLAFDPSSRISVEEALEHRYLHIWHDASDEPNCPTPFDFHFEVVDDVQEMRRM 346

Query: 241 IAQEVMSFK 249
           I  EV  F+
Sbjct: 347 ILNEVQRFR 355



>gi|471892359|emb|CCO31988.1| hypothetical protein BN14_06040 [Rhizoctonia solani AG-1 IB]
          Length = 1277

 Score =  360 bits (923), Expect = 4e-97,   Method: Compositional matrix adjust.
 Identities = 187/329 (56%), Positives = 219/329 (66%), Gaps = 12/329 (3%)

Query: 1    MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
            MEADLH IIRS QPL+DAHFQ F+YQ   GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 949  MEADLHAIIRSGQPLSDAHFQSFLYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 1008

Query: 61   DFGLARGFSDSPDH------NAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFA 114
            DFGLARG+  S         N GFMTEYVATRWYRAPEIMLSF NYT AID+WS+GCI A
Sbjct: 1009 DFGLARGYVASGGDARAAAGNQGFMTEYVATRWYRAPEIMLSFANYTTAIDVWSIGCILA 1068

Query: 115  EMLGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLY 174
            E+LGGKP+FKGRDYVDQLNQIL  LGTP E+TLRRVGS RAQ YI SLP  P IPF+ +Y
Sbjct: 1069 ELLGGKPIFKGRDYVDQLNQILHHLGTPSEDTLRRVGSPRAQDYIRSLPIKPRIPFNTMY 1128

Query: 175  PKANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELI 234
            P ANP           FDPA RI+ EQAL H YL  +HD  DEP     FDF FE  + +
Sbjct: 1129 PHANPQALDLLAKLLAFDPAKRISCEQALTHPYLNVWHDPSDEPVCSSAFDFGFEEEDSV 1188

Query: 235  EDMKKMIAQEVMSFKASKQAALGLNRQLGRKSSLSAPDRDSL--SXXXXXXXXXXSMYEY 292
            + M+++I  EV +F+ + ++         R+  L+ P RD +  S          +   Y
Sbjct: 1189 DGMRQLIVDEVNAFRHAVRSQARAAGAARRQ-DLTVPSRDDVINSPLSDKVPANGATSGY 1247

Query: 293  GAASQHAAIPSA---SMEVDEQLEQELGG 318
             + S   + P A   S E+  +LEQ+  G
Sbjct: 1248 TSNSGRVSSPVAEDPSAELVRELEQQTLG 1276



>gi|465792314|emb|CCU97422.1| MAPK-like protein [Malassezia sympodialis ATCC 42132]
          Length = 494

 Score =  359 bits (921), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 177/255 (69%), Positives = 191/255 (74%), Gaps = 8/255 (3%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS QPLTDAHFQ FIYQ   GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 117 MEADLHAIIRSGQPLTDAHFQSFIYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 176

Query: 61  DFGLARGFSDSPDHNA------GFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFA 114
           DFGL+RGF   PD N        FMTEYVATRWYRAPEIMLS QNYT AIDMWSVGCI A
Sbjct: 177 DFGLSRGFD--PDQNTVVPGQQEFMTEYVATRWYRAPEIMLSHQNYTTAIDMWSVGCILA 234

Query: 115 EMLGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLY 174
           E+LG +PLFKGRDYVDQLNQIL  LG P E  L+R+ S RAQ YI SLP  P IPF QLY
Sbjct: 235 ELLGRRPLFKGRDYVDQLNQILHYLGHPSEAMLQRIASPRAQQYIRSLPFKPGIPFEQLY 294

Query: 175 PKANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELI 234
           P+ANP           FDP  RIT ++ALAH YLA +HD  DEP     FDFSFE+V+ I
Sbjct: 295 PRANPLALDLLRRLLAFDPRQRITCDEALAHPYLAVWHDPADEPVCHSKFDFSFENVDDI 354

Query: 235 EDMKKMIAQEVMSFK 249
             MKK+I  EV+SF+
Sbjct: 355 PGMKKLILDEVISFR 369



>gi|7385125|gb|AAF61706.1|AF226711_1 MAP kinase [Kluyveromyces lactis]
          Length = 520

 Score =  359 bits (921), Expect = 7e-97,   Method: Compositional matrix adjust.
 Identities = 166/249 (66%), Positives = 194/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQI++S QPLTDAH+Q FIYQI  GLKYIHSA+VLHRDLKPGNLLVNADC+LKIC
Sbjct: 113 MECDMHQIVKSGQPLTDAHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKIC 172

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+S++P  N  F+TEYVATRWYRAPEIMLS+Q YTKAID+WS GCI AE+LGGK
Sbjct: 173 DFGLARGYSENPVENNQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSCGCILAELLGGK 232

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+FKG+DYVDQLN+IL +LGTP EETL+R+GS+  Q YI  L  +P IPFS LYP ANP 
Sbjct: 233 PIFKGKDYVDQLNRILQVLGTPPEETLKRIGSKNVQDYIHQLGYIPKIPFSTLYPNANPD 292

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP  RITV+ AL H YL+ +HD  DEP     FDFSFESV  IE +K+M
Sbjct: 293 ALNLLEGMLSFDPQLRITVDDALQHPYLSIWHDPADEPICTEKFDFSFESVNEIEQLKQM 352

Query: 241 IAQEVMSFK 249
           +  EV  F+
Sbjct: 353 VIDEVTDFR 361



>gi|149246025|ref|XP_001527482.1| mitogen-activated protein kinase MKC1 [Lodderomyces elongisporus
           NRRL YB-4239]
 gi|146447436|gb|EDK41824.1| mitogen-activated protein kinase MKC1 [Lodderomyces elongisporus
           NRRL YB-4239]
          Length = 552

 Score =  358 bits (920), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 170/250 (68%), Positives = 196/250 (78%), Gaps = 1/250 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQIIRS QPLTD H+Q FIYQI  GLKYIHSA+VLHRDLKPGNLLVNADCELKI 
Sbjct: 137 MECDMHQIIRSGQPLTDLHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLVNADCELKIG 196

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS+ P+ N GFMTEYVATRWYRAPEIMLSF NYTKAID+WSVGCI AE+LGGK
Sbjct: 197 DFGLARGFSEDPEQNQGFMTEYVATRWYRAPEIMLSFSNYTKAIDVWSVGCILAELLGGK 256

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLF+G+DYVDQLNQIL ILGTP E+TL ++GS+RAQ Y+ SLP M  I +SQL+P ANP 
Sbjct: 257 PLFRGKDYVDQLNQILMILGTPPEDTLVKIGSQRAQNYVRSLPYMKKISYSQLFPNANPL 316

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDF-SFESVELIEDMKK 239
                      DP  RI+V  AL H YL  +HD  DEP  +  FDF SFE+ E ++DMK+
Sbjct: 317 ALDLLEKMLTLDPHERISVNDALNHKYLEIWHDPRDEPECQIKFDFKSFETFEELDDMKQ 376

Query: 240 MIAQEVMSFK 249
           +I +EV  F+
Sbjct: 377 LIMEEVKGFR 386



>gi|50304219|ref|XP_452059.1| hypothetical protein [Kluyveromyces lactis NRRL Y-1140]
 gi|49641191|emb|CAH02452.1| KLLA0B11902p [Kluyveromyces lactis]
          Length = 495

 Score =  358 bits (920), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 166/249 (66%), Positives = 194/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQI++S QPLTDAH+Q FIYQI  GLKYIHSA+VLHRDLKPGNLLVNADC+LKIC
Sbjct: 113 MECDMHQIVKSGQPLTDAHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKIC 172

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+S++P  N  F+TEYVATRWYRAPEIMLS+Q YTKAID+WS GCI AE+LGGK
Sbjct: 173 DFGLARGYSENPVENNQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSCGCILAELLGGK 232

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+FKG+DYVDQLN+IL +LGTP EETL+R+GS+  Q YI  L  +P IPFS LYP ANP 
Sbjct: 233 PIFKGKDYVDQLNRILQVLGTPPEETLKRIGSKNVQDYIHQLGYIPKIPFSTLYPNANPD 292

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP  RITV+ AL H YL+ +HD  DEP     FDFSFESV  IE +K+M
Sbjct: 293 ALNLLEGMLSFDPQLRITVDDALQHPYLSIWHDPADEPICTEKFDFSFESVNEIEQLKQM 352

Query: 241 IAQEVMSFK 249
           +  EV  F+
Sbjct: 353 VIDEVTDFR 361



>gi|398409100|ref|XP_003856015.1| mitogen-activated protein kinase [Zymoseptoria tritici IPO323]
 gi|339475900|gb|EGP90991.1| mitogen-activated protein kinase [Zymoseptoria tritici IPO323]
          Length = 414

 Score =  358 bits (920), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 173/254 (68%), Positives = 193/254 (75%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKA D+WSVGCI AE+LG K
Sbjct: 167 DFGLARGFSVDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKASDVWSVGCILAELLGSK 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP E TL R+GS RAQ Y+ +LP M  IPF  L+  ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHYLGTPSESTLARIGSPRAQEYVRNLPYMQKIPFHTLFRNANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP+ RI V++AL H YL+ +HD  DEP     FDF FE VE + +M++M
Sbjct: 287 ALDLLDRMLAFDPSQRIDVDEALEHRYLSIWHDASDEPNCPTTFDFGFEVVEEVPEMRQM 346

Query: 241 IAQEVMSFKASKQA 254
           I QEV  F+ S +A
Sbjct: 347 ILQEVRQFRQSVRA 360



>gi|453086115|gb|EMF14157.1| SLT2-like MAP kinase protein [Mycosphaerella populorum SO2202]
          Length = 419

 Score =  358 bits (920), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 173/254 (68%), Positives = 194/254 (76%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKI 
Sbjct: 107 MECDLAAIIRSGQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIA 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P+ NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WSVGCI AE+LG K
Sbjct: 167 DFGLARGFSIDPEENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDVWSVGCILAELLGSK 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL  LGTP E TL R+GS RAQ Y+ +LP M  IPF  L+ +ANP 
Sbjct: 227 PFFKGRDYVDQLNQILHFLGTPSESTLSRIGSPRAQEYVRNLPYMQKIPFQTLFHRANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP+ RI+VE AL H YL+ +HD  DEPA    FDF FE V+ + +M++M
Sbjct: 287 ALDLLDRMLAFDPSQRISVEDALEHRYLSIWHDASDEPACPTPFDFGFEVVDEVPEMRQM 346

Query: 241 IAQEVMSFKASKQA 254
           I  EV  F+ S +A
Sbjct: 347 ILDEVRRFRQSVRA 360



>gi|260944918|ref|XP_002616757.1| hypothetical protein CLUG_03997 [Clavispora lusitaniae ATCC 42720]
 gi|238850406|gb|EEQ39870.1| hypothetical protein CLUG_03997 [Clavispora lusitaniae ATCC 42720]
          Length = 544

 Score =  358 bits (919), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 168/250 (67%), Positives = 199/250 (79%), Gaps = 1/250 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQIIRS QPLTD+H+Q F+YQI  GLKYIHSA+VLHRDLKPGNLLVNADCELKIC
Sbjct: 114 MECDMHQIIRSGQPLTDSHYQSFVYQILCGLKYIHSADVLHRDLKPGNLLVNADCELKIC 173

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS+  + NAGFMTEYVATRWYRAPEIMLSF NYTKAID+WSVGCI  E+LGGK
Sbjct: 174 DFGLARGFSEDVEQNAGFMTEYVATRWYRAPEIMLSFSNYTKAIDIWSVGCILGELLGGK 233

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLF+G+DYVDQLNQIL ILGTP E TL ++GS RAQ Y+ SLP M  +P+S+L+P ANP 
Sbjct: 234 PLFRGKDYVDQLNQILMILGTPKEATLTKIGSVRAQNYVRSLPIMRRVPYSELFPGANPL 293

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDF-SFESVELIEDMKK 239
                      DP  RITV +AL H YLA +HD +DEP     FDF +FE+V+ ++ MK+
Sbjct: 294 ALDLLDKMLTLDPFQRITVNEALNHPYLAIWHDPQDEPECTVKFDFTTFETVDDMDYMKQ 353

Query: 240 MIAQEVMSFK 249
           +I +EV +F+
Sbjct: 354 LIVEEVQNFR 363



>gi|190345293|gb|EDK37155.2| hypothetical protein PGUG_01253 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 466

 Score =  358 bits (918), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 165/250 (66%), Positives = 199/250 (79%), Gaps = 1/250 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQIIRS Q LTD+H+Q FIYQ+  GLKYIHSA+VLHRDLKPGNLLVNADCELKIC
Sbjct: 85  MECDMHQIIRSGQALTDSHYQSFIYQVLCGLKYIHSADVLHRDLKPGNLLVNADCELKIC 144

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS+ P+ NAGFMTEYVATRWYRAPEIMLSF NY+KAID+WS GCI AE+LGGK
Sbjct: 145 DFGLARGFSEDPEQNAGFMTEYVATRWYRAPEIMLSFTNYSKAIDIWSAGCILAELLGGK 204

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLF+G+DYVDQLNQIL +LGTPDE TL ++GS RAQ Y+ SLP M  +P+++++P ANP 
Sbjct: 205 PLFRGKDYVDQLNQILLVLGTPDEPTLTKIGSVRAQNYVRSLPAMRKVPYNEIFPNANPL 264

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDF-SFESVELIEDMKK 239
                      DP  RITVE+AL H YL+ +HD +DEP  +  FDF SFE  + +  MK+
Sbjct: 265 ALDLLEKMLTLDPFKRITVEEALEHPYLSVWHDPQDEPRCQVKFDFKSFEKADDMNIMKR 324

Query: 240 MIAQEVMSFK 249
           +I +EV +F+
Sbjct: 325 LIMEEVKNFR 334



>gi|354544732|emb|CCE41457.1| hypothetical protein CPAR2_800090 [Candida parapsilosis]
          Length = 491

 Score =  358 bits (918), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 166/250 (66%), Positives = 198/250 (79%), Gaps = 1/250 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQIIRS QPLTD+H+Q FIYQI  GLKYIHSA+VLHRDLKPGNLLVNADCELKIC
Sbjct: 127 MECDMHQIIRSGQPLTDSHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLVNADCELKIC 186

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS++P+ N GFMTEYVATRWYRAPEIMLSF NYTKAID+WSVGCI AE+LGGK
Sbjct: 187 DFGLARGFSENPEQNQGFMTEYVATRWYRAPEIMLSFTNYTKAIDVWSVGCILAELLGGK 246

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+F+G+DYVDQLNQIL ILGTP E TL ++GS+RAQ Y+ SLP M  I +  L+P ANP 
Sbjct: 247 PIFRGKDYVDQLNQILMILGTPPESTLVKIGSQRAQNYVRSLPFMKKISYRHLFPNANPL 306

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDF-SFESVELIEDMKK 239
                      DP  RI+V +AL H YL  +HD  DEP  +  FDF +FE+ E +++MK+
Sbjct: 307 ALDLLEKMLALDPHERISVNEALEHPYLEVWHDPRDEPECQVKFDFKTFETFEELDEMKQ 366

Query: 240 MIAQEVMSFK 249
           +I +EV +F+
Sbjct: 367 LIMEEVRTFR 376



>gi|511009403|gb|EPB90647.1| CMGC/MAPK protein kinase [Mucor circinelloides f. circinelloides
           1006PhL]
          Length = 419

 Score =  358 bits (918), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 185/327 (56%), Positives = 217/327 (66%), Gaps = 17/327 (5%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLHQIIRS QPLTD H+Q FIYQ C GLKYIHSANVLHRDLKP NLLVN  CELKIC
Sbjct: 103 MEADLHQIIRSGQPLTDEHYQSFIYQACCGLKYIHSANVLHRDLKPCNLLVNTKCELKIC 162

Query: 61  DFGLARGFSD--SPDHNAGFMTEYVATRWYRAPEIMLSFQNYT-----KAIDMWSVGCIF 113
           DFGLARG+ D  S + +AGFMTEYVATR+YRAPEIMLSF+          +DMWS+GCIF
Sbjct: 163 DFGLARGYVDTKSGEGDAGFMTEYVATRYYRAPEIMLSFRTVVLTRSCNIVDMWSLGCIF 222

Query: 114 AEMLGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQL 173
           AE+LG KPLFKGRD+VDQLNQIL ILGTPD++TL R+GSERAQ YI SL +   IP  QL
Sbjct: 223 AELLGSKPLFKGRDFVDQLNQILYILGTPDDDTLNRIGSERAQTYIRSLERFAKIPLEQL 282

Query: 174 YPKANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVEL 233
           YP A             FDP +RI VE AL H Y   +HD +DEP H    DFSFES+  
Sbjct: 283 YPNATETALDLLEKLLTFDPMSRIGVEDALNHPYFELFHDPDDEPTHFATVDFSFESLNS 342

Query: 234 IEDMKKMIAQEVMSFKASKQAALGLNRQLGRKSSLSAPDRDSLSXXXXXXXXXXSMYEYG 293
           IE+MK+ I  EV  FKA K +     R L R++S++ P                 + E G
Sbjct: 343 IEEMKETIIDEVKMFKARKHSLKLDMRGLRRQNSITTP-------TSKRARYSSQVNEMG 395

Query: 294 AASQHAAIPSASMEVDEQLEQELGGLV 320
            A Q    P   ++VD  LE++L G++
Sbjct: 396 YADQLITSP---VDVDPNLERDLSGII 419



>gi|254572043|ref|XP_002493131.1| Serine/threonine MAP kinase [Komagataella pastoris GS115]
 gi|8250614|emb|CAB93665.1| serine/threonine protein kinase [Komagataella pastoris]
 gi|238032929|emb|CAY70952.1| Serine/threonine MAP kinase [Komagataella pastoris GS115]
 gi|328352851|emb|CCA39249.1| mitogen-activated protein kinase 7 [Komagataella pastoris CBS 7435]
          Length = 426

 Score =  357 bits (917), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 168/249 (67%), Positives = 193/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DLH II+S+QPLTD+H+Q FIYQI  GLKYIHSA+VLHRDLKP NLLVN+DCELKIC
Sbjct: 109 MECDLHHIIKSKQPLTDSHYQSFIYQILGGLKYIHSADVLHRDLKPVNLLVNSDCELKIC 168

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+S   + NAGF+TEYVATRWYRAPEI+LSFQ YTKAID+WSVGCI AE+LGG+
Sbjct: 169 DFGLARGYSSDAEKNAGFLTEYVATRWYRAPEIILSFQTYTKAIDIWSVGCILAELLGGR 228

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+F+GRDYVDQLN IL  LGT  EETL+ + SERAQ Y+ SLP MP IPFSQL+P ANP 
Sbjct: 229 PIFRGRDYVDQLNLILSTLGTVSEETLQSIRSERAQDYVRSLPFMPKIPFSQLFPGANPE 288

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                      DP  RITV +AL H YL  +HD  DEP     FDFSFE V+ IE MK+M
Sbjct: 289 AIDLLDRMLTVDPTHRITVTEALEHPYLKVWHDPNDEPVCSSKFDFSFEVVDDIETMKQM 348

Query: 241 IAQEVMSFK 249
           I  EV+S +
Sbjct: 349 IVDEVLSLR 357



>gi|410079779|ref|XP_003957470.1| hypothetical protein KAFR_0E01810 [Kazachstania africana CBS 2517]
 gi|372464056|emb|CCF58335.1| hypothetical protein KAFR_0E01810 [Kazachstania africana CBS 2517]
          Length = 476

 Score =  357 bits (917), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 165/249 (66%), Positives = 194/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQII+S QPLTDAH+Q FIYQI  GLKYIHSA+VLHRDLKPGNLLVNADC+LKIC
Sbjct: 111 MECDMHQIIKSSQPLTDAHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKIC 170

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+S++P  N  F+TEYVATRWYRAPEIMLS+Q YTKAID+WS GCI AE LGGK
Sbjct: 171 DFGLARGYSENPVENNQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSTGCILAEFLGGK 230

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+FKG+DYV QLNQIL +LGTP +ETL+R+GS+  Q YI  L  +PTIPFS LYP ANP 
Sbjct: 231 PIFKGKDYVHQLNQILQVLGTPPDETLKRIGSKNVQDYIHQLGYIPTIPFSNLYPDANPQ 290

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP  RITV++AL H YL+ +HD  DEP     FDF FE V  +ED+K+M
Sbjct: 291 ALDLLERMLAFDPQKRITVDEALQHPYLSIWHDPADEPICSEKFDFGFEVVTDMEDLKQM 350

Query: 241 IAQEVMSFK 249
           + +EV  F+
Sbjct: 351 VIEEVNDFR 359



>gi|213409748|ref|XP_002175644.1| mitogen-activated protein kinase spm1 [Schizosaccharomyces
           japonicus yFS275]
 gi|212003691|gb|EEB09351.1| mitogen-activated protein kinase spm1 [Schizosaccharomyces
           japonicus yFS275]
          Length = 410

 Score =  357 bits (916), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 171/277 (61%), Positives = 204/277 (73%), Gaps = 10/277 (3%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADL+ II+S QPLTDAHFQ FIYQI  GLKYIHSANV+HRDLKPGNLLVNADCELKIC
Sbjct: 83  MEADLNAIIKSGQPLTDAHFQSFIYQILCGLKYIHSANVIHRDLKPGNLLVNADCELKIC 142

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFSD+PD NAGFMTEYVATRWYRAPEIMLSF +Y K ID+WSVGCI AE+LGG+
Sbjct: 143 DFGLARGFSDNPDENAGFMTEYVATRWYRAPEIMLSFSSYHKGIDVWSVGCILAELLGGR 202

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKG+DYV QLN IL  LGTPDEETL R+ SERA  YI S P    IPF  ++P ANP 
Sbjct: 203 PFFKGKDYVHQLNLILHYLGTPDEETLSRISSERAYNYIRSFPPKKPIPFETIFPYANPL 262

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDPA RI+V +AL H YLA +HD  DEP     FDFSFE++  + +++ +
Sbjct: 263 ALDLLSRMLTFDPAKRISVTEALEHPYLAVWHDPADEPECPIPFDFSFEAINDMNELRDL 322

Query: 241 IAQEVMSFKASKQAA----------LGLNRQLGRKSS 267
           I +EV++F+ + + +          + +N QL  ++S
Sbjct: 323 IQREVLAFRRNVRRSPNPSLPHLHPIQINSQLSSRAS 359



>gi|448507836|ref|XP_003865857.1| Mkc1 MAP kinase [Candida orthopsilosis Co 90-125]
 gi|380350195|emb|CCG20414.1| Mkc1 MAP kinase [Candida orthopsilosis Co 90-125]
          Length = 491

 Score =  357 bits (916), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 167/250 (66%), Positives = 197/250 (78%), Gaps = 1/250 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQIIRS QPLTD+H+Q FIYQI  GLKYIHSA+VLHRDLKPGNLLVNADCELKIC
Sbjct: 127 MECDMHQIIRSGQPLTDSHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLVNADCELKIC 186

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS++P+ N GFMTEYVATRWYRAPEIMLSF NYTKAID+WSVGCI AE+LGGK
Sbjct: 187 DFGLARGFSENPEQNQGFMTEYVATRWYRAPEIMLSFTNYTKAIDVWSVGCILAELLGGK 246

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLF+G+DYVDQLNQIL ILGTP E TL ++GS+RAQ Y+ SLP M  I +  L+P ANP 
Sbjct: 247 PLFRGKDYVDQLNQILMILGTPPESTLVKIGSQRAQNYVRSLPIMKKISYRHLFPDANPL 306

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDF-SFESVELIEDMKK 239
                      DP  RI+V +AL H YL  +HD  DEP  +  FDF +FE+ E +++MK+
Sbjct: 307 ALDLLEKMLALDPHERISVNEALEHPYLEVWHDPRDEPECQVKFDFKTFETFEELDEMKQ 366

Query: 240 MIAQEVMSFK 249
           +I  EV +F+
Sbjct: 367 LIMDEVRTFR 376



>gi|320583036|gb|EFW97252.1| Serine/threonine MAP kinase [Ogataea parapolymorpha DL-1]
          Length = 435

 Score =  356 bits (914), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 191/249 (76%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQIIRS QPLTD+H+Q F+YQI  GLKYIHSA+VLHRDLKPGNLLVNADCELKIC
Sbjct: 109 MECDMHQIIRSNQPLTDSHYQSFVYQILCGLKYIHSADVLHRDLKPGNLLVNADCELKIC 168

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+S+ P+ N GF+TEYVATRWYRAPEI+LSFQ YTKAIDMWSVGCI AE+LGG 
Sbjct: 169 DFGLARGYSNDPEKNQGFLTEYVATRWYRAPEIILSFQGYTKAIDMWSVGCILAELLGGS 228

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
            +FKG+DYVDQLN+IL +LGTP+E T++ + S RAQ Y+ SLP MP +PF   +P ANP 
Sbjct: 229 TIFKGKDYVDQLNEILKVLGTPNEHTMQSIKSSRAQAYVRSLPYMPKVPFENFFPHANPL 288

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                      +P  RITVE AL H YL  +HD  DEP     FDFSFE  + I +MK+M
Sbjct: 289 AIDLLNRMLTLNPEDRITVEDALQHPYLEVWHDPNDEPVCSAKFDFSFEETDDINEMKQM 348

Query: 241 IAQEVMSFK 249
           I +E  SF+
Sbjct: 349 IIEETRSFR 357



>gi|513032580|gb|AGO12572.1| AaceriAER232Cp [Saccharomycetaceae sp. 'Ashbya aceri']
          Length = 581

 Score =  356 bits (913), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 160/249 (64%), Positives = 197/249 (79%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQII+S QPLTDAH+Q F+YQI  GLKYIHSA+VLHRDLKPGNLLVNADC+LKIC
Sbjct: 111 MECDMHQIIKSGQPLTDAHYQSFVYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKIC 170

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+S++P  N  F+TEYVATRWYRAPEIMLS+Q YT+AID+WS GC+ AE+LGG+
Sbjct: 171 DFGLARGYSENPVENDQFLTEYVATRWYRAPEIMLSYQGYTRAIDVWSCGCVLAELLGGR 230

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+FKG+DYVDQLN+IL +LGTP EETL+R+GS+  Q YI  L  +P +PF +LYP ANP 
Sbjct: 231 PIFKGKDYVDQLNRILQVLGTPPEETLKRIGSKNVQDYIHQLGYIPKVPFERLYPNANPA 290

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                      DP TRITV++AL H YL+ +HD  DEP     FDFSFESV  +E++K+M
Sbjct: 291 AADLLERMLALDPKTRITVDEALEHPYLSIWHDPSDEPVCSEKFDFSFESVNEMEELKRM 350

Query: 241 IAQEVMSFK 249
           + +EV  F+
Sbjct: 351 VIEEVKDFR 359



>gi|344230296|gb|EGV62181.1| hypothetical protein CANTEDRAFT_109071 [Candida tenuis ATCC 10573]
          Length = 489

 Score =  356 bits (913), Expect = 6e-96,   Method: Compositional matrix adjust.
 Identities = 166/250 (66%), Positives = 196/250 (78%), Gaps = 1/250 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQIIRS QPLTD H+Q FIYQ+  GLKYIHSA+VLHRDLKPGNLLVNADCELKIC
Sbjct: 118 MECDMHQIIRSGQPLTDQHYQSFIYQVLCGLKYIHSADVLHRDLKPGNLLVNADCELKIC 177

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS+ P+ NAGFMTEYVATRWYRAPEIMLSF NYTKAID+WSVGCI AE+LGGK
Sbjct: 178 DFGLARGFSEDPEQNAGFMTEYVATRWYRAPEIMLSFTNYTKAIDIWSVGCILAELLGGK 237

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+F+G+DYVDQLNQIL ILGTP E TL ++GS RAQ Y+ SLP    + +S+L+P ANP 
Sbjct: 238 PIFRGKDYVDQLNQILLILGTPKESTLTKIGSVRAQNYVRSLPYTRKVEYSELFPTANPL 297

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDF-SFESVELIEDMKK 239
                      DP  RITV++AL H Y   +HD +DEP  +  FDF SFE+++ +  MK+
Sbjct: 298 ALDLLEHMLTLDPYERITVDEALKHPYFQVWHDPQDEPECQIKFDFKSFETIDDLPTMKQ 357

Query: 240 MIAQEVMSFK 249
           +I  EV SF+
Sbjct: 358 IIIDEVRSFR 367



>gi|146419238|ref|XP_001485582.1| hypothetical protein PGUG_01253 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 466

 Score =  355 bits (912), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 164/250 (65%), Positives = 198/250 (79%), Gaps = 1/250 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQIIRS Q LTD+H+Q FIYQ+  GLKYIHSA+VLHRDLKPGNLLVNADCELKIC
Sbjct: 85  MECDMHQIIRSGQALTDSHYQSFIYQVLCGLKYIHSADVLHRDLKPGNLLVNADCELKIC 144

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGF + P+ NAGFMTEYVATRWYRAPEIMLSF NY+KAID+WS GCI AE+LGGK
Sbjct: 145 DFGLARGFLEDPEQNAGFMTEYVATRWYRAPEIMLSFTNYSKAIDIWSAGCILAELLGGK 204

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLF+G+DYVDQLNQIL +LGTPDE TL ++GS RAQ Y+ SLP M  +P+++++P ANP 
Sbjct: 205 PLFRGKDYVDQLNQILLVLGTPDEPTLTKIGSVRAQNYVRSLPAMRKVPYNEIFPNANPL 264

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDF-SFESVELIEDMKK 239
                      DP  RITVE+AL H YL+ +HD +DEP  +  FDF SFE  + +  MK+
Sbjct: 265 ALDLLEKMLTLDPFKRITVEEALEHPYLSVWHDPQDEPRCQVKFDFKSFEKADDMNIMKR 324

Query: 240 MIAQEVMSFK 249
           +I +EV +F+
Sbjct: 325 LIMEEVKNFR 334



>gi|294657798|ref|XP_460098.2| DEHA2E18348p [Debaryomyces hansenii CBS767]
 gi|199432958|emb|CAG88362.2| DEHA2E18348p [Debaryomyces hansenii CBS767]
          Length = 503

 Score =  355 bits (912), Expect = 8e-96,   Method: Compositional matrix adjust.
 Identities = 167/250 (66%), Positives = 197/250 (78%), Gaps = 1/250 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQIIRS Q LTD+H+Q FIYQ   GLKYIHSA+VLHRDLKPGNLLVNADCELKIC
Sbjct: 120 MECDMHQIIRSGQHLTDSHYQSFIYQTLCGLKYIHSADVLHRDLKPGNLLVNADCELKIC 179

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS+ P+ N GFMTEYVATRWYRAPEIMLSF NYTKAID+WSVGCI AE+LGGK
Sbjct: 180 DFGLARGFSECPEQNVGFMTEYVATRWYRAPEIMLSFTNYTKAIDIWSVGCILAELLGGK 239

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+F+G+DYVDQLNQIL ILGTP E TL ++GS RAQ Y+ SLP M  + +S+L+P ANP 
Sbjct: 240 PIFRGKDYVDQLNQILLILGTPKESTLTKIGSVRAQNYVRSLPFMRKVHYSELFPTANPL 299

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDF-SFESVELIEDMKK 239
                      DP  RITVE+AL H YL+ +HD +DEP  +  FDF SFE+V+ ++ MK 
Sbjct: 300 ALDLLEKMLTLDPYERITVEEALNHPYLSVWHDPQDEPECQIKFDFKSFETVDDMKSMKN 359

Query: 240 MIAQEVMSFK 249
           +I  EV +F+
Sbjct: 360 LIIDEVKNFR 369



>gi|302308233|ref|NP_985089.2| AER232Cp [Ashbya gossypii ATCC 10895]
 gi|299789356|gb|AAS52913.2| AER232Cp [Ashbya gossypii ATCC 10895]
 gi|374108314|gb|AEY97221.1| FAER232Cp [Ashbya gossypii FDAG1]
          Length = 569

 Score =  355 bits (911), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 160/249 (64%), Positives = 197/249 (79%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQII+S QPLTDAH+Q F+YQI  GLKYIHSA+VLHRDLKPGNLLVNADC+LKIC
Sbjct: 111 MECDMHQIIKSGQPLTDAHYQSFVYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKIC 170

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+S++P  N  F+TEYVATRWYRAPEIMLS+Q YT+AID+WS GC+ AE+LGG+
Sbjct: 171 DFGLARGYSENPIENDQFLTEYVATRWYRAPEIMLSYQGYTRAIDVWSCGCVLAELLGGR 230

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+FKG+DYVDQLN+IL +LGTP EETL+R+GS+  Q YI  L  +P +PF +LYP ANP 
Sbjct: 231 PIFKGKDYVDQLNRILQVLGTPPEETLKRIGSKNVQDYIHQLGYIPKVPFERLYPNANPD 290

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                      DP TRITV++AL H YL+ +HD  DEP     FDFSFESV  +E++K+M
Sbjct: 291 AADLLERMLALDPKTRITVDEALEHPYLSIWHDPSDEPVCCKKFDFSFESVNEMEELKRM 350

Query: 241 IAQEVMSFK 249
           + +EV  F+
Sbjct: 351 VIEEVKDFR 359



>gi|363755580|ref|XP_003648005.1| hypothetical protein Ecym_7361 [Eremothecium cymbalariae
           DBVPG#7215]
 gi|356892041|gb|AET41188.1| hypothetical protein Ecym_7361 [Eremothecium cymbalariae
           DBVPG#7215]
          Length = 483

 Score =  355 bits (911), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 161/249 (64%), Positives = 195/249 (78%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQII+S QPLTDAH Q F+YQI  GLKYIHSA+VLHRDLKPGNLLVNADC+LKIC
Sbjct: 113 MECDMHQIIKSGQPLTDAHHQSFVYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKIC 172

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+S++P  N  F+TEYVATRWYRAPEIMLS+Q YT+AID+WS GC+ AE+LGGK
Sbjct: 173 DFGLARGYSENPVENNQFLTEYVATRWYRAPEIMLSYQGYTRAIDVWSCGCVLAELLGGK 232

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+FKG+DYVDQLN+IL +LGTP EETL+R+GS+  Q YI  L  +P +PF +LYP ANP 
Sbjct: 233 PIFKGKDYVDQLNRILQVLGTPPEETLKRIGSKNVQDYIHQLGFIPKVPFHKLYPNANPQ 292

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP TRITV++AL H YL+ +HD  DEP     FDF FESV  +E +K+M
Sbjct: 293 AADLLERMLAFDPKTRITVDEALEHPYLSIWHDPSDEPVCNKKFDFGFESVNEMEQLKQM 352

Query: 241 IAQEVMSFK 249
           + +EV  F+
Sbjct: 353 VIEEVNDFR 361



>gi|367014613|ref|XP_003681806.1| hypothetical protein TDEL_0E03520 [Torulaspora delbrueckii]
 gi|359749467|emb|CCE92595.1| hypothetical protein TDEL_0E03520 [Torulaspora delbrueckii]
          Length = 490

 Score =  355 bits (910), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 160/250 (64%), Positives = 198/250 (79%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQII+SEQPLTDAH+Q FIYQI  GLKYIHSA+VLHRDLKPGNLLVNADC+LKIC
Sbjct: 111 MECDMHQIIKSEQPLTDAHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKIC 170

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+S++P  N  F+TEYVATRWYRAPEIMLS+Q YTKAID+WS GCI AE LGGK
Sbjct: 171 DFGLARGYSENPVENNQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSTGCILAEFLGGK 230

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+FKG+DYV+QLN+IL +LGTP +ETL+R+GS+  Q YI  L  +P +PF  ++P+ANP 
Sbjct: 231 PIFKGKDYVNQLNRILQVLGTPPDETLKRIGSKNVQDYIHQLGFIPKVPFVDIFPQANPE 290

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP+ RITV +A+ H YL+ +HD  DEP     F+FSFESV  +E++K+M
Sbjct: 291 ALDLLERMLAFDPSRRITVNEAIKHPYLSIWHDPADEPVCSEKFEFSFESVNEMEELKQM 350

Query: 241 IAQEVMSFKA 250
           + QEV  F++
Sbjct: 351 VIQEVQDFRS 360



>gi|323333344|gb|EGA74741.1| Slt2p [Saccharomyces cerevisiae AWRI796]
          Length = 484

 Score =  355 bits (910), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 163/249 (65%), Positives = 194/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQII+S QPLTDAH+Q F YQI  GLKYIHSA+VLHRDLKPGNLLVNADC+LKIC
Sbjct: 111 MECDMHQIIKSGQPLTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKIC 170

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+S++P  N+ F+TEYVATRWYRAPEIMLS+Q YTKAID+WS GCI AE LGGK
Sbjct: 171 DFGLARGYSENPVENSQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSAGCILAEFLGGK 230

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+FKG+DYV+QLNQIL +LGTP +ETLRR+GS+  Q YI  L  +P +PF  LYP AN  
Sbjct: 231 PIFKGKDYVNQLNQILQVLGTPPDETLRRIGSKNVQDYIHQLGFIPKVPFVNLYPNANSQ 290

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP  RITV++AL H YL+ +HD  DEP     F+FSFESV  +ED+K+M
Sbjct: 291 ALDLLEQMLAFDPQKRITVDEALEHPYLSIWHDPADEPVCSEKFEFSFESVNDMEDLKQM 350

Query: 241 IAQEVMSFK 249
           + QEV  F+
Sbjct: 351 VIQEVQDFR 359



>gi|349578580|dbj|GAA23745.1| K7_Slt2p [Saccharomyces cerevisiae Kyokai no. 7]
          Length = 490

 Score =  354 bits (909), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 163/249 (65%), Positives = 194/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQII+S QPLTDAH+Q F YQI  GLKYIHSA+VLHRDLKPGNLLVNADC+LKIC
Sbjct: 111 MECDMHQIIKSGQPLTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKIC 170

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+S++P  N+ F+TEYVATRWYRAPEIMLS+Q YTKAID+WS GCI AE LGGK
Sbjct: 171 DFGLARGYSENPVENSQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSAGCILAEFLGGK 230

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+FKG+DYV+QLNQIL +LGTP +ETLRR+GS+  Q YI  L  +P +PF  LYP AN  
Sbjct: 231 PIFKGKDYVNQLNQILQVLGTPPDETLRRIGSKNVQDYIHQLGFIPKVPFVNLYPNANSQ 290

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP  RITV++AL H YL+ +HD  DEP     F+FSFESV  +ED+K+M
Sbjct: 291 ALDLLEQMLAFDPQKRITVDEALEHPYLSIWHDPADEPVCSEKFEFSFESVNDMEDLKQM 350

Query: 241 IAQEVMSFK 249
           + QEV  F+
Sbjct: 351 VIQEVQDFR 359



>gi|323304732|gb|EGA58493.1| Slt2p [Saccharomyces cerevisiae FostersB]
          Length = 500

 Score =  354 bits (909), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 163/249 (65%), Positives = 194/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQII+S QPLTDAH+Q F YQI  GLKYIHSA+VLHRDLKPGNLLVNADC+LKIC
Sbjct: 111 MECDMHQIIKSGQPLTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKIC 170

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+S++P  N+ F+TEYVATRWYRAPEIMLS+Q YTKAID+WS GCI AE LGGK
Sbjct: 171 DFGLARGYSENPVENSQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSAGCILAEFLGGK 230

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+FKG+DYV+QLNQIL +LGTP +ETLRR+GS+  Q YI  L  +P +PF  LYP AN  
Sbjct: 231 PIFKGKDYVNQLNQILQVLGTPPDETLRRIGSKNVQDYIHQLGFIPKVPFVNLYPNANSQ 290

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP  RITV++AL H YL+ +HD  DEP     F+FSFESV  +ED+K+M
Sbjct: 291 ALDLLEQMLAFDPQKRITVDEALEHPYLSIWHDPADEPVCSEKFEFSFESVNDMEDLKQM 350

Query: 241 IAQEVMSFK 249
           + QEV  F+
Sbjct: 351 VIQEVQDFR 359



>gi|190405815|gb|EDV09082.1| mitogen-activated protein kinase SLT2/MPK1 [Saccharomyces
           cerevisiae RM11-1a]
          Length = 486

 Score =  354 bits (909), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 163/249 (65%), Positives = 194/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQII+S QPLTDAH+Q F YQI  GLKYIHSA+VLHRDLKPGNLLVNADC+LKIC
Sbjct: 111 MECDMHQIIKSGQPLTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKIC 170

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+S++P  N+ F+TEYVATRWYRAPEIMLS+Q YTKAID+WS GCI AE LGGK
Sbjct: 171 DFGLARGYSENPVENSQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSAGCILAEFLGGK 230

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+FKG+DYV+QLNQIL +LGTP +ETLRR+GS+  Q YI  L  +P +PF  LYP AN  
Sbjct: 231 PIFKGKDYVNQLNQILQVLGTPPDETLRRIGSKNVQDYIHQLGFIPKVPFVNLYPNANSQ 290

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP  RITV++AL H YL+ +HD  DEP     F+FSFESV  +ED+K+M
Sbjct: 291 ALDLLEQMLAFDPQKRITVDEALEHPYLSIWHDPADEPVCSEKFEFSFESVNDMEDLKQM 350

Query: 241 IAQEVMSFK 249
           + QEV  F+
Sbjct: 351 VIQEVQDFR 359



>gi|151943974|gb|EDN62267.1| serine/threonine MAP kinase [Saccharomyces cerevisiae YJM789]
 gi|259147061|emb|CAY80315.1| Slt2p [Saccharomyces cerevisiae EC1118]
          Length = 482

 Score =  354 bits (909), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 163/249 (65%), Positives = 194/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQII+S QPLTDAH+Q F YQI  GLKYIHSA+VLHRDLKPGNLLVNADC+LKIC
Sbjct: 111 MECDMHQIIKSGQPLTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKIC 170

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+S++P  N+ F+TEYVATRWYRAPEIMLS+Q YTKAID+WS GCI AE LGGK
Sbjct: 171 DFGLARGYSENPVENSQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSAGCILAEFLGGK 230

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+FKG+DYV+QLNQIL +LGTP +ETLRR+GS+  Q YI  L  +P +PF  LYP AN  
Sbjct: 231 PIFKGKDYVNQLNQILQVLGTPPDETLRRIGSKNVQDYIHQLGFIPKVPFVNLYPNANSQ 290

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP  RITV++AL H YL+ +HD  DEP     F+FSFESV  +ED+K+M
Sbjct: 291 ALDLLEQMLAFDPQKRITVDEALEHPYLSIWHDPADEPVCSEKFEFSFESVNDMEDLKQM 350

Query: 241 IAQEVMSFK 249
           + QEV  F+
Sbjct: 351 VIQEVQDFR 359



>gi|6321819|ref|NP_011895.1| Slt2p [Saccharomyces cerevisiae S288c]
 gi|730747|sp|Q00772.2|SLT2_YEAST RecName: Full=Mitogen-activated protein kinase SLT2/MPK1; Short=MAP
           kinase MPK1
 gi|455519|emb|CAA41954.1| SLT2 protein kinase [Saccharomyces cerevisiae]
 gi|488177|gb|AAB68912.1| Slt2p: Putative Ser/Thr protein kinases [Saccharomyces cerevisiae]
 gi|256270596|gb|EEU05770.1| Slt2p [Saccharomyces cerevisiae JAY291]
 gi|285809934|tpg|DAA06721.1| TPA: Slt2p [Saccharomyces cerevisiae S288c]
 gi|365765359|gb|EHN06870.1| Slt2p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
 gi|392299085|gb|EIW10180.1| Slt2p [Saccharomyces cerevisiae CEN.PK113-7D]
          Length = 484

 Score =  354 bits (909), Expect = 1e-95,   Method: Compositional matrix adjust.
 Identities = 163/249 (65%), Positives = 194/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQII+S QPLTDAH+Q F YQI  GLKYIHSA+VLHRDLKPGNLLVNADC+LKIC
Sbjct: 111 MECDMHQIIKSGQPLTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKIC 170

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+S++P  N+ F+TEYVATRWYRAPEIMLS+Q YTKAID+WS GCI AE LGGK
Sbjct: 171 DFGLARGYSENPVENSQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSAGCILAEFLGGK 230

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+FKG+DYV+QLNQIL +LGTP +ETLRR+GS+  Q YI  L  +P +PF  LYP AN  
Sbjct: 231 PIFKGKDYVNQLNQILQVLGTPPDETLRRIGSKNVQDYIHQLGFIPKVPFVNLYPNANSQ 290

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP  RITV++AL H YL+ +HD  DEP     F+FSFESV  +ED+K+M
Sbjct: 291 ALDLLEQMLAFDPQKRITVDEALEHPYLSIWHDPADEPVCSEKFEFSFESVNDMEDLKQM 350

Query: 241 IAQEVMSFK 249
           + QEV  F+
Sbjct: 351 VIQEVQDFR 359



>gi|401625400|gb|EJS43409.1| slt2p [Saccharomyces arboricola H-6]
          Length = 479

 Score =  354 bits (909), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 195/249 (78%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQII+S QPLTDAH+Q F YQI  GLKYIHSA+VLHRDLKPGNLLVNADC+LKIC
Sbjct: 111 MECDMHQIIKSGQPLTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKIC 170

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+S++P  N+ F+TEYVATRWYRAPEIMLS+Q YTKAID+WS GCI AE LGGK
Sbjct: 171 DFGLARGYSENPVENSQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSAGCILAEFLGGK 230

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+FKG+DYV+QLNQIL +LGTP +ETLRR+GS+  Q YI  L  +P +PF  LYP AN  
Sbjct: 231 PIFKGKDYVNQLNQILQVLGTPPDETLRRIGSKNVQDYIHQLGFIPKVPFVNLYPNANSH 290

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP  R+TV++AL H YL+ +HD  DEP     F+FSFESV  +ED+K+M
Sbjct: 291 ALDLLEKMLAFDPQKRVTVDEALEHPYLSIWHDPADEPVCSEKFEFSFESVNDMEDLKQM 350

Query: 241 IAQEVMSFK 249
           + QEV +F+
Sbjct: 351 VIQEVQNFR 359



>gi|323348356|gb|EGA82604.1| Slt2p [Saccharomyces cerevisiae Lalvin QA23]
          Length = 495

 Score =  354 bits (909), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 163/249 (65%), Positives = 194/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQII+S QPLTDAH+Q F YQI  GLKYIHSA+VLHRDLKPGNLLVNADC+LKIC
Sbjct: 111 MECDMHQIIKSGQPLTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKIC 170

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+S++P  N+ F+TEYVATRWYRAPEIMLS+Q YTKAID+WS GCI AE LGGK
Sbjct: 171 DFGLARGYSENPVENSQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSAGCILAEFLGGK 230

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+FKG+DYV+QLNQIL +LGTP +ETLRR+GS+  Q YI  L  +P +PF  LYP AN  
Sbjct: 231 PIFKGKDYVNQLNQILQVLGTPPDETLRRIGSKNVQDYIHQLGFIPKVPFVNLYPNANSQ 290

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP  RITV++AL H YL+ +HD  DEP     F+FSFESV  +ED+K+M
Sbjct: 291 ALDLLEQMLAFDPQKRITVDEALEHPYLSIWHDPADEPVCSEKFEFSFESVNDMEDLKQM 350

Query: 241 IAQEVMSFK 249
           + QEV  F+
Sbjct: 351 VIQEVQDFR 359



>gi|299627|gb|AAB26249.1| Mpk1p=mitogen-activated protein kinase homolog [Saccharomyces
           cerevisiae, Peptide, 484 aa]
          Length = 484

 Score =  354 bits (909), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 163/249 (65%), Positives = 194/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQII+S QPLTDAH+Q F YQI  GLKYIHSA+VLHRDLKPGNLLVNADC+LKIC
Sbjct: 111 MECDMHQIIKSGQPLTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKIC 170

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+S++P  N+ F+TEYVATRWYRAPEIMLS+Q YTKAID+WS GCI AE LGGK
Sbjct: 171 DFGLARGYSENPVENSQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSAGCILAEFLGGK 230

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+FKG+DYV+QLNQIL +LGTP +ETLRR+GS+  Q YI  L  +P +PF  LYP AN  
Sbjct: 231 PIFKGKDYVNQLNQILQVLGTPPDETLRRIGSKNVQDYIHQLGFIPKVPFVNLYPNANSQ 290

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP  RITV++AL H YL+ +HD  DEP     F+FSFESV  +ED+K+M
Sbjct: 291 ALDLLEQMLAFDPQKRITVDEALEHPYLSIWHDPADEPVCSEKFEFSFESVNDMEDLKQM 350

Query: 241 IAQEVMSFK 249
           + QEV  F+
Sbjct: 351 VIQEVQDFR 359



>gi|392577195|gb|EIW70324.1| hypothetical protein TREMEDRAFT_38101 [Tremella mesenterica DSM
           1558]
          Length = 425

 Score =  353 bits (907), Expect = 3e-95,   Method: Compositional matrix adjust.
 Identities = 176/279 (63%), Positives = 198/279 (70%), Gaps = 15/279 (5%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS QPL+DAHFQ F+YQ   GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 110 MEADLHAIIRSGQPLSDAHFQSFLYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 169

Query: 61  DFGLARGFS----DSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEM 116
           DFGLARGF      +    AGFMTEYVATRWYRAPEIMLSF NYT +IDMWSVGCI AE+
Sbjct: 170 DFGLARGFQPGAVQTEQGQAGFMTEYVATRWYRAPEIMLSFANYTSSIDMWSVGCILAEL 229

Query: 117 LGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPK 176
           LGGKP+FKG DYVDQLN+IL  LGTP E+TLRRVGS RAQ YI SLP  P + F  LYP 
Sbjct: 230 LGGKPIFKGEDYVDQLNKILNFLGTPTEDTLRRVGSPRAQDYIRSLPIKPRVHFKTLYPN 289

Query: 177 ANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIED 236
           A+P           FDPA RI  ++AL H YLA +HD  DEPA E  FDFSFE  +  + 
Sbjct: 290 ASPLALDLLQKLLAFDPAKRIGCQEALEHPYLAVWHDPADEPACEVSFDFSFEKEDSTQG 349

Query: 237 MKKMIAQEVMSFKASKQAALGLNRQLGRKSSLSAPDRDS 275
           M+ +I +EV SF           R L R+  +  P R++
Sbjct: 350 MRNLIVEEVRSF-----------RSLVRQQEVPLPPRNA 377



>gi|358060951|dbj|GAA93373.1| hypothetical protein E5Q_00013 [Mixia osmundae IAM 14324]
          Length = 828

 Score =  353 bits (905), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 176/282 (62%), Positives = 203/282 (71%), Gaps = 7/282 (2%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS QPL+DAHFQ FIYQ   GL+YIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 500 MEADLHAIIRSGQPLSDAHFQSFIYQTLCGLRYIHSANVLHRDLKPGNLLVNADCELKIC 559

Query: 61  DFGLARGF-----SDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAE 115
           DFGLARGF      + P+   G MTEYVATRWYRAPEIMLSFQNYT AIDMWSVGCI AE
Sbjct: 560 DFGLARGFDLDNKGNDPN-GGGLMTEYVATRWYRAPEIMLSFQNYTTAIDMWSVGCILAE 618

Query: 116 MLGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYP 175
           +LGG+P+FKG+DYVDQLNQI+  LGTP ++TLRRVGS RAQ YI SLP    IPF+ LYP
Sbjct: 619 LLGGRPIFKGKDYVDQLNQIIHYLGTPSDQTLRRVGSPRAQEYIRSLPYKAGIPFNLLYP 678

Query: 176 KANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIE 235
            ANP           FDPA RIT + AL H YL+ ++D  D       FDF+FE+ + IE
Sbjct: 679 HANPQALDLLARLLAFDPAERITCQDALRHPYLSVWYDPADILTTTTTFDFAFENEDTIE 738

Query: 236 DMKKMIAQEVMSFKA-SKQAALGLNRQLGRKSSLSAPDRDSL 276
            MK +IA+EV  F+A  ++      R   R+ SL  P R+ +
Sbjct: 739 GMKVLIAEEVREFRAFVREPIQEPVRPAKRQESLPIPSREEI 780



>gi|207344745|gb|EDZ71784.1| YHR030Cp-like protein [Saccharomyces cerevisiae AWRI1631]
          Length = 482

 Score =  353 bits (905), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 163/249 (65%), Positives = 193/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQII+S QPLTDAH+Q F YQI  GLKYIHSA+VLHRDLKPGNLLVNADC+LKIC
Sbjct: 111 MECDMHQIIKSGQPLTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKIC 170

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+S++P  N+ F+TEYVATRWYRAPEIMLS+Q YTKAID+WS GCI AE LGGK
Sbjct: 171 DFGLARGYSENPVENSQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSAGCILAEFLGGK 230

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+FKG+DYV+QLNQIL +LGTP +ETLRR+GS+  Q YI  L  +P +PF  LYP AN  
Sbjct: 231 PIFKGKDYVNQLNQILQVLGTPPDETLRRIGSKNVQDYIHQLGFIPKVPFVNLYPNANSQ 290

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP  RITV++AL H YL  +HD  DEP     F+FSFESV  +ED+K+M
Sbjct: 291 ALDLLEQMLAFDPQKRITVDEALEHPYLFIWHDPADEPVCSEKFEFSFESVNDMEDLKQM 350

Query: 241 IAQEVMSFK 249
           + QEV  F+
Sbjct: 351 VIQEVQDFR 359



>gi|401838286|gb|EJT41988.1| SLT2-like protein [Saccharomyces kudriavzevii IFO 1802]
          Length = 481

 Score =  352 bits (903), Expect = 8e-95,   Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 194/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQII+S QPLTDAH+Q F YQI  GLKYIHSA+VLHRDLKPGNLLVNADC+LKIC
Sbjct: 111 MECDMHQIIKSGQPLTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKIC 170

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+S++P  N+ F+TEYVATRWYRAPEIMLS+Q YTKAID+WS GCI AE LGGK
Sbjct: 171 DFGLARGYSENPVENSQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSAGCILAEFLGGK 230

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+FKG+DYV+QLNQIL +LGTP +ETL+R+GS+  Q YI  L  +P +PF  LYP AN  
Sbjct: 231 PVFKGKDYVNQLNQILQVLGTPPDETLKRIGSKNVQDYIHQLGFIPKVPFVNLYPNANSQ 290

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP  RITV++AL H YL+ +HD  DEP     F+FSFESV  +ED+K+M
Sbjct: 291 ALDLLEKMLAFDPQRRITVDEALEHPYLSIWHDPADEPVCSEKFEFSFESVNDMEDLKQM 350

Query: 241 IAQEVMSFK 249
           + QEV  F+
Sbjct: 351 VIQEVQDFR 359



>gi|255718121|ref|XP_002555341.1| KLTH0G06974p [Lachancea thermotolerans]
 gi|238936725|emb|CAR24904.1| KLTH0G06974p [Lachancea thermotolerans CBS 6340]
          Length = 499

 Score =  352 bits (903), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 163/249 (65%), Positives = 193/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQII+S QPLTDAH+Q FIYQI   LKYIHSA+VLHRDLKPGNLLVNADC+LK+C
Sbjct: 111 MECDIHQIIKSGQPLTDAHYQSFIYQILCALKYIHSADVLHRDLKPGNLLVNADCQLKVC 170

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+S++P  N  F+TEYVATRWYRAPEIMLS+Q YTKAID+WS GCI AE+LGGK
Sbjct: 171 DFGLARGYSENPVENNQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSCGCILAELLGGK 230

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+FKG+DYVDQLN+IL +LGTP EETL R+GS+  Q YI  L  +P +PF  LYP+AN  
Sbjct: 231 PIFKGKDYVDQLNRILQVLGTPPEETLERIGSKNVQDYIHQLGYIPKVPFVTLYPRANAQ 290

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP  RITVE+AL H YL+ +HD  DEP     FDF+FESV  +ED+K+M
Sbjct: 291 ALDLLERMLTFDPQKRITVEEALEHPYLSIWHDPADEPVCAEKFDFNFESVNEMEDLKQM 350

Query: 241 IAQEVMSFK 249
           I  EV  F+
Sbjct: 351 ILDEVRDFR 359



>gi|366987681|ref|XP_003673607.1| hypothetical protein NCAS_0A06680 [Naumovozyma castellii CBS 4309]
 gi|342299470|emb|CCC67226.1| hypothetical protein NCAS_0A06680 [Naumovozyma castellii CBS 4309]
          Length = 479

 Score =  352 bits (903), Expect = 9e-95,   Method: Compositional matrix adjust.
 Identities = 160/249 (64%), Positives = 193/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQII+S QPLTDAH+Q FIYQI  GLKYIHSA+VLHRDLKPGNLLVNADC+LKIC
Sbjct: 111 MECDMHQIIKSSQPLTDAHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKIC 170

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+S++P  N  F+TEYVATRWYRAPEIMLS+Q YTKAID+WS GCI AE LGGK
Sbjct: 171 DFGLARGYSENPVENNQFLTEYVATRWYRAPEIMLSYQGYTKAIDIWSTGCILAEFLGGK 230

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+FKG+DYVDQL +IL +LGTP +ETLRR+GS+  Q YI  L  +P +PF  LYP ANP 
Sbjct: 231 PIFKGKDYVDQLTRILQVLGTPPDETLRRIGSKNVQDYIHQLGYIPKVPFVNLYPDANPQ 290

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP  RIT ++AL H YL+ +HD  DEP     F+FSFE+V  ++++KKM
Sbjct: 291 ALDLLEKMLAFDPQKRITTDEALEHPYLSIWHDPSDEPVCSEKFEFSFEAVNDMDELKKM 350

Query: 241 IAQEVMSFK 249
           + +EV  F+
Sbjct: 351 VIEEVRDFR 359



>gi|50290605|ref|XP_447735.1| hypothetical protein [Candida glabrata CBS 138]
 gi|49527046|emb|CAG60682.1| unnamed protein product [Candida glabrata]
          Length = 488

 Score =  352 bits (902), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 164/249 (65%), Positives = 193/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQII+S Q LTDAH+Q F YQI  GLKYIHSA+VLHRDLKPGNLLVNADC+LKIC
Sbjct: 109 MECDMHQIIKSGQALTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKIC 168

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+S++P+ N  F+TEYVATRWYRAPEIMLS+Q YTKAID+WS GCI AE LGGK
Sbjct: 169 DFGLARGYSENPEENNQFLTEYVATRWYRAPEIMLSYQGYTKAIDIWSTGCILAEFLGGK 228

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLFKG+DYVDQLN+IL +LGTP +ETLRRVGS+  Q YI  L  +  IPFS+L+P AN  
Sbjct: 229 PLFKGKDYVDQLNRILQVLGTPPDETLRRVGSKNVQDYIHQLGYIQKIPFSELFPNANED 288

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP  RITV++AL H YL  +HD  DEP     F+FSFESV  +ED+K+M
Sbjct: 289 ALDLLEGMLAFDPQKRITVDKALEHPYLTIWHDPADEPECNEKFEFSFESVNEMEDLKRM 348

Query: 241 IAQEVMSFK 249
           +  EV SF+
Sbjct: 349 VVDEVQSFR 357



>gi|365985774|ref|XP_003669719.1| hypothetical protein NDAI_0D01620 [Naumovozyma dairenensis CBS 421]
 gi|343768488|emb|CCD24476.1| hypothetical protein NDAI_0D01620 [Naumovozyma dairenensis CBS 421]
          Length = 492

 Score =  352 bits (902), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 193/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQII+S QPLTDAH+Q FIYQI  GLKYIHSA+VLHRDLKPGNLLVNADC+LKIC
Sbjct: 111 MECDMHQIIKSSQPLTDAHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKIC 170

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS++P  N  F+TEYVATRWYRAPEIMLS+Q YTKAID+WS GCI AE LGGK
Sbjct: 171 DFGLARGFSENPVENNQFLTEYVATRWYRAPEIMLSYQGYTKAIDIWSTGCILAEFLGGK 230

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+FKG+DYVDQLN+IL +LGTP +ETLRR+GS+  Q YI +L  +P +PF  LYP AN  
Sbjct: 231 PIFKGKDYVDQLNRILEVLGTPPDETLRRIGSKNVQDYIHNLGYIPKVPFVNLYPNANLQ 290

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP  RITV++AL H YL+ +HD  DEP     F+FSFE V  +E++K+M
Sbjct: 291 ALDLLEKMLAFDPQRRITVDEALEHPYLSVWHDPSDEPVCSEKFEFSFEVVNDMEELKQM 350

Query: 241 IAQEVMSFK 249
           +  EV  F+
Sbjct: 351 VIDEVHDFR 359



>gi|365760382|gb|EHN02106.1| Slt2p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7]
          Length = 475

 Score =  351 bits (901), Expect = 1e-94,   Method: Compositional matrix adjust.
 Identities = 162/249 (65%), Positives = 194/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQII+S QPLTDAH+Q F YQI  GLKYIHSA+VLHRDLKPGNLLVNADC+LKIC
Sbjct: 107 MECDMHQIIKSGQPLTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+S++P  N+ F+TEYVATRWYRAPEIMLS+Q YTKAID+WS GCI AE LGGK
Sbjct: 167 DFGLARGYSENPVENSRFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSAGCILAEFLGGK 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+FKG+DYV+QLNQIL +LGTP +ETL+R+GS+  Q YI  L  +P +PF  LYP AN  
Sbjct: 227 PVFKGKDYVNQLNQILQVLGTPPDETLKRIGSKNVQDYIHQLGFIPKVPFVNLYPNANSQ 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP  RITV++AL H YL+ +HD  DEP     F+FSFESV  +ED+K+M
Sbjct: 287 ALDLLEKMLAFDPQRRITVDEALEHPYLSIWHDPADEPVCSEKFEFSFESVNDMEDLKQM 346

Query: 241 IAQEVMSFK 249
           + QEV  F+
Sbjct: 347 VIQEVQDFR 355



>gi|444315363|ref|XP_004178339.1| hypothetical protein TBLA_0A10420 [Tetrapisispora blattae CBS 6284]
 gi|387511378|emb|CCH58820.1| hypothetical protein TBLA_0A10420 [Tetrapisispora blattae CBS 6284]
          Length = 492

 Score =  351 bits (900), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 162/250 (64%), Positives = 195/250 (78%), Gaps = 1/250 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQII+S QPLTDAH+Q FIYQI  GLKYIHSA+VLHRDLKPGNLLVNADC+LKIC
Sbjct: 116 MECDMHQIIKSNQPLTDAHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKIC 175

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+S++P  N  F+TEYVATRWYRAPEIMLS+Q YTKAID+WS GCI AE LGGK
Sbjct: 176 DFGLARGYSENPVENNQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSTGCILAEFLGGK 235

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+FKG+DYV+QLNQIL +LGTP +ETL+R+GS+  Q YI  L  +P +PF  LYP ANP 
Sbjct: 236 PIFKGKDYVNQLNQILQVLGTPPDETLKRIGSKNVQDYIHQLGFIPKVPFVNLYPNANPQ 295

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDF-SFESVELIEDMKK 239
                     FDP  RITV++AL H YL+ +HD  DEP     F+F SFESV  +E++K+
Sbjct: 296 ALDLLEKMLAFDPQKRITVDEALEHPYLSIWHDPADEPICSEKFEFSSFESVNEMEELKR 355

Query: 240 MIAQEVMSFK 249
           M+ +EV  F+
Sbjct: 356 MVIEEVHDFR 365



>gi|58271314|ref|XP_572813.1| MAP kinase [Cryptococcus neoformans var. neoformans JEC21]
 gi|134114570|ref|XP_773993.1| hypothetical protein CNBH0400 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50256623|gb|EAL19346.1| hypothetical protein CNBH0400 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57229072|gb|AAW45506.1| MAP kinase, putative [Cryptococcus neoformans var. neoformans
           JEC21]
          Length = 426

 Score =  350 bits (899), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 176/279 (63%), Positives = 197/279 (70%), Gaps = 15/279 (5%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS QPL+DAHFQ F+YQ   GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 110 MEADLHAIIRSGQPLSDAHFQSFLYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 169

Query: 61  DFGLARGFS----DSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEM 116
           DFGLARGF      +    AGFMTEYVATRWYRAPEIMLSF NYT +IDMWSVGCI AE+
Sbjct: 170 DFGLARGFQPGAVQTDQGQAGFMTEYVATRWYRAPEIMLSFANYTSSIDMWSVGCILAEL 229

Query: 117 LGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPK 176
           LGGKP+FKG DYVDQLN+IL +LGTP E+TLRRVGS RAQ YI SLP  P + F  LYP 
Sbjct: 230 LGGKPIFKGEDYVDQLNKILNLLGTPTEDTLRRVGSPRAQDYIRSLPIKPRVKFETLYPN 289

Query: 177 ANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIED 236
           A+P           FDPA R   E+AL H YLA +HD  DEP  E  FDFSFE  + +  
Sbjct: 290 ASPLALDLLSKLLTFDPAKRYGCEEALEHQYLAVWHDPADEPLCEVPFDFSFEEEDSVSG 349

Query: 237 MKKMIAQEVMSFKASKQAALGLNRQLGRKSSLSAPDRDS 275
           M+ +I +EV SF           R L R+ S+    +DS
Sbjct: 350 MRDLILEEVRSF-----------RYLVRQQSMPPARKDS 377



>gi|170293000|gb|ACB12685.1| mitogen-activated protein kinase 1 [Cryptococcus gattii]
          Length = 426

 Score =  350 bits (899), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 177/279 (63%), Positives = 197/279 (70%), Gaps = 15/279 (5%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS QPL+DAHFQ F+YQ   GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 110 MEADLHAIIRSGQPLSDAHFQSFLYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 169

Query: 61  DFGLARGFS----DSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEM 116
           DFGLARGF      +    AGFMTEYVATRWYRAPEIMLSF NYT +IDMWSVGCI AE+
Sbjct: 170 DFGLARGFQPGAVQTDQGQAGFMTEYVATRWYRAPEIMLSFANYTSSIDMWSVGCILAEL 229

Query: 117 LGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPK 176
           LGGKP+FKG DYVDQLN+IL +LGTP E+TLRRVGS RAQ YI SLP  P + F  LYP 
Sbjct: 230 LGGKPIFKGEDYVDQLNKILNLLGTPTEDTLRRVGSPRAQDYIRSLPIKPRVKFETLYPN 289

Query: 177 ANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIED 236
           A+P           FDPA R   E+AL H YLA +HD  DEP  E  FDFSFE  + +  
Sbjct: 290 ASPLALDLLSKLLTFDPAKRYGCEEALEHPYLAVWHDPADEPLCEVPFDFSFEEEDSVSG 349

Query: 237 MKKMIAQEVMSFKASKQAALGLNRQLGRKSSLSAPDRDS 275
           M+ +I +EV SF           R L R+ S+    RDS
Sbjct: 350 MRDLILEEVRSF-----------RYLVRQHSMPPVRRDS 377



>gi|405122466|gb|AFR97233.1| CMGC/MAPK/ERK protein kinase [Cryptococcus neoformans var. grubii
           H99]
          Length = 426

 Score =  350 bits (898), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 170/253 (67%), Positives = 189/253 (74%), Gaps = 4/253 (1%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS QPL+DAHFQ F+YQ   GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 110 MEADLHAIIRSGQPLSDAHFQSFLYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 169

Query: 61  DFGLARGFS----DSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEM 116
           DFGLARGF      +    AGFMTEYVATRWYRAPEIMLSF NYT +IDMWSVGCI AE+
Sbjct: 170 DFGLARGFQPGAVQTDQGQAGFMTEYVATRWYRAPEIMLSFANYTSSIDMWSVGCILAEL 229

Query: 117 LGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPK 176
           LGGKP+FKG DYVDQLN+IL +LGTP E+TLRRVGS RAQ YI SLP  P + F  LYP 
Sbjct: 230 LGGKPIFKGEDYVDQLNKILNLLGTPTEDTLRRVGSPRAQDYIRSLPIKPRVKFGTLYPN 289

Query: 177 ANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIED 236
           A+P           FDPA R   E+AL H YLA +HD  DEP  E  FDFSFE  + +  
Sbjct: 290 ASPLALDLLSKLLTFDPAKRYGCEEALEHPYLAVWHDPADEPLCEVPFDFSFEEEDSVSG 349

Query: 237 MKKMIAQEVMSFK 249
           M+ +I +EV SF+
Sbjct: 350 MRDLILEEVRSFR 362



>gi|321261878|ref|XP_003195658.1| MAP kinase [Cryptococcus gattii WM276]
 gi|317462132|gb|ADV23871.1| MAP kinase, putative [Cryptococcus gattii WM276]
          Length = 426

 Score =  350 bits (898), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 177/279 (63%), Positives = 197/279 (70%), Gaps = 15/279 (5%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS QPL+DAHFQ F+YQ   GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 110 MEADLHAIIRSGQPLSDAHFQSFLYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 169

Query: 61  DFGLARGFS----DSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEM 116
           DFGLARGF      +    AGFMTEYVATRWYRAPEIMLSF NYT +IDMWSVGCI AE+
Sbjct: 170 DFGLARGFQPGAVQTDQGQAGFMTEYVATRWYRAPEIMLSFANYTSSIDMWSVGCILAEL 229

Query: 117 LGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPK 176
           LGGKP+FKG DYVDQLN+IL +LGTP E+TLRRVGS RAQ YI SLP  P + F  LYP 
Sbjct: 230 LGGKPIFKGEDYVDQLNKILNLLGTPTEDTLRRVGSPRAQDYIRSLPIKPRVKFETLYPN 289

Query: 177 ANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIED 236
           A+P           FDPA R   E+AL H YLA +HD  DEP  E  FDFSFE  + +  
Sbjct: 290 ASPLALDLLSKLLTFDPAKRYGCEEALEHPYLAVWHDPADEPLCEVPFDFSFEEEDSVSG 349

Query: 237 MKKMIAQEVMSFKASKQAALGLNRQLGRKSSLSAPDRDS 275
           M+ +I +EV SF           R L R+ S+    RDS
Sbjct: 350 MRDLILEEVRSF-----------RYLVRQHSMPPIRRDS 377



>gi|19112081|ref|NP_595289.1| MAP kinase Pmk1 [Schizosaccharomyces pombe 972h-]
 gi|2499592|sp|Q92398.1|SPM1_SCHPO RecName: Full=Mitogen-activated protein kinase spm1; Short=MAP
           kinase spm1; AltName: Full=MAP kinase pmk1
 gi|1513146|gb|AAC49707.1| Spm1 [Schizosaccharomyces pombe]
 gi|1666671|emb|CAA66899.1| pmk1+ [Schizosaccharomyces pombe]
 gi|2959369|emb|CAA17923.1| MAP kinase Pmk1 [Schizosaccharomyces pombe]
          Length = 422

 Score =  350 bits (897), Expect = 4e-94,   Method: Compositional matrix adjust.
 Identities = 164/249 (65%), Positives = 192/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADL+ II+S QPLTDAHFQ FIYQI  GLKYIHSANV+HRDLKPGNLLVNADCELKIC
Sbjct: 107 MEADLNAIIKSGQPLTDAHFQSFIYQILCGLKYIHSANVIHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG S++P+ N GFMTEYVATRWYRAPEIMLSF +Y K ID+WSVGCI AE+LGG 
Sbjct: 167 DFGLARGCSENPEENPGFMTEYVATRWYRAPEIMLSFSSYHKGIDVWSVGCILAELLGGT 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLFKG+D+V QLN IL  LGTPDEETL  + S RAQ Y+ SLPK   IPF   +PKANP 
Sbjct: 227 PLFKGKDFVHQLNLILHQLGTPDEETLSHISSSRAQEYVRSLPKQRPIPFETNFPKANPL 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP  RI+V+ AL H YLA +HD  DEP  + +FDFSFE +E   +++++
Sbjct: 287 ALDLLAKLLAFDPNRRISVDDALEHPYLAVWHDPSDEPVCDSVFDFSFEYIEDANELRRV 346

Query: 241 IAQEVMSFK 249
           I  EV++F+
Sbjct: 347 ILDEVLNFR 355



>gi|28974309|gb|AAO61669.1| Mpk1 [Cryptococcus neoformans var. neoformans]
          Length = 441

 Score =  349 bits (896), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 170/253 (67%), Positives = 189/253 (74%), Gaps = 4/253 (1%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS QPL+DAHFQ F+YQ   GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 110 MEADLHAIIRSGQPLSDAHFQSFLYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 169

Query: 61  DFGLARGFS----DSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEM 116
           DFGLARGF      +    AGFMTEYVATRWYRAPEIMLSF NYT +IDMWSVGCI AE+
Sbjct: 170 DFGLARGFQPGAVQTDQGQAGFMTEYVATRWYRAPEIMLSFANYTSSIDMWSVGCILAEL 229

Query: 117 LGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPK 176
           LGGKP+FKG DYVDQLN+IL +LGTP E+TLRRVGS RAQ YI SLP  P + F  LYP 
Sbjct: 230 LGGKPIFKGEDYVDQLNKILNLLGTPTEDTLRRVGSPRAQDYIRSLPIKPRVKFGTLYPN 289

Query: 177 ANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIED 236
           A+P           FDPA R   E+AL H YLA +HD  DEP  E  FDFSFE  + +  
Sbjct: 290 ASPLALDLLSKLLTFDPAKRYGCEEALEHPYLAVWHDPADEPLCEVPFDFSFEEEDSVSG 349

Query: 237 MKKMIAQEVMSFK 249
           M+ +I +EV SF+
Sbjct: 350 MRDLILEEVRSFR 362



>gi|366999230|ref|XP_003684351.1| hypothetical protein TPHA_0B02440 [Tetrapisispora phaffii CBS 4417]
 gi|357522647|emb|CCE61917.1| hypothetical protein TPHA_0B02440 [Tetrapisispora phaffii CBS 4417]
          Length = 467

 Score =  349 bits (895), Expect = 6e-94,   Method: Compositional matrix adjust.
 Identities = 159/249 (63%), Positives = 194/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL+QII+S QPLTDAH+Q F YQI  GLKYIHSA+VLHRDLKPGNLLVNADC+LKIC
Sbjct: 113 MECDLYQIIKSGQPLTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKIC 172

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+S++P  N  F+TEYVATRWYRAPEIMLS+Q YT+AID+WS GCI AE LGGK
Sbjct: 173 DFGLARGYSENPVENNQFLTEYVATRWYRAPEIMLSYQGYTRAIDVWSTGCILAEFLGGK 232

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+FKG+DYV+QLN+IL +LGTP +ETLRR+GS+  Q YI  L  +P +PFS LYP+ANP 
Sbjct: 233 PIFKGKDYVNQLNRILQVLGTPPDETLRRIGSKNVQDYIHQLGHIPKVPFSNLYPQANPD 292

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP  RITV +AL H YL+ +HD  DEP     F+FSFE+V  ++ +++M
Sbjct: 293 ALDLLEKMLAFDPQDRITVNEALEHPYLSVWHDPSDEPICLEKFEFSFETVNEMDMLREM 352

Query: 241 IAQEVMSFK 249
           + QEV  F+
Sbjct: 353 VIQEVQDFR 361



>gi|238879512|gb|EEQ43150.1| mitogen-activated protein kinase SLT2/MPK1 [Candida albicans WO-1]
          Length = 509

 Score =  349 bits (895), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 164/250 (65%), Positives = 194/250 (77%), Gaps = 1/250 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQIIRS QPL+D H+Q FIYQ+  GL +IHSA+VLHRDLKPGNLLVNADCELKIC
Sbjct: 132 MECDMHQIIRSGQPLSDQHYQSFIYQVLCGLNFIHSADVLHRDLKPGNLLVNADCELKIC 191

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS++PD NAGFMTEYVATRWYRAPEIMLSF NYTKAID+WSVGCI AE+LGGK
Sbjct: 192 DFGLARGFSENPDENAGFMTEYVATRWYRAPEIMLSFTNYTKAIDIWSVGCILAELLGGK 251

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLF+G+DYVDQLNQIL ILGTP E TL+R+GS RAQ Y+ SLP      + +L+P ANP 
Sbjct: 252 PLFRGKDYVDQLNQILMILGTPPESTLQRIGSHRAQNYVRSLPITRKASYEELFPDANPL 311

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDF-SFESVELIEDMKK 239
                      DP  RITV  AL H YL  +HD ++E   +  FDF SFE+V+ +++MK+
Sbjct: 312 ALDLLERMLTLDPRERITVRDALNHKYLELWHDPKEEIECQVKFDFKSFETVDGLDEMKQ 371

Query: 240 MIAQEVMSFK 249
           +I  EV  F+
Sbjct: 372 LIMDEVQKFR 381



>gi|68474614|ref|XP_718680.1| likely protein kinase [Candida albicans SC5314]
 gi|46440459|gb|EAK99765.1| likely protein kinase [Candida albicans SC5314]
          Length = 509

 Score =  349 bits (895), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 164/250 (65%), Positives = 194/250 (77%), Gaps = 1/250 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQIIRS QPL+D H+Q FIYQ+  GL +IHSA+VLHRDLKPGNLLVNADCELKIC
Sbjct: 132 MECDMHQIIRSGQPLSDQHYQSFIYQVLCGLNFIHSADVLHRDLKPGNLLVNADCELKIC 191

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS++PD NAGFMTEYVATRWYRAPEIMLSF NYTKAID+WSVGCI AE+LGGK
Sbjct: 192 DFGLARGFSENPDENAGFMTEYVATRWYRAPEIMLSFTNYTKAIDIWSVGCILAELLGGK 251

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLF+G+DYVDQLNQIL ILGTP E TL+R+GS RAQ Y+ SLP      + +L+P ANP 
Sbjct: 252 PLFRGKDYVDQLNQILMILGTPPESTLQRIGSHRAQNYVRSLPITRKASYEELFPDANPL 311

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDF-SFESVELIEDMKK 239
                      DP  RITV  AL H YL  +HD ++E   +  FDF SFE+V+ +++MK+
Sbjct: 312 ALDLLERMLTLDPRERITVRDALNHKYLELWHDPKEEIECQVKFDFKSFETVDGLDEMKQ 371

Query: 240 MIAQEVMSFK 249
           +I  EV  F+
Sbjct: 372 LIMDEVQKFR 381



>gi|1170963|sp|P43068.1|MKC1_CANAL RecName: Full=Mitogen-activated protein kinase MKC1; Short=MAP
           kinase MKC1
 gi|619450|emb|CAA54129.1| MAP kinase Mkc1 [Candida albicans]
          Length = 501

 Score =  349 bits (895), Expect = 7e-94,   Method: Compositional matrix adjust.
 Identities = 164/250 (65%), Positives = 194/250 (77%), Gaps = 1/250 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQIIRS QPL+D H+Q FIYQ+  GL +IHSA+VLHRDLKPGNLLVNADCELKIC
Sbjct: 132 MECDMHQIIRSGQPLSDQHYQSFIYQVLCGLNFIHSADVLHRDLKPGNLLVNADCELKIC 191

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS++PD NAGFMTEYVATRWYRAPEIMLSF NYTKAID+WSVGCI AE+LGGK
Sbjct: 192 DFGLARGFSENPDENAGFMTEYVATRWYRAPEIMLSFTNYTKAIDIWSVGCILAELLGGK 251

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLF+G+DYVDQLNQIL ILGTP E TL+R+GS RAQ Y+ SLP      + +L+P ANP 
Sbjct: 252 PLFRGKDYVDQLNQILMILGTPPESTLQRIGSHRAQNYVRSLPITRKASYEELFPDANPL 311

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDF-SFESVELIEDMKK 239
                      DP  RITV  AL H YL  +HD ++E   +  FDF SFE+V+ +++MK+
Sbjct: 312 ALDLLERMLTLDPRERITVRDALNHKYLELWHDPKEEIECQVKFDFKSFETVDGLDEMKQ 371

Query: 240 MIAQEVMSFK 249
           +I  EV  F+
Sbjct: 372 LIMDEVQKFR 381



>gi|401889093|gb|EJT53033.1| MAP kinase [Trichosporon asahii var. asahii CBS 2479]
 gi|406699083|gb|EKD02302.1| MAP kinase [Trichosporon asahii var. asahii CBS 8904]
          Length = 432

 Score =  349 bits (895), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 171/254 (67%), Positives = 187/254 (73%), Gaps = 4/254 (1%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS QPL+DAHFQ F+YQ   GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 108 MEADLHAIIRSGQPLSDAHFQSFLYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 167

Query: 61  DFGLARGFS----DSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEM 116
           DFGLARGF      +    AGFMTEYVATRWYRAPEIMLSF NYT +IDMWSVGCI AE+
Sbjct: 168 DFGLARGFQPGQVQTEQGTAGFMTEYVATRWYRAPEIMLSFANYTSSIDMWSVGCILAEL 227

Query: 117 LGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPK 176
           LGGKP+FKG DYVDQLN+IL +LGTP E+TLRRVGS RAQ YI SLP  P + F  LYP 
Sbjct: 228 LGGKPIFKGEDYVDQLNRILNLLGTPTEDTLRRVGSPRAQDYIRSLPIKPRVKFKTLYPN 287

Query: 177 ANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIED 236
           A P           FDPA RI  + AL H YL  +HD  DEP+ E  FDFSFE     E 
Sbjct: 288 AQPQALDLLEKLLCFDPAKRIGCQAALEHPYLQVWHDPLDEPSCEVPFDFSFEKENSEEG 347

Query: 237 MKKMIAQEVMSFKA 250
           M+ +I  EV SF+A
Sbjct: 348 MRNLIVGEVGSFRA 361



>gi|512199775|gb|EPE28608.1| Protein kinase-like (PK-like) [Glarea lozoyensis ATCC 20868]
          Length = 413

 Score =  348 bits (894), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 165/249 (66%), Positives = 189/249 (75%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTD HFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDPHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P  NAG+MTEYVATRWYRAPEIMLSFQ+YTKAID+WS+GCI AE+LGG+
Sbjct: 167 DFGLARGFSVDPQENAGYMTEYVATRWYRAPEIMLSFQSYTKAIDIWSIGCILAELLGGR 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILG PD++TL ++GS RAQ Y+ +LP M    F++L+P A   
Sbjct: 227 PFFKGRDYVDQLNQILHILGKPDDKTLEKIGSPRAQDYVRNLPPMDKQDFNKLFPGAKKE 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP  R+TVE+AL H YL  +HD  DEP     F+F FE VE + +M++M
Sbjct: 287 ALDILEKMLAFDPTRRVTVEEALEHEYLQIWHDPSDEPGCPTTFNFDFEVVEDVGEMRQM 346

Query: 241 IAQEVMSFK 249
           I  EV  F+
Sbjct: 347 ILDEVHRFR 355



>gi|403218508|emb|CCK72998.1| hypothetical protein KNAG_0M01450 [Kazachstania naganishii CBS
           8797]
          Length = 479

 Score =  348 bits (894), Expect = 8e-94,   Method: Compositional matrix adjust.
 Identities = 160/249 (64%), Positives = 195/249 (78%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQII+S Q LTDAH+Q FIYQI  GLKYIHSA+VLHRDLKPGNLLVNADC+LKIC
Sbjct: 111 MECDMHQIIKSNQHLTDAHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKIC 170

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+S++P  N  F+TEYVATRWYRAPEIMLS+Q YTKAID+WS GCI AE LGGK
Sbjct: 171 DFGLARGYSENPVQNNQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSTGCILAEFLGGK 230

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+FKG+DYV+QLN+IL +LGTP +ETL+R+GS+  Q YI  L  +P IPFS LYP+ANP 
Sbjct: 231 PIFKGKDYVNQLNRILQVLGTPPDETLKRIGSKNVQDYIHQLGFIPKIPFSSLYPEANPQ 290

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP  RITV++AL H YL+ +HD  DEP     F+FSFE+V  ++++K+M
Sbjct: 291 ALDLLEKMLTFDPQERITVDEALEHPYLSIWHDPADEPVCSEKFEFSFEAVNDLDELKQM 350

Query: 241 IAQEVMSFK 249
           +  EV  F+
Sbjct: 351 VINEVQDFR 359



>gi|393239470|gb|EJD47002.1| CMGC/MAPK/ERK protein kinase [Auricularia delicata TFB-10046 SS5]
          Length = 445

 Score =  346 bits (887), Expect = 6e-93,   Method: Compositional matrix adjust.
 Identities = 171/277 (61%), Positives = 199/277 (71%), Gaps = 1/277 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS QPL+DAH+Q FIYQ   GLKYIHSA V+HRDLKPGNLLVNADC LKIC
Sbjct: 114 MEADLHAIIRSGQPLSDAHYQSFIYQTLCGLKYIHSAGVIHRDLKPGNLLVNADCLLKIC 173

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLAR  +         MTEYVATRWYRAPE+MLSF NY+ AID+WSVGCI AE+ G K
Sbjct: 174 DFGLARSNTMDKGAENSLMTEYVATRWYRAPEVMLSFGNYSTAIDIWSVGCILAELHGRK 233

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+FKGRDYVDQLNQIL  LGTP E+ LRR+GS RAQ YI SLP    +PFS LY  AN  
Sbjct: 234 PIFKGRDYVDQLNQILQCLGTPTEDALRRIGSPRAQEYIRSLPIRARVPFSTLYRNANHE 293

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDPA R+T EQALAH YLA +HDE  EP  E +FDFSFE  + +E MKK+
Sbjct: 294 ALDLLGRMLAFDPARRLTCEQALAHPYLAQWHDEFYEPTCESIFDFSFEDEDSMEGMKKL 353

Query: 241 IAQEVMSFKA-SKQAALGLNRQLGRKSSLSAPDRDSL 276
           I +EVM+F+   +Q A   +++  +  SL+ P RD +
Sbjct: 354 IVEEVMAFRRLVRQQATPASKKRTQDDSLAVPSRDDI 390



>gi|164658447|ref|XP_001730349.1| hypothetical protein MGL_2731 [Malassezia globosa CBS 7966]
 gi|159104244|gb|EDP43135.1| hypothetical protein MGL_2731 [Malassezia globosa CBS 7966]
          Length = 489

 Score =  345 bits (884), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 170/255 (66%), Positives = 188/255 (73%), Gaps = 8/255 (3%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS QPL+DAHFQ FIYQ   GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 111 MEADLHAIIRSGQPLSDAHFQSFIYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 170

Query: 61  DFGLARGFSDSPDHNA------GFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFA 114
           DFGL+RGF   P+ N        FMTEYVATRWYRAPEIMLS QNYT AID+WSVGCI A
Sbjct: 171 DFGLSRGFD--PEQNTVMSGQQEFMTEYVATRWYRAPEIMLSHQNYTTAIDLWSVGCILA 228

Query: 115 EMLGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLY 174
           E+LG +PLFKG DYVDQLNQIL  +GTP E  L RV S RAQ YI SLP    +PF  LY
Sbjct: 229 ELLGRRPLFKGHDYVDQLNQILYYIGTPPEPMLCRVASPRAQQYIRSLPYKKPVPFEHLY 288

Query: 175 PKANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELI 234
           P+A P           FDP  RIT ++AL H YLA +HD  DEP   + FDFSFE V+ I
Sbjct: 289 PEATPLALDMLRRLLSFDPEQRITCDEALEHPYLAVWHDPNDEPVCANKFDFSFEQVDDI 348

Query: 235 EDMKKMIAQEVMSFK 249
           + MKK+I QEV+SF+
Sbjct: 349 DGMKKLILQEVISFR 363



>gi|254586223|ref|XP_002498679.1| ZYRO0G16082p [Zygosaccharomyces rouxii]
 gi|238941573|emb|CAR29746.1| ZYRO0G16082p [Zygosaccharomyces rouxii]
          Length = 482

 Score =  345 bits (884), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 157/249 (63%), Positives = 193/249 (77%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQII+S QPLTDAH+Q FIYQI  GLKYIHSA+VLHRDLKPGNLLVNADC+LKIC
Sbjct: 111 MECDMHQIIKSGQPLTDAHYQSFIYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKIC 170

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+S++P  N  F+TEYVATRWYRAPEIMLS+Q YTKAID+WS GCI AE LGGK
Sbjct: 171 DFGLARGYSENPVENNQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSTGCILAEFLGGK 230

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+FKG+DYV+QLN+IL +LGTP +ETL R+GS+  Q YI  L  +P +PF  ++P+ANP 
Sbjct: 231 PIFKGKDYVNQLNRILQVLGTPPDETLGRIGSKNVQDYIHQLGFIPKVPFVDIFPQANPQ 290

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP  RITVE AL H YL+ +HD  DEP     F+FSFES+  + ++++M
Sbjct: 291 ALDLLEKMLMFDPEERITVEDALEHPYLSIWHDPADEPVCNEKFEFSFESINEMSELRQM 350

Query: 241 IAQEVMSFK 249
           + +EV  F+
Sbjct: 351 VIREVQEFR 359



>gi|323308887|gb|EGA62123.1| Slt2p [Saccharomyces cerevisiae FostersO]
          Length = 469

 Score =  343 bits (881), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 158/238 (66%), Positives = 186/238 (78%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQII+S QPLTDAH+Q F YQI  GLKYIHSA+VLHRDLKPGNLLVNADC+LKIC
Sbjct: 111 MECDMHQIIKSGQPLTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKIC 170

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+S++P  N+ F+TEYVATRWYRAPEIMLS+Q YTKAID+WS GCI AE LGGK
Sbjct: 171 DFGLARGYSENPVENSQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSAGCILAEFLGGK 230

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+FKG+DYV+QLNQIL +LGTP +ETLRR+GS+  Q YI  L  +P +PF  LYP AN  
Sbjct: 231 PIFKGKDYVNQLNQILQVLGTPPDETLRRIGSKNVQDYIHQLGFIPKVPFVNLYPNANSQ 290

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMK 238
                     FDP  RITV++AL H YL+ +HD  DEP     F+FSFESV  +ED+K
Sbjct: 291 ALDLLEQMLAFDPQKRITVDEALEHPYLSIWHDPADEPVCSEKFEFSFESVNDMEDLK 348



>gi|472583105|gb|EMS20759.1| mitogen-activated protein kinase 7 [Rhodosporidium toruloides NP11]
          Length = 466

 Score =  338 bits (867), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 161/253 (63%), Positives = 187/253 (73%), Gaps = 4/253 (1%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS QPL+DAHFQ FIYQ   GLKYIHSA+VLHRDLKPGNLLVNADCELKIC
Sbjct: 128 MEADLHAIIRSGQPLSDAHFQSFIYQTLCGLKYIHSAHVLHRDLKPGNLLVNADCELKIC 187

Query: 61  DFGLARGFSD----SPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEM 116
           DFGLARGF      +     GFMTEYVATRWYRAPEIMLSF NYT AID+WSVGC+ AE+
Sbjct: 188 DFGLARGFDQDAAAADGQQQGFMTEYVATRWYRAPEIMLSFANYTTAIDIWSVGCVLAEL 247

Query: 117 LGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPK 176
           LGG+P+FKG+DY+DQLN +L  LGTP + TLRRVGS RAQ YI SLP    +P  QL+P+
Sbjct: 248 LGGRPIFKGKDYIDQLNIVLHFLGTPSDRTLRRVGSPRAQDYIRSLPYKLGVPLVQLFPQ 307

Query: 177 ANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIED 236
           ANP           FDP  RI+ E AL H YL+ +H+  DEP     FDF FE  E ++ 
Sbjct: 308 ANPLALDLLAKLLAFDPHERISCEDALLHPYLSVWHEPADEPVCPEKFDFGFEEEETVDG 367

Query: 237 MKKMIAQEVMSFK 249
           M+++I +EV SF+
Sbjct: 368 MRRLIVEEVESFR 380



>gi|402216592|gb|EJT96677.1| kinase-like protein [Dacryopinax sp. DJM-731 SS1]
          Length = 434

 Score =  338 bits (867), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 183/327 (55%), Positives = 212/327 (64%), Gaps = 11/327 (3%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS QPL+DAHFQ FIYQ   GLKYIHSA  LHRDLKPGNLLVNADCELKI 
Sbjct: 106 MEADLHAIIRSGQPLSDAHFQSFIYQTLCGLKYIHSAKGLHRDLKPGNLLVNADCELKIG 165

Query: 61  DFGLARGFS-------DSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIF 113
           DFG ARG+         +     GFMTEYVATR YRAPEIMLSF N+   ID+W+VGCI 
Sbjct: 166 DFGRARGWQPGLGIQQQNNRGQEGFMTEYVATRGYRAPEIMLSFANHGPPIDIWNVGCIL 225

Query: 114 AEMLGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQL 173
           AE+LGGKP+FKGR+ VDQLNQIL  LGTP E+TLRRV S RAQ YI SLP  P IPF  L
Sbjct: 226 AELLGGKPIFKGRECVDQLNQILHYLGTPSEDTLRRVDSPRAQDYIRSLPIKPRIPFQSL 285

Query: 174 YPKANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVEL 233
           YP ANP           FDPA RI+ E+AL H YLA +HD  DEP     FDF+FE V+ 
Sbjct: 286 YPHANPLAIDLLSQMLCFDPAKRISCEKALEHPYLAVWHDTADEPLCSQTFDFAFEKVDD 345

Query: 234 IEDMKKMIAQEVMSFKASKQAALGLNRQLGRKSSLSAPDRDSLSXXXXXXXXXXSMYEYG 293
           +  MK++I +EV SF+A  ++      Q  ++ SL  P RD +           S Y + 
Sbjct: 346 MPGMKQLIIEEVNSFRALVRSQARQQLQARKQDSLPIPIRDDILASPVNENEGTSGYTFP 405

Query: 294 AASQHAAIPSASM--EVDEQLEQELGG 318
             S  A  PS  M  E   +L++ELGG
Sbjct: 406 HPS--APGPSGGMVEEPGAELDKELGG 430



>gi|71003804|ref|XP_756568.1| hypothetical protein UM00421.1 [Ustilago maydis 521]
 gi|46096099|gb|EAK81332.1| hypothetical protein UM00421.1 [Ustilago maydis 521]
          Length = 424

 Score =  337 bits (863), Expect = 3e-90,   Method: Compositional matrix adjust.
 Identities = 171/280 (61%), Positives = 196/280 (70%), Gaps = 19/280 (6%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS QPL+DAHFQ FIYQ   GLKYIHSA+VLHRDLKPGNLL        IC
Sbjct: 110 MEADLHAIIRSGQPLSDAHFQSFIYQTLCGLKYIHSASVLHRDLKPGNLL--------IC 161

Query: 61  DFGLARGFSDSPDH----NAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEM 116
           DFGLARGF   P+      AGFMTEYVATRWYRAPEIMLSFQNYT AID+WS       +
Sbjct: 162 DFGLARGFETDPELAKQVGAGFMTEYVATRWYRAPEIMLSFQNYTTAIDIWS-------L 214

Query: 117 LGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPK 176
           LGG+P+FKGRDYVDQLNQIL  LGTP EETLRRVGS RAQ YI SLP  P IPF +LYP+
Sbjct: 215 LGGRPIFKGRDYVDQLNQILHYLGTPSEETLRRVGSPRAQDYIRSLPYQPRIPFDRLYPQ 274

Query: 177 ANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIED 236
           ANP          +FDPA RI+ E+AL H YL+ +HD  DEP     FDF FESV+ ++ 
Sbjct: 275 ANPQALNLLERMLEFDPAKRISCEEALQHPYLSVWHDPADEPVCPRKFDFGFESVDEVQG 334

Query: 237 MKKMIAQEVMSFKASKQAALGLNRQLGRKSSLSAPDRDSL 276
           MK +I +EV SF+   +    L +Q  R+ SL  P R+ +
Sbjct: 335 MKTLILEEVRSFRTEVRRQARLMQQPKRQESLPIPSREDI 374



>gi|388579554|gb|EIM19876.1| kinase-like protein [Wallemia sebi CBS 633.66]
          Length = 444

 Score =  336 bits (861), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 163/254 (64%), Positives = 185/254 (72%), Gaps = 13/254 (5%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS QPLTD H+Q F+YQ   GLKYIHSA+V+HRDLKPGNLL        IC
Sbjct: 108 MEADLHAIIRSGQPLTDQHYQSFVYQTLCGLKYIHSADVIHRDLKPGNLL--------IC 159

Query: 61  DFGLARGFSDSPDH-----NAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAE 115
           DFGLARGF   P       +AGFMTEYVATRWYRAPEIMLSF NY+ +ID+WSVGCI AE
Sbjct: 160 DFGLARGFESDPLRAGLAGSAGFMTEYVATRWYRAPEIMLSFANYSTSIDIWSVGCILAE 219

Query: 116 MLGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYP 175
           +LGG+P+FKGRDYVDQLNQIL +LGTP EETLRRVGS RA  YI SLP  P IPF ++YP
Sbjct: 220 LLGGRPIFKGRDYVDQLNQILHVLGTPSEETLRRVGSPRAVEYIRSLPIKPRIPFERIYP 279

Query: 176 KANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIE 235
           KANP           FDPA RIT ++AL H YLA +HD  DEP+    FDF FE  + +E
Sbjct: 280 KANPLALDLLSKMLTFDPAKRITCDEALKHPYLAVWHDPTDEPSCPERFDFGFEVEDSLE 339

Query: 236 DMKKMIAQEVMSFK 249
            MK  I +EV SF+
Sbjct: 340 GMKSAIVEEVKSFR 353



>gi|470318033|gb|EMR09712.1| CMGC/MAPK/ERK1 protein kinase [Pneumocystis murina B123]
          Length = 370

 Score =  335 bits (859), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 152/249 (61%), Positives = 188/249 (75%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           M+A+L+ IIRS+QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKP NLL+NADC+LKIC
Sbjct: 107 MQANLNSIIRSDQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPSNLLINADCKLKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGL+RG S +      +MTEYV TRWYRAPE+MLSFQ+Y+KAID+WSVGCI AE+LG K
Sbjct: 167 DFGLSRGMSVNQGQGTEYMTEYVTTRWYRAPEVMLSFQSYSKAIDLWSVGCILAELLGRK 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKG +YVDQLNQI  ILGTP+E  + ++ S  AQ YI SLP +P +P+S+++P ANP 
Sbjct: 227 PFFKGSNYVDQLNQIFCILGTPNENIISKIKSASAQNYIRSLPILPKMPYSKIFPYANPE 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP  RI+ E+AL H YL  +HD + EP     FDF FE+++ IE++K+M
Sbjct: 287 ALDLLNCLLTFDPCDRISCEKALEHPYLIIWHDPKKEPICSEQFDFGFEAIDSIEEIKQM 346

Query: 241 IAQEVMSFK 249
           I  EV+ FK
Sbjct: 347 IINEVLRFK 355



>gi|470318034|gb|EMR09713.1| CMGC/MAPK/ERK1 protein kinase, variant [Pneumocystis murina B123]
          Length = 264

 Score =  334 bits (857), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 152/249 (61%), Positives = 188/249 (75%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           M+A+L+ IIRS+QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKP NLL+NADC+LKIC
Sbjct: 1   MQANLNSIIRSDQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPSNLLINADCKLKIC 60

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGL+RG S +      +MTEYV TRWYRAPE+MLSFQ+Y+KAID+WSVGCI AE+LG K
Sbjct: 61  DFGLSRGMSVNQGQGTEYMTEYVTTRWYRAPEVMLSFQSYSKAIDLWSVGCILAELLGRK 120

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKG +YVDQLNQI  ILGTP+E  + ++ S  AQ YI SLP +P +P+S+++P ANP 
Sbjct: 121 PFFKGSNYVDQLNQIFCILGTPNENIISKIKSASAQNYIRSLPILPKMPYSKIFPYANPE 180

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP  RI+ E+AL H YL  +HD + EP     FDF FE+++ IE++K+M
Sbjct: 181 ALDLLNCLLTFDPCDRISCEKALEHPYLIIWHDPKKEPICSEQFDFGFEAIDSIEEIKQM 240

Query: 241 IAQEVMSFK 249
           I  EV+ FK
Sbjct: 241 IINEVLRFK 249



>gi|393222133|gb|EJD07617.1| kinase-like protein [Fomitiporia mediterranea MF3/22]
          Length = 783

 Score =  333 bits (855), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 152/251 (60%), Positives = 188/251 (74%), Gaps = 2/251 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLHQII+S Q LT+ H QYF+YQI RG+KY+HSA+V+HRDLKPGNLLVNADCELKIC
Sbjct: 176 MEADLHQIIKSGQMLTNEHIQYFVYQILRGMKYVHSASVVHRDLKPGNLLVNADCELKIC 235

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGL+RGF+  PD  A  MTEYVATRWYRAPEIML+F+ Y  AID+WS+GCI AE+L GK
Sbjct: 236 DFGLSRGFNSGPDEYATHMTEYVATRWYRAPEIMLAFRRYDTAIDVWSIGCILAELLLGK 295

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLFKG+DYVDQLN+IL +LGTP+E  L R+GSE+AQ Y+ SLP+  T+PFS++ P A+P 
Sbjct: 296 PLFKGKDYVDQLNKILDVLGTPEESVLTRIGSEKAQAYVRSLPRRKTVPFSKIIPHADPQ 355

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDF--SFESVELIEDMK 238
                     FDP  RITV  AL H +LA YHD  DEP    ++D     E +E IED +
Sbjct: 356 AIDLLDKMLSFDPEQRITVTTALEHPWLAQYHDVNDEPDCPIIYDKWQEIEKLETIEDFR 415

Query: 239 KMIAQEVMSFK 249
           + +  E+  ++
Sbjct: 416 EALWNEIHEYR 426



>gi|74676217|sp|O94737.1|MAPK1_PNECA RecName: Full=Mitogen-activated protein kinase 1; AltName: Full=MAP
           kinase Mkp1
 gi|4193375|gb|AAD10000.1| mitogen-activated protein kinase [Pneumocystis carinii]
 gi|4322415|gb|AAD16043.1| MAP kinase Mkp1 [Pneumocystis carinii]
          Length = 370

 Score =  333 bits (854), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 151/250 (60%), Positives = 186/250 (74%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           M+A+L+ IIRS+QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKP NLL+NADC+LKIC
Sbjct: 107 MQANLNSIIRSDQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPSNLLINADCKLKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGL+RG S +      +MTEYV TRWYRAPE+MLSFQ+Y+KAID+WSVGCI AE+LG K
Sbjct: 167 DFGLSRGISVNQGQGTEYMTEYVTTRWYRAPEVMLSFQSYSKAIDLWSVGCILAELLGRK 226

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKG +YVDQLNQI  ILGTP+E  + ++ S  AQ YI SLP +P +P+S+++P ANP 
Sbjct: 227 PFFKGSNYVDQLNQIFCILGTPNENIISKIKSASAQSYIRSLPTLPKMPYSKIFPYANPD 286

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP  RI+ E+AL H YL  +HD   EP     FDF FE+++ IE++++M
Sbjct: 287 ALDLLNCLLTFDPYDRISCEEALEHPYLIIWHDPNKEPVCSEQFDFGFEAIDSIEEIRQM 346

Query: 241 IAQEVMSFKA 250
           I  EV  FK 
Sbjct: 347 IINEVSRFKG 356



>gi|323337264|gb|EGA78517.1| Slt2p [Saccharomyces cerevisiae Vin13]
          Length = 336

 Score =  324 bits (830), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 148/219 (67%), Positives = 173/219 (78%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME D+HQII+S QPLTDAH+Q F YQI  GLKYIHSA+VLHRDLKPGNLLVNADC+LKIC
Sbjct: 111 MECDMHQIIKSGQPLTDAHYQSFTYQILCGLKYIHSADVLHRDLKPGNLLVNADCQLKIC 170

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG+S++P  N+ F+TEYVATRWYRAPEIMLS+Q YTKAID+WS GCI AE LGGK
Sbjct: 171 DFGLARGYSENPVENSQFLTEYVATRWYRAPEIMLSYQGYTKAIDVWSAGCILAEFLGGK 230

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+FKG+DYV+QLNQIL +LGTP +ETLRR+GS+  Q YI  L  +P +PF  LYP AN  
Sbjct: 231 PIFKGKDYVNQLNQILQVLGTPPDETLRRIGSKNVQDYIHQLGFIPKVPFVNLYPNANSQ 290

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPA 219
                     FDP  RITV++AL H YL+ +HD  DEP 
Sbjct: 291 ALDLLEQMLAFDPQKRITVDEALEHPYLSIWHDPADEPV 329



>gi|389745531|gb|EIM86712.1| kinase-like protein [Stereum hirsutum FP-91666 SS1]
          Length = 728

 Score =  322 bits (824), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 145/251 (57%), Positives = 183/251 (72%), Gaps = 2/251 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLHQII+S Q L++ H QYF YQI RG+KY+HSA+V+HRDLKPGNLLVN+DCELKIC
Sbjct: 174 MEADLHQIIKSGQMLSNEHVQYFTYQILRGMKYVHSASVVHRDLKPGNLLVNSDCELKIC 233

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGL+RGF   PD     MTEYVATRWYRAPEIML+F+ Y  AID+WS+GCI AE+L GK
Sbjct: 234 DFGLSRGFESRPDEYVSHMTEYVATRWYRAPEIMLAFKRYDTAIDVWSIGCILAELLTGK 293

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLFKG+DYVDQLN+IL +LGTP E  ++R+GSE+AQ Y+ +LP    +PF +L P A+P 
Sbjct: 294 PLFKGKDYVDQLNKILDVLGTPSEAVIKRIGSEKAQAYVRTLPIKKKVPFRKLVPSADPQ 353

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFD--FSFESVELIEDMK 238
                     FDP+ RITV +AL H +L+ YHD  DEP     FD     E +E IE  +
Sbjct: 354 ALDLLEKMLSFDPSGRITVAEALEHPWLSGYHDVNDEPECPTKFDRWRDIEKLETIEQFR 413

Query: 239 KMIAQEVMSFK 249
           + + +E+  ++
Sbjct: 414 EALWKEIEDYR 424



>gi|390596698|gb|EIN06099.1| Pkinase-domain-containing protein [Punctularia strigosozonata
           HHB-11173 SS5]
          Length = 747

 Score =  322 bits (824), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 149/252 (59%), Positives = 187/252 (74%), Gaps = 3/252 (1%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLHQII+S Q LT+ H QYF+YQ+ RG+KY+HSA+V+HRDLKPGNLLVNADCELKIC
Sbjct: 184 MEADLHQIIKSGQSLTNEHVQYFLYQVLRGMKYVHSASVVHRDLKPGNLLVNADCELKIC 243

Query: 61  DFGLARGFSDSPD-HNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGG 119
           DFGL+RGF   PD H    MTEYVATRWYRAPEIML+F+ Y  AID+WS+GCIFAE+L G
Sbjct: 244 DFGLSRGFEQRPDEHATTNMTEYVATRWYRAPEIMLAFRQYDTAIDVWSIGCIFAELLLG 303

Query: 120 KPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANP 179
           KPLFKG+DYVDQLN+IL +LGTP++  + R+GSERAQ YI SLP    +PF ++ P A+ 
Sbjct: 304 KPLFKGKDYVDQLNKILDVLGTPEDPVITRIGSERAQAYIRSLPVKKRVPFHKIVPTADS 363

Query: 180 XXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFD--FSFESVELIEDM 237
                      FDPA RITV  ALAH +L++YHDE+DEP     F+     E++E I+  
Sbjct: 364 AALDLLEKMLAFDPAARITVPDALAHPWLSSYHDEQDEPECPIPFEKWRYIETLETIDQF 423

Query: 238 KKMIAQEVMSFK 249
           +  +  E+  ++
Sbjct: 424 RDALWNEIQEYR 435



>gi|430811227|emb|CCJ31321.1| unnamed protein product [Pneumocystis jirovecii]
          Length = 763

 Score =  321 bits (822), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 148/239 (61%), Positives = 178/239 (74%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           M+A+L+ IIRS QPLTDAHFQ FIYQI  GLKYIHSANVLHRDLKP NLL+NADCELKIC
Sbjct: 523 MQANLNSIIRSNQPLTDAHFQSFIYQILCGLKYIHSANVLHRDLKPSNLLINADCELKIC 582

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGL+RG   +      +MTEYV TRWYRAPEIMLSFQ+Y+KAID+WSVGCI AE+LG K
Sbjct: 583 DFGLSRGMLLNQGQGTEYMTEYVTTRWYRAPEIMLSFQSYSKAIDIWSVGCILAELLGRK 642

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGR+YVDQLNQI  ILGTPDE  + ++ S  AQ YI  LP +P I +S+++P ANP 
Sbjct: 643 PFFKGRNYVDQLNQIFCILGTPDENIISKIKSTSAQNYIRGLPVVPKISYSKIFPYANPD 702

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKK 239
                     FDP  RI+ E+AL H YL  +HD + EP     FDF FE+++ IE++K+
Sbjct: 703 ALDLLNRLLTFDPDDRISCEKALEHPYLIIWHDPKKEPVCSKQFDFGFEAIDNIEEIKR 761



>gi|170086864|ref|XP_001874655.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164649855|gb|EDR14096.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 359

 Score =  317 bits (813), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 142/251 (56%), Positives = 185/251 (73%), Gaps = 2/251 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLHQII+S Q LT+ H QYF+YQI RG+KY+HSA+V+HRDLKPGNLLVNADCELKIC
Sbjct: 105 MEADLHQIIKSGQHLTNEHVQYFLYQILRGMKYVHSASVIHRDLKPGNLLVNADCELKIC 164

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGL+RGF   PD  A  +TEYVATRWYRAPEIML+F+ Y  AID+WS+GCI AE+L GK
Sbjct: 165 DFGLSRGFDARPDEYASHLTEYVATRWYRAPEIMLAFRRYNTAIDVWSIGCILAELLLGK 224

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLFKG+DYVDQLN++L +LGTPDE  +R++GS++AQ Y+ SLP   ++P  ++ P A+P 
Sbjct: 225 PLFKGKDYVDQLNKVLDVLGTPDESVIRKIGSDKAQAYVRSLPSKKSVPLRKILPTADPQ 284

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFD--FSFESVELIEDMK 238
                     FDP+ RITV +AL H +L +YHD  DEP     F+     E +  +E+ +
Sbjct: 285 ALDLLSKMLAFDPSDRITVPEALEHPWLTSYHDISDEPDCPQKFERWREIEKLNTLEEFR 344

Query: 239 KMIAQEVMSFK 249
           + +  E+  ++
Sbjct: 345 EALWNEIEDYR 355



>gi|361126513|gb|EHK98511.1| putative Mitogen-activated protein kinase spm1 [Glarea lozoyensis
           74030]
          Length = 402

 Score =  317 bits (812), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 156/249 (62%), Positives = 179/249 (71%), Gaps = 11/249 (4%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL  IIRS QPLTD HFQ FIYQI  GLKYIHSANVLHRDLKPGNLLVNADCELKIC
Sbjct: 107 MECDLAAIIRSGQPLTDPHFQSFIYQILCGLKYIHSANVLHRDLKPGNLLVNADCELKIC 166

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGFS  P  NAG+MTEYVATRWYRAPEIMLSFQ+YTK           A++LGG+
Sbjct: 167 DFGLARGFSVDPQENAGYMTEYVATRWYRAPEIMLSFQSYTK-----------AKLLGGR 215

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P FKGRDYVDQLNQIL ILG PD++TL ++GS RAQ Y+ +LP M    F++L+P A   
Sbjct: 216 PFFKGRDYVDQLNQILHILGKPDDKTLEKIGSPRAQDYVRNLPPMDKQDFNKLFPGAKKE 275

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP  R+TVE+AL H YL  +HD  DEP     F+F FE VE + +M++M
Sbjct: 276 ALDILEKMLAFDPTRRVTVEEALEHEYLQIWHDPSDEPGCPTTFNFDFEVVEDVGEMRQM 335

Query: 241 IAQEVMSFK 249
           I  EV  F+
Sbjct: 336 ILDEVHRFR 344



>gi|426196714|gb|EKV46642.1| hypothetical protein AGABI2DRAFT_223047 [Agaricus bisporus var.
           bisporus H97]
          Length = 713

 Score =  315 bits (808), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 146/250 (58%), Positives = 185/250 (74%), Gaps = 3/250 (1%)

Query: 3   ADLHQIIRSEQPLTDAHFQYFIYQICRG-LKYIHSANVLHRDLKPGNLLVNADCELKICD 61
           ADLHQII+S Q LT+ H QYFIYQI RG +KYIHSA+V+HRDLKPGNLLVNA+CELKICD
Sbjct: 176 ADLHQIIKSGQVLTNEHVQYFIYQILRGRMKYIHSASVIHRDLKPGNLLVNANCELKICD 235

Query: 62  FGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGKP 121
           FGL+RGF  +PD N   +TEYVATRWYRAPEIML+F+ Y  AID+WS+GCI AE+L  KP
Sbjct: 236 FGLSRGFDSAPDENTPHLTEYVATRWYRAPEIMLAFRRYNVAIDVWSIGCILAELLMQKP 295

Query: 122 LFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPXX 181
           LFKG+DYVDQLN+I  +LG+P+E  ++++GSERAQ Y+ SLP   T+PF +L P A+P  
Sbjct: 296 LFKGKDYVDQLNKIFDVLGSPEEYIMQKIGSERAQAYVRSLPFKKTVPFRKLMPDADPQA 355

Query: 182 XXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFD--FSFESVELIEDMKK 239
                    FDP+ RI+V QAL H +L+ YHD +DEP     FD     E +E IE+ ++
Sbjct: 356 LDLLNKILTFDPSERISVLQALEHPWLSTYHDPDDEPTCPTNFDKWKEIERLETIEEFRE 415

Query: 240 MIAQEVMSFK 249
            +  E+  F+
Sbjct: 416 ALWNEIEDFR 425



>gi|409081475|gb|EKM81834.1| hypothetical protein AGABI1DRAFT_54872 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 711

 Score =  315 bits (808), Expect = 8e-84,   Method: Compositional matrix adjust.
 Identities = 146/250 (58%), Positives = 185/250 (74%), Gaps = 3/250 (1%)

Query: 3   ADLHQIIRSEQPLTDAHFQYFIYQICRG-LKYIHSANVLHRDLKPGNLLVNADCELKICD 61
           ADLHQII+S Q LT+ H QYFIYQI RG +KYIHSA+V+HRDLKPGNLLVNA+CELKICD
Sbjct: 176 ADLHQIIKSGQVLTNEHVQYFIYQILRGRMKYIHSASVIHRDLKPGNLLVNANCELKICD 235

Query: 62  FGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGKP 121
           FGL+RGF  +PD N   +TEYVATRWYRAPEIML+F+ Y  AID+WS+GCI AE+L  KP
Sbjct: 236 FGLSRGFDSAPDENTPHLTEYVATRWYRAPEIMLAFRRYNVAIDVWSIGCILAELLMQKP 295

Query: 122 LFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPXX 181
           LFKG+DYVDQLN+I  +LG+P+E  ++++GSERAQ Y+ SLP   T+PF +L P A+P  
Sbjct: 296 LFKGKDYVDQLNKIFDVLGSPEEYIMQKIGSERAQAYVRSLPFKKTVPFRKLMPDADPQA 355

Query: 182 XXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFD--FSFESVELIEDMKK 239
                    FDP+ RI+V QAL H +L+ YHD +DEP     FD     E +E IE+ ++
Sbjct: 356 LDLLNKILTFDPSERISVLQALEHPWLSTYHDPDDEPTCPANFDKWKEIERLETIEEFRE 415

Query: 240 MIAQEVMSFK 249
            +  E+  F+
Sbjct: 416 ALWNEIEDFR 425



>gi|392565446|gb|EIW58623.1| kinase-like protein [Trametes versicolor FP-101664 SS1]
          Length = 719

 Score =  314 bits (805), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 142/251 (56%), Positives = 183/251 (72%), Gaps = 2/251 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           M +DLHQII+S Q LT+ H QYF+YQ+ RG+KYIHSA+V+HRDLKPGNLLVNADCELKIC
Sbjct: 179 MPSDLHQIIKSGQALTNEHVQYFVYQVLRGMKYIHSASVVHRDLKPGNLLVNADCELKIC 238

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGL+RGF+ +PD N   MTEYVATRWYRAPEIML ++ Y  AID+WS+GCI AE++ GK
Sbjct: 239 DFGLSRGFNSAPDENPTLMTEYVATRWYRAPEIMLVYKAYNTAIDVWSIGCIMAELMMGK 298

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLFKG+DYVDQLN+IL +LG+P++  + R+ S +AQ YI SLP    +PF +L P A+  
Sbjct: 299 PLFKGKDYVDQLNKILDVLGSPEDAVITRIASPKAQAYIRSLPIKKRVPFEKLIPTADAQ 358

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFD--FSFESVELIEDMK 238
                    +FDPA RITV +AL H +L+AYHD  DEPA    F+     E +E +   +
Sbjct: 359 AIDLLTKLLQFDPAARITVAEALEHPWLSAYHDVSDEPACAAPFEGWRQIEELETLPQFR 418

Query: 239 KMIAQEVMSFK 249
           + I  E+  ++
Sbjct: 419 EAIYNEIHDYR 429



>gi|401885870|gb|EJT49955.1| MAP kinase [Trichosporon asahii var. asahii CBS 2479]
          Length = 803

 Score =  314 bits (804), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 144/255 (56%), Positives = 188/255 (73%), Gaps = 5/255 (1%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLHQI+RS QPL++ H Q+F+YQ+ RG+KYIHSANV+HRDLKPGNLLVN+DCELKIC
Sbjct: 299 MEADLHQIVRSGQPLSNLHIQFFLYQLLRGVKYIHSANVIHRDLKPGNLLVNSDCELKIC 358

Query: 61  DFGLARGF----SDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEM 116
           DFGLARG+     ++P +    MTEYVATRWYRAPEIMLS + YT AID+WS+GCI  E+
Sbjct: 359 DFGLARGYQPVTGEAPQNEELRMTEYVATRWYRAPEIMLSNKRYTSAIDVWSIGCILGEL 418

Query: 117 LGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPK 176
           LG KPLFKG+DYVDQLN IL +LGTPD+ETL+R+ SE+A++Y+++LP       +++ P 
Sbjct: 419 LGLKPLFKGKDYVDQLNLILNVLGTPDDETLQRMSSEKARMYMATLPHSEKRDLAEVLPG 478

Query: 177 ANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFS-FESVELIE 235
           A+P           FDP+ RI V QAL H Y+ AYHD  DEP  E    +   E +E  E
Sbjct: 479 ADPAALDLLAQLLSFDPSKRIDVVQALEHPYVGAYHDPSDEPTCEPFNQWEQVEGLETTE 538

Query: 236 DMKKMIAQEVMSFKA 250
           ++K  + +E++ ++A
Sbjct: 539 ELKAALTKEIIEYRA 553



>gi|406695737|gb|EKC99039.1| MAP kinase [Trichosporon asahii var. asahii CBS 8904]
          Length = 803

 Score =  314 bits (804), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 144/255 (56%), Positives = 188/255 (73%), Gaps = 5/255 (1%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLHQI+RS QPL++ H Q+F+YQ+ RG+KYIHSANV+HRDLKPGNLLVN+DCELKIC
Sbjct: 299 MEADLHQIVRSGQPLSNLHIQFFLYQLLRGVKYIHSANVIHRDLKPGNLLVNSDCELKIC 358

Query: 61  DFGLARGF----SDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEM 116
           DFGLARG+     ++P +    MTEYVATRWYRAPEIMLS + YT AID+WS+GCI  E+
Sbjct: 359 DFGLARGYQPVTGEAPQNEELRMTEYVATRWYRAPEIMLSNKRYTSAIDVWSIGCILGEL 418

Query: 117 LGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPK 176
           LG KPLFKG+DYVDQLN IL +LGTPD+ETL+R+ SE+A++Y+++LP       +++ P 
Sbjct: 419 LGLKPLFKGKDYVDQLNLILNVLGTPDDETLQRMSSEKARMYMATLPHSEKRDLAEVLPG 478

Query: 177 ANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFS-FESVELIE 235
           A+P           FDP+ RI V QAL H Y+ AYHD  DEP  E    +   E +E  E
Sbjct: 479 ADPAALDLLAQLLSFDPSKRIDVVQALEHPYVGAYHDPSDEPTCEPFNQWEQVEGLETTE 538

Query: 236 DMKKMIAQEVMSFKA 250
           ++K  + +E++ ++A
Sbjct: 539 ELKAALTKEIIEYRA 553



>gi|402223581|gb|EJU03645.1| Pkinase-domain-containing protein [Dacryopinax sp. DJM-731 SS1]
          Length = 641

 Score =  313 bits (802), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 144/253 (56%), Positives = 193/253 (76%), Gaps = 6/253 (2%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLHQIIRS Q LT+AH QYF+YQI RG+KYIHSANV+HRD+KPGNLLVNADCELKIC
Sbjct: 165 MEADLHQIIRSGQKLTNAHVQYFLYQILRGVKYIHSANVVHRDIKPGNLLVNADCELKIC 224

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGL+RGF+   D N   MTEYVATRWYRAPE+MLSF+ Y+  ID+WS+GC+  E++ GK
Sbjct: 225 DFGLSRGFNARADENTTQMTEYVATRWYRAPEVMLSFKRYSFGIDLWSIGCVLGELVMGK 284

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLP-KMP-TIPFSQLYPKAN 178
           P+FKG+DYVDQLN I+  LGTP ++T++++GS+RA+ Y+ +LP K+P ++P  +L+P+ +
Sbjct: 285 PVFKGKDYVDQLNLIINTLGTPPDDTIKKIGSDRAREYVRNLPFKLPQSLP--KLFPRTD 342

Query: 179 PXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDF--SFESVELIED 236
                      +FDP  RI+V +ALAH +L  YHDE DEP   H+F+     E++E ++D
Sbjct: 343 NMGRDLIHRFLRFDPDERISVNEALAHPFLETYHDEADEPTCPHIFNKWERIETLESMDD 402

Query: 237 MKKMIAQEVMSFK 249
            ++ I +EV  F+
Sbjct: 403 FRQEIYKEVEEFR 415



>gi|470296739|ref|XP_004345440.1| mitogen-activated kinase 7 [Capsaspora owczarzaki ATCC 30864]
 gi|320163819|gb|EFW40718.1| mitogen-activated kinase 7 [Capsaspora owczarzaki ATCC 30864]
          Length = 975

 Score =  313 bits (802), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 146/247 (59%), Positives = 184/247 (74%), Gaps = 3/247 (1%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           M+ DLH IIRS QPL+D H +YF+YQ+ RGLKYIHSA VLHRDLKP NLLVNA+C++KIC
Sbjct: 190 MDTDLHNIIRSSQPLSDDHVRYFMYQLLRGLKYIHSAGVLHRDLKPSNLLVNAECDIKIC 249

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFG+ARG S +P+ ++ FMT YVATRWYRAPEIMLSF +YTKAID+WS GCIFAEMLG  
Sbjct: 250 DFGMARGVSATPEEHSMFMTSYVATRWYRAPEIMLSFAHYTKAIDVWSAGCIFAEMLGRH 309

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLR-RVGSERAQIYISSLPKMPTIPFSQLYPKANP 179
            LF G+DYV QLN I+G++GTPD + +   +GSE+ + Y+ S P    +P  +LYP+ANP
Sbjct: 310 TLFPGKDYVHQLNLIIGLVGTPDRKFIESSIGSEKVKRYMLSFPARERVPLQRLYPQANP 369

Query: 180 XXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVEL-IEDMK 238
                     +FDP  RI+VE ALAH YLA YH E DEP     F+F FE +EL ++D+K
Sbjct: 370 QALDLLDRMLQFDPEKRISVEAALAHPYLAMYHSEIDEPECAP-FNFDFERLELTVQDLK 428

Query: 239 KMIAQEV 245
           +M+  E+
Sbjct: 429 RMVLAEI 435



>gi|365984921|ref|XP_003669293.1| hypothetical protein NDAI_0C03900 [Naumovozyma dairenensis CBS 421]
 gi|343768061|emb|CCD24050.1| hypothetical protein NDAI_0C03900 [Naumovozyma dairenensis CBS 421]
          Length = 489

 Score =  313 bits (801), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 141/249 (56%), Positives = 183/249 (73%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ++ DL+QI+ S Q LTD+H+Q FIYQI  GLK+IHSANVLHRD+KPGNLLVNADC+LKIC
Sbjct: 110 VDCDLYQILHSGQSLTDSHYQCFIYQILCGLKFIHSANVLHRDIKPGNLLVNADCQLKIC 169

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGL+RG+S++   N  F+TEYV T+WYRAPEIMLS+Q Y+ A+D+WS GCI AE L GK
Sbjct: 170 DFGLSRGYSNNMTENEQFVTEYVPTKWYRAPEIMLSYQGYSTAVDVWSTGCILAEFLNGK 229

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           P+F+G DYV+QLN+IL +LG+P+ ET++++ S+  Q YI  L  +P IPF  L+P A   
Sbjct: 230 PMFEGDDYVNQLNKILQVLGSPNIETIKKINSKNVQDYILQLGNIPKIPFPVLFPNATKN 289

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDPA RITVE ALAH YL+ +HD +DEP      DF FE V+ ++ +K+M
Sbjct: 290 AIDLLEKMLTFDPAERITVESALAHPYLSVWHDSDDEPVCPQKVDFMFEKVDDLDLLKEM 349

Query: 241 IAQEVMSFK 249
           I  EV  F+
Sbjct: 350 IINEVNDFR 358



>gi|134115006|ref|XP_773801.1| hypothetical protein CNBH2530 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50256429|gb|EAL19154.1| hypothetical protein CNBH2530 [Cryptococcus neoformans var.
           neoformans B-3501A]
          Length = 807

 Score =  310 bits (795), Expect = 3e-82,   Method: Compositional matrix adjust.
 Identities = 145/255 (56%), Positives = 184/255 (72%), Gaps = 6/255 (2%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLHQIIRS QPL +AH Q+FIYQ+ RG+KYIHSANV+HRDLKPGNLLVN+ CELKIC
Sbjct: 285 MEADLHQIIRSGQPLGNAHIQFFIYQLLRGMKYIHSANVIHRDLKPGNLLVNSGCELKIC 344

Query: 61  DFGLARGFS----DSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEM 116
           DFGLARGF+    + P    G +TEYVATRWYRAPEIMLS + YT AID+WS+GCI AE+
Sbjct: 345 DFGLARGFNPVRGEEPQGEEGKLTEYVATRWYRAPEIMLSNRRYTTAIDVWSIGCILAEL 404

Query: 117 LGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPK 176
           LG KP+FKG+DY++Q+  IL  LGTPDEET+ RV SE+A  ++ +LP         ++P 
Sbjct: 405 LGLKPVFKGKDYIEQMTLILETLGTPDEETMARVASEKALTFLKTLPTYEKKDLGSIFPD 464

Query: 177 ANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDF--SFESVELI 234
           A+P          +FDP  RI V  AL H+Y+  YHD EDEP+ + +FD     ES+  I
Sbjct: 465 ADPLAVDLTDKLLEFDPTRRIDVPSALTHAYVERYHDPEDEPSCDKIFDKWEEVESLSTI 524

Query: 235 EDMKKMIAQEVMSFK 249
           E++K+ I +E+  F+
Sbjct: 525 EELKEAITREIQGFR 539



>gi|58271510|ref|XP_572911.1| MAP kinase [Cryptococcus neoformans var. neoformans JEC21]
 gi|57229170|gb|AAW45604.1| MAP kinase, putative [Cryptococcus neoformans var. neoformans
           JEC21]
          Length = 760

 Score =  310 bits (793), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 145/255 (56%), Positives = 184/255 (72%), Gaps = 6/255 (2%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLHQIIRS QPL +AH Q+FIYQ+ RG+KYIHSANV+HRDLKPGNLLVN+ CELKIC
Sbjct: 285 MEADLHQIIRSGQPLGNAHIQFFIYQLLRGMKYIHSANVIHRDLKPGNLLVNSGCELKIC 344

Query: 61  DFGLARGFS----DSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEM 116
           DFGLARGF+    + P    G +TEYVATRWYRAPEIMLS + YT AID+WS+GCI AE+
Sbjct: 345 DFGLARGFNPVKGEEPQGEEGKLTEYVATRWYRAPEIMLSNRRYTTAIDVWSIGCILAEL 404

Query: 117 LGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPK 176
           LG KP+FKG+DY++Q+  IL  LGTPDEET+ RV SE+A  ++ +LP         ++P 
Sbjct: 405 LGLKPVFKGKDYIEQMTLILETLGTPDEETMARVASEKALTFLKTLPTYEKKDLGSIFPD 464

Query: 177 ANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDF--SFESVELI 234
           A+P          +FDP  RI V  AL H+Y+  YHD EDEP+ + +FD     ES+  I
Sbjct: 465 ADPLAVDLTDKLLEFDPTRRIDVPSALTHAYVERYHDPEDEPSCDKIFDKWEEVESLSTI 524

Query: 235 EDMKKMIAQEVMSFK 249
           E++K+ I +E+  F+
Sbjct: 525 EELKEAITREIQGFR 539



>gi|302686956|ref|XP_003033158.1| hypothetical protein SCHCODRAFT_75776 [Schizophyllum commune H4-8]
 gi|300106852|gb|EFI98255.1| hypothetical protein SCHCODRAFT_75776, partial [Schizophyllum
           commune H4-8]
          Length = 427

 Score =  309 bits (792), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 144/255 (56%), Positives = 188/255 (73%), Gaps = 6/255 (2%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           + ADLHQII+S Q LT+ H QYF+YQ+ RG+KYIHSA+V+HRDLKPGNLLVNADCELKIC
Sbjct: 166 LAADLHQIIKSGQTLTNEHVQYFLYQVLRGMKYIHSASVIHRDLKPGNLLVNADCELKIC 225

Query: 61  DFGLARGFSDSPDHNAG-FMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGG 119
           DFGL+RG+  +PD N    +TEYVATRWYRAPEIML+F+ Y  AID+WS+GCIFAE+L G
Sbjct: 226 DFGLSRGYDANPDENTSHHLTEYVATRWYRAPEIMLAFRRYNTAIDVWSIGCIFAELLLG 285

Query: 120 KPLFKGRDY---VDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPK 176
           KPLFKG+++   VDQLN+IL +LG PDE  + R+GSE+AQ Y+ SLP  P +PF+++ P 
Sbjct: 286 KPLFKGKEWAYSVDQLNKILDVLGHPDEFVISRIGSEKAQAYVRSLPYKPRVPFNKVIPS 345

Query: 177 ANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFD--FSFESVELI 234
           A+            FDP+ RI+V  +LAH YL+AYHD  DEP    +FD     E +E I
Sbjct: 346 ADSQAVDLLTKMLAFDPSDRISVVDSLAHPYLSAYHDVTDEPDCPRVFDRWREVEELETI 405

Query: 235 EDMKKMIAQEVMSFK 249
           +D ++ +  E+  ++
Sbjct: 406 DDFREALWNEIEDYR 420



>gi|23452044|gb|AAN32906.1| MAP kinase-like protein [Colletotrichum gloeosporioides f. sp.
           malvae]
          Length = 316

 Score =  307 bits (786), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 145/216 (67%), Positives = 168/216 (77%)

Query: 34  IHSANVLHRDLKPGNLLVNADCELKICDFGLARGFSDSPDHNAGFMTEYVATRWYRAPEI 93
           + SA  +HRDLKPGNLLVNADCELKICDFGLARGFS  P+ NAG+MTEYVATRWYRAPEI
Sbjct: 63  MSSAIRIHRDLKPGNLLVNADCELKICDFGLARGFSVDPEENAGYMTEYVATRWYRAPEI 122

Query: 94  MLSFQNYTKAIDMWSVGCIFAEMLGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSE 153
           MLSFQ+YTKAID+WSVGCI AE+LGG+P FKGRDYVDQLNQIL ILGTP+EETL R+GS 
Sbjct: 123 MLSFQSYTKAIDVWSVGCILAELLGGRPFFKGRDYVDQLNQILHILGTPNEETLSRIGSP 182

Query: 154 RAQIYISSLPKMPTIPFSQLYPKANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHD 213
           RAQ YI +LP MP  PF QL+ +ANP           FDP++R +VEQAL H YL  +H+
Sbjct: 183 RAQEYIRNLPFMPKKPFPQLFAQANPDALDLLDRMLAFDPSSRFSVEQALEHPYLHIWHN 242

Query: 214 EEDEPAHEHMFDFSFESVELIEDMKKMIAQEVMSFK 249
             DEP     F+F FE VE + DM+KMI +EV  F+
Sbjct: 243 ASDEPDCPTTFNFDFEVVEDVGDMRKMILEEVYRFR 278



>gi|118403626|ref|NP_001072332.1| mitogen-activated protein kinase 7 [Xenopus (Silurana) tropicalis]
 gi|111305652|gb|AAI21411.1| mitogen-activated protein kinase 7 [Xenopus (Silurana) tropicalis]
          Length = 925

 Score =  306 bits (785), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 146/269 (54%), Positives = 186/269 (69%), Gaps = 4/269 (1%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME+DLHQII S QPLT  H +YF+YQ+ RGLKYIHSANVLHRDLKP NLL+N +CELKI 
Sbjct: 135 MESDLHQIIHSSQPLTLEHARYFLYQLLRGLKYIHSANVLHRDLKPSNLLINENCELKIG 194

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFG+ARG    PD    FMTEYVATRWYR PE+MLS   YT+AIDMWSVGCIFAEMLG K
Sbjct: 195 DFGMARGLCTKPDEYKYFMTEYVATRWYRPPELMLSLHEYTQAIDMWSVGCIFAEMLGRK 254

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLF G++Y+ QL+ I+ +LGTP  + +R +G+ER + YI SLP    +P++ LYP+A   
Sbjct: 255 PLFPGKNYLHQLHLIMTVLGTPSSQVIRAIGAERVRAYIQSLPSRQPVPWATLYPQAGKK 314

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIED-MKK 239
                    +FDP  RI+V +AL H +L+ YHD +DEP     FDF F+   L +D +K+
Sbjct: 315 ALDLLSKMLRFDPRDRISVAEALRHPFLSKYHDPDDEPECIPAFDFGFDKKILTKDQIKE 374

Query: 240 MIAQEVMSFKASKQAALGLNRQLGRKSSL 268
            I  E+  F   ++   G+ RQ+  K +L
Sbjct: 375 AITAEIDGFHRRRE---GIRRQISFKPAL 400



>gi|513237204|ref|XP_003643551.2| PREDICTED: uncharacterized transmembrane protein DDB_G0289901-like,
           partial [Gallus gallus]
          Length = 843

 Score =  306 bits (784), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 142/249 (57%), Positives = 172/249 (69%), Gaps = 1/249 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME+DLHQII S QPLT  H +YF+YQ+ RGLKYIHSANVLHRDLKP NLLVN +CELKI 
Sbjct: 1   MESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYIHSANVLHRDLKPSNLLVNENCELKIG 60

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFG+ARG    P H+  F+TEYVATRWYRAPE++LS   YT+AIDMWSVGCIFAEMLG +
Sbjct: 61  DFGMARGLGADPRHSKAFLTEYVATRWYRAPELLLSLHRYTRAIDMWSVGCIFAEMLGRR 120

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
            LF GR+YV QL  I+ +LGTP    +  +G+ER + Y+ SLP  P +P+  LY  A P 
Sbjct: 121 QLFPGRNYVHQLQLIMAVLGTPPAGVMAAIGAERVRAYLQSLPPRPPVPWESLYGDAEPA 180

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELI-EDMKK 239
                    +FDP  R+ V +AL H +LA YHD EDEP     FDF+FE   L  E++K 
Sbjct: 181 ALALLGRMLRFDPRERVGVAEALRHPFLAKYHDPEDEPECIPAFDFAFERRVLTKEEIKA 240

Query: 240 MIAQEVMSF 248
            I  E+  F
Sbjct: 241 AIVAEIEDF 249



>gi|160420257|ref|NP_001086764.1| mitogen-activated protein kinase 7 [Xenopus laevis]
 gi|50415198|gb|AAH77412.1| Mapk7-prov protein [Xenopus laevis]
          Length = 925

 Score =  306 bits (783), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 147/269 (54%), Positives = 186/269 (69%), Gaps = 4/269 (1%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME+DLHQII S QPLT  H +YF+YQ+ RGLKYIHSANVLHRDLKP NLL+N +CELKI 
Sbjct: 135 MESDLHQIIHSSQPLTLEHARYFLYQLLRGLKYIHSANVLHRDLKPSNLLINENCELKIG 194

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFG+ARG    PD    FMTEYVATRWYRAPE+MLS   YT+AIDMWSVGCIFAEMLG K
Sbjct: 195 DFGMARGLCTKPDEYKYFMTEYVATRWYRAPELMLSLHEYTQAIDMWSVGCIFAEMLGRK 254

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLF G +Y+ QL+ I+ +LGTP  + +R +G+ER + YI SLP    +P++ LYP+A   
Sbjct: 255 PLFPGNNYLHQLHLIMTVLGTPSSQVIRAIGAERVRAYIQSLPSRQPVPWATLYPQAGKK 314

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIED-MKK 239
                    +FD   RI+V +AL H +L+ YHD +DEP     FDF F+   L +D +K+
Sbjct: 315 ALDLLSKMLRFDTRDRISVAEALRHPFLSKYHDPDDEPECIPAFDFGFDKNILTKDQIKE 374

Query: 240 MIAQEVMSFKASKQAALGLNRQLGRKSSL 268
            I  E+ SF   ++   G+ RQ+  K +L
Sbjct: 375 AITTEIDSFHRRRE---GIRRQISFKPAL 400



>gi|82568554|dbj|BAE48519.1| ERK5 [Xenopus laevis]
          Length = 925

 Score =  306 bits (783), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 147/269 (54%), Positives = 186/269 (69%), Gaps = 4/269 (1%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME+DLHQII S QPLT  H +YF+YQ+ RGLKYIHSANVLHRDLKP NLL+N +CELKI 
Sbjct: 135 MESDLHQIIHSSQPLTLEHARYFLYQLLRGLKYIHSANVLHRDLKPSNLLINENCELKIG 194

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFG+ARG    PD    FMTEYVATRWYRAPE+MLS   YT+AIDMWSVGCIFAEMLG K
Sbjct: 195 DFGMARGLCTKPDEYKYFMTEYVATRWYRAPELMLSLHEYTQAIDMWSVGCIFAEMLGRK 254

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLF G +Y+ QL+ I+ +LGTP  + +R +G+ER + YI SLP    +P++ LYP+A   
Sbjct: 255 PLFPGNNYLHQLHLIMTVLGTPSSQVIRAIGAERVRAYIQSLPSRQPVPWATLYPQAGKK 314

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIED-MKK 239
                    +FD   RI+V +AL H +L+ YHD +DEP     FDF F+   L +D +K+
Sbjct: 315 ALDLLSKMLRFDTRDRISVAEALRHPFLSKYHDPDDEPECIPAFDFGFDKNILTKDQIKE 374

Query: 240 MIAQEVMSFKASKQAALGLNRQLGRKSSL 268
            I  E+ SF   ++   G+ RQ+  K +L
Sbjct: 375 AITTEIDSFHRRRE---GIRRQISFKPAL 400



>gi|328766213|gb|EGF76269.1| hypothetical protein BATDEDRAFT_37565 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 407

 Score =  305 bits (782), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 143/253 (56%), Positives = 184/253 (72%), Gaps = 2/253 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADL+QII+S Q LT  HFQYF+YQ+ RGLK++HSAN++HRDLKPGNLLVN+DCEL+IC
Sbjct: 99  MEADLNQIIQSGQQLTKQHFQYFLYQLLRGLKWMHSANIIHRDLKPGNLLVNSDCELRIC 158

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG SD   H     TEYVATR+YRAPE++LS ++YTKAID+WSVGCIF EML G+
Sbjct: 159 DFGLARGISDVNSHLVN--TEYVATRYYRAPEVVLSPKHYTKAIDLWSVGCIFGEMLTGR 216

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
            LFKG DY+DQL +I  +LGTP +  L R+ S R   Y+ + PK   +P  Q +P+A+  
Sbjct: 217 VLFKGADYIDQLEKIFKVLGTPQDPALTRLCSSRVFKYLRAWPKRSKMPLEQAFPRADAE 276

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FD + RIT ++ALAH +LA YH  +DEP+H  +FDF FE  + IE++K++
Sbjct: 277 GLDFIDKLLVFDASHRITADEALAHPFLAVYHFSDDEPSHPALFDFGFEEAKTIEEIKEL 336

Query: 241 IAQEVMSFKASKQ 253
           I  EV  FK S+Q
Sbjct: 337 IVTEVAEFKKSQQ 349



>gi|50553802|ref|XP_504312.1| YALI0E23496p [Yarrowia lipolytica]
 gi|49650181|emb|CAG79911.1| YALI0E23496p [Yarrowia lipolytica CLIB122]
          Length = 356

 Score =  305 bits (780), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 151/254 (59%), Positives = 179/254 (70%), Gaps = 7/254 (2%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           M+ DLH++IR+ Q L+D H QYF+YQ  R +K +HSANVLHRDLKP NLL+NA C+LKIC
Sbjct: 103 MDTDLHRVIRT-QELSDDHCQYFVYQTLRAIKALHSANVLHRDLKPSNLLLNASCDLKIC 161

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLAR  + + D N GFMTEYVATRWYRAPEIML+F+ YTKAIDMWS+GCI AEMLGG+
Sbjct: 162 DFGLARSAASTED-NFGFMTEYVATRWYRAPEIMLTFKEYTKAIDMWSIGCILAEMLGGR 220

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLF GRDY  QL  IL +LGTP  E    V S RA+ YI SLP    +PFSQL+PKANP 
Sbjct: 221 PLFPGRDYHSQLTMILDVLGTPTMEDYYSVKSRRAREYIRSLPFKKKLPFSQLFPKANPL 280

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHE----HMFDFSFESVEL-IE 235
                     F+PA RITVE+AL H YL  YHD +DEP  E      FDF     EL +E
Sbjct: 281 AIDLLEKLLTFNPAKRITVEEALVHPYLEQYHDADDEPTAEPIPDEFFDFDRNKDELSVE 340

Query: 236 DMKKMIAQEVMSFK 249
            +K +I  E+M +K
Sbjct: 341 QLKTLIYNEIMYWK 354



>gi|449546531|gb|EMD37500.1| hypothetical protein CERSUDRAFT_83240 [Ceriporiopsis subvermispora
           B]
          Length = 509

 Score =  304 bits (779), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 147/258 (56%), Positives = 176/258 (68%), Gaps = 9/258 (3%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLH IIRS Q LTD HFQ FIYQ   GLKYIHSA VLHRDLKP NLLVN DCELKIC
Sbjct: 105 MEADLHGIIRSGQSLTDQHFQSFIYQTLCGLKYIHSAGVLHRDLKPANLLVNEDCELKIC 164

Query: 61  DFGLARGFSDSPDHN---------AGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGC 111
           DFGLARG++     N          GFM++YVA RWYRAPE+MLSF+NY  A DMW++GC
Sbjct: 165 DFGLARGYNTCAVENIKRNNGRGPGGFMSDYVAMRWYRAPELMLSFENYGPATDMWALGC 224

Query: 112 IFAEMLGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFS 171
           I  E++ GKP+F+GRDYV QLN I+  LG+P EE+L RVGS  AQ YI SLP  P + FS
Sbjct: 225 ILGELIDGKPIFRGRDYVHQLNMIIDKLGSPSEESLERVGSPYAQDYIRSLPNRPRVSFS 284

Query: 172 QLYPKANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESV 231
            L+P ANP          +FDP  RIT   AL H Y A + D +D+P  +  F F FE+V
Sbjct: 285 MLFPNANPLALDLLDKLLQFDPRGRITCSDALDHPYFADWIDPKDQPVCDQPFGFEFENV 344

Query: 232 ELIEDMKKMIAQEVMSFK 249
           +  E++  +IA EV +F+
Sbjct: 345 DTKEELLHLIAMEVTNFR 362



>gi|321262114|ref|XP_003195776.1| MAP kinase [Cryptococcus gattii WM276]
 gi|317462250|gb|ADV23989.1| MAP kinase, putative [Cryptococcus gattii WM276]
          Length = 756

 Score =  303 bits (777), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 142/255 (55%), Positives = 183/255 (71%), Gaps = 6/255 (2%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLHQIIRS QPL + H Q+FIYQ+ RG+KYIHSANV+HRDLKPGNLLVN+DCELKIC
Sbjct: 281 MEADLHQIIRSGQPLGNDHIQFFIYQLLRGMKYIHSANVIHRDLKPGNLLVNSDCELKIC 340

Query: 61  DFGLARGFS----DSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEM 116
           DFGLARGF+    + P    G +TEYVATRWYRAPEIMLS + YT AID+WS+GCI AE+
Sbjct: 341 DFGLARGFNPVSGEEPQGEEGKLTEYVATRWYRAPEIMLSNRRYTTAIDVWSIGCILAEL 400

Query: 117 LGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPK 176
           LG KP+FKG+DY++Q+  IL  +GTPDEET+ RV SE+A +++ +LP         ++P 
Sbjct: 401 LGLKPMFKGKDYIEQMTLILETVGTPDEETMARVASEKALLFLKTLPTYEKKDLRSIFPD 460

Query: 177 ANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDF--SFESVELI 234
           A+P          +FD   RI V  AL H+Y+  YHD EDEP+ + +FD     ES+  I
Sbjct: 461 ADPLAVDLTDQLLEFDHTRRIDVPTALKHAYVEKYHDPEDEPSCDKIFDKWEEVESLRTI 520

Query: 235 EDMKKMIAQEVMSFK 249
           +++K  I +E+  F+
Sbjct: 521 DELKAAITREINEFR 535



>gi|392578872|gb|EIW71999.1| hypothetical protein TREMEDRAFT_24574, partial [Tremella
           mesenterica DSM 1558]
          Length = 497

 Score =  303 bits (776), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 143/252 (56%), Positives = 183/252 (72%), Gaps = 7/252 (2%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           MEADLHQI+RS Q L++ H QYF+YQ+ RG+KYIH+ANV+HRDLKPGNLLVN+DCELKIC
Sbjct: 103 MEADLHQIVRSGQALSNTHIQYFLYQLLRGMKYIHTANVIHRDLKPGNLLVNSDCELKIC 162

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARGF   P      +   VATRWYRAPEIMLS + YT AID+WS+GCI AE+LGGK
Sbjct: 163 DFGLARGFR--PGMMGTKLMTDVATRWYRAPEIMLSNERYTTAIDVWSIGCILAELLGGK 220

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLFKG+DYVDQLN ILG+LGTPD+ETL +V SE+A +YI SLP    +P  ++ P A+  
Sbjct: 221 PLFKGKDYVDQLNLILGVLGTPDDETLNKVASEKAAVYIRSLPYTRPVPLDEVLPGADSQ 280

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPA---HEHMFDFSFESVELIEDM 237
                     FDP+ RI V  AL+H Y+A YHD  DEP+    EH      ES++ + ++
Sbjct: 281 ALDLLSHFLTFDPSKRIDVTTALSHPYMAQYHDPTDEPSCPTFEHW--EQVESLDTLPEL 338

Query: 238 KKMIAQEVMSFK 249
           ++ I++++  F+
Sbjct: 339 REAISEQIRLFR 350



>gi|255080238|ref|XP_002503699.1| predicted protein [Micromonas sp. RCC299]
 gi|226518966|gb|ACO64957.1| predicted protein [Micromonas sp. RCC299]
          Length = 415

 Score =  301 bits (772), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 141/249 (56%), Positives = 183/249 (73%), Gaps = 6/249 (2%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           M+ DLHQIIRS QPL+D H QYFIYQ+ RGLKY+HSANVLHRDLKP NLL+NA+C+LKIC
Sbjct: 139 MDTDLHQIIRSNQPLSDDHCQYFIYQLLRGLKYVHSANVLHRDLKPSNLLLNANCDLKIC 198

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLAR   ++      FMTEYV TRWYRAPE++LS   YT AID+WSVGCIFAE+LG K
Sbjct: 199 DFGLARTGRETE-----FMTEYVVTRWYRAPELLLSCSEYTSAIDVWSVGCIFAELLGRK 253

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLF G+DYV QLN I  ++G+P EE +  + S++A+ YI SLP+ P + F ++YP+A P 
Sbjct: 254 PLFPGKDYVHQLNLIARVIGSPSEEEMEFITSDKARRYIRSLPRTPRVDFQKVYPEAEPD 313

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIED-MKK 239
                     FDPA+RITVE+AL+H YLA+ HD  DEP+    F+FSFE   + E+ +++
Sbjct: 314 AVDLIDKMLVFDPASRITVEEALSHPYLASLHDVSDEPSASGPFEFSFEGEAMTEERVRE 373

Query: 240 MIAQEVMSF 248
           ++  E+  +
Sbjct: 374 LVHAELTEY 382



>gi|260800250|ref|XP_002595047.1| hypothetical protein BRAFLDRAFT_84433 [Branchiostoma floridae]
 gi|229280288|gb|EEN51058.1| hypothetical protein BRAFLDRAFT_84433 [Branchiostoma floridae]
          Length = 381

 Score =  299 bits (766), Expect = 6e-79,   Method: Compositional matrix adjust.
 Identities = 142/252 (56%), Positives = 180/252 (71%), Gaps = 1/252 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME+DLH II S+Q LTD H +YF+YQI RGLKYIHSANVLHRDLKP NLLVN +CELKI 
Sbjct: 116 MESDLHHIIHSDQDLTDEHIRYFLYQILRGLKYIHSANVLHRDLKPSNLLVNENCELKIG 175

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFG+ARG S SP+    FMTEYVATRWYRAPE+MLS   YT AID+WSVGCIFAEMLG K
Sbjct: 176 DFGMARGVSSSPNDYKAFMTEYVATRWYRAPELMLSLNEYTFAIDVWSVGCIFAEMLGRK 235

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
            LF G++Y++QLN I+ +LGTP +  ++ V +ER + Y+S++PK   +P+S LYP+ +  
Sbjct: 236 QLFPGKNYLNQLNLIMSVLGTPPDSIIQSVTAERVRHYMSNIPKRRPVPWSVLYPQKSKE 295

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIED-MKK 239
                     F+P  RI+VE AL+H YL+ YHD +DEP     FDF FE   +  D +K+
Sbjct: 296 ALCLLSKMLNFNPKERISVEDALSHPYLSKYHDPDDEPICIPAFDFDFERRTMTRDQIKQ 355

Query: 240 MIAQEVMSFKAS 251
            I  E+  ++ S
Sbjct: 356 AILSEIDEYEKS 367



>gi|499050771|ref|XP_004575902.1| PREDICTED: mitogen-activated protein kinase 7-like [Maylandia
           zebra]
          Length = 1120

 Score =  299 bits (766), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 141/256 (55%), Positives = 179/256 (69%), Gaps = 1/256 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME+DLHQII S Q LT  H +YF+YQ+ RGLKY+HSANV+HRDLKP NLLVN +CELKI 
Sbjct: 154 MESDLHQIIHSAQTLTPEHTRYFLYQLLRGLKYVHSANVIHRDLKPSNLLVNENCELKIG 213

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFG+ARG S  P+ +  FMTEYVATRWYRAPE++LS  +Y+ AID+WSVGCIFAEMLG K
Sbjct: 214 DFGMARGLSSHPEESHSFMTEYVATRWYRAPELLLSLNHYSLAIDLWSVGCIFAEMLGRK 273

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
            LF G+ YV QL  IL +LGTP E  +    ++R + Y+ SLP    IP ++LYP+A P 
Sbjct: 274 QLFPGKHYVHQLQLILNVLGTPPEGLIGASRADRVRAYVQSLPSRSPIPLAKLYPQAEPE 333

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVEL-IEDMKK 239
                    +FDP  RI+V +AL H YLA YHD +DEP     FDF F+ ++L  E +K+
Sbjct: 334 ALDLLAAMLRFDPRQRISVTEALEHPYLAKYHDPDDEPICVPAFDFEFDKLQLNKEQIKE 393

Query: 240 MIAQEVMSFKASKQAA 255
            I  E+  F  +KQ++
Sbjct: 394 AILMEIQDFHRNKQSS 409



>gi|432924260|ref|XP_004080544.1| PREDICTED: mitogen-activated protein kinase 7-like [Oryzias
           latipes]
          Length = 851

 Score =  299 bits (765), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 141/255 (55%), Positives = 175/255 (68%), Gaps = 1/255 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME+DLHQII S Q LT  H +YF+YQ+ RGLKY+HSANV+HRDLKP NLLVN +CELKI 
Sbjct: 136 MESDLHQIIHSTQTLTPEHTRYFLYQLLRGLKYVHSANVIHRDLKPSNLLVNENCELKIG 195

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFG+ARG S  P+ +  FMTEYVATRWYRAPE++LS  +Y+ AID+WSVGCIFAEMLG K
Sbjct: 196 DFGMARGLSSHPEESYSFMTEYVATRWYRAPELLLSLNHYSLAIDLWSVGCIFAEMLGRK 255

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
            LF G+ YV QL  IL +LGTP E  +  + +ER + Y+ SLP    +P S+LYP+A P 
Sbjct: 256 QLFPGKHYVHQLQLILSVLGTPPEGLISAIRAERVRSYVQSLPSRTAVPLSKLYPQAEPD 315

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELI-EDMKK 239
                    +FDP  RI V +AL H YLA YHD +DEP     FDF F+ + +  E +K 
Sbjct: 316 ALDLLGAMLRFDPRQRIGVTEALEHPYLAKYHDPDDEPICVPAFDFEFDKIAMSKEQIKD 375

Query: 240 MIAQEVMSFKASKQA 254
            I  E+  F   KQ+
Sbjct: 376 AILMEIQDFHKKKQS 390



>gi|327278368|ref|XP_003223934.1| PREDICTED: mitogen-activated protein kinase 7-like [Anolis
           carolinensis]
          Length = 908

 Score =  298 bits (762), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 143/269 (53%), Positives = 181/269 (67%), Gaps = 4/269 (1%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME+DLHQII S QPLT  H +YF+YQ+ RGLKYIHSANV+HRDLKP NLL+N +CELKI 
Sbjct: 136 MESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYIHSANVIHRDLKPSNLLINENCELKIG 195

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFG+ARG    PD    FMTEYVATRWYRAPE+MLS   YT+AIDMWSVGCIFAEMLG K
Sbjct: 196 DFGMARGLCTKPDEYKYFMTEYVATRWYRAPELMLSLHEYTQAIDMWSVGCIFAEMLGRK 255

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
            LF G++Y+ QL  I+ +LGTP  + +  +G++R + YI SLP    +P+  LY  A+  
Sbjct: 256 QLFPGKNYIHQLQLIITVLGTPPAKVVHSIGADRVRAYIQSLPSRQPVPWETLYQNADRK 315

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELI-EDMKK 239
                    +FDP  RI+V +AL H +LA YHD +DEP     FDF F+   L  E +K+
Sbjct: 316 ALSLLSKMLRFDPRERISVVEALNHPFLAKYHDPDDEPNCVPAFDFDFDKQVLTKEQIKE 375

Query: 240 MIAQEVMSFKASKQAALGLNRQLGRKSSL 268
            I  E+  F   ++   G+ RQ+  K +L
Sbjct: 376 AIVAEINDFHERRE---GIRRQISFKPTL 401



>gi|47228192|emb|CAG07587.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 741

 Score =  298 bits (762), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 141/255 (55%), Positives = 175/255 (68%), Gaps = 1/255 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME+DLHQII S Q LT  H +YF+YQ+ RGLKY+HSANV+HRDLKP NLLVN +CELKI 
Sbjct: 139 MESDLHQIIHSAQTLTPEHTRYFLYQLLRGLKYVHSANVIHRDLKPSNLLVNENCELKIG 198

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFG+ARG S  P+    FMTEYVATRWYRAPE++LS  +Y+ AID+WSVGCIFAEMLG K
Sbjct: 199 DFGMARGLSSHPEDCRSFMTEYVATRWYRAPELLLSLNHYSLAIDLWSVGCIFAEMLGRK 258

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
            LF+G+ Y+ QL  IL +LGTP E  +  + S+R + Y+ SLP    +P S+LYP+A P 
Sbjct: 259 QLFRGKHYLHQLQLILSVLGTPPELLIGGITSDRVRSYVQSLPSRAAVPLSKLYPQAEPE 318

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELI-EDMKK 239
                     FDP  RI+V QAL H YLA YHD  DEP     FDF F+ + +  E +K+
Sbjct: 319 ALDLLAAMLHFDPRDRISVTQALEHPYLAKYHDPNDEPTCVPAFDFEFDKLSMSKEQIKE 378

Query: 240 MIAQEVMSFKASKQA 254
            I  E+  F  +KQ 
Sbjct: 379 AILIEIQDFHQTKQT 393



>gi|156382591|ref|XP_001632636.1| predicted protein [Nematostella vectensis]
 gi|156219695|gb|EDO40573.1| predicted protein [Nematostella vectensis]
          Length = 391

 Score =  296 bits (759), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 143/273 (52%), Positives = 183/273 (67%), Gaps = 9/273 (3%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME+DLH+II ++QPLT  H +YF+YQI RGLKYIHSA VLHRDLKP NLLVN + ELKI 
Sbjct: 108 MESDLHRIIHTDQPLTTEHVRYFLYQILRGLKYIHSAKVLHRDLKPSNLLVNENAELKIG 167

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFG+ARG   SP     FMTEYVATRWYRAPE+MLS   Y++AIDMWSVGCI AEM+G +
Sbjct: 168 DFGMARGLCSSPLEQKRFMTEYVATRWYRAPELMLSLNEYSEAIDMWSVGCILAEMIGRR 227

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLF G +Y++QL  IL + GTP +  + R+G+ER + Y++ LP    +PF + +PKA+P 
Sbjct: 228 PLFPGANYLNQLQMILSVTGTPSQNFIERMGAERVKTYLNQLPHKDPVPFEKFFPKAHPE 287

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELI-EDMKK 239
                    + DP  RITVE AL H +L  YH EEDEP      DF F++V +  E +K+
Sbjct: 288 AINLLSQMLQLDPKERITVENALQHPFLKEYHSEEDEPTCYSPLDFKFDTVLMTKEALKE 347

Query: 240 MIAQEVMSFKASKQAALGLNRQLGRKSSLSAPD 272
            I  E+  F+  K+ AL L+        L+ PD
Sbjct: 348 AIVNEIKDFQ--KKQALVLS------PVLTVPD 372



>gi|348686547|gb|EGZ26362.1| hypothetical protein PHYSODRAFT_312415 [Phytophthora sojae]
          Length = 456

 Score =  296 bits (758), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 141/247 (57%), Positives = 178/247 (72%), Gaps = 3/247 (1%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DLH+II S QPLTD H QYF+YQI R LKYIHSANVLHRDLKP NLL+N++C+LK+C
Sbjct: 174 METDLHRIIYSRQPLTDDHVQYFLYQILRALKYIHSANVLHRDLKPSNLLLNSNCDLKVC 233

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGL+RG +  P+ +   +TEYV TRWYRAPEIMLS + YTKAID+WS GCIFAE+LG  
Sbjct: 234 DFGLSRGVA--PEEDNMELTEYVVTRWYRAPEIMLSSREYTKAIDIWSTGCIFAELLGRT 291

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLF G DY+ QL  I   +GTP EE L  V SERA+ ++ + P  P +PF++L+PKA P 
Sbjct: 292 PLFPGDDYIHQLQIICDKIGTPCEEDLHFVVSERAKRFMKNQPMRPGVPFAKLFPKATPE 351

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIED-MKK 239
                     FDPA RI+VE+AL H YLA+ H+ EDEP  +  F F FE  +L E  +K+
Sbjct: 352 AIDLLQRMLVFDPAKRISVEEALEHPYLASLHNLEDEPVADSSFSFDFEKEDLTESRLKE 411

Query: 240 MIAQEVM 246
           +I +E++
Sbjct: 412 LIFEEIL 418



>gi|195997367|ref|XP_002108552.1| hypothetical protein TRIADDRAFT_814 [Trichoplax adhaerens]
 gi|190589328|gb|EDV29350.1| hypothetical protein TRIADDRAFT_814, partial [Trichoplax adhaerens]
          Length = 350

 Score =  296 bits (758), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 142/249 (57%), Positives = 175/249 (70%), Gaps = 1/249 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DLH II S+QPLT+ H Q+F+YQ+ RGLKYIHSANVLHRDLKP NLL+N++CELKI 
Sbjct: 102 METDLHHIIHSQQPLTNDHMQFFMYQLLRGLKYIHSANVLHRDLKPSNLLINSNCELKIG 161

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFG+AR  S S   +  +MTEYVATRWYRAPE+MLS Q YT+AIDMWSVGCIFAEMLG K
Sbjct: 162 DFGMARCISSSQIDHTTYMTEYVATRWYRAPELMLSLQGYTRAIDMWSVGCIFAEMLGRK 221

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
            LF G+ YV QL  I+G+LGTP  + L   G+ER + YI SLP+   I ++ L+P     
Sbjct: 222 QLFPGKTYVHQLRLIIGVLGTPCHQFLLSSGAERVRKYIDSLPQRQRIAWTVLFPSITEH 281

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIED-MKK 239
                    +FDP+ R+ VE+AL H YLA+ HD EDEP     FDF FE   L  + +K+
Sbjct: 282 ALTLLDQLLQFDPSQRLNVEEALLHPYLASLHDAEDEPVCTSSFDFDFEKNTLSSNALKE 341

Query: 240 MIAQEVMSF 248
           +I  E+ SF
Sbjct: 342 VIVDEIKSF 350



>gi|301103436|ref|XP_002900804.1| sporangia induced mitogen-activated protein kinase, putative
           [Phytophthora infestans T30-4]
 gi|262101559|gb|EEY59611.1| sporangia induced mitogen-activated protein kinase, putative
           [Phytophthora infestans T30-4]
          Length = 456

 Score =  296 bits (758), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 141/247 (57%), Positives = 178/247 (72%), Gaps = 3/247 (1%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DLH+II S QPLTD H QYF+YQI R LKYIHSANVLHRDLKP NLL+N++C+LK+C
Sbjct: 173 METDLHRIIYSRQPLTDDHVQYFLYQILRALKYIHSANVLHRDLKPSNLLLNSNCDLKVC 232

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGL+RG +  P+ +   +TEYV TRWYRAPEIMLS + YTKAID+WS GCIFAE+LG  
Sbjct: 233 DFGLSRGVT--PEEDNMELTEYVVTRWYRAPEIMLSSREYTKAIDIWSTGCIFAELLGRT 290

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLF G DY+ QL  I   +GTP EE L  V SERA+ ++ + P  P +PF++LYPKA+P 
Sbjct: 291 PLFPGDDYIHQLQIICDKIGTPCEEDLHFVVSERAKRFMKNQPMRPGVPFAKLYPKASPE 350

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIED-MKK 239
                     FDP  RI+VE+AL H YLA+ H+ EDEP  +  F F FE  +L E  +K+
Sbjct: 351 AMDLLQRMLVFDPVKRISVEEALEHPYLASLHNLEDEPVADSCFSFDFEKEDLTESRLKE 410

Query: 240 MIAQEVM 246
           +I +E++
Sbjct: 411 LIFEEIL 417



>gi|325188928|emb|CCA23457.1| sporangia induced mitogenactivated protein kinase pu [Albugo
           laibachii Nc14]
          Length = 458

 Score =  296 bits (757), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 141/249 (56%), Positives = 174/249 (69%), Gaps = 3/249 (1%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DLH+II S QPL+D H QYF+YQI R LKYIHSANVLHRDLKP NLL+N++C+LKIC
Sbjct: 157 METDLHRIIYSRQPLSDDHVQYFLYQILRALKYIHSANVLHRDLKPSNLLLNSNCDLKIC 216

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLARG    P+ +   +TEYV TRWYRAPEIMLS + YTKAID+WS GCIFAE++G K
Sbjct: 217 DFGLARGVE--PEADNMELTEYVVTRWYRAPEIMLSTKEYTKAIDIWSTGCIFAELMGRK 274

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLF G DY+ QL  I   LGTP EE L  V SE+A+ ++ S PK P IPF++++P   P 
Sbjct: 275 PLFPGDDYIHQLQIICDKLGTPTEEDLHFVTSEKARRFMKSQPKCPKIPFARVFPATKPT 334

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIED-MKK 239
                     FDP  RI+VE ALAH YL + H+EEDEP     F F FE   L +  +++
Sbjct: 335 AIDLLEKMLIFDPEKRISVEDALAHPYLESLHNEEDEPVAHEAFSFDFEKEALTKKRLQE 394

Query: 240 MIAQEVMSF 248
           +I +E+  F
Sbjct: 395 LILEEICRF 403



>gi|410079733|ref|XP_003957447.1| hypothetical protein KAFR_0E01580 [Kazachstania africana CBS 2517]
 gi|372464033|emb|CCF58312.1| hypothetical protein KAFR_0E01580 [Kazachstania africana CBS 2517]
          Length = 429

 Score =  295 bits (756), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 141/269 (52%), Positives = 182/269 (67%), Gaps = 4/269 (1%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ++ DLHQII+S+QPLTD+H+QYFIYQI   LKYIHSA VLHRDLKP N+L+N+DC+LKI 
Sbjct: 112 LDCDLHQIIQSKQPLTDSHYQYFIYQILCALKYIHSAGVLHRDLKPKNILINSDCQLKIA 171

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFG ARG+S  P  N  F+TEYVATRWYRAPEIML ++ Y  AID+WSVGCI AE+LGG 
Sbjct: 172 DFGFARGYSQDPVDNNQFLTEYVATRWYRAPEIMLGYKAYFTAIDVWSVGCILAELLGGT 231

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
            +F G DYVDQLN+IL +LG+P  +TLRR+GS   Q YI  L  +  IPF +++   +  
Sbjct: 232 AMFPGSDYVDQLNRILYVLGSPSVDTLRRIGSMNVQQYILQLGDIQKIPFKEIFTSGSIL 291

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP  RI+V+ AL H YL+ +HD++DEP      DFSFE ++ +  ++  
Sbjct: 292 AIDMLEKTLTFDPDQRISVDDALRHPYLSVWHDQDDEPQCPRGIDFSFERIDDLNVLRMA 351

Query: 241 IAQEVMSFKASKQAALGLNRQLGRKSSLS 269
           +  EV  F+   + A    R  G   SLS
Sbjct: 352 VVCEVNDFRQFAREA----RDEGEDQSLS 376



>gi|299745216|ref|XP_002910888.1| CMGC/MAPK protein kinase [Coprinopsis cinerea okayama7#130]
 gi|298406485|gb|EFI27394.1| CMGC/MAPK protein kinase [Coprinopsis cinerea okayama7#130]
          Length = 740

 Score =  295 bits (756), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 142/285 (49%), Positives = 194/285 (68%), Gaps = 13/285 (4%)

Query: 4   DLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKICDFG 63
           +++  + S Q LT+ H QYF+YQI RG+K+IHSA V+HRDLKPGNLLVNADCELKICDFG
Sbjct: 191 EIYIFMESGQVLTNEHVQYFLYQILRGMKFIHSAGVIHRDLKPGNLLVNADCELKICDFG 250

Query: 64  LARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSF-QNYTKA----------IDMWSVGCI 112
           L+RGF   PD NA  +TEYVATRWYRAPEIML+F ++Y  A          +D+WS+GCI
Sbjct: 251 LSRGFDAVPDENATRLTEYVATRWYRAPEIMLAFPKSYQLALNFLCLLGILVDVWSIGCI 310

Query: 113 FAEMLGGKPLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQ 172
             E+L GKPLFKG+DYVDQLN+IL ILG+PDE  ++++GS++AQ Y+ SLP   T+PF +
Sbjct: 311 LGELLLGKPLFKGKDYVDQLNKILDILGSPDETIIQKIGSDKAQAYVRSLPFRRTVPFRR 370

Query: 173 LYPKANPXXXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFD--FSFES 230
           + P ++P           FDP+TR+TV ++L H +LAAYHDE DEP     F+     E 
Sbjct: 371 VLPGSDPLALDLMAKMLSFDPSTRVTVLESLEHPWLAAYHDESDEPECSERFERWREIEK 430

Query: 231 VELIEDMKKMIAQEVMSFKASKQAALGLNRQLGRKSSLSAPDRDS 275
           +E ++D +K +  E+  ++   +  L +   L  K   +  +RD+
Sbjct: 431 LETLDDFRKALWDEIEDYRREVRGLLPVVDPLELKERDADKERDA 475



>gi|465953143|gb|EMP25250.1| Mitogen-activated protein kinase 7 [Chelonia mydas]
          Length = 664

 Score =  295 bits (754), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 142/266 (53%), Positives = 179/266 (67%), Gaps = 4/266 (1%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME+DLHQII S QPLT  H +YF+YQ+ RGLKYIHSANV+HRDLKP NLL+N +CELKI 
Sbjct: 115 MESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYIHSANVIHRDLKPSNLLINENCELKIG 174

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFG+ARG    PD    FMTEYVATRWYRAPE+MLS   YT+AIDMWSVGCIFAEMLG K
Sbjct: 175 DFGMARGLCTKPDEYKYFMTEYVATRWYRAPELMLSLHEYTQAIDMWSVGCIFAEMLGRK 234

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
            LF G++Y+ QL  I+ +LGTP  + +  +G++R + YI SLP    +P+  LY +A+  
Sbjct: 235 QLFPGKNYIHQLQLIMTVLGTPSAKVIHAIGADRVRAYIQSLPSRQPVPWENLYQQADRS 294

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELI-EDMKK 239
                     FDP  RI V +AL H ++A YHD +DEP     FDF F+   L  E +K+
Sbjct: 295 ALALLAKMLHFDPRERIAVAEALKHPFVAKYHDPDDEPDCVPAFDFDFDKQVLTKERIKE 354

Query: 240 MIAQEVMSFKASKQAALGLNRQLGRK 265
            I  E+  F A ++   G+ RQ+  K
Sbjct: 355 AIVAEIRDFHARRE---GIRRQISFK 377



>gi|470322770|ref|XP_004349328.1| extracellular signal-regulated protein kinase [Capsaspora
           owczarzaki ATCC 30864]
 gi|320167654|gb|EFW44553.1| extracellular signal-regulated protein kinase [Capsaspora
           owczarzaki ATCC 30864]
          Length = 434

 Score =  295 bits (754), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 139/249 (55%), Positives = 178/249 (71%), Gaps = 1/249 (0%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ++ DLHQII S Q LTD H QYF+YQI RGLKYIHSA VLHRDLKP NLL+N +C+LKIC
Sbjct: 122 LDTDLHQIIGSPQQLTDDHCQYFLYQILRGLKYIHSAGVLHRDLKPSNLLLNGNCDLKIC 181

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLAR         AGFMTEYVATRWYRAPEIMLS++ YTKAIDMWSVGCIFAE+LG +
Sbjct: 182 DFGLARVAQAGDASAAGFMTEYVATRWYRAPEIMLSWREYTKAIDMWSVGCIFAELLGRR 241

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLF G+D++ QL+ I  +LG+P  + +  + +++A+ ++  LP  P IPF  +YP ANP 
Sbjct: 242 PLFPGKDFLHQLSLITDVLGSPSNDDIAGISNDKARRFVRQLPAKPRIPFQTIYPNANPI 301

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIED-MKK 239
                     F+P  RI+VE+ALAH YLA  HD  DEP     F+F FE+  L ++ +K+
Sbjct: 302 ALDLLQRFLMFNPDNRISVEEALAHPYLAPLHDPADEPTCHSTFNFDFENRPLTKEIIKE 361

Query: 240 MIAQEVMSF 248
           +  QE+++F
Sbjct: 362 LTFQEMLAF 370



>gi|401838088|gb|EJT41875.1| KDX1-like protein [Saccharomyces kudriavzevii IFO 1802]
          Length = 508

 Score =  294 bits (753), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 137/249 (55%), Positives = 175/249 (70%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DL QI+RS Q L D+H+Q FIYQ    LKYIHSA VLH DLKP NLLVN+DC+LK+C
Sbjct: 111 MECDLSQILRSGQHLEDSHYQSFIYQTLCALKYIHSAGVLHGDLKPKNLLVNSDCQLKVC 170

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           +FGL+RG S+  + N  F TE+VA+R Y APEIMLS Q YTKA+D+WS GCI AE+LGGK
Sbjct: 171 NFGLSRGCSEDYEENNHFTTEFVASRCYIAPEIMLSHQGYTKAVDVWSTGCILAELLGGK 230

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLF G+DYVDQLN IL ILGTP +E L+ +GS++ Q YI     +P  PF  + PKANP 
Sbjct: 231 PLFDGKDYVDQLNNILQILGTPSKEMLQEIGSQKIQSYILLFGHIPGTPFESILPKANPK 290

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                    +FDP  RI V++AL H +L+ +HD +DEP+ E  F F FE +  +E+++  
Sbjct: 291 GLDLLKKMLEFDPKQRIVVDEALKHPFLSVWHDIDDEPSCEKTFAFEFEHISNMEELQSQ 350

Query: 241 IAQEVMSFK 249
           + +EV  FK
Sbjct: 351 VTREVSDFK 359



>gi|168048183|ref|XP_001776547.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162672138|gb|EDQ58680.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 368

 Score =  294 bits (752), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 145/255 (56%), Positives = 173/255 (67%), Gaps = 4/255 (1%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           M+ DLHQIIRS Q LTD H QYFIYQ+ RGLKY+HSANVLHRDLKP NLL+NA C+LKIC
Sbjct: 116 MDTDLHQIIRSSQTLTDDHCQYFIYQLLRGLKYVHSANVLHRDLKPSNLLLNASCDLKIC 175

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLAR  SD       FMTEYV TRWYRAPE++LS   YT AIDMWSVGCIFAE+LG K
Sbjct: 176 DFGLARTGSD----KGQFMTEYVVTRWYRAPELLLSCDEYTSAIDMWSVGCIFAELLGRK 231

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLF G+DY+ QL  I+ I+G+PDE  L  + S++A+ YI SLP  P +  ++LYP+ANP 
Sbjct: 232 PLFPGKDYIHQLKLIISIIGSPDETDLHFIQSQKARSYIRSLPFTPRVSLARLYPRANPL 291

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHMFDFSFESVELIEDMKKM 240
                     FDP  RITV +AL H YL+  HD   EP+    F+F FE  +L ED  + 
Sbjct: 292 AIQLIDKMLVFDPRKRITVHEALEHPYLSMLHDATVEPSAPAPFEFDFEDEDLKEDALRE 351

Query: 241 IAQEVMSFKASKQAA 255
                M F   + AA
Sbjct: 352 RVWNEMLFYHPEAAA 366



>gi|190347165|gb|EDK39391.2| extracellular signal-regulated kinase 1 [Meyerozyma guilliermondii
           ATCC 6260]
          Length = 357

 Score =  293 bits (751), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 146/251 (58%), Positives = 179/251 (71%), Gaps = 7/251 (2%)

Query: 1   MEADLHQIIRSEQPLTDAHFQYFIYQICRGLKYIHSANVLHRDLKPGNLLVNADCELKIC 60
           ME DLH++IR+ Q L+D H QYFIYQ  R LK +H+ANVLHRDLKP NLL+N++C+LKIC
Sbjct: 106 METDLHRVIRT-QKLSDDHVQYFIYQTLRALKAMHAANVLHRDLKPSNLLLNSNCDLKIC 164

Query: 61  DFGLARGFSDSPDHNAGFMTEYVATRWYRAPEIMLSFQNYTKAIDMWSVGCIFAEMLGGK 120
           DFGLAR  + + D N GFMTEYVATRWYRAPEIML+F  YT AID+WSVGCI AEML G+
Sbjct: 165 DFGLARSVASTED-NFGFMTEYVATRWYRAPEIMLTFSEYTTAIDVWSVGCILAEMLTGR 223

Query: 121 PLFKGRDYVDQLNQILGILGTPDEETLRRVGSERAQIYISSLPKMPTIPFSQLYPKANPX 180
           PLF GRDY +QL  I+ +LGTP+ E    + S+RA+ YI SLP    IPF++L+  ANP 
Sbjct: 224 PLFPGRDYHNQLWLIMEVLGTPNMEDYYNIKSKRAREYIRSLPFCKKIPFNELFANANPL 283

Query: 181 XXXXXXXXXKFDPATRITVEQALAHSYLAAYHDEEDEPAHEHM----FDFSFESVEL-IE 235
                     F+PA RITVE AL H YL  YHD  DEP+ E +    FDF     EL IE
Sbjct: 284 AVDLLEKLLIFNPAKRITVEDALDHPYLKLYHDPTDEPSAEKIPDDFFDFDRRKDELTIE 343

Query: 236 DMKKMIAQEVM 246
           D+KK++ +E+M
Sbjct: 344 DLKKLLYEEIM 354