BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10222_c0_seq1-m.87 5prime_partial 66-728(-) 221 (-)
         (220 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|340371521|ref|XP_003384294.1| PREDICTED: nmrA-like family dom...   118   1e-24   Amphimedon queenslandica
gi|290974188|ref|XP_002669828.1| predicted protein [Naegleria gr...   103   3e-20   Naegleria gruberi strain NEG-M
gi|395536445|ref|XP_003770227.1| PREDICTED: nmrA-like family dom...   103   4e-20   Sarcophilus harrisii
gi|46250145|gb|AAH68857.1| LOC414512 protein, partial [Xenopus l...   101   1e-19   Xenopus laevis [clawed frog]
gi|507927735|ref|XP_004675122.1| PREDICTED: nmrA-like family dom...   101   1e-19   Condylura cristata
gi|62858755|ref|NP_001016962.1| NmrA-like family domain containi...   101   2e-19   Xenopus tropicalis [western clawed frog]
gi|322695956|gb|EFY87756.1| NmrA family transcriptional regulato...   100   2e-19   Metarhizium acridum CQMa 102
gi|165971552|gb|AAI58423.1| hypothetical protein LOC549716 [Xeno...   100   3e-19   Xenopus tropicalis [western clawed frog]
gi|471574808|gb|EMR72564.1| putative nitrogen metabolite repress...   100   4e-19   Eutypa lata UCREL1
gi|290974041|ref|XP_002669755.1| predicted protein [Naegleria gr...   100   4e-19   Naegleria gruberi strain NEG-M
gi|344239812|gb|EGV95915.1| NmrA-like family domain-containing p...    99   6e-19   Cricetulus griseus [Chinese hamsters]
gi|354484190|ref|XP_003504273.1| PREDICTED: nmrA-like family dom...    99   6e-19   Cricetulus griseus [Chinese hamsters]
gi|66802414|ref|XP_629989.1| hypothetical protein DDB_G0291732 [...    99   7e-19   Dictyostelium discoideum AX4
gi|46125639|ref|XP_387373.1| hypothetical protein FG07197.1 [Fus...    98   2e-18   
gi|391870023|gb|EIT79211.1| HSCARG dehydrogenase [Aspergillus or...    98   2e-18   Aspergillus oryzae 3.042
gi|169764371|ref|XP_001816657.1| HSCARG dehydrogenase [Aspergill...    97   2e-18   Aspergillus oryzae RIB40
gi|238504394|ref|XP_002383428.1| hscarg dehydrogenase, putative ...    97   2e-18   Aspergillus flavus NRRL3357
gi|345329630|ref|XP_003431399.1| PREDICTED: nmrA-like family dom...    97   2e-18   
gi|334324936|ref|XP_001377212.2| PREDICTED: nmrA-like family dom...    97   4e-18   Monodelphis domestica
gi|408397492|gb|EKJ76634.1| hypothetical protein FPSE_03184 [Fus...    96   4e-18   Fusarium pseudograminearum CS3096
gi|322712044|gb|EFZ03617.1| NmrA family transcriptional regulato...    96   5e-18   Metarhizium robertsii ARSEF 23
gi|505779476|ref|XP_004603319.1| PREDICTED: nmrA-like family dom...    96   6e-18   Sorex araneus [Eurasian shrew]
gi|470505372|ref|XP_004348563.1| NmrAlike family protein [Acanth...    96   7e-18   Acanthamoeba castellanii str. Neff
gi|212541022|ref|XP_002150666.1| conserved hypothetical protein ...    96   7e-18   Talaromyces marneffei ATCC 18224
gi|189209193|ref|XP_001940929.1| conserved hypothetical protein ...    96   7e-18   Pyrenophora tritici-repentis Pt-1C-BFP
gi|149641722|ref|XP_001507495.1| PREDICTED: nmrA-like family dom...    96   8e-18   Ornithorhynchus anatinus [duck-billed platypus]
gi|410985286|ref|XP_003998954.1| PREDICTED: nmrA-like family dom...    96   8e-18   
gi|3549877|emb|CAA75863.1| nitrogen metabolite repression-(nmr)-...    95   1e-17   Fusarium fujikuroi
gi|395515479|ref|XP_003761931.1| PREDICTED: nmrA-like family dom...    95   1e-17   Sarcophilus harrisii
gi|66827991|ref|XP_647350.1| hypothetical protein DDB_G0267842 [...    95   1e-17   Dictyostelium discoideum AX4
gi|507693672|ref|XP_004713526.1| PREDICTED: nmrA-like family dom...    95   1e-17   Echinops telfairi [lesser hedgehog tenrec]
gi|410985288|ref|XP_003998955.1| PREDICTED: nmrA-like family dom...    95   1e-17   
gi|342875982|gb|EGU77647.1| hypothetical protein FOXB_11822 [Fus...    95   1e-17   Fusarium oxysporum Fo5176
gi|378728761|gb|EHY55220.1| nitrogen metabolite repression prote...    95   1e-17   Exophiala dermatitidis NIH/UT8656
gi|301778463|ref|XP_002924639.1| PREDICTED: nmrA-like family dom...    94   2e-17   Ailuropoda melanoleuca
gi|302911095|ref|XP_003050417.1| predicted protein [Nectria haem...    94   2e-17   Nectria haematococca mpVI 77-13-4
gi|281353427|gb|EFB29011.1| hypothetical protein PANDA_014027 [A...    94   2e-17   Ailuropoda melanoleuca
gi|511958889|ref|XP_004797694.1| PREDICTED: nmrA-like family dom...    94   2e-17   
gi|302915298|ref|XP_003051460.1| hypothetical protein NECHADRAFT...    94   3e-17   Nectria haematococca mpVI 77-13-4
gi|291412075|ref|XP_002722308.1| PREDICTED: NmrA-like family dom...    94   3e-17   
gi|330928645|ref|XP_003302345.1| hypothetical protein PTT_14119 ...    94   3e-17   Pyrenophora teres f. teres 0-1
gi|511852737|ref|XP_004750567.1| PREDICTED: nmrA-like family dom...    93   4e-17   
gi|291400293|ref|XP_002716397.1| PREDICTED: hCG2041270-like [Ory...    93   4e-17   
gi|402860727|ref|XP_003894774.1| PREDICTED: nmrA-like family dom...    93   4e-17   
gi|471365464|ref|XP_004373273.1| PREDICTED: nmrA-like family dom...    93   5e-17   Trichechus manatus latirostris
gi|472367533|ref|XP_004403299.1| PREDICTED: nmrA-like family dom...    93   5e-17   Odobenus rosmarus divergens
gi|116251023|ref|YP_766861.1| nitrogen metabolite repression reg...    92   6e-17   
gi|396498104|ref|XP_003845138.1| similar to nitrogen metabolite ...    92   6e-17   Leptosphaeria maculans JN3
gi|66820416|ref|XP_643826.1| hypothetical protein DDB_G0275053 [...    92   8e-17   Dictyostelium discoideum AX4
gi|126335245|ref|XP_001369286.1| PREDICTED: nmrA-like family dom...    92   1e-16   Monodelphis domestica
gi|330919958|ref|XP_003298831.1| hypothetical protein PTT_09651 ...    92   1e-16   Pyrenophora teres f. teres 0-1
gi|209548370|ref|YP_002280287.1| NmrA family protein [Rhizobium ...    92   1e-16   
gi|403270480|ref|XP_003927206.1| PREDICTED: nmrA-like family dom...    92   1e-16   
gi|194222670|ref|XP_001497893.2| PREDICTED: nmrA-like family dom...    91   1e-16   
gi|507536501|ref|XP_004652283.1| PREDICTED: nmrA-like family dom...    91   2e-16   Jaculus jaculus
gi|495089609|ref|WP_007814432.1| NmrA-like family protein [Rhizo...    91   2e-16   Rhizobium sp. CF142
gi|126314450|ref|XP_001377245.1| PREDICTED: nmrA-like family dom...    91   2e-16   Monodelphis domestica
gi|57088489|ref|XP_547146.1| PREDICTED: NmrA-like family domain ...    91   2e-16   
gi|348584864|ref|XP_003478192.1| PREDICTED: LOW QUALITY PROTEIN:...    91   3e-16   Cavia porcellus [guinea pig]
gi|296224516|ref|XP_002758025.1| PREDICTED: nmrA-like family dom...    91   3e-16   Callithrix jacchus [common marmoset]
gi|451999959|gb|EMD92421.1| hypothetical protein COCHEDRAFT_1021...    90   3e-16   Bipolaris maydis C5
gi|451854041|gb|EMD67334.1| hypothetical protein COCSADRAFT_8348...    90   3e-16   Bipolaris sorokiniana ND90Pr
gi|330805814|ref|XP_003290872.1| hypothetical protein DICPUDRAFT...    90   4e-16   Dictyostelium purpureum
gi|395839821|ref|XP_003792774.1| PREDICTED: nmrA-like family dom...    90   4e-16   
gi|494825896|gb|EON63026.1| hypothetical protein W97_02252 [Coni...    90   4e-16   Coniosporium apollinis CBS 100218
gi|115496758|ref|NP_001069500.1| nmrA-like family domain-contain...    90   5e-16   Bos taurus [bovine]
gi|345560444|gb|EGX43569.1| hypothetical protein AOL_s00215g305 ...    90   5e-16   Arthrobotrys oligospora ATCC 24927
gi|332240202|ref|XP_003269279.1| PREDICTED: nmrA-like family dom...    90   5e-16   
gi|504129500|ref|XP_004577778.1| PREDICTED: nmrA-like family dom...    90   5e-16   Ochotona princeps [southern American pika]
gi|497679854|ref|WP_009994038.1| hypothetical protein [Rhizobium...    89   6e-16   
gi|242810577|ref|XP_002485609.1| NmrA family transcriptional reg...    89   7e-16   Talaromyces stipitatus ATCC 10500
gi|395836067|ref|XP_003790990.1| PREDICTED: nmrA-like family dom...    89   7e-16   Otolemur garnettii
gi|507659588|ref|XP_004705894.1| PREDICTED: nmrA-like family dom...    89   8e-16   Echinops telfairi [lesser hedgehog tenrec]
gi|482807059|gb|EOA84111.1| hypothetical protein SETTUDRAFT_9274...    89   9e-16   Setosphaeria turcica Et28A
gi|497745513|ref|WP_010059697.1| hypothetical protein [Rhizobium...    89   9e-16   
gi|399171477|emb|CCE27667.1| probable nitrogen metabolic regulat...    89   1e-15   Claviceps purpurea 20.1
gi|294656995|ref|XP_002770363.1| DEHA2D19008p [Debaryomyces hans...    89   1e-15   Debaryomyces hansenii CBS767
gi|488558962|ref|XP_004469734.1| PREDICTED: nmrA-like family dom...    88   1e-15   Dasypus novemcinctus
gi|507631176|ref|XP_004627865.1| PREDICTED: LOW QUALITY PROTEIN:...    88   1e-15   
gi|489676114|ref|WP_003580354.1| putative nucleoside-diphosphate...    88   1e-15   
gi|444731765|gb|ELW72111.1| NmrA-like family domain-containing p...    88   1e-15   Tupaia chinensis
gi|488520611|ref|XP_004452237.1| PREDICTED: nmrA-like family dom...    88   1e-15   Dasypus novemcinctus
gi|109042319|ref|XP_001093249.1| PREDICTED: nmrA-like family dom...    88   1e-15   Macaca mulatta [rhesus macaque]
gi|504149427|ref|XP_004587118.1| PREDICTED: nmrA-like family dom...    88   1e-15   
gi|440912637|gb|ELR62191.1| NmrA-like family domain-containing p...    88   1e-15   Bos mutus
gi|489641944|ref|WP_003546384.1| putative nucleoside-diphosphate...    88   2e-15   Rhizobium leguminosarum
gi|226371956|gb|ACO51603.1| NmrA-like family domain-containing p...    88   2e-15   Rana catesbeiana [bullfrog]
gi|297672687|ref|XP_002814420.1| PREDICTED: nmrA-like family dom...    88   2e-15   Pongo abelii [Orang-utan]
gi|86356765|ref|YP_468657.1| hypothetical protein RHE_CH01123 [R...    87   2e-15   
gi|169624477|ref|XP_001805644.1| hypothetical protein SNOG_15498...    87   2e-15   Parastagonospora nodorum SN15
gi|441633664|ref|XP_003256326.2| PREDICTED: nmrA-like family dom...    87   2e-15   
gi|477517466|gb|ENH69715.1| NmrA-like family domain-containing p...    87   3e-15   Fusarium oxysporum f. sp. cubense race 1
gi|410037905|ref|XP_001152180.2| PREDICTED: uncharacterized prot...    87   3e-15   
gi|340522309|gb|EGR52542.1| predicted protein [Trichoderma reese...    87   3e-15   Trichoderma reesei QM6a
gi|224069691|ref|XP_002194655.1| PREDICTED: nmrA-like family dom...    87   4e-15   
gi|426254256|ref|XP_004020795.1| PREDICTED: nmrA-like family dom...    87   4e-15   Ovis aries [domestic sheep]
gi|212534836|ref|XP_002147574.1| nitrogen metabolite repression ...    86   4e-15   Talaromyces marneffei ATCC 18224
gi|432111565|gb|ELK34679.1| NmrA-like family domain-containing p...    86   5e-15   Myotis davidii
gi|342883538|gb|EGU84001.1| hypothetical protein FOXB_05421 [Fus...    86   5e-15   Fusarium oxysporum Fo5176
gi|483500127|gb|EOA94652.1| NmrA-like family domain-containing p...    86   6e-15   Anas platyrhynchos [duck]
gi|145242376|ref|XP_001393804.1| nitrogen metabolite repression ...    86   6e-15   Aspergillus niger CBS 513.88
gi|395747444|ref|XP_002826140.2| PREDICTED: nmrA-like family dom...    86   6e-15   
gi|358371764|dbj|GAA88371.1| nitrogen metabolite repression regu...    86   6e-15   Aspergillus kawachii IFO 4308
gi|115437748|ref|XP_001217889.1| nitrogen metabolic regulation p...    86   6e-15   Aspergillus terreus NIH2624
gi|466011182|ref|XP_004270275.1| PREDICTED: nmrA-like family dom...    86   7e-15   Orcinus orca [Orca]
gi|358401383|gb|EHK50689.1| hypothetical protein TRIATDRAFT_2970...    86   7e-15   Trichoderma atroviride IMI 206040
gi|344249492|gb|EGW05596.1| NmrA-like family domain-containing p...    86   8e-15   Cricetulus griseus [Chinese hamsters]
gi|440226668|ref|YP_007333759.1| hypothetical protein RTCIAT899_...    86   8e-15   
gi|478527980|ref|XP_004438170.1| PREDICTED: nmrA-like family dom...    86   8e-15   Ceratotherium simum simum [southern square-lipped rhinoceros]
gi|260829035|ref|XP_002609468.1| hypothetical protein BRAFLDRAFT...    86   9e-15   Branchiostoma floridae
gi|254839199|pdb|2WMD|A Chain A, Crystal Structure Of Nmra-Like ...    86   1e-14   Homo sapiens [man]
gi|119183009|ref|XP_001242591.1| hypothetical protein CIMG_06487...    86   1e-14   Coccidioides immitis RS
gi|190890817|ref|YP_001977359.1| hypothetical protein RHECIAT_CH...    85   1e-14   
gi|237640501|pdb|3DXF|A Chain A, Crystal Structure Of The Hscarg...    85   1e-14   Homo sapiens [man]
gi|119598609|gb|EAW78203.1| hCG2041270 [Homo sapiens]                  85   1e-14   Homo sapiens [man]
gi|403273446|ref|XP_003928526.1| PREDICTED: nmrA-like family dom...    85   1e-14   Saimiri boliviensis boliviensis
gi|472245751|gb|EMR90312.1| putative hscarg dehydrogenase protei...    85   1e-14   Botrytis cinerea BcDW1
gi|10190720|ref|NP_065728.1| nmrA-like family domain-containing ...    85   1e-14   Homo sapiens [man]
gi|470594557|ref|XP_004310400.1| PREDICTED: nmrA-like family dom...    85   1e-14   Tursiops truncatus [Atlantic bottle-nosed dolphin]
gi|350581768|ref|XP_003124684.3| PREDICTED: nmrA-like family dom...    85   1e-14   
gi|71897147|ref|NP_001025816.1| nmrA-like family domain-containi...    85   1e-14   Gallus gallus [bantam]
gi|397470086|ref|XP_003806664.1| PREDICTED: nmrA-like family dom...    85   1e-14   Pan paniscus [bonobo]
gi|119389384|pdb|2EXX|A Chain A, Crystal Structure Of Hscarg Fro...    85   1e-14   Homo sapiens [man]
gi|489665303|ref|WP_003569594.1| putative nucleoside-diphosphate...    85   1e-14   Rhizobium leguminosarum
gi|354488479|ref|XP_003506396.1| PREDICTED: LOW QUALITY PROTEIN:...    85   1e-14   
gi|237640509|pdb|3E5M|A Chain A, Crystal Structure Of The Hscarg...    85   1e-14   Homo sapiens [man]
gi|322701216|gb|EFY92966.1| nitrogen metabolite repression-(nmr)...    85   1e-14   Metarhizium acridum CQMa 102
gi|241203614|ref|YP_002974710.1| NmrA family protein [Rhizobium ...    85   1e-14   
gi|431906585|gb|ELK10706.1| NmrA-like family domain-containing p...    85   1e-14   Pteropus alecto
gi|489683671|ref|WP_003587893.1| putative nucleoside-diphosphate...    85   1e-14   Rhizobium leguminosarum
gi|119605708|gb|EAW85302.1| HSCARG protein, isoform CRA_b [Homo ...    85   1e-14   Homo sapiens [man]
gi|367038797|ref|XP_003649779.1| hypothetical protein THITE_2108...    85   1e-14   Thielavia terrestris NRRL 8126
gi|378775866|ref|YP_005191373.1| NmrA-like family domain-contain...    85   1e-14   
gi|242791315|ref|XP_002481733.1| nitrogen metabolite repression ...    85   1e-14   Talaromyces stipitatus ATCC 10500
gi|402907521|ref|XP_003919629.1| PREDICTED: LOW QUALITY PROTEIN:...    85   2e-14   
gi|300797607|ref|NP_001178517.1| nmrA-like family domain-contain...    85   2e-14   Rattus norvegicus [brown rat]
gi|355709924|gb|EHH31388.1| NmrA-like family domain-containing p...    85   2e-14   Macaca mulatta [rhesus macaque]
gi|493750259|ref|WP_006699215.1| NmrA-like family domain-contain...    85   2e-14   
gi|322703483|gb|EFY95091.1| nitrogen metabolite repression-(nmr)...    85   2e-14   Metarhizium robertsii ARSEF 23
gi|388490430|ref|NP_001252614.1| nmrA-like family domain-contain...    84   2e-14   Macaca mulatta [rhesus macaque]
gi|310794371|gb|EFQ29832.1| NmrA-like family protein [Glomerella...    84   2e-14   Colletotrichum graminicola M1.001
gi|466084988|ref|XP_004285420.1| PREDICTED: nmrA-like family dom...    84   2e-14   Orcinus orca [Orca]
gi|296219478|ref|XP_002755897.1| PREDICTED: nmrA-like family dom...    84   2e-14   
gi|149751156|ref|XP_001502359.1| PREDICTED: nmrA-like family dom...    84   3e-14   Equus caballus [domestic horse]
gi|375146506|ref|YP_005008947.1| NmrA family protein [Niastella ...    84   3e-14   
gi|212536955|ref|XP_002148633.1| NmrA family transcriptional reg...    84   3e-14   Talaromyces marneffei ATCC 18224
gi|154285214|ref|XP_001543402.1| hypothetical protein HCAG_00448...    84   3e-14   Histoplasma capsulatum NAm1
gi|281212082|gb|EFA86243.1| hypothetical protein PPL_00805 [Poly...    84   3e-14   Polysphondylium pallidum PN500
gi|119498963|ref|XP_001266239.1| nitrogen metabolite repression ...    84   3e-14   Aspergillus fischeri NRRL 181
gi|24431937|ref|NP_080669.1| nmrA-like family domain-containing ...    83   4e-14   Mus musculus [mouse]
gi|410049940|ref|XP_001173760.3| PREDICTED: NmrA-like family dom...    83   4e-14   
gi|121718933|ref|XP_001276238.1| nitrogen metabolite repression ...    83   4e-14   Aspergillus clavatus NRRL 1
gi|505783607|ref|XP_004604206.1| PREDICTED: nmrA-like family dom...    83   5e-14   Sorex araneus [Eurasian shrew]
gi|70985090|ref|XP_748051.1| nitrogen metabolite repression regu...    83   5e-14   Aspergillus fumigatus Af293
gi|490807390|ref|WP_004669512.1| hypothetical protein [Rhizobium...    83   5e-14   Rhizobium etli
gi|154297931|ref|XP_001549390.1| hypothetical protein BC1G_12118...    83   6e-14   Botrytis cinerea B05.10
gi|493776993|ref|WP_006725449.1| NmrA-like family domain-contain...    83   6e-14   Agrobacterium albertimagni
gi|261202656|ref|XP_002628542.1| nitrogen metabolic regulation p...    83   6e-14   Blastomyces gilchristii SLH14081
gi|159126026|gb|EDP51142.1| nitrogen metabolite repression regul...    82   6e-14   Aspergillus fumigatus A1163
gi|327357042|gb|EGE85899.1| nitrogen metabolic regulation protei...    82   6e-14   Blastomyces dermatitidis ATCC 18188
gi|500257872|gb|EOO00950.1| putative hscarg dehydrogenase protei...    82   6e-14   Phaeoacremonium minimum UCRPA7
gi|470485860|ref|XP_004344216.1| NmrA family protein [Acanthamoe...    82   7e-14   Acanthamoeba castellanii str. Neff
gi|169767944|ref|XP_001818443.1| nmrA family transcriptional reg...    82   8e-14   Aspergillus oryzae RIB40
gi|470525021|ref|XP_004356557.1| NmrAlike family protein [Acanth...    82   1e-13   Acanthamoeba castellanii str. Neff
gi|485921174|gb|EOD46964.1| putative nitrogen metabolite repress...    82   1e-13   Neofusicoccum parvum UCRNP2
gi|397488298|ref|XP_003815205.1| PREDICTED: nmrA-like family dom...    82   1e-13   
gi|347829097|emb|CCD44794.1| similar to NmrA-like family domain-...    81   1e-13   Botrytis cinerea T4
gi|212546087|ref|XP_002153197.1| hscarg dehydrogenase, putative ...    81   1e-13   Talaromyces marneffei ATCC 18224
gi|340914867|gb|EGS18208.1| hypothetical protein CTHT_0062230 [C...    81   1e-13   Chaetomium thermophilum var. thermophilum DSM 1495
gi|326929331|ref|XP_003210820.1| PREDICTED: nmrA-like family dom...    81   2e-13   
gi|489877055|ref|WP_003780550.1| NmrA family protein [Actinomyce...    81   2e-13   Actinomyces naeslundii
gi|302693148|ref|XP_003036253.1| hypothetical protein SCHCODRAFT...    81   2e-13   Schizophyllum commune H4-8
gi|115400225|ref|XP_001215701.1| conserved hypothetical protein ...    81   2e-13   Aspergillus terreus NIH2624
gi|242763533|ref|XP_002340593.1| hscarg dehydrogenase, putative ...    81   2e-13   Talaromyces stipitatus ATCC 10500
gi|169610335|ref|XP_001798586.1| hypothetical protein SNOG_08267...    81   2e-13   Parastagonospora nodorum SN15
gi|67536876|ref|XP_662212.1| hypothetical protein AN4608.2 [Aspe...    81   2e-13   Aspergillus nidulans FGSC A4
gi|67902362|ref|XP_681437.1| hypothetical protein AN8168.2 [Aspe...    80   3e-13   Aspergillus nidulans FGSC A4
gi|490845980|ref|WP_004708043.1| NmrA family protein [Yersinia f...    80   4e-13   Yersinia frederiksenii
gi|58177341|pdb|1XGK|A Chain A, Crystal Structure Of N12g And A1...    80   4e-13   Aspergillus nidulans
gi|255955831|ref|XP_002568668.1| Pc21g16620 [Penicillium chrysog...    80   4e-13   Penicillium rubens Wisconsin 54-1255
gi|3015626|gb|AAC39442.1| nitrogen metabolite repression regulat...    80   4e-13   Aspergillus nidulans
gi|358389691|gb|EHK27283.1| hypothetical protein TRIVIDRAFT_1760...    80   4e-13   Trichoderma virens Gv29-8
gi|367025783|ref|XP_003662176.1| hypothetical protein MYCTH_2302...    80   4e-13   Myceliophthora thermophila ATCC 42464
gi|507974714|ref|XP_004691836.1| PREDICTED: nmrA-like family dom...    80   5e-13   
gi|489653170|ref|WP_003557550.1| putative nucleoside-diphosphate...    79   6e-13   
gi|346974233|gb|EGY17685.1| nitrogen metabolic regulation protei...    79   6e-13   Verticillium dahliae VdLs.17
gi|66823091|ref|XP_644900.1| NmrA-like protein [Dictyostelium di...    79   7e-13   Dictyostelium discoideum AX4
gi|512919365|ref|XP_004904008.1| PREDICTED: nmrA-like family dom...    79   7e-13   
gi|320590323|gb|EFX02766.1| nitrogen metabolite repression regul...    79   8e-13   Grosmannia clavigera kw1407
gi|400593619|gb|EJP61548.1| nmrA family transcriptional regulato...    79   9e-13   Beauveria bassiana ARSEF 2860
gi|116197973|ref|XP_001224798.1| hypothetical protein CHGG_07142...    79   9e-13   Chaetomium globosum CBS 148.51
gi|500259091|gb|EOO01942.1| putative family transcriptional regu...    79   1e-12   Phaeoacremonium minimum UCRPA7
gi|169595688|ref|XP_001791268.1| hypothetical protein SNOG_00588...    79   1e-12   Parastagonospora nodorum SN15
gi|67477341|sp|P23762.2|NMR1_NEUCR RecName: Full=Nitrogen metabo...    79   1e-12   Neurospora crassa OR74A
gi|164426515|ref|XP_961314.2| hypothetical protein NCU04158 [Neu...    79   1e-12   
gi|393227990|gb|EJD35649.1| nucleoside-diphosphate-sugar epimera...    79   1e-12   Auricularia subglabra TFB-10046 SS5
gi|225555191|gb|EEH03484.1| NmrA-like family domain-containing p...    79   1e-12   Histoplasma capsulatum G186AR
gi|452982441|gb|EME82200.1| hypothetical protein MYCFIDRAFT_2115...    78   1e-12   Cercospora fijiensis CIRAD86
gi|149042651|gb|EDL96288.1| similar to RIKEN cDNA 1110025F24 (pr...    78   1e-12   Rattus norvegicus [brown rat]
gi|512207609|gb|EPE36427.1| NAD(P)-binding Rossmann-fold contain...    78   1e-12   Glarea lozoyensis ATCC 20868
gi|470246932|ref|XP_004366619.1| NmrA-like protein [Dictyosteliu...    78   1e-12   Dictyostelium fasciculatum
gi|344291949|ref|XP_003417691.1| PREDICTED: nmrA-like family dom...    78   2e-12   Loxodonta africana [African bush elephant]
gi|26347201|dbj|BAC37249.1| unnamed protein product [Mus musculus]     78   2e-12   Mus musculus [mouse]
gi|365970474|ref|YP_004952035.1| NmrA family protein [Enterobact...    78   2e-12   
gi|66821746|ref|XP_644302.1| hypothetical protein DDB_G0274161 [...    77   2e-12   Dictyostelium discoideum AX4
gi|330795533|ref|XP_003285827.1| hypothetical protein DICPUDRAFT...    77   2e-12   Dictyostelium purpureum
gi|408392294|gb|EKJ71651.1| hypothetical protein FPSE_08097 [Fus...    77   3e-12   Fusarium pseudograminearum CS3096
gi|344282131|ref|XP_003412828.1| PREDICTED: nmrA-like family dom...    77   3e-12   Loxodonta africana [African bush elephant]
gi|488520609|ref|XP_004452236.1| PREDICTED: nmrA-like family dom...    77   3e-12   Dasypus novemcinctus
gi|189207106|ref|XP_001939887.1| nitrogen metabolic regulation p...    77   3e-12   Pyrenophora tritici-repentis Pt-1C-BFP
gi|330802956|ref|XP_003289477.1| hypothetical protein DICPUDRAFT...    77   3e-12   Dictyostelium purpureum
gi|83771390|dbj|BAE61522.1| unnamed protein product [Aspergillus...    77   3e-12   Aspergillus oryzae RIB40
gi|497343027|ref|WP_009657240.1| NmrA family protein [Selenomona...    77   3e-12   Selenomonas sp. FOBRC9
gi|238503057|ref|XP_002382762.1| nitrogen metabolite repression ...    77   3e-12   Aspergillus flavus NRRL3357
gi|148664829|gb|EDK97245.1| NmrA-like family domain containing 1...    77   3e-12   Mus musculus [mouse]
gi|471563858|gb|EMR64960.1| putative nmral1 protein [Eutypa lata...    77   3e-12   Eutypa lata UCREL1
gi|317148264|ref|XP_001822655.2| nitrogen metabolite repression ...    77   3e-12   Aspergillus oryzae RIB40
gi|190344587|gb|EDK36288.2| hypothetical protein PGUG_00386 [Mey...    77   3e-12   Meyerozyma guilliermondii ATCC 6260
gi|148664828|gb|EDK97244.1| NmrA-like family domain containing 1...    77   4e-12   Mus musculus [mouse]
gi|12849017|dbj|BAB28172.1| unnamed protein product [Mus musculus]     77   4e-12   Mus musculus [mouse]
gi|449304749|gb|EMD00756.1| hypothetical protein BAUCODRAFT_1820...    77   4e-12   Baudoinia panamericana UAMH 10762
gi|240281413|gb|EER44916.1| NmrA-like family domain-containing p...    77   4e-12   Histoplasma capsulatum H143
gi|497017503|ref|WP_009438003.1| NmrA family protein [Selenomona...    77   4e-12   Selenomonas sp. oral taxon 137
gi|325092095|gb|EGC45405.1| NmrA-like family domain-containing p...    77   4e-12   Histoplasma capsulatum H88
gi|336257901|ref|XP_003343772.1| hypothetical protein SMAC_04430...    77   4e-12   Sordaria macrospora k-hell
gi|500255169|gb|EON98686.1| putative nitrogen metabolite repress...    76   5e-12   Phaeoacremonium minimum UCRPA7
gi|291233581|ref|XP_002736731.1| PREDICTED: NmrA-like family dom...    76   5e-12   Saccoglossus kowalevskii
gi|477531027|gb|ENH82752.1| nitrogen metabolite repression-respo...    76   6e-12   Colletotrichum orbiculare MAFF 240422
gi|261188991|ref|XP_002620908.1| NmrA family transcriptional reg...    76   6e-12   Blastomyces gilchristii SLH14081
gi|358385495|gb|EHK23092.1| hypothetical protein TRIVIDRAFT_2880...    76   7e-12   Trichoderma virens Gv29-8
gi|239609186|gb|EEQ86173.1| NmrA family transcriptional regulato...    76   7e-12   Blastomyces dermatitidis ER-3
gi|485928668|gb|EOD52338.1| putative family transcriptional regu...    75   8e-12   Neofusicoccum parvum UCRNP2
gi|471567623|gb|EMR67531.1| putative hscarg dehydrogenase protei...    75   9e-12   Eutypa lata UCREL1
gi|358388796|gb|EHK26389.1| hypothetical protein TRIVIDRAFT_6370...    75   9e-12   Trichoderma virens Gv29-8
gi|46117599|ref|XP_384810.1| hypothetical protein FG04634.1 [Fus...    75   1e-11   
gi|146422135|ref|XP_001487009.1| hypothetical protein PGUG_00386...    75   1e-11   Meyerozyma guilliermondii ATCC 6260
gi|393239928|gb|EJD47456.1| NAD(P)-binding protein [Auricularia ...    75   1e-11   Auricularia subglabra TFB-10046 SS5
gi|346319914|gb|EGX89515.1| nitrogen metabolic regulation protei...    75   2e-11   Cordyceps militaris CM01
gi|395734516|ref|XP_003776429.1| PREDICTED: nmrA-like family dom...    74   2e-11   
gi|449298210|gb|EMC94227.1| hypothetical protein BAUCODRAFT_1504...    74   2e-11   Baudoinia panamericana UAMH 10762
gi|116195358|ref|XP_001223491.1| hypothetical protein CHGG_04277...    74   2e-11   Chaetomium globosum CBS 148.51
gi|258578183|ref|XP_002543273.1| conserved hypothetical protein ...    74   3e-11   Uncinocarpus reesii 1704
gi|340518202|gb|EGR48444.1| predicted protein [Trichoderma reese...    74   3e-11   Trichoderma reesei QM6a
gi|475664937|gb|EMT62731.1| NmrA-like family domain-containing p...    74   3e-11   Fusarium oxysporum f. sp. cubense race 4
gi|492547361|ref|WP_005881266.1| NmrA-like family domain-contain...    74   3e-11   Enterococcus durans
gi|302901517|ref|XP_003048455.1| hypothetical protein NECHADRAFT...    74   3e-11   Nectria haematococca mpVI 77-13-4
gi|512187228|gb|EPE03009.1| hypothetical protein F503_08623 [Oph...    74   3e-11   Ophiostoma piceae UAMH 11346
gi|494823960|gb|EON61279.1| hypothetical protein W97_00492 [Coni...    74   3e-11   Coniosporium apollinis CBS 100218
gi|342888596|gb|EGU87856.1| hypothetical protein FOXB_01650 [Fus...    74   3e-11   Fusarium oxysporum Fo5176
gi|494833410|gb|EON69386.1| hypothetical protein W97_08646 [Coni...    73   4e-11   Coniosporium apollinis CBS 100218
gi|330802954|ref|XP_003289476.1| hypothetical protein DICPUDRAFT...    73   5e-11   Dictyostelium purpureum
gi|294654717|ref|XP_456778.2| DEHA2A10274p [Debaryomyces hanseni...    73   5e-11   Debaryomyces hansenii CBS767
gi|392589084|gb|EIW78415.1| NAD(P)-binding protein [Coniophora p...    73   5e-11   Coniophora puteana RWD-64-598 SS2
gi|226294237|gb|EEH49657.1| nitrogen metabolic regulation protei...    73   5e-11   Paracoccidioides brasiliensis Pb18
gi|471563914|gb|EMR64997.1| putative nmral1 protein [Eutypa lata...    73   5e-11   Eutypa lata UCREL1
gi|378727314|gb|EHY53773.1| hypothetical protein HMPREF1120_0195...    73   6e-11   Exophiala dermatitidis NIH/UT8656
gi|429853646|gb|ELA28706.1| hscarg protein [Colletotrichum gloeo...    72   7e-11   Colletotrichum gloeosporioides Nara gc5
gi|119180489|ref|XP_001241710.1| hypothetical protein CIMG_08873...    72   7e-11   Coccidioides immitis RS
gi|470236844|ref|XP_004350375.1| hypothetical protein DFA_11432 ...    72   8e-11   Dictyostelium fasciculatum
gi|154272794|ref|XP_001537249.1| conserved hypothetical protein ...    72   8e-11   Histoplasma capsulatum NAm1
gi|407926061|gb|EKG19032.1| NmrA-like protein [Macrophomina phas...    72   9e-11   Macrophomina phaseolina MS6
gi|397470088|ref|XP_003806665.1| PREDICTED: nmrA-like family dom...    72   1e-10   


>gi|340371521|ref|XP_003384294.1| PREDICTED: nmrA-like family domain-containing protein 1-like
           [Amphimedon queenslandica]
          Length = 290

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 79/214 (36%), Positives = 125/214 (58%), Gaps = 21/214 (9%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           RQGK +AD  K+ G++ L+YS L +   E  G+  D  HF GK  VE+Y+  +G+PN T 
Sbjct: 92  RQGKAVADACKKAGVSHLVYSGL-ELVKEITGRNCD--HFDGKGEVEKYLDSIGLPN-TS 147

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             +SFY +N  +F      NE+G   +    F  N  +  + V+D GP +A I  + P +
Sbjct: 148 VRVSFYYENFLSFSQK---NEDGSYSIA---FSMNGPMDAVSVKDVGPAVAAIFSK-PEE 200

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHK-VRTLNDEDIAKDFPTLNNKSLKQMFKYE 180
           + GKK+ ++ +  T+K+  D++TK+TG +   ++ LND D AK FP  ++  L  MF Y 
Sbjct: 201 FIGKKIGLSGDRKTLKEYCDLVTKLTGVSMTYIKMLND-DYAKLFPGSDD--LAAMFHY- 256

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYILE 214
            EFG     N ++DI++ KKL+PN K+F +++ E
Sbjct: 257 YEFG-----NPVRDISLTKKLNPNAKSFTEWVTE 285



>gi|290974188|ref|XP_002669828.1| predicted protein [Naegleria gruberi]
 gi|284083380|gb|EFC37084.1| predicted protein [Naegleria gruberi]
          Length = 246

 Score =  103 bits (257), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 111/211 (52%), Gaps = 9/211 (4%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
            +G  + + A +  +   ++SSL D T  SGGK   V HFT KN VEQ  RK  IP  TF
Sbjct: 36  HEGLNLVEAAVKNNVQHFVFSSLDDVTKASGGKI-SVPHFTNKNKVEQEARKTNIPFKTF 94

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
            Y  F++ N+      L  NE+    ++      + ++ +  V D G +++++ +  PT 
Sbjct: 95  VYPPFFADNLPGMMFRL--NEDRASAMIFAGINTDRKIPVFAVDDLGIVVSEVFKN-PTT 151

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMFKYEK 181
           +NG+K+  A + VT+K++ D+ T+V     +   ++ E + +   +      K MF Y  
Sbjct: 152 YNGRKILTAGDYVTLKEMADICTQVLNIPTQYFAMDAETVGQRMGS----EAKNMFTYFN 207

Query: 182 EFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
           E G   +DNE + +  A+KL P++ TFEQY+
Sbjct: 208 ECGYY-QDNEQEAVKEARKLFPDLLTFEQYV 237



>gi|395536445|ref|XP_003770227.1| PREDICTED: nmrA-like family domain-containing protein 1-like
           [Sarcophilus harrisii]
          Length = 299

 Score =  103 bits (256), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 70/214 (32%), Positives = 120/214 (56%), Gaps = 15/214 (7%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGKM+AD++K+ GL  ++YS L +    + GK  +V HF GK  VE+Y  +LG+P +T 
Sbjct: 92  QQGKMVADVSKQVGLKHVVYSGLENVKKLTKGKL-EVPHFDGKGKVEEYFWELGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             ++ Y +N  + + P+ +++    +LV+P   ++  +  I V D GP++  I    P +
Sbjct: 150 VRIAPYFENFLSLWKPVKASDGDYYNLVLPM--KDIPMDGISVADLGPVVVSIFRS-PGE 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + GK V +++E +TI+Q  DVL++  GK  K   +  E   K  FP    K L  M +  
Sbjct: 207 FLGKAVGLSAEALTIQQYADVLSETLGKVFKDSKITAEAYEKLGFP--GAKELADMMR-- 262

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYILE 214
             F  +  D   +D+ +  KL+P +K+F Q++LE
Sbjct: 263 --FYYLRPD---RDVKLTHKLNPEVKSFSQFVLE 291



>gi|46250145|gb|AAH68857.1| LOC414512 protein, partial [Xenopus laevis]
          Length = 299

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 77/217 (35%), Positives = 121/217 (55%), Gaps = 28/217 (12%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK IAD++K  GL  +++S L +    +GGK  +V HF GK  VE+Y R +G+P +T  
Sbjct: 94  QGKRIADMSKRLGLKHVVFSGLENVKKLTGGKL-EVLHFDGKGEVEEYFRAIGVP-MTSV 151

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLL-LIDVRDTGPIIAKIIEEGPTK 121
            L FY +N+ TF  P  +++    +L IP     D LL  + V D GP++A I++  P K
Sbjct: 152 RLPFYFENLLTF-RPTKASDGESYNLAIPM---GDILLDGMSVADLGPVVASILK-CPAK 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKD------FPTLNNKSLKQ 175
           + GK + I+++ +T+ Q  D+++KVTGKT K     D  I+ D      FP    + L  
Sbjct: 207 YIGKDIGISTDKLTVAQYADIMSKVTGKTIK-----DAKISLDAYRNLGFPA--AQELAN 259

Query: 176 MFKYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
           MF    EF  +  D  + D+T+  +L+P  K F +++
Sbjct: 260 MF----EFFQMKLDRNV-DLTL--ELNPKAKKFAEWM 289



>gi|507927735|ref|XP_004675122.1| PREDICTED: nmrA-like family domain-containing protein 1-like
           [Condylura cristata]
          Length = 299

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 71/213 (33%), Positives = 117/213 (54%), Gaps = 15/213 (7%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK++ADIAK  GL  ++YS L +    SGGK  +V HF GK  VE+Y   +G+P +T  
Sbjct: 93  QGKLVADIAKPLGLKHVVYSGLENVKRLSGGKL-EVPHFDGKGEVEEYFWSIGVP-MTST 150

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
            L+ Y +N  T + P+ +++     L +P    +  +  I V D GPII+ I    P ++
Sbjct: 151 RLAAYFENFLTMWKPVKASDADYYTLALPM--GDTPMDGISVGDIGPIISSIF-NCPEEF 207

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYEK 181
            GK V +++E +TI+Q  D+L+K  GK  +   ++ E   K  FP    + L  M ++ +
Sbjct: 208 LGKAVGLSAEALTIQQYADILSKALGKEVRDAKISPETYEKLGFPA--AQELANMCRFYQ 265

Query: 182 EFGAIGKDNELQDITIAKKLHPNIKTFEQYILE 214
               +  D   +D+ +  +L+P +K+F Q+I E
Sbjct: 266 ----MKPD---RDVKLTHRLNPRVKSFSQFISE 291



>gi|62858755|ref|NP_001016962.1| NmrA-like family domain containing 1 [Xenopus (Silurana)
           tropicalis]
          Length = 299

 Score =  101 bits (251), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 66/212 (31%), Positives = 117/212 (55%), Gaps = 17/212 (8%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK IAD+ K  GL  ++YS L +    +GGK  +V HF GK  VE+Y R +G+P +T  
Sbjct: 93  QGKRIADVTKRLGLKHVVYSGLENVKKLTGGKL-EVLHFDGKGEVEEYFRAIGVP-MTSV 150

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLL-LIDVRDTGPIIAKIIEEGPTK 121
            L  Y +N+ TFF P  +++    +L IP     D LL  + V D GP++  +++  P K
Sbjct: 151 RLPSYFENLLTFFRPTKASDGETYNLAIPM---GDMLLDGMSVSDLGPVVVSVLK-CPAK 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLN-DEDIAKDFPTLNNKSLKQMFKYE 180
           + GK + ++++ + + Q  D+++K TGKT K   ++ D   +  FP    + L  MF++ 
Sbjct: 207 YIGKDIGLSTDKLLVAQYADIMSKATGKTIKDAKISLDAYRSLGFP--GAQELGNMFEFY 264

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
           +          ++++ +  +L+P  K F++++
Sbjct: 265 QM-------KPVRNVDLTLELNPKAKKFQEWM 289



>gi|322695956|gb|EFY87756.1| NmrA family transcriptional regulator [Metarhizium acridum CQMa
           102]
          Length = 309

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 68/212 (32%), Positives = 105/212 (49%), Gaps = 4/212 (1%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QG+ IAD A   G  +LI+S+LP     SGG+Y    HF  K  VE+YIR L I +  FA
Sbjct: 96  QGRRIADAAVAVGAKYLIFSTLPSIDENSGGRYNKGGHFDCKTQVERYIRTLPIKSAFFA 155

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
             SF  QN  T   P  +++   +   +       +L LID+ +TG  ++ I+ + P  +
Sbjct: 156 PGSFM-QNFATNLRPNATDDGTYVLATVA--SPATKLPLIDITETGKYVSAILAD-PDAF 211

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMFKYEKE 182
            GK +  A+   T+++I  +++K TGKT   R L +E   K  P      +  M  Y ++
Sbjct: 212 QGKTLCAATGLYTMEEIVGIISKSTGKTVAYRQLPEEVFRKFLPPAMGDYIVHMLLYIQD 271

Query: 183 FGAIGKDNELQDITIAKKLHPNIKTFEQYILE 214
           FG  GK+ E      A +    + + E Y+ E
Sbjct: 272 FGYYGKNTEELVAWTAGQARGRLHSLEDYLAE 303



>gi|165971552|gb|AAI58423.1| hypothetical protein LOC549716 [Xenopus (Silurana) tropicalis]
          Length = 299

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 66/212 (31%), Positives = 117/212 (55%), Gaps = 17/212 (8%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK IAD+ K  GL  ++YS L +    +GGK  +V HF GK  VE+Y R +G+P +T  
Sbjct: 93  QGKRIADVTKRLGLKHVVYSGLENVKKLTGGKL-EVLHFDGKGEVEEYFRAIGVP-MTSV 150

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLL-LIDVRDTGPIIAKIIEEGPTK 121
            L  Y +N+ TFF P  +++    +L IP     D LL  + V D GP++  +++  P K
Sbjct: 151 RLPSYFENLLTFFRPTKASDGETYNLAIPM---GDILLDGMSVSDLGPVVVSVLK-CPAK 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLN-DEDIAKDFPTLNNKSLKQMFKYE 180
           + GK + ++++ + + Q  D+++K TGKT K   ++ D   +  FP    + L  MF++ 
Sbjct: 207 YIGKDIGLSTDKLLVAQYADIMSKATGKTIKDAKISLDAYRSLGFP--GAQELGNMFEFY 264

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
           +          ++++ +  +L+P  K F++++
Sbjct: 265 QM-------KPVRNVDLTLELNPKAKKFQEWM 289



>gi|471574808|gb|EMR72564.1| putative nitrogen metabolite repression- -responsible protein
           [Eutypa lata UCREL1]
          Length = 401

 Score = 99.8 bits (247), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 52/155 (33%), Positives = 88/155 (56%), Gaps = 7/155 (4%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           G+ +ADIAK+ G+   +YSS+PD    +   +P +  + GK+ VE YIRK+G+P  TF Y
Sbjct: 112 GEAVADIAKKVGVQHYVYSSMPDHAAYNSA-WPSLPLWAGKHKVEDYIRKIGLP-ATFVY 169

Query: 64  LSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEGP 119
              Y+ N  +   PL   E   +G  +   P F  + +L  +D   D GP I ++ +EGP
Sbjct: 170 TGIYNNNFTSLLYPLFCMELQPDGSFEWQAP-FHPHAKLPWLDAEHDVGPAILQLFKEGP 228

Query: 120 TKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVR 154
            KWNGK++ +A E+++  ++ ++  +  G+  + R
Sbjct: 229 NKWNGKRIALAYEHLSPMEVCEMFERGIGRPVRYR 263



>gi|290974041|ref|XP_002669755.1| predicted protein [Naegleria gruberi]
 gi|284083306|gb|EFC37011.1| predicted protein [Naegleria gruberi]
          Length = 302

 Score = 99.8 bits (247), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 65/210 (30%), Positives = 108/210 (51%), Gaps = 9/210 (4%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           +G  + + A +  +   ++SSL D T  SGGK   V HFT KN VEQ  RK  IP  TF 
Sbjct: 93  EGLNLVEAAVKNNVQHFVFSSLDDVTKASGGKI-SVPHFTNKNKVEQEARKTNIPFKTFV 151

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
           Y  F++ N+      L  NE+    ++      + +L +  V D G +++++ +  P  +
Sbjct: 152 YPPFFADNLPGMMFRL--NEDRASAMIFAGVNTDRKLPVFGVDDLGIVVSEVFKH-PENY 208

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMFKYEKE 182
           NG+K+  A + V++K++ D+ T V     +   ++ E + +   +      K MF Y  E
Sbjct: 209 NGRKLLTAGDYVSLKEMADICTTVLNVPTQYVAMDAETVGQRMGS----EAKNMFMYFNE 264

Query: 183 FGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
            G   +DNE Q +  A++L P + TFEQY+
Sbjct: 265 CGYY-QDNEQQAVKEARELFPGLLTFEQYV 293



>gi|344239812|gb|EGV95915.1| NmrA-like family domain-containing protein 1 [Cricetulus griseus]
          Length = 284

 Score = 99.4 bits (246), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 71/216 (32%), Positives = 117/216 (54%), Gaps = 16/216 (7%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK++AD+AK  GL  ++YS L +    +GGK   V HF GK  VE+Y   +G+P +T  
Sbjct: 79  QGKLVADVAKRLGLKHVVYSGLENVDRLTGGKLK-VLHFDGKGEVEEYFWSIGVP-MTSV 136

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
            L+ Y +N  T + P+ ++E G   L +P    +  +  I V D G +++ I    P ++
Sbjct: 137 RLAAYFENFLTLWKPVKTSE-GHYTLALPM--GDVPMDGISVADVGAVVSSIFAS-PEEF 192

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYEK 181
            GK V +++E +TI+Q  D+L+K  GK  +   +  E   K  FP +  + +  MF+   
Sbjct: 193 VGKAVGLSAEALTIQQYADILSKTLGKDIRDAKITLEAFEKMGFPGV--EEMASMFR--- 247

Query: 182 EFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
            F  +  D   +DI +  +L+P I++F Q+I E  G
Sbjct: 248 -FYHMKPD---RDIKLTHRLNPKIRSFSQFISENQG 279



>gi|354484190|ref|XP_003504273.1| PREDICTED: nmrA-like family domain-containing protein 1-like
           [Cricetulus griseus]
          Length = 298

 Score = 99.4 bits (246), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 71/216 (32%), Positives = 117/216 (54%), Gaps = 16/216 (7%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK++AD+AK  GL  ++YS L +    +GGK   V HF GK  VE+Y   +G+P +T  
Sbjct: 93  QGKLVADVAKRLGLKHVVYSGLENVDRLTGGKLK-VLHFDGKGEVEEYFWSIGVP-MTSV 150

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
            L+ Y +N  T + P+ ++E G   L +P    +  +  I V D G +++ I    P ++
Sbjct: 151 RLAAYFENFLTLWKPVKTSE-GHYTLALPM--GDVPMDGISVADVGAVVSSIFAS-PEEF 206

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYEK 181
            GK V +++E +TI+Q  D+L+K  GK  +   +  E   K  FP +  + +  MF+   
Sbjct: 207 VGKAVGLSAEALTIQQYADILSKTLGKDIRDAKITLEAFEKMGFPGV--EEMASMFR--- 261

Query: 182 EFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
            F  +  D   +DI +  +L+P I++F Q+I E  G
Sbjct: 262 -FYHMKPD---RDIKLTHRLNPKIRSFSQFISENQG 293



>gi|66802414|ref|XP_629989.1| hypothetical protein DDB_G0291732 [Dictyostelium discoideum AX4]
 gi|60463374|gb|EAL61562.1| hypothetical protein DDB_G0291732 [Dictyostelium discoideum AX4]
          Length = 308

 Score = 99.0 bits (245), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 75/208 (36%), Positives = 107/208 (51%), Gaps = 16/208 (7%)

Query: 14  KGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA----YLSFYSQ 69
           K +   ++  L    T S  KY  V HF  K  VEQ++RK+   N TF     Y  FY Q
Sbjct: 106 KTVKHYVFHGLISCKTVSNDKY-SVPHFDLKYRVEQHLRKVSKENPTFISSFIYSPFYMQ 164

Query: 70  NIGTFFLPLISNE-NGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKWNGKKVP 128
           N  + F P  S   NG   + +P  EE+  L ++D++D GPI+A I+   P+K++G  VP
Sbjct: 165 NFSSIFTPKRSTTTNGTYTISMP-LEESKPLDMVDIKDIGPIVAGIV-ANPSKYSGVIVP 222

Query: 129 IASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYEKEFGAIG 187
           +A E +T  QI  V TKVTGK  K   +         FP  N   +  MF++  EFGA  
Sbjct: 223 LAGEKLTGDQICQVFTKVTGKQVKYNYIPPATFRTFAFPYANE--IASMFQFFSEFGAF- 279

Query: 188 KDNELQDITIAKKLHPNIKTFEQYILET 215
             N+L D T+A  +H  + + E Y++ T
Sbjct: 280 --NDL-DTTLASSIH-KLTSLEDYLIST 303



>gi|46125639|ref|XP_387373.1| hypothetical protein FG07197.1 [Fusarium graminearum PH-1]
          Length = 465

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/150 (35%), Positives = 83/150 (55%), Gaps = 7/150 (4%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           GK +AD AK  G+   +YSS+PD       K+P +  +  K+ VEQY+RKL +P  TF Y
Sbjct: 179 GKALADAAKRAGIQHYVYSSMPDHAAYDT-KWPSLPLWAAKHEVEQYVRKLRMP-ATFVY 236

Query: 64  LSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEGP 119
              Y+ N  +   PL   E   +G      P F  + +L  +D   D GP + +I ++GP
Sbjct: 237 TGIYNNNFTSLQYPLFCMELQKDGSFRWQAP-FHPDAKLPWLDAEHDVGPAVLQIFKDGP 295

Query: 120 TKWNGKKVPIASENVTIKQITDVLTKVTGK 149
           TKWNG+++ +A E +T K++  + +K  G+
Sbjct: 296 TKWNGERIALAYEYLTPKEVCRLFSKGVGR 325



>gi|391870023|gb|EIT79211.1| HSCARG dehydrogenase [Aspergillus oryzae 3.042]
          Length = 313

 Score = 97.8 bits (242), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 69/213 (32%), Positives = 104/213 (48%), Gaps = 3/213 (1%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +  K IAD+A ++G  ++I+S+LP  +  SGGKY  VT F  K   E+YIR L I +  F
Sbjct: 94  QSAKTIADVAIDQGAEYIIFSTLPAISEISGGKYTQVTPFEAKAKAEKYIRGLPIKSAFF 153

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
           +  SF        FL      +G   +V P   +    L+  V DTG  I  I+ E P K
Sbjct: 154 SPGSFMENYQLLPFLRPRQAPDGTWVMVHPMSPKGLLPLIDAVGDTGKFIGAILAE-PDK 212

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFP--TLNNKSLKQMFKY 179
           + GK    A+   ++ +I  V++K TGKT   + ++ E+  K  P   L      + F+ 
Sbjct: 213 YEGKTFCAATALYSLDEIAAVMSKATGKTIACKQVHPEEFKKSLPFLALAFNVFVEGFQS 272

Query: 180 EKEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
             EFG  G D+E      A+     + TFE+Y+
Sbjct: 273 IGEFGYYGPDSERLVAWAAQNARGRLSTFEEYL 305



>gi|169764371|ref|XP_001816657.1| HSCARG dehydrogenase [Aspergillus oryzae RIB40]
 gi|83764511|dbj|BAE54655.1| unnamed protein product [Aspergillus oryzae RIB40]
          Length = 313

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 69/213 (32%), Positives = 104/213 (48%), Gaps = 3/213 (1%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +  K IAD+A ++G  ++I+S+LP  +  SGGKY  VT F  K   E+YIR L I +  F
Sbjct: 94  QSAKTIADVAIDQGAEYIIFSTLPAISEISGGKYTQVTPFEAKAKAEKYIRGLPIKSAFF 153

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
           +  SF        FL      +G   +V P   +    L+  V DTG  I  I+ E P K
Sbjct: 154 SPGSFMENYQLLPFLRPRQAPDGTWVMVHPMSPKGLLPLIDAVGDTGKFIGAILAE-PDK 212

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFP--TLNNKSLKQMFKY 179
           + GK    A+   ++ +I  V++K TGKT   + ++ E+  K  P   L      + F+ 
Sbjct: 213 YEGKTFCAATALYSLDEIAAVMSKATGKTIACKQVHPEEFKKSLPFLALAFNVFIEGFQS 272

Query: 180 EKEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
             EFG  G D+E      A+     + TFE+Y+
Sbjct: 273 IGEFGYYGPDSERLVAWAAQNARGRLSTFEEYL 305



>gi|238504394|ref|XP_002383428.1| hscarg dehydrogenase, putative [Aspergillus flavus NRRL3357]
 gi|220690899|gb|EED47248.1| hscarg dehydrogenase, putative [Aspergillus flavus NRRL3357]
          Length = 313

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 69/213 (32%), Positives = 104/213 (48%), Gaps = 3/213 (1%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +  K IAD+A ++G  ++I+S+LP  +  SGGKY  VT F  K   E+YIR L I +  F
Sbjct: 94  QSAKTIADVAIDQGAEYIIFSTLPAISEISGGKYTQVTPFEAKAKAEKYIRGLPIKSAFF 153

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
           +  SF        FL      +G   +V P   +    L+  V DTG  I  I+ E P K
Sbjct: 154 SPGSFMENYQLLPFLRPRQAPDGTWVMVHPMSPKGLLPLINAVGDTGKFIGAILAE-PDK 212

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFP--TLNNKSLKQMFKY 179
           + GK    A+   ++ +I  V++K TGKT   + ++ E+  K  P   L      + F+ 
Sbjct: 213 YEGKTFCAATALYSLDEIAAVMSKATGKTIACKQVHPEEFKKSLPFLALAFNVFIEGFQS 272

Query: 180 EKEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
             EFG  G D+E      A+     + TFE+Y+
Sbjct: 273 IGEFGYYGPDSERLVAWAAQNARGRLSTFEEYL 305



>gi|345329630|ref|XP_003431399.1| PREDICTED: nmrA-like family domain-containing protein 1-like
           isoform 2 [Ornithorhynchus anatinus]
          Length = 305

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 65/214 (30%), Positives = 120/214 (56%), Gaps = 15/214 (7%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           RQGK++AD++K  GL +++YS L +    +GGK  +V HF GK  VE+Y R LG+P +T 
Sbjct: 98  RQGKLLADLSKRLGLRYVVYSGLENVKKLTGGKL-EVGHFDGKGEVEEYFRGLGVP-MTS 155

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ T+FLP  +++     L +P    +  +  + + D GP++  +++  P +
Sbjct: 156 VRLPCYFENLLTYFLPKKASDGSGYLLNLPL--ADIPMDGLGISDLGPVVLSLLKS-PGE 212

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDI-AKDFPTLNNKSLKQMFKYE 180
           + G+ + +++   T+++   +L+K TGK  +   +  E+  +  FP    K L  MF+  
Sbjct: 213 YVGQDIGLSTCKHTVEEYASLLSKHTGKAVRDAKMTPEEYESLGFP--GAKELANMFR-- 268

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYILE 214
             F A+  D   +++ +  KL+P  KT +Q++ E
Sbjct: 269 --FYALKPD---RNMELTLKLNPKAKTLDQWLEE 297



>gi|334324936|ref|XP_001377212.2| PREDICTED: nmrA-like family domain-containing protein 1-like
           [Monodelphis domestica]
          Length = 299

 Score = 96.7 bits (239), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 67/214 (31%), Positives = 116/214 (54%), Gaps = 15/214 (7%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGKM+AD +K+ GL  ++YS L +    + GK  +V HF GK  VE+Y   +G+P +T 
Sbjct: 92  KQGKMVADASKQLGLKHVVYSGLENVKKLTKGKL-EVKHFDGKGEVEEYFWSIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             +S Y +N    + P+ +++    +L++P   ++  +  I V D GP +A I    P +
Sbjct: 150 VRISAYFENFLNIWKPVKASDGDYYNLMLPM--KDIPMDGISVADIGPAVASIFRS-PEE 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + GK V +++E +T++Q  D+L+K  GK  K   +  E   K  FP    K +  M +  
Sbjct: 207 FLGKAVGLSAEALTVQQYADILSKTLGKVVKDSKITPEAYEKLGFP--GAKEMADMMR-- 262

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYILE 214
             F  +  D   +D+ +  KL+P +K+F Q++ E
Sbjct: 263 --FYHMKPD---RDVQLTHKLNPKVKSFSQFVSE 291



>gi|408397492|gb|EKJ76634.1| hypothetical protein FPSE_03184 [Fusarium pseudograminearum CS3096]
          Length = 465

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 52/150 (34%), Positives = 82/150 (54%), Gaps = 7/150 (4%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           GK +AD AK  G+   +YSS+PD       K+P +  +  K+ VEQY+RKL +P  TF Y
Sbjct: 179 GKALADAAKRAGIQHYVYSSMPDHAAYDT-KWPSLPLWAAKHEVEQYVRKLRMP-ATFVY 236

Query: 64  LSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEGP 119
              Y+ N  +   PL   E   +G      P F  + +L  +D   D GP + +I ++GP
Sbjct: 237 TGIYNNNFTSLQYPLFCMELQKDGSFRWQAP-FHPDAKLPWLDAEHDVGPAVLQIFKDGP 295

Query: 120 TKWNGKKVPIASENVTIKQITDVLTKVTGK 149
            KWNG+++ +A E +T K++  + +K  G+
Sbjct: 296 AKWNGERIALAYEYLTPKEVCRLFSKGVGR 325



>gi|322712044|gb|EFZ03617.1| NmrA family transcriptional regulator [Metarhizium anisopliae ARSEF
           23]
          Length = 309

 Score = 96.3 bits (238), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 104/212 (49%), Gaps = 4/212 (1%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QG+ IAD A   G  +LI+S+LP     SGG+Y    HF  K  VE+YIR L + +  FA
Sbjct: 96  QGRRIADAAVAVGAKYLIFSTLPSIKENSGGRYNKGGHFDCKTQVEKYIRTLPVKSAFFA 155

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
             SF  QN  T   P  +++   +   +       +L LID+ +TG  ++ I+   P  +
Sbjct: 156 PGSFM-QNFATNLRPNATDDGTYVLATVA--SPATKLPLIDITETGKYVSAILAN-PDAF 211

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMFKYEKE 182
            GK +  A+   T+++I  ++++ TGKT   R L ++   K  P      +  M  Y ++
Sbjct: 212 QGKTLCAATGLYTMEEIVGIISRSTGKTVAYRQLPEDAFRKFLPPAMGDYIVHMLLYIQD 271

Query: 183 FGAIGKDNELQDITIAKKLHPNIKTFEQYILE 214
           FG  G++ E      A +    + + E Y+ E
Sbjct: 272 FGYYGENTEELVAWAAGQARGKLHSLEDYLAE 303



>gi|505779476|ref|XP_004603319.1| PREDICTED: nmrA-like family domain-containing protein 1-like [Sorex
           araneus]
          Length = 299

 Score = 95.9 bits (237), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 66/216 (30%), Positives = 114/216 (52%), Gaps = 15/216 (6%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGKM+AD AK  GL  ++YS L +    SGGK  +V HF GK  VE+Y   +G+P +T  
Sbjct: 93  QGKMVADAAKRLGLKHVVYSGLENVKRLSGGKL-EVPHFDGKGEVEEYFWSIGVP-MTSV 150

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
            LS Y +N  T + P+ +++     L +P    +  +  I V D G  +  I    P ++
Sbjct: 151 RLSAYFENFLTMWKPMKASDGDYYTLALPM--GDTPMDGISVSDVGVAVLSIFNS-PEEF 207

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYEK 181
            GK V +++E +T++Q  D+ +K  GK  +   ++ E   K  FP    + +  M ++ +
Sbjct: 208 FGKAVGLSAEALTVQQYADLFSKSLGKEVRDAKISPEAYEKLGFPA--AEEIANMCRFYQ 265

Query: 182 EFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
               +  D   +D+ +  +L+PN+++F Q++ E  G
Sbjct: 266 ----MRPD---RDVKLTHRLNPNVRSFSQFLAENQG 294



>gi|470505372|ref|XP_004348563.1| NmrAlike family protein [Acanthamoeba castellanii str. Neff]
 gi|440801080|gb|ELR22105.1| NmrAlike family protein [Acanthamoeba castellanii str. Neff]
          Length = 315

 Score = 95.9 bits (237), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 61/195 (31%), Positives = 99/195 (50%), Gaps = 19/195 (9%)

Query: 37  DVTHFTGKNHVEQYIR---KLGIPNVTFAYLSFYSQNIGTFFLPLISNENGEIDLVIPYF 93
           +++H+ GK  VE Y+R   K   P  +F Y+ FY QN+ TFF P I   +G +    P +
Sbjct: 119 NLSHYAGKYQVEHYVRTHHKDSFPVQSFVYVGFYFQNVTTFFQPTIE-ADGALVFRQPLY 177

Query: 94  EENDQLLLIDVRDTGPIIAKIIEEGPTKWNGKKVPIASENVTIKQITDVLTKVTGKTHKV 153
           +    L L DV DTG ++A I ++ P  +NG+ VPI ++N+T+ Q+ + +TKV G+  + 
Sbjct: 178 KHT-TLPLFDVNDTGNVVAAIFDK-PETYNGESVPIVAQNLTVTQMCEAITKVKGRAARH 235

Query: 154 RTLNDEDIAKDFPTLNNKSLKQMFKYEKEFGAIGK---DNELQD----------ITIAKK 200
              +  + AKD  T    +++    Y     A      DNE  D            I  K
Sbjct: 236 EPQDFAEWAKDLSTETADNMRWYNDYAPIHEASSNDDIDNEADDYHNKKQQHRHAEITAK 295

Query: 201 LHPNIKTFEQYILET 215
           ++P + TFE ++ E+
Sbjct: 296 VYPAMATFEAWLAES 310



>gi|212541022|ref|XP_002150666.1| conserved hypothetical protein [Talaromyces marneffei ATCC 18224]
 gi|210067965|gb|EEA22057.1| conserved hypothetical protein [Talaromyces marneffei ATCC 18224]
          Length = 311

 Score = 95.9 bits (237), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 69/211 (32%), Positives = 106/211 (50%), Gaps = 5/211 (2%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           RQGK IAD A E G+ +LI+S+L   T ES GKYP+V  F  K  VEQYIR L I +  F
Sbjct: 95  RQGKAIADAAIEAGVKYLIWSTLSSPTLESKGKYPNVESFDSKYEVEQYIRNLPIKSAFF 154

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVR-DTGPIIAKIIEEGPT 120
           A  SF  QN   F LP  S  +G    +I     + +L  I+ + DTG  +  ++ E P 
Sbjct: 155 APSSFM-QNYNRFVLPHHSG-DGTFS-IINVVRGDTKLPHIETKGDTGKYVGAVLAE-PD 210

Query: 121 KWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMFKYE 180
           K+ GK +  +++  +   + + LT++TGKT K   +  +      P    + + +M  Y 
Sbjct: 211 KFEGKVLSASTDLYSYDDVAETLTRLTGKTVKYNQVPVDVFKGYLPPHGAQCMAEMMLYS 270

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQY 211
           ++ G  G + + +           + T E+Y
Sbjct: 271 EDTGYYGSETKEKVAWTVSVARGKLTTLEEY 301



>gi|189209193|ref|XP_001940929.1| conserved hypothetical protein [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187977022|gb|EDU43648.1| conserved hypothetical protein [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 313

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 96/181 (53%), Gaps = 2/181 (1%)

Query: 11  AKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAYLSFYSQN 70
           A ++G+ ++I+SS   ++  + GK  +V HF  K  +E YIR L I +  FA  SF  QN
Sbjct: 106 AVKQGVRYIIFSSAAHASEITDGKLSNVEHFDVKAEIEAYIRSLPIQSAFFAPASFM-QN 164

Query: 71  IGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKWNGKKVPIA 130
           + T   P  S E     ++     ++ ++  ID+ DTG  +  I+ E P ++ GK +  A
Sbjct: 165 LHTHMRPQPSGEGDGSYVLTTMLRDDTKVPFIDILDTGKFVGAILAE-PQRYAGKYLAAA 223

Query: 131 SENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMFKYEKEFGAIGKDN 190
               T+++I  V+ +VTGKT +   L DE +   FP     +L +M+   +E+G  GK+ 
Sbjct: 224 EGFYTLREIVAVMARVTGKTVRHVQLEDEIVKARFPEGLRGALGEMWILCREYGYFGKEQ 283

Query: 191 E 191
           E
Sbjct: 284 E 284



>gi|149641722|ref|XP_001507495.1| PREDICTED: nmrA-like family domain-containing protein 1-like
           isoform 1 [Ornithorhynchus anatinus]
          Length = 299

 Score = 95.5 bits (236), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 64/214 (29%), Positives = 120/214 (56%), Gaps = 15/214 (7%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD++K  GL +++YS L +    +GGK  +V HF GK  VE+Y R LG+P +T 
Sbjct: 92  KQGKLLADLSKRLGLRYVVYSGLENVKKLTGGKL-EVGHFDGKGEVEEYFRGLGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ T+FLP  +++     L +P    +  +  + + D GP++  +++  P +
Sbjct: 150 VRLPCYFENLLTYFLPKKASDGSGYLLNLPL--ADIPMDGLGISDLGPVVLSLLKS-PGE 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDI-AKDFPTLNNKSLKQMFKYE 180
           + G+ + +++   T+++   +L+K TGK  +   +  E+  +  FP    K L  MF+  
Sbjct: 207 YVGQDIGLSTCKHTVEEYASLLSKHTGKAVRDAKMTPEEYESLGFP--GAKELANMFR-- 262

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYILE 214
             F A+  D   +++ +  KL+P  KT +Q++ E
Sbjct: 263 --FYALKPD---RNMELTLKLNPKAKTLDQWLEE 291



>gi|410985286|ref|XP_003998954.1| PREDICTED: nmrA-like family domain-containing protein 1 isoform 1
           [Felis catus]
          Length = 299

 Score = 95.5 bits (236), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 63/212 (29%), Positives = 115/212 (54%), Gaps = 15/212 (7%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL +++YS L +    + G+     HF GK  VE+Y R +G+P +T 
Sbjct: 92  KQGKLLADVAKRLGLRYVVYSGLENIRKLTAGRLA-AGHFDGKGEVEEYFRDIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L+ Y +N+ ++FLP  + +     L +P    +  +  I V D GP++  +++  P +
Sbjct: 150 VRLACYFENLLSYFLPQKAPDGKSYLLSLPM--GDVPMDGISVTDLGPVVLSLLKM-PEE 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + G+ + +++   T ++   +L+K TGK  +      ED  + DFP    + L  MF+  
Sbjct: 207 YIGRNIGLSTCRHTAEEYAALLSKHTGKAVRSAKTTPEDYERYDFP--GARDLANMFR-- 262

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
             F A+  D   +DI +  +L+P  KT +Q++
Sbjct: 263 --FYALKPD---RDIELTLRLNPKAKTLDQWL 289



>gi|3549877|emb|CAA75863.1| nitrogen metabolite repression-(nmr)-responsible protein [Fusarium
           fujikuroi]
          Length = 462

 Score = 95.1 bits (235), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 84/150 (56%), Gaps = 7/150 (4%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           GK +AD AK  G+   +YSS+PD    +  ++P +  +  K+ VEQY+RKL IP  TF Y
Sbjct: 177 GKALADAAKRAGIQTYVYSSMPDHGAYNP-EWPSIPLWAAKHEVEQYVRKLRIP-ATFVY 234

Query: 64  LSFYSQNIGTFFLPLIS---NENGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEGP 119
              Y+ N  +   PL      ++G      P F  + +L  +D   D GP + +I ++GP
Sbjct: 235 TGIYNNNFTSLQYPLFCMDLQKDGSFKWQAP-FHPDAKLPWLDAEHDVGPAVLQIFKDGP 293

Query: 120 TKWNGKKVPIASENVTIKQITDVLTKVTGK 149
           +KWNG+++ +A E +T K++  + +K  G+
Sbjct: 294 SKWNGERIALAYEYLTPKEVCRLFSKGVGR 323



>gi|395515479|ref|XP_003761931.1| PREDICTED: nmrA-like family domain-containing protein 1
           [Sarcophilus harrisii]
          Length = 299

 Score = 95.1 bits (235), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 65/212 (30%), Positives = 114/212 (53%), Gaps = 15/212 (7%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD++K  GLN++IYS L +    +GG+   V HF GK  VE+Y R LG+P ++ 
Sbjct: 92  KQGKLLADLSKRLGLNYVIYSGLENVKKLTGGQLI-VRHFDGKGEVEEYFRALGVPMIS- 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ T+FLP  + +     L +P    +  +  + V D GP++  +++  P +
Sbjct: 150 VRLPCYFENLLTYFLPQKALDGKGYLLNLPM--GDVPMDGMAVADLGPVVLSLLKS-PEE 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + G+ + +++   T  +    L+K TGKT +    + ED  K  FP    + L  MF++ 
Sbjct: 207 YVGRNIGLSTCKHTATEYASFLSKYTGKTVQDAKTSPEDYEKLGFP--GAQDLANMFRFY 264

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
                    N  +D+ +  KL+P  +T EQ++
Sbjct: 265 TM-------NPDRDVELTLKLNPKARTLEQWL 289



>gi|66827991|ref|XP_647350.1| hypothetical protein DDB_G0267842 [Dictyostelium discoideum AX4]
 gi|60475439|gb|EAL73374.1| hypothetical protein DDB_G0267842 [Dictyostelium discoideum AX4]
          Length = 306

 Score = 95.1 bits (235), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 70/215 (32%), Positives = 108/215 (50%), Gaps = 14/215 (6%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPN----V 59
           GK +AD A   G+   ++S L      S G+Y DV HF  K+ VE Y R+L   N     
Sbjct: 92  GKKVADAALGAGVKHFVFSGLAPCNEISNGRY-DVPHFDNKHKVEMYARQLSKENPSFVS 150

Query: 60  TFAYLSFYSQNIGTFFLPLISNENG--EIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEE 117
           +F Y  FY QN  T+F P  SNENG     + +P       L + D+ + G I+++I   
Sbjct: 151 SFVYAPFYYQNFKTYFQPKKSNENGNENYSISLPSDPTGKPLDMGDIENIGSIVSEIFSN 210

Query: 118 GPTKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMF 177
             +K++G  VP + + +T  +I +  +KVTGKT     +    + + F       +  MF
Sbjct: 211 -QSKYSGVVVPFSGDALTGPEIANTFSKVTGKTVTFNFI-PPSVYRTFGFPGADEMASMF 268

Query: 178 KYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
           +Y  EFGA    N+L D +IA K+   + + E+Y+
Sbjct: 269 EYYNEFGAF---NDL-DKSIASKIT-KLTSLEEYL 298



>gi|507693672|ref|XP_004713526.1| PREDICTED: nmrA-like family domain-containing protein 1-like
           [Echinops telfairi]
          Length = 299

 Score = 95.1 bits (235), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 64/216 (29%), Positives = 116/216 (53%), Gaps = 15/216 (6%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK++AD AK +GL  ++YS L +    +GG+  +V HF GK  VE+Y   +G+P +T  
Sbjct: 93  QGKLVADAAKRQGLQHVVYSGLENVKRLTGGQL-EVPHFDGKGEVEEYFWSIGVP-MTSV 150

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
            ++ Y +N  T + P+ ++      L +P    +  +  I V D GPI++ I    P ++
Sbjct: 151 RMAAYFENFLTLWKPVKASGGDYYTLALPM--GDVPMDGISVDDIGPIVSSIFNS-PKEF 207

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYEK 181
            GK V +++E +T++Q  DV +K  GK  +   +  E   K DFP    + +  M ++ +
Sbjct: 208 VGKAVGLSAEALTVQQYADVFSKFLGKEVRDAKITPEAYEKLDFPA--AEEMANMCRFYQ 265

Query: 182 EFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
               +  D   +D+ + ++L+  +K+F Q++ E  G
Sbjct: 266 ----MKPD---RDVKLTRRLNQAVKSFSQFMSENRG 294



>gi|410985288|ref|XP_003998955.1| PREDICTED: nmrA-like family domain-containing protein 1 isoform 2
           [Felis catus]
          Length = 309

 Score = 95.1 bits (235), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 63/211 (29%), Positives = 114/211 (54%), Gaps = 15/211 (7%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK++AD+AK  GL +++YS L +    + G+     HF GK  VE+Y R +G+P +T  
Sbjct: 103 QGKLLADVAKRLGLRYVVYSGLENIRKLTAGRLA-AGHFDGKGEVEEYFRDIGVP-MTSV 160

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
            L+ Y +N+ ++FLP  + +     L +P    +  +  I V D GP++  +++  P ++
Sbjct: 161 RLACYFENLLSYFLPQKAPDGKSYLLSLPM--GDVPMDGISVTDLGPVVLSLLKM-PEEY 217

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYEK 181
            G+ + +++   T ++   +L+K TGK  +      ED  + DFP    + L  MF+   
Sbjct: 218 IGRNIGLSTCRHTAEEYAALLSKHTGKAVRSAKTTPEDYERYDFP--GARDLANMFR--- 272

Query: 182 EFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
            F A+  D   +DI +  +L+P  KT +Q++
Sbjct: 273 -FYALKPD---RDIELTLRLNPKAKTLDQWL 299



>gi|342875982|gb|EGU77647.1| hypothetical protein FOXB_11822 [Fusarium oxysporum Fo5176]
 gi|475667345|gb|EMT65134.1| Nitrogen metabolic regulation protein 1 [Fusarium oxysporum f. sp.
           cubense race 4]
          Length = 462

 Score = 95.1 bits (235), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 51/150 (34%), Positives = 84/150 (56%), Gaps = 7/150 (4%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           GK +AD AK  G+   +YSS+PD    +  ++P +  +  K+ VEQY+RKL IP  TF Y
Sbjct: 177 GKALADAAKRAGIQHYVYSSMPDHGAYNP-EWPSLPLWAAKHEVEQYVRKLRIP-ATFVY 234

Query: 64  LSFYSQNIGTFFLPLIS---NENGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEGP 119
              Y+ N  +   PL      ++G      P F  + +L  +D   D GP + +I ++GP
Sbjct: 235 TGIYNNNFTSLQYPLFCMDLQKDGSFKWQAP-FHPDAKLPWLDAEHDVGPAVLQIFKDGP 293

Query: 120 TKWNGKKVPIASENVTIKQITDVLTKVTGK 149
           +KWNG+++ +A E +T K++  + +K  G+
Sbjct: 294 SKWNGERIALAYEYLTPKEVCRLFSKGVGR 323



>gi|378728761|gb|EHY55220.1| nitrogen metabolite repression protein nmrA [Exophiala dermatitidis
           NIH/UT8656]
          Length = 364

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 55/184 (29%), Positives = 95/184 (51%), Gaps = 8/184 (4%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           GK +AD AK + +   +YSS+PD +  +   +P +  +  K  VE YIR+LG+P  TF Y
Sbjct: 92  GKALADAAKRRNIQHFVYSSMPDHSIHNP-NWPALPLWACKFTVENYIRQLGLP-ATFVY 149

Query: 64  LSFYSQNIGTFFLPLIS---NENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPT 120
              Y+ N  +   PL      ++G ++   P+  +     L    D GP + +++++GP 
Sbjct: 150 AGIYNNNFTSLPYPLFCMDFKDDGTLEWRAPFHPDTKLPWLDAEHDVGPAVLQVLKDGPK 209

Query: 121 KWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMFKYE 180
           KW G+++P+A EN+T  Q+ D+  +   +    R + D+ I    P + N   +Q+   E
Sbjct: 210 KWVGQRIPLAFENLTPLQVCDIFGRALER--PCRYVFDQHIEIKVP-IPNVYRQQLAGIE 266

Query: 181 KEFG 184
             FG
Sbjct: 267 VLFG 270



>gi|301778463|ref|XP_002924639.1| PREDICTED: nmrA-like family domain-containing protein 1-like
           [Ailuropoda melanoleuca]
          Length = 299

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 65/212 (30%), Positives = 116/212 (54%), Gaps = 15/212 (7%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL++++YS L +    + G+     HF GK  VE+Y R +G+P +T 
Sbjct: 92  KQGKLLADLAKRLGLHYVVYSGLENIKKLTAGRLA-AGHFDGKGEVEEYFRDIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             LS Y +N+ ++FLP  + +     L +P    +  +  + V D GP++  +++  P +
Sbjct: 150 VRLSCYFENLLSYFLPQKAPDGKSYLLSLPM--GDVPMDGLSVTDLGPVVLSLLKM-PEE 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + G+ + +++   T ++   +L+K TGKT +      ED  K  FP    + L  MF+  
Sbjct: 207 YVGQNIGLSTCKHTAEEYAALLSKHTGKTVRNAKTTPEDYEKYGFP--GAQDLANMFR-- 262

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
             F A+  D   +DI +  KL+P  +T EQ++
Sbjct: 263 --FYALKPD---RDIELTLKLNPKARTLEQWL 289



>gi|302911095|ref|XP_003050417.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256731354|gb|EEU44704.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 459

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/150 (32%), Positives = 85/150 (56%), Gaps = 7/150 (4%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           GK +AD AK  G+   +YSS+PD    +  ++P +  +  K+ VEQY+RKL +P+ TF Y
Sbjct: 171 GKALADAAKRAGVQHYVYSSMPDHAAYNP-EWPSLPLWAAKHEVEQYVRKLRLPS-TFVY 228

Query: 64  LSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEGP 119
              Y+ N  +   PL   E   +G      P F E+ +L  +D   D GP + +I ++GP
Sbjct: 229 TGIYNNNFTSLQYPLFCMELQRDGSFKWQAP-FHEDAKLPWLDAEHDVGPAVLQIFKDGP 287

Query: 120 TKWNGKKVPIASENVTIKQITDVLTKVTGK 149
            KW+G+++ +A E +T +++  + ++  G+
Sbjct: 288 AKWHGERIALAYEYLTPREVCRLFSRGVGR 317



>gi|281353427|gb|EFB29011.1| hypothetical protein PANDA_014027 [Ailuropoda melanoleuca]
          Length = 284

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 65/212 (30%), Positives = 116/212 (54%), Gaps = 15/212 (7%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL++++YS L +    + G+     HF GK  VE+Y R +G+P +T 
Sbjct: 80  KQGKLLADLAKRLGLHYVVYSGLENIKKLTAGRLA-AGHFDGKGEVEEYFRDIGVP-MTS 137

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             LS Y +N+ ++FLP  + +     L +P    +  +  + V D GP++  +++  P +
Sbjct: 138 VRLSCYFENLLSYFLPQKAPDGKSYLLSLPM--GDVPMDGLSVTDLGPVVLSLLKM-PEE 194

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + G+ + +++   T ++   +L+K TGKT +      ED  K  FP    + L  MF+  
Sbjct: 195 YVGQNIGLSTCKHTAEEYAALLSKHTGKTVRNAKTTPEDYEKYGFP--GAQDLANMFR-- 250

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
             F A+  D   +DI +  KL+P  +T EQ++
Sbjct: 251 --FYALKPD---RDIELTLKLNPKARTLEQWL 277



>gi|511958889|ref|XP_004797694.1| PREDICTED: nmrA-like family domain-containing protein 1 isoform X2
           [Mustela putorius furo]
 gi|511958891|ref|XP_004797695.1| PREDICTED: nmrA-like family domain-containing protein 1 isoform X3
           [Mustela putorius furo]
          Length = 292

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 118/217 (54%), Gaps = 15/217 (6%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL++++YS L +    + G+     HF GK  VE+Y R +G+P +T 
Sbjct: 85  KQGKLLADLAKRLGLHYVVYSGLENIKRLTAGRLA-AGHFDGKGEVEEYFRDIGVP-MTS 142

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             LS Y +N+ ++FLP  + +     L +P    +  +  I V D GP++  ++++ P +
Sbjct: 143 VRLSCYFENLLSYFLPQKTPDGKNYLLSLPM--GDVPMDGISVTDLGPVVLSLLKK-PEE 199

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + G+ + +++   T  +   +L+K TGK  +   +  ED  K  FP    + L  MF+  
Sbjct: 200 YVGRNIGLSTCKHTAAEYAALLSKHTGKAVRDAKVTPEDYEKYGFP--GARDLANMFR-- 255

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
             F A+  D   +DI +  +L+P  +T +Q++ +  G
Sbjct: 256 --FYALKPD---RDIELTLRLNPKARTLDQWLEQHKG 287



>gi|302915298|ref|XP_003051460.1| hypothetical protein NECHADRAFT_41150 [Nectria haematococca mpVI
           77-13-4]
 gi|256732398|gb|EEU45747.1| hypothetical protein NECHADRAFT_41150 [Nectria haematococca mpVI
           77-13-4]
          Length = 310

 Score = 93.6 bits (231), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 61/211 (28%), Positives = 109/211 (51%), Gaps = 6/211 (2%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
            K IAD+A EKG+ ++++S+LP  T  SGGKY  +  F  K   EQYIR L + +  +  
Sbjct: 96  AKRIADVAVEKGVQYIVFSTLPSVTEISGGKYTKIVPFDAKAKAEQYIRSLPVKSAFYRP 155

Query: 64  LSFYSQ-NIGTFFLPLISNENGEIDLVIPYFEENDQLLLID-VRDTGPIIAKIIEEGPTK 121
            SF    +   F+ P  + +   +  +  +     +L LID V D+G  +  ++ E P K
Sbjct: 156 GSFMENFHSQPFWGPRQAPDGTWV--ISTHMSPQTRLPLIDAVGDSGKFVGAVLAE-PEK 212

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMFKYEK 181
           + GK +  A+   +++++   ++KVTG+      +  E+ AK+ P +  +   + F+Y +
Sbjct: 213 FQGKTLSAATRLYSLEELAATMSKVTGQKVVYEQITPEEFAKEVPIM-TEIFVEAFQYYE 271

Query: 182 EFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
           EFG  G D+E      A+     + T E+++
Sbjct: 272 EFGYFGPDSESLVAWAAENARGKLSTLEEFL 302



>gi|291412075|ref|XP_002722308.1| PREDICTED: NmrA-like family domain containing 1-like [Oryctolagus
           cuniculus]
          Length = 309

 Score = 93.6 bits (231), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 65/217 (29%), Positives = 115/217 (52%), Gaps = 15/217 (6%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           RQGK++AD+AK  GL++++YS L +    + G+     HF GK  VE+Y R +G+P +T 
Sbjct: 102 RQGKLLADLAKRLGLHYVVYSGLENIRKLTAGRLA-AGHFDGKGEVEEYFRDIGVP-MTS 159

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N  ++FLP  + +     L +P    N  +  + V D GP++  +++  P +
Sbjct: 160 VRLPCYFENFLSYFLPQKAPDGKSYLLSLPM--GNVPMDGMAVSDLGPVVLSLLKN-PEE 216

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + G+ + +++   T ++   +LTK TGK  +      ED  K  FP    + L  MF+  
Sbjct: 217 YVGRNIGLSTCRHTAEEFAGLLTKHTGKVVRDAKTTPEDYEKLGFP--GAQDLANMFR-- 272

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
             F A+  D   +DI +  +L+P  +T +Q++ +  G
Sbjct: 273 --FYALKPD---RDIELTLRLNPKAQTLDQWLEQHKG 304



>gi|330928645|ref|XP_003302345.1| hypothetical protein PTT_14119 [Pyrenophora teres f. teres 0-1]
 gi|311322356|gb|EFQ89552.1| hypothetical protein PTT_14119 [Pyrenophora teres f. teres 0-1]
          Length = 313

 Score = 93.6 bits (231), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 100/190 (52%), Gaps = 2/190 (1%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +  + +   A ++G+ ++++SS  +++  +GGK  +V HF  K  +E YIR L + +  F
Sbjct: 97  QHARNVCTEAIKQGVRYIVFSSAANASEITGGKLSNVEHFDVKAEIEAYIRNLPVQSAFF 156

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
           A  SF  QN+ T   P  S E     ++     ++ ++  ID+ DTG  +  I++E P K
Sbjct: 157 APASFM-QNLHTHMRPQPSGEGDGSYVLATMLRDDTKVPFIDILDTGKFVGAILDE-PEK 214

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMFKYEK 181
           + GK +  A    T ++I +V+ +VTGK  +   + DE     FP    ++L +M+    
Sbjct: 215 YAGKYLAAAEGFYTPREIVEVMARVTGKRVRHVQVEDEVAKARFPEGLREALGEMWVLNS 274

Query: 182 EFGAIGKDNE 191
           E+G  GK+ E
Sbjct: 275 EYGYYGKEQE 284



>gi|511852737|ref|XP_004750567.1| PREDICTED: nmrA-like family domain-containing protein 1 [Mustela
           putorius furo]
 gi|511958887|ref|XP_004797693.1| PREDICTED: nmrA-like family domain-containing protein 1 isoform X1
           [Mustela putorius furo]
          Length = 379

 Score = 93.2 bits (230), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 118/217 (54%), Gaps = 15/217 (6%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL++++YS L +    + G+     HF GK  VE+Y R +G+P +T 
Sbjct: 172 KQGKLLADLAKRLGLHYVVYSGLENIKRLTAGRLA-AGHFDGKGEVEEYFRDIGVP-MTS 229

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             LS Y +N+ ++FLP  + +     L +P    +  +  I V D GP++  ++++ P +
Sbjct: 230 VRLSCYFENLLSYFLPQKTPDGKNYLLSLPM--GDVPMDGISVTDLGPVVLSLLKK-PEE 286

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + G+ + +++   T  +   +L+K TGK  +   +  ED  K  FP    + L  MF+  
Sbjct: 287 YVGRNIGLSTCKHTAAEYAALLSKHTGKAVRDAKVTPEDYEKYGFP--GARDLANMFR-- 342

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
             F A+  D   +DI +  +L+P  +T +Q++ +  G
Sbjct: 343 --FYALKPD---RDIELTLRLNPKARTLDQWLEQHKG 374



>gi|291400293|ref|XP_002716397.1| PREDICTED: hCG2041270-like [Oryctolagus cuniculus]
          Length = 309

 Score = 93.2 bits (230), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 64/216 (29%), Positives = 110/216 (50%), Gaps = 15/216 (6%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK++AD+AK  GL  +++S L +    +GG+   V HF GK  VE+Y   +G+P +T  
Sbjct: 103 QGKLVADLAKRLGLKHVVFSGLENVQKLTGGRLT-VPHFDGKGEVEEYFWSIGVP-MTSV 160

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
            L+ Y +N  T + P  +++     L IP    +  +  I V D G  I  I    P ++
Sbjct: 161 RLAAYFENFLTLWKPAKASDGDYYTLAIPM--GDVPMHGISVADAGAAILSIFNS-PEEF 217

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYEK 181
            GK V +++E +T++Q  DV +K  GK  +   +  E   K  FP    K L  M ++ +
Sbjct: 218 LGKAVGLSAEALTVQQYCDVFSKTLGKDVRDTKITPEAYEKLSFPA--AKELADMCRFYQ 275

Query: 182 EFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
                    + +D+ +  +L+P +++F Q+I +  G
Sbjct: 276 M-------QQDRDVALTHRLNPRVRSFNQFISDNLG 304



>gi|402860727|ref|XP_003894774.1| PREDICTED: nmrA-like family domain-containing protein 1-like [Papio
           anubis]
          Length = 306

 Score = 93.2 bits (230), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 69/219 (31%), Positives = 116/219 (52%), Gaps = 14/219 (6%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK++AD AK  GL  ++YS L +    + GK   V HF  K  VE+Y   +GIP +T  
Sbjct: 93  QGKLVADTAKHLGLKHVVYSGLENVKRLTDGKL-QVPHFDSKGEVEEYFWSIGIP-MTSV 150

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
            ++ Y +N  T + P+ +++     L +P    +  +  I V D G  ++ I    P ++
Sbjct: 151 RVAAYFENFLTAWRPVKASDGDYYTLAVPM--GDVPMDGISVADIGAAVSNIFNS-PEEF 207

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKD-FPTLNNKSLKQMFKYEK 181
            GK V +++E +T++Q  DVL+KV GK  KVR   D  I  + F  L   + K++    K
Sbjct: 208 LGKAVGLSAEALTVQQYADVLSKVLGK--KVR---DAKITPEVFEKLGFPAAKEIADMSK 262

Query: 182 EFGAIGKDNEL---QDITIAKKLHPNIKTFEQYILETYG 217
           E   + +  ++   +D+ +  +L+P +K+F Q+I E  G
Sbjct: 263 EIADMCRFYQMKPDRDVKLTHRLNPKVKSFSQFISENQG 301



>gi|471365464|ref|XP_004373273.1| PREDICTED: nmrA-like family domain-containing protein 1 [Trichechus
           manatus latirostris]
          Length = 299

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 116/212 (54%), Gaps = 15/212 (7%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL++++YS L +    +GGK     HF GK  VE+Y R +G+P +T 
Sbjct: 92  KQGKLLADLAKRLGLHYVVYSGLENIKKLTGGKLA-AGHFDGKGEVEEYFRDIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ ++FLP  + +     L +P    +  +  + V D GP++  ++ + P +
Sbjct: 150 VRLPCYFENLLSYFLPQKAPDGKSYLLSLPM--GDIPMDGMAVADLGPVVLSLL-KAPEE 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKT-HKVRTLNDEDIAKDFPTLNNKSLKQMFKYE 180
           + G+ + +++   T+ + T +LTK TG   H  +T  +E     FP    + L  MF+  
Sbjct: 207 YVGQNLGLSTCRHTVGEYTTLLTKHTGHAVHDAKTTPEEYEKLGFP--GAQELANMFR-- 262

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
             F A+  D   ++I +  KL+P  +T +Q++
Sbjct: 263 --FYAMKPD---RNIELTLKLNPKARTLDQWL 289



>gi|472367533|ref|XP_004403299.1| PREDICTED: nmrA-like family domain-containing protein 1 [Odobenus
           rosmarus divergens]
          Length = 299

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 114/212 (53%), Gaps = 15/212 (7%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL++++YS L +    + GK     HF GK  VE+Y R +G+P +T 
Sbjct: 92  KQGKLLADLAKSLGLHYVVYSGLENIKRLTAGKLA-AGHFDGKGEVEEYFRDIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             LS Y +N+ ++FLP  + +     L +P    +  +  + V D GP++  +++  P +
Sbjct: 150 VRLSCYFENLLSYFLPQKAPDGKSYLLSLPM--GDVPMDGVSVTDLGPVVLSLLKM-PEE 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + G+ + +++   T  +   +L+K TGKT        ED  K  FP    + L  MF+  
Sbjct: 207 YVGRNIGLSTCKHTAAEYAALLSKHTGKTVCNAKTTPEDYEKYGFP--GARDLANMFR-- 262

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
             F A+  D   +DI +  +L+P  +T +Q++
Sbjct: 263 --FYALKPD---RDIELTLRLNPKARTLDQWL 289



>gi|116251023|ref|YP_766861.1| nitrogen metabolite repression regulator [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|499970262|ref|WP_011650980.1| nitrogen metabolite repression regulator [Rhizobium leguminosarum]
 gi|115255671|emb|CAK06752.1| putative nitrogen metabolite repression regulator [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 317

 Score = 92.4 bits (228), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 121/226 (53%), Gaps = 20/226 (8%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPD-STTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           G+ +AD A E G+  L++S+L +     +G +Y    HFT K  V  YIR L I + +F 
Sbjct: 97  GRQLADAAVEAGVGHLVFSTLENVDEITNGAQY--APHFTDKARVADYIRGLPISH-SFV 153

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIP-YFEENDQLLLID-VRDTGPIIAKIIEEGPT 120
            L+F+  N+  +++P +  +     L++P Y  E+ +   +D +  TGP++ +I    P 
Sbjct: 154 MLAFFYTNLLEYYVPRMEGDT----LLLPVYLPEDFRAPFVDPLTATGPVVLEIFSN-PA 208

Query: 121 KWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDED-IAKDFPTLNN-----KSLK 174
           ++NGK +P+  + ++ +++ +   +VTG+  + R     D +   FP         + L 
Sbjct: 209 RYNGKTLPVLGDIISPREMIETFQRVTGRKAEYRNAFTRDGLLHYFPEFAANELLVRELL 268

Query: 175 QMFKYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYGKSD 220
            M +Y  E+G  GK+++L+    +++L+P+   +EQY+ +T  + D
Sbjct: 269 GMVEYAVEYGYFGKEHDLE---WSRRLNPDTLNWEQYLRKTGWRGD 311



>gi|396498104|ref|XP_003845138.1| similar to nitrogen metabolite repression regulator NmrA
           [Leptosphaeria maculans JN3]
 gi|312221719|emb|CBY01659.1| similar to nitrogen metabolite repression regulator NmrA
           [Leptosphaeria maculans JN3]
          Length = 337

 Score = 92.4 bits (228), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 66/221 (29%), Positives = 107/221 (48%), Gaps = 14/221 (6%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           G+ +AD AK+ G+   IYSS+PD +   G  +  +  +  K  VEQY+R++G+   TF Y
Sbjct: 87  GRSLADAAKKAGIQHYIYSSMPDHSV-FGNNWRALPLWAPKFTVEQYVRQIGL-QATFVY 144

Query: 64  LSFYSQNIGTFFLPLISNEN---GEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEGP 119
              Y  N      PL   E+   G      P F  N  L  +D   D GP I ++ +EGP
Sbjct: 145 CGIYHNNFTGLDFPLFRMEHQPDGSFVWQAP-FNPNQPLPWLDSEHDIGPAIIQLFKEGP 203

Query: 120 TKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTL--NNKSLKQMF 177
            KWNGK++P+A +++T K++    ++  G+  + +      I  + PT     + L  + 
Sbjct: 204 RKWNGKRIPLAFQSLTPKEVCQSFSRGLGRPVRYKR---GPIVINVPTPIGYREHLSALG 260

Query: 178 KYEKEFGA--IGKDNELQDITIAKKLHPNIKTFEQYILETY 216
               E GA   G D E    ++A +L    ++ E+Y  E +
Sbjct: 261 YTLGELGAPYFGPDLEPDFPSVALELWEGFRSMEEYAQEVF 301



>gi|66820416|ref|XP_643826.1| hypothetical protein DDB_G0275053 [Dictyostelium discoideum AX4]
 gi|60471853|gb|EAL69807.1| hypothetical protein DDB_G0275053 [Dictyostelium discoideum AX4]
          Length = 305

 Score = 92.4 bits (228), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 65/205 (31%), Positives = 108/205 (52%), Gaps = 13/205 (6%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPN----V 59
           G  IA  A   G+   ++S L      SGG+Y +V HF  K+ +E+ +RK+   N     
Sbjct: 89  GLNIAHAALAAGVKHFVFSGLAPCNKISGGRY-NVPHFDLKHKIEEELRKMSKENPSFVT 147

Query: 60  TFAYLSFYSQNIGTFFLP--LISNENGEIDLVI--PYFEENDQLLLIDVRDTGPIIAKII 115
           +F Y  FY QN  TFF P   ++    E+  V+  P   +   L + D+ D G I+A ++
Sbjct: 148 SFVYAPFYMQNFKTFFAPKRTVNEATQEVTYVLGMPLNPKMLPLDMGDINDIGSIVAVMM 207

Query: 116 EEGPTKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLK 174
           ++ PTK++GK +P + + +  ++I ++++KVTGK      +  +D A+ DFP      + 
Sbjct: 208 KD-PTKYSGKIIPFSGDCLHGEKIAEIMSKVTGKKVVYNFIEPKDFAQFDFPGAG--EMA 264

Query: 175 QMFKYEKEFGAIGKDNELQDITIAK 199
           +MF Y  EFGA  K ++ +   I K
Sbjct: 265 EMFSYYNEFGAFDKLDKTEASKITK 289



>gi|126335245|ref|XP_001369286.1| PREDICTED: nmrA-like family domain-containing protein 1-like
           [Monodelphis domestica]
          Length = 299

 Score = 91.7 bits (226), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 65/213 (30%), Positives = 115/213 (53%), Gaps = 17/213 (7%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD++K  GL+++IYS L +    +GG+   V HF GK  VE+Y R L +P ++ 
Sbjct: 92  KQGKLLADLSKRLGLSYVIYSGLENVKKLTGGRLI-VRHFDGKGEVEEYFRALDVPMIS- 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ T+FLP  + +     L +P    +  +  + V D GP++  +++  P  
Sbjct: 150 VRLPCYFENLLTYFLPQKAPDGNGYLLSLPM--GDVPMDGMAVADLGPVVLSLLKS-PEG 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKT-HKVRTLNDEDIAK-DFPTLNNKSLKQMFKY 179
           + G+ + +++   T  +   +L+K TGKT H  +T + ED  K  FP    + L  MF++
Sbjct: 207 YVGRNIGLSTCKHTATEYASLLSKYTGKTVHDAKT-SPEDYEKLGFP--GAQELANMFRF 263

Query: 180 EKEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
                     N  +D+ +  KL+P  +T EQ++
Sbjct: 264 YTM-------NPDRDVELTFKLNPKARTLEQWL 289



>gi|330919958|ref|XP_003298831.1| hypothetical protein PTT_09651 [Pyrenophora teres f. teres 0-1]
 gi|311327802|gb|EFQ93077.1| hypothetical protein PTT_09651 [Pyrenophora teres f. teres 0-1]
          Length = 332

 Score = 91.7 bits (226), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 65/218 (29%), Positives = 103/218 (47%), Gaps = 8/218 (3%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           G+ +AD AK+ G+   IYSS+PD +    G +  +  +  K  VEQY+R++G+P  TF Y
Sbjct: 87  GRSLADAAKKAGIQHYIYSSMPDHSVFGNG-WRALPLWAPKFTVEQYVRQIGLP-ATFVY 144

Query: 64  LSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPT 120
              Y  N      PL   E   +G      P+  +     L    D GP I ++ +EGP 
Sbjct: 145 CGIYHNNFTGLDFPLFRMEHQYDGSFVWQAPFHPDQPLPWLDSEHDIGPAIFQLFKEGPR 204

Query: 121 KWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMFKYE 180
           KWNGK+VP+A  ++T K++    +K   +  + R      I    PT   + L  +    
Sbjct: 205 KWNGKRVPLAFASMTPKEVCHAFSKGLRRPVRYRR-GPIMINVPTPTGYREHLSALEYTL 263

Query: 181 KEFGA--IGKDNELQDITIAKKLHPNIKTFEQYILETY 216
            E GA   G D E    +++ +L    ++ E+Y  E +
Sbjct: 264 GEKGAPYFGPDLEPDVPSVSLELWEGNRSMEEYAQEVF 301



>gi|209548370|ref|YP_002280287.1| NmrA family protein [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|501552432|ref|WP_012556944.1| NmrA family protein [Rhizobium leguminosarum]
 gi|209534126|gb|ACI54061.1| NmrA family protein [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 317

 Score = 91.7 bits (226), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 64/226 (28%), Positives = 119/226 (52%), Gaps = 20/226 (8%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGG-KYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           G+ +AD A E G+  +++S+L +  T +GG KY    HFT K  V  YIR+L I + +F 
Sbjct: 97  GRQLADAAVEAGVGHIVFSTLENVDTITGGTKY--APHFTDKARVADYIRRLPISH-SFI 153

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIP-YFEENDQLLLID-VRDTGPIIAKIIEEGPT 120
            L+F+  N+  ++ P +  +     L++P Y  E+     +D +  TGP++ +I    P 
Sbjct: 154 MLAFFYTNLLEYYAPRMEGDT----LLLPIYLPEDFAAPFVDPLTATGPVVLEIFSN-PE 208

Query: 121 KWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDED-IAKDFPTLNN-----KSLK 174
           ++NGK +PI  + ++ +++ +   +VTG   + R     D +   FP         + L 
Sbjct: 209 RYNGKTLPIVGDIISPREMVETFQRVTGLKAEYRNAFTRDGLLAYFPEFAANESFVRELL 268

Query: 175 QMFKYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYGKSD 220
            M +Y  E+G  GK+++L+    +++L+P    +EQ++  T  + D
Sbjct: 269 GMVEYAVEYGYFGKEHDLE---WSRRLNPGTLNWEQFLRTTGWRGD 311



>gi|403270480|ref|XP_003927206.1| PREDICTED: nmrA-like family domain-containing protein 1-like
           [Saimiri boliviensis boliviensis]
          Length = 296

 Score = 91.7 bits (226), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 66/217 (30%), Positives = 114/217 (52%), Gaps = 13/217 (5%)

Query: 1   ERQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVT 60
           +++GK++AD AK  GL  ++YS L +    +GGK  +V HF  K  VE+Y   LGIP +T
Sbjct: 88  DKEGKLVADTAKRLGLKHVVYSGLENVKRLTGGKL-EVPHFDAKGEVEEYFWSLGIP-MT 145

Query: 61  FAYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPT 120
              ++ Y +N  T + P  +++     L +P    +  +  I V D G  ++ I    P 
Sbjct: 146 SVRVAAYFENFLTVWKPGKASDGDYYTLALPM--GDVPMDGISVADVGAAVSSIFNS-PE 202

Query: 121 KWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMFKYE 180
           ++ GK V +++E +TI+Q  DVL+KV GK  +   +  E   K    L  K +  M ++ 
Sbjct: 203 EFLGKAVGLSAEKLTIQQYADVLSKVLGKKVRDAKITPEAYEK-LGFLAAKEVANMCRFY 261

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
           +    +  D   +D+ +  +L+P +K+F Q++ E  G
Sbjct: 262 Q----MKPD---RDVKLTHRLNPKVKSFSQFMSENQG 291



>gi|194222670|ref|XP_001497893.2| PREDICTED: nmrA-like family domain-containing protein 1-like [Equus
           caballus]
          Length = 313

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 65/216 (30%), Positives = 111/216 (51%), Gaps = 15/216 (6%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK++AD AK  G+  +++S L +    SGGK  +V HF  K  VE+Y   +G+P +T  
Sbjct: 107 QGKLVADAAKRLGVKHVVFSGLENVKRLSGGKL-EVPHFDAKGEVEEYFWSIGVP-MTSV 164

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
            ++ Y +N  T + P+ +++     L IP    +  +  I V D G ++  I    P ++
Sbjct: 165 RVAAYFENFLTTWKPVKASDGDYYTLAIPM--GDVPMDGISVADVGAVVCSIFNS-PEEF 221

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYEK 181
            GK V +++E +TI+Q  DVL+KV GK  +   +  E   K   P    K +  M ++  
Sbjct: 222 VGKAVGLSAEALTIQQYADVLSKVLGKDIRDAKMTPEAYEKLGIPV--GKEIANMCRFY- 278

Query: 182 EFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
                 +    +D+ +  +L+P +K+F Q+I E  G
Sbjct: 279 ------QTRPDRDVKLTHRLNPKVKSFSQFISENKG 308



>gi|507536501|ref|XP_004652283.1| PREDICTED: nmrA-like family domain-containing protein 1 [Jaculus
           jaculus]
          Length = 299

 Score = 91.3 bits (225), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 120/218 (55%), Gaps = 15/218 (6%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL++++YS L +    + G+     HF GK  VE+Y R +G+P +T 
Sbjct: 92  KQGKLLADLAKRLGLHYVVYSGLENIRKLTAGRLA-AGHFDGKGEVEEYFRDIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ ++FLP  + +     L +P    +  +  I V D GP++  ++++ P +
Sbjct: 150 VRLPCYFENLLSYFLPQKAPDGKSYLLDLPM--GDVPMDGIAVSDLGPVVLSLLKK-PEE 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKT-HKVRTLNDEDIAKDFPTLNNKSLKQMFKYE 180
           + G+ + +++   T ++   +LT+ TGKT H  +T  ++     FP    + L  MF+  
Sbjct: 207 YVGQNIGLSTCRHTAEEYAALLTRHTGKTVHHAKTTPEDYEKHGFP--GARDLANMFR-- 262

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYGK 218
             F A+   N  ++I +  +L+P  +T +Q++ +  G+
Sbjct: 263 --FYAL---NPERNIELTLRLNPKARTLDQWLQQHKGE 295



>gi|495089609|ref|WP_007814432.1| NmrA-like family protein [Rhizobium sp. CF142]
 gi|397326245|gb|EJJ30566.1| NmrA-like family protein [Rhizobium sp. CF142]
          Length = 317

 Score = 91.3 bits (225), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 64/226 (28%), Positives = 119/226 (52%), Gaps = 20/226 (8%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGG-KYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           G+ +AD A E G+  +++S+L +    SGG KY    HFT K  V  YIR L I + +F 
Sbjct: 97  GRQLADAAVEAGVGHIVFSTLENVDVISGGTKY--APHFTDKARVADYIRGLPISH-SFV 153

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIP-YFEENDQLLLID-VRDTGPIIAKIIEEGPT 120
            L+F+  N+  ++ P +  +     LV+P Y  E+ +   +D +  TGP + +I    P 
Sbjct: 154 MLAFFYTNLLEYYPPRMEGDT----LVLPIYLPEDFRAPFVDPLTATGPAVLEIFSN-PE 208

Query: 121 KWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDED-IAKDFPTLNN-----KSLK 174
           ++NGK +PI  + ++ +++ +   +VTG   + R     D + + FP         + L 
Sbjct: 209 RYNGKTLPIVGDVISPREMVETFREVTGLKAEYRNAFTRDGLLRHFPEFGANELFVRELL 268

Query: 175 QMFKYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYGKSD 220
            M +Y  E+G  G++++L+    +++L+P+   ++QY+  T  + D
Sbjct: 269 GMVEYAVEYGYFGREHDLE---WSRRLNPDTLDWKQYLRTTGWRGD 311



>gi|126314450|ref|XP_001377245.1| PREDICTED: nmrA-like family domain-containing protein 1-like
           [Monodelphis domestica]
          Length = 299

 Score = 91.3 bits (225), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 65/214 (30%), Positives = 115/214 (53%), Gaps = 15/214 (7%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK +AD +K+ GL  ++YS L +    + GK  +V HF GK  VE+Y   +G+P +T 
Sbjct: 92  KQGKTVADASKQLGLEHVVYSGLENVKKLTKGKL-EVPHFDGKGEVEEYFWSIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             ++ Y +N    + P+ +++    +L++P   ++  +  I + D GP +A I    P +
Sbjct: 150 VRIAPYFENFLNLWKPVKASDGDYYNLMLPM--KDIPMDGICIADIGPAVASIFRS-PEE 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + GK V +++E +TI+Q  D+L+K  GK  K   +  E   K  FP    K +  M +  
Sbjct: 207 FLGKAVGLSAEALTIQQYADILSKTLGKVVKDSKITPEAYEKLGFP--GAKEIANMMR-- 262

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYILE 214
             F  +  D   +D+ +  KL+P +K+F Q++ E
Sbjct: 263 --FYHMKPD---RDVQLTHKLNPKVKSFSQFVSE 291



>gi|57088489|ref|XP_547146.1| PREDICTED: NmrA-like family domain containing 1 [Canis lupus
           familiaris]
          Length = 300

 Score = 90.9 bits (224), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 63/212 (29%), Positives = 114/212 (53%), Gaps = 15/212 (7%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++A++AK  GL++++YS L +    + G+     HF GK  VEQY R +G+P +T 
Sbjct: 93  KQGKLLANVAKRLGLHYVVYSGLENIKKLTAGRLA-AGHFDGKGEVEQYFRDIGVP-MTS 150

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             LS Y +N+ ++FLP  + +     L +P    +  +  I V D GP++  +++  P +
Sbjct: 151 VRLSCYFENLLSYFLPKKAPDGKSYLLSLPM--GDVPMDGISVTDLGPVVLSLLKM-PEE 207

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKD-FPTLNNKSLKQMFKYE 180
           + G+ + +++   T ++   +L+K TGK         ED  K  FP    + L  MF+  
Sbjct: 208 YVGRNIGLSTCKHTAEEYAALLSKHTGKAVCDAKTTPEDYEKQGFP--GARDLANMFR-- 263

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
             F A+  D   +DI +  +L+P  +T +Q++
Sbjct: 264 --FYALKPD---RDIELTLRLNPKARTLDQWL 290



>gi|348584864|ref|XP_003478192.1| PREDICTED: LOW QUALITY PROTEIN: nmrA-like family domain-containing
           protein 1-like [Cavia porcellus]
          Length = 297

 Score = 90.5 bits (223), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 118/217 (54%), Gaps = 15/217 (6%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL++++YS L +    + GK     HF GK  VE+Y R +G+P +T 
Sbjct: 91  KQGKLLADLAKRLGLHYIVYSGLENIKKLTAGKLA-AGHFDGKGEVEEYFRDIGVP-MTS 148

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ ++FLP  + +     L +P    +  +  + V D GP++  +++  P +
Sbjct: 149 VRLPCYFENLLSYFLPQKAPDGKSYLLNLPM--GDIPMDGMAVSDLGPVVLSLLKM-PEE 205

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + G+ + +++   T ++   +LT+ TGKT     +  ED  K DFP   +  L  MF+  
Sbjct: 206 YVGQNIGLSTCRHTAEEYAALLTRHTGKTVHHTKITPEDYEKLDFP--GSCDLANMFR-- 261

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
             F A+  D   ++I +  +L+P  +T +Q++ +  G
Sbjct: 262 --FYAMKPD---RNIELTLRLNPKAQTLDQWLEQHKG 293



>gi|296224516|ref|XP_002758025.1| PREDICTED: nmrA-like family domain-containing protein 1-like
           [Callithrix jacchus]
          Length = 299

 Score = 90.5 bits (223), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 67/216 (31%), Positives = 112/216 (51%), Gaps = 13/216 (6%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD AK  GL  ++YS L +    +GGK  +V HF GK   E+Y   LGIP +T 
Sbjct: 92  QQGKLVADTAKRLGLKHVVYSGLENVKRLTGGKL-EVPHFDGKGEAEEYFWSLGIP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             ++ Y +N  T + P  +++     L +P    +  +  I V D G  ++ I    P +
Sbjct: 150 VRVAAYFENFLTAWKPEKASDGDYYILALPM--GDVPMDGISVADVGAAVSSIFNS-PEE 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMFKYEK 181
           + GK V +++E +TI+Q  DVL+KV GK  +   +  E   K    L  K +  M  + +
Sbjct: 207 FLGKAVGLSAEKLTIQQYADVLSKVLGKEVRDAKITPEAYEK-LEYLAGKEVANMCLFYQ 265

Query: 182 EFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
               +  D   +D+ +  +L+P +K+F Q++ E  G
Sbjct: 266 ----MKPD---RDVKLTHRLNPKVKSFSQFMSENQG 294



>gi|451999959|gb|EMD92421.1| hypothetical protein COCHEDRAFT_1021212 [Bipolaris maydis C5]
 gi|477591038|gb|ENI08111.1| hypothetical protein COCC4DRAFT_30711 [Bipolaris maydis ATCC 48331]
          Length = 337

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 75/144 (52%), Gaps = 5/144 (3%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           G+ +AD AK+ G+   IYSS+PD +    G +  +  +  K  VEQY+R++G+P  TF Y
Sbjct: 87  GRALADAAKKAGIQHYIYSSMPDHSVFGQG-WKALPMWAPKFTVEQYVRQIGLP-ATFVY 144

Query: 64  LSFYSQNIGTFFLPLISNEN---GEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPT 120
              Y  N      PL   E+   G      P+  +     L    D GP I ++ +EGP 
Sbjct: 145 CGAYHNNFTGLDFPLFRMEHQYDGSFVWQAPFHPDQPLPWLDSEHDVGPAIFQLFKEGPR 204

Query: 121 KWNGKKVPIASENVTIKQITDVLT 144
           KWNGK++P+A  ++T +Q+    +
Sbjct: 205 KWNGKRIPLAFASMTPRQVCKAFS 228



>gi|451854041|gb|EMD67334.1| hypothetical protein COCSADRAFT_83484 [Bipolaris sorokiniana
           ND90Pr]
          Length = 332

 Score = 90.1 bits (222), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 75/144 (52%), Gaps = 5/144 (3%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           G+ +AD AK+ G+   IYSS+PD +    G +  +  +  K  VEQY+R++G+P  TF Y
Sbjct: 87  GRALADAAKKAGIQHYIYSSMPDHSVFGQG-WKALPMWAPKFTVEQYVRQIGLP-ATFVY 144

Query: 64  LSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPT 120
              Y  N      PL   E   +G      P+  +     L    D GP I ++ +EGP 
Sbjct: 145 CGAYHNNFTGLDFPLFRMEHQYDGSFVWQAPFHPDQPLPWLDSEHDVGPAIFQLFKEGPR 204

Query: 121 KWNGKKVPIASENVTIKQITDVLT 144
           KWNGK++P+A  ++T +Q+    +
Sbjct: 205 KWNGKRIPLAFASMTPRQVCKAFS 228



>gi|330805814|ref|XP_003290872.1| hypothetical protein DICPUDRAFT_38177 [Dictyostelium purpureum]
 gi|325078957|gb|EGC32581.1| hypothetical protein DICPUDRAFT_38177 [Dictyostelium purpureum]
          Length = 305

 Score = 90.1 bits (222), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 70/214 (32%), Positives = 104/214 (48%), Gaps = 14/214 (6%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPN----V 59
           GK   D A    +  L++SSL  +   SGG+Y  V HF  KN VE+Y R+L   +     
Sbjct: 93  GKKAVDAALAAKIGHLVFSSLAPANKISGGRY-HVPHFDEKNAVEEYARELSKKHPEFKS 151

Query: 60  TFAYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEEND-QLLLIDVRDTGPIIAKIIEEG 118
           +F Y  FY QN  TFF  +    + E  L +P    +   L + D+ D GPI+  I    
Sbjct: 152 SFVYAPFYMQNFNTFF-KVQKGADNEYSLSLPVDPSSKFPLDMADIDDIGPIVKGIFSN- 209

Query: 119 PTKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMFK 178
           PTK+ G  VP +   +T  +I   ++K +GK  K   +  +  AK  P      + +MF 
Sbjct: 210 PTKYAGLSVPFSGSALTGDEIAQAISKNSGKPVKFNYVPTDIFAKA-PFPGASEMAEMFA 268

Query: 179 YEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
           Y  EFGA  K N+     + K+L   + TF+Q++
Sbjct: 269 YYNEFGAFDKLNK----DLGKELT-TLTTFDQFL 297



>gi|395839821|ref|XP_003792774.1| PREDICTED: nmrA-like family domain-containing protein 1-like
           [Otolemur garnettii]
          Length = 299

 Score = 89.7 bits (221), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 64/213 (30%), Positives = 107/213 (50%), Gaps = 15/213 (7%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGKM+A +AK  GL  +++S L +    SGGK  +V HF GK  VE+Y   +G+P +T  
Sbjct: 93  QGKMVAQVAKRLGLKHVVFSGLENVKRLSGGKL-EVPHFDGKGEVEEYFWSIGVP-MTSV 150

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
            ++ Y +N  T + P  + +     L +P    +  +  I V D G ++  I    P ++
Sbjct: 151 RVAAYFENFLTMWKPAKAPDGDYYTLALPM--GDVPMDGISVTDVGAVVTSIFNS-PEEF 207

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYEK 181
            GK V +++E +TI+Q  D+L+K  GK  +   +  E   K  FP     +   +F   K
Sbjct: 208 IGKAVGLSAEALTIQQYADILSKCLGKDIRDAKITPEAYKKLGFPAAEEIANMCLFYQMK 267

Query: 182 EFGAIGKDNELQDITIAKKLHPNIKTFEQYILE 214
                      +D+ +  +L+P +K+F Q+I E
Sbjct: 268 ---------PDRDVKLTHRLNPKVKSFSQFISE 291



>gi|494825896|gb|EON63026.1| hypothetical protein W97_02252 [Coniosporium apollinis CBS 100218]
          Length = 344

 Score = 89.7 bits (221), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 64/222 (28%), Positives = 104/222 (46%), Gaps = 16/222 (7%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           G+ +AD AK+  +  LIYSS+PD +    G +  +  +  K  +E YIR++G+P  TF Y
Sbjct: 88  GRSMADAAKKARVQHLIYSSMPDHSIYGKG-WRALPLWAQKFTIENYIRQIGLP-ATFIY 145

Query: 64  LSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEGP 119
              Y  N  +   PL   E   +       P F  ND+L  +D   D GP + +I +EGP
Sbjct: 146 CGIYHNNFTSLAYPLFRMELQPDRSFIWQAP-FHPNDKLPWLDAEHDVGPAVLQIFKEGP 204

Query: 120 TKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMFKY 179
            KW+G ++P+A E++T +++    ++     H+  T     I  D P       + +   
Sbjct: 205 RKWSGHRIPLAFEHLTPREVCQAFSRA---LHRPVTYVRGPICIDVPVPTGYR-EHLEAL 260

Query: 180 EKEFGAI-----GKDNELQDITIAKKLHPNIKTFEQYILETY 216
           E+  G +     G D E      A KL    ++ E+Y  E +
Sbjct: 261 EQTLGQMRAPYFGPDLEENCTAEAWKLWEGPRSIEEYAGEAF 302



>gi|115496758|ref|NP_001069500.1| nmrA-like family domain-containing protein 1 [Bos taurus]
 gi|122142427|sp|Q0VCN1.1|NMRL1_BOVIN RecName: Full=NmrA-like family domain-containing protein 1
 gi|111305019|gb|AAI20090.1| NmrA-like family domain containing 1 [Bos taurus]
 gi|296473488|tpg|DAA15603.1| TPA: nmrA-like family domain-containing protein 1 [Bos taurus]
          Length = 299

 Score = 89.7 bits (221), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 64/215 (29%), Positives = 116/215 (53%), Gaps = 21/215 (9%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL +++YS L +    + G+   V HF GK  VE+Y R +G+P +T 
Sbjct: 92  KQGKLLADLAKRLGLRYVVYSGLENIKKLTAGRL-TVGHFDGKGEVEEYFRDIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLID---VRDTGPIIAKIIEEG 118
             L  Y +N+ ++FLP  + +     L +P  +     + ID   V D GP++  +++  
Sbjct: 150 VRLPCYFENLLSYFLPQKAPDGRSYLLSLPMGD-----VPIDGMSVADLGPVVLSLLKT- 203

Query: 119 PTKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMF 177
           P ++ G+ + +++   T+++   +LTK TGK  +    + ED  K  FP    + L  MF
Sbjct: 204 PEEYVGRNIGLSTCRHTVEEYAALLTKHTGKAVRDAKTSPEDYEKLGFP--GAQDLANMF 261

Query: 178 KYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
           +    F A+  D   ++I +  KL+P  +  +Q++
Sbjct: 262 R----FYALKPD---RNIELTLKLNPKARRLDQWL 289



>gi|345560444|gb|EGX43569.1| hypothetical protein AOL_s00215g305 [Arthrobotrys oligospora ATCC
           24927]
          Length = 375

 Score = 89.7 bits (221), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 67/226 (29%), Positives = 107/226 (47%), Gaps = 18/226 (7%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNV--TF 61
           G  +A  AKE G+   IYSSL D     G   P + ++  K+ VE+YIR   + ++  TF
Sbjct: 97  GMSLAKAAKEAGIKHYIYSSLTDHKKCWGNHLPHLPYWATKHQVEEYIRSELLKDMPTTF 156

Query: 62  AYLSFYSQNIGTFF-LPLIS------NENGEIDLVIPYFEENDQLLLIDV-RDTGPIIAK 113
            Y   Y+ N  TF  LPL         + G      P F+E+ ++  +D   DTGP + +
Sbjct: 157 VYAGIYNNNFSTFHHLPLWELQLADEKDGGGFVWTAP-FDEDYKMPFLDAEHDTGPAVIQ 215

Query: 114 IIEEGPTKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSL 173
           I+++GP KWNG ++P+A E +  ++I  V TK   +    +    E  AK    L +  +
Sbjct: 216 ILKDGPQKWNGARIPLAFEYLNPREIAAVFTKALNRPFTYKKAGLEIKAK----LPDGYM 271

Query: 174 KQMFKYEKEFGAIGKDNELQDITI---AKKLHPNIKTFEQYILETY 216
            Q+    + FG    D     +T    A+K+    +  E+Y  E +
Sbjct: 272 TQVLAIAELFGTHRADYFPPGMTAPGPARKIWRGWRGLEEYAREVF 317



>gi|332240202|ref|XP_003269279.1| PREDICTED: nmrA-like family domain-containing protein 1 [Nomascus
           leucogenys]
          Length = 299

 Score = 89.7 bits (221), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 62/212 (29%), Positives = 113/212 (53%), Gaps = 15/212 (7%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+A+  GL++++YS L +    + G+     HF GK  VE+Y R +G+P +T 
Sbjct: 92  KQGKLLADLARRLGLHYVVYSGLENIKKLTAGRLA-AAHFDGKGEVEEYFRDIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             LS Y +N+ + FLP  + +     L +P    +  +  + V D GP++  +++  P K
Sbjct: 150 VRLSCYFENLLSHFLPRKAPDGKSYLLSLP--TGDVPMDGMSVSDLGPVVLSLLKM-PEK 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + G+ + +++ +   ++   +LTK TGK      +  ED  K  FP    + L  MF+  
Sbjct: 207 YVGQNIGLSTCSTRAEEYAALLTKHTGKVVHDAKVGPEDYEKLGFP--GARDLANMFR-- 262

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
             F A+  D   +DI +  +L+P   T +Q++
Sbjct: 263 --FYALRPD---RDIQLTLRLNPKALTLDQWL 289



>gi|504129500|ref|XP_004577778.1| PREDICTED: nmrA-like family domain-containing protein 1-like
           [Ochotona princeps]
          Length = 299

 Score = 89.7 bits (221), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 61/213 (28%), Positives = 112/213 (52%), Gaps = 13/213 (6%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           RQGK++AD++K  GL  +++S L      SGG+     HF GK  VE+Y   +G+P +T 
Sbjct: 92  RQGKLVADLSKHLGLKHVVFSGLEHVHKLSGGRLT-APHFDGKGEVEEYFWSIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             +  Y +N   ++ P+ +++     L +P    +  +  I V D G +I+ I    P +
Sbjct: 150 VRVGAYYENFSNWWKPVKASDGDYYTLKLPM--GDVPIDSISVADAGVVISNIFNS-PEE 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMFKYEK 181
           + GK V +++E +T++Q  D+L+K  GK  +   +  E   K    LN +  K++    +
Sbjct: 207 FIGKAVGLSAEALTMQQYADILSKSLGKDIRDSKMTPEAYEK----LNFRGAKELADMCR 262

Query: 182 EFGAIGKDNELQDITIAKKLHPNIKTFEQYILE 214
            F    +    +DI +  +L+P I++F+Q++ E
Sbjct: 263 FF----QKKPDRDIKLTHQLYPKIRSFQQFVSE 291



>gi|497679854|ref|WP_009994038.1| hypothetical protein [Rhizobium etli]
          Length = 248

 Score = 89.4 bits (220), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 118/226 (52%), Gaps = 20/226 (8%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGG-KYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           G+ +AD A E G+  +++S+L +    +GG KY    HFT K  V  YIR L + + +F 
Sbjct: 28  GRQLADAAVEAGVGHIVFSTLENVDKITGGTKY--APHFTDKASVADYIRGLPVSH-SFI 84

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIP-YFEENDQLLLID-VRDTGPIIAKIIEEGPT 120
            L+F+  N+  ++ P +  +     L++P Y  E+     +D +  TGP++ +I    P 
Sbjct: 85  MLAFFYTNLIEYYAPRMEGDT----LLLPIYLPEDFAAPFVDPLTATGPVVLEIFSN-PE 139

Query: 121 KWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLND-EDIAKDFPTLNN-----KSLK 174
           ++NGK +P+  E ++ +++ +   +VTG+  + R   D E +   FP         + L 
Sbjct: 140 RYNGKTLPVIGEIISPREMVETFQRVTGRKAEYRNAFDREGLLNYFPEFAANEFFVRELL 199

Query: 175 QMFKYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYGKSD 220
            M +Y  E+G  GK+++L+    +++L P    +EQ++  +  + D
Sbjct: 200 GMVEYAVEYGYFGKEHDLE---WSRRLAPETLNWEQFLRTSGWRGD 242



>gi|242810577|ref|XP_002485609.1| NmrA family transcriptional regulator, putative [Talaromyces
           stipitatus ATCC 10500]
 gi|218716234|gb|EED15656.1| NmrA family transcriptional regulator, putative [Talaromyces
           stipitatus ATCC 10500]
          Length = 323

 Score = 89.4 bits (220), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 65/192 (33%), Positives = 94/192 (48%), Gaps = 9/192 (4%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK +AD  KE G+  LI+SSL   +  +GGK P+V HF GK  VEQYIR  GIP  TF 
Sbjct: 113 QGKAVADACKETGVKHLIFSSLRSISEVTGGKLPNVLHFEGKAEVEQYIRDSGIP-ATFV 171

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEGPTK 121
               +   +      +I   +    L +P   E  ++ + DV  DTG  +  +I   P  
Sbjct: 172 LAGLFMTGLSG---SMIQKRDDIWTLALPVNPEKAKIPVFDVEEDTGKFVKAVITHFPDT 228

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFP-TLNNKSLKQMFKYE 180
             GK++ +A++ +T KQ+TD L +  G       + +E      P  +  + L+ M   E
Sbjct: 229 I-GKRILMATDYLTPKQVTDELAETFGVKAAAVQIPEETFKSFLPGPIAQEMLENMLVLE 287

Query: 181 KE--FGAIGKDN 190
           KE  FG  G D 
Sbjct: 288 KEGYFGGEGLDQ 299



>gi|395836067|ref|XP_003790990.1| PREDICTED: nmrA-like family domain-containing protein 1 [Otolemur
           garnettii]
          Length = 306

 Score = 89.0 bits (219), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 63/212 (29%), Positives = 115/212 (54%), Gaps = 15/212 (7%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL++++YS L +    + G+     HF GK  VEQY R +G+P +T 
Sbjct: 99  KQGKLLADLAKHLGLHYVVYSGLENIKKLTAGRL-TAGHFDGKGEVEQYFRDIGVP-MTS 156

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ ++FLP  +++     L +P    +  +  + V D GP++  +++  P +
Sbjct: 157 VRLPCYFENLLSYFLPQKASDGKSYLLSLPM--GDVPMDGMAVADLGPVVLSLLKM-PEE 213

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + G+ + +++   T ++   +LTK  GKT +      ED  K  FP    + L  MF+  
Sbjct: 214 YIGQNIGLSTCRHTAEEYAALLTKHIGKTVRDAKTTPEDYEKLGFP--GAQDLANMFR-- 269

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
             F A+  D   ++I +  KL+P  +T +Q++
Sbjct: 270 --FYALRPD---RNIDLTFKLNPKARTLDQWL 296



>gi|507659588|ref|XP_004705894.1| PREDICTED: nmrA-like family domain-containing protein 1 [Echinops
           telfairi]
          Length = 299

 Score = 89.0 bits (219), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 61/212 (28%), Positives = 114/212 (53%), Gaps = 15/212 (7%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL +++YS L +    +GGK   V HF GK  VE+Y R +G+P ++ 
Sbjct: 92  KQGKLLADLAKRLGLRYVVYSGLENIQKLTGGKLC-VGHFDGKGQVEEYFRAIGVPMIS- 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ ++FLP  + +     L +P    +  +  + V D GP++  ++ + P +
Sbjct: 150 VRLPCYFENLLSYFLPKKAPDGKSYLLSLPM--GDIPMDGMAVADLGPVVLSLL-KAPEE 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKT-HKVRTLNDEDIAKDFPTLNNKSLKQMFKYE 180
           + G+ + +++   T  +   +L+K  GK  H  +T  +E     FP    + L  MF+  
Sbjct: 207 YVGQDIGLSTCRHTPAEYAALLSKHLGKAVHDAKTTPEEYEKLGFP--GAQDLANMFR-- 262

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
             F A+  D   ++I +  +L+P  +T +Q++
Sbjct: 263 --FYALKPD---RNIGLTLRLNPRARTLDQWL 289



>gi|482807059|gb|EOA84111.1| hypothetical protein SETTUDRAFT_92742 [Setosphaeria turcica Et28A]
          Length = 332

 Score = 89.0 bits (219), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 78/154 (50%), Gaps = 7/154 (4%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           G+ +AD AK+  +   IYSS+PD +    G +  +  +  K  VEQY+R++G+P  TF Y
Sbjct: 87  GRALADAAKKACIQHYIYSSMPDHSVFGHG-WKALPMWAPKFTVEQYVRQIGLP-ATFVY 144

Query: 64  LSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPT 120
              Y  N      PL   +   +G      P+  +     L    D GP I ++ +EGP 
Sbjct: 145 CGIYHNNFTGLDFPLFCMQHQYDGSFVWQAPFHPDQPLPWLDSEHDVGPAIFQLFKEGPR 204

Query: 121 KWNGKKVPIASENVTIKQITDVLTKVTGKTHKVR 154
           KWNGK+VP+A  ++T K++    +  TG    VR
Sbjct: 205 KWNGKRVPLAFASMTPKEVCKAFS--TGLRRPVR 236



>gi|497745513|ref|WP_010059697.1| hypothetical protein [Rhizobium etli]
          Length = 324

 Score = 88.6 bits (218), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 61/226 (26%), Positives = 118/226 (52%), Gaps = 20/226 (8%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGG-KYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           G+ +AD A E G+  +++S+L +    +GG KY    HFT K  V  YIR L I + +F 
Sbjct: 104 GRQLADAAVEAGVGHIVFSTLENVDKITGGTKY--APHFTDKASVADYIRGLPISH-SFI 160

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIP-YFEENDQLLLID-VRDTGPIIAKIIEEGPT 120
            L+F+  N+  +++P +  +     L++P Y  E+     +D +  TGP++ +I    P 
Sbjct: 161 MLAFFYTNLLEYYVPRMEGDT----LLLPIYLPEDFAAPFVDPLTATGPVVLEIFSH-PE 215

Query: 121 KWNGKKVPIASENVTIKQITDVLTKVTGKTHKVR-TLNDEDIAKDFPTLNN-----KSLK 174
           ++NGK +PI  + ++ +++ +   +VTG+  + R     E +   FP         + + 
Sbjct: 216 RYNGKTLPIVGDIISPREMVETFQRVTGRKAEYRNAFTREGLLTYFPEFAANELLVREIL 275

Query: 175 QMFKYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYGKSD 220
            M +Y  E+G  GK+++L+    +++L P    +EQ++  +  + D
Sbjct: 276 GMVEYAVEYGYFGKEHDLE---WSRRLAPETLNWEQFLRTSGWRGD 318



>gi|399171477|emb|CCE27667.1| probable nitrogen metabolic regulation protein nmr [Claviceps
           purpurea 20.1]
          Length = 462

 Score = 88.6 bits (218), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 83/156 (53%), Gaps = 8/156 (5%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           G  +AD AK+ G+   IYSS+PD    +   +P +  +  K+ VE Y+R+L +P  TF Y
Sbjct: 171 GMALADAAKKAGVQHYIYSSMPDHAAYNE-DWPSLPLWAAKHKVEDYVRELNLP-ATFVY 228

Query: 64  LSFYSQNIGTFFLPLIS---NENGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEGP 119
              Y+ N  +   PL      E+G      P F E+ +L  +D   D GP I ++ ++GP
Sbjct: 229 TGIYNNNFTSLTYPLFCMELQEDGSFIWQAP-FHEDAKLPWLDAEHDVGPAILQVFKDGP 287

Query: 120 TKWNGKKVPIASENVTIKQITDVLTKVTGK-THKVR 154
           T+W G ++ +A E +T K+   + ++  G+  H +R
Sbjct: 288 TRWRGHRIALAYEYLTPKEACRLFSRGVGRPVHYIR 323



>gi|294656995|ref|XP_002770363.1| DEHA2D19008p [Debaryomyces hansenii CBS767]
 gi|199431881|emb|CAR65717.1| DEHA2D19008p [Debaryomyces hansenii CBS767]
          Length = 310

 Score = 88.6 bits (218), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 71/212 (33%), Positives = 108/212 (50%), Gaps = 7/212 (3%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK I D A   G+ +LI+S+  + T  + GK   VT F  K  +E+YIR L I +  +A
Sbjct: 96  QGKAITDEAVAAGVQYLIWSTSTNVTKITDGKLKCVTQFDVKAEIEEYIRSLPIRSAFYA 155

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIP-YFEENDQLLLID-VRDTGPIIAKIIEEGPT 120
             SF  QN  T   P   + +G+   VI   F+   ++  ID V DTG  IA I+EE P 
Sbjct: 156 PGSFM-QNFHTQMKP---HPSGDGTYVISNIFKPETKIPFIDIVGDTGKFIAPILEE-PD 210

Query: 121 KWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMFKYE 180
           K+  K    A +  +++++T  L+ VTGK    + + +E      P      L QMFKY 
Sbjct: 211 KYEDKVFYAAVKLYSLEEVTRALSAVTGKIVNYKQVAEEVFHGFLPPTFADELIQMFKYL 270

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
           +++G  G   E      +K++H  + T E+Y+
Sbjct: 271 RDYGYYGPSTEEAVEWTSKQVHRKLTTIEEYL 302



>gi|488558962|ref|XP_004469734.1| PREDICTED: nmrA-like family domain-containing protein 1-like
           [Dasypus novemcinctus]
          Length = 299

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/217 (28%), Positives = 110/217 (50%), Gaps = 15/217 (6%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD A+  GL  ++YS L +    SGG+   V HF GK  VE+Y   +G+P +T 
Sbjct: 92  QQGKLVADAARRLGLQHVVYSGLENVQRLSGGRLA-VPHFDGKGEVEEYFWAIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             ++ Y +N  T + P+ + +     L +P    +  +  I V D G  ++ +    P +
Sbjct: 150 VRVAAYFENFVTMWKPVKAPDGDYYTLALPM--GDIPMDGISVADVGAAVSSVFNS-PGE 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + GK V +++E +T++Q  +VL+K  GK  +   +  E   K  FP    K +  M ++ 
Sbjct: 207 FLGKAVGLSAEALTVQQYAEVLSKGLGKEVRDAKITPEAYEKLGFP--EAKEIADMCRFY 264

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
                       +D+ +  +L+P +K+F Q+I E  G
Sbjct: 265 -------HTRPDRDVKLTHRLNPKVKSFSQFISENQG 294



>gi|507631176|ref|XP_004627865.1| PREDICTED: LOW QUALITY PROTEIN: nmrA-like family domain-containing
           protein 1 [Octodon degus]
          Length = 305

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 64/216 (29%), Positives = 115/216 (53%), Gaps = 18/216 (8%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK++AD+AK  GL++++YS L +    + G+     HF GK  VE+Y R +G+P +T  
Sbjct: 102 QGKLLADLAKSLGLHYVVYSGLENIKKLTAGRLA-AGHFDGKGEVEEYFRDIGVP-MTSV 159

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
            L  Y +N  +FFLP    +     L +P    ++ +  + V D GP++  +++  P ++
Sbjct: 160 RLPCYFENFLSFFLP---XDGKSYLLNLPM--GDNPMDGMAVSDLGPVVLSLLKR-PEEY 213

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYEK 181
            G+ + +++   T ++   +LTK TGKT     +  ED  K  FP    + L  MF+   
Sbjct: 214 VGQNIGLSTCRHTAEEYAALLTKYTGKTVHHTKITPEDYEKLGFP--GARDLANMFR--- 268

Query: 182 EFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
            F A+  D   ++I +  +L+P  +T +Q++ +  G
Sbjct: 269 -FYALNPD---RNIELTLRLNPKAQTLDQWLEQHKG 300



>gi|489676114|ref|WP_003580354.1| putative nucleoside-diphosphate sugar epimerase [Rhizobium
           leguminosarum]
 gi|393179928|gb|EJC79967.1| putative nucleoside-diphosphate sugar epimerase [Rhizobium
           leguminosarum bv. trifolii WSM2297]
          Length = 317

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 118/226 (52%), Gaps = 20/226 (8%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGG-KYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           G+ +AD A E G+  +++S+L +    +GG KY    HFT K  V  YIR L I + +F 
Sbjct: 97  GRQLADAAAEAGVGHIVFSTLENVDKIAGGTKY--APHFTDKARVADYIRGLPISH-SFI 153

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIP-YFEENDQLLLID-VRDTGPIIAKIIEEGPT 120
            L+F+  N+  ++ P +  +     L++P Y  E+     +D +  TGP++ +I    P 
Sbjct: 154 MLAFFYTNLLEYYAPRMEGDT----LLLPIYLPEDFAAPFVDPLTATGPVVLEIFSN-PE 208

Query: 121 KWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDED-IAKDFPTLNN-----KSLK 174
           ++NGK +PI  + ++ +++ +   +VTG   + R     D +   FP  +      + + 
Sbjct: 209 RYNGKTLPIVGDIISPREMVETFQRVTGLKAEYRNAFTRDGLLHYFPDFSANEFLVREIL 268

Query: 175 QMFKYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYGKSD 220
            M +Y  E+G  GK+++L+    +++L+P    +EQ++  T  + D
Sbjct: 269 GMVEYAVEYGYFGKEHDLE---WSRRLNPETLNWEQFLRTTGWRGD 311



>gi|444731765|gb|ELW72111.1| NmrA-like family domain-containing protein 1 [Tupaia chinensis]
          Length = 298

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/212 (29%), Positives = 114/212 (53%), Gaps = 15/212 (7%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL++++YS L +    + GK   V HF GK  VE+Y R +G+P +T 
Sbjct: 91  KQGKLLADLAKRLGLHYVVYSGLENVRKLTAGKLV-VGHFDGKGEVEEYFRDIGVP-MTS 148

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ ++FLP  + +     L +P    +  +  + V D GP++  +++  P +
Sbjct: 149 VRLPCYFENLLSYFLPRKAPDGKSYLLSLPL--GDVPMDGMAVTDLGPVVLTLLKT-PEE 205

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKT-HKVRTLNDEDIAKDFPTLNNKSLKQMFKYE 180
           + G+ + +++   T ++   +L K TGK     +T  +E     FP    + L  MF+  
Sbjct: 206 YVGQNIGLSTCRHTAEEYAALLAKHTGKAIQAAKTAPEEYEQLGFP--GARDLANMFR-- 261

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
             F A+  D   +DI +  +L+P  +T +Q++
Sbjct: 262 --FYAMKPD---RDIELTLRLNPKAQTLDQWL 288



>gi|488520611|ref|XP_004452237.1| PREDICTED: nmrA-like family domain-containing protein 1 isoform 2
           [Dasypus novemcinctus]
          Length = 299

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/217 (28%), Positives = 115/217 (52%), Gaps = 15/217 (6%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL  ++YS L +    +GGK     HF GK  VE+Y R +G+P +T 
Sbjct: 92  KQGKLLADLAKRLGLRHVVYSGLENIKKLTGGKLA-AGHFDGKGEVEEYFRDIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ ++FLP  + +     L +P    +  +  + V D GP++  +++  P +
Sbjct: 150 VRLPCYFENLFSYFLPQKAPDGKSYLLSLPM--GDIPMDGMAVADLGPVVLSLLQT-PGE 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKT-HKVRTLNDEDIAKDFPTLNNKSLKQMFKYE 180
           + G+ + +++   T  +   +L+K TGK  H  +T  +E     FP    + L  MF+  
Sbjct: 207 YVGRNIGLSTCRHTAAEYAALLSKHTGKAVHDAKTTPEEYEKLGFP--GAQDLANMFR-- 262

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
             F A+  +   ++I +  +L+P  +T +Q++ +  G
Sbjct: 263 --FYAMKPE---RNIELTLRLNPKARTLDQWLEQHRG 294



>gi|109042319|ref|XP_001093249.1| PREDICTED: nmrA-like family domain-containing protein 1-like
           [Macaca mulatta]
          Length = 299

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 69/218 (31%), Positives = 112/218 (51%), Gaps = 19/218 (8%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK++AD AK  GL  ++YS L +    + GK   V HF  K  VE+Y   +GIP  T  
Sbjct: 93  QGKLVADTAKHLGLKHVVYSGLENVKRLTDGKL-QVPHFDSKGEVEEYFWSIGIPT-TSV 150

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
            ++ Y +N  T + P+ +++     L +P    +  +  I V D G  ++ I    P ++
Sbjct: 151 RVAAYFENFLTAWRPVKASDGDYYTLAVPM--GDVPMDGISVADIGAAVSNIFNS-PEEF 207

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMFKYEKE 182
            GK V +++E +T++Q  DVL+KV GK  KVR       AK  P +     K  F   KE
Sbjct: 208 LGKAVGLSAEALTVQQYADVLSKVLGK--KVRD------AKITPEVFE---KLGFPAAKE 256

Query: 183 FGAIGKDNEL---QDITIAKKLHPNIKTFEQYILETYG 217
              + +  ++   +D+ +  +L+P +K+F Q+I E  G
Sbjct: 257 IADMCRFYQMKPDRDVKLTHRLNPKVKSFSQFISENQG 294



>gi|504149427|ref|XP_004587118.1| PREDICTED: nmrA-like family domain-containing protein 1 [Ochotona
           princeps]
          Length = 319

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 60/212 (28%), Positives = 115/212 (54%), Gaps = 15/212 (7%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL++++YS L +    + G+     HF GK  VE+Y R +G+P +T 
Sbjct: 112 KQGKLLADVAKRLGLHYVVYSGLENIRKLTAGRLA-AGHFDGKGEVEEYFRDIGVP-MTS 169

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N  ++FLP  + +     L +P    +  +  + V D GP++  ++++ P +
Sbjct: 170 VRLPCYFENFLSYFLPQKAPDGKSYLLSLPL--GDVPMDSMAVSDLGPVVLSLLKK-PEE 226

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKT-HKVRTLNDEDIAKDFPTLNNKSLKQMFKYE 180
           + G+ + +++   T ++   +LTK TGK     +T  +E     FP    + L  MF+  
Sbjct: 227 YVGQNIGLSACRHTAQEYAALLTKHTGKAVQDAKTTPEEYEKLGFP--GAQDLANMFR-- 282

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
             F A+  D   ++I +  +L+P ++T +Q++
Sbjct: 283 --FYALKPD---RNIELTLRLNPKVQTLDQWL 309



>gi|440912637|gb|ELR62191.1| NmrA-like family domain-containing protein 1 [Bos grunniens mutus]
          Length = 299

 Score = 88.2 bits (217), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 64/215 (29%), Positives = 115/215 (53%), Gaps = 21/215 (9%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL +++YS L +    + G+   V HF GK  VE+Y R +G+P +T 
Sbjct: 92  KQGKLLADLAKRLGLRYVVYSGLENIKKLTAGRL-TVGHFDGKGEVEEYFRDIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLID---VRDTGPIIAKIIEEG 118
             L  Y +N+ ++FLP  + +     L +P  +     + ID   V D GP++  +++  
Sbjct: 150 VRLPSYFENLLSYFLPQKAPDGRSYLLSLPMGD-----VPIDGMSVADLGPVVLSLLKT- 203

Query: 119 PTKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMF 177
           P ++ G+ + +++   T ++   +LTK TGK  +    + ED  K  FP    + L  MF
Sbjct: 204 PEEYVGRNIGLSTCRHTAEEYAALLTKHTGKAVRDAKTSPEDYEKLGFP--GARDLANMF 261

Query: 178 KYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
           +    F A+  D   ++I +  KL+P  +  +Q++
Sbjct: 262 R----FYALKPD---RNIELTLKLNPKARRLDQWL 289



>gi|489641944|ref|WP_003546384.1| putative nucleoside-diphosphate sugar epimerase [Rhizobium
           leguminosarum]
 gi|393170003|gb|EJC70050.1| putative nucleoside-diphosphate sugar epimerase [Rhizobium
           leguminosarum bv. viciae WSM1455]
          Length = 317

 Score = 87.8 bits (216), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 63/227 (27%), Positives = 118/227 (51%), Gaps = 22/227 (9%)

Query: 4   GKMIADIAKEKGLNWLIYSSLP--DSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           G+ +AD A E G+  +++S+L   D+ T  G KY    HFT K  V  YIR L I + +F
Sbjct: 97  GRQLADAAVEAGVGHIVFSTLENVDAITR-GTKY--APHFTDKARVADYIRGLPISH-SF 152

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIP-YFEENDQLLLID-VRDTGPIIAKIIEEGP 119
             L+F+  N+  +++P +  +     L++P Y  E+ +   +D +  TGP++ +I    P
Sbjct: 153 IMLAFFYTNLLEYYVPRMEGDT----LLLPVYLPEDFRAPFVDPLTATGPVVLEIFSN-P 207

Query: 120 TKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVR-TLNDEDIAKDFPTLNN-----KSL 173
            ++NGK +PI  + ++ +++ +   +VTG     R     + +   FP         + L
Sbjct: 208 ERYNGKTLPIVGDIISPREMVETFQRVTGLKAAYRNAFTGDGLLHYFPEFAANELLVREL 267

Query: 174 KQMFKYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYGKSD 220
             M +Y  ++G  GK+   +D+  +++L+P+   +EQY+  T  + D
Sbjct: 268 LGMVEYAVDYGYFGKE---RDLEWSRRLNPDTLNWEQYLRTTGWRGD 311



>gi|226371956|gb|ACO51603.1| NmrA-like family domain-containing protein 1 [Rana catesbeiana]
          Length = 298

 Score = 87.8 bits (216), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 67/219 (30%), Positives = 111/219 (50%), Gaps = 15/219 (6%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK IAD++K   L  +++S L +    + GK  +V HF GK  VE+Y R++G+P  +  
Sbjct: 92  QGKRIADVSKRLSLTLVVFSGLENVKKLTNGKL-EVLHFDGKGVVEEYFREIGVPMTSVR 150

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
             S+Y +N+ TFF P    +     L  P    +  L    V+D G ++  I++  P+K+
Sbjct: 151 LPSYY-ENLLTFFRPQKDKDGDGYTLGFPM--GDVPLDGFSVKDLGGVVLSILKS-PSKY 206

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYEK 181
            GK + +++E +T +Q   ++T+V GK  +   L  E  AK  FP    + L  MF +  
Sbjct: 207 TGKDIGLSTEKLTTEQYAAIMTRVLGKNIRDAKLTPEIYAKMGFP--GAQELANMFTFYT 264

Query: 182 EFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYGKSD 220
                 K N  +DI +  +L+P  K F+ ++ E     D
Sbjct: 265 M-----KPN--RDIQLTLQLNPKAKKFQSWLQENKAAFD 296



>gi|297672687|ref|XP_002814420.1| PREDICTED: nmrA-like family domain-containing protein 1-like
           isoform 1 [Pongo abelii]
          Length = 299

 Score = 87.8 bits (216), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 66/216 (30%), Positives = 112/216 (51%), Gaps = 15/216 (6%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK++AD AK  GL  ++YS L +    + GK  +V HF  K  VE+Y   +GIP +T  
Sbjct: 93  QGKLVADSAKHLGLKHVVYSGLENVKRLTDGKL-EVPHFDSKGEVEEYFWSIGIP-MTSV 150

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
            ++ Y +N    + P+ +++     L +P    +  +  I V D G  ++ I    P ++
Sbjct: 151 RVAAYFENFLAAWQPVKASDGDYYTLAVPM--GDVPMDGISVADIGAAVSSIFNS-PEEF 207

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYEK 181
            GK V +++E +TI+Q  DVL+KV GK  +   +  E   K  FP    K +  M ++ +
Sbjct: 208 VGKAVGLSAEALTIQQYADVLSKVLGKEVRDAKITPEAFEKLGFPA--AKEIANMCRFYE 265

Query: 182 EFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
               +  D   +D+ +  +L+P +K+F Q+I E  G
Sbjct: 266 ----MKPD---RDVKLTHQLNPKVKSFSQFISENQG 294



>gi|86356765|ref|YP_468657.1| hypothetical protein RHE_CH01123 [Rhizobium etli CFN 42]
 gi|499743730|ref|WP_011424464.1| hypothetical protein [Rhizobium etli]
 gi|86280867|gb|ABC89930.1| hypothetical conserved protein [Rhizobium etli CFN 42]
          Length = 317

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 117/226 (51%), Gaps = 20/226 (8%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGG-KYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           G+ +AD A E G+  +++S+L +    +GG KY    HFT K  V  YIR L + + +F 
Sbjct: 97  GRQLADAAVEAGVKHIVFSTLENVDKITGGTKY--APHFTDKARVADYIRGLPVSH-SFI 153

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIP-YFEENDQLLLID-VRDTGPIIAKIIEEGPT 120
            L+F+  N+  ++ P +  +     L++P Y  E+     +D +  TGP++ +I    P 
Sbjct: 154 MLAFFYTNLLEYYAPRMEGDT----LLLPIYLPEDFAAPFVDPLTATGPVVLEIFSH-PE 208

Query: 121 KWNGKKVPIASENVTIKQITDVLTKVTGKTHKVR-TLNDEDIAKDFPTLNN-----KSLK 174
           ++NGK +PI  + ++ +++ +   +VTG+  + R     E +   FP         + + 
Sbjct: 209 RYNGKTLPIVGDIISPREMVETFQRVTGRKAEYRNAFTREGLLTYFPEFAANEFLVREIL 268

Query: 175 QMFKYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYGKSD 220
            M +Y  E+G  GK+++L+    +++L P    +EQ++  +  + D
Sbjct: 269 GMVEYAVEYGYFGKEHDLE---WSRRLAPETLNWEQFLRTSGWRGD 311



>gi|169624477|ref|XP_001805644.1| hypothetical protein SNOG_15498 [Phaeosphaeria nodorum SN15]
 gi|160705179|gb|EAT77163.2| hypothetical protein SNOG_15498 [Phaeosphaeria nodorum SN15]
          Length = 337

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 47/144 (32%), Positives = 75/144 (52%), Gaps = 5/144 (3%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           G+ +AD AK  G+   IYSS+PD +   G     +  ++ K  VEQY+R++G+P  TF Y
Sbjct: 87  GRSLADAAKRAGIQHYIYSSMPDHSV-FGHNLKALPMWSPKFTVEQYVRQIGLP-ATFVY 144

Query: 64  LSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPT 120
              Y  N  +   PL   E   +G      P+  +     L    D GP I ++ +EGP 
Sbjct: 145 CGIYHNNFTSLDFPLFRMELQHDGSFVWQAPFHPDQPLPWLDSEHDIGPAIFQLFKEGPR 204

Query: 121 KWNGKKVPIASENVTIKQITDVLT 144
           KWNGK++P+A  +++ K++    +
Sbjct: 205 KWNGKRIPLAFASMSPKEVVKAFS 228



>gi|441633664|ref|XP_003256326.2| PREDICTED: nmrA-like family domain-containing protein 1-like
           [Nomascus leucogenys]
          Length = 348

 Score = 87.4 bits (215), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 66/218 (30%), Positives = 113/218 (51%), Gaps = 15/218 (6%)

Query: 1   ERQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVT 60
           +++GK++AD AK  GL  ++YS L +    + GK  +V HF  K  VE+Y   +GIP +T
Sbjct: 140 DKEGKLVADSAKHLGLKHVVYSGLENVKRLADGKL-EVPHFDSKGEVEEYFWSIGIP-MT 197

Query: 61  FAYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPT 120
              ++ Y +N    + P+ +++     L +P    +  +  I V D G  ++ I    P 
Sbjct: 198 SVRVAAYFENFLAAWQPVKASDGDYYTLAVPM--GDVPMDGISVADIGAAVSSIFNS-PE 254

Query: 121 KWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKY 179
           ++ GK V +++E +TI+Q  DVL+KV GK  +   +  E   K  FP    K +  M + 
Sbjct: 255 EFLGKAVGLSAEALTIQQYADVLSKVLGKKVRDAKITPEAFEKLGFPAA--KEIANMCR- 311

Query: 180 EKEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
              F  +  D   +D+ +  +L+P +K+F Q+I E  G
Sbjct: 312 ---FYHMKPD---RDVKLTHQLNPKVKSFSQFISENQG 343



>gi|477517466|gb|ENH69715.1| NmrA-like family domain-containing protein 1 [Fusarium oxysporum f.
           sp. cubense race 1]
          Length = 311

 Score = 87.0 bits (214), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 63/211 (29%), Positives = 108/211 (51%), Gaps = 8/211 (3%)

Query: 5   KMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAYL 64
           K  AD A + G++++I+SSLP +T  SGGKY     F  K   E+YIR L + +  F  L
Sbjct: 98  KKTADAAVKAGIDYIIFSSLPSTTDVSGGKYTANHPFDAKAEGEKYIRTLPVKSA-FVRL 156

Query: 65  SFYSQNIGTFFLPLIS---NENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
            F+ +NI    +PL +   +ENG   + +P+  E     + +  + G  +  I+ E P K
Sbjct: 157 GFFLENI--IQVPLWAPQKDENGNWVVSLPFTPETRIPWIDNGSNCGSFVGAILAE-PEK 213

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMFKYEK 181
           + G     A+   +++++  + +KVTGK    + ++ E+ A+  P L +  + Q FK  +
Sbjct: 214 YEGVGFDAAAGFYSLEELVAIESKVTGKEITYKQISSEEFAEKLPILKDVYV-QAFKAGQ 272

Query: 182 EFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
           EFG  G D E      A++    + T E++ 
Sbjct: 273 EFGYYGADGEKSVAWAAERARGKLITPEEFF 303



>gi|410037905|ref|XP_001152180.2| PREDICTED: uncharacterized protein LOC471029 isoform 1 [Pan
           troglodytes]
          Length = 723

 Score = 87.0 bits (214), Expect = 3e-15,   Method: Composition-based stats.
 Identities = 64/218 (29%), Positives = 112/218 (51%), Gaps = 15/218 (6%)

Query: 1   ERQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVT 60
           +++GK++AD AK  GL  ++YS L +    + GK  +V HF  K  VE+Y   +G+P +T
Sbjct: 88  DKEGKLVADSAKHLGLKHVVYSGLENVKRLTDGKL-EVPHFDSKGEVEEYFWSIGVP-MT 145

Query: 61  FAYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPT 120
              ++ Y +N    + P+ +++     L +P    +  +  I V D G  ++ I    P 
Sbjct: 146 SVRVAAYFENFLAAWRPVKASDGDYYTLAVPM--GDVPMDGISVADIGAAVSSIFNS-PE 202

Query: 121 KWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKY 179
           ++ GK V +++E +TI+Q  DVL+ V GK  +   +  E   K  FP    K +  M + 
Sbjct: 203 EFLGKAVGLSAEALTIQQYADVLSNVLGKEVRDAKITPEAFEKLGFPAA--KEIANMCR- 259

Query: 180 EKEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
              F  +  D   +D+ +  +L+P +K+F Q+I E  G
Sbjct: 260 ---FYEMKPD---RDVKLTHQLNPKVKSFSQFISENQG 291



>gi|340522309|gb|EGR52542.1| predicted protein [Trichoderma reesei QM6a]
          Length = 458

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 81/150 (54%), Gaps = 7/150 (4%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           GK +AD AK   +   IYSS+PD    +  ++P +  +  K+ VE+Y+R+LG+P  TF Y
Sbjct: 170 GKALADAAKRANIQHYIYSSMPDHAAYNS-EWPSLPLWAAKHKVEEYVRELGLP-ATFVY 227

Query: 64  LSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEGP 119
              Y+ N  +   PL   E   +G      P F EN +L  +D   D GP + ++ ++G 
Sbjct: 228 TGIYNNNFTSLLYPLFCMELQPDGSFTWQAP-FHENVKLPWLDAEHDVGPAVIQLFKDGV 286

Query: 120 TKWNGKKVPIASENVTIKQITDVLTKVTGK 149
           +KW G+++ +A E +T  +  ++  +  G+
Sbjct: 287 SKWAGERIALAYEYLTPIEACELFARGVGR 316



>gi|224069691|ref|XP_002194655.1| PREDICTED: nmrA-like family domain-containing protein 1
           [Taeniopygia guttata]
          Length = 296

 Score = 86.7 bits (213), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 114/211 (54%), Gaps = 15/211 (7%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QG+ +AD++K +GL  +++S L +    +GG+  +V HF GK  VE+Y +K+G+P  T  
Sbjct: 93  QGQRLADVSKRQGLRHVVFSGLENVHQLTGGQL-EVLHFDGKGVVEEYFQKIGVPT-TII 150

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
            L FY +N  + F P  + +     L +P    +  +  + V D GP++  +++  P ++
Sbjct: 151 RLPFYFENFLSIFKPQKALQGDTFVLELPM--GDTPMDGMAVEDLGPVVLGLLKS-PGEY 207

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYEK 181
            G+ + +++  +T  +   +L++ TG+T     ++ E+  K DFP    K    MF+   
Sbjct: 208 IGRVIGLSTGKLTEAEYAAILSQQTGRTVTASKISPEEYEKQDFP--GAKETAAMFR--- 262

Query: 182 EFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
            F A+  D   + + +  +L+P  +TF+Q++
Sbjct: 263 -FYALKPD---RSVALTMELNPRARTFQQWV 289



>gi|426254256|ref|XP_004020795.1| PREDICTED: nmrA-like family domain-containing protein 1 [Ovis
           aries]
          Length = 299

 Score = 86.7 bits (213), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 61/212 (28%), Positives = 113/212 (53%), Gaps = 15/212 (7%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL +++YS L +    + G+     HF GK  VE+Y R +G+P +T 
Sbjct: 92  KQGKLLADLAKRLGLRYVVYSGLENIKKLTAGRL-TAGHFDGKGEVEEYFRDIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ ++FLP  + +     L +P   ++  +  + V D GP++  +++  P +
Sbjct: 150 VRLPCYFENLLSYFLPQKAPDGRSYLLSLPM--DDVPMDGMSVADLGPVVLSLLKT-PEE 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + G+ + +++   T ++   +LTK  GK       + ED  K  FP    + L  MF+  
Sbjct: 207 YVGRNIGLSTCRHTAEEYAALLTKHIGKVVCNAKTSPEDYEKLGFP--GAQDLANMFR-- 262

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
             F A+  D   ++I +  KL+P  +T +Q++
Sbjct: 263 --FYALKPD---RNIELTLKLNPKARTLDQWL 289



>gi|212534836|ref|XP_002147574.1| nitrogen metabolite repression regulator NmrA [Talaromyces
           marneffei ATCC 18224]
 gi|210069973|gb|EEA24063.1| nitrogen metabolite repression regulator NmrA [Talaromyces
           marneffei ATCC 18224]
          Length = 353

 Score = 86.3 bits (212), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 52/168 (30%), Positives = 82/168 (48%), Gaps = 9/168 (5%)

Query: 4   GKMIADIAKEKG-LNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           G+ +AD AK  G +   IYSS+PD +    G +P    +  K  VE Y+R+LGIP  TF 
Sbjct: 93  GRALADAAKRAGTIQHFIYSSMPDHSVH--GPWPGPPMWACKFTVENYVRQLGIP-ATFV 149

Query: 63  YLSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEG 118
           Y   Y+ N  +   PL   E   +G  +   P F  +  L  +D   D GP + +I ++G
Sbjct: 150 YAGIYNNNFTSLPYPLFQMELQPDGSFEWAAP-FNPDVPLPWLDAEHDVGPALIQIFKDG 208

Query: 119 PTKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFP 166
           P KWNG ++ +  E ++  Q+     +  G+  + R  +  +I    P
Sbjct: 209 PKKWNGHRIALTFETLSPIQVCAAFARALGRRVQYRRTSKIEIKVKIP 256



>gi|432111565|gb|ELK34679.1| NmrA-like family domain-containing protein 1 [Myotis davidii]
          Length = 299

 Score = 86.3 bits (212), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 117/212 (55%), Gaps = 15/212 (7%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++A++AK  GL++++YS L +    + G+     HF GK  VE+Y R +G+P ++ 
Sbjct: 92  KQGKLLANLAKRLGLHYVVYSGLENIKKLTAGRLA-AGHFDGKGEVEEYFRDIGVPMIS- 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ ++FLP  + +     L +P    +  +  + V D GP++  +++  P +
Sbjct: 150 VRLPCYFENLLSYFLPQKAPDGKSYLLSLPM--GDIPMDGMSVTDLGPVVLSLLKM-PEQ 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKT-HKVRTLNDEDIAKDFPTLNNKSLKQMFKYE 180
           + G+ + +++   T+++   +L+K TGKT H  +T  ++     FP    + L  MF+  
Sbjct: 207 YIGQNLGLSTCRHTVEEYAALLSKHTGKTVHDAKTTPEDYEKLGFP--GAQDLANMFR-- 262

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
             F A+  D   ++I +  +L+P  +T +Q++
Sbjct: 263 --FYALKPD---RNIELTLRLNPKARTLDQWL 289



>gi|342883538|gb|EGU84001.1| hypothetical protein FOXB_05421 [Fusarium oxysporum Fo5176]
          Length = 311

 Score = 86.3 bits (212), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 63/211 (29%), Positives = 108/211 (51%), Gaps = 8/211 (3%)

Query: 5   KMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAYL 64
           K  AD A E G++++I+SSLP +T  SGGKY     F  K   E++IR L + +  F  L
Sbjct: 98  KKTADAAVEAGIDYIIFSSLPSTTDVSGGKYTANHPFDAKAEGEKHIRTLPVKSA-FVRL 156

Query: 65  SFYSQNIGTFFLPLIS---NENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
            F+ +NI    +PL +   +ENG   + +P+  E     + +  + G  +  I+ E P K
Sbjct: 157 GFFLENI--IQVPLWAPQKDENGNWVVSLPFTPETRIPWIDNGSNCGSFVGAILAE-PEK 213

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMFKYEK 181
           + G     A+   +++++  + +KVTGK    + ++ E+ A+  P L +  + Q FK  +
Sbjct: 214 YEGVGFDAAAGFYSLEELVALESKVTGKEITYKQISSEEFAEKLPILKDVYV-QAFKAGQ 272

Query: 182 EFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
           EFG  G D E      A++    + T E++ 
Sbjct: 273 EFGYYGADGEKSVAWAAERARGKLITPEEFF 303



>gi|483500127|gb|EOA94652.1| NmrA-like family domain-containing protein 1, partial [Anas
           platyrhynchos]
          Length = 218

 Score = 86.3 bits (212), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 110/211 (52%), Gaps = 15/211 (7%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK +AD++K  GL  ++YS L +    +GG+   V HF GK  VE+Y + +G+P  T  
Sbjct: 15  QGKRLADLSKRLGLRHVVYSGLENVQQLTGGRL-QVPHFDGKGVVEKYFQAIGVPT-TII 72

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
            +  Y +N  + F P  + +     L +P    +  +  + V D GP++  +++  P ++
Sbjct: 73  RMPCYFENFLSCFRPEKAPQGDAFVLALPM--GDTPMDGMAVEDLGPVVLSLLKS-PEEY 129

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYEK 181
            G+ + +++  +T+ +     ++ TGKT +   ++ E+  K  FP    K L  MF+   
Sbjct: 130 VGRVIGLSTGKLTVAEYAAAFSQQTGKTVEASKISPEEYEKLGFP--GAKELAAMFR--- 184

Query: 182 EFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
            F A+  +   +D+ +  KL+P  +TF Q++
Sbjct: 185 -FYALRPE---RDVELTMKLNPKARTFHQWL 211



>gi|145242376|ref|XP_001393804.1| nitrogen metabolite repression protein nmrA [Aspergillus niger CBS
           513.88]
 gi|134078353|emb|CAK40345.1| unnamed protein product [Aspergillus niger]
 gi|350640111|gb|EHA28464.1| hypothetical protein ASPNIDRAFT_50094 [Aspergillus niger ATCC 1015]
          Length = 352

 Score = 86.3 bits (212), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 49/154 (31%), Positives = 81/154 (52%), Gaps = 9/154 (5%)

Query: 4   GKMIADIAKEKG-LNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           G+ +AD AK  G +   IYSS+PD +    G +P V  +  K  VE Y+R+LG+P+ TF 
Sbjct: 92  GRALADAAKRAGTIQHYIYSSMPDHSVH--GPWPPVPLWAPKFTVENYVRQLGLPS-TFV 148

Query: 63  YLSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEG 118
           Y   Y+ N  +   PL   E   +G  +   P F+ +  L  +D   D GP + +I ++G
Sbjct: 149 YAGIYNNNFTSLPYPLFQMELMQDGSFEWHAP-FDPDIPLPWLDAEHDVGPALLQIFKDG 207

Query: 119 PTKWNGKKVPIASENVTIKQITDVLTKVTGKTHK 152
           P KWNG ++ +  E ++  Q+    ++  G+  +
Sbjct: 208 PKKWNGHRIALTFETLSPNQVCAAFSRALGRPCR 241



>gi|395747444|ref|XP_002826140.2| PREDICTED: nmrA-like family domain-containing protein 1 [Pongo
           abelii]
          Length = 351

 Score = 85.9 bits (211), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 63/217 (29%), Positives = 113/217 (52%), Gaps = 15/217 (6%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+A+  GL++++YS L +    + G+     HF GK  VE+Y R +G+P +T 
Sbjct: 144 KQGKLLADLARRLGLHYVVYSGLENIKKLTAGRLA-AAHFDGKGEVEEYFRDIGVP-MTS 201

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ + FLP  + +     L +P    +  +  + V D GP++  +++  P K
Sbjct: 202 VRLPCYFENLLSHFLPQKAPDGKSYLLSLP--TGDVPMDGMSVSDLGPVVLSLLKM-PEK 258

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + G+ + +++   T K+   +LTK T K      +  ED  K  FP    + L  MF+  
Sbjct: 259 YVGQNMGLSTCRHTAKEYAALLTKHTRKVVHDAKMTPEDYEKLGFP--GARDLANMFR-- 314

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
             F A+  D   +DI +  +L+P   T +Q++ +  G
Sbjct: 315 --FYALRPD---RDIELTLRLNPKALTLDQWLEQHKG 346



>gi|358371764|dbj|GAA88371.1| nitrogen metabolite repression regulator NmrA [Aspergillus kawachii
           IFO 4308]
          Length = 352

 Score = 85.9 bits (211), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 49/154 (31%), Positives = 81/154 (52%), Gaps = 9/154 (5%)

Query: 4   GKMIADIAKEKG-LNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           G+ +AD AK  G +   +YSS+PD +    G +P V  +  K  VE YIR+LG+P+ TF 
Sbjct: 92  GRALADAAKRAGTIQHYVYSSMPDHSVH--GPWPPVPLWAPKFTVENYIRQLGLPS-TFV 148

Query: 63  YLSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEG 118
           Y   Y+ N  +   PL   E   +G  +   P F+ +  L  +D   D GP + +I ++G
Sbjct: 149 YAGIYNNNFTSLPYPLFQMELMQDGSFEWHAP-FDPDIPLPWLDAEHDVGPALLQIFKDG 207

Query: 119 PTKWNGKKVPIASENVTIKQITDVLTKVTGKTHK 152
           P KWNG ++ +  E ++  Q+    ++  G+  +
Sbjct: 208 PKKWNGHRIALTFETLSPNQVCAAFSRALGRPCR 241



>gi|115437748|ref|XP_001217889.1| nitrogen metabolic regulation protein [Aspergillus terreus NIH2624]
 gi|114188704|gb|EAU30404.1| nitrogen metabolic regulation protein [Aspergillus terreus NIH2624]
          Length = 352

 Score = 85.9 bits (211), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 79/151 (52%), Gaps = 9/151 (5%)

Query: 4   GKMIADIAKEKG-LNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           G+ +AD AK  G +   IYSS+PD +    G +P V  +  K  VE YIR+LG+P  TF 
Sbjct: 92  GRALADAAKRAGSIQHYIYSSMPDHSVH--GPWPPVPLWAPKFTVENYIRQLGLP-ATFV 148

Query: 63  YLSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEG 118
           Y   Y+ N  +   PL   E   +G  +   P F+ +  L  +D   D GP + +I ++G
Sbjct: 149 YTGIYNNNFTSLPYPLFQMELMPDGSFEWHAP-FDPDTPLPWLDAEHDVGPALLQIFKDG 207

Query: 119 PTKWNGKKVPIASENVTIKQITDVLTKVTGK 149
           P +WNG ++ +  E ++  Q+    ++  G+
Sbjct: 208 PKRWNGHRIALTFETLSPNQVCAAFSRALGR 238



>gi|466011182|ref|XP_004270275.1| PREDICTED: nmrA-like family domain-containing protein 1 [Orcinus
           orca]
          Length = 299

 Score = 85.9 bits (211), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 60/217 (27%), Positives = 118/217 (54%), Gaps = 15/217 (6%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL++++YS L +    + G+     HF GK  VE+Y R +G+P +T 
Sbjct: 92  KQGKLLADLAKRLGLHYVVYSGLENIKKLTAGRLA-AGHFDGKGEVEEYFRDIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ + FLP  + +     L +P    +  +  + V D GP++  +++  P  
Sbjct: 150 VRLPCYFENLLSCFLPQKAPDGKSYLLSLPM--GDVPMDGMSVSDLGPVVLSLLKM-PED 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + G+ + +++   T+++   +L++ T KT +   ++ ED  K  FP    + L  MF+  
Sbjct: 207 YIGQNIGLSTCRHTVEEYAALLSRHTRKTVRDAKISPEDYEKLGFP--GAQDLANMFR-- 262

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
             F A+  D   ++I ++ +L+P  +T +Q++ +  G
Sbjct: 263 --FYALKPD---RNIELSLRLNPKARTLDQWLEQHKG 294



>gi|358401383|gb|EHK50689.1| hypothetical protein TRIATDRAFT_297054 [Trichoderma atroviride IMI
           206040]
          Length = 461

 Score = 85.9 bits (211), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 60/195 (30%), Positives = 98/195 (50%), Gaps = 13/195 (6%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           GK +AD AK+  +   IYSS+PD    + G +P +  +  K+ VE Y+R LG+P  TF Y
Sbjct: 170 GKALADAAKQTNIQHYIYSSMPDHAAYNSG-WPSLPLWAAKHEVEVYVRHLGLP-ATFVY 227

Query: 64  LSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEGP 119
              Y+ N  +   PL   E   +G      P F E+ +L  +D   D GP I ++ ++G 
Sbjct: 228 TGIYNNNFTSLPYPLFCMELQPDGSFTWQAP-FHEDAKLPWLDAEHDVGPAILQLFKDGV 286

Query: 120 TKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDE-DIAKDFPTLNNKSLKQMFK 178
           +KW G+++ +A E +T  +   +  +  G+  +VR +    +I    PT   + L+ +  
Sbjct: 287 SKWAGERIALAYEYLTPVEACKLFARGVGR--RVRYIRGPIEIKVRIPTGYRQQLEAL-- 342

Query: 179 YEKEFGAIGKDNELQ 193
            EK F    KD + Q
Sbjct: 343 -EKLFDPNEKDAKQQ 356



>gi|344249492|gb|EGW05596.1| NmrA-like family domain-containing protein 1 [Cricetulus griseus]
          Length = 285

 Score = 85.5 bits (210), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 62/217 (28%), Positives = 119/217 (54%), Gaps = 15/217 (6%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL++++YS L +    + G+     HF GK  VE+Y R +G+P +T 
Sbjct: 78  KQGKLLADLAKRLGLHYVVYSGLENIRKLTAGRLA-AGHFDGKGEVEEYFRDIGVP-MTS 135

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ ++FLP  + +     L +P    +  +  + V D GP++  ++++ P +
Sbjct: 136 VRLPCYFENLLSYFLPQKAADGKSYLLDLPM--GDVPMDGMAVSDLGPVVLSLLKK-PEE 192

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKT-HKVRTLNDEDIAKDFPTLNNKSLKQMFKYE 180
           + G+ + +++   T ++   +LT+  GKT H  +T   ED  +    L  + L  MF+  
Sbjct: 193 YVGQNIGLSTCKHTAEEYAALLTRHIGKTVHHAKT-TPEDYER-LGFLGARDLANMFR-- 248

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
             F A+  D  + D+T+  +L+P  +T +Q++ +  G
Sbjct: 249 --FYALKPDRNI-DLTL--QLNPKAQTLDQWLEQHKG 280



>gi|440226668|ref|YP_007333759.1| hypothetical protein RTCIAT899_CH09130 [Rhizobium tropici CIAT 899]
 gi|505152814|ref|WP_015339916.1| hypothetical protein [Rhizobium tropici]
 gi|440038179|gb|AGB71213.1| hypothetical protein RTCIAT899_CH09130 [Rhizobium tropici CIAT 899]
          Length = 317

 Score = 85.5 bits (210), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 61/220 (27%), Positives = 112/220 (50%), Gaps = 18/220 (8%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGG-KYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           G+ +AD A E G+  +++S+L +    +GG KY    HFT K  V  YIR L + + +F 
Sbjct: 97  GRQLADAAVEAGVGHVVFSTLENVEKITGGTKY--APHFTDKAEVADYIRGLPVSH-SFV 153

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLID-VRDTGPIIAKIIEEGPTK 121
            L+F+  N+  +++P     +G+  L+  Y  E+     +D +  TGP++ +I    P +
Sbjct: 154 MLAFFYTNLMEYYVP---RYDGDTLLLPIYLPEDFAAPFVDPLTATGPVVLEIFSH-PER 209

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDED-IAKDFPTLNNKSL-----KQ 175
           +NGK +PI  + ++ ++I D   +VTG   + R     D + + FP      L       
Sbjct: 210 YNGKTLPIVGDIISPREIVDTFRRVTGLKAEYRNAFSRDGLLRYFPEFAPNELLVRETLG 269

Query: 176 MFKYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYILET 215
           M +Y  E+G    ++   D+  +++L P+   +EQ++  T
Sbjct: 270 MVEYAVEYGYFSGEH---DLGWSRRLDPDTLNWEQFLRTT 306



>gi|478527980|ref|XP_004438170.1| PREDICTED: nmrA-like family domain-containing protein 1
           [Ceratotherium simum simum]
          Length = 299

 Score = 85.5 bits (210), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 60/212 (28%), Positives = 113/212 (53%), Gaps = 15/212 (7%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++A++A+  GL +++YS L +    + G+     HF GK  VE+Y R +G+P +T 
Sbjct: 92  KQGKLLANLARRLGLRYVVYSGLENIKKLTAGRLA-AGHFDGKGEVEEYFRDIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ ++FLP  S +     L +P    +  +  + V D GP++  +++  P +
Sbjct: 150 VRLPCYFENLLSYFLPQKSPDGKSYLLSLPM--GDVPMDGMSVNDLGPVVLSLLKM-PEE 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + G+ + +++   T ++   +L+K TGK  +      ED  K  FP    + L  MF+  
Sbjct: 207 YIGQNIGLSTCRHTAEEYAALLSKHTGKAVRDAKTTPEDYEKLGFP--GAQDLANMFR-- 262

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
             F A+  D   ++I +  +L+P  KT +Q++
Sbjct: 263 --FYALKPD---RNIELTLRLNPQAKTLDQWL 289



>gi|260829035|ref|XP_002609468.1| hypothetical protein BRAFLDRAFT_266378 [Branchiostoma floridae]
 gi|229294824|gb|EEN65478.1| hypothetical protein BRAFLDRAFT_266378 [Branchiostoma floridae]
          Length = 298

 Score = 85.5 bits (210), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 62/215 (28%), Positives = 107/215 (49%), Gaps = 18/215 (8%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           RQGK IAD AK  G+  +++S L +    +G   P   HF  K  +E+Y+  + +P VTF
Sbjct: 90  RQGKSIADAAKAAGVLHVVFSGLENVQKIAGFPCP---HFDAKGLIEEYMTSIELP-VTF 145

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
              SFY +N  +   P    E+G   L +P   E   + ++   D GP +  I +    +
Sbjct: 146 VRFSFYYENYISLLKPQ-KQEDGTYVLGVPM--EGAAMDIVSAGDMGPAVRAIFKSW-AQ 201

Query: 122 WNGKKVPIASENVTIKQITDVLTK-VTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKY 179
           W  K V  + + +TI+Q  D+L+K +  K  K   +  +  A+  FP  ++  L  MFK+
Sbjct: 202 WIRKAVGFSGDKLTIQQTADILSKHLAPKVFKASDMTADAFAQLGFPGADD--LGNMFKF 259

Query: 180 EKEFGAIGKDNELQDITIAKKLHPNIKTFEQYILE 214
            +        N  + + + ++LHP  K+F++++ E
Sbjct: 260 YR------LHNPDRSVELTRQLHPAAKSFDKWVAE 288



>gi|254839199|pdb|2WMD|A Chain A, Crystal Structure Of Nmra-Like Family Domain Containing
           Protein 1 In Complex With Nadp And  2-(4-Chloro-
           Phenylamino)-Nicotinic Acid
 gi|255311736|pdb|2WM3|A Chain A, Crystal Structure Of Nmra-Like Family Domain Containing
           Protein 1 In Complex With Niflumic Acid
          Length = 299

 Score = 85.5 bits (210), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/217 (28%), Positives = 113/217 (52%), Gaps = 15/217 (6%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+A+  GL++++YS L +    + G+     HF GK  VE+Y R +G+P +T 
Sbjct: 93  KQGKLLADLARRLGLHYVVYSGLENIKKLTAGRLA-AAHFDGKGEVEEYFRDIGVP-MTS 150

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ + FLP  + +     L +P    +  +  + V D GP++  +++  P K
Sbjct: 151 VRLPCYFENLLSHFLPQKAPDGKSYLLSLP--TGDVPMDGMSVSDLGPVVLSLLKM-PEK 207

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + G+ + +++   T ++   +LTK T K      +  ED  K  FP    + L  MF+  
Sbjct: 208 YVGQNIGLSTCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFP--GARDLANMFR-- 263

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
             F A+  D   +DI +  +L+P   T +Q++ +  G
Sbjct: 264 --FYALRPD---RDIELTLRLNPKALTLDQWLEQHKG 295



>gi|119183009|ref|XP_001242591.1| hypothetical protein CIMG_06487 [Coccidioides immitis RS]
 gi|303319565|ref|XP_003069782.1| Nitrogen metabolic regulation protein , putative [Coccidioides
           posadasii C735 delta SOWgp]
 gi|240109468|gb|EER27637.1| Nitrogen metabolic regulation protein , putative [Coccidioides
           posadasii C735 delta SOWgp]
 gi|320040747|gb|EFW22680.1| nitrogen metabolite repression regulator NmrA [Coccidioides
           posadasii str. Silveira]
 gi|392865495|gb|EJB10989.1| nitrogen metabolite repression protein nmrA [Coccidioides immitis
           RS]
          Length = 344

 Score = 85.5 bits (210), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 78/147 (53%), Gaps = 6/147 (4%)

Query: 4   GKMIADIAKEKG-LNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           G+ +AD AK  G +   IYSS+PD +  +   +P +  ++ K  VE Y+R+LG+P  TF 
Sbjct: 91  GRALADAAKRAGTVQHYIYSSMPDHSIYNP-HWPSLPLWSCKFAVENYVRQLGLP-ATFV 148

Query: 63  YLSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGP 119
           Y   Y+ N  +   PL   E   +G  +   P+  +     L    D GP I +I ++GP
Sbjct: 149 YAGIYNNNFTSLPYPLFCMELMADGGFEWRAPFHPDIPLPWLDAEHDVGPTILQIFKDGP 208

Query: 120 TKWNGKKVPIASENVTIKQITDVLTKV 146
            KWNG ++ ++ E +T +Q+ D  ++ 
Sbjct: 209 KKWNGHRIAMSFETLTPRQVCDAFSRA 235



>gi|190890817|ref|YP_001977359.1| hypothetical protein RHECIAT_CH0001200 [Rhizobium etli CIAT 652]
 gi|501459615|ref|WP_012483060.1| hypothetical protein [Rhizobium etli]
 gi|190696096|gb|ACE90181.1| hypothetical conserved protein [Rhizobium etli CIAT 652]
          Length = 317

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 116/226 (51%), Gaps = 20/226 (8%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGG-KYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           G+ +AD A E G+  +++S+L +    +GG KY    HFT K  V  +IR L + + +F 
Sbjct: 97  GRQLADAAVEAGVQHIVFSTLENVDKITGGTKY--APHFTDKARVADHIRGLPVSH-SFI 153

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIP-YFEENDQLLLID-VRDTGPIIAKIIEEGPT 120
            L+F+  N+  ++ P +  +     L++P Y  E+     +D +  TGP++ +I    P 
Sbjct: 154 MLAFFYTNLLEYYAPRMEGDT----LLLPIYLPEDFAAPFVDPLTATGPVVLEIFSH-PE 208

Query: 121 KWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDED-IAKDFPTLNN-----KSLK 174
           ++NGK +P+  + ++ +Q+ +   +VTG   + R     D +   FP         + L 
Sbjct: 209 RYNGKTLPVVGDIISPRQMVETFQRVTGIKAEYRNAFTRDGLLAYFPEFAANEFFVRELL 268

Query: 175 QMFKYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYGKSD 220
            M +Y  E+G  GK+++L+    +++L P    +EQ++  +  + D
Sbjct: 269 GMLEYAVEYGYFGKEHDLE---WSRRLAPETLNWEQFLRTSGWRGD 311



>gi|237640501|pdb|3DXF|A Chain A, Crystal Structure Of The Hscarg R37a Mutant
 gi|237640502|pdb|3DXF|B Chain B, Crystal Structure Of The Hscarg R37a Mutant
          Length = 299

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/217 (28%), Positives = 113/217 (52%), Gaps = 15/217 (6%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+A+  GL++++YS L +    + G+     HF GK  VE+Y R +G+P +T 
Sbjct: 92  KQGKLLADLARRLGLHYVVYSGLENIKKLTAGRLA-AAHFDGKGEVEEYFRDIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ + FLP  + +     L +P    +  +  + V D GP++  +++  P K
Sbjct: 150 VRLPCYFENLLSHFLPQKAPDGKSYLLSLP--TGDVPMDGMSVSDLGPVVLSLLKM-PEK 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + G+ + +++   T ++   +LTK T K      +  ED  K  FP    + L  MF+  
Sbjct: 207 YVGQNIGLSTCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFP--GARDLANMFR-- 262

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
             F A+  D   +DI +  +L+P   T +Q++ +  G
Sbjct: 263 --FYALRPD---RDIELTLRLNPKALTLDQWLEQHKG 294



>gi|119598609|gb|EAW78203.1| hCG2041270 [Homo sapiens]
          Length = 251

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/216 (29%), Positives = 111/216 (51%), Gaps = 15/216 (6%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           +GK++AD AK  GL  ++YS L +    + GK  +V HF  K  VE+Y   +GIP +T  
Sbjct: 45  RGKLVADSAKHLGLKHVVYSGLENVKRLTDGKL-EVPHFDSKGEVEEYFWSIGIP-MTSV 102

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
            ++ Y +N    + P+ +++     L +P    +  +  I V D G  ++ I    P ++
Sbjct: 103 RVAAYFENFLAAWRPVKASDGDYYTLAVPM--GDVPMDGISVADIGAAVSSIFNS-PEEF 159

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYEK 181
            GK V +++E +TI+Q  DVL+K  GK  +   +  E   K  FP    K +  M ++ +
Sbjct: 160 LGKAVGLSAEALTIQQYADVLSKALGKEVRDAKITPEAFEKLGFPAA--KEIANMCRFYE 217

Query: 182 EFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
               +  D   +D+ +  +L+P +K+F Q+I E  G
Sbjct: 218 ----MKPD---RDVNLTHQLNPKVKSFSQFISENQG 246



>gi|403273446|ref|XP_003928526.1| PREDICTED: nmrA-like family domain-containing protein 1 [Saimiri
           boliviensis boliviensis]
          Length = 299

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/217 (29%), Positives = 113/217 (52%), Gaps = 15/217 (6%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL++++YS L +    + G+   V HF GK  VE+Y R +G+P +T 
Sbjct: 92  KQGKLLADVAKCLGLHYVVYSGLENIKKLTAGRL-TVAHFDGKGEVEEYFRDIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N  + FLP  + +     L +P    +  +  + V D GP++  +++  P K
Sbjct: 150 VRLPCYFENFLSHFLPQKAPDGKSYLLSLP--TGDVPMDGMSVSDLGPVVLSLLKM-PEK 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + G+ + +++   T ++   +LTK T K      +  ED  K  FP    + L  MF+  
Sbjct: 207 YVGQNIGLSTCRHTAEEYAALLTKHTRKVVHNTKMTPEDYEKLGFP--GAQDLANMFR-- 262

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
             F A+  D   +DI +  +L+P   T +Q++ +  G
Sbjct: 263 --FYALRPD---RDIELTLRLNPKALTLDQWLEQHKG 294



>gi|472245751|gb|EMR90312.1| putative hscarg dehydrogenase protein [Botryotinia fuckeliana
           BcDW1]
          Length = 310

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 107/218 (49%), Gaps = 16/218 (7%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           R GK I D A E G+ ++I+S+LP  +  S G+Y  VT F  K  +EQYIR L I + +F
Sbjct: 94  RNGKTIVDAAIEMGVQYIIFSTLPHVSAISNGRYTKVTAFDAKAKIEQYIRGLPIKS-SF 152

Query: 62  AYLSFYSQNI--GTFFLPLISNENGEI-----DLVIPYFEENDQLLLIDVRDTGPIIAKI 114
             L F+ +N     F  P  +N+   +        +P+       LL  V D G  ++ I
Sbjct: 153 ISLGFFMENFQAQAFLAPQPANDGTWVMSRHTSAKMPF------PLLDAVGDAGKFVSAI 206

Query: 115 IEEGPTKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLK 174
           + E P K+ GK    A++  T+++I   L+K +GKT   + +++ +  K       +   
Sbjct: 207 LAE-PDKYEGKIFCAAAKIYTMEEIVAALSKSSGKTIVYKQISEGEF-KGSMAFAAEMFT 264

Query: 175 QMFKYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
           + F + +EFG  G  +E + +   +     + T E+++
Sbjct: 265 EYFSFCEEFGYWGPGSEEKVVWAGENARGRLSTLEEFL 302



>gi|10190720|ref|NP_065728.1| nmrA-like family domain-containing protein 1 [Homo sapiens]
 gi|74734255|sp|Q9HBL8.1|NMRL1_HUMAN RecName: Full=NmrA-like family domain-containing protein 1
 gi|9963841|gb|AAG09721.1|AF225419_1 HSCARG [Homo sapiens]
 gi|12804145|gb|AAH02927.1| NMRAL1 protein [Homo sapiens]
 gi|13938446|gb|AAH07364.1| NmrA-like family domain containing 1 [Homo sapiens]
 gi|119605707|gb|EAW85301.1| HSCARG protein, isoform CRA_a [Homo sapiens]
 gi|312150662|gb|ADQ31843.1| NmrA-like family domain containing 1 [synthetic construct]
          Length = 299

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/217 (28%), Positives = 113/217 (52%), Gaps = 15/217 (6%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+A+  GL++++YS L +    + G+     HF GK  VE+Y R +G+P +T 
Sbjct: 92  KQGKLLADLARRLGLHYVVYSGLENIKKLTAGRLA-AAHFDGKGEVEEYFRDIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ + FLP  + +     L +P    +  +  + V D GP++  +++  P K
Sbjct: 150 VRLPCYFENLLSHFLPQKAPDGKSYLLSLP--TGDVPMDGMSVSDLGPVVLSLLKM-PEK 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + G+ + +++   T ++   +LTK T K      +  ED  K  FP    + L  MF+  
Sbjct: 207 YVGQNIGLSTCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFP--GARDLANMFR-- 262

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
             F A+  D   +DI +  +L+P   T +Q++ +  G
Sbjct: 263 --FYALRPD---RDIELTLRLNPKALTLDQWLEQHKG 294



>gi|470594557|ref|XP_004310400.1| PREDICTED: nmrA-like family domain-containing protein 1 [Tursiops
           truncatus]
          Length = 299

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 60/217 (27%), Positives = 118/217 (54%), Gaps = 15/217 (6%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL++++YS L +    + G+     HF GK  VE+Y R +G+P +T 
Sbjct: 92  KQGKLLADLAKCLGLHYVVYSGLENIKKLTAGRLA-AGHFDGKGEVEEYFRDIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ + FLP  + +     L +P    +  +  + V D GP++  +++  P  
Sbjct: 150 VRLPCYFENLLSCFLPQKAPDGKSYLLSLPM--GDVPMDGMSVSDLGPVVLSLLKM-PED 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + G+ + +++   T+++   +L++ T KT +   ++ ED  K  FP    + L  MF+  
Sbjct: 207 YIGQNIGLSTCRHTVEEYAALLSRHTRKTVRDAKISPEDYEKLGFP--GAQDLANMFR-- 262

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
             F A+  D   ++I ++ +L+P  +T +Q++ +  G
Sbjct: 263 --FYALKPD---RNIELSLRLNPKARTLDQWLEQHKG 294



>gi|350581768|ref|XP_003124684.3| PREDICTED: nmrA-like family domain-containing protein 1-like [Sus
           scrofa]
          Length = 325

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 113/217 (52%), Gaps = 15/217 (6%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL +++YS L +    + G+     HF GK  VE+Y R +G+P +T 
Sbjct: 118 KQGKLLADLAKRLGLRYVVYSGLENVKKLTAGRLA-AGHFDGKGEVEEYFRDIGVP-MTS 175

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ + FLP  + +     L +P    +  +  + V D GP++  +++  P +
Sbjct: 176 VRLPCYFENLLSAFLPQKAPDGKSYLLSLPM--GDVPMDGMSVTDLGPVVLSLLKM-PEE 232

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + G+ + +++   T+ +   +L++ T KT +      ED  K  FP    + L  MF+  
Sbjct: 233 YVGQNIGLSTCRHTVGEYAALLSRHTRKTVRDAKTTPEDFEKLGFP--GAQDLANMFR-- 288

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
             F  +  D   +DI +  +L+P  +T EQ++ +  G
Sbjct: 289 --FYTLKPD---RDIELTLRLNPKARTLEQWLEQHKG 320



>gi|71897147|ref|NP_001025816.1| nmrA-like family domain-containing protein 1 [Gallus gallus]
 gi|82081096|sp|Q5ZID0.1|NMRL1_CHICK RecName: Full=NmrA-like family domain-containing protein 1
 gi|53136368|emb|CAG32513.1| hypothetical protein RCJMB04_27o15 [Gallus gallus]
          Length = 296

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/211 (27%), Positives = 112/211 (53%), Gaps = 15/211 (7%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QG+ +AD++K  GL  ++YS L +    + G+  +V HF GK  VE+Y R + +P  T  
Sbjct: 93  QGRRLADLSKRLGLQHVVYSGLENVKQLTKGRL-EVLHFDGKGEVEEYFRAVNVPTTTI- 150

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
            L FY +N  + F P  + +  ++ L +P    +  +  + V D GPI+  +++  P ++
Sbjct: 151 RLPFYYENFLSSFKPQKAPQGDKLLLGLPM--GDTPMDGMAVEDLGPIVLSLLKS-PEQY 207

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYEK 181
            G+ + +++  +T+ +     ++ TGKT +   +  E+  K  FP    K L  MF+   
Sbjct: 208 IGQVIGLSAGKLTVAEYAAAFSQQTGKTVEDSKITPEEYEKLGFP--GAKELADMFR--- 262

Query: 182 EFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
            F A+  D   +++ +  KL+P  +TF+Q++
Sbjct: 263 -FYALKPD---RNVELTMKLNPKARTFQQWL 289



>gi|397470086|ref|XP_003806664.1| PREDICTED: nmrA-like family domain-containing protein 1-like
           isoform 1 [Pan paniscus]
          Length = 299

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/216 (29%), Positives = 111/216 (51%), Gaps = 15/216 (6%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK++AD AK  GL  ++YS L +    + GK  +V HF  K  VE+Y   +G+P +T  
Sbjct: 93  QGKLVADSAKHLGLKHVVYSGLENVKRLTDGKL-EVPHFDSKGEVEEYFWSIGVP-MTSV 150

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
            ++ Y +N    + P+ +++     L +P    +  +  I V D G  ++ I    P ++
Sbjct: 151 RVAAYFENFLAAWRPVKASDGDYYTLAVPM--GDVPMDGISVADIGAAVSSIFNS-PEEF 207

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYEK 181
            GK V +++E +T +Q  DVL+KV GK  +   +  E   K  FP    K +  M ++ +
Sbjct: 208 LGKAVGLSAEALTTQQYADVLSKVLGKEVRDTKITPEAFEKLGFPA--AKEIANMCRFYE 265

Query: 182 EFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
               +  D   +D+ +  +L+P +K+F Q+I E  G
Sbjct: 266 ----MKPD---RDVKLTHQLNPKVKSFSQFISENQG 294



>gi|119389384|pdb|2EXX|A Chain A, Crystal Structure Of Hscarg From Homo Sapiens In Complex
           With Nadp
 gi|119389385|pdb|2EXX|B Chain B, Crystal Structure Of Hscarg From Homo Sapiens In Complex
           With Nadp
          Length = 306

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 61/212 (28%), Positives = 111/212 (52%), Gaps = 15/212 (7%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+A+  GL++++YS L +    + G+     HF GK  VE+Y R +G+P +T 
Sbjct: 99  KQGKLLADLARRLGLHYVVYSGLENIKKLTAGRLA-AAHFDGKGEVEEYFRDIGVP-MTS 156

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ + FLP  + +     L +P    +  +  + V D GP++  +++  P K
Sbjct: 157 VRLPCYFENLLSHFLPQKAPDGKSYLLSLP--TGDVPMDGMSVSDLGPVVLSLLKM-PEK 213

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + G+ + +++   T ++   +LTK T K      +  ED  K  FP    + L  MF+  
Sbjct: 214 YVGQNIGLSTCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFP--GARDLANMFR-- 269

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
             F A+  D   +DI +  +L+P   T +Q++
Sbjct: 270 --FYALRPD---RDIELTLRLNPKALTLDQWL 296



>gi|489665303|ref|WP_003569594.1| putative nucleoside-diphosphate sugar epimerase [Rhizobium
           leguminosarum]
 gi|393173747|gb|EJC73791.1| putative nucleoside-diphosphate sugar epimerase [Rhizobium
           leguminosarum bv. trifolii WSM2012]
          Length = 317

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 116/226 (51%), Gaps = 20/226 (8%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGG-KYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           G+ +AD A E G+  +++S+L +    +GG KY    HFT K  V  YIR L I + +F 
Sbjct: 97  GRQLADAAVEAGIGHIVFSTLENVDKIAGGTKY--APHFTDKARVADYIRGLPISH-SFI 153

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIP-YFEENDQLLLID-VRDTGPIIAKIIEEGPT 120
            L+F+  N+  ++ P +  +     L++P Y  E+     +D +  TGP++ +I    P 
Sbjct: 154 MLAFFYTNLLEYYAPRMEGDT----LLLPIYLPEDFAAPFVDPLTATGPVVLEIFSN-PE 208

Query: 121 KWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDED-IAKDFPTLNN-----KSLK 174
           ++NGK +PI  + ++ +++ +   +VTG   + R     D +   FP         + + 
Sbjct: 209 RYNGKTLPIVGDIISPREMVETFQRVTGLKAEYRNAFTRDGLLHYFPEFAANEFLVREIL 268

Query: 175 QMFKYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYGKSD 220
            M +Y  E+G  GK+++L+    +++L+P    +EQ +  T  + D
Sbjct: 269 GMVEYAVEYGYFGKEHDLE---WSRRLNPETLDWEQLLRTTGWRGD 311



>gi|354488479|ref|XP_003506396.1| PREDICTED: LOW QUALITY PROTEIN: nmrA-like family domain-containing
           protein 1-like [Cricetulus griseus]
          Length = 305

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/216 (28%), Positives = 118/216 (54%), Gaps = 15/216 (6%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK++AD+AK  GL++++YS L +    + G+     HF GK  VE+Y R +G+P +T  
Sbjct: 99  QGKLLADLAKRLGLHYVVYSGLENIRKLTAGRLA-AGHFDGKGEVEEYFRDIGVP-MTSV 156

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
            L  Y +N+ ++FLP  + +     L +P    +  +  + V D GP++  ++++ P ++
Sbjct: 157 RLPCYFENLLSYFLPQKAADGKSYLLDLPM--GDVPMDGMAVSDLGPVVLSLLKK-PEEY 213

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKT-HKVRTLNDEDIAKDFPTLNNKSLKQMFKYEK 181
            G+ + +++   T ++   +LT+  GKT H  +T   ED  +    L  + L  MF+   
Sbjct: 214 VGQNIGLSTCKHTAEEYAALLTRHIGKTVHHAKT-TPEDYER-LGFLGARDLANMFR--- 268

Query: 182 EFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
            F A+  D  + D+T+  +L+P  +T +Q++ +  G
Sbjct: 269 -FYALKPDRNI-DLTL--QLNPKAQTLDQWLEQHKG 300



>gi|237640509|pdb|3E5M|A Chain A, Crystal Structure Of The Hscarg Y81a Mutant
 gi|237640510|pdb|3E5M|B Chain B, Crystal Structure Of The Hscarg Y81a Mutant
          Length = 299

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/217 (28%), Positives = 113/217 (52%), Gaps = 15/217 (6%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+A+  GL++++YS L +    + G+     HF GK  VE+Y R +G+P +T 
Sbjct: 92  KQGKLLADLARRLGLHYVVYSGLENIKKLTAGRLA-AAHFDGKGEVEEYFRDIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ + FLP  + +     L +P    +  +  + V D GP++  +++  P K
Sbjct: 150 VRLPCYFENLLSHFLPQKAPDGKSYLLSLP--TGDVPMDGMSVSDLGPVVLSLLKM-PEK 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + G+ + +++   T ++   +LTK T K      +  ED  K  FP    + L  MF+  
Sbjct: 207 YVGQNIGLSTCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFP--GARDLANMFR-- 262

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
             F A+  D   +DI +  +L+P   T +Q++ +  G
Sbjct: 263 --FYALRPD---RDIELTLRLNPKALTLDQWLEQHKG 294



>gi|322701216|gb|EFY92966.1| nitrogen metabolite repression-(nmr)-responsible protein
           [Metarhizium acridum CQMa 102]
          Length = 461

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 83/156 (53%), Gaps = 8/156 (5%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           G  +AD AK+ G+   IYSS+PD    +   +P +  +  K+ VE+Y+RKL +P  TF Y
Sbjct: 171 GMALADAAKKAGVQHYIYSSMPDHKAYNK-DWPSLPLWAAKHEVEEYVRKLDLP-ATFVY 228

Query: 64  LSFYSQNIGTFFLPLIS---NENGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEGP 119
              Y+ N  +   PL      E+G      P F E+ +L  +D   D GP I ++ ++G 
Sbjct: 229 TGIYNNNFTSLPYPLFCMELQEDGSFVWQAP-FHEDAKLPWLDAEHDVGPAIVQLFKDGV 287

Query: 120 TKWNGKKVPIASENVTIKQITDVLTKVTGK-THKVR 154
           +KW G+++ +A E ++ K+   +  +  G+  H VR
Sbjct: 288 SKWKGERIALAYEYLSPKEACRLFARGVGRPVHYVR 323



>gi|241203614|ref|YP_002974710.1| NmrA family protein [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|502301474|ref|WP_012756532.1| NmrA family protein [Rhizobium leguminosarum]
 gi|240857504|gb|ACS55171.1| NmrA family protein [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 317

 Score = 85.1 bits (209), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 116/226 (51%), Gaps = 20/226 (8%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPD-STTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           G+ +AD A E G+  +++S+L +     SG KY    HFT K  V  +IR L I + +F 
Sbjct: 97  GRQLADAAAEAGVGHIVFSTLENVDKITSGTKY--APHFTDKARVADHIRGLPISH-SFV 153

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIP-YFEENDQLLLID-VRDTGPIIAKIIEEGPT 120
            L+F+  N+  +++P +  +     L++P Y  E+ +   +D +  TGP + +I    P 
Sbjct: 154 MLAFFYTNLLEYYVPRMEGDT----LLLPVYLPEDFRAPFVDPLTATGPAVLEIFSN-PE 208

Query: 121 KWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDED-IAKDFPTLNN-----KSLK 174
           ++NGK +PI  + ++  ++ +   +VTG     R     D +   FP         + L 
Sbjct: 209 RYNGKTLPIVGDIISPSEMIETFQRVTGLKAAYRNAFTRDGLLHYFPEFAANELLVRELL 268

Query: 175 QMFKYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYGKSD 220
            M +Y  ++G  GK+++L+    +++L+P+   +EQY+  T  + D
Sbjct: 269 GMVEYAVDYGYFGKEHDLE---WSRRLNPDTLNWEQYLKTTGWRGD 311



>gi|431906585|gb|ELK10706.1| NmrA-like family domain-containing protein 1 [Pteropus alecto]
          Length = 298

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 117/217 (53%), Gaps = 16/217 (7%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK +AD+AK  GL++++YS L +    + G+     HF GK  VE+Y R +G+P +T 
Sbjct: 92  KQGKRLADVAKRLGLHYVVYSGLENIKKLTAGRLA-AGHFDGKGEVEEYFRDIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L FY +N+ + FLP  + +     L +P    +  +  + V D GP++  +++  P +
Sbjct: 150 VRLPFYFENLLS-FLPQKAPDGKSYLLSLPM--GDAPMDGMSVSDLGPVVLSLLKM-PEE 205

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKT-HKVRTLNDEDIAKDFPTLNNKSLKQMFKYE 180
           + G+ + +++   T+++   +L+K TGK  H  +T  ++     FP    + L  MF+  
Sbjct: 206 YIGQNLGLSTCRHTVEEYAALLSKHTGKAVHDAKTTPEDYERLGFP--GARDLANMFR-- 261

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
             F A+  D   ++I +  +L+P  +T +Q++ +  G
Sbjct: 262 --FYALKPD---RNIELTLRLNPKARTLDQWLEQHKG 293



>gi|489683671|ref|WP_003587893.1| putative nucleoside-diphosphate sugar epimerase [Rhizobium
           leguminosarum]
 gi|392851208|gb|EJB03729.1| putative nucleoside-diphosphate sugar epimerase [Rhizobium
           leguminosarum bv. trifolii WSM597]
          Length = 317

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/226 (27%), Positives = 116/226 (51%), Gaps = 20/226 (8%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGG-KYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           G+ +AD A E G+  +++S+L +    +GG KY    HFT K  V  YIR L I + +F 
Sbjct: 97  GRQLADAAVEAGVGHVVFSTLENVDKITGGTKY--APHFTDKARVADYIRGLPISH-SFI 153

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIP-YFEENDQLLLID-VRDTGPIIAKIIEEGPT 120
            L+F+  N+  ++ P +  +     L++P Y  E+     +D +  TGP++ +I    P 
Sbjct: 154 MLAFFYTNLLEYYAPRMEGDT----LLLPIYLPEDFAAPFVDPLTATGPVVLEIFSN-PE 208

Query: 121 KWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDED-IAKDFPTLNN-----KSLK 174
           ++NGK +PI  + ++ +++ +   +VTG   + R     D +   FP         + L 
Sbjct: 209 RYNGKTLPIVGDIISPREMVETFQRVTGLKAEYRNAFTRDGLLAYFPEFAANESFVRELL 268

Query: 175 QMFKYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYGKSD 220
            M +Y   +G  GK+++L+    +++L+P    +EQ++  T  + D
Sbjct: 269 GMVEYAVGYGYFGKEHDLE---WSRRLNPGTLDWEQFLRTTGWRGD 311



>gi|119605708|gb|EAW85302.1| HSCARG protein, isoform CRA_b [Homo sapiens]
          Length = 335

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/217 (28%), Positives = 113/217 (52%), Gaps = 15/217 (6%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+A+  GL++++YS L +    + G+     HF GK  VE+Y R +G+P +T 
Sbjct: 128 KQGKLLADLARRLGLHYVVYSGLENIKKLTAGRLA-AAHFDGKGEVEEYFRDIGVP-MTS 185

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ + FLP  + +     L +P    +  +  + V D GP++  +++  P K
Sbjct: 186 VRLPCYFENLLSHFLPQKAPDGKSYLLSLP--TGDVPMDGMSVSDLGPVVLSLLKM-PEK 242

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + G+ + +++   T ++   +LTK T K      +  ED  K  FP    + L  MF+  
Sbjct: 243 YVGQNIGLSTCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFP--GARDLANMFR-- 298

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
             F A+  D   +DI +  +L+P   T +Q++ +  G
Sbjct: 299 --FYALRPD---RDIELTLRLNPKALTLDQWLEQHKG 330



>gi|367038797|ref|XP_003649779.1| hypothetical protein THITE_2108713 [Thielavia terrestris NRRL 8126]
 gi|346997040|gb|AEO63443.1| hypothetical protein THITE_2108713 [Thielavia terrestris NRRL 8126]
          Length = 468

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 65/231 (28%), Positives = 116/231 (50%), Gaps = 27/231 (11%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           G+ +AD AK+ G+   +YSS+PD    +  ++P +  +  K+ VE+Y++K G+P  TF Y
Sbjct: 173 GQALADAAKKAGIQHYVYSSMPDHNAYNK-EWPSLPLWASKHKVEEYVKKTGLP-ATFVY 230

Query: 64  LSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEGP 119
              Y+ N  +   PL   E   +G      P F  + +L  +D   D GP I +I ++G 
Sbjct: 231 TGIYNNNFTSLPYPLFCTELQPDGSWIWQAP-FHPDVKLPWLDAEHDVGPAILQIFKDGT 289

Query: 120 TKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDE-DIAKDFPTLNNKSLKQMFK 178
            KW GK++ +A E ++ ++  +V ++  G+   VR ++   +I    P      L+ +  
Sbjct: 290 KKWGGKRIALAYEMLSPREACEVFSRGVGR--PVRYVHGPIEIKVTIPEGYRSQLEAL-- 345

Query: 179 YEKEFGAIGKDN-----------ELQDIT--IAKKLHPNIKTFEQYILETY 216
            E+ FG +GKD+           EL+D    +A +L    ++ E+Y  E +
Sbjct: 346 -EELFG-LGKDDPKKQPPYFGDQELEDSCPRVALELWEGPRSLEEYAREVF 394



>gi|378775866|ref|YP_005191373.1| NmrA-like family domain-containing protein 1 [Sinorhizobium fredii
           HH103]
 gi|504096916|ref|WP_014330910.1| NmrA-like family domain-containing protein 1 [Sinorhizobium fredii]
 gi|365181754|emb|CCE98606.1| NmrA-like family domain-containing protein 1 [Sinorhizobium fredii
           HH103]
          Length = 317

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 64/226 (28%), Positives = 118/226 (52%), Gaps = 20/226 (8%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGG-KYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           G+ +AD A E G+  +++S+L      +GG KY    HFT K  V  YI  L I + +F 
Sbjct: 97  GRQLADAAVEAGVGHIVFSTLEGVDKITGGTKY--APHFTDKARVADYISSLPISH-SFI 153

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIP-YFEENDQLLLID-VRDTGPIIAKIIEEGPT 120
            L+F+  N+  +++P +  +     L++P Y  EN +   +D +  TGP++ +I    P 
Sbjct: 154 MLAFFYTNLLEYYVPRMEGDT----LLLPVYLPENFRAPFVDPLTATGPVVLEIFSN-PE 208

Query: 121 KWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDED-IAKDFPTL-NNKSLKQ--- 175
            +NGK +PI  + ++ +++ +   +VTG   + R     D + + FP    N+ L Q   
Sbjct: 209 LYNGKTLPIVGDIISPREMVETFQRVTGLKAEYRNAFTRDGLLQYFPEFAANELLVQEIL 268

Query: 176 -MFKYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYGKSD 220
            M +Y  E+G  G  ++L+    +++L+P+   +EQ++  T  + D
Sbjct: 269 GMVEYAVEYGYFGNQHDLE---WSRRLNPDTLNWEQFLRATGWRGD 311



>gi|242791315|ref|XP_002481733.1| nitrogen metabolite repression regulator NmrA [Talaromyces
           stipitatus ATCC 10500]
 gi|218718321|gb|EED17741.1| nitrogen metabolite repression regulator NmrA [Talaromyces
           stipitatus ATCC 10500]
          Length = 352

 Score = 84.7 bits (208), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 82/168 (48%), Gaps = 9/168 (5%)

Query: 4   GKMIADIAKEKG-LNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           G+ +AD AK  G +   IYSS+PD +    G +P    +  K  VE Y+R+LGIP  TF 
Sbjct: 92  GRALADAAKRAGTIQHYIYSSMPDHSVH--GPWPGPPMWACKFTVENYVRQLGIP-ATFV 148

Query: 63  YLSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEG 118
           Y   Y+ N  +   PL   E   +G  +   P F  +  L  +D   D GP + +I ++G
Sbjct: 149 YAGIYNNNFTSLPYPLFQMELQPDGSFEWAAP-FNPDVPLPWLDAEHDVGPALIQIFKDG 207

Query: 119 PTKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFP 166
           P +WNG ++ +  E ++  Q+     +  G+  + R  +  +I    P
Sbjct: 208 PKRWNGHRIALTFETLSPIQVCAAFGRALGRRVRYRRTSKIEIKVKIP 255



>gi|402907521|ref|XP_003919629.1| PREDICTED: LOW QUALITY PROTEIN: nmrA-like family domain-containing
           protein 1 [Papio anubis]
          Length = 299

 Score = 84.7 bits (208), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/217 (29%), Positives = 112/217 (51%), Gaps = 15/217 (6%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL++++YS L +    + G+     HF GK  VE+Y R +G+P +T 
Sbjct: 92  KQGKLLADLAKHLGLHYVVYSGLENIKKLTAGRL-TAAHFDGKGEVEEYFRDIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N  + FLP  + +     L +P    +  +  + V D GP++  +++  P K
Sbjct: 150 VRLPCYFENFLSHFLPQKAPDGKSYLLSLP--TGDVPMDGMSVSDLGPVVLSLLKM-PEK 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + G+ + +++   T ++   +LTK T K      +  ED  K  FP    + L  MF+  
Sbjct: 207 YIGQNIGLSTCRHTAEEYAALLTKHTHKVVHDAKMTPEDYEKLGFP--GARDLANMFR-- 262

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
             F A+  D+   DI +  +L+P   T +Q++ +  G
Sbjct: 263 --FYALRPDH---DIELTLRLNPKALTLDQWLEQHKG 294



>gi|300797607|ref|NP_001178517.1| nmrA-like family domain-containing protein 1 [Rattus norvegicus]
 gi|149042650|gb|EDL96287.1| similar to RIKEN cDNA 1110025F24 (predicted), isoform CRA_a [Rattus
           norvegicus]
          Length = 305

 Score = 84.7 bits (208), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/218 (27%), Positives = 119/218 (54%), Gaps = 19/218 (8%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK++AD+AK  GL++++YS L +    + G+     HF GK  VE+Y R +G+P +T  
Sbjct: 99  QGKLLADLAKRLGLHYVVYSGLENIKKLTAGRLA-AGHFDGKGEVEEYFRHIGVP-MTSV 156

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
            L  Y +N+ ++FLP  + +     L +P    +  +  + V D GP++  ++++ P ++
Sbjct: 157 RLPCYFENLLSYFLPQKAADGKSFLLDLPM--GDVPMDGMSVSDLGPVVLSLLKK-PEEY 213

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTL---NNKSLKQMFKY 179
            G+ V +++   T ++   +L+K TGKT     L+ +   +++  L     + L  MF+ 
Sbjct: 214 IGQNVGLSTCRHTAEEYAALLSKHTGKT----VLHAKTTPEEYEKLGFQGAQDLANMFR- 268

Query: 180 EKEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
              F A+  D  + D+T+  +L+P  +T +Q++ +  G
Sbjct: 269 ---FYALKPDRNI-DLTL--RLNPKAQTLDQWLEQHKG 300



>gi|355709924|gb|EHH31388.1| NmrA-like family domain-containing protein 1 [Macaca mulatta]
          Length = 299

 Score = 84.7 bits (208), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 62/212 (29%), Positives = 110/212 (51%), Gaps = 15/212 (7%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL++++YS L +    + G+     HF GK  VE+Y R +G+P +T 
Sbjct: 92  KQGKLLADLAKHLGLHYVVYSGLQNIKKLTAGRL-TAAHFDGKGEVEEYFRDIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N  + FLP  + +     L +P    +  +  + V D GP++  +++  P K
Sbjct: 150 VRLPCYFENFLSHFLPQKAPDGKSYLLSLP--TGDVPMDGMSVSDLGPVVLSLLKM-PEK 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + G+ + +++   T ++   +LTK T K      +  ED  K  FP    + L  MF+  
Sbjct: 207 YIGQNIGLSTCRHTAEEYAALLTKHTHKVVHDAKMTPEDYEKLGFP--GARDLANMFR-- 262

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
             F A+  D+   DI +  +L+P   T +Q++
Sbjct: 263 --FYALRPDH---DIELTLRLNPKALTLDQWL 289



>gi|493750259|ref|WP_006699215.1| NmrA-like family domain-containing protein 1 [Rhizobium lupini]
 gi|408486510|gb|EKJ94836.1| NmrA-like family domain-containing protein 1 [Rhizobium lupini
           HPC(L)]
          Length = 317

 Score = 84.7 bits (208), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 113/217 (52%), Gaps = 18/217 (8%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           GK +AD A E G+  +++S+L +    +GGK     HFT K  V  YIR L + + +F  
Sbjct: 97  GKKLADAAVEAGVGHIVFSTLDNVDKITGGK-KYAPHFTDKALVADYIRTLPVTH-SFVS 154

Query: 64  LSFYSQNIGTFFLPLISNENGEIDLVIP-YFEENDQLLLID-VRDTGPIIAKIIEEGPTK 121
           L+F+  N+  +++P +  +     L++P Y  E+     +D    TGP +  I+ + P  
Sbjct: 155 LAFFYTNLLEYYVPQMKGDT----LLMPIYLPEDFCAPFVDPTTATGPAVLSILSD-PDT 209

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDED-IAKDFPTLNN-----KSLKQ 175
           + GK +PI  E ++ ++I D    VTG   + R+    D +   FP         + L  
Sbjct: 210 FRGKTLPIVGEIISPREIVDTFQTVTGIKAEYRSAYSRDELLHYFPGFAANDLLVQELIG 269

Query: 176 MFKYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
           M +Y  E+G  G+++   D+  +++L+P++ T+E+++
Sbjct: 270 MVEYAVEYGYFGREH---DLDWSRRLNPDMLTWEKFL 303



>gi|322703483|gb|EFY95091.1| nitrogen metabolite repression-(nmr)-responsible protein
           [Metarhizium anisopliae ARSEF 23]
          Length = 659

 Score = 84.7 bits (208), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 83/156 (53%), Gaps = 8/156 (5%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           G  +AD AK+ G+   IYSS+PD    +   +P +  +  K+ VE+Y+RKL +P  TF Y
Sbjct: 369 GMALADAAKKAGVQHYIYSSMPDHKAYNK-DWPSLPLWAAKHEVEEYVRKLDLP-ATFVY 426

Query: 64  LSFYSQNIGTFFLPLIS---NENGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEGP 119
              Y+ N  +   PL      E+G      P F E+ +L  +D   D GP I ++ ++G 
Sbjct: 427 TGIYNNNFTSCPYPLFCMELQEDGSFIWQAP-FHEDAKLPWLDAEHDVGPAIVQLFKDGV 485

Query: 120 TKWNGKKVPIASENVTIKQITDVLTKVTGK-THKVR 154
           +KW G+++ +A E ++ K+   +  +  G+  H VR
Sbjct: 486 SKWKGERIALAYEYLSPKEACRLFARGVGRPVHYVR 521



>gi|388490430|ref|NP_001252614.1| nmrA-like family domain-containing protein 1 [Macaca mulatta]
 gi|355756522|gb|EHH60130.1| NmrA-like family domain-containing protein 1 [Macaca fascicularis]
          Length = 299

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/217 (29%), Positives = 112/217 (51%), Gaps = 15/217 (6%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL++++YS L +    + G+     HF GK  VE+Y R +G+P +T 
Sbjct: 92  KQGKLLADLAKHLGLHYVVYSGLQNIKKLTAGRL-TAAHFDGKGEVEEYFRDIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N  + FLP  + +     L +P    +  +  + V D GP++  +++  P K
Sbjct: 150 VRLPCYFENFLSHFLPQKAPDGKSYLLSLP--TGDVPMDGMSVSDLGPVVLSLLKM-PEK 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + G+ + +++   T ++   +LTK T K      +  ED  K  FP    + L  MF+  
Sbjct: 207 YIGQNIGLSTCRHTAEEYAALLTKHTHKVVHDAKMTPEDYEKLGFP--GARDLANMFR-- 262

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
             F A+  D+   DI +  +L+P   T +Q++ +  G
Sbjct: 263 --FYALRPDH---DIELTLRLNPKALTLDQWLEQHKG 294



>gi|310794371|gb|EFQ29832.1| NmrA-like family protein [Glomerella graminicola M1.001]
          Length = 402

 Score = 84.3 bits (207), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 80/150 (53%), Gaps = 7/150 (4%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           GK +AD AK  G+   +YSS+PD    +   +P +  +  K+ VE+Y+R + +P+ TF Y
Sbjct: 113 GKALADAAKVAGVQHYVYSSMPDHAAYNT-DWPSLPLWAAKHKVEEYVRSIDLPS-TFVY 170

Query: 64  LSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEGP 119
              Y+ N  +   PL   E   +G      P F E+ +L  ID   D GP I +I ++G 
Sbjct: 171 TGIYNNNFTSLPYPLFCMELQRDGSFQWQAP-FHEDVKLPWIDAEHDIGPAILQIFKDGV 229

Query: 120 TKWNGKKVPIASENVTIKQITDVLTKVTGK 149
           +KW  K++ +A E +T ++  +V  +  G+
Sbjct: 230 SKWRAKRIALAWEMLTPREACEVFARGVGR 259



>gi|466084988|ref|XP_004285420.1| PREDICTED: nmrA-like family domain-containing protein 1-like
           [Orcinus orca]
          Length = 298

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 59/217 (27%), Positives = 117/217 (53%), Gaps = 15/217 (6%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL++++YS L +    + G+     HF GK  VE+Y R +G+P +T 
Sbjct: 91  KQGKLLADLAKRLGLHYVVYSGLENIKKLTAGRLA-AGHFDGKGEVEEYFRDIGVP-MTS 148

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ + FLP  + +     L +P    +  +  + V D GP++  +++  P  
Sbjct: 149 VRLPCYFENLLSCFLPQKAPDGKSYLLSLPM--GDVPMDGMSVSDLGPVVLSLLKM-PED 205

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + G+ + +++   T+++   +L++ T KT +   ++ ED  K  FP    + L  MF+  
Sbjct: 206 YIGQNIGLSTCRHTVEEYAALLSRHTRKTVRDAKISPEDYEKLGFP--GAQDLANMFR-- 261

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
             F A+  D   ++I ++ +L+P  +  +Q++ +  G
Sbjct: 262 --FYALKPD---RNIELSLRLNPKARMLDQWLEQHKG 293



>gi|296219478|ref|XP_002755897.1| PREDICTED: nmrA-like family domain-containing protein 1 [Callithrix
           jacchus]
          Length = 299

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 63/217 (29%), Positives = 112/217 (51%), Gaps = 15/217 (6%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL++++YS L +    + G+     HF GK  VE+Y R +G+P +T 
Sbjct: 92  KQGKLLADLAKRLGLHYVVYSGLENIKKLTAGRL-TAAHFDGKGEVEEYFRDIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N  + FLP  + +     L +P    +  +  + V D GP++  +++  P K
Sbjct: 150 VRLPCYFENFLSHFLPQKAPDGKSYLLSLP--TGDVPMDGMSVSDLGPVVLSLLKM-PEK 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + G+ + +++   T ++   +LTK T K      +  ED  K  FP    + L  MF+  
Sbjct: 207 YVGQNIGLSTCRHTAEEYAALLTKHTRKVVHNTKMTPEDYEKLGFP--GAQDLANMFR-- 262

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
             F A+  D   +DI +  +L+P   T +Q++ +  G
Sbjct: 263 --FYALRPD---RDIELTLRLNPKALTLDQWLEQHKG 294



>gi|149751156|ref|XP_001502359.1| PREDICTED: nmrA-like family domain-containing protein 1-like [Equus
           caballus]
          Length = 299

 Score = 84.0 bits (206), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 113/212 (53%), Gaps = 15/212 (7%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+ K  GL +++YS L +    + G+     HF GK  VE+Y R +G+P +T 
Sbjct: 92  KQGKLLADLTKRLGLRYVVYSGLENIKKLTAGRLA-AGHFDGKGEVEEYFRDIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ ++FLP  +       L +P    +  +  + V D GP++  +++  P +
Sbjct: 150 VRLPCYFENLLSYFLPQKAPGGKSYLLSLPM--GDVPMDGMSVSDLGPVVLSLLKM-PEE 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHK-VRTLNDEDIAKDFPTLNNKSLKQMFKYE 180
           + G+ + +++   T ++   +L+K TGK  +  +T  +E   + FP    + L  MF+  
Sbjct: 207 YVGQNIGLSTCRHTAEEYAALLSKHTGKAVRDAKTTPEEYEKRGFP--GAQDLANMFR-- 262

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
             F A+  D   ++I +  +L+P  +T +Q++
Sbjct: 263 --FYALKPD---RNIELTLRLNPKARTLDQWL 289



>gi|375146506|ref|YP_005008947.1| NmrA family protein [Niastella koreensis GR20-10]
 gi|503985463|ref|WP_014219457.1| NmrA family protein [Niastella koreensis]
 gi|361060552|gb|AEV99543.1| NmrA family protein [Niastella koreensis GR20-10]
          Length = 315

 Score = 84.0 bits (206), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 59/220 (26%), Positives = 112/220 (50%), Gaps = 18/220 (8%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           GK +AD A E G+  +I+SSL +    SGG      HFT K ++E YIR L + + +F Y
Sbjct: 97  GKQLADAAVEAGVRHIIFSSLENVDKISGGIL-FAPHFTDKANIEAYIRTLPVTS-SFIY 154

Query: 64  LSFYSQNIGTFFLPLISNENGEIDLVIP-YFEENDQLLLID-VRDTGPIIAKIIEEGPTK 121
           ++F+  N+  F+ P +  +     LV P Y  ++ +   +D +  TGP + +I    P K
Sbjct: 155 MAFFYTNLMEFYPPAMKGDT----LVFPIYLPKDFRAPFVDPLTATGPAVLEIFSN-PDK 209

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTG-KTHKVRTLNDEDIAKDFPTLNN-----KSLKQ 175
           + G  +P+  + ++ +++ D   +VTG K         E++   FP  ++     + +  
Sbjct: 210 YAGMSLPVIGDLISPQEMVDTFMQVTGRKAEYTSAFTQEELLYHFPDFSSNEMLVREIIG 269

Query: 176 MFKYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYILET 215
           M  Y  E+G    +   +D+  +++++P+   +EQ++  T
Sbjct: 270 MVAYAVEYGYFSNN---RDLLWSRQINPHTLNWEQFLRTT 306



>gi|212536955|ref|XP_002148633.1| NmrA family transcriptional regulator, putative [Talaromyces
           marneffei ATCC 18224]
 gi|210068375|gb|EEA22466.1| NmrA family transcriptional regulator, putative [Talaromyces
           marneffei ATCC 18224]
          Length = 333

 Score = 84.0 bits (206), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 66/219 (30%), Positives = 111/219 (50%), Gaps = 21/219 (9%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK +AD  K  G+  LI+SSL   +  + GK P+V+HF GK  +EQYIR  GIP  TF 
Sbjct: 123 QGKAVADACKNTGVKHLIFSSLRSISEVTSGKLPNVSHFEGKAEIEQYIRNSGIP-ATFV 181

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEGPTK 121
               + Q +      +I   +    L +P   E  ++ + DV  DTG  +  +++  P  
Sbjct: 182 LAGLFMQGLSG---SMIKKRDDVYMLALPIDPETAKIPVFDVEEDTGKFVKAVVKNYPNI 238

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDF--PTLNNKSLKQMFKY 179
             GK++ IA++ V+ +Q+TD +++  G       + +E   K F  P +  + L+ M   
Sbjct: 239 I-GKRILIATDYVSPRQLTDEISQTLGVKAAAIQIPEETF-KSFLPPPVAQELLENMLVM 296

Query: 180 EKE--FG--AIGKDNELQDITIAKKLHPNIKTFEQYILE 214
           ++E  FG  ++ K + L        L  N+ T++++IL 
Sbjct: 297 DREGYFGGESLDKSHFL--------LEDNLTTWKEHILR 327



>gi|154285214|ref|XP_001543402.1| hypothetical protein HCAG_00448 [Ajellomyces capsulatus NAm1]
 gi|150407043|gb|EDN02584.1| hypothetical protein HCAG_00448 [Ajellomyces capsulatus NAm1]
          Length = 413

 Score = 83.6 bits (205), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 77/151 (50%), Gaps = 5/151 (3%)

Query: 4   GKMIADIAKEKG-LNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           G+ +AD AK  G +   IYSS+PD    +  ++  +  ++ K  VE Y+R+LG+P  TF 
Sbjct: 100 GRDLADAAKRAGSITHYIYSSMPDHAAHNPSRWISLPLWSCKFAVENYVRQLGLP-ATFV 158

Query: 63  YLSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGP 119
           Y   Y+ N  +   PL   E   NG  +   P+  +     L    D GP + +I ++GP
Sbjct: 159 YAGIYNNNFTSLPYPLFQMELLENGSFEWRAPFHPDIPLPWLDAEHDVGPTVLQIFKDGP 218

Query: 120 TKWNGKKVPIASENVTIKQITDVLTKVTGKT 150
            +WNG ++ ++ E +T  Q+    ++   ++
Sbjct: 219 KRWNGHRIALSFETLTPNQVCAAFSRALRRS 249



>gi|281212082|gb|EFA86243.1| hypothetical protein PPL_00805 [Polysphondylium pallidum PN500]
          Length = 326

 Score = 83.6 bits (205), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 109/212 (51%), Gaps = 13/212 (6%)

Query: 8   ADIAKEKGLNWLIYSSLPDSTTESGGKYP-DVTHFTGKNHVEQYIRKLGIPNV-TFAYLS 65
           ADIA E+ +  +I+SS+   T E   ++  D+   +GKN  ++YI  L +  V TF    
Sbjct: 102 ADIALEEKVEHVIFSSVDVPTAEQLKEFKHDI--LSGKNKAQKYIESLPLKYVSTFNLAY 159

Query: 66  FYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKWNGK 125
           FYS  I   F PLI N +G  +L +P   + +Q  +     TGPI+++ +   P K+N  
Sbjct: 160 FYSNQIE--FFPLIKNSDGSFELSMPLGADVEQPYVDTYTATGPIVSEFLAH-PEKYNRA 216

Query: 126 KVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQ-----MFKYE 180
            VP+ SE +T +Q+     +VTG     + L+ E   + + + N    +Q     +F+  
Sbjct: 217 VVPVVSEFLTGRQMAQTFQEVTGIKTTYKELSREQYLEQY-SFNGSPEQQLVGNRLFEVW 275

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
            E    G  N  +D+T++KK++P   T+ Q++
Sbjct: 276 DETSKCGYYNHDRDVTLSKKINPKQLTWRQFL 307



>gi|119498963|ref|XP_001266239.1| nitrogen metabolite repression regulator NmrA [Neosartorya fischeri
           NRRL 181]
 gi|119414403|gb|EAW24342.1| nitrogen metabolite repression regulator NmrA [Neosartorya fischeri
           NRRL 181]
          Length = 352

 Score = 83.6 bits (205), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 84/169 (49%), Gaps = 9/169 (5%)

Query: 4   GKMIADIAKEKG-LNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           GK +AD AK  G +   IYSS+PD +    G +P V  +  K  VE YIR+LG+P  TF 
Sbjct: 92  GKALADAAKRAGSIQHYIYSSMPDHSVH--GPWPPVPLWAPKFTVENYIRQLGLP-ATFV 148

Query: 63  YLSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEG 118
           Y   Y+ N  +   PL   E   +G  +   P F+ +  L  +D   D GP + +I ++G
Sbjct: 149 YAGIYNNNFTSLPYPLFQMELMPDGSFEWHAP-FDPDTPLPWLDAEHDVGPALLQIFKDG 207

Query: 119 PTKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPT 167
           P KW+G ++ +  E ++  Q+    ++   +  +   +   +I  + P 
Sbjct: 208 PKKWHGHRIALTFETLSPNQVCAAFSRALNRPCRYVHVPKVEIKVNIPA 256



>gi|24431937|ref|NP_080669.1| nmrA-like family domain-containing protein 1 [Mus musculus]
 gi|81901029|sp|Q8K2T1.1|NMRL1_MOUSE RecName: Full=NmrA-like family domain-containing protein 1
 gi|20987990|gb|AAH30039.1| NmrA-like family domain containing 1 [Mus musculus]
 gi|148664830|gb|EDK97246.1| NmrA-like family domain containing 1, isoform CRA_c [Mus musculus]
          Length = 309

 Score = 83.2 bits (204), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 116/217 (53%), Gaps = 15/217 (6%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL++++YS L +    + GK     HF GK  VE+Y R +G+P +T 
Sbjct: 102 KQGKLLADLAKRLGLHYVVYSGLENIRKLTAGKLA-AGHFDGKGEVEEYFRDIGVP-MTS 159

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ ++FLP  + +     L +P    +  +  + V D GP++  ++++ P +
Sbjct: 160 VRLPCYFENLLSYFLPQKAADGKSFLLDLPM--GDVPMDGMSVSDLGPVVLSLLKK-PEE 216

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKT-HKVRTLNDEDIAKDFPTLNNKSLKQMFKYE 180
           + G+ + +++   T ++   +L+K TGK  H  +T   ED  K       + L  MF+  
Sbjct: 217 YVGQNIGLSTCRHTAEEYAALLSKHTGKAVHHAKT-TPEDYEK-LGFQGAQDLANMFR-- 272

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
             F  +  D   ++I +  +L+P  +T +Q++ +  G
Sbjct: 273 --FYTLKPD---RNIHLTLRLNPKAQTLDQWLEQHKG 304



>gi|410049940|ref|XP_001173760.3| PREDICTED: NmrA-like family domain containing 1 [Pan troglodytes]
          Length = 533

 Score = 83.2 bits (204), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 62/217 (28%), Positives = 113/217 (52%), Gaps = 15/217 (6%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+A+  GL++++YS L +    + G+     HF GK  VE+Y R +G+P +T 
Sbjct: 326 KQGKLLADLARRLGLHYVVYSGLENIKKLTAGRL-AAAHFDGKGEVEEYFRDIGVP-MTS 383

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ + FLP  + +     L +P  +    +  + V D GP++  +++  P K
Sbjct: 384 VRLPCYFENLLSHFLPQKAPDGKSYLLSLPTGDV--PMDGMSVSDLGPVVLSLLKM-PEK 440

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + G+ + +++   T ++   +LTK T K      +  ED  K  FP    + L  MF+  
Sbjct: 441 YVGQNIGLSTCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFP--GARDLANMFR-- 496

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
             F A+  D   +DI +  +L+P   T +Q++ +  G
Sbjct: 497 --FYALRPD---RDIELTLRLNPKALTLDQWLEQHKG 528



>gi|121718933|ref|XP_001276238.1| nitrogen metabolite repression regulator NmrA [Aspergillus clavatus
           NRRL 1]
 gi|119404436|gb|EAW14812.1| nitrogen metabolite repression regulator NmrA [Aspergillus clavatus
           NRRL 1]
          Length = 352

 Score = 83.2 bits (204), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 52/178 (29%), Positives = 87/178 (48%), Gaps = 9/178 (5%)

Query: 4   GKMIADIAKEKG-LNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           GK +AD AK  G +   IYSS+PD +    G +P V  +  K  VE Y+R+LGIP  TF 
Sbjct: 92  GKALADAAKRAGTIQHYIYSSMPDHSVH--GPWPPVPLWAPKFTVENYVRQLGIP-ATFV 148

Query: 63  YLSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEG 118
           Y   Y+ N  +   PL   E   +G  +   P F+ +  L  +D   D GP + +I  +G
Sbjct: 149 YAGIYNNNFTSLPYPLFQMELMPDGSFEWHAP-FDPDTPLPWLDAEHDVGPALLQIFMDG 207

Query: 119 PTKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQM 176
           P KW+G ++ +  E ++  Q+    ++   +      +   ++  + PT   + L+ +
Sbjct: 208 PKKWHGHRIALTFETLSPNQVCAAFSRALNRPCHYVHVPRVEVKVNIPTGYREQLEAI 265



>gi|505783607|ref|XP_004604206.1| PREDICTED: nmrA-like family domain-containing protein 1 [Sorex
           araneus]
          Length = 299

 Score = 83.2 bits (204), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 63/217 (29%), Positives = 109/217 (50%), Gaps = 15/217 (6%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK +AD+AK  GL +++YS L +    + G+     HF GK  VE+Y   +G+P +T 
Sbjct: 92  KQGKQLADVAKRLGLQYVVYSGLENIKKLTAGRL-TAGHFDGKGEVEEYFWDIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ ++FLP  + +     L +P    N  +  + V D GP++  ++++ P  
Sbjct: 150 VRLPCYFENLLSYFLPQKAPDGKSYLLSLPM--GNVPMDGMSVADLGPVVLSLLKQ-PEG 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
             G+ + +++   T ++    L K TGK  +    + ED  K  FP    + L  MF+  
Sbjct: 207 HVGQALGLSTCRHTAREYAAFLCKHTGKDVRDAKTSPEDYEKLGFP--GARDLANMFR-- 262

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
             F  +  D   +DI    +L+P  KT EQ++ +  G
Sbjct: 263 --FYTLKPD---RDIEQTLRLNPKAKTLEQWLEQHKG 294



>gi|70985090|ref|XP_748051.1| nitrogen metabolite repression regulator NmrA [Aspergillus
           fumigatus Af293]
 gi|66845679|gb|EAL86013.1| nitrogen metabolite repression regulator NmrA [Aspergillus
           fumigatus Af293]
          Length = 352

 Score = 82.8 bits (203), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 88/178 (49%), Gaps = 9/178 (5%)

Query: 4   GKMIADIAKEKG-LNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           GK +AD AK  G +   +YSS+PD +    G +P V  +  K  VE YIR+LG+P  TF 
Sbjct: 92  GKALADAAKRAGSIQHYVYSSMPDHSVH--GPWPPVPLWAPKFTVENYIRQLGLP-ATFV 148

Query: 63  YLSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEG 118
           Y   Y+ N  +   PL   E   +G  +   P F+ +  L  +D   D GP + +I ++G
Sbjct: 149 YAGIYNNNFTSLPYPLFQMELMPDGSFEWHAP-FDPDTPLPWLDAEHDVGPALLQIFKDG 207

Query: 119 PTKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQM 176
           P KW+G ++ +  E ++  Q+    ++   +  +   +   +I  + P    + L+ +
Sbjct: 208 PKKWHGHRIALTFETLSPNQVCAAFSRALNRPCRYVRVPKIEIKVNIPAGYREQLEAI 265



>gi|490807390|ref|WP_004669512.1| hypothetical protein [Rhizobium etli]
 gi|327194303|gb|EGE61164.1| hypothetical protein RHECNPAF_1240014 [Rhizobium etli CNPAF512]
          Length = 317

 Score = 82.8 bits (203), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 115/226 (50%), Gaps = 20/226 (8%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPD-STTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           G+ +AD A E G+  +++S+L +     SG KY    HFT K  V  +IR L I + +F 
Sbjct: 97  GRQLADAAVEAGVQHIVFSTLENVDKITSGTKY--APHFTDKARVADHIRGLPISH-SFI 153

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIP-YFEENDQLLLID-VRDTGPIIAKIIEEGPT 120
            L+F+  N+  ++ P +  +     L++P Y  E+     +D +  TGP++ +I    P 
Sbjct: 154 MLAFFYTNLLEYYAPRMEGDT----LLLPIYLPEDFAAPFVDPLTATGPVVLEIFSN-PE 208

Query: 121 KWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDED-IAKDFPTLNN-----KSLK 174
           ++NGK +P+  + ++ +Q+ +   +VTG   + R     D +   FP         + L 
Sbjct: 209 RYNGKTLPVVGDIISPRQMVETFQRVTGIKAEYRNAFTRDGLLTYFPEFAANEFFVRELL 268

Query: 175 QMFKYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYGKSD 220
            M +Y  E+G  G++++L+    +++L P    +EQ++  +  + D
Sbjct: 269 GMVEYAVEYGYFGQEHDLE---WSRRLAPETLNWEQFLRTSGWRGD 311



>gi|154297931|ref|XP_001549390.1| hypothetical protein BC1G_12118 [Botryotinia fuckeliana B05.10]
          Length = 310

 Score = 82.8 bits (203), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 61/218 (27%), Positives = 107/218 (49%), Gaps = 16/218 (7%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           R GK I D A E G+ ++I+S+LP  +  S G+Y  VT F  K  +EQYIR+L I + +F
Sbjct: 94  RNGKTIVDAAIEMGVQYIIFSTLPHVSAISNGRYTKVTAFDAKAKIEQYIRELPIKS-SF 152

Query: 62  AYLSFYSQNI--GTFFLPLISNENGEI-----DLVIPYFEENDQLLLIDVRDTGPIIAKI 114
             L  + +N     F  P  +N+   +        +P+       LL  V D G  ++ I
Sbjct: 153 ISLGSFMENFQAQAFLAPQPANDGTWVISRHTSAKMPF------PLLDAVGDAGKFVSAI 206

Query: 115 IEEGPTKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLK 174
           + E P K+ GK    A++  T+++I   L+K +GKT   + +++ +  K       +   
Sbjct: 207 LAE-PEKYEGKIFCAAAKIYTMEEIVAALSKSSGKTIVYKQISEGEF-KGSMAFAAEMFT 264

Query: 175 QMFKYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
           + F + +EFG  G  +E + +   +     + T E+++
Sbjct: 265 EYFSFCEEFGYWGPGSEEKVVWAGENARGRLSTLEEFL 302



>gi|493776993|ref|WP_006725449.1| NmrA-like family domain-containing protein 1 [Agrobacterium
           albertimagni]
 gi|407748363|gb|EKF59878.1| NmrA-like family domain-containing protein 1 [Agrobacterium
           albertimagni AOL15]
          Length = 317

 Score = 82.8 bits (203), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 58/220 (26%), Positives = 113/220 (51%), Gaps = 18/220 (8%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPD-STTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           G+ +AD A   G+  +++S+L +     +G KY    HFT K  V  YIR L + + +F 
Sbjct: 97  GRQLADAAVAAGVQHIVFSTLENVDAISNGSKY--APHFTDKAKVADYIRGLPVSH-SFV 153

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLID-VRDTGPIIAKIIEEGPTK 121
            L+F+  N+  +++P     +G+  L+  Y  EN +   +D +  TGP++ +I    P  
Sbjct: 154 MLAFFYTNLLEYYVP---RYDGDRLLLPIYLPENFRAPFVDPLTATGPVVLEIFSN-PAI 209

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDED-IAKDFPTLNN-----KSLKQ 175
           + G+ +PI  + ++ +++ +   +VTG   + R     D + ++FP   +     K L  
Sbjct: 210 YAGRTLPIVGDIISPREMVETFQRVTGIRAEYRNAFTRDGLLENFPAFASNDLLVKELLG 269

Query: 176 MFKYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYILET 215
           M +Y  E+G     +E  D+  +++L+P+   +EQ++  T
Sbjct: 270 MVQYAVEYGYF---SEASDLEWSRRLNPSTLNWEQFLRTT 306



>gi|261202656|ref|XP_002628542.1| nitrogen metabolic regulation protein [Ajellomyces dermatitidis
           SLH14081]
 gi|239590639|gb|EEQ73220.1| nitrogen metabolic regulation protein [Ajellomyces dermatitidis
           SLH14081]
 gi|239612366|gb|EEQ89353.1| nitrogen metabolic regulation protein [Ajellomyces dermatitidis
           ER-3]
          Length = 382

 Score = 82.8 bits (203), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 75/147 (51%), Gaps = 5/147 (3%)

Query: 4   GKMIADIAKEKG-LNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           G+ +AD AK  G +   IYSS+PD    +  ++  +  ++ K  VE Y+R+LG+P  TF 
Sbjct: 91  GRDLADAAKRAGSITHYIYSSMPDHAAYNPSRWISLPLWSCKFAVENYVRQLGLP-ATFV 149

Query: 63  YLSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGP 119
           Y   Y+ N  +   PL   E   NG  +   P+  +     L    D GP + +I ++GP
Sbjct: 150 YAGIYNNNFTSLPYPLFQMELLENGSFEWRAPFHPDIPLPWLDAEHDVGPAVLQIFKDGP 209

Query: 120 TKWNGKKVPIASENVTIKQITDVLTKV 146
            KWNG ++ ++ E +T  Q+    ++ 
Sbjct: 210 KKWNGHRIALSFETLTPNQVCAAFSRA 236



>gi|159126026|gb|EDP51142.1| nitrogen metabolite repression regulator NmrA [Aspergillus
           fumigatus A1163]
          Length = 352

 Score = 82.4 bits (202), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 84/169 (49%), Gaps = 9/169 (5%)

Query: 4   GKMIADIAKEKG-LNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           GK +AD AK  G +   +YSS+PD +    G +P V  +  K  VE YIR+LG+P  TF 
Sbjct: 92  GKALADAAKRAGSIQHYVYSSMPDHSVH--GPWPPVPLWAPKFTVENYIRQLGLP-ATFV 148

Query: 63  YLSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEG 118
           Y   Y+ N  +   PL   E   +G  +   P F+ +  L  +D   D GP + +I ++G
Sbjct: 149 YAGIYNNNFTSLPYPLFQMELMPDGSFEWHAP-FDPDTPLPWLDAEHDVGPALLQIFKDG 207

Query: 119 PTKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPT 167
           P KW+G ++ +  E ++  Q+    ++   +  +   +   +I  + P 
Sbjct: 208 PKKWHGHRIALTFETLSPNQVCAAFSRALNRPCRYVHVPKIEIKVNIPA 256



>gi|327357042|gb|EGE85899.1| nitrogen metabolic regulation protein [Ajellomyces dermatitidis
           ATCC 18188]
          Length = 382

 Score = 82.4 bits (202), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 75/147 (51%), Gaps = 5/147 (3%)

Query: 4   GKMIADIAKEKG-LNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           G+ +AD AK  G +   IYSS+PD    +  ++  +  ++ K  VE Y+R+LG+P  TF 
Sbjct: 91  GRDLADAAKRAGSITHYIYSSMPDHAAYNPSRWISLPLWSCKFAVENYVRQLGLP-ATFV 149

Query: 63  YLSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGP 119
           Y   Y+ N  +   PL   E   NG  +   P+  +     L    D GP + +I ++GP
Sbjct: 150 YAGIYNNNFTSLPYPLFQMELLENGSFEWRAPFHPDIPLPWLDAEHDVGPAVLQIFKDGP 209

Query: 120 TKWNGKKVPIASENVTIKQITDVLTKV 146
            KWNG ++ ++ E +T  Q+    ++ 
Sbjct: 210 KKWNGHRIALSFETLTPNQVCAAFSRA 236



>gi|500257872|gb|EOO00950.1| putative hscarg dehydrogenase protein [Togninia minima UCRPA7]
          Length = 311

 Score = 82.4 bits (202), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 60/210 (28%), Positives = 103/210 (49%), Gaps = 4/210 (1%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
            K+IAD A EKGL ++I+S+LP  +  S G+Y  VT F  K   E+YIR L I +  F  
Sbjct: 97  AKLIADTAVEKGLEYIIFSTLPSVSGMSNGRYTHVTPFDAKAKAEEYIRSLSIKSA-FVS 155

Query: 64  LSFYSQNIGTF-FLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
           L+++ +N+ T  +L      +G   +  P   +     L  V D G  +  I+ E P K+
Sbjct: 156 LAYFMENLQTQPWLGPQPTSDGTYVMSRPVPSKVRLPYLDAVGDVGKFVGAILAE-PDKY 214

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMFKYEKE 182
            GK    A    ++++I   ++K TGKT   R ++ ++ AK  P +    +    + ++E
Sbjct: 215 EGKTFHAAQGLYSLEEIAAAISKNTGKTVVYRQISYDEFAKAMPFVPQLWVDG-HRAQEE 273

Query: 183 FGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
           +G  G   E      A +    + T ++++
Sbjct: 274 YGYFGPGEEQSTAWAAAQARGRLTTLDEFL 303



>gi|470485860|ref|XP_004344216.1| NmrA family protein [Acanthamoeba castellanii str. Neff]
 gi|440799769|gb|ELR20813.1| NmrA family protein [Acanthamoeba castellanii str. Neff]
          Length = 308

 Score = 82.4 bits (202), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 56/213 (26%), Positives = 101/213 (47%), Gaps = 22/213 (10%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
             G  IA  AK   +  L++SSL         ++  V HF  K  VE YI+ LG+P    
Sbjct: 102 HHGVHIAHAAKATNVKHLVWSSL---------EFSYVPHFVSKAMVESYIQHLGVPYTAI 152

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
            + ++Y  ++G    P     +G   L +P   +  +L L  V D+G  + + +   P +
Sbjct: 153 YFPAYYENHLGFPMAPR-RQADGTFVLSMPMDPDQARLPLFSVADSGAFVVEALNY-PDQ 210

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMFKYEK 181
           + GK++ +ASE++T +QI     +VTG   +   ++ E   + FP       ++++   K
Sbjct: 211 YLGKQMRVASESLTARQIAVTFERVTGLATRAEEVDHEAFQRSFP-----GAEELYLNLK 265

Query: 182 EFGAIGKDNE--LQDITIAKKLHPNIKTFEQYI 212
            F     DN   L+D+  + ++HP IK +  ++
Sbjct: 266 WFA----DNPTGLRDVAWSHRVHPQIKDWAGFV 294



>gi|169767944|ref|XP_001818443.1| nmrA family transcriptional regulator [Aspergillus oryzae RIB40]
 gi|238484873|ref|XP_002373675.1| NmrA family transcriptional regulator, putative [Aspergillus flavus
           NRRL3357]
 gi|83766298|dbj|BAE56441.1| unnamed protein product [Aspergillus oryzae RIB40]
 gi|220701725|gb|EED58063.1| NmrA family transcriptional regulator, putative [Aspergillus flavus
           NRRL3357]
 gi|391870606|gb|EIT79786.1| putative nucleoside-diphosphate-sugar epimerase [Aspergillus oryzae
           3.042]
          Length = 305

 Score = 82.0 bits (201), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 53/148 (35%), Positives = 79/148 (53%), Gaps = 6/148 (4%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK +AD+AKE G+  LI+SSL   T  + G+   V HF GK  +E+YIR  G+P  TF 
Sbjct: 95  QGKNVADVAKELGVQHLIFSSLVHVTDSTNGRLSHVPHFDGKAEIERYIRASGVP-CTFV 153

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLID-VRDTGPIIAKIIEEGPTK 121
              ++  N   +   L  +++G   L  P      +  L D   DTG  +  +I+   +K
Sbjct: 154 LAGYFMLN---YLQMLKKSDDGTYQLFYPVDGAKAKFPLFDAANDTGLFVKAVIKHA-SK 209

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGK 149
            NGK+V  A+   T ++I  + T+VTGK
Sbjct: 210 LNGKQVLEAAGYYTAEEIVKIFTEVTGK 237



>gi|470525021|ref|XP_004356557.1| NmrAlike family protein [Acanthamoeba castellanii str. Neff]
 gi|440803774|gb|ELR24657.1| NmrAlike family protein [Acanthamoeba castellanii str. Neff]
          Length = 307

 Score = 82.0 bits (201), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 54/211 (25%), Positives = 101/211 (47%), Gaps = 20/211 (9%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QG  IA  AK   +  L++SSL         ++  V HF  K  VE YI+ LG+P     
Sbjct: 103 QGVHIAHAAKATHVKHLVWSSL---------EFSYVPHFVSKAMVESYIQHLGVPYTAIH 153

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
           + ++Y  ++G   +      +G   L +P   +  +L L  V D+G  + + +   P  +
Sbjct: 154 FPAYYENHLGFPTMTPRRQADGTFVLSMPIDPDQARLPLFSVADSGAFVVEALNY-PDLY 212

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMFKYEKE 182
            GK++ +ASE++T +Q+     +VTG   +   ++ E   + FP       ++++   K 
Sbjct: 213 LGKQMRVASESLTARQMAATFERVTGVATRAEEVDHEAFQRSFP-----GAEELYLNLKW 267

Query: 183 FGAIGKDN-ELQDITIAKKLHPNIKTFEQYI 212
           F     DN   +D+  ++++HP IK +  ++
Sbjct: 268 FA----DNPTARDVAWSRRVHPQIKDWAGFV 294



>gi|485921174|gb|EOD46964.1| putative nitrogen metabolite repression regulator protein
           [Neofusicoccum parvum UCRNP2]
          Length = 345

 Score = 82.0 bits (201), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 75/152 (49%), Gaps = 5/152 (3%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           G+ +A  AK  G+   IYSS+PD +    G +  +  +  K  VE +IR++GIP  TF Y
Sbjct: 89  GRAVATAAKRAGVEHFIYSSMPDHSIYDKG-WRALPLWANKFAVENFIRQIGIP-ATFVY 146

Query: 64  LSFYSQNIGTFFLPLIS---NENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPT 120
              Y  N  +   PL      E+G  +   P+        L    D GP I +I ++GP 
Sbjct: 147 AGTYHNNFTSLPYPLFRMELQEDGSFEWQAPFHPRIPIPWLDAEHDVGPAILQIFKQGPR 206

Query: 121 KWNGKKVPIASENVTIKQITDVLTKVTGKTHK 152
           KW G+++P+A  ++T  Q+ +  ++   +  +
Sbjct: 207 KWAGQRIPLAFSHLTPVQVCEAFSRALNRPCR 238



>gi|397488298|ref|XP_003815205.1| PREDICTED: nmrA-like family domain-containing protein 1 [Pan
           paniscus]
          Length = 271

 Score = 81.6 bits (200), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 60/211 (28%), Positives = 109/211 (51%), Gaps = 15/211 (7%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
            GK++AD+A+  GL++++YS L +    + G+     HF GK  VE+Y R +G+P +T  
Sbjct: 65  MGKLLADLARRLGLHYVVYSGLENIKKLTAGRL-AAAHFDGKGEVEEYFRDIGVP-MTSV 122

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
            L  Y +N+ + FLP  + +     L +P    +  +  + V D GP++  +++  P K+
Sbjct: 123 RLPCYFENLLSHFLPQKAPDGKSYLLSLP--TGDVPMDGMSVSDLGPVVLSLLKM-PEKY 179

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYEK 181
            G+ + +++   T ++   +LTK T K      +  ED  K  FP    + L  MF+   
Sbjct: 180 VGQNIGLSTCRHTAEEYAALLTKHTRKVVHDAKMTPEDYEKLGFP--GARDLANMFR--- 234

Query: 182 EFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
            F A+  D   +DI +  +L+P   T +Q++
Sbjct: 235 -FYALRPD---RDIELTLRLNPKALTLDQWL 261



>gi|347829097|emb|CCD44794.1| similar to NmrA-like family domain-containing protein [Botryotinia
           fuckeliana T4]
          Length = 310

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 59/211 (27%), Positives = 101/211 (47%), Gaps = 2/211 (0%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           R GK I D A E G+ ++I+S+LP  +  S GKY  VT F  K  +EQY+R L I +   
Sbjct: 94  RNGKTIVDAAIEMGVQYIIFSTLPHVSAISNGKYTKVTAFDAKAKIEQYVRGLPIKSSFV 153

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
           +  SF        FL     ++G   +      +    LL  V D G  ++ I+ E P K
Sbjct: 154 SLGSFMENFQAQAFLAPQPADDGTWVISRHTSAKMPFPLLDAVGDAGKFVSAILAE-PEK 212

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMFKYEK 181
           + GK    A++  T+++I   L+K +GKT   + +++ +  K       +   + F + +
Sbjct: 213 YEGKIFCAAAKIYTMEEIVAALSKSSGKTIVYKQISEGEF-KGSMAFAAEMFTEYFSFCE 271

Query: 182 EFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
           EFG  G  +E + +   +     + T E+++
Sbjct: 272 EFGYWGPGSEEKVVWAGENARGRLSTLEEFL 302



>gi|212546087|ref|XP_002153197.1| hscarg dehydrogenase, putative [Talaromyces marneffei ATCC 18224]
 gi|210064717|gb|EEA18812.1| hscarg dehydrogenase, putative [Talaromyces marneffei ATCC 18224]
          Length = 310

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 101/213 (47%), Gaps = 7/213 (3%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
            GK IAD A  +G+ +LI+S+LP     SGGKY  VT F  K  +E YIR L I N  F 
Sbjct: 95  HGKTIADAAVRQGVEYLIFSTLPGVNEISGGKYSHVTPFDAKAKIEHYIRDLPIRN-AFV 153

Query: 63  YLSFYSQNIGT--FFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPT 120
            L F+ QN+ T  F  P+ + ++  + L  P    +    +  V + G ++  I+ E P 
Sbjct: 154 SLGFFMQNLHTQPFLGPVPAPDDTWV-LARPAPRTSTIPYIDAVANVGNVVGSILAE-PE 211

Query: 121 KWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMFKYE 180
           K+ GK    A    ++ +I  +L++ +GKT   + +  E+     P          F + 
Sbjct: 212 KYEGKTFCAAERLYSLGEIAALLSRSSGKTVVYKQVTLEEFKNSIP-FAADVFSDGFGFL 270

Query: 181 KEFGAI-GKDNELQDITIAKKLHPNIKTFEQYI 212
           +EFG   G  +E       +     +++ E+Y+
Sbjct: 271 EEFGGYWGPSSEKAVDWAVQNTRGKLRSLEEYL 303



>gi|340914867|gb|EGS18208.1| hypothetical protein CTHT_0062230 [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 440

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/150 (32%), Positives = 80/150 (53%), Gaps = 7/150 (4%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           G+ +AD AK+  +   IYSS+PD    +   +P +  +  K+ VE+YIRKLG+P  TF Y
Sbjct: 135 GQALADAAKKYNVQHYIYSSMPDHHYYNK-DWPSLPLWASKHKVEEYIRKLGLP-ATFVY 192

Query: 64  LSFYSQNIGTFFLPLIS---NENGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEGP 119
              Y+ N  +   PL      E+G      P F  + +L  +D   D GP I +I ++G 
Sbjct: 193 AGIYNNNFTSLPYPLFCTEMQEDGSFVWQAP-FHPDAKLPWLDAEHDVGPAILQIFKDGV 251

Query: 120 TKWNGKKVPIASENVTIKQITDVLTKVTGK 149
            KW GK++ +A E ++  +  +V ++  G+
Sbjct: 252 KKWGGKRIALAYEMLSPVEACEVFSRGVGR 281



>gi|326929331|ref|XP_003210820.1| PREDICTED: nmrA-like family domain-containing protein 1-like
           [Meleagris gallopavo]
          Length = 265

 Score = 81.3 bits (199), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 60/211 (28%), Positives = 110/211 (52%), Gaps = 15/211 (7%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK +AD++K  GL  ++YS L +    + G + +V HF GK  VE+Y R + +P  T  
Sbjct: 62  QGKRLADLSKRLGLQHVVYSGLENVKQLTKG-HLEVLHFDGKGVVEEYFRAVNVP-ATSV 119

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
            L FY +N  + F P  + +  +  L +P    +  +  + V D GPI+  +++  P ++
Sbjct: 120 RLPFYFENFLSSFKPQKAPQGDKFLLGLPM--GDTPMDGMAVEDLGPIVLSLLKS-PEQY 176

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYEK 181
            G+ + +++  +T+ +     ++ TGKT +   +  E+  K  FP    K L  MF+   
Sbjct: 177 VGQVIGLSTGKLTVAEYAAAFSQQTGKTVEDSKITPEEYEKLGFP--GAKELANMFR--- 231

Query: 182 EFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
            F A+  D   + + +  KL+P  +TF+Q++
Sbjct: 232 -FYALKPD---RSVELTMKLNPKARTFQQWL 258



>gi|489877055|ref|WP_003780550.1| NmrA family protein [Actinomyces naeslundii]
 gi|399902933|gb|EJN85708.1| NmrA family protein [Actinomyces naeslundii str. Howell 279]
          Length = 317

 Score = 81.3 bits (199), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 112/219 (51%), Gaps = 16/219 (7%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           G  IAD A   G+  +++S+L +    +GG+     HFT K  V  YI  L + + TF  
Sbjct: 95  GCRIADAAVRAGVEHIVFSTLENVDKITGGRM-FAPHFTDKARVADYISGLPVAS-TFVI 152

Query: 64  LSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLID-VRDTGPIIAKIIEEGPTKW 122
           LSF+  N+  +++P +  E+G + L I Y  E+ +   +D V  TGP + +II + P K+
Sbjct: 153 LSFFYTNLMEYYVPRV--ESGSLILPI-YLPEDFRAPFVDPVTATGPAVREIISK-PEKY 208

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVR-TLNDEDIAKDFPT-----LNNKSLKQM 176
           +G+ +P+  + V+ +++  +   VTG   + R     + +A +FP      L+ + +  M
Sbjct: 209 DGETLPVVGDIVSPREMVRIFQDVTGLKGEYRDAFTYDGLAYNFPELIADDLHAQEILGM 268

Query: 177 FKYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYILET 215
             Y  E G    D   +D+  ++ + P   T+EQ++  T
Sbjct: 269 VNYAVECGYFRPD---RDMEWSRSIDPEALTWEQFLRVT 304



>gi|302693148|ref|XP_003036253.1| hypothetical protein SCHCODRAFT_14604 [Schizophyllum commune H4-8]
 gi|300109949|gb|EFJ01351.1| hypothetical protein SCHCODRAFT_14604 [Schizophyllum commune H4-8]
          Length = 314

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 71/215 (33%), Positives = 102/215 (47%), Gaps = 12/215 (5%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK IAD +KE+G+  LI+SS+ + T  + G    V HF  K  VE+YIR LGIP  TF 
Sbjct: 96  QGKNIADASKEEGVQHLIWSSVLNVTKLTKGVLSQVAHFDSKATVEEYIRDLGIP-ATFF 154

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
              FY  N     L    +   +++L +P  ++    L     DTG  +  I  +     
Sbjct: 155 LAGFYMSNFPGDMLSASPDRKWKLNLPMP--DDAPIPLFAAEYDTGKFVKAIFLKREETL 212

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDED-----IAKDFPTLNNKSLKQMF 177
            GK+V  A+   T  QI D   KV GK    + L  E+      AK +P    + + Q  
Sbjct: 213 -GKRVYGATAYTTPVQIIDGFNKVYGKHEVYKRLTGEEYKATLAAKGYPEALQEEMLQNM 271

Query: 178 KYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
           +   EFG  G DN   D +++    P + T+E+YI
Sbjct: 272 RLVYEFGYYGGDN--LDWSVSLVDEP-LTTWEEYI 303



>gi|115400225|ref|XP_001215701.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gi|114191367|gb|EAU33067.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 305

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 50/156 (32%), Positives = 85/156 (54%), Gaps = 9/156 (5%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK + D  KE G+  +++SSL + T  + G+ P+V+HF GK  +E+YIR  G+P  +F 
Sbjct: 95  QGKAVTDACKEAGVKHIVFSSLRNVTEITNGRLPNVSHFDGKAEIEEYIRASGVP-ASFV 153

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEGPTK 121
              FY  N    F  ++S ++G   L  P   +  Q  L DV  DTG  +   I+  P+ 
Sbjct: 154 LPGFYMSN----FFQMLSKQDGVYTLAWPVDLDKAQAPLYDVAEDTGKFVKAAIKHYPST 209

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLN 157
            N +++  A++  + ++I +   +VTG  +K + +N
Sbjct: 210 VN-QRILAATDYYSPRRIVEEFAEVTG--YKAQAVN 242



>gi|242763533|ref|XP_002340593.1| hscarg dehydrogenase, putative [Talaromyces stipitatus ATCC 10500]
 gi|218723789|gb|EED23206.1| hscarg dehydrogenase, putative [Talaromyces stipitatus ATCC 10500]
          Length = 394

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 62/216 (28%), Positives = 114/216 (52%), Gaps = 11/216 (5%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF- 61
            GK + D A    +++ IYS+LP     SGGKY    HF  K+ VE YI+K  I +    
Sbjct: 180 HGKGLVDAAVAANVSFYIYSTLPSIKHYSGGKYLHGDHFDVKSKVEDYIKKQNIKSAFVS 239

Query: 62  --AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGP 119
             +++S + +++G    PL +     +++VIP   + +  LL  + D G  +A ++ + P
Sbjct: 240 PGSFMSIFLESMGP--APLGNGTYAIMNVVIP---QTELPLLDTLGDIGKFVALMLAD-P 293

Query: 120 TKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMFKY 179
            K+ GK +P A++  +++QI  ++ +V+GK  +      E + K  P      +  M  Y
Sbjct: 294 KKYEGKVIPAATKLYSMQQIAQIMGEVSGKEIRYIQQPPEVMRKFIPANAADRVIDMMLY 353

Query: 180 EKEFGAIGKDNELQDITIAKKLHP-NIKTFEQYILE 214
            ++FG  G  N  + +  +++L P N+ TFE+++L+
Sbjct: 354 FQDFGYYGP-NTAKVLEESQELAPKNLTTFEEFLLK 388



>gi|169610335|ref|XP_001798586.1| hypothetical protein SNOG_08267 [Phaeosphaeria nodorum SN15]
 gi|111063423|gb|EAT84543.1| hypothetical protein SNOG_08267 [Phaeosphaeria nodorum SN15]
          Length = 310

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/211 (29%), Positives = 105/211 (49%), Gaps = 5/211 (2%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
            G+ +AD A   G+ + IYS+LP++   SGGK  ++ HF GK  VEQYIRKL + +  FA
Sbjct: 96  HGRALADAAVAAGVPYYIYSTLPNAGKNSGGKLKNMGHFDGKEEVEQYIRKLPLKSSFFA 155

Query: 63  YLSFYSQNIGTFF-LPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             SF S    T    P+ +      + V P   E    L+    DTG  IA I+ +  +K
Sbjct: 156 PGSFMSNFSATMKPHPVGNGTYALFNFVTP---ETKMPLIDTAGDTGKWIAAILADF-SK 211

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMFKYEK 181
           + GK +  A+   + K+I + ++K +GK      L +E      P      + +M +Y +
Sbjct: 212 YEGKVLCAATGLYSFKEIAEHMSKSSGKAVAYIQLPEEKWRGFLPPTMRDHVAEMLQYFQ 271

Query: 182 EFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
           ++G  G++ E +    A++    + T ++Y 
Sbjct: 272 DYGYYGENTEEKVKWSAEQARGKLTTLDEYF 302



>gi|67536876|ref|XP_662212.1| hypothetical protein AN4608.2 [Aspergillus nidulans FGSC A4]
 gi|40741220|gb|EAA60410.1| hypothetical protein AN4608.2 [Aspergillus nidulans FGSC A4]
 gi|259482560|tpe|CBF77158.1| TPA: NmrA family transcriptional regulator, putative
           (AFU_orthologue; AFUA_7G06920) [Aspergillus nidulans
           FGSC A4]
          Length = 309

 Score = 80.9 bits (198), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 59/165 (35%), Positives = 84/165 (50%), Gaps = 8/165 (4%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK +AD AK  G+  LI+SSL + +  + G+  +V HF  K  VEQYIR LGIP  TF 
Sbjct: 95  QGKNVADAAKRAGVQHLIFSSLLNVSGSTSGRLKNVPHFDHKAQVEQYIRDLGIP-ATFV 153

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVR-DTGPIIAKIIEEGPTK 121
              ++  N   F   L   E+G   L  P   E  Q  L+D+  D G  +A  ++  P+K
Sbjct: 154 LPGYFMSNY-VFLGMLRKGEDGVYTLAYP-VNEGSQFPLVDIEADLGKYVATALKS-PSK 210

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLN-DEDIAKDF 165
             G ++  A++  T  +I     +VTG  HK R +  D +  K F
Sbjct: 211 TQGSRILAATDYYTPTRILKEFEEVTG--HKTRFIQIDHETYKSF 253



>gi|67902362|ref|XP_681437.1| hypothetical protein AN8168.2 [Aspergillus nidulans FGSC A4]
 gi|74593063|sp|Q5AU62.1|NMRA_EMENI RecName: Full=Nitrogen metabolite repression protein nmrA
 gi|17943024|pdb|1K6I|A Chain A, Crystal Structure Of Nmra, A Negative Transcriptional
           Regulator (Trigonal Form)
 gi|20150697|pdb|1K6J|A Chain A, Crystal Structure Of Nmra, A Negative Transcriptional
           Regulator (Monoclinic Form)
 gi|20150698|pdb|1K6J|B Chain B, Crystal Structure Of Nmra, A Negative Transcriptional
           Regulator (Monoclinic Form)
 gi|20150699|pdb|1K6X|A Chain A, Crystal Structure Of Nmra, A Negative Transcriptional
           Regulator In Complex With Nad At 1.5 A Resolution
           (Trigonal Form)
 gi|49259311|pdb|1TI7|A Chain A, Crystal Structure Of Nmra, A Negative Transcriptional
           Regulator, In Complex With Nadp At 1.7a Resolution
 gi|194709038|pdb|2VUS|A Chain A, Crystal Structure Of Unliganded Nmra-Area Zinc Finger
           Complex
 gi|194709039|pdb|2VUS|B Chain B, Crystal Structure Of Unliganded Nmra-Area Zinc Finger
           Complex
 gi|194709040|pdb|2VUS|C Chain C, Crystal Structure Of Unliganded Nmra-Area Zinc Finger
           Complex
 gi|194709041|pdb|2VUS|D Chain D, Crystal Structure Of Unliganded Nmra-Area Zinc Finger
           Complex
 gi|194709042|pdb|2VUS|E Chain E, Crystal Structure Of Unliganded Nmra-Area Zinc Finger
           Complex
 gi|194709043|pdb|2VUS|F Chain F, Crystal Structure Of Unliganded Nmra-Area Zinc Finger
           Complex
 gi|194709044|pdb|2VUS|G Chain G, Crystal Structure Of Unliganded Nmra-Area Zinc Finger
           Complex
 gi|194709045|pdb|2VUS|H Chain H, Crystal Structure Of Unliganded Nmra-Area Zinc Finger
           Complex
 gi|194709054|pdb|2VUT|A Chain A, Crystal Structure Of Nad-Bound Nmra-Area Zinc Finger
           Complex
 gi|194709055|pdb|2VUT|B Chain B, Crystal Structure Of Nad-Bound Nmra-Area Zinc Finger
           Complex
 gi|194709056|pdb|2VUT|C Chain C, Crystal Structure Of Nad-Bound Nmra-Area Zinc Finger
           Complex
 gi|194709057|pdb|2VUT|D Chain D, Crystal Structure Of Nad-Bound Nmra-Area Zinc Finger
           Complex
 gi|194709058|pdb|2VUT|E Chain E, Crystal Structure Of Nad-Bound Nmra-Area Zinc Finger
           Complex
 gi|194709059|pdb|2VUT|F Chain F, Crystal Structure Of Nad-Bound Nmra-Area Zinc Finger
           Complex
 gi|194709060|pdb|2VUT|G Chain G, Crystal Structure Of Nad-Bound Nmra-Area Zinc Finger
           Complex
 gi|194709061|pdb|2VUT|H Chain H, Crystal Structure Of Nad-Bound Nmra-Area Zinc Finger
           Complex
 gi|194709070|pdb|2VUU|A Chain A, Crystal Structure Of Nadp-Bound Nmra-Area Zinc Finger
           Complex
 gi|194709071|pdb|2VUU|B Chain B, Crystal Structure Of Nadp-Bound Nmra-Area Zinc Finger
           Complex
 gi|194709072|pdb|2VUU|C Chain C, Crystal Structure Of Nadp-Bound Nmra-Area Zinc Finger
           Complex
 gi|194709073|pdb|2VUU|D Chain D, Crystal Structure Of Nadp-Bound Nmra-Area Zinc Finger
           Complex
 gi|194709074|pdb|2VUU|E Chain E, Crystal Structure Of Nadp-Bound Nmra-Area Zinc Finger
           Complex
 gi|194709075|pdb|2VUU|F Chain F, Crystal Structure Of Nadp-Bound Nmra-Area Zinc Finger
           Complex
 gi|194709076|pdb|2VUU|G Chain G, Crystal Structure Of Nadp-Bound Nmra-Area Zinc Finger
           Complex
 gi|194709077|pdb|2VUU|H Chain H, Crystal Structure Of Nadp-Bound Nmra-Area Zinc Finger
           Complex
 gi|40740000|gb|EAA59190.1| hypothetical protein AN8168.2 [Aspergillus nidulans FGSC A4]
 gi|259480939|tpe|CBF74025.1| TPA: Nitrogen metabolite repression regulator NmrA
           [Source:UniProtKB/TrEMBL;Acc:O59919] [Aspergillus
           nidulans FGSC A4]
          Length = 352

 Score = 80.1 bits (196), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 79/151 (52%), Gaps = 9/151 (5%)

Query: 4   GKMIADIAKEKG-LNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           GK +AD AK  G +   IYSS+PD +    G +P V  +  K  VE Y+R+LG+P+ TF 
Sbjct: 92  GKDLADAAKRAGTIQHYIYSSMPDHSLY--GPWPAVPMWAPKFTVENYVRQLGLPS-TFV 148

Query: 63  YLSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEG 118
           Y   Y+ N  +   PL   E   +G  +   P F+ +  L  +D   D GP + +I ++G
Sbjct: 149 YAGIYNNNFTSLPYPLFQMELMPDGTFEWHAP-FDPDIPLPWLDAEHDVGPALLQIFKDG 207

Query: 119 PTKWNGKKVPIASENVTIKQITDVLTKVTGK 149
           P KWNG ++ +  E ++  Q+    ++   +
Sbjct: 208 PQKWNGHRIALTFETLSPVQVCAAFSRALNR 238



>gi|490845980|ref|WP_004708043.1| NmrA family protein [Yersinia frederiksenii]
 gi|238723497|gb|EEQ15143.1| NmrA family protein [Yersinia frederiksenii ATCC 33641]
          Length = 321

 Score = 80.1 bits (196), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 66/226 (29%), Positives = 119/226 (52%), Gaps = 23/226 (10%)

Query: 1   ERQ-GKMIADIAKEKGLNWLIYSSLP--DSTTESGGKYPDVTHFTGKNHVEQYIRKLGIP 57
           ER+ G+ IAD A E G+  L+++SL   D  TE G K+  V HFT K  VE+YIR L I 
Sbjct: 97  ERELGQEIADAAVEAGVQHLVFTSLENVDKITE-GKKW--VPHFTDKAQVEEYIRTLPIK 153

Query: 58  NVTFAYLSFYSQNIGTFFLPLISNENGEIDLVIP-YFEENDQLLLID-VRDTGPIIAKII 115
           + +F Y+ F+  N+  ++ P    +     L+ P Y  E+     +D +  TGP + ++ 
Sbjct: 154 S-SFVYMGFFYTNLMEYYPPYQEGDT----LIFPLYLPEDFCAPFVDPLTATGPAVLELF 208

Query: 116 EEGPTKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVR-TLNDEDIAKDFPTLN----- 169
           +    K+ G  +PI  E ++ +++ +  T+VTG   + R  +  +++   FP+ +     
Sbjct: 209 DNQ-DKYAGCSLPIIGEFLSPREMVETFTRVTGIKAQYRPAITLKELLHHFPSYSGMDGL 267

Query: 170 NKSLKQMFKYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYILET 215
              +  M +Y  E+G   K+   +D+  ++K++P   T+EQ++  T
Sbjct: 268 TAEIVGMAEYAFEYGYYHKN---RDLLWSRKINPQTLTWEQFLRTT 310



>gi|58177341|pdb|1XGK|A Chain A, Crystal Structure Of N12g And A18g Mutant Nmra
          Length = 352

 Score = 80.1 bits (196), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 79/151 (52%), Gaps = 9/151 (5%)

Query: 4   GKMIADIAKEKG-LNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           GK +AD AK  G +   IYSS+PD +    G +P V  +  K  VE Y+R+LG+P+ TF 
Sbjct: 92  GKDLADAAKRAGTIQHYIYSSMPDHSLY--GPWPAVPMWAPKFTVENYVRQLGLPS-TFV 148

Query: 63  YLSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEG 118
           Y   Y+ N  +   PL   E   +G  +   P F+ +  L  +D   D GP + +I ++G
Sbjct: 149 YAGIYNNNFTSLPYPLFQMELMPDGTFEWHAP-FDPDIPLPWLDAEHDVGPALLQIFKDG 207

Query: 119 PTKWNGKKVPIASENVTIKQITDVLTKVTGK 149
           P KWNG ++ +  E ++  Q+    ++   +
Sbjct: 208 PQKWNGHRIALTFETLSPVQVCAAFSRALNR 238



>gi|255955831|ref|XP_002568668.1| Pc21g16620 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211590379|emb|CAP96559.1| Pc21g16620 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 352

 Score = 80.1 bits (196), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 55/186 (29%), Positives = 91/186 (48%), Gaps = 12/186 (6%)

Query: 4   GKMIADIAKEKG-LNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           G+ +AD AK  G +   IYSS+PD +    G +P V  +  K  VE YIR+LG+P  TF 
Sbjct: 92  GRDLADAAKRSGTIQHYIYSSMPDHSVH--GPWPAVPQWAPKFTVENYIRQLGMP-ATFV 148

Query: 63  YLSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEG 118
           Y   Y+ N  +   PL   E   +G  +   P F+    L  +DV  D GP + +I ++G
Sbjct: 149 YAGIYNNNFTSLPYPLFQMELLSDGSFEWRAP-FDPEIPLPWLDVEHDVGPTLLQIFKDG 207

Query: 119 PTKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMFK 178
             KWNG ++ +  E ++  Q+    ++   +  +   +   +I  + P    + L+ +  
Sbjct: 208 TKKWNGHRIALTFETLSPLQVCAAFSRALDRPCQYVRVPKIEIKVNIPPGYREQLEAL-- 265

Query: 179 YEKEFG 184
            E+ FG
Sbjct: 266 -EELFG 270



>gi|3015626|gb|AAC39442.1| nitrogen metabolite repression regulator NmrA [Emericella nidulans]
          Length = 352

 Score = 79.7 bits (195), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 78/148 (52%), Gaps = 9/148 (6%)

Query: 4   GKMIADIAKEKG-LNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           GK +AD AK  G +   IYSS+PD +    G +P V  +  K  VE Y+R+LG+P+ TF 
Sbjct: 92  GKDLADAAKRAGTIQHYIYSSMPDHSLY--GPWPAVPMWAPKFTVENYVRQLGLPS-TFV 148

Query: 63  YLSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEG 118
           Y   Y+ N  +   PL   E   +G  +   P F+ +  L  +D   D GP + +I ++G
Sbjct: 149 YAGIYNNNFTSLPYPLFQMELMPDGTFEWHAP-FDPDIPLPWLDAEHDVGPALLQIFKDG 207

Query: 119 PTKWNGKKVPIASENVTIKQITDVLTKV 146
           P KWNG ++ +  E ++  Q+    ++ 
Sbjct: 208 PQKWNGHRIALTFETLSPVQVCAAFSRA 235



>gi|358389691|gb|EHK27283.1| hypothetical protein TRIVIDRAFT_176019 [Trichoderma virens Gv29-8]
          Length = 458

 Score = 79.7 bits (195), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 44/134 (32%), Positives = 71/134 (52%), Gaps = 7/134 (5%)

Query: 20  IYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAYLSFYSQNIGTFFLPLI 79
           IYSS+PD      G +P +  +  K+ VEQY+R+LG+P  TF Y   Y+ N  +   PL 
Sbjct: 186 IYSSMPDHAAYHSG-WPSLPLWAAKHKVEQYVRQLGLP-ATFVYTGIYNNNFTSLLYPLF 243

Query: 80  SNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEGPTKWNGKKVPIASENVT 135
             E   +G      P F E+ +L  +D   D GP I ++ ++G +KW G+++ +A E +T
Sbjct: 244 CMELQPDGSFTWQAP-FHEDAKLPWLDAEHDVGPAIIQLFKDGISKWQGERIALAYEYLT 302

Query: 136 IKQITDVLTKVTGK 149
             +   V  +  G+
Sbjct: 303 PVEACKVFARGVGR 316



>gi|367025783|ref|XP_003662176.1| hypothetical protein MYCTH_2302460 [Myceliophthora thermophila ATCC
           42464]
 gi|347009444|gb|AEO56931.1| hypothetical protein MYCTH_2302460 [Myceliophthora thermophila ATCC
           42464]
          Length = 476

 Score = 79.7 bits (195), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 48/154 (31%), Positives = 84/154 (54%), Gaps = 8/154 (5%)

Query: 1   ERQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVT 60
           +R G+ +AD AK+ G+   IYSS+PD    +   +P +  +  K+ VE+Y++K+G+P  T
Sbjct: 171 QRIGEALADAAKKAGIQHYIYSSMPDHHAYN-KDWPSLPLWASKHRVEEYVKKIGLP-AT 228

Query: 61  FAYLSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIE 116
           F Y   Y+ N  +   PL   E   +G      P F  + +L  +D   D GP I +I +
Sbjct: 229 FVYTGIYNNNFTSLPYPLFCTELQPDGSWIWQAP-FHPDVKLPWLDAEHDVGPAILQIFK 287

Query: 117 EGPTKW-NGKKVPIASENVTIKQITDVLTKVTGK 149
           +G  KW  GK++ +A E ++ ++  +V ++  G+
Sbjct: 288 DGVKKWGGGKRISLAYEMLSPREACEVFSRGVGR 321



>gi|507974714|ref|XP_004691836.1| PREDICTED: nmrA-like family domain-containing protein 1 [Condylura
           cristata]
          Length = 299

 Score = 79.7 bits (195), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 110/212 (51%), Gaps = 15/212 (7%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++A++AK  GL++++YS L +    + G+     HF GK  VE+Y  +LG+P +T 
Sbjct: 92  KQGKLLANVAKRLGLSYVVYSGLENIKKLTAGRLA-AGHFDGKGEVEEYFWELGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ ++FLP  + +     L +P    +  +  + V D GP +  +++  P  
Sbjct: 150 VRLPCYFENLLSYFLPQKAPDGKGYLLSLPM--GDVPMDGMSVADLGPAVLSLLKT-PEA 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
             G+ + +++   T  +   +L+K TG+  +   +  ED  K  FP    + L  MF+  
Sbjct: 207 HVGRSLGLSTCRHTAGEYAQLLSKHTGRAVQDAKVTPEDYEKLGFP--GARDLANMFR-- 262

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
             F A+  D   +D+ +  +L+P  +T  Q++
Sbjct: 263 --FYALRPD---RDVELTLQLNPKARTLGQWL 289



>gi|489653170|ref|WP_003557550.1| putative nucleoside-diphosphate sugar epimerase [Rhizobium
           leguminosarum]
          Length = 317

 Score = 79.3 bits (194), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 60/226 (26%), Positives = 114/226 (50%), Gaps = 20/226 (8%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPD-STTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           G  +AD A E G+  +++S+L +      G KY    HFT K  V  +IR L I + +F 
Sbjct: 97  GLQLADAAVEAGVGHIVFSTLENVDKITRGKKY--APHFTDKARVADHIRGLPISH-SFI 153

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIP-YFEENDQLLLID-VRDTGPIIAKIIEEGPT 120
            L+F+  N+  +++P +  +     L++P Y  E+ +   +D +  TGP + +I    P 
Sbjct: 154 MLAFFYTNLLEYYVPRMEGDT----LLLPVYLPEDFRAPFVDPLTATGPAVLEIFSN-PE 208

Query: 121 KWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDED-IAKDFPTLNN-----KSLK 174
           ++NGK +PI  + ++  ++ +   +VTG     R     D +   FP         + + 
Sbjct: 209 RYNGKTLPIVGDIISPSEMIETFQRVTGLKAAYRNAFTRDGLLHYFPEFAANELLVREIL 268

Query: 175 QMFKYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYGKSD 220
            M +Y  ++G  GK+++L+    +++L+P+   +EQY+  T  + D
Sbjct: 269 GMVEYAVDYGYFGKEHDLE---WSRRLNPDTLNWEQYLRTTGWRGD 311



>gi|346974233|gb|EGY17685.1| nitrogen metabolic regulation protein [Verticillium dahliae
           VdLs.17]
          Length = 461

 Score = 79.3 bits (194), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 73/134 (54%), Gaps = 7/134 (5%)

Query: 20  IYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAYLSFYSQNIGTFFLPLI 79
           IYSS+PD +  +  ++P +  +  K+ VE+YIRK+ +P  TF Y   Y+ N  +   PL 
Sbjct: 191 IYSSMPDHSAYNS-EWPSLPLWASKHQVEEYIRKIELP-ATFVYTGIYNNNFTSLQYPLF 248

Query: 80  SNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEGPTKWNGKKVPIASENVT 135
             E   +G      P F E+ +L  ID   D GP I +I ++G +KW G++V +A E +T
Sbjct: 249 CMELQADGSFRWEAP-FHEDVKLPWIDAEHDVGPAIIQIFKDGASKWRGRRVALAWEMLT 307

Query: 136 IKQITDVLTKVTGK 149
            ++   V  K  G+
Sbjct: 308 PREACKVFAKGVGR 321



>gi|66823091|ref|XP_644900.1| NmrA-like protein [Dictyostelium discoideum AX4]
 gi|60473033|gb|EAL70981.1| NmrA-like protein [Dictyostelium discoideum AX4]
          Length = 299

 Score = 79.3 bits (194), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 67/213 (31%), Positives = 105/213 (49%), Gaps = 14/213 (6%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPN----V 59
           GK IAD A   G+   ++S LP     S G+   V HF  K  VE+Y+R+L   N     
Sbjct: 89  GKKIADAAFGAGVKHFVFSGLPPCNKISNGRII-VPHFDQKYLVEEYVRELSESNPSFIS 147

Query: 60  TFAYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGP 119
           +F Y  FY QN  + F+P   NENG+    I        + + DV + G I+ +I+    
Sbjct: 148 SFVYAPFYYQNFKS-FVPK-KNENGDGGYTISLPSNGKPMDMGDVDNIGAIVCEILLN-E 204

Query: 120 TKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMFKY 179
            K++G  VP +   ++  +I ++ +KV+GK+   + +    I + F   N   L  MF++
Sbjct: 205 NKYSGVVVPFSGGALSGPEIANIFSKVSGKSVTFKFI-PPSIFRTFGFPNANDLASMFEF 263

Query: 180 EKEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
             EFG     N+L D +IA K+     TF +Y+
Sbjct: 264 YNEFGVF---NDL-DQSIASKIT-KFTTFGEYL 291



>gi|512919365|ref|XP_004904008.1| PREDICTED: nmrA-like family domain-containing protein 1 isoform X1
           [Heterocephalus glaber]
 gi|513006795|ref|XP_004864843.1| PREDICTED: nmrA-like family domain-containing protein 1 isoform X1
           [Heterocephalus glaber]
 gi|351712137|gb|EHB15056.1| NmrA-like family domain-containing protein 1 [Heterocephalus
           glaber]
          Length = 299

 Score = 79.0 bits (193), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 59/212 (27%), Positives = 112/212 (52%), Gaps = 15/212 (7%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL++++YS L +    + G+     HF GK  VE+Y R +G+P +T 
Sbjct: 92  KQGKLLADLAKHLGLHYVVYSGLENIKKLTAGRLA-AGHFDGKGEVEEYFRDIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ ++ L   + +     L +P    +  +  + V D GP++  +++  P +
Sbjct: 150 VRLPCYFENLLSYSLLQRAPDGKSYLLNLPM--GDVPMDGMAVSDLGPVVLSLLKM-PEE 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYE 180
           + G+ + +++   T ++   +LT+ TGK      +  ED  K DFP   +  L  MF+  
Sbjct: 207 YVGQNIGLSTCRHTAEEYAALLTRHTGKAVHNTKITPEDYEKLDFPGACD--LANMFR-- 262

Query: 181 KEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
             F A+  D   ++I +  +L+P  +T  Q++
Sbjct: 263 --FYALKPD---RNIELTLRLNPKAQTLNQWL 289



>gi|320590323|gb|EFX02766.1| nitrogen metabolite repression regulator [Grosmannia clavigera
           kw1407]
          Length = 522

 Score = 79.0 bits (193), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 62/230 (26%), Positives = 113/230 (49%), Gaps = 24/230 (10%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           G+ +AD AK+ G+   +YSS+PD    +  ++P +  +  K+ VE+YI+++G+P  TF Y
Sbjct: 220 GEALADAAKKAGIQHYVYSSMPDHQAYN-PEWPSLPLWATKHQVEEYIQEIGLP-ATFVY 277

Query: 64  LSFYSQNIGTFFLPLIS---NENGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEGP 119
              Y+ N  +   PL       +G      P F  + +L  +D   D GP I ++ ++G 
Sbjct: 278 TGIYNNNFTSLSYPLFCMHLRSDGSFLWEAP-FHPDAKLPWLDAEHDVGPAILQVFKDGV 336

Query: 120 TKW-NGKKVPIASENVTIKQITDVLTKVTGKT--HKVRTLNDEDIAKDFPTLNNKSLKQM 176
           TKW  GK++ +A E ++ ++   +  +  G+   +K R +  +    D      K+L+Q+
Sbjct: 337 TKWGGGKRIALAYEMLSPREACQLFARGVGRPVRYKRRPIELKVPIPDGYRTQLKALEQL 396

Query: 177 FKYEKE--------FGAIGKDNELQD--ITIAKKLHPNIKTFEQYILETY 216
           F +  E        FG+     EL+D    +A +L    +  E+Y  E +
Sbjct: 397 FFFGGEDPKKQPPYFGS----RELEDDVPKLAMELWEGPRGIEEYAREVF 442



>gi|400593619|gb|EJP61548.1| nmrA family transcriptional regulator [Beauveria bassiana ARSEF
           2860]
          Length = 305

 Score = 79.0 bits (193), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 53/165 (32%), Positives = 82/165 (49%), Gaps = 6/165 (3%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK + D+AK   +++LI+SSL   T ES G+   V HF  K +VE+YI+  GI    F 
Sbjct: 95  QGKNVTDVAKICDVSYLIFSSLLHVTEESNGRLKHVPHFDSKANVEKYIKSSGI-KCAFV 153

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLID-VRDTGPIIAKIIEEGPTK 121
              FY QN+ T    +   ++G   LV P      +  L D   DTG  +   ++   T 
Sbjct: 154 LPGFYMQNLTTM---IRKGDDGAYQLVFPVDGNKAKFPLFDAANDTGLFVKAALKHKDT- 209

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFP 166
            NGK++  + +  T +QI +  ++VTGK  +   +  +   K  P
Sbjct: 210 LNGKRILASCDYYTSEQIVETFSQVTGKKARFVQVTADQFRKSLP 254



>gi|116197973|ref|XP_001224798.1| hypothetical protein CHGG_07142 [Chaetomium globosum CBS 148.51]
 gi|88178421|gb|EAQ85889.1| hypothetical protein CHGG_07142 [Chaetomium globosum CBS 148.51]
          Length = 419

 Score = 79.0 bits (193), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 82/151 (54%), Gaps = 8/151 (5%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           G+ +AD AK  G+   +YSS+PD    +  ++P +  +  K+ VE+Y++K+G+P  TF Y
Sbjct: 114 GEALADAAKRAGIQHYVYSSMPDHHAYN-KEWPSLPLWASKHKVEEYVKKIGLP-ATFVY 171

Query: 64  LSFYSQNIGTFFLPLIS---NENGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEGP 119
              Y+ N  +   PL      E+G      P F  + +L  +D   D GP I +I ++G 
Sbjct: 172 TGIYNNNFTSLPYPLFCTDLQEDGSWIWQAP-FHPDVKLPWLDAEHDVGPAILQIFKDGV 230

Query: 120 TKW-NGKKVPIASENVTIKQITDVLTKVTGK 149
            KW  GK+V +A E ++ K+  +V ++  G+
Sbjct: 231 KKWGGGKRVGLAYEMLSPKEACEVFSRGVGR 261



>gi|500259091|gb|EOO01942.1| putative family transcriptional regulator protein [Togninia minima
           UCRPA7]
          Length = 312

 Score = 78.6 bits (192), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 82/164 (50%), Gaps = 5/164 (3%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           +GK +AD AK+ G+  +I+SSL + T  S G+ P V HF  K  +EQYIR  G P  TF 
Sbjct: 97  RGKNVADAAKDAGVQHVIFSSLINVTEASNGRLPHVVHFDRKADIEQYIRSQGTP-ATFI 155

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQL-LLIDVRDTGPIIAKIIEEGPTK 121
              +Y  N     L L   E+G   L  P      QL L     D G  +   ++    K
Sbjct: 156 QPGYYMSNFTNLQL-LRKGEDGTYTLTGPTSATKAQLPLFFPEDDMGKYVVAALKNR-DK 213

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDF 165
             GK++P AS+  T+ +I D   +VTGK  +   + D+D+ K F
Sbjct: 214 VLGKQIPAASDYYTLTRIMDEFREVTGKDGQYVQI-DQDVYKSF 256



>gi|169595688|ref|XP_001791268.1| hypothetical protein SNOG_00588 [Phaeosphaeria nodorum SN15]
 gi|111070963|gb|EAT92083.1| hypothetical protein SNOG_00588 [Phaeosphaeria nodorum SN15]
          Length = 310

 Score = 78.6 bits (192), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 58/192 (30%), Positives = 96/192 (50%), Gaps = 8/192 (4%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           RQ K +   A   G+ ++I+SS+      S G    V HF  K  +EQYIR L + +  F
Sbjct: 96  RQAKSLCTAALAAGVKYIIFSSMSHPFKISAGALKHVEHFDAKAEIEQYIRSLPVQSSFF 155

Query: 62  AYLSFYSQNIGTFFLPL-ISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPT 120
           A  SF  QN  T+  P  + +    I  ++     + ++  ID+ DTG  I  I+ + P 
Sbjct: 156 APASFM-QNFTTYSGPKPVGDGTYAISNIL---HPHTKVPFIDIADTGKWIGAILAD-PE 210

Query: 121 KWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTL-NNKSLKQMFKY 179
           K++GK         T+ Q  ++++KV+GKT + + + DE + K F TL   +   +M+  
Sbjct: 211 KYSGKFFAAGEGLYTMPQACELMSKVSGKTIRYQQVEDE-VYKGFLTLVMREPYYEMWVL 269

Query: 180 EKEFGAIGKDNE 191
            +E+G  G+  E
Sbjct: 270 NREYGYYGEGQE 281



>gi|67477341|sp|P23762.2|NMR1_NEUCR RecName: Full=Nitrogen metabolic regulation protein 1;
           Short=Protein NMR
 gi|12718468|emb|CAC28734.1| nitrogen metabolic regulation protein nmr [Neurospora crassa]
          Length = 488

 Score = 78.6 bits (192), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 49/154 (31%), Positives = 81/154 (52%), Gaps = 8/154 (5%)

Query: 1   ERQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVT 60
           ER G  +AD AK+ G+   +YSS+PD    +   +P +  +  K+ VE Y++++GIP  T
Sbjct: 173 ERIGMALADAAKKAGVQHYVYSSMPDHHAYN-KDWPSLPLWASKHRVEDYVKEIGIP-AT 230

Query: 61  FAYLSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIE 116
           F Y   Y+ N  +   PL   +   +G      P F  N +L  +D   D GP I +I +
Sbjct: 231 FVYTGIYNNNFTSLPYPLFCTDLQPDGSWIWQAP-FHPNAKLPWLDAEHDVGPAILQIFK 289

Query: 117 EGPTKW-NGKKVPIASENVTIKQITDVLTKVTGK 149
           +G  KW  GK++ +A E +T  +  +V ++  G+
Sbjct: 290 DGVKKWGGGKRIALAYEMLTPLEACEVFSRGVGR 323



>gi|164426515|ref|XP_961314.2| hypothetical protein NCU04158 [Neurospora crassa OR74A]
 gi|157071366|gb|EAA32078.2| hypothetical protein NCU04158 [Neurospora crassa OR74A]
          Length = 429

 Score = 78.6 bits (192), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 49/154 (31%), Positives = 81/154 (52%), Gaps = 8/154 (5%)

Query: 1   ERQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVT 60
           ER G  +AD AK+ G+   +YSS+PD    +   +P +  +  K+ VE Y++++GIP  T
Sbjct: 114 ERIGMALADAAKKAGVQHYVYSSMPDHHAYN-KDWPSLPLWASKHRVEDYVKEIGIP-AT 171

Query: 61  FAYLSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIE 116
           F Y   Y+ N  +   PL   +   +G      P F  N +L  +D   D GP I +I +
Sbjct: 172 FVYTGIYNNNFTSLPYPLFCTDLQPDGSWIWQAP-FHPNAKLPWLDAEHDVGPAILQIFK 230

Query: 117 EGPTKW-NGKKVPIASENVTIKQITDVLTKVTGK 149
           +G  KW  GK++ +A E +T  +  +V ++  G+
Sbjct: 231 DGVKKWGGGKRIALAYEMLTPLEACEVFSRGVGR 264



>gi|393227990|gb|EJD35649.1| nucleoside-diphosphate-sugar epimerase family protein [Auricularia
           delicata TFB-10046 SS5]
          Length = 298

 Score = 78.6 bits (192), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 101/223 (45%), Gaps = 29/223 (13%)

Query: 1   ERQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIR-KLGIPNV 59
           ERQGK +AD A++ G+   +Y+S+     E     P   HF  K  VE++IR K  +P  
Sbjct: 100 ERQGKALADEAEKAGVRHFVYTSVDIGKLEGTTGIP---HFDSKRRVEEHIRAKQNLPFT 156

Query: 60  TF---AYL-SFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKII 115
                A++ +F+   + T F  ++ N+             N +L LID  D G   A   
Sbjct: 157 ILRPVAFMDNFFDPQMATVFATMVKNK----------LRPNTKLQLIDSSDIGEFAAIAF 206

Query: 116 EEGPTKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQ 175
           ++ P +W GK + +A E +   +++     VTGK  K  TL    I      L +K ++ 
Sbjct: 207 QQ-PEEWIGKTLSLAGEELPYAEMSKAFQDVTGKPPKT-TLA---IVGSLVNLMSKEMRT 261

Query: 176 MFKYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYGK 218
           MF +        KD    DI   ++++P +K F Q +    GK
Sbjct: 262 MFAF------FDKDGYAADIARCREVYPGLKDFRQCVESRQGK 298



>gi|225555191|gb|EEH03484.1| NmrA-like family domain-containing protein [Ajellomyces capsulatus
           G186AR]
          Length = 306

 Score = 78.6 bits (192), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 56/165 (33%), Positives = 84/165 (50%), Gaps = 7/165 (4%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK +AD AK  G++  I+SSL + T  + G+ P+V+HF  K +VE+Y+R +G+P  TF 
Sbjct: 95  QGKNVADAAKSAGVSHFIFSSLVNVTDVTHGRLPNVSHFDSKANVEKYVRSIGLP-ATFV 153

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVR-DTGPIIAKIIEEGPTK 121
              ++  N   F   L   E+G   L +P   EN Q  L D   DTG  +   +++ P  
Sbjct: 154 LPGYFMSN---FEKTLRKGEDGVFTLSLP-VSENAQFPLFDAAGDTGKYVTAAMKKYPAT 209

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFP 166
             GK +  A++  T  +I    T+VTG   KV  +  E      P
Sbjct: 210 L-GKDIYEATDYYTPGRIVSEFTEVTGYPAKVVQITPEQYKSFMP 253



>gi|452982441|gb|EME82200.1| hypothetical protein MYCFIDRAFT_211569 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 378

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 76/150 (50%), Gaps = 7/150 (4%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           GK  AD AK  G+   I+SS+PD +   G  +  +  +  K  +E Y+R++GIP  TF Y
Sbjct: 91  GKACADAAKRAGIAHYIFSSMPDHSV-YGEDWRALPMWETKFAIENYVRQIGIP-ATFVY 148

Query: 64  LSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEGP 119
              Y+ N  +   PL   E   +G      P F  +D L  +D   D GP + +I + GP
Sbjct: 149 TGIYNNNFTSLPYPLFQMELQDDGSFVWQAP-FHPDDPLPWLDAEHDVGPALLQIFKMGP 207

Query: 120 TKWNGKKVPIASENVTIKQITDVLTKVTGK 149
           + W G++V +A E +T  Q  +  ++  G+
Sbjct: 208 SHWKGQRVTLAFEKLTPIQACNRFSRGVGR 237



>gi|149042651|gb|EDL96288.1| similar to RIKEN cDNA 1110025F24 (predicted), isoform CRA_b [Rattus
           norvegicus]
          Length = 288

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 87/149 (58%), Gaps = 5/149 (3%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL++++YS L +    + G+     HF GK  VE+Y R +G+P +T 
Sbjct: 92  QQGKLLADLAKRLGLHYVVYSGLENIKKLTAGRLA-AGHFDGKGEVEEYFRHIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ ++FLP  + +     L +P    +  +  + V D GP++  ++++ P +
Sbjct: 150 VRLPCYFENLLSYFLPQKAADGKSFLLDLPM--GDVPMDGMSVSDLGPVVLSLLKK-PEE 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKT 150
           + G+ V +++   T ++   +L+K TGKT
Sbjct: 207 YIGQNVGLSTCRHTAEEYAALLSKHTGKT 235



>gi|512207609|gb|EPE36427.1| NAD(P)-binding Rossmann-fold containing protein [Glarea lozoyensis
           ATCC 20868]
          Length = 311

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 84/167 (50%), Gaps = 7/167 (4%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
             K IAD+A +KG  ++I+S+LP  T  SGGKY  VT F  K   E+YIR L I +   +
Sbjct: 95  SAKTIADVAVQKGAQYIIFSTLPSVTELSGGKYTHVTPFDAKAVAEKYIRSLPIKSAFVS 154

Query: 63  YLSFYSQNIGT--FFLPLISNENGEIDLVIPYFEENDQLLLIDVR-DTGPIIAKIIEEGP 119
           Y  F+ +N  T  F  P  +++   +  +  +     ++  ID   D G  +  I+ E P
Sbjct: 155 Y-GFFMENFHTQPFLGPQKTSDGTWV--LARHISSKHKVPYIDATGDAGKFVGAILAE-P 210

Query: 120 TKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFP 166
            K+ GK    A    +  +I  +L+K TGKT   + ++ +D  K  P
Sbjct: 211 EKYAGKTFCAAQALYSFDEIVAILSKTTGKTVVYKQISLDDFEKSLP 257



>gi|470246932|ref|XP_004366619.1| NmrA-like protein [Dictyostelium fasciculatum]
 gi|328870340|gb|EGG18715.1| NmrA-like protein [Dictyostelium fasciculatum]
          Length = 304

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 65/214 (30%), Positives = 99/214 (46%), Gaps = 15/214 (7%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPN----- 58
           GK I D      +   I+SSL +    S G  P VTHF  K+ ++ Y       N     
Sbjct: 96  GKKIVDAVVLAKVEHFIFSSLVNCEKISNGTLP-VTHFDQKDEIKVYAEFQASKNPTSLT 154

Query: 59  VTFAYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEG 118
           V+F Y+ FY QN  TFF P  S +     + IP F     + + DV D G I++ I+E  
Sbjct: 155 VSFVYIPFYYQNFETFFAPKKSEDGQSYSITIP-FNPKIPIAMADVTDVGAIVSAILENK 213

Query: 119 PTKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMFK 178
            TK+    +P     V++  I   L+K  G   +   +  + +   FP  N K +  MF+
Sbjct: 214 -TKYANASIPFC-HTVSMNDIIQSLSKFYGFDIQYNYIPPQ-VFGTFPFPNAKEMGNMFQ 270

Query: 179 YEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
           + +EFG         D++IA  L  +I TF++Y+
Sbjct: 271 FYEEFGTFPG----LDLSIAPNLT-HITTFDEYL 299



>gi|344291949|ref|XP_003417691.1| PREDICTED: nmrA-like family domain-containing protein 1-like
           [Loxodonta africana]
          Length = 398

 Score = 77.8 bits (190), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 59/210 (28%), Positives = 110/210 (52%), Gaps = 15/210 (7%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           GK++AD+AK  GL++++YS L +    +GGK     HF GK  VE+Y R +G+P +T   
Sbjct: 193 GKLLADLAKRLGLHYVVYSGLENIKKLTGGKL-AAGHFDGKGEVEEYFRHIGVP-MTSVR 250

Query: 64  LSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKWN 123
           L  Y +N+ + FLP  + +     L +P    +  +  + V D GP++  +++  P ++ 
Sbjct: 251 LPCYFENLLSSFLPKKAPDGKSYLLSLPI--GDIPMDGMAVADLGPVVLSLLKV-PEEYI 307

Query: 124 GKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYEKE 182
           G+ + +++   T  +   +L+K TG   +      E+  K  FP    + L  MF+    
Sbjct: 308 GQNLGLSTCRHTAGEYAALLSKHTGHAIRDAKATPEEYEKLGFP--GAQDLANMFR---- 361

Query: 183 FGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
           F A+  D   ++I +  +L+P  +T +Q++
Sbjct: 362 FYAMKPD---RNIELTLRLNPKARTLDQWL 388



>gi|26347201|dbj|BAC37249.1| unnamed protein product [Mus musculus]
          Length = 243

 Score = 77.8 bits (190), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 86/149 (57%), Gaps = 5/149 (3%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL++++YS L +    + GK     HF GK  VE+Y R +G+P +T 
Sbjct: 92  QQGKLLADLAKRLGLHYVVYSGLENIRKLTAGKLA-AGHFDGKGEVEEYFRDIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ ++FLP  + +     L +P    +  +  + V D GP++  ++++ P +
Sbjct: 150 VRLPCYFENLLSYFLPQKAADGKSFLLDLPM--GDVPMDGMSVSDLGPVVLSLLKK-PEE 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKT 150
           + G+ + +++   T ++   +L+K TGK 
Sbjct: 207 YVGQNIGLSTCRHTAEEYAALLSKHTGKA 235



>gi|365970474|ref|YP_004952035.1| NmrA family protein [Enterobacter cloacae EcWSU1]
 gi|503936054|ref|WP_014170048.1| NmrA family protein [Enterobacter cloacae]
 gi|365749387|gb|AEW73614.1| NmrA Family Protein [Enterobacter cloacae EcWSU1]
          Length = 320

 Score = 77.8 bits (190), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/220 (24%), Positives = 113/220 (51%), Gaps = 18/220 (8%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           G  +AD A   G+  L++SSL +    + G      HF+ K  +E+YIR L + + +F  
Sbjct: 101 GYRLADAAVNAGVKHLVFSSLENVERITAGTL-WAPHFSDKGRIEEYIRTLPV-SASFIQ 158

Query: 64  LSFYSQNIGTFFLPLISNENGEIDLVIP-YFEENDQLLLID-VRDTGPIIAKIIEEGPTK 121
           L+F+  N+  ++ P    + G+ +L+ P Y  E+ +   +D +  TGP + ++ +  P  
Sbjct: 159 LAFFYTNLAEYYPP---RKEGD-ELIFPLYLPEDVRAPFVDPLTATGPAVLEMFDN-PEH 213

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRT-LNDEDIAKDFPTLNNKS-----LKQ 175
           +NG  +P+  E ++ +++ +  T+VTG   + R+    E +   FP   + +     +  
Sbjct: 214 YNGMTLPVVGECLSPREMVETFTEVTGIKARYRSAYTREALLHHFPDFADNAALVSEITG 273

Query: 176 MFKYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYILET 215
           M +Y   +G  GKD   +D+  ++ ++P   T+ ++++ +
Sbjct: 274 MTEYAVNYGYYGKD---RDLNWSRTINPATLTWREFLIAS 310



>gi|66821746|ref|XP_644302.1| hypothetical protein DDB_G0274161 [Dictyostelium discoideum AX4]
 gi|60472020|gb|EAL69973.1| hypothetical protein DDB_G0274161 [Dictyostelium discoideum AX4]
          Length = 308

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 112/219 (51%), Gaps = 17/219 (7%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPN----- 58
           G+ +AD A   G+   I+S L      S G++  V H+  K  +E+YIR+L   N     
Sbjct: 91  GRNMADAALAAGIKHFIFSGLTPMNEISQGRF-SVPHYDQKYLIEKYIRELSKLNPKTFI 149

Query: 59  VTFAYLSFYSQNIGTFFL---PLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKII 115
            +F Y   Y QN  TF+     + S+ +    L  P       L + D+ + G I+  I+
Sbjct: 150 SSFVYAPGYMQNFLTFYKLKKNIESDGSETYTLSTPSDPIGKPLDIGDITEMGYIVESIL 209

Query: 116 EEGPTKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNN-KSLK 174
            + P K++G  +P++ + +T  QI ++ +KVTGKT     +    + +  P +++ + + 
Sbjct: 210 SD-PIKYSGSVIPMSGDCLTGPQIAEIYSKVTGKTVNFEFI-PPSVFRTLPFIHHSEDIA 267

Query: 175 QMFKYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYIL 213
            M+++  E+GA G      D +IA K+H  +KTFE++++
Sbjct: 268 SMYEFCNEYGAFGG----IDTSIAPKMH-KLKTFEEFLI 301



>gi|330795533|ref|XP_003285827.1| hypothetical protein DICPUDRAFT_76765 [Dictyostelium purpureum]
 gi|325084206|gb|EGC37639.1| hypothetical protein DICPUDRAFT_76765 [Dictyostelium purpureum]
          Length = 307

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 63/218 (28%), Positives = 109/218 (50%), Gaps = 17/218 (7%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPN----V 59
           G  +AD A   G+   ++S+LPD    S GKY D   F  K  +E+YIR L   N     
Sbjct: 90  GCKVADAALLSGVQHFVFSTLPDPRELSNGKYNDFIDFNSKVDIEKYIRNLSKQNSHFIS 149

Query: 60  TFAYLSFYSQNIGTFFLPLISNENGE-----IDLVIPYFEENDQLLLIDVRDTGPIIAKI 114
           +F     Y QN  T+F PL  + + +       L +P  + + +L   D+ D GP++++ 
Sbjct: 150 SFVSAPMYFQNFKTYF-PLQKHTDSKDGSTYYSLDLP-GKPDLKLDHGDINDLGPLVSEQ 207

Query: 115 IEEGPTKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLK 174
             + PTK++G+ +P++++ +T  ++TD  TKV GK      +  ++ AK    +    + 
Sbjct: 208 F-KNPTKYSGQVIPLSAQELTGPELTDTFTKVLGKKVVYNYVPSKEYAKSNVYVEAPYIA 266

Query: 175 QMFKYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
            ++ Y  E    G      D TI+KK+   + TFE+++
Sbjct: 267 HLYDYFSENPYFGH----FDNTISKKIL-KLTTFEEFL 299



>gi|408392294|gb|EKJ71651.1| hypothetical protein FPSE_08097 [Fusarium pseudograminearum CS3096]
          Length = 305

 Score = 77.4 bits (189), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 79/148 (53%), Gaps = 6/148 (4%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK +AD  K  G+  LI+SSL D+   S G+   + HF GK  +E+YIR++ +P  TF 
Sbjct: 95  QGKAVADACKTAGVKQLIFSSLLDTKKISNGRLTHIKHFEGKAEIEEYIRQINVP-ATFV 153

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVR-DTGPIIAKIIEEGPTK 121
              F++ N+   F  +  NE+G     +P   +  Q+ + DV+ D G  +   I+  P  
Sbjct: 154 LPGFFASNL---FTSIRKNEDGSYAWALPGDGDKTQVPIFDVQGDMGKFVKAAIKNFPGT 210

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGK 149
            N K+V  A++  +  +IT   ++V GK
Sbjct: 211 LN-KRVFAATDYYSPNRITTEFSEVMGK 237



>gi|344282131|ref|XP_003412828.1| PREDICTED: nmrA-like family domain-containing protein 1-like
           [Loxodonta africana]
          Length = 327

 Score = 77.4 bits (189), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 58/216 (26%), Positives = 103/216 (47%), Gaps = 15/216 (6%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           +G+++AD+AK  GL  +++S L +    SGGK  +V HF GK  V ++   + IP  +  
Sbjct: 93  RGRLVADVAKHLGLQHMVFSGLENIKRLSGGKL-EVPHFDGKGEVGEFFWSVSIPMTSVC 151

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
             ++Y +N    + P+ + +     L +P  +       I V D G + + I    P ++
Sbjct: 152 VAAYY-ENFLLLWKPVKAADRDYYTLGLPMGDIPKH--GISVADVGAVASGIFNS-PEEF 207

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKYEK 181
            GK   +++E +TI+Q  DVL+K+ GK      +  E   K   P   + +    F   K
Sbjct: 208 LGKAAGLSAEALTIQQYADVLSKILGKDVCNAKITPEAYEKLGLPGAEDIANMCRFYCTK 267

Query: 182 EFGAIGKDNELQDITIAKKLHPNIKTFEQYILETYG 217
                      +D+ +  +L+P +K+F Q+I E  G
Sbjct: 268 PD---------RDVKLTHRLNPKVKSFSQFISENQG 294



>gi|488520609|ref|XP_004452236.1| PREDICTED: nmrA-like family domain-containing protein 1 isoform 1
           [Dasypus novemcinctus]
          Length = 247

 Score = 77.4 bits (189), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 46/149 (30%), Positives = 83/149 (55%), Gaps = 5/149 (3%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL  ++YS L +    +GGK     HF GK  VE+Y R +G+P +T 
Sbjct: 92  KQGKLLADLAKRLGLRHVVYSGLENIKKLTGGKLA-AGHFDGKGEVEEYFRDIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ ++FLP  + +     L +P    +  +  + V D GP++  +++  P +
Sbjct: 150 VRLPCYFENLFSYFLPQKAPDGKSYLLSLPM--GDIPMDGMAVADLGPVVLSLLQT-PGE 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKT 150
           + G+ + +++   T  +   +L+K TGK 
Sbjct: 207 YVGRNIGLSTCRHTAAEYAALLSKHTGKA 235



>gi|189207106|ref|XP_001939887.1| nitrogen metabolic regulation protein [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187975980|gb|EDU42606.1| nitrogen metabolic regulation protein [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 210

 Score = 77.4 bits (189), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/126 (34%), Positives = 64/126 (50%), Gaps = 5/126 (3%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           G+ +AD AK+ G+   IYSS+PD +    G +  +  +  K  VEQY+R++G+P  TF Y
Sbjct: 87  GRSLADAAKKAGIQHYIYSSMPDHSVFGNG-WRALPLWAPKFTVEQYVRQIGLP-ATFVY 144

Query: 64  LSFYSQNIGTFFLPLISNEN---GEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPT 120
              Y  N      PL   E+   G      P+  +     L    D GP I ++ +EGP 
Sbjct: 145 CGIYHNNFTGLDFPLFRMEHQYDGSFVWQAPFHPDQPLPWLDSEHDIGPAIYQLFKEGPR 204

Query: 121 KWNGKK 126
           KWNGK+
Sbjct: 205 KWNGKR 210



>gi|330802956|ref|XP_003289477.1| hypothetical protein DICPUDRAFT_92307 [Dictyostelium purpureum]
 gi|325080435|gb|EGC33991.1| hypothetical protein DICPUDRAFT_92307 [Dictyostelium purpureum]
          Length = 304

 Score = 77.4 bits (189), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 63/215 (29%), Positives = 101/215 (46%), Gaps = 15/215 (6%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPN----V 59
           G  +AD   + G+  L++SSL      S G+  DV HF  K  +E +IR+L         
Sbjct: 91  GNKVADACFDAGVEHLVFSSLSACKKISNGRI-DVPHFDLKAEIEDHIRELSKKKPQFIS 149

Query: 60  TFAYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEEND-QLLLIDVRDTGPIIAKIIEEG 118
           +F Y  FY QNIG  F    S +     + +P    +   L + D+ D GP+++ I    
Sbjct: 150 SFVYAPFYMQNIGDGFKVEKSADGNSYTISLPADPSSKFPLDMGDINDIGPVVSGIFNN- 208

Query: 119 PTKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMF 177
           P+K++G  VP +   +T ++I   ++K TGK  K   +  +  A   FP      L  MF
Sbjct: 209 PSKYSGVDVPFSGSALTGEEIAKSISKATGKQVKFNYIPTKVFATFGFPGAGE--LAHMF 266

Query: 178 KYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
            +  EFGA        D ++  K+   + TF++Y+
Sbjct: 267 DFYNEFGAF----HTLDKSLGSKI-TKLTTFDEYL 296



>gi|83771390|dbj|BAE61522.1| unnamed protein product [Aspergillus oryzae RIB40]
          Length = 426

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 77/151 (50%), Gaps = 9/151 (5%)

Query: 4   GKMIADIAKEKG-LNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           G+ +AD AK  G +   IYSS+PD +    G +  V  +  K  VE YIR+LG+P  TF 
Sbjct: 166 GRALADAAKRAGTIQHYIYSSMPDHSVY--GPWLPVPLWAPKFTVENYIRQLGLP-ATFV 222

Query: 63  YLSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEG 118
           Y   Y+ N  +   PL   E   +G  +   P F+ +  L  +D   D GP + +I ++G
Sbjct: 223 YAGIYNNNFTSLPYPLFQMELMPDGSFEWHAP-FDPDTPLPWLDAEHDVGPALLQIFKDG 281

Query: 119 PTKWNGKKVPIASENVTIKQITDVLTKVTGK 149
           P KW+G ++ +  E ++  Q+    ++   +
Sbjct: 282 PKKWHGHRIALTFETLSPNQVCAAFSRALNR 312



>gi|497343027|ref|WP_009657240.1| NmrA family protein [Selenomonas sp. FOBRC9]
 gi|400381284|gb|EJP34087.1| NmrA family protein [Selenomonas sp. FOBRC9]
          Length = 317

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 63/220 (28%), Positives = 110/220 (50%), Gaps = 16/220 (7%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           GK +AD A   G+  ++YSSL +    +GG+     HFT K  VE YIR L +   +F Y
Sbjct: 97  GKELADAAAAAGVRHMVYSSLENVDQITGGRL-SAPHFTDKACVEAYIRTLPV-QSSFIY 154

Query: 64  LSFYSQNIGTFFLPLISNENGEIDLVIP-YFEENDQLLLID-VRDTGPIIAKIIEEGPTK 121
           L+F+  N   F+ P    ++G   LV P Y  E+ +   +D    TGP + +I+   P +
Sbjct: 155 LAFFYTNFMEFYTPY--RKDGADTLVFPIYLPEDFKAPFVDPTSATGPAVLEILSH-PEQ 211

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDED-IAKDFPTL-NNKSLKQ---- 175
           + G  +P+  + ++ +++ D   +VTGK     +    D +   FP    NK L +    
Sbjct: 212 YAGASLPVIGDVLSPREVVDAFVEVTGKQAIYSSAYTRDELLSHFPDFAANKPLVEELCG 271

Query: 176 MFKYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYILET 215
           M +Y  E+G   K    +D++  +K++P+   ++ ++  T
Sbjct: 272 MTRYAVEYGYYQKT---RDLSWYRKINPHALRWKDFLRTT 308



>gi|238503057|ref|XP_002382762.1| nitrogen metabolite repression regulator NmrA [Aspergillus flavus
           NRRL3357]
 gi|220691572|gb|EED47920.1| nitrogen metabolite repression regulator NmrA [Aspergillus flavus
           NRRL3357]
 gi|391874487|gb|EIT83362.1| hypothetical protein Ao3042_11376 [Aspergillus oryzae 3.042]
          Length = 351

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 77/151 (50%), Gaps = 9/151 (5%)

Query: 4   GKMIADIAKEKG-LNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           G+ +AD AK  G +   IYSS+PD +    G +  V  +  K  VE YIR+LG+P  TF 
Sbjct: 91  GRALADAAKRAGTIQHYIYSSMPDHSVY--GPWLPVPLWAPKFTVENYIRQLGLP-ATFV 147

Query: 63  YLSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEG 118
           Y   Y+ N  +   PL   E   +G  +   P F+ +  L  +D   D GP + +I ++G
Sbjct: 148 YAGIYNNNFTSLPYPLFQMELMPDGSFEWHAP-FDPDTPLPWLDAEHDVGPALLQIFKDG 206

Query: 119 PTKWNGKKVPIASENVTIKQITDVLTKVTGK 149
           P KW+G ++ +  E ++  Q+    ++   +
Sbjct: 207 PKKWHGHRIALTFETLSPNQVCAAFSRALNR 237



>gi|148664829|gb|EDK97245.1| NmrA-like family domain containing 1, isoform CRA_b [Mus musculus]
          Length = 266

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 86/149 (57%), Gaps = 5/149 (3%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL++++YS L +    + GK     HF GK  VE+Y R +G+P +T 
Sbjct: 115 QQGKLLADLAKRLGLHYVVYSGLENIRKLTAGKLA-AGHFDGKGEVEEYFRDIGVP-MTS 172

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ ++FLP  + +     L +P    +  +  + V D GP++  ++++ P +
Sbjct: 173 VRLPCYFENLLSYFLPQKAADGKSFLLDLPM--GDVPMDGMSVSDLGPVVLSLLKK-PEE 229

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKT 150
           + G+ + +++   T ++   +L+K TGK 
Sbjct: 230 YVGQNIGLSTCRHTAEEYAALLSKHTGKA 258



>gi|471563858|gb|EMR64960.1| putative nmral1 protein [Eutypa lata UCREL1]
          Length = 681

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 63/200 (31%), Positives = 91/200 (45%), Gaps = 17/200 (8%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK +AD AKE G+   I+SSL D    S GK   V HF  K  VE Y+R LGIP  TF
Sbjct: 99  QQGKNLADAAKEAGVQHYIWSSLDDVKKISKGKLQKVYHFDSKAEVEDYVRTLGIP-ATF 157

Query: 62  AYLSFYSQNIGT-FFLPLISNENGEIDLV----IPYFEENDQLLLIDVRDTGPIIAKIIE 116
               FY  NI    F P+ + +     LV    IP    +  +   D RDTG  +  I+ 
Sbjct: 158 FLAGFYMSNIPEDLFKPMPTADGNNSSLVWTFKIP-CAASTPIPTFDTRDTGKYVKAIVR 216

Query: 117 EGPTKWNGKKVPIASENVTIKQITDVLTKV----TGKTHKVRTLNDEDI-----AKDFPT 167
                  GK+   A+  +T++++ D   +      GKT +   ++DE       ++  P 
Sbjct: 217 NRDVLL-GKRFLGANAYITVQEMVDAFARAFPEEAGKTARFLQVSDEVYRASLRSQGSPE 275

Query: 168 LNNKSLKQMFKYEKEFGAIG 187
                L +M +   E+G  G
Sbjct: 276 FIVDELAEMGRLLDEYGYFG 295



>gi|317148264|ref|XP_001822655.2| nitrogen metabolite repression protein nmrA [Aspergillus oryzae
           RIB40]
          Length = 351

 Score = 77.0 bits (188), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 77/151 (50%), Gaps = 9/151 (5%)

Query: 4   GKMIADIAKEKG-LNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           G+ +AD AK  G +   IYSS+PD +    G +  V  +  K  VE YIR+LG+P  TF 
Sbjct: 91  GRALADAAKRAGTIQHYIYSSMPDHSVY--GPWLPVPLWAPKFTVENYIRQLGLP-ATFV 147

Query: 63  YLSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEG 118
           Y   Y+ N  +   PL   E   +G  +   P F+ +  L  +D   D GP + +I ++G
Sbjct: 148 YAGIYNNNFTSLPYPLFQMELMPDGSFEWHAP-FDPDTPLPWLDAEHDVGPALLQIFKDG 206

Query: 119 PTKWNGKKVPIASENVTIKQITDVLTKVTGK 149
           P KW+G ++ +  E ++  Q+    ++   +
Sbjct: 207 PKKWHGHRIALTFETLSPNQVCAAFSRALNR 237



>gi|190344587|gb|EDK36288.2| hypothetical protein PGUG_00386 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 313

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 65/216 (30%), Positives = 100/216 (46%), Gaps = 11/216 (5%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK I D A E G  + I+SS PD    S GKY  V+ + GK+ V  YI+   I  + +
Sbjct: 96  KQGKSIVDAAIEAGAKYFIWSSAPDPDKISHGKYKHVSIYGGKSGVMDYIKSQPITGIYY 155

Query: 62  AYLSFYSQNIGTFFL--PLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGP 119
           +  SF  QN  +     PL     G    +   F+ + +L +ID+ DTG  I  I+E  P
Sbjct: 156 SPGSFM-QNYQSQLAPKPLGDGTYG----IFGRFKPDTELPIIDINDTGKFIGAILEN-P 209

Query: 120 TKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNK---SLKQM 176
            K++ + V  A     ++ I   + KV+GKT        E   ++ P         L   
Sbjct: 210 EKFSEQFVASAEGVYKVEDIVARIAKVSGKTITYHQATVEQFKENVPPFLKPFADVLNDF 269

Query: 177 FKYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
           F+   EFG  G D++ Q    +K+ H  + T E++ 
Sbjct: 270 FQLIVEFGYYGPDSKKQVDNWSKQAHGKLTTIEEFF 305



>gi|148664828|gb|EDK97244.1| NmrA-like family domain containing 1, isoform CRA_a [Mus musculus]
          Length = 291

 Score = 76.6 bits (187), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 86/149 (57%), Gaps = 5/149 (3%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL++++YS L +    + GK     HF GK  VE+Y R +G+P +T 
Sbjct: 92  QQGKLLADLAKRLGLHYVVYSGLENIRKLTAGKLA-AGHFDGKGEVEEYFRDIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ ++FLP  + +     L +P    +  +  + V D GP++  ++++ P +
Sbjct: 150 VRLPCYFENLLSYFLPQKAADGKSFLLDLPM--GDVPMDGMSVSDLGPVVLSLLKK-PEE 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKT 150
           + G+ + +++   T ++   +L+K TGK 
Sbjct: 207 YVGQNIGLSTCRHTAEEYAALLSKHTGKA 235



>gi|12849017|dbj|BAB28172.1| unnamed protein product [Mus musculus]
          Length = 291

 Score = 76.6 bits (187), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 45/149 (30%), Positives = 86/149 (57%), Gaps = 5/149 (3%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK++AD+AK  GL++++YS L +    + GK     HF GK  VE+Y R +G+P +T 
Sbjct: 92  QQGKLLADLAKRLGLHYVVYSGLENIRKLTAGKLA-AGHFDGKGEVEEYFRDIGVP-MTS 149

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
             L  Y +N+ ++FLP  + +     L +P    +  +  + V D GP++  ++++ P +
Sbjct: 150 VRLPCYFENLLSYFLPQKAADGKSFLLDMPM--GDVPMDGMSVSDLGPVVLSLLKK-PEE 206

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKT 150
           + G+ + +++   T ++   +L+K TGK 
Sbjct: 207 YVGQNIGLSTCRHTAEEYAALLSKHTGKA 235



>gi|449304749|gb|EMD00756.1| hypothetical protein BAUCODRAFT_182018 [Baudoinia compniacensis
           UAMH 10762]
          Length = 301

 Score = 76.6 bits (187), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 62/204 (30%), Positives = 93/204 (45%), Gaps = 16/204 (7%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           RQGK I D  K +G+   I+SSLP +   S GKY  + HF GK  VE+Y+ K G  ++  
Sbjct: 96  RQGKNIFDAVKAEGVKHYIWSSLPWTAKVSNGKYTHIDHFDGKAEVEEYVEK-GKGDM-- 152

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
                    I ++F+P I   NG   L +P+ +     L+   RD+G  I  + E G   
Sbjct: 153 ---------IASYFMPAI---NGTPMLNMPFPDSIAWPLMDPRRDSGKYIMGLFEGGDAA 200

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMFKYEK 181
            NG +V   S   T K++    +K +G+     T+  E  A   P      L +M +Y  
Sbjct: 201 -NGVEVQAVSFWTTPKEVVAAYSKASGRDVVFNTIPGEMFASYLPENIRDELTEMVEYIG 259

Query: 182 EFGAIGKDNELQDITIAKKLHPNI 205
           E+   GK  E +     K + P +
Sbjct: 260 EYSYYGKGTEKEQDKHDKWIVPGV 283



>gi|240281413|gb|EER44916.1| NmrA-like family domain-containing protein [Ajellomyces capsulatus
           H143]
          Length = 306

 Score = 76.6 bits (187), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 83/165 (50%), Gaps = 7/165 (4%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK +AD AK  G++  I+SSL + T  + G+ P+V+HF  K +VE+Y+R +G+P  TF 
Sbjct: 95  QGKNVADAAKSAGVSHFIFSSLVNVTDVTQGRLPNVSHFDSKANVEKYVRSIGLP-ATFV 153

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVR-DTGPIIAKIIEEGPTK 121
              ++  N   F   L   E+G   L +P   EN Q  L D   DTG  +   +++ P  
Sbjct: 154 LPGYFMSN---FEKMLRKGEDGVFTLSLP-VSENAQFPLFDAAGDTGKYVTAAMKKYPAT 209

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFP 166
             GK +  A++  T  +I    T+VTG   K   +  E      P
Sbjct: 210 L-GKDIYEATDYYTPGRIVSEFTEVTGYPAKAVQITPEQYKSFMP 253



>gi|497017503|ref|WP_009438003.1| NmrA family protein [Selenomonas sp. oral taxon 137]
 gi|312976441|gb|EFR41896.1| NmrA family protein [Selenomonas sp. oral taxon 137 str. F0430]
          Length = 317

 Score = 76.6 bits (187), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 63/220 (28%), Positives = 110/220 (50%), Gaps = 16/220 (7%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           GK +AD A   G+  ++YSSL +    +GG+     HFT K  VE YIR L +   +F Y
Sbjct: 97  GKELADAAAAAGVRHIVYSSLENVDQITGGRL-SAPHFTDKACVEAYIRTLPV-QSSFIY 154

Query: 64  LSFYSQNIGTFFLPLISNENGEIDLVIP-YFEENDQLLLID-VRDTGPIIAKIIEEGPTK 121
           L+F+  N   F+ P    ++G   LV P Y  E+ +   +D    TGP + +I+   P +
Sbjct: 155 LAFFYTNFMEFYTPY--RKDGADTLVFPIYLPEDFKAPFVDPTSATGPAVLEILSH-PEQ 211

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDED-IAKDFPTL-NNKSLKQ---- 175
           + G  +P+  + ++ +++ D   +VTGK     +    D +   FP    NK L +    
Sbjct: 212 YAGASLPVIGDVLSPREVVDAFVEVTGKQAIYSSAYTRDELLSHFPDFAANKPLVEELCG 271

Query: 176 MFKYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYILET 215
           M +Y  E+G   K    +D++  +K++P+   ++ ++  T
Sbjct: 272 MTRYAVEYGYYQKT---RDLSWYRKINPHALRWKDFLRTT 308



>gi|325092095|gb|EGC45405.1| NmrA-like family domain-containing protein [Ajellomyces capsulatus
           H88]
          Length = 306

 Score = 76.6 bits (187), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 83/165 (50%), Gaps = 7/165 (4%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK +AD AK  G++  I+SSL + T  + G+ P+V+HF  K +VE+Y+R +G+P  TF 
Sbjct: 95  QGKNVADAAKSAGVSHFIFSSLVNVTDVTQGRLPNVSHFDSKANVEKYVRSIGLP-ATFV 153

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVR-DTGPIIAKIIEEGPTK 121
              ++  N   F   L   E+G   L +P   EN Q  L D   DTG  +   +++ P  
Sbjct: 154 LPGYFMSN---FEKMLRKGEDGVFTLSLP-VSENAQFPLFDAAGDTGKYVTAAMKKYPAT 209

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFP 166
             GK +  A++  T  +I    T+VTG   K   +  E      P
Sbjct: 210 L-GKDIYEATDYYTPGRIVSEFTEVTGYPAKAVQITPEQYKSFMP 253



>gi|336257901|ref|XP_003343772.1| hypothetical protein SMAC_04430 [Sordaria macrospora k-hell]
 gi|380091600|emb|CCC10732.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 491

 Score = 76.6 bits (187), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 83/159 (52%), Gaps = 10/159 (6%)

Query: 1   ERQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVT 60
           E+ G  +AD AK+ G+   +YSS+PD    +   +P +  +  K+ VE Y++++GIP  T
Sbjct: 174 EKIGMALADAAKKAGVQHYVYSSMPDHHVYN-KDWPSLPLWASKHRVEDYVKEIGIP-AT 231

Query: 61  FAYLSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIE 116
           F Y   Y+ N  +   PL   E   +G      P F  N +L  +D   D GP I +I +
Sbjct: 232 FVYTGIYNNNFTSLPYPLFCTEMQPDGSWIWQAP-FHPNAKLPWLDAEHDVGPAILQIFK 290

Query: 117 EGPTKW-NGKKVPIASENVTIKQITDVLTKVTGKTHKVR 154
           +G  KW  GK++ +A E +T  +  +V ++  G +  VR
Sbjct: 291 DGVKKWGGGKRIALAYEMLTPLEACEVFSR--GVSRPVR 327



>gi|500255169|gb|EON98686.1| putative nitrogen metabolite repression- -responsible protein
           [Togninia minima UCRPA7]
          Length = 410

 Score = 76.3 bits (186), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 48/160 (30%), Positives = 80/160 (50%), Gaps = 9/160 (5%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAY 63
           G+ +AD AK  G+   IYSS+PD        +P +  +  K+ VE Y++ +G+P  TF Y
Sbjct: 114 GEALADAAKRAGIQHYIYSSMPDHRAYD-ATWPSLPLWASKHKVEDYVKSIGLP-ATFVY 171

Query: 64  LSFYSQNIGTFFLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEGP 119
              Y+ N  +   PL   E   +G      P F  + +L  +D   D GP I +I ++G 
Sbjct: 172 TGIYNNNFTSLPYPLFCMELQPDGSFRWQAP-FHPDAKLPWLDAEHDVGPAIIQIFKDGI 230

Query: 120 TKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDE 159
           +KW  +++ +A E ++ ++   +    TG   KVR +  E
Sbjct: 231 SKWKDQRIALAYEMLSPREACKLFE--TGVGRKVRYVRGE 268



>gi|291233581|ref|XP_002736731.1| PREDICTED: NmrA-like family domain containing 1-like [Saccoglossus
           kowalevskii]
          Length = 298

 Score = 76.3 bits (186), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 62/214 (28%), Positives = 111/214 (51%), Gaps = 18/214 (8%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QG+ +AD AK  G+  +++S L ++     GK  D  HF GK  +E+Y+ ++G+P  + 
Sbjct: 90  QQGRNLADAAKNAGVKHVVFSGL-ENVKSLFGKACD--HFDGKWEIEEYMAEIGLPYTSV 146

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
            Y  +    +GT  L  I   +G   L IP    +  + +I   + G  I  + +  P+ 
Sbjct: 147 RYSKYVENILGT--LKPIKGPDGVYYLGIPV--RDQPIHIISAGEAGVAIVSVFDN-PSD 201

Query: 122 WNGKKVPIASENVTIKQITDVLTK-VTGKTHKVRTLNDEDIAK-DFPTLNNKSLKQMFKY 179
           + GK++ ++ +  T+ ++  VLT+ ++    K   +  E  A  DFP  ++  L  MF  
Sbjct: 202 YIGKRIGLSGDFCTVAEMAKVLTRHLSPLQFKPGNMTCEQFASLDFPGADD--LAVMF-- 257

Query: 180 EKEFGAIGKDNELQDITIAKKLHPNIKTFEQYIL 213
             EF   GK   ++DI + +KL PN KT+EQ+++
Sbjct: 258 --EFYQSGK--MVRDIELTRKLDPNTKTWEQWVV 287



>gi|477531027|gb|ENH82752.1| nitrogen metabolite repression-responsible protein [Colletotrichum
           orbiculare MAFF 240422]
          Length = 486

 Score = 75.9 bits (185), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 75/142 (52%), Gaps = 7/142 (4%)

Query: 15  GLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAYLSFYSQNIGTF 74
           G+   IYSS+PD    +   +P +  +  K+ VE+Y+R++ +P  TF Y   Y+ N  + 
Sbjct: 205 GIQHYIYSSMPDHAAYNA-DWPSLPLWAAKHEVEEYVRQIELP-ATFVYTGIYNNNFTSL 262

Query: 75  FLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEGPTKWNGKKVPIA 130
             PL   E   +G      P F E+ +L  +D   D GP I +I ++G +KW  K+V +A
Sbjct: 263 PYPLFCMELMPDGSFRWQAP-FHEDVKLPWLDAEHDVGPAILQIFKDGVSKWRTKRVALA 321

Query: 131 SENVTIKQITDVLTKVTGKTHK 152
            E +T ++  DV ++  G+  K
Sbjct: 322 WEMLTPREACDVFSRGVGRPVK 343



>gi|261188991|ref|XP_002620908.1| NmrA family transcriptional regulator [Ajellomyces dermatitidis
           SLH14081]
 gi|239591912|gb|EEQ74493.1| NmrA family transcriptional regulator [Ajellomyces dermatitidis
           SLH14081]
          Length = 305

 Score = 75.9 bits (185), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 83/164 (50%), Gaps = 5/164 (3%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QG+ +AD AK  G++ LI+SSL + T  + G+ P+V+HF  K +VE+YIR +G+P  TF 
Sbjct: 95  QGRNVADAAKSAGVSHLIFSSLINVTEATNGRLPNVSHFDSKANVEKYIRTIGVP-ATFV 153

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
              ++  N  T    L    +G   L +P  ++    L   V DTG  +  ++++ P   
Sbjct: 154 LPGYFMSNFET---ALRKGPDGVFTLNMPVSDKAQFPLFDVVGDTGKFVTAVMKKYPATL 210

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFP 166
            G+ +  A++  T  +I    T+VTG   K   +  E      P
Sbjct: 211 -GRDIYEATDYYTPSRIVSEFTEVTGYPAKAVQITPEQYKSFMP 253



>gi|358385495|gb|EHK23092.1| hypothetical protein TRIVIDRAFT_28808 [Trichoderma virens Gv29-8]
          Length = 307

 Score = 75.9 bits (185), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 52/149 (34%), Positives = 77/149 (51%), Gaps = 6/149 (4%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK + D AK+ G++++I+SSL   T E+ G+   V HF  K ++E+YIR  G+   TF 
Sbjct: 95  QGKNVTDAAKKVGVSYIIFSSLHHVTDETKGRLSHVPHFDSKANIEKYIRASGL-QCTFV 153

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLID-VRDTG-PIIAKIIEEGPT 120
              +Y  N   F   L   E+G   L  P   +  +  L D  +DTG  +  K   +   
Sbjct: 154 LAGYYMSN---FTQMLNKAEDGSYQLFYPVDGKKAKFPLFDAAKDTGMSLFVKATLKNAD 210

Query: 121 KWNGKKVPIASENVTIKQITDVLTKVTGK 149
              GK+V  AS+  T ++I D  +KVTGK
Sbjct: 211 NLQGKQVLAASDYYTTEEIVDTFSKVTGK 239



>gi|239609186|gb|EEQ86173.1| NmrA family transcriptional regulator [Ajellomyces dermatitidis
           ER-3]
 gi|327355912|gb|EGE84769.1| NmrA family transcriptional regulator [Ajellomyces dermatitidis
           ATCC 18188]
          Length = 305

 Score = 75.9 bits (185), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 51/164 (31%), Positives = 83/164 (50%), Gaps = 5/164 (3%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QG+ +AD AK  G++ LI+SSL + T  + G+ P+V+HF  K +VE+YIR +G+P  TF 
Sbjct: 95  QGRNVADAAKSAGVSHLIFSSLINVTEATNGRLPNVSHFDSKANVEKYIRTIGVP-ATFV 153

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
              ++  N  T    L    +G   L +P  ++    L   V DTG  +  ++++ P   
Sbjct: 154 LPGYFMSNFET---ALRKGPDGVFTLNMPVSDKAQFPLFDVVGDTGKFVTAVMKKYPATL 210

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFP 166
            G+ +  A++  T  +I    T+VTG   K   +  E      P
Sbjct: 211 -GRDIYEATDYYTPSRIVSEFTEVTGYPAKAVQITPEQYKSFMP 253



>gi|485928668|gb|EOD52338.1| putative family transcriptional regulator protein [Neofusicoccum
           parvum UCRNP2]
          Length = 302

 Score = 75.5 bits (184), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 56/165 (33%), Positives = 83/165 (50%), Gaps = 7/165 (4%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK +AD+AKE G+  LI+S+L   T  SGG+   V HF GK  +EQYIR  G+P  +F 
Sbjct: 95  QGKNVADVAKEVGIQHLIFSTLLHVTKASGGRLKHVPHFDGKAEIEQYIRDSGVP-CSFY 153

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEGPTK 121
              ++  N   +   L   ++G + L  P   E  +  L+D+  DTG  +  II+    K
Sbjct: 154 LPGYFMSN---YKAQLNEGDDGVVTLAYP-VSEKARFPLVDIAEDTGKFVKAIIKN-REK 208

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFP 166
             G +V  A+   T  QI     + TGK  +   +++E   K  P
Sbjct: 209 LLGAQVFGAAGYYTPSQILADYEEATGKKTRFVQVSNEQYKKFLP 253



>gi|471567623|gb|EMR67531.1| putative hscarg dehydrogenase protein [Eutypa lata UCREL1]
          Length = 329

 Score = 75.5 bits (184), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 56/201 (27%), Positives = 91/201 (45%), Gaps = 3/201 (1%)

Query: 14  KGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAYLSFYSQNIGT 73
           +G+ +L++S+LP     SGGKY  VT F  K   E+YIR L I +  +A   F       
Sbjct: 122 QGVEYLVFSTLPAVGEISGGKYARVTPFDAKAKAERYIRGLPIRSAFYAGGWFMENFEAQ 181

Query: 74  FFLPLISNENGEIDLVIPYFEENDQLLLID-VRDTGPIIAKIIEEGPTKWNGKKVPIASE 132
            FL    + +G   ++        ++ L+D + DTG  +  I+ E P K+ GK    A  
Sbjct: 182 TFLAPKLDADGTTWVMSRNSSPQTKMPLVDAIGDTGKFVGAILAE-PDKYEGKTFTGAVA 240

Query: 133 NVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDF-PTLNNKSLKQMFKYEKEFGAIGKDNE 191
             T++++  +L+K TGK    R ++ ED  K   P L        + ++ E+G  G   E
Sbjct: 241 LYTLEEVAAILSKATGKNVVYRQISTEDFKKTLPPGLLGDIFVDAYSFQDEYGYFGPGTE 300

Query: 192 LQDITIAKKLHPNIKTFEQYI 212
                  +     + T E+Y 
Sbjct: 301 ESVAWAVENARGRLTTLEEYF 321



>gi|358388796|gb|EHK26389.1| hypothetical protein TRIVIDRAFT_63701 [Trichoderma virens Gv29-8]
          Length = 312

 Score = 75.5 bits (184), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 54/186 (29%), Positives = 94/186 (50%), Gaps = 4/186 (2%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           Q K++     +  +N++I+SSLP +   S G+  DV HF  K  +EQYIR L I + +F 
Sbjct: 97  QAKVLCSELLQAKVNFVIWSSLPYAREISKGEL-DVKHFDVKAEIEQYIRNLPIKS-SFF 154

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLL-LIDVRDTGPIIAKIIEEGPTK 121
             +++ QN+  F +   S+   +   VI      D L+ LIDV DTG  +  ++ E P +
Sbjct: 155 TPAYFMQNLINFRMAPRSSPTEDETYVISNCCNQDTLMPLIDVTDTGKWVGAMLAE-PEQ 213

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMFKYEK 181
             GK +       T  +I  + ++V+GK  + + ++DE    + P      L  M++  +
Sbjct: 214 HEGKAIAAGENLYTWAEIAKIFSQVSGKDVRFQHISDEAFRSNLPEGLRDDLLDMYQLFR 273

Query: 182 EFGAIG 187
           ++G  G
Sbjct: 274 DYGYYG 279



>gi|46117599|ref|XP_384810.1| hypothetical protein FG04634.1 [Fusarium graminearum PH-1]
          Length = 881

 Score = 75.5 bits (184), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 47/148 (31%), Positives = 78/148 (52%), Gaps = 6/148 (4%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK +AD  K  G+  L++SSL D+   S G+   + HF GK  +E+YIR++ +P  TF 
Sbjct: 99  QGKAVADACKTAGVKQLVFSSLLDTKKISNGRLAHIKHFEGKAEIEEYIRQINVP-ATFV 157

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVR-DTGPIIAKIIEEGPTK 121
              F++ N+   F  +  NE+G     +P   +  Q+ + DV+ D G  +   I+  P  
Sbjct: 158 LPGFFASNL---FTSIRKNEDGSYAWALPGHGDKTQVPIFDVQGDMGKFVKAAIKNFPGT 214

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGK 149
            N K+V  A++  +  +I    ++V GK
Sbjct: 215 LN-KRVFAATDYYSPNRIISEFSEVMGK 241



>gi|146422135|ref|XP_001487009.1| hypothetical protein PGUG_00386 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 313

 Score = 75.1 bits (183), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 65/216 (30%), Positives = 99/216 (45%), Gaps = 11/216 (5%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK I D A E G  + I+SS PD    S GKY  V+ + GK+ V  YI+   I  + +
Sbjct: 96  KQGKSIVDAAIEAGAKYFIWSSAPDPDKISHGKYKHVSIYGGKSGVMDYIKSQPITGIYY 155

Query: 62  AYLSFYSQNIGTFFL--PLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGP 119
           +  SF  QN  +     PL     G    +   F+ + +L +ID+ DTG  I  I+E  P
Sbjct: 156 SPGSFM-QNYQSQLAPKPLGDGTYG----IFGRFKPDTELPIIDINDTGKFIGAILEN-P 209

Query: 120 TKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNK---SLKQM 176
            K++ + V  A     ++ I   + KV+GKT        E   ++ P         L   
Sbjct: 210 EKFSEQFVASAEGVYKVEDIVARIAKVSGKTITYHQATVEQFKENVPPFLKPFADVLNDF 269

Query: 177 FKYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYI 212
           F+   EFG  G D + Q    +K+ H  + T E++ 
Sbjct: 270 FQLIVEFGYYGPDLKKQVDNWSKQAHGKLTTIEEFF 305



>gi|393239928|gb|EJD47456.1| NAD(P)-binding protein [Auricularia delicata TFB-10046 SS5]
          Length = 312

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 102/211 (48%), Gaps = 14/211 (6%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK + D AK  G+   I+ +LP S         DV HF GK+ +++Y++  G+P  +F 
Sbjct: 101 QGKALVDAAKAAGVQHFIFFTLPHS---------DVPHFEGKHQIDEYLKASGVPRTSF- 150

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
           Y +FY +N+      +   ++G + + IP   E+  +    V  +G  +    +  P+++
Sbjct: 151 YNAFYFENLVGQMGMVKKADDGSVVVEIP-IPEDTYIPSYSVDQSGGWVLAAFKN-PSEY 208

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMFKYEKE 182
            GK +    EN+T K+  DVL K  GK  KV++ + E+         N  + ++F   K 
Sbjct: 209 IGKDIIAVGENITPKKYADVLGKALGKPFKVKSPSREEFYL-MAHAPNPFIVELFLNMKY 267

Query: 183 FGA-IGKDNELQDITIAKKLHPNIKTFEQYI 212
           F         + D   +KK++P    FE+++
Sbjct: 268 FHEHCQPPKTVYDEAASKKVYPGQHNFEEFV 298



>gi|346319914|gb|EGX89515.1| nitrogen metabolic regulation protein [Cordyceps militaris CM01]
          Length = 451

 Score = 74.7 bits (182), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 73/139 (52%), Gaps = 7/139 (5%)

Query: 15  GLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAYLSFYSQNIGTF 74
           G+   IYSS+PD    +   +P +  +  K+ VE Y+R+L +P  TF Y   Y+ N  + 
Sbjct: 174 GVQHYIYSSMPDHAAYNK-NWPSLPLWAAKHKVEDYVRQLDLP-ATFVYTGIYNNNFTSL 231

Query: 75  FLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEGPTKWNGKKVPIA 130
             PL   E   +G      P F E+ +L  +D   D GP I ++ ++G +KW  +++ +A
Sbjct: 232 LYPLFCTEIQDDGSFVWQAP-FHEDAKLPWLDAEHDVGPAILQLFKDGVSKWRNERIALA 290

Query: 131 SENVTIKQITDVLTKVTGK 149
            E +T K+  +V ++  G+
Sbjct: 291 YEYLTPKEACEVFSRGVGR 309



>gi|395734516|ref|XP_003776429.1| PREDICTED: nmrA-like family domain-containing protein 1-like
           isoform 2 [Pongo abelii]
          Length = 255

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 81/147 (55%), Gaps = 5/147 (3%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK++AD AK  GL  ++YS L +    + GK  +V HF  K  VE+Y   +GIP +T  
Sbjct: 93  QGKLVADSAKHLGLKHVVYSGLENVKRLTDGKL-EVPHFDSKGEVEEYFWSIGIP-MTSV 150

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
            ++ Y +N    + P+ +++     L +P    +  +  I V D G  ++ I    P ++
Sbjct: 151 RVAAYFENFLAAWQPVKASDGDYYTLAVPM--GDVPMDGISVADIGAAVSSIFNS-PEEF 207

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGK 149
            GK V +++E +TI+Q  DVL+KV GK
Sbjct: 208 VGKAVGLSAEALTIQQYADVLSKVLGK 234



>gi|449298210|gb|EMC94227.1| hypothetical protein BAUCODRAFT_150423 [Baudoinia compniacensis
           UAMH 10762]
          Length = 379

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/139 (32%), Positives = 72/139 (51%), Gaps = 7/139 (5%)

Query: 15  GLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFAYLSFYSQNIGTF 74
           G++  IYSS+PD +T  G  +  +  ++ K  +E Y+R+LGIP  TF Y   Y+ N  + 
Sbjct: 102 GVSHYIYSSMPDHST-FGRNWKALPMWSSKFAIENYVRQLGIP-ATFVYTGIYNNNFTSL 159

Query: 75  FLPLISNE---NGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEGPTKWNGKKVPIA 130
             PL   E   +G  +   P F  ND L  +D   D GP + +I + GP  W G++V +A
Sbjct: 160 PYPLFQMELQDDGSFEWQAP-FHPNDPLPWLDAEHDVGPALLQIFKMGPNHWKGQRVTLA 218

Query: 131 SENVTIKQITDVLTKVTGK 149
            E +T  +   +  +  G+
Sbjct: 219 FEKLTPLECCALFGRGLGR 237



>gi|116195358|ref|XP_001223491.1| hypothetical protein CHGG_04277 [Chaetomium globosum CBS 148.51]
 gi|88180190|gb|EAQ87658.1| hypothetical protein CHGG_04277 [Chaetomium globosum CBS 148.51]
          Length = 313

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 57/192 (29%), Positives = 97/192 (50%), Gaps = 7/192 (3%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           RQGK  AD A    + +++YS+       SGGK+  V  F  +  VE YIR L + +  +
Sbjct: 99  RQGKAAADAAVAARVEYIVYSTEVHCEVVSGGKH-QVPSFDSRGEVEAYIRSLPVRSAFY 157

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLL-LIDVR-DTGPIIAKIIEEGP 119
           A  SF    +G      + +  G    VI      D++L  IDV  DTGP++  ++ E  
Sbjct: 158 APGSFMPNLLGMMAPRPVGDGEG---FVIANILPGDRVLPWIDVAADTGPVVGAVLAE-L 213

Query: 120 TKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPTLNNKSLKQMFKY 179
            ++ GK++ +ASE  +++++ + ++KVTGKT K   ++++      P    + +  MF++
Sbjct: 214 ERFEGKRLCVASELFSLEEVAEKISKVTGKTVKYLRVSEDVFKSYLPEGAREPVVNMFRF 273

Query: 180 EKEFGAIGKDNE 191
             E G  G   E
Sbjct: 274 IAESGYYGPGTE 285



>gi|258578183|ref|XP_002543273.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237903539|gb|EEP77940.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 302

 Score = 73.9 bits (180), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 56/165 (33%), Positives = 81/165 (49%), Gaps = 6/165 (3%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK +AD AKE  ++ LIYSSL      S G   +V HF  K + E YIR+L IP  TF 
Sbjct: 95  QGKNVADAAKEAHVSHLIYSSLYHIMDASAGALLNVPHFDTKANTEVYIRELRIP-ATFV 153

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPTKW 122
              ++  N   F   L   E+G   L++P   +  Q  L DV DTG  +   I+   +  
Sbjct: 154 LPGYFMSN---FLTSLNKGEDGTYTLMLP-LTDKAQFPLFDVSDTGKYVVTAIKNRDSLL 209

Query: 123 NGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPT 167
            GK++  A +  +  +I +   +VTG   K  T++ +D  K  P 
Sbjct: 210 -GKQILEAVDYYSPGRIVEEFEQVTGHKAKFLTIDADDYVKFLPA 253



>gi|340518202|gb|EGR48444.1| predicted protein [Trichoderma reesei QM6a]
          Length = 313

 Score = 73.9 bits (180), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/159 (28%), Positives = 77/159 (48%), Gaps = 3/159 (1%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK + D +K  G+  +I+SSL D+T  SGG+ P+++HF GK  +E+YIR       TF 
Sbjct: 95  QGKAVVDASKAAGVEHIIFSSLIDATKASGGRLPNISHFDGKARIEEYIRATSGVKGTFV 154

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPY-FEENDQLLLIDVRDTGPIIAKIIEEGPTK 121
               +     T   P   +E     L +P   ++ +  L     D G  +   I+  P +
Sbjct: 155 LPGMFMSGFTTMIRPNPPSEPAGYTLALPVDPDKAEAPLFAAAEDMGKFVKAAIKNFPLQ 214

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGK-THKVRTLNDE 159
             G ++  A++  TI ++     +V GK  H V+  +D+
Sbjct: 215 -TGNRILAATDYYTIHRLISEFAEVMGKPAHAVQIPDDK 252



>gi|475664937|gb|EMT62731.1| NmrA-like family domain-containing protein 1 [Fusarium oxysporum f.
           sp. cubense race 4]
          Length = 305

 Score = 73.9 bits (180), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 77/148 (52%), Gaps = 6/148 (4%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK +AD  K  G+  LI+SSL D+   S G+   + HF GK  +E+YIR++ +P  TF 
Sbjct: 95  QGKAVADACKTAGVKQLIFSSLLDTNKISNGRLTHIKHFEGKAEIEEYIRQINVP-ATFV 153

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVR-DTGPIIAKIIEEGPTK 121
              F++ N+   F  +  NE+G     +P   +  ++ L DV  D G  +   I+  P  
Sbjct: 154 LPGFFASNL---FTSIRKNEDGSYGWALPANGDKAKVPLFDVNADMGKFVKAAIKNFPGT 210

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGK 149
            N K++  A++  +  +I    ++V GK
Sbjct: 211 IN-KRIFAATDYYSPNRIISEFSEVIGK 237



>gi|492547361|ref|WP_005881266.1| NmrA-like family domain-containing protein 1 [Enterococcus durans]
 gi|474481024|gb|EMS74319.1| NmrA-like family domain-containing protein 1 [Enterococcus durans
           IPLA 655]
          Length = 317

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 62/220 (28%), Positives = 114/220 (51%), Gaps = 18/220 (8%)

Query: 4   GKMIADIAKEKGLNWLIYSSLPD-STTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           G  + D A E G+  +++S+L +      G K+    HFT K ++  YIR   I + TF 
Sbjct: 97  GCEMVDAAVEAGVQHIVFSTLANVEKITRGEKW--APHFTDKANIADYIRSQPIAH-TFI 153

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLID-VRDTGPIIAKIIEEGPTK 121
             + +  NI  +++P +   NG+  L+  Y  E+ +   +D +  TGP + +I    P  
Sbjct: 154 MQALFYTNILEYYVPQM---NGDTLLIPIYLPEDFKAPFVDPLTATGPAVLEIFS-NPEI 209

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGKTHKVR-TLNDEDIAKDFPTL--NNKSLKQ--- 175
           ++G+ +PI  E ++ +++ +   +VTG   + R     E +   FP L  N  S+K+   
Sbjct: 210 YSGRTLPIVGEVLSPREMVETFQRVTGIKAEYRNAYTKEGLTSYFPELAINELSVKEILG 269

Query: 176 MFKYEKEFGAIGKDNELQDITIAKKLHPNIKTFEQYILET 215
           M +Y  E+G    D+ L D+  +++L+P+I  +EQ++ ET
Sbjct: 270 MVEYTVEYGYF--DSNL-DLEWSRRLNPSILNWEQFLKET 306



>gi|302901517|ref|XP_003048455.1| hypothetical protein NECHADRAFT_101466 [Nectria haematococca mpVI
           77-13-4]
 gi|256729388|gb|EEU42742.1| hypothetical protein NECHADRAFT_101466 [Nectria haematococca mpVI
           77-13-4]
          Length = 305

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/148 (32%), Positives = 76/148 (51%), Gaps = 6/148 (4%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK++AD  K  G+  LI+SSL D+   SGG+   + HF GK  +E+YIR++ IP  TF 
Sbjct: 95  QGKVVADACKAAGVKHLIFSSLLDTNKISGGRLTHIKHFEGKAEIEEYIRQINIP-ATFV 153

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDV-RDTGPIIAKIIEEGPTK 121
              F+  N+   F  +  NE G     +P   +  Q+ L +   D G  +   I+  P  
Sbjct: 154 LPGFFMSNL---FTMIRKNEEGGYAWSLPVSGDKAQVPLFNAGDDNGKFVKAAIKHFPDT 210

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGK 149
            N K++  A++  T  ++    ++V GK
Sbjct: 211 LN-KRIYAATDYYTPDRMMSEFSEVIGK 237



>gi|512187228|gb|EPE03009.1| hypothetical protein F503_08623 [Ophiostoma piceae UAMH 11346]
          Length = 304

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 61/192 (31%), Positives = 92/192 (47%), Gaps = 6/192 (3%)

Query: 1   ERQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVT 60
            +QGK + D A + G++ +I+S+L + T E+ G+   V HF  K  V +YIR  G+ N T
Sbjct: 93  RQQGKNVTDAANQAGVSHVIFSTLYNVTEETKGRLTHVPHFDSKADVAKYIRASGL-NYT 151

Query: 61  FAYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIEEGPT 120
           F    +Y  N   F   L  N++G   L  P  ++    L     D+G +  K I +   
Sbjct: 152 FVLPGYYMSN---FTRMLAKNDDGSYTLYYPVGDKAKFPLYDAASDSG-LFVKAILKNLD 207

Query: 121 KWNGKKVPIASENVTIKQITDVLTKVTG-KTHKVRTLNDEDIAKDFPTLNNKSLKQMFKY 179
             NGK+V  AS   T  QI +  +K TG K + V+  ND+  A   P L ++ L      
Sbjct: 208 SLNGKEVLAASGYYTPSQIVETFSKATGKKANFVQVTNDQYKASLPPALADEYLDNQLFV 267

Query: 180 EKEFGAIGKDNE 191
           EK    +G+  E
Sbjct: 268 EKPGYYLGQSLE 279



>gi|494823960|gb|EON61279.1| hypothetical protein W97_00492 [Coniosporium apollinis CBS 100218]
          Length = 322

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 49/115 (42%), Positives = 63/115 (54%), Gaps = 6/115 (5%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           +QGK IAD+AKE G+  L++SSL + T  SGGK   V HF  K  VE+YIRK+GIP  TF
Sbjct: 102 QQGKDIADVAKELGVQHLVWSSLLNVTKLSGGKLSKVAHFDSKADVEEYIRKIGIP-ATF 160

Query: 62  AYLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVR-DTGPIIAKII 115
               FY  NI    L   +N  G  +  +P    N  + L D   DTG  +  I+
Sbjct: 161 FLPGFYMANIPGQSL---NNMQGAYNFALP-IPTNSPIPLFDTEADTGKFVKAIL 211



>gi|342888596|gb|EGU87856.1| hypothetical protein FOXB_01650 [Fusarium oxysporum Fo5176]
 gi|477523906|gb|ENH75888.1| NmrA-like family domain-containing protein 1 [Fusarium oxysporum f.
           sp. cubense race 1]
          Length = 305

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 77/148 (52%), Gaps = 6/148 (4%)

Query: 3   QGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTFA 62
           QGK +AD  K  G+  LI+SSL D+   S G+   + HF GK  +E+YIR++ +P  TF 
Sbjct: 95  QGKAVADACKTAGVKQLIFSSLLDTKKISNGRLTHIKHFEGKAEIEEYIRQINVP-ATFV 153

Query: 63  YLSFYSQNIGTFFLPLISNENGEIDLVIPYFEENDQLLLIDVR-DTGPIIAKIIEEGPTK 121
              F++ N+   F  +  NE+G     +P   +  ++ L DV  D G  +   I+  P  
Sbjct: 154 LPGFFASNL---FTSIRKNEDGSYGWALPANGDKAKVPLFDVNADMGKFVKAAIKNFPGT 210

Query: 122 WNGKKVPIASENVTIKQITDVLTKVTGK 149
            N K++  A++  +  +I    ++V GK
Sbjct: 211 IN-KRIFAATDYYSPNRIISEFSEVIGK 237



>gi|494833410|gb|EON69386.1| hypothetical protein W97_08646 [Coniosporium apollinis CBS 100218]
          Length = 310

 Score = 73.2 bits (178), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 54/169 (31%), Positives = 79/169 (46%), Gaps = 8/169 (4%)

Query: 2   RQGKMIADIAKEKGLNWLIYSSLPDSTTESGGKYPDVTHFTGKNHVEQYIRKLGIPNVTF 61
           RQGK +AD AKE G+  LI+SSL + T  + G+   V+HF GK  +E YI++ G+P  TF
Sbjct: 94  RQGKNVADAAKEAGVQHLIFSSLLNVTKTTNGRLTHVSHFDGKAEIEDYIKQSGVP-CTF 152

Query: 62  AYLSFYSQNIGTFFLPLIS-NENGEIDLVIPYFEENDQLLLIDVRDTGPIIAKIIE--EG 118
               +Y  N     L ++S +++G   L  P        L     D G  +A  I+  + 
Sbjct: 153 VLAGYYMSNC----LGVLSEDDDGVYTLTYPVSAYAKFPLFDAGEDMGKFVAAAIKAHDS 208

Query: 119 PTKWNGKKVPIASENVTIKQITDVLTKVTGKTHKVRTLNDEDIAKDFPT 167
            T  NG  V  AS   T  +I +    VTG   +   ++ E      P 
Sbjct: 209 STLPNGAHVLAASAYYTPPEILETFADVTGHATRFVQVSPEQYKSFLPA 257