BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10226_c0_seq1-m.88 5prime_partial 2-871(+) 290 (+)
         (289 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|511009595|gb|EPB90833.1| hypothetical protein HMPREF1544_0225...   329   4e-88   Mucor circinelloides f. circinelloides 1006PhL
gi|384499447|gb|EIE89938.1| hypothetical protein RO3G_14649 [Rhi...   329   4e-88   Rhizopus delemar RA 99-880
gi|384489619|gb|EIE80841.1| hypothetical protein RO3G_05546 [Rhi...   324   2e-86   Rhizopus delemar RA 99-880
gi|328771587|gb|EGF81627.1| hypothetical protein BATDEDRAFT_2986...   317   2e-84   Batrachochytrium dendrobatidis JAM81
gi|470316508|gb|EMR08262.1| hypothetical protein PNEG_03428 [Pne...   306   4e-81   Pneumocystis murina B123
gi|430812171|emb|CCJ30393.1| unnamed protein product [Pneumocyst...   305   7e-81   Pneumocystis jirovecii
gi|241122592|ref|XP_002403593.1| splicing factor 3A subunit, put...   303   2e-80   Ixodes scapularis [blacklegged tick]
gi|432915931|ref|XP_004079236.1| PREDICTED: splicing factor 3A s...   303   3e-80   Oryzias latipes [Japanese rice fish]
gi|328861913|gb|EGG11015.1| hypothetical protein MELLADRAFT_9244...   303   5e-80   Melampsora larici-populina 98AG31
gi|331224308|ref|XP_003324826.1| hypothetical protein PGTG_06363...   303   5e-80   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|498946622|ref|XP_004522401.1| PREDICTED: splicing factor 3A s...   302   8e-80   Ceratitis capitata
gi|195997639|ref|XP_002108688.1| hypothetical protein TRIADDRAFT...   301   1e-79   Trichoplax adhaerens
gi|156383692|ref|XP_001632967.1| predicted protein [Nematostella...   301   2e-79   Nematostella vectensis
gi|443714085|gb|ELU06653.1| hypothetical protein CAPTEDRAFT_1686...   299   5e-79   Capitella teleta
gi|47228339|emb|CAG07734.1| unnamed protein product [Tetraodon n...   299   7e-79   Tetraodon nigroviridis
gi|307170169|gb|EFN62576.1| Splicing factor 3A subunit 2 [Campon...   298   1e-78   Camponotus floridanus
gi|332030557|gb|EGI70245.1| Splicing factor 3A subunit 2 [Acromy...   298   1e-78   Acromyrmex echinatior
gi|383849657|ref|XP_003700461.1| PREDICTED: splicing factor 3A s...   298   1e-78   Megachile rotundata
gi|340722419|ref|XP_003399603.1| PREDICTED: splicing factor 3A s...   298   1e-78   Bombus terrestris [large earth bumblebee]
gi|66526752|ref|XP_624713.1| PREDICTED: splicing factor 3A subun...   298   1e-78   Apis mellifera [European honey bee]
gi|322790906|gb|EFZ15572.1| hypothetical protein SINV_10875 [Sol...   298   1e-78   Solenopsis invicta [imported red fire ant]
gi|156552244|ref|XP_001606508.1| PREDICTED: splicing factor 3A s...   298   1e-78   
gi|260795269|ref|XP_002592628.1| hypothetical protein BRAFLDRAFT...   297   3e-78   Branchiostoma floridae
gi|449304825|gb|EMD00832.1| hypothetical protein BAUCODRAFT_1858...   296   3e-78   Baudoinia panamericana UAMH 10762
gi|195428092|ref|XP_002062108.1| GK16828 [Drosophila willistoni]...   295   7e-78   Drosophila willistoni
gi|307197217|gb|EFN78538.1| Splicing factor 3A subunit 2 [Harpeg...   295   1e-77   Harpegnathos saltator
gi|348500914|ref|XP_003438016.1| PREDICTED: splicing factor 3A s...   294   1e-77   Oreochromis niloticus
gi|339239211|ref|XP_003381160.1| splicing factor 3A subunit 2 [T...   294   1e-77   Trichinella spiralis
gi|194752039|ref|XP_001958330.1| GF10865 [Drosophila ananassae] ...   294   1e-77   Drosophila ananassae
gi|125979941|ref|XP_001354003.1| GA10545 [Drosophila pseudoobscu...   294   1e-77   Drosophila pseudoobscura pseudoobscura
gi|307192848|gb|EFN75902.1| Splicing factor 3A subunit 2 [Harpeg...   294   2e-77   Harpegnathos saltator
gi|344243435|gb|EGV99538.1| Splicing factor 3A subunit 2 [Cricet...   294   2e-77   Cricetulus griseus [Chinese hamsters]
gi|195021731|ref|XP_001985451.1| GH14494 [Drosophila grimshawi] ...   294   2e-77   Drosophila grimshawi
gi|195128531|ref|XP_002008716.1| GI13650 [Drosophila mojavensis]...   294   2e-77   
gi|195379390|ref|XP_002048462.1| GJ13983 [Drosophila virilis] >g...   293   3e-77   Drosophila virilis
gi|52138695|ref|NP_001004397.1| splicing factor 3A subunit 2 [Ga...   293   3e-77   Gallus gallus [bantam]
gi|153792445|ref|NP_001093340.1| uncharacterized protein LOC1001...   293   4e-77   Xenopus laevis [clawed frog]
gi|118344168|ref|NP_001071907.1| zinc finger protein [Ciona inte...   293   4e-77   Ciona intestinalis [sea vase]
gi|147900053|ref|NP_001080140.1| splicing factor 3a, subunit 2, ...   293   4e-77   Xenopus laevis [clawed frog]
gi|58865548|ref|NP_001011986.1| splicing factor 3A subunit 2 [Ra...   293   4e-77   Rattus norvegicus [brown rat]
gi|452989822|gb|EME89577.1| hypothetical protein MYCFIDRAFT_3274...   293   4e-77   Cercospora fijiensis CIRAD86
gi|345786790|ref|XP_855016.2| PREDICTED: splicing factor 3A subu...   293   4e-77   
gi|291222755|ref|XP_002731380.1| PREDICTED: splicing factor 3a, ...   293   4e-77   Saccoglossus kowalevskii
gi|354480886|ref|XP_003502634.1| PREDICTED: splicing factor 3A s...   293   4e-77   
gi|471381522|ref|XP_004378553.1| PREDICTED: uncharacterized prot...   293   5e-77   Trichechus manatus latirostris
gi|378729422|gb|EHY55881.1| hypothetical protein HMPREF1120_0399...   293   5e-77   Exophiala dermatitidis NIH/UT8656
gi|354480888|ref|XP_003502635.1| PREDICTED: splicing factor 3A s...   293   5e-77   
gi|116283242|gb|AAH15804.1| SF3A2 protein [Homo sapiens]              292   6e-77   Homo sapiens [man]
gi|158749553|ref|NP_038679.3| splicing factor 3A subunit 2 [Mus ...   292   6e-77   Mus musculus [mouse]
gi|21361376|ref|NP_009096.2| splicing factor 3A subunit 2 [Homo ...   292   6e-77   Homo sapiens [man]
gi|194870079|ref|XP_001972582.1| GG13802 [Drosophila erecta] >gi...   292   6e-77   Drosophila erecta
gi|354480884|ref|XP_003502633.1| PREDICTED: splicing factor 3A s...   292   6e-77   
gi|24663500|ref|NP_648603.1| CG10754 [Drosophila melanogaster] >...   292   7e-77   Drosophila melanogaster
gi|478534534|ref|XP_004441399.1| PREDICTED: splicing factor 3A s...   292   7e-77   Ceratotherium simum simum [southern square-lipped rhinoceros]
gi|512863414|ref|XP_004890399.1| PREDICTED: splicing factor 3A s...   292   7e-77   
gi|403291739|ref|XP_003936925.1| PREDICTED: splicing factor 3A s...   292   7e-77   Saimiri boliviensis boliviensis
gi|52345468|ref|NP_001004782.1| splicing factor 3a, subunit 2, 6...   292   7e-77   Xenopus tropicalis [western clawed frog]
gi|513009034|ref|XP_004865942.1| PREDICTED: splicing factor 3A s...   292   8e-77   Heterocephalus glaber [naked mole rat]
gi|472351526|ref|XP_004395446.1| PREDICTED: splicing factor 3A s...   292   9e-77   Odobenus rosmarus divergens
gi|297703020|ref|XP_002828453.1| PREDICTED: splicing factor 3A s...   292   9e-77   Pongo abelii [Orang-utan]
gi|348550143|ref|XP_003460892.1| PREDICTED: splicing factor 3A s...   291   9e-77   Cavia porcellus [guinea pig]
gi|395831337|ref|XP_003788759.1| PREDICTED: splicing factor 3A s...   291   1e-76   Otolemur garnettii
gi|301781072|ref|XP_002925957.1| PREDICTED: hypothetical protein...   291   1e-76   Ailuropoda melanoleuca
gi|149643081|ref|NP_001092681.1| splicing factor 3A subunit 2 [B...   291   1e-76   Bos taurus [bovine]
gi|507541948|ref|XP_004654970.1| PREDICTED: splicing factor 3A s...   291   1e-76   Jaculus jaculus
gi|296485635|tpg|DAA27750.1| TPA: splicing factor 3A subunit 2 [...   291   1e-76   Bos taurus [bovine]
gi|466088572|ref|XP_004286406.1| PREDICTED: splicing factor 3A s...   291   1e-76   Orcinus orca [Orca]
gi|470605958|ref|XP_004314032.1| PREDICTED: splicing factor 3A s...   291   1e-76   Tursiops truncatus [Atlantic bottle-nosed dolphin]
gi|511983275|ref|XP_004809450.1| PREDICTED: splicing factor 3A s...   291   1e-76   
gi|511917570|ref|XP_004778057.1| PREDICTED: splicing factor 3A s...   291   1e-76   Mustela putorius furo [black ferret]
gi|507696980|ref|XP_004714348.1| PREDICTED: splicing factor 3A s...   291   1e-76   Echinops telfairi [lesser hedgehog tenrec]
gi|498943601|ref|XP_004542563.1| PREDICTED: splicing factor 3A s...   291   1e-76   Maylandia zebra
gi|505843016|ref|XP_004615008.1| PREDICTED: splicing factor 3A s...   291   2e-76   
gi|507651009|ref|XP_004632756.1| PREDICTED: splicing factor 3A s...   291   2e-76   Octodon degus
gi|221121042|ref|XP_002156054.1| PREDICTED: uncharacterized prot...   291   2e-76   Hydra vulgaris
gi|504172826|ref|XP_004595988.1| PREDICTED: splicing factor 3A s...   291   2e-76   Ochotona princeps [southern American pika]
gi|397496945|ref|XP_003819281.1| PREDICTED: splicing factor 3A s...   291   2e-76   
gi|126323518|ref|XP_001364347.1| PREDICTED: splicing factor 3A s...   291   2e-76   
gi|390478347|ref|XP_003735484.1| PREDICTED: splicing factor 3A s...   291   2e-76   
gi|351703665|gb|EHB06584.1| Splicing factor 3A subunit 2 [Hetero...   291   2e-76   Heterocephalus glaber [naked mole rat]
gi|431922245|gb|ELK19336.1| Splicing factor 3A subunit 2 [Pterop...   291   2e-76   Pteropus alecto
gi|30931324|gb|AAH52697.1| Sf3a2 protein [Mus musculus]               290   2e-76   Mus musculus [mouse]
gi|426229203|ref|XP_004023503.1| PREDICTED: LOW QUALITY PROTEIN:...   290   3e-76   Ovis aries [domestic sheep]
gi|149034494|gb|EDL89231.1| rCG29232, isoform CRA_a [Rattus norv...   290   3e-76   Rattus norvegicus [brown rat]
gi|355702948|gb|EHH29439.1| Spliceosome-associated protein 62 [M...   290   3e-76   Macaca mulatta [rhesus macaque]
gi|156062160|ref|XP_001597002.1| hypothetical protein SS1G_01195...   290   3e-76   Sclerotinia sclerotiorum 1980 UF-70
gi|409219|gb|AAA60301.1| spiceosomal protein [Homo sapiens]           290   3e-76   Homo sapiens [man]
gi|397496947|ref|XP_003819282.1| PREDICTED: splicing factor 3A s...   290   3e-76   
gi|507967666|ref|XP_004689436.1| PREDICTED: splicing factor 3A s...   290   4e-76   
gi|212542377|ref|XP_002151343.1| splicing factor 3a subunit 2, p...   289   5e-76   Talaromyces marneffei ATCC 18224
gi|242768747|ref|XP_002341631.1| splicing factor 3a subunit 2, p...   289   5e-76   Talaromyces stipitatus ATCC 10500
gi|41054840|ref|NP_957337.1| splicing factor 3A subunit 2 [Danio...   289   7e-76   Danio rerio [leopard danio]
gi|91080581|ref|XP_973561.1| PREDICTED: similar to AGAP011035-PA...   288   8e-76   Tribolium castaneum [rust-red flour beetle]
gi|452848355|gb|EME50287.1| hypothetical protein DOTSEDRAFT_7733...   288   8e-76   Dothistroma septosporum NZE10
gi|494830929|gb|EON67440.1| hypothetical protein W97_06694 [Coni...   288   9e-76   Coniosporium apollinis CBS 100218
gi|259155264|ref|NP_001158873.1| splicing factor 3A subunit 2 [S...   288   1e-75   Salmo salar
gi|395513272|ref|XP_003760851.1| PREDICTED: splicing factor 3A s...   288   1e-75   Sarcophilus harrisii
gi|321465384|gb|EFX76386.1| putative splicing factor 3A subunit ...   288   2e-75   Daphnia pulex
gi|410950027|ref|XP_003981715.1| PREDICTED: splicing factor 3A s...   287   2e-75   
gi|340371467|ref|XP_003384267.1| PREDICTED: splicing factor 3A s...   287   3e-75   Amphimedon queenslandica
gi|332375997|gb|AEE63139.1| unknown [Dendroctonus ponderosae]         286   3e-75   Dendroctonus ponderosae
gi|119500174|ref|XP_001266844.1| splicing factor 3a subunit 2, p...   286   3e-75   Aspergillus fischeri NRRL 181
gi|303311265|ref|XP_003065644.1| Splicing factor 3A subunit 2 , ...   286   3e-75   Coccidioides posadasii C735 delta SOWgp
gi|154318157|ref|XP_001558397.1| conserved hypothetical protein ...   286   4e-75   Botrytis cinerea B05.10
gi|115391101|ref|XP_001213055.1| hypothetical protein ATEG_03877...   286   6e-75   Aspergillus terreus NIH2624
gi|70993590|ref|XP_751642.1| splicing factor 3a subunit 2 [Asper...   286   6e-75   Aspergillus fumigatus Af293
gi|410924461|ref|XP_003975700.1| PREDICTED: splicing factor 3A s...   286   6e-75   Takifugu rubripes [tiger puffer]
gi|391346408|ref|XP_003747466.1| PREDICTED: splicing factor 3A s...   285   7e-75   Metaseiulus occidentalis
gi|296420560|ref|XP_002839837.1| hypothetical protein [Tuber mel...   285   8e-75   Tuber melanosporum Mel28
gi|295669464|ref|XP_002795280.1| splicing factor 3a [Paracoccidi...   285   1e-74   Paracoccidioides lutzii Pb01
gi|170586560|ref|XP_001898047.1| sf3a2-prov protein [Brugia mala...   285   1e-74   Brugia malayi [agent of lymphatic filariasis]
gi|312083676|ref|XP_003143962.1| hypothetical protein LOAG_08382...   284   2e-74   Loa loa
gi|67538720|ref|XP_663134.1| hypothetical protein AN5530.2 [Aspe...   284   2e-74   Aspergillus nidulans FGSC A4
gi|242022601|ref|XP_002431728.1| Splicing factor 3A subunit, put...   284   2e-74   Pediculus humanus corporis [human body lice]
gi|512196423|gb|EPE25260.1| hypothetical protein GLAREA_11841 [G...   284   2e-74   Glarea lozoyensis ATCC 20868
gi|225682714|gb|EEH20998.1| splicing factor 3a [Paracoccidioides...   284   2e-74   Paracoccidioides brasiliensis Pb03
gi|226290149|gb|EEH45633.1| splicing factor 3a subunit 2 [Paraco...   284   2e-74   Paracoccidioides brasiliensis Pb18
gi|170033891|ref|XP_001844809.1| splicing factor 3A subunit 2 [C...   284   2e-74   Culex quinquefasciatus
gi|406860079|gb|EKD13139.1| splicing factor 3a [Marssonina brunn...   284   2e-74   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|483494043|gb|EOA93398.1| Splicing factor 3A subunit 2, partia...   283   3e-74   Anas platyrhynchos [duck]
gi|313224972|emb|CBY20764.1| unnamed protein product [Oikopleura...   283   3e-74   Oikopleura dioica
gi|119194461|ref|XP_001247834.1| conserved hypothetical protein ...   283   3e-74   Coccidioides immitis RS
gi|121708157|ref|XP_001272046.1| splicing factor 3a subunit 2, p...   283   4e-74   Aspergillus clavatus NRRL 1
gi|449491768|ref|XP_002191731.2| PREDICTED: splicing factor 3A s...   283   4e-74   
gi|326431245|gb|EGD76815.1| splicing factor 3a [Salpingoeca sp. ...   283   4e-74   Salpingoeca rosetta
gi|449281964|gb|EMC88905.1| Splicing factor 3A subunit 2 [Columb...   283   5e-74   Columba livia [carrier pigeon]
gi|225559794|gb|EEH08076.1| splicing factor 3a [Ajellomyces caps...   283   5e-74   Histoplasma capsulatum G186AR
gi|268536640|ref|XP_002633455.1| Hypothetical protein CBG06223 [...   282   6e-74   Caenorhabditis briggsae
gi|17539744|ref|NP_502290.1| Protein REPO-1 [Caenorhabditis eleg...   282   6e-74   Caenorhabditis elegans [roundworm]
gi|453089634|gb|EMF17674.1| splicing factor 3a subunit 2 [Mycosp...   282   6e-74   Sphaerulina musiva SO2202
gi|325089809|gb|EGC43119.1| splicing factor 3A [Ajellomyces caps...   282   6e-74   Histoplasma capsulatum H88
gi|261191813|ref|XP_002622314.1| splicing factor 3a subunit 2 [A...   282   7e-74   Blastomyces gilchristii SLH14081
gi|358367002|dbj|GAA83622.1| splicing factor 3a subunit 2 [Asper...   282   7e-74   Aspergillus kawachii IFO 4308
gi|341884181|gb|EGT40116.1| hypothetical protein CAEBREN_22766 [...   282   7e-74   Caenorhabditis brenneri
gi|145229665|ref|XP_001389141.1| CWF complex protein sap62 [Aspe...   282   7e-74   Aspergillus niger CBS 513.88
gi|308477121|ref|XP_003100775.1| CRE-REPO-1 protein [Caenorhabdi...   282   8e-74   Caenorhabditis remanei
gi|169771331|ref|XP_001820135.1| CWF complex protein sap62 [Aspe...   282   9e-74   Aspergillus oryzae RIB40
gi|258567778|ref|XP_002584633.1| hypothetical protein UREG_05322...   281   9e-74   Uncinocarpus reesii 1704
gi|465954153|gb|EMP25739.1| Splicing factor 3A subunit 2 [Chelon...   281   1e-73   Chelonia mydas [green seaturtle]
gi|440637893|gb|ELR07812.1| splicing factor 3A subunit 2 [Geomyc...   281   1e-73   Pseudogymnoascus destructans 20631-21
gi|296808003|ref|XP_002844340.1| splicing factor 3a [Arthroderma...   281   2e-73   Arthroderma otae CBS 113480
gi|118777492|ref|XP_308101.3| AGAP011035-PA [Anopheles gambiae s...   280   2e-73   Anopheles gambiae str. PEST
gi|312374536|gb|EFR22075.1| hypothetical protein AND_15803 [Anop...   280   3e-73   
gi|226466746|emb|CAX69508.1| Splicing factor 3A subunit 2 [Schis...   280   3e-73   Schistosoma japonicum
gi|488590205|ref|XP_004480381.1| PREDICTED: muellerian-inhibitin...   280   4e-73   Dasypus novemcinctus
gi|511917568|ref|XP_004778056.1| PREDICTED: splicing factor 3A s...   279   5e-73   
gi|358338309|dbj|GAA56639.1| splicing factor 3A subunit 2, parti...   279   6e-73   Clonorchis sinensis [oriental liver fluke]
gi|511983273|ref|XP_004809449.1| PREDICTED: splicing factor 3A s...   279   7e-73   
gi|302502455|ref|XP_003013218.1| hypothetical protein ARB_00402 ...   279   8e-73   Arthroderma benhamiae CBS 112371
gi|149476781|ref|XP_001519977.1| PREDICTED: splicing factor 3A s...   278   8e-73   
gi|315042764|ref|XP_003170758.1| splicing factor 3A subunit 2 [A...   278   9e-73   Microsporum gypseum CBS 118893
gi|326475694|gb|EGD99703.1| splicing factor 3a subunit 2 [Tricho...   278   1e-72   Trichophyton tonsurans CBS 112818
gi|392597568|gb|EIW86890.1| hypothetical protein CONPUDRAFT_8682...   278   1e-72   Coniophora puteana RWD-64-598 SS2
gi|157132537|ref|XP_001656059.1| U2 small nuclear ribonucleoprot...   278   1e-72   Aedes aegypti
gi|310797039|gb|EFQ32500.1| splicing factor 3A subunit 2 [Glomer...   278   1e-72   Colletotrichum graminicola M1.001
gi|193688052|ref|XP_001950533.1| PREDICTED: splicing factor 3A s...   278   2e-72   
gi|322697982|gb|EFY89756.1| splicing factor 3a subunit 2, putati...   276   5e-72   Metarhizium acridum CQMa 102
gi|380488401|emb|CCF37399.1| splicing factor 3A subunit 2 [Colle...   276   6e-72   Colletotrichum higginsianum
gi|396462678|ref|XP_003835950.1| similar to splicing factor 3a s...   276   6e-72   Leptosphaeria maculans JN3
gi|393218209|gb|EJD03697.1| hypothetical protein FOMMEDRAFT_2760...   275   9e-72   Fomitiporia mediterranea MF3/22
gi|242219322|ref|XP_002475442.1| predicted protein [Postia place...   275   1e-71   Postia placenta Mad-698-R
gi|485921375|gb|EOD47115.1| putative splicing factor 3a subunit ...   275   1e-71   Neofusicoccum parvum UCRNP2
gi|115764755|ref|XP_781674.2| PREDICTED: splicing factor 3A subu...   275   1e-71   
gi|392571062|gb|EIW64234.1| hypothetical protein TRAVEDRAFT_1582...   274   3e-71   Trametes versicolor FP-101664 SS1
gi|345570463|gb|EGX53284.1| hypothetical protein AOL_s00006g150 ...   273   3e-71   Arthrobotrys oligospora ATCC 24927
gi|256085302|ref|XP_002578861.1| hypothetical protein [Schistoso...   273   4e-71   
gi|255947536|ref|XP_002564535.1| Pc22g04980 [Penicillium chrysog...   273   4e-71   Penicillium rubens Wisconsin 54-1255
gi|19924252|sp|Q62203.2|SF3A2_MOUSE RecName: Full=Splicing facto...   272   6e-71   Mus musculus [mouse]
gi|477532654|gb|ENH84265.1| splicing factor 3a subunit [Colletot...   272   9e-71   Colletotrichum orbiculare MAFF 240422
gi|358057293|dbj|GAA96642.1| hypothetical protein E5Q_03313 [Mix...   271   1e-70   Mixia osmundae IAM 14324
gi|148699549|gb|EDL31496.1| splicing factor 3a, subunit 2, isofo...   271   1e-70   Mus musculus [mouse]
gi|340517371|gb|EGR47615.1| predicted protein [Trichoderma reese...   271   1e-70   Trichoderma reesei QM6a
gi|425768865|gb|EKV07376.1| Splicing factor 3a subunit 2, putati...   271   1e-70   Penicillium digitatum PHI26
gi|170084265|ref|XP_001873356.1| predicted protein [Laccaria bic...   271   2e-70   Laccaria bicolor S238N-H82
gi|500253876|gb|EON97523.1| putative splicing factor 3a subunit ...   271   2e-70   Phaeoacremonium minimum UCRPA7
gi|400598792|gb|EJP66499.1| splicing factor 3A subunit 2 [Beauve...   271   2e-70   Beauveria bassiana ARSEF 2860
gi|472584746|gb|EMS22332.1| splicing factor 3A subunit 2 [Rhodos...   271   2e-70   Rhodotorula toruloides NP11
gi|451848442|gb|EMD61748.1| hypothetical protein COCSADRAFT_1237...   270   3e-70   Bipolaris sorokiniana ND90Pr
gi|346978617|gb|EGY22069.1| splicing factor 3A subunit 2 [Vertic...   270   3e-70   Verticillium dahliae VdLs.17
gi|301114113|ref|XP_002998826.1| splicing factor 3A subunit, put...   270   3e-70   Phytophthora infestans T30-4
gi|511917566|ref|XP_004778055.1| PREDICTED: splicing factor 3A s...   270   4e-70   
gi|409083835|gb|EKM84192.1| hypothetical protein AGABI1DRAFT_110...   270   4e-70   Agaricus bisporus var. burnettii JB137-S8
gi|471571536|gb|EMR70288.1| putative splicing factor 3a subunit ...   270   4e-70   Eutypa lata UCREL1
gi|342320986|gb|EGU12924.1| Splicing factor 3a [Rhodotorula glut...   270   4e-70   Rhodotorula toruloides ATCC 204091
gi|302412174|ref|XP_003003920.1| splicing factor 3A subunit 2 [V...   270   4e-70   Verticillium alfalfae VaMs.102
gi|511983271|ref|XP_004809448.1| PREDICTED: splicing factor 3A s...   270   5e-70   
gi|358395891|gb|EHK45278.1| hypothetical protein TRIATDRAFT_2436...   270   5e-70   Trichoderma atroviride IMI 206040
gi|399163730|emb|CCE35251.1| related to splicing factor 3A subun...   269   5e-70   Claviceps purpurea 20.1
gi|409051812|gb|EKM61288.1| hypothetical protein PHACADRAFT_2449...   269   5e-70   Phanerochaete carnosa HHB-10118-sp
gi|367022022|ref|XP_003660296.1| hypothetical protein MYCTH_2298...   269   6e-70   Myceliophthora thermophila ATCC 42464
gi|482804799|gb|EOA81898.1| hypothetical protein SETTUDRAFT_1654...   269   7e-70   Setosphaeria turcica Et28A
gi|358388846|gb|EHK26439.1| hypothetical protein TRIVIDRAFT_1887...   269   7e-70   Trichoderma virens Gv29-8
gi|169844733|ref|XP_001829087.1| splicing factor 3a [Coprinopsis...   268   9e-70   Coprinopsis cinerea okayama7#130
gi|85068275|ref|XP_962153.1| hypothetical protein NCU07299 [Neur...   268   9e-70   
gi|451998906|gb|EMD91369.1| hypothetical protein COCHEDRAFT_1203...   268   1e-69   Bipolaris maydis C5
gi|346321002|gb|EGX90602.1| splicing factor 3a subunit 2 [Cordyc...   268   1e-69   Cordyceps militaris CM01
gi|390604644|gb|EIN14035.1| hypothetical protein PUNSTDRAFT_9554...   268   1e-69   Punctularia strigosozonata HHB-11173 SS5
gi|299473576|emb|CBN77971.1| conserved unknown protein [Ectocarp...   268   1e-69   Ectocarpus siliculosus
gi|395334533|gb|EJF66909.1| hypothetical protein DICSQDRAFT_9578...   267   2e-69   Dichomitus squalens LYAD-421 SS1
gi|189188870|ref|XP_001930774.1| splicing factor 3a subunit 2 [P...   267   2e-69   Pyrenophora tritici-repentis Pt-1C-BFP
gi|367045150|ref|XP_003652955.1| hypothetical protein THITE_2114...   266   3e-69   Thielavia terrestris NRRL 8126
gi|470296429|ref|XP_004345333.1| splicing factor 3a subunit 2 [C...   266   4e-69   Capsaspora owczarzaki ATCC 30864
gi|330928328|ref|XP_003302223.1| hypothetical protein PTT_13951 ...   266   4e-69   Pyrenophora teres f. teres 0-1
gi|336376098|gb|EGO04433.1| hypothetical protein SERLA73DRAFT_12...   266   5e-69   Serpula lacrymans var. lacrymans S7.3
gi|389751236|gb|EIM92309.1| splicing factor 3a [Stereum hirsutum...   265   9e-69   Stereum hirsutum FP-91666 SS1
gi|116195670|ref|XP_001223647.1| conserved hypothetical protein ...   265   9e-69   Chaetomium globosum CBS 148.51
gi|347975971|ref|XP_003437315.1| unnamed protein product [Podosp...   265   9e-69   Podospora anserina S mat+
gi|323451351|gb|EGB07228.1| hypothetical protein AURANDRAFT_2809...   265   1e-68   Aureococcus anophagefferens
gi|340960451|gb|EGS21632.1| splicing factor 3a subunit 2-like pr...   265   1e-68   Chaetomium thermophilum var. thermophilum DSM 1495
gi|403417508|emb|CCM04208.1| predicted protein [Fibroporia radic...   265   1e-68   Fibroporia radiculosa
gi|46108610|ref|XP_381363.1| hypothetical protein FG01187.1 [Fus...   265   2e-68   
gi|302925732|ref|XP_003054153.1| predicted protein [Nectria haem...   265   2e-68   Nectria haematococca mpVI 77-13-4
gi|302695565|ref|XP_003037461.1| hypothetical protein SCHCODRAFT...   264   2e-68   Schizophyllum commune H4-8
gi|471881829|emb|CCO34413.1| Splicing factor 3A subunit 2 [Rhizo...   263   3e-68   Rhizoctonia solani AG-1 IB
gi|342876172|gb|EGU77830.1| hypothetical protein FOXB_11694 [Fus...   263   3e-68   Fusarium oxysporum Fo5176
gi|449550991|gb|EMD41955.1| hypothetical protein CERSUDRAFT_1292...   263   4e-68   Gelatoporia subvermispora B
gi|426201106|gb|EKV51029.1| hypothetical protein AGABI2DRAFT_140...   263   5e-68   Agaricus bisporus var. bisporus H97
gi|389625135|ref|XP_003710221.1| splicing factor 3a subunit 2 [M...   262   7e-68   Magnaporthe oryzae 70-15
gi|357627577|gb|EHJ77230.1| hypothetical protein KGM_02786 [Dana...   262   8e-68   Danaus plexippus [American monarch]
gi|58266582|ref|XP_570447.1| hypothetical protein [Cryptococcus ...   261   2e-67   Cryptococcus neoformans var. neoformans JEC21
gi|501753326|emb|CCG82952.1| CWF complex protein sap62 [Taphrina...   261   2e-67   Taphrina deformans PYCC 5710
gi|405120272|gb|AFR95043.1| zinc finger protein Sap62 [Cryptococ...   259   4e-67   
gi|320589222|gb|EFX01684.1| splicing factor 3a subunit [Grosmann...   258   9e-67   Grosmannia clavigera kw1407
gi|19113377|ref|NP_596585.1| zinc finger protein Sap62 [Schizosa...   257   3e-66   Schizosaccharomyces pombe 972h-
gi|393244264|gb|EJD51776.1| hypothetical protein AURDEDRAFT_1113...   255   8e-66   Auricularia subglabra TFB-10046 SS5
gi|237834251|ref|XP_002366423.1| splicing factor 3A subunit 2, p...   254   2e-65   Toxoplasma gondii ME49
gi|512193333|gb|EPE09090.1| splicing factor 3a subunit 2 [Ophios...   253   3e-65   Ophiostoma piceae UAMH 11346
gi|321257417|ref|XP_003193581.1| hypothetical protein CGB_D4720C...   253   4e-65   Cryptococcus gattii WM276
gi|507113284|emb|CDF36919.1| unnamed protein product [Chondrus c...   253   4e-65   Chondrus crispus [Irish moss]
gi|485613258|gb|EOD11345.1| hypothetical protein EMIHUDRAFT_3578...   253   6e-65   Emiliania huxleyi CCMP1516
gi|357017581|gb|AET50819.1| hypothetical protein [Eimeria tenella]    251   1e-64   Eimeria tenella
gi|405974254|gb|EKC38913.1| Splicing factor 3A subunit 2 [Crasso...   251   2e-64   Crassostrea gigas
gi|428173492|gb|EKX42394.1| hypothetical protein GUITHDRAFT_1598...   251   2e-64   Guillardia theta CCMP2712
gi|452821654|gb|EME28682.1| splicing factor 3A subunit 2 [Galdie...   251   2e-64   Galdieria sulphuraria
gi|397575383|gb|EJK49665.1| hypothetical protein THAOC_31429 [Th...   251   2e-64   Thalassiosira oceanica
gi|325184636|emb|CCA19128.1| splicing factor 3A subunit putative...   249   4e-64   Albugo laibachii Nc14
gi|392580549|gb|EIW73676.1| hypothetical protein TREMEDRAFT_5984...   249   5e-64   Tremella mesenterica DSM 1558
gi|402080310|gb|EJT75455.1| splicing factor 3a subunit 2 [Gaeuma...   249   6e-64   Gaeumannomyces graminis var. tritici R3-111a-1
gi|291510296|gb|ADE10104.1| PRP11 [Tremella fuciformis]               249   6e-64   Tremella fuciformis
gi|302803829|ref|XP_002983667.1| hypothetical protein SELMODRAFT...   249   9e-64   Selaginella moellendorffii
gi|353236539|emb|CCA68531.1| related to PRP11-pre-mRNA splicing ...   248   1e-63   Serendipita indica DSM 11827
gi|343427374|emb|CBQ70901.1| related to PRP11-pre-mRNA splicing ...   246   6e-63   Sporisorium reilianum SRZ2
gi|350580739|ref|XP_003123077.3| PREDICTED: splicing factor 3A s...   245   8e-63   
gi|356550634|ref|XP_003543690.1| PREDICTED: splicing factor 3A s...   245   9e-63   Glycine max [soybeans]
gi|149034495|gb|EDL89232.1| rCG29232, isoform CRA_b [Rattus norv...   245   1e-62   Rattus norvegicus [brown rat]
gi|255556836|ref|XP_002519451.1| Splicing factor 3A subunit, put...   244   1e-62   Ricinus communis
gi|224140247|ref|XP_002323495.1| predicted protein [Populus tric...   244   2e-62   
gi|482563477|gb|EOA27667.1| hypothetical protein CARUB_v10023821...   244   2e-62   Capsella rubella
gi|403368451|gb|EJY84061.1| Splicing factor 3A subunit 2, putati...   244   2e-62   Oxytricha trifallax
gi|478262956|gb|ENN81367.1| hypothetical protein YQE_02233, part...   244   3e-62   Dendroctonus ponderosae
gi|148699551|gb|EDL31498.1| splicing factor 3a, subunit 2, isofo...   244   3e-62   Mus musculus [mouse]
gi|18403023|ref|NP_565747.1| splicing factor 3A subunit 2-like p...   244   3e-62   Arabidopsis thaliana [mouse-ear cress]
gi|388854732|emb|CCF51625.1| related to PRP11-pre-mRNA splicing ...   243   4e-62   Ustilago hordei
gi|502155744|ref|XP_004510177.1| PREDICTED: splicing factor 3A s...   243   4e-62   Cicer arietinum [garbanzo]
gi|297826701|ref|XP_002881233.1| hydroxyproline-rich glycoprotei...   243   6e-62   Arabidopsis lyrata subsp. lyrata
gi|356554761|ref|XP_003545711.1| PREDICTED: splicing factor 3A s...   242   7e-62   Glycine max [soybeans]
gi|262192723|gb|ACY30431.1| hypothetical protein [Nicotiana taba...   242   7e-62   Nicotiana tabacum [American tobacco]
gi|460402204|ref|XP_004246604.1| PREDICTED: splicing factor 3A s...   242   1e-61   Solanum lycopersicum
gi|470137465|ref|XP_004304484.1| PREDICTED: splicing factor 3A s...   241   2e-61   Fragaria vesca subsp. vesca
gi|449440151|ref|XP_004137848.1| PREDICTED: splicing factor 3A s...   240   3e-61   Cucumis sativus [cucumbers]
gi|449501030|ref|XP_004161259.1| PREDICTED: splicing factor 3A s...   240   3e-61   
gi|508716079|gb|EOY07976.1| Hydroxyproline-rich glycoprotein fam...   240   3e-61   Theobroma cacao [chocolate]
gi|443894948|dbj|GAC72294.1| splicing factor 3a, subunit 2 [Pseu...   239   5e-61   Moesziomyces antarcticus T-34
gi|66799995|ref|XP_628923.1| U1-type zinc finger-containing prot...   239   7e-61   Dictyostelium discoideum AX4
gi|225441145|ref|XP_002266748.1| PREDICTED: splicing factor 3A s...   239   8e-61   Vitis vinifera
gi|297739988|emb|CBI30170.3| unnamed protein product [Vitis vini...   238   1e-60   Vitis vinifera
gi|465795081|emb|CCU99723.1| unnamed protein product [Malassezia...   238   1e-60   Malassezia sympodialis ATCC 42132
gi|302845975|ref|XP_002954525.1| splicing factor 3a, subunit 2 [...   238   2e-60   Volvox carteri f. nagariensis
gi|297592073|gb|ADI46858.1| SPL2f [Volvox carteri f. nagariensis]     238   2e-60   Volvox carteri f. nagariensis
gi|470248386|ref|XP_004357736.1| U1-type zinc finger-containing ...   238   2e-60   Dictyostelium fasciculatum
gi|412985564|emb|CCO19010.1| splicing factor 3A subunit 2 [Bathy...   238   2e-60   Bathycoccus prasinos
gi|470384871|ref|XP_004334092.1| splicing factor 3a subunit 2, p...   237   2e-60   Acanthamoeba castellanii str. Neff
gi|330803005|ref|XP_003289501.1| U1-type Zn finger-containing pr...   237   3e-60   Dictyostelium purpureum
gi|118370424|ref|XP_001018413.1| spliceosome associated protein ...   237   3e-60   Tetrahymena thermophila SB210
gi|501310103|dbj|GAC98906.1| potential splicing factor subunit [...   236   5e-60   Pseudozyma hubeiensis SY62
gi|462397841|gb|EMJ03509.1| hypothetical protein PRUPE_ppa008045...   236   7e-60   Prunus persica
gi|224002683|ref|XP_002291013.1| predicted protein [Thalassiosir...   235   8e-60   Thalassiosira pseudonana CCMP1335
gi|116788201|gb|ABK24792.1| unknown [Picea sitchensis]                235   1e-59   Picea sitchensis
gi|462408816|gb|EMJ14150.1| hypothetical protein PRUPE_ppa022118...   235   1e-59   Prunus persica
gi|116787560|gb|ABK24557.1| unknown [Picea sitchensis]                235   1e-59   
gi|510901151|ref|XP_004829270.1| splicing factor 3A subunit 2, p...   235   1e-59   
gi|297592155|gb|ADI46939.1| SPL2m [Volvox carteri f. nagariensis]     234   2e-59   
gi|168010033|ref|XP_001757709.1| predicted protein [Physcomitrel...   233   5e-59   
gi|398411174|ref|XP_003856930.1| hypothetical protein MYCGRDRAFT...   233   5e-59   
gi|50551617|ref|XP_503283.1| YALI0D25652p [Yarrowia lipolytica] ...   233   5e-59   
gi|294846037|gb|ADF43195.1| SPL2m [Chlamydomonas reinhardtii]         233   6e-59   
gi|159476604|ref|XP_001696401.1| splicing factor 3a, subunit 2 [...   233   6e-59   
gi|46850171|gb|AAT02517.1| splicing factor [Chlamydomonas reinha...   233   6e-59   
gi|308811642|ref|XP_003083129.1| splicing factor (ISS) [Ostreoco...   231   1e-58   
gi|145489817|ref|XP_001430910.1| hypothetical protein [Parameciu...   231   1e-58   
gi|145542305|ref|XP_001456840.1| hypothetical protein [Parameciu...   231   1e-58   
gi|294892393|ref|XP_002774041.1| splicing factor 3A subunit 2, p...   231   2e-58   
gi|219123865|ref|XP_002182237.1| predicted protein [Phaeodactylu...   231   2e-58   
gi|388579151|gb|EIM19479.1| hypothetical protein WALSEDRAFT_5279...   231   2e-58   
gi|429850997|gb|ELA26221.1| splicing factor 3a subunit [Colletot...   230   4e-58   
gi|168060146|ref|XP_001782059.1| predicted protein [Physcomitrel...   229   6e-58   
gi|281201312|gb|EFA75524.1| U1-type zinc finger-containing prote...   229   7e-58   
gi|357113011|ref|XP_003558298.1| PREDICTED: splicing factor 3A s...   229   9e-58   
gi|242036231|ref|XP_002465510.1| hypothetical protein SORBIDRAFT...   228   1e-57   
gi|226494582|ref|NP_001140524.1| Splicing factor 3A subunit 2 [Z...   228   2e-57   
gi|475539071|gb|EMT09345.1| Splicing factor 3A subunit 2 [Aegilo...   227   3e-57   
gi|226532239|ref|NP_001141762.1| uncharacterized protein LOC1002...   226   4e-57   
gi|115452067|ref|NP_001049634.1| Os03g0263500 [Oryza sativa Japo...   226   4e-57   
gi|218192483|gb|EEC74910.1| hypothetical protein OsI_10848 [Oryz...   226   5e-57   
gi|303281320|ref|XP_003059952.1| predicted protein [Micromonas p...   226   6e-57   
gi|505755349|gb|EOQ99566.1| Pre-mRNA-splicing factor sap62 [Wall...   225   9e-57   
gi|307104057|gb|EFN52313.1| hypothetical protein CHLNCDRAFT_3256...   224   2e-56   
gi|291000276|ref|XP_002682705.1| splicing factor 3a, subunit 2 [...   224   3e-56   
gi|154287320|ref|XP_001544455.1| hypothetical protein HCAG_01502...   223   4e-56   
gi|71023553|ref|XP_762006.1| hypothetical protein UM05859.1 [Ust...   223   5e-56   
gi|255087432|ref|XP_002505639.1| predicted protein [Micromonas s...   223   5e-56   
gi|406694469|gb|EKC97795.1| PRP11 protein [Trichosporon asahii v...   222   9e-56   
gi|384250539|gb|EIE24018.1| hypothetical protein COCSUDRAFT_5319...   222   1e-55   
gi|164660424|ref|XP_001731335.1| hypothetical protein MGL_1518 [...   221   2e-55   
gi|399217418|emb|CCF74305.1| unnamed protein product [Babesia mi...   221   2e-55   
gi|156085559|ref|XP_001610189.1| splicing factor 3a, subunit 2 [...   219   6e-55   
gi|401409380|ref|XP_003884138.1| hypothetical protein NCLIV_0454...   218   2e-54   
gi|71031120|ref|XP_765202.1| splicing factor 3A subunit 2 [Theil...   217   2e-54   
gi|84994716|ref|XP_952080.1| splicing factor 3a subunit 2 [Theil...   217   3e-54   
gi|145356810|ref|XP_001422618.1| predicted protein [Ostreococcus...   217   3e-54   
gi|482554745|gb|EOA18938.1| hypothetical protein CARUB_v10007569...   214   2e-53   
gi|262401187|gb|ACY66496.1| splicing factor 3A subunit 2 [Scylla...   214   2e-53   
gi|444509466|gb|ELV09262.1| Splicing factor 3A subunit 2 [Tupaia...   213   4e-53   
gi|302817736|ref|XP_002990543.1| hypothetical protein SELMODRAFT...   213   5e-53   
gi|239788281|dbj|BAH70828.1| ACYPI000572 [Acyrthosiphon pisum]        212   9e-53   
gi|478267309|gb|ENN83025.1| hypothetical protein YQE_00611, part...   212   1e-52   
gi|300176956|emb|CBK25525.2| unnamed protein product [Blastocyst...   212   1e-52   
gi|426386592|ref|XP_004059767.1| PREDICTED: splicing factor 3A s...   211   2e-52   
gi|29893604|gb|AAP06858.1| hypothetical protein [Oryza sativa Ja...   210   3e-52   
gi|86171308|ref|XP_966185.1| splicing factor 3a subunit, putativ...   209   6e-52   
gi|457872768|ref|XP_004223303.1| splicing factor 3a subunit [Pla...   207   3e-51   
gi|221057936|ref|XP_002261476.1| splicing factor subunit 3a [Pla...   206   6e-51   
gi|83317615|ref|XP_731238.1| hypothetical protein [Plasmodium yo...   206   6e-51   
gi|68069505|ref|XP_676664.1| splicing factor 3a subunit [Plasmod...   206   8e-51   
gi|443916028|gb|ELU37265.1| splicing factor 3a [Rhizoctonia sola...   205   1e-50   
gi|336270364|ref|XP_003349941.1| hypothetical protein SMAC_00833...   204   3e-50   
gi|70945228|ref|XP_742456.1| splicing factor 3a subunit [Plasmod...   203   4e-50   
gi|224068841|ref|XP_002326213.1| predicted protein [Populus tric...   201   2e-49   
gi|406603540|emb|CCH44942.1| Splicing factor 3A subunit 2 [Wicke...   197   3e-48   
gi|401884929|gb|EJT49064.1| PRP11 protein [Trichosporon asahii v...   191   2e-46   
gi|478265621|gb|ENN82531.1| hypothetical protein YQE_01096, part...   189   8e-46   
gi|156101037|ref|XP_001616212.1| splicing factor 3a subunit [Pla...   187   3e-45   
gi|432099369|gb|ELK28609.1| Splicing factor 3A subunit 2 [Myotis...   187   4e-45   
gi|471194569|ref|XP_004254281.1| splicing factor 3A subunit, put...   185   1e-44   
gi|358254252|dbj|GAA54255.1| splicing factor 3A subunit 2, parti...   184   2e-44   
gi|474147258|gb|EMS56804.1| Splicing factor 3A subunit 2 [Tritic...   183   4e-44   
gi|402592855|gb|EJW86782.1| splicing factor 3a subunit 2 [Wucher...   180   3e-43   
gi|213402003|ref|XP_002171774.1| splicing factor 3A subunit 2 [S...   180   4e-43   
gi|167526662|ref|XP_001747664.1| hypothetical protein [Monosiga ...   177   3e-42   
gi|403365210|gb|EJY82383.1| Splicing factor 3a, subunit 2 [Oxytr...   174   3e-41   
gi|83596332|gb|ABC25501.1| Sf3a2 [Gallus gallus]                      172   8e-41   
gi|67603299|ref|XP_666541.1| f11a10.2 protein [Cryptosporidium h...   171   2e-40   
gi|308198177|ref|XP_001386890.2| predicted protein [Scheffersomy...   171   2e-40   
gi|119589805|gb|EAW69399.1| splicing factor 3a, subunit 2, 66kDa...   171   2e-40   
gi|403274074|ref|XP_003928814.1| PREDICTED: uncharacterized prot...   170   3e-40   
gi|66475630|ref|XP_627631.1| splicing factor 3a 66kD; N-terminus...   170   3e-40   
gi|407034123|gb|EKE37074.1| splicing factor 3a subunit 2, putati...   170   5e-40   
gi|67481425|ref|XP_656062.1| splicing factor 3a subunit 2 [Entam...   169   8e-40   
gi|167389310|ref|XP_001738910.1| splicing factor 3A subunit [Ent...   168   1e-39   
gi|448086657|ref|XP_004196153.1| Piso0_005600 [Millerozyma farin...   164   4e-38   
gi|169623558|ref|XP_001805186.1| hypothetical protein SNOG_15022...   163   6e-38   
gi|448082126|ref|XP_004195059.1| Piso0_005600 [Millerozyma farin...   163   6e-38   
gi|147775444|emb|CAN69421.1| hypothetical protein VITISV_037973 ...   161   2e-37   
gi|119589810|gb|EAW69404.1| splicing factor 3a, subunit 2, 66kDa...   160   4e-37   
gi|407926200|gb|EKG19169.1| hypothetical protein MPH_03539 [Macr...   156   5e-36   
gi|512914181|ref|XP_004928078.1| PREDICTED: splicing factor 3A s...   155   9e-36   
gi|380293177|gb|AFD50237.1| hydroxyproline-rich glycoprotein fam...   155   2e-35   
gi|50422649|ref|XP_459900.1| DEHA2E13684p [Debaryomyces hansenii...   154   2e-35   
gi|402903627|ref|XP_003914664.1| PREDICTED: splicing factor 3A s...   153   4e-35   
gi|426386590|ref|XP_004059766.1| PREDICTED: splicing factor 3A s...   153   6e-35   
gi|380293179|gb|AFD50238.1| hydroxyproline-rich glycoprotein fam...   152   9e-35   
gi|344302142|gb|EGW32447.1| hypothetical protein SPAPADRAFT_6151...   152   1e-34   
gi|255727991|ref|XP_002548921.1| hypothetical protein CTRG_03218...   151   2e-34   
gi|459372141|gb|EMG49686.1| Pre-mrna splicing factor, putative [...   150   4e-34   
gi|354545118|emb|CCE41844.1| hypothetical protein CPAR2_803940 [...   150   4e-34   
gi|380293173|gb|AFD50235.1| hydroxyproline-rich glycoprotein fam...   150   4e-34   
gi|339262794|ref|XP_003367229.1| splicing factor 3A subunit 2 [T...   149   9e-34   
gi|260947054|ref|XP_002617824.1| hypothetical protein CLUG_01283...   148   2e-33   
gi|380293175|gb|AFD50236.1| hydroxyproline-rich glycoprotein fam...   147   2e-33   
gi|241949481|ref|XP_002417463.1| pre-mrna splicing factor, putat...   147   4e-33   
gi|238878713|gb|EEQ42351.1| conserved hypothetical protein [Cand...   146   5e-33   
gi|68464667|ref|XP_723411.1| potential splicing factor SF3A subu...   146   5e-33   
gi|254564947|ref|XP_002489584.1| hypothetical protein [Komagatae...   145   1e-32   
gi|76163046|gb|AAX30809.2| SJCHGC07808 protein [Schistosoma japo...   144   3e-32   
gi|448509803|ref|XP_003866225.1| hypothetical protein CORT_0A039...   142   8e-32   
gi|154421407|ref|XP_001583717.1| splicing factor [Trichomonas va...   142   1e-31   
gi|149247228|ref|XP_001528033.1| conserved hypothetical protein ...   141   2e-31   
gi|146415941|ref|XP_001483940.1| hypothetical protein PGUG_03321...   140   3e-31   
gi|344229951|gb|EGV61836.1| hypothetical protein CANTEDRAFT_1075...   136   5e-30   
gi|388520683|gb|AFK48403.1| unknown [Medicago truncatula]             131   2e-28   
gi|302826527|ref|XP_002994716.1| hypothetical protein SELMODRAFT...   128   1e-27   
gi|339260064|ref|XP_003368594.1| splicing factor 3A subunit 2 [T...   127   3e-27   
gi|414865961|tpg|DAA44518.1| TPA: hypothetical protein ZEAMMB73_...   126   5e-27   
gi|403222230|dbj|BAM40362.1| splicing factor 3a subunit 2 [Theil...   119   1e-24   
gi|405959828|gb|EKC25816.1| Splicing factor 3A subunit 2 [Crasso...   116   6e-24   
gi|161899529|ref|XP_001712990.1| mRNA splicing factor 3A subunit...   114   2e-23   
gi|255712635|ref|XP_002552600.1| KLTH0C08668p [Lachancea thermot...   114   3e-23   
gi|402578635|gb|EJW72588.1| hypothetical protein WUBG_16505 [Wuc...   111   2e-22   
gi|223948359|gb|ACN28263.1| unknown [Zea mays]                        109   8e-22   
gi|393701958|gb|AFN16167.1| hydroxyproline-rich glycoprotein fam...   105   1e-20   
gi|303388619|ref|XP_003072543.1| splicing factor 3A subunit 2 [E...   102   1e-19   
gi|45190593|ref|NP_984847.1| AEL014Cp [Ashbya gossypii ATCC 1089...   102   2e-19   
gi|156846796|ref|XP_001646284.1| hypothetical protein Kpol_1032p...   101   2e-19   
gi|209881713|ref|XP_002142294.1| splicing factor 3A subunit 2 [C...   100   4e-19   
gi|513032351|gb|AGO12343.1| AaceriAEL014Cp [Saccharomycetaceae s...   100   7e-19   
gi|363753292|ref|XP_003646862.1| hypothetical protein Ecym_5283 ...    99   1e-18   
gi|366996929|ref|XP_003678227.1| hypothetical protein NCAS_0I021...    99   2e-18   
gi|50312105|ref|XP_456084.1| hypothetical protein [Kluyveromyces...    97   4e-18   
gi|254578380|ref|XP_002495176.1| ZYRO0B05170p [Zygosaccharomyces...    97   6e-18   
gi|471221504|ref|XP_004027685.1| splicing factor subunit 2, puta...    92   1e-16   
gi|308160880|gb|EFO63347.1| Splicing factor 3A subunit 2 [Giardi...    89   2e-15   
gi|396081039|gb|AFN82658.1| splicing factor 3A subunit 2 [Enceph...    88   3e-15   
gi|440492245|gb|ELQ74829.1| Splicing factor 3a, subunit 2 [Trach...    86   9e-15   
gi|380293169|gb|AFD50234.1| hydroxyproline-rich glycoprotein fam...    86   1e-14   
gi|365761623|gb|EHN03264.1| Prp11p [Saccharomyces cerevisiae x S...    82   2e-13   
gi|365982475|ref|XP_003668071.1| hypothetical protein NDAI_0A067...    80   5e-13   
gi|401840800|gb|EJT43472.1| PRP11-like protein [Saccharomyces ku...    80   8e-13   
gi|238605472|ref|XP_002396459.1| hypothetical protein MPER_03303...    79   2e-12   
gi|50291709|ref|XP_448287.1| hypothetical protein [Candida glabr...    77   4e-12   
gi|403218054|emb|CCK72546.1| hypothetical protein KNAG_0K01810 [...    76   1e-11   
gi|429965155|gb|ELA47152.1| hypothetical protein VCUG_01341 [Vav...    75   2e-11   


>gi|511009595|gb|EPB90833.1| hypothetical protein HMPREF1544_02250 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 246

 Score =  329 bits (844), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 156/228 (68%), Positives = 187/228 (82%), Gaps = 2/228 (0%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR GSK   GG+A  SE+NVDRRERLRKLA+ETID++KDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRVGSKHRGGGMASASESNVDRRERLRKLAMETIDISKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQ-AQTKVQIKKNLVKIGRPG 152
           TLHT+EGSYLAHTQGKKHQT               IQPA+  A+  V  ++N++KIGRPG
Sbjct: 61  TLHTSEGSYLAHTQGKKHQTNLARRAAKEAKEANIIQPAVGPAKPLVAPRRNIIKIGRPG 120

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTKVRDP+TRQ GL FQIQYP+I  DV PRHRFM AYEQ+IEPPN A+QY++ AAEPY
Sbjct: 121 YRVTKVRDPVTRQSGLLFQIQYPQIAEDVKPRHRFMGAYEQKIEPPNNAYQYVVIAAEPY 180

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGI 260
           E+IAFK+QS ++D+  GKF+THWD D+KQFSLQFF+KN++ GM+ EG+
Sbjct: 181 ESIAFKIQSHKIDETPGKFWTHWDQDAKQFSLQFFYKNEKNGMF-EGM 227



>gi|384499447|gb|EIE89938.1| hypothetical protein RO3G_14649 [Rhizopus delemar RA 99-880]
          Length = 241

 Score =  329 bits (844), Expect = 4e-88,   Method: Compositional matrix adjust.
 Identities = 158/240 (65%), Positives = 189/240 (78%), Gaps = 5/240 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR GSK   GGVA YSE+NVDRRERLRKLA+ETID++KDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRVGSKHRGGGVASYSESNVDRRERLRKLAMETIDISKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQI-KKNLVKIGRPG 152
           TLHT+EGSYLAHTQGKKHQT               IQP +     V I ++N++KIGRPG
Sbjct: 61  TLHTSEGSYLAHTQGKKHQTNLARRAAKEARENNIIQPTIGPAKPVVIPRRNVIKIGRPG 120

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y++TKVRDPITRQLG  FQIQYPEI  D+ PRHRFM AYEQ++E PN A+QY++ AAEPY
Sbjct: 121 YRITKVRDPITRQLGFLFQIQYPEIEQDIKPRHRFMGAYEQKVELPNNAYQYVVIAAEPY 180

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIPPGIERAPMVNP 272
           E+IAFK+QS ++D+  G+F+THWD DS+QFSLQFFFKN+R  M+ EG+ P +   P+  P
Sbjct: 181 ESIAFKIQSSKIDETPGRFWTHWDQDSRQFSLQFFFKNERNVMF-EGMGPSV---PLTAP 236



>gi|384489619|gb|EIE80841.1| hypothetical protein RO3G_05546 [Rhizopus delemar RA 99-880]
          Length = 241

 Score =  324 bits (830), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 156/240 (65%), Positives = 187/240 (77%), Gaps = 5/240 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR GSK   GGVA YSE+NVDRRERLRKLA+ETID+ KDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRVGSKHRGGGVASYSESNVDRRERLRKLAMETIDITKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQI-KKNLVKIGRPG 152
           TLHT+EGSYLAHTQGKKHQT               IQP +     V + ++N++KIGRPG
Sbjct: 61  TLHTSEGSYLAHTQGKKHQTNLARRAAKEARENNIIQPTIGPAKPVVVPRRNVIKIGRPG 120

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y++TKVRDP+T QLG  FQ+QYPEI  DV PRHRFM AYEQ+IE PN A+QYL+ AA+PY
Sbjct: 121 YRITKVRDPVTHQLGFLFQVQYPEIEQDVKPRHRFMGAYEQKIELPNNAYQYLVIAADPY 180

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIPPGIERAPMVNP 272
           E+IAFK+QS +VD+  G+F+T+WD DSKQFSLQFFF+N+R  M+ EG+ P +   P+  P
Sbjct: 181 ESIAFKIQSAKVDETPGRFWTYWDQDSKQFSLQFFFRNERNVMF-EGMGPSV---PLTAP 236



>gi|328771587|gb|EGF81627.1| hypothetical protein BATDEDRAFT_29868 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 228

 Score =  317 bits (812), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 161/224 (71%), Positives = 173/224 (77%), Gaps = 14/224 (6%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR GSK GSGGVA  S+ NVDRRERLRKLA ETIDL KDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRAGSKPGSGGVADSSQFNVDRRERLRKLASETIDLTKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLHTNEGSYLAHTQGKKHQT                + A +      I+K  +KIGRPGY
Sbjct: 61  TLHTNEGSYLAHTQGKKHQT---------NLARRAAKDAREPNMFPAIRKVAIKIGRPGY 111

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLD-----VIPRHRFMSAYEQRIEPPNKAHQYLLFA 208
           KVTKVRDP T QLGL FQ+ YPEIG D     + PRHRFMSAYEQRIEPP K  QYLL A
Sbjct: 112 KVTKVRDPTTYQLGLLFQVHYPEIGKDSGIENLKPRHRFMSAYEQRIEPPLKNFQYLLIA 171

Query: 209 AEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDR 252
           AEPYETIAFKVQS EVD+GEG+F++HWDPD+KQF LQFFFK DR
Sbjct: 172 AEPYETIAFKVQSLEVDRGEGRFWSHWDPDAKQFHLQFFFKGDR 215



>gi|470316508|gb|EMR08262.1| hypothetical protein PNEG_03428 [Pneumocystis murina B123]
          Length = 237

 Score =  306 bits (784), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 146/232 (62%), Positives = 176/232 (75%), Gaps = 7/232 (3%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVAG SETN DRRERLRKLALETIDL KDPY +KNHLGS+ECKLCL
Sbjct: 1   MDYQNRVGSKFGGGGVAGTSETNADRRERLRKLALETIDLAKDPYILKNHLGSFECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQ----PALQAQTKVQIKKNLVKIG 149
           TLH N+GSYLAHTQGKKHQT                     P      ++Q++KN++KIG
Sbjct: 61  TLHANDGSYLAHTQGKKHQTNLARRAAKEQKEGATDAITGLPVGVIGQQIQVRKNIIKIG 120

Query: 150 RPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAA 209
           RPGYK+TK+RDP TRQ+GL FQ+ YPEIG D+ PRHRFMSAYEQRIE P++  QYL+ +A
Sbjct: 121 RPGYKITKIRDPYTRQIGLLFQLSYPEIGTDIHPRHRFMSAYEQRIEHPDRRWQYLIISA 180

Query: 210 EPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIP 261
           EPYE+IAFK+++KE+D+ EG F+T WD  +  FS+QFFFK+DR   Y  G+P
Sbjct: 181 EPYESIAFKIEAKEIDRSEGNFWTFWDKPT--FSMQFFFKSDRDTRYM-GVP 229



>gi|430812171|emb|CCJ30393.1| unnamed protein product [Pneumocystis jirovecii]
          Length = 238

 Score =  305 bits (782), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 145/232 (62%), Positives = 176/232 (75%), Gaps = 7/232 (3%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVAG SETN DRRERLRKLALETIDL KDPY +KNHLGS+ECKLCL
Sbjct: 1   MDYQNRVGSKFGGGGVAGTSETNADRRERLRKLALETIDLAKDPYILKNHLGSFECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQ----PALQAQTKVQIKKNLVKIG 149
           TLH N+GSYLAHTQGKKHQT                     P      ++Q++KN++KIG
Sbjct: 61  TLHANDGSYLAHTQGKKHQTNLARRAAKEQKDGSADAITGLPVGVIGQQIQVRKNVIKIG 120

Query: 150 RPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAA 209
           RPGYK+TK+RDP TRQ+GL FQ+ YPEIG D+ PRHRFMSAYEQRIE P++  QYL+ +A
Sbjct: 121 RPGYKITKIRDPYTRQIGLLFQLSYPEIGADIHPRHRFMSAYEQRIEHPDRRWQYLIISA 180

Query: 210 EPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIP 261
           EPYE++AFK+++KE+D+ EG F+T WD  +  FS+QFFFK+DR   Y  G+P
Sbjct: 181 EPYESVAFKIEAKEIDRSEGNFWTFWDKPT--FSMQFFFKSDRDTRYM-GVP 229



>gi|241122592|ref|XP_002403593.1| splicing factor 3A subunit, putative [Ixodes scapularis]
 gi|215493483|gb|EEC03124.1| splicing factor 3A subunit, putative [Ixodes scapularis]
          Length = 235

 Score =  303 bits (777), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 154/218 (70%), Positives = 170/218 (77%), Gaps = 3/218 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA +SE+N DRRERLR+LALETIDL KDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASWSESNRDRRERLRQLALETIDLQKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQ                IQPA  A+ +V IKK  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQANLARRAAKEAKDSP-IQPA-PAKPRVDIKK-FVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           +VTK RD  T Q  L FQ+ YPE+G  V+PRHRFMSAYEQ++EPP+K  QYLLFAAEPYE
Sbjct: 118 RVTKQRDGTTGQQSLLFQVDYPEVGDSVVPRHRFMSAYEQKVEPPDKKWQYLLFAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKND 251
           TIAFKV S+EVDK E KF+T W+ DSKQF LQF FK D
Sbjct: 178 TIAFKVPSREVDKSETKFWTLWNRDSKQFFLQFSFKLD 215



>gi|432915931|ref|XP_004079236.1| PREDICTED: splicing factor 3A subunit 2-like [Oryzias latipes]
          Length = 290

 Score =  303 bits (777), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 159/246 (64%), Positives = 182/246 (73%), Gaps = 8/246 (3%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+R G K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRAGGKTGSGGVASASESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA  A+ KV++KK  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKESP-AQPA-PAKLKVEVKK-FVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RDP   Q  L FQI YPEI   + PRHRFMSAYEQRIEPP++  QYLLFAAEPYE
Sbjct: 118 KVTKQRDPEIGQQSLLFQIDYPEIAEGIGPRHRFMSAYEQRIEPPDRRWQYLLFAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEG--IPPGIERAP--M 269
           TIAFKV S+E+DK E +F+THW+ ++KQF LQF FK ++  +   G  +PPG++  P  M
Sbjct: 178 TIAFKVPSREIDKAETRFWTHWNKETKQFFLQFHFKMEK-AISQSGNLLPPGMKHPPPLM 236

Query: 270 VNPLNP 275
             P  P
Sbjct: 237 SGPRQP 242



>gi|328861913|gb|EGG11015.1| hypothetical protein MELLADRAFT_92446 [Melampsora larici-populina
           98AG31]
          Length = 221

 Score =  303 bits (775), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 143/220 (65%), Positives = 164/220 (74%), Gaps = 5/220 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR GSK G GGVAG SE NVDRRERLRKLALETIDL KDPY ++NHLG  EC+LCL
Sbjct: 1   MDFQNRVGSKFGGGGVAGASEANVDRRERLRKLALETIDLAKDPYILRNHLGGLECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQ-----IKKNLVKI 148
           TLHTNEGSYLAHTQGKKHQT                Q +L AQ   Q      KK  +KI
Sbjct: 61  TLHTNEGSYLAHTQGKKHQTNLARRAAKDAKDSSLYQSSLLAQQAAQSRLTITKKQFIKI 120

Query: 149 GRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFA 208
           G PGY+VTKVRDPIT QLGL FQI YP+I  +V PRHRFMS++EQ +E  ++AHQYLL A
Sbjct: 121 GSPGYQVTKVRDPITGQLGLLFQIHYPQIANEVKPRHRFMSSFEQHVETADRAHQYLLIA 180

Query: 209 AEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFF 248
           AEPY+TIAFK+QS+E+D  EGK + HWD D+K +S+QF F
Sbjct: 181 AEPYQTIAFKLQSQEIDNSEGKSWNHWDLDTKTYSMQFLF 220



>gi|331224308|ref|XP_003324826.1| hypothetical protein PGTG_06363 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|331250246|ref|XP_003337733.1| hypothetical protein PGTG_19269 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309303816|gb|EFP80407.1| hypothetical protein PGTG_06363 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309316723|gb|EFP93314.1| hypothetical protein PGTG_19269 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 221

 Score =  303 bits (775), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 142/220 (64%), Positives = 165/220 (75%), Gaps = 5/220 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR GSK G GG+AG SE NVDRRERLRKLALETIDL KDPY ++NHLG  EC+LCL
Sbjct: 1   MDFQNRVGSKFGGGGLAGASEANVDRRERLRKLALETIDLAKDPYILRNHLGGLECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQ-----IKKNLVKI 148
           TLHTNEGSYLAHTQGKKHQT                Q +L AQ   Q     +KK  +KI
Sbjct: 61  TLHTNEGSYLAHTQGKKHQTNLARRAAKDAKDSSLYQSSLLAQQAAQSRLSIVKKQFIKI 120

Query: 149 GRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFA 208
           G PGY+VTKVRDP+T QLGL FQI YP+I   V PRHRFMS++EQR+E  ++AHQYLL A
Sbjct: 121 GSPGYQVTKVRDPLTGQLGLLFQIHYPQIAEGVKPRHRFMSSFEQRVESADRAHQYLLIA 180

Query: 209 AEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFF 248
           AEPY+TIAFK+QS+E+D  EGK + HWD D+K +S+QF F
Sbjct: 181 AEPYQTIAFKLQSQEIDNSEGKSWHHWDLDTKTYSMQFLF 220



>gi|498946622|ref|XP_004522401.1| PREDICTED: splicing factor 3A subunit 2-like [Ceratitis capitata]
          Length = 268

 Score =  302 bits (773), Expect = 8e-80,   Method: Compositional matrix adjust.
 Identities = 150/217 (69%), Positives = 168/217 (77%), Gaps = 5/217 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR G K GSGGVA +SETN DR+ERLR+LALETIDLNKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRAGGKTGSGGVASWSETNRDRKERLRQLALETIDLNKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIK-KNLVKIGRPG 152
           TLH NEGSYLAHTQGKKHQ                  P++ A  K +++ K  VKIGRPG
Sbjct: 61  TLHNNEGSYLAHTQGKKHQENLARRAAKEAKEA----PSMLAPEKPRVEPKKFVKIGRPG 116

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTK RDP   Q  L FQI YPEI   +IPRHRFMSAYEQ+IEPP++  QYLLFAAEPY
Sbjct: 117 YRVTKQRDPTNGQQSLLFQIDYPEITESIIPRHRFMSAYEQKIEPPDRKWQYLLFAAEPY 176

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFK 249
           ETIAFKV S+EV+K EGKF+THW+ D+KQF LQF FK
Sbjct: 177 ETIAFKVPSREVEKTEGKFWTHWNRDTKQFFLQFSFK 213



>gi|195997639|ref|XP_002108688.1| hypothetical protein TRIADDRAFT_63497 [Trichoplax adhaerens]
 gi|190589464|gb|EDV29486.1| hypothetical protein TRIADDRAFT_63497 [Trichoplax adhaerens]
          Length = 293

 Score =  301 bits (771), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 157/250 (62%), Positives = 178/250 (71%), Gaps = 8/250 (3%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+R GSK+GSGGVA  SE+N DRRERLRKLALETIDLNKDPYFMKNHLG+YECKLCL
Sbjct: 1   MDFQHRVGSKIGSGGVASSSESNRDRRERLRKLALETIDLNKDPYFMKNHLGTYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQ                 QPAL+ + +V +K+  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQQNLARRAAKDAKDAPA-QPALE-KARVDVKQ-FVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK  +    Q  L FQI YPEI   + PRHRFMSAYEQRIEPP+K  QYLLFAAEPYE
Sbjct: 118 KVTKQYNQEAGQQSLLFQIDYPEIVDGITPRHRFMSAYEQRIEPPDKQWQYLLFAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIP-----PGIERAP 268
           TI+FK+ S+E+DK + K +T W+ +SKQF LQ  FK D     S  IP     P     P
Sbjct: 178 TISFKIPSREIDKSDDKLWTQWNKESKQFFLQIHFKADIKQQPSRNIPQSAIVPNQRNIP 237

Query: 269 MVNPLNPYNA 278
             NPLNPY+A
Sbjct: 238 SQNPLNPYSA 247



>gi|156383692|ref|XP_001632967.1| predicted protein [Nematostella vectensis]
 gi|156220030|gb|EDO40904.1| predicted protein [Nematostella vectensis]
          Length = 260

 Score =  301 bits (770), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 158/261 (60%), Positives = 183/261 (70%), Gaps = 20/261 (7%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+R G K GSGGVA  SE+N DRRERLR+LALETIDLNKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRAGGKTGSGGVASSSESNRDRRERLRQLALETIDLNKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQ+                QPA + + +V +KK  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQSNLARRAAKEAKDAP-AQPAPE-KPRVSLKK-FVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK R+P   Q  L FQ+ YPEI   V+PRHRFMSAYEQRIEPPNK  QYLLFAAEPYE
Sbjct: 118 KVTKQRNPDNGQHSLLFQVDYPEIAEGVVPRHRFMSAYEQRIEPPNKQWQYLLFAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEG------------IP 261
           TIAFK+ S+E+DK EGKF+T W+ D+KQF +QF F+     +  +             +P
Sbjct: 178 TIAFKIPSREIDKEEGKFWTQWNRDTKQFYIQFHFRLSPHQLQMQQQQQQNRKQPPPLMP 237

Query: 262 PGI-----ERAPMVNPLNPYN 277
           PG+        P  NPLNP++
Sbjct: 238 PGLVPQRPRNIPAANPLNPFS 258



>gi|443714085|gb|ELU06653.1| hypothetical protein CAPTEDRAFT_168698 [Capitella teleta]
          Length = 259

 Score =  299 bits (766), Expect = 5e-79,   Method: Compositional matrix adjust.
 Identities = 156/241 (64%), Positives = 178/241 (73%), Gaps = 10/241 (4%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD QNR G K G+GGVA  SE+N DRRERLR LALETIDLNKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDHQNRAGGKTGTGGVASSSESNRDRRERLRMLALETIDLNKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQ+                QPA + + +V I+K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQSNLARRAAKDAKDAPS-QPAPE-RARVDIRK-FVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RDP + Q  L FQI YPEI  +++PRHRFM+AYEQR+EPP+K  QYLLFAAEPYE
Sbjct: 118 KVTKQRDPESGQQSLLFQIDYPEIVDNIVPRHRFMAAYEQRVEPPDKKWQYLLFAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIP--PGIERAPMVN 271
           TIAFKV S+EVDK   KF+THW+ ++KQF LQF FK D      +G+P  PG    PM+ 
Sbjct: 178 TIAFKVPSREVDKDSKKFWTHWNRETKQFFLQFSFKFD-----PKGLPPIPGTGAQPMIP 232

Query: 272 P 272
           P
Sbjct: 233 P 233



>gi|47228339|emb|CAG07734.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 287

 Score =  299 bits (765), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 151/219 (68%), Positives = 171/219 (78%), Gaps = 3/219 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+R G K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRAGGKTGSGGVASTSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA  A+ KV++KK  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA-PAKLKVEVKK-FVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RDP T Q  L FQI YPE+   + PRHRFMSAYEQRIEPP++  QYLLFAAEPYE
Sbjct: 118 KVTKQRDPETGQQSLLFQIDYPEVAEGIGPRHRFMSAYEQRIEPPDRRWQYLLFAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDR 252
           TIAFKV S+E+DK E +F+THW+ ++KQF LQF FK ++
Sbjct: 178 TIAFKVPSREIDKAETRFWTHWNRETKQFFLQFHFKMEK 216



>gi|307170169|gb|EFN62576.1| Splicing factor 3A subunit 2 [Camponotus floridanus]
          Length = 274

 Score =  298 bits (764), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 151/223 (67%), Positives = 173/223 (77%), Gaps = 5/223 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNRPG K G GGVA +SE+N DRRERLR+LALETIDLNKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRPGGKTGGGGVASWSESNRDRRERLRQLALETIDLNKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIK-KNLVKIGRPG 152
           TLH NEGSYLAHTQGKKHQ                  P   A  K +++ K  VKIGRPG
Sbjct: 61  TLHNNEGSYLAHTQGKKHQANLARRAAKEAKEA----PQTLAPEKPRVEPKKFVKIGRPG 116

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTK RDP + Q  L FQ+ YPE+  +VIPRHRFMSAYEQR+EPP++  QYLLFAAEPY
Sbjct: 117 YRVTKQRDPESGQQSLLFQVDYPEVADNVIPRHRFMSAYEQRVEPPDRKWQYLLFAAEPY 176

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGM 255
           ETIAFKV S+EV+K EGKF+THW+ D+KQF LQF FKN++P +
Sbjct: 177 ETIAFKVPSREVEKAEGKFWTHWNKDTKQFFLQFAFKNEKPSV 219



>gi|332030557|gb|EGI70245.1| Splicing factor 3A subunit 2 [Acromyrmex echinatior]
          Length = 274

 Score =  298 bits (763), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 151/223 (67%), Positives = 173/223 (77%), Gaps = 5/223 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNRPG K G GGVA +SE+N DRRERLR+LALETIDLNKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRPGGKTGGGGVASWSESNRDRRERLRQLALETIDLNKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIK-KNLVKIGRPG 152
           TLH NEGSYLAHTQGKKHQ                  P   A  K +++ K  VKIGRPG
Sbjct: 61  TLHNNEGSYLAHTQGKKHQANLARRAAKEAKEA----PQTLAPEKPRVEPKKFVKIGRPG 116

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTK RDP + Q  L FQ+ YPE+  +VIPRHRFMSAYEQR+EPP++  QYLLFAAEPY
Sbjct: 117 YRVTKQRDPESGQQSLLFQVDYPEVADNVIPRHRFMSAYEQRVEPPDRKWQYLLFAAEPY 176

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGM 255
           ETIAFKV S+EV+K EGKF+THW+ D+KQF LQF FKN++P +
Sbjct: 177 ETIAFKVPSREVEKAEGKFWTHWNKDTKQFFLQFAFKNEKPAV 219



>gi|383849657|ref|XP_003700461.1| PREDICTED: splicing factor 3A subunit 2-like [Megachile rotundata]
          Length = 274

 Score =  298 bits (763), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 151/223 (67%), Positives = 173/223 (77%), Gaps = 5/223 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNRPG K G GGVA +SE+N DRRERLR+LALETIDLNKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRPGGKTGGGGVASWSESNRDRRERLRQLALETIDLNKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIK-KNLVKIGRPG 152
           TLH NEGSYLAHTQGKKHQ                  P   A  K +++ K  VKIGRPG
Sbjct: 61  TLHNNEGSYLAHTQGKKHQANLARRAAKEAKEA----PQTLAPEKPRVEPKKFVKIGRPG 116

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTK RDP + Q  L FQ+ YPE+  +VIPRHRFMSAYEQR+EPP++  QYLLFAAEPY
Sbjct: 117 YRVTKQRDPESGQQSLLFQVDYPEVADNVIPRHRFMSAYEQRVEPPDRKWQYLLFAAEPY 176

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGM 255
           ETIAFKV S+EV+K EGKF+THW+ D+KQF LQF FKN++P +
Sbjct: 177 ETIAFKVPSREVEKAEGKFWTHWNKDTKQFFLQFAFKNEKPSV 219



>gi|340722419|ref|XP_003399603.1| PREDICTED: splicing factor 3A subunit 2-like [Bombus terrestris]
 gi|350416626|ref|XP_003491024.1| PREDICTED: splicing factor 3A subunit 2-like [Bombus impatiens]
          Length = 274

 Score =  298 bits (763), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 151/223 (67%), Positives = 173/223 (77%), Gaps = 5/223 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNRPG K G GGVA +SE+N DRRERLR+LALETIDLNKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRPGGKTGGGGVASWSESNRDRRERLRQLALETIDLNKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIK-KNLVKIGRPG 152
           TLH NEGSYLAHTQGKKHQ                  P   A  K +++ K  VKIGRPG
Sbjct: 61  TLHNNEGSYLAHTQGKKHQANLARRAAKEAKEA----PQTLAPEKPRVEPKKFVKIGRPG 116

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTK RDP + Q  L FQ+ YPE+  +VIPRHRFMSAYEQR+EPP++  QYLLFAAEPY
Sbjct: 117 YRVTKQRDPESGQQSLLFQVDYPEVADNVIPRHRFMSAYEQRVEPPDRKWQYLLFAAEPY 176

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGM 255
           ETIAFKV S+EV+K EGKF+THW+ D+KQF LQF FKN++P +
Sbjct: 177 ETIAFKVPSREVEKAEGKFWTHWNKDTKQFFLQFAFKNEKPSV 219



>gi|66526752|ref|XP_624713.1| PREDICTED: splicing factor 3A subunit 2-like [Apis mellifera]
 gi|380014361|ref|XP_003691203.1| PREDICTED: splicing factor 3A subunit 2-like [Apis florea]
          Length = 274

 Score =  298 bits (763), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 151/223 (67%), Positives = 173/223 (77%), Gaps = 5/223 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNRPG K G GGVA +SE+N DRRERLR+LALETIDLNKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRPGGKTGGGGVASWSESNRDRRERLRQLALETIDLNKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIK-KNLVKIGRPG 152
           TLH NEGSYLAHTQGKKHQ                  P   A  K +++ K  VKIGRPG
Sbjct: 61  TLHNNEGSYLAHTQGKKHQANLARRAAKEAKEA----PQTLAPEKPRVEPKKFVKIGRPG 116

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTK RDP + Q  L FQ+ YPE+  +VIPRHRFMSAYEQR+EPP++  QYLLFAAEPY
Sbjct: 117 YRVTKQRDPESGQQSLLFQVDYPEVADNVIPRHRFMSAYEQRVEPPDRKWQYLLFAAEPY 176

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGM 255
           ETIAFKV S+EV+K EGKF+THW+ D+KQF LQF FKN++P +
Sbjct: 177 ETIAFKVPSREVEKAEGKFWTHWNKDTKQFFLQFAFKNEKPSV 219



>gi|322790906|gb|EFZ15572.1| hypothetical protein SINV_10875 [Solenopsis invicta]
          Length = 274

 Score =  298 bits (763), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 151/223 (67%), Positives = 173/223 (77%), Gaps = 5/223 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNRPG K G GGVA +SE+N DRRERLR+LALETIDLNKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRPGGKTGGGGVASWSESNRDRRERLRQLALETIDLNKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIK-KNLVKIGRPG 152
           TLH NEGSYLAHTQGKKHQ                  P   A  K +++ K  VKIGRPG
Sbjct: 61  TLHNNEGSYLAHTQGKKHQANLARRAAKEAKEA----PQTLAPEKPRVEPKKFVKIGRPG 116

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTK RDP + Q  L FQ+ YPE+  +VIPRHRFMSAYEQR+EPP++  QYLLFAAEPY
Sbjct: 117 YRVTKQRDPESGQQSLLFQVDYPEVADNVIPRHRFMSAYEQRVEPPDRKWQYLLFAAEPY 176

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGM 255
           ETIAFKV S+EV+K EGKF+THW+ D+KQF LQF FKN++P +
Sbjct: 177 ETIAFKVPSREVEKAEGKFWTHWNKDTKQFFLQFAFKNEKPSV 219



>gi|156552244|ref|XP_001606508.1| PREDICTED: splicing factor 3A subunit 2-like [Nasonia vitripennis]
          Length = 263

 Score =  298 bits (763), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 150/223 (67%), Positives = 173/223 (77%), Gaps = 5/223 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNRPG K G GGVA +SE+N DRRERLR+LALETIDLNKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDYQNRPGGKTGGGGVASWSESNRDRRERLRQLALETIDLNKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIK-KNLVKIGRPG 152
           TLH NEGSYLAHTQGKKHQ                  P   A  K +++ K  VKIGRPG
Sbjct: 61  TLHNNEGSYLAHTQGKKHQANLARRAAKEAKEA----PQTLAPEKPRVEPKKFVKIGRPG 116

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTK RDP + Q  L FQ+ YPE+  ++IPRHRFMSAYEQR+EPP++  QYLLFAAEPY
Sbjct: 117 YRVTKQRDPESGQQSLLFQVDYPEVADNIIPRHRFMSAYEQRVEPPDRKWQYLLFAAEPY 176

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGM 255
           ETIAFKV S+EVDK EGKF+THW+ D+KQF LQF FKN++P +
Sbjct: 177 ETIAFKVPSREVDKAEGKFWTHWNKDTKQFFLQFAFKNEKPSI 219



>gi|260795269|ref|XP_002592628.1| hypothetical protein BRAFLDRAFT_85076 [Branchiostoma floridae]
 gi|229277850|gb|EEN48639.1| hypothetical protein BRAFLDRAFT_85076 [Branchiostoma floridae]
          Length = 303

 Score =  297 bits (760), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 150/218 (68%), Positives = 167/218 (76%), Gaps = 3/218 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR G K GSGGVA  SETN DRRERLR+LALETIDLNKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRAGGKTGSGGVASTSETNRDRRERLRQLALETIDLNKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQ                 QPA  A+ +V+ KK  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQANLARRAAKEAKDSP-AQPA-PARDRVETKK-FVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RDP T Q  L +QI YPE+   + PRHRFMSAYEQR+EPP++  QYL+FAAEPYE
Sbjct: 118 KVTKQRDPETGQQSLLYQIDYPEVVEAISPRHRFMSAYEQRVEPPDRRWQYLIFAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKND 251
            IAFK+ S+EVDK EGKF+T W+ ++KQF LQF FK D
Sbjct: 178 NIAFKIPSREVDKSEGKFWTQWNRETKQFFLQFHFKLD 215



>gi|449304825|gb|EMD00832.1| hypothetical protein BAUCODRAFT_185871 [Baudoinia compniacensis
           UAMH 10762]
          Length = 239

 Score =  296 bits (759), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 138/229 (60%), Positives = 173/229 (75%), Gaps = 2/229 (0%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA  S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASQSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXX-XXXXIQPALQAQTKVQIKKNLVKIGRPG 152
           T+H N+GSYLAHTQG+KHQT                 +        VQ+++N+VKIGRPG
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAKDAQLGKRREEEGYTGANAVQVRRNVVKIGRPG 120

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y++TK RDPITRQ GL FQIQYP++G DV+PR RFMSAYEQ++E P+KA+QYL+ AAEPY
Sbjct: 121 YQITKTRDPITRQQGLLFQIQYPDVGTDVVPRVRFMSAYEQKVEEPDKAYQYLVVAAEPY 180

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIP 261
           +T  FK+Q++EVD+   K++T +D DSK+F +Q  FK +R   YS G+P
Sbjct: 181 DTCGFKLQAREVDRSSDKYWTWFDQDSKEFWVQITFKTEREERYS-GVP 228



>gi|195428092|ref|XP_002062108.1| GK16828 [Drosophila willistoni]
 gi|194158193|gb|EDW73094.1| GK16828 [Drosophila willistoni]
          Length = 260

 Score =  295 bits (756), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 166/217 (76%), Gaps = 4/217 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR G K GSGGVA +SETN DR+ERLR+LALETIDLNKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRAGGKTGSGGVASWSETNRDRKERLRQLALETIDLNKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIK-KNLVKIGRPG 152
           TLH NEGSYLAHTQGKKHQ                   +L A  K +++ K  VKIGRPG
Sbjct: 61  TLHNNEGSYLAHTQGKKHQENLARRAAKEAKEAPS---SLLAPEKPRVEPKKFVKIGRPG 117

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTK R+P   Q  L FQI YPEI   ++PRHRFMSAYEQ+IEPP++  QYLLFA+EPY
Sbjct: 118 YRVTKQREPSNGQQSLLFQIDYPEITESIVPRHRFMSAYEQKIEPPDRKWQYLLFASEPY 177

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFK 249
           ETI FKV S+EV+K EGKF+THW+ D+KQF LQF FK
Sbjct: 178 ETIGFKVPSREVEKAEGKFWTHWNRDTKQFFLQFAFK 214



>gi|307197217|gb|EFN78538.1| Splicing factor 3A subunit 2 [Harpegnathos saltator]
          Length = 273

 Score =  295 bits (754), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 171/220 (77%), Gaps = 5/220 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNRPG K G GGVA +SE+N DRRERLR+LALETIDLNKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRPGGKTGGGGVASWSESNRDRRERLRQLALETIDLNKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIK-KNLVKIGRPG 152
           TLH NEGSYLAHTQGKKHQ                  P   A  K +++ K  VKIGRPG
Sbjct: 61  TLHNNEGSYLAHTQGKKHQANLARRAAKEAKEA----PQTLAPEKPRVEPKKFVKIGRPG 116

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTK RDP + Q  L FQ+ YPE+  +VIPRHRFMSAYEQR+EPP++  QYLLFAAEPY
Sbjct: 117 YRVTKQRDPESGQQSLLFQVDYPEVADNVIPRHRFMSAYEQRVEPPDRKWQYLLFAAEPY 176

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDR 252
           ETIAFKV S+EV+K EGKF+THW+ D+KQF LQF FKN++
Sbjct: 177 ETIAFKVPSREVEKAEGKFWTHWNKDTKQFFLQFAFKNEK 216



>gi|348500914|ref|XP_003438016.1| PREDICTED: splicing factor 3A subunit 2-like [Oreochromis
           niloticus]
          Length = 294

 Score =  294 bits (753), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 154/237 (64%), Positives = 172/237 (72%), Gaps = 5/237 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+R G K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRAGGKTGSGGVASASESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA          K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PAKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RDP T Q  L FQI YPEI   + PRHRFMSAYEQRIEPP++  QYLLFAAEPYE
Sbjct: 118 KVTKQRDPETGQQSLLFQIDYPEIAEGIGPRHRFMSAYEQRIEPPDRRWQYLLFAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIPPG--IERAP 268
           TIAFKV S+E+DK E +F+THW+ ++KQF LQF FK ++P   S G  P   ++R P
Sbjct: 178 TIAFKVPSREIDKAENRFWTHWNKETKQFFLQFHFKMEKPVTQSSGPAPAATVKRPP 234



>gi|339239211|ref|XP_003381160.1| splicing factor 3A subunit 2 [Trichinella spiralis]
 gi|316975828|gb|EFV59224.1| splicing factor 3A subunit 2 [Trichinella spiralis]
          Length = 311

 Score =  294 bits (753), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 149/217 (68%), Positives = 165/217 (76%), Gaps = 4/217 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+R G K G+GGVA +SE N DRRERLR+LALETIDLNKDPYFMKNHLG YECKLCL
Sbjct: 20  MDFQHRAGGKTGTGGVASFSEANRDRRERLRQLALETIDLNKDPYFMKNHLGGYECKLCL 79

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIK-KNLVKIGRPG 152
           TLH NEGSYLAHTQGKKHQ                I  +L    K +I+ K  VKIGRPG
Sbjct: 80  TLHNNEGSYLAHTQGKKHQANLARRAAKDAFD---INGSLSLPDKPRIEPKKFVKIGRPG 136

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           YKVTK RDP T Q  L FQ+ YPE    VIPRHRFMSAYEQ+IEPP+K  QYLLFAAEPY
Sbjct: 137 YKVTKQRDPNTGQQSLLFQVDYPEAVDSVIPRHRFMSAYEQKIEPPDKRWQYLLFAAEPY 196

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFK 249
           ETIAFK+ S+EVDKGEGKF+T W+ D+KQF LQF F+
Sbjct: 197 ETIAFKIPSREVDKGEGKFWTLWNKDTKQFFLQFAFR 233



>gi|194752039|ref|XP_001958330.1| GF10865 [Drosophila ananassae]
 gi|190625612|gb|EDV41136.1| GF10865 [Drosophila ananassae]
          Length = 261

 Score =  294 bits (753), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 145/217 (66%), Positives = 166/217 (76%), Gaps = 4/217 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR G K GSGGVA +SE+N DR+ERLR+LALETIDLNKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRAGGKTGSGGVASWSESNRDRKERLRQLALETIDLNKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIK-KNLVKIGRPG 152
           TLH NEGSYLAHTQGKKHQ                   +L A  K +++ K  VKIGRPG
Sbjct: 61  TLHNNEGSYLAHTQGKKHQENLARRAAKEAKEAPS---SLLAPEKPRVEPKKFVKIGRPG 117

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTK R+P   Q  L FQI YPEI   ++PRHRFMSAYEQ+IEPP++  QYLLFA+EPY
Sbjct: 118 YRVTKQREPSNGQQSLLFQIDYPEISDSIVPRHRFMSAYEQKIEPPDRKWQYLLFASEPY 177

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFK 249
           ETI FKV S+EV+K EGKF+THW+ D+KQF LQF FK
Sbjct: 178 ETIGFKVPSREVEKSEGKFWTHWNRDTKQFFLQFAFK 214



>gi|125979941|ref|XP_001354003.1| GA10545 [Drosophila pseudoobscura pseudoobscura]
 gi|195166735|ref|XP_002024190.1| GL22896 [Drosophila persimilis]
 gi|54640988|gb|EAL29739.1| GA10545 [Drosophila pseudoobscura pseudoobscura]
 gi|194107545|gb|EDW29588.1| GL22896 [Drosophila persimilis]
          Length = 260

 Score =  294 bits (753), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 166/217 (76%), Gaps = 4/217 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR G K GSGGVA +SETN DR+ERLR+LALETIDLNKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRAGGKTGSGGVASWSETNRDRKERLRQLALETIDLNKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIK-KNLVKIGRPG 152
           TLH NEGSYLAHTQGKKHQ                   +L A  K +++ K  VKIGRPG
Sbjct: 61  TLHNNEGSYLAHTQGKKHQENLARRAAKEAKEAPS---SLLAPEKPRVEPKKFVKIGRPG 117

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTK R+P   Q  L FQI YPEI   ++PRHRFMSAYEQ+IEPP++  QYLLFA+EPY
Sbjct: 118 YRVTKQREPSNGQQSLLFQIDYPEITEAIVPRHRFMSAYEQKIEPPDRKWQYLLFASEPY 177

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFK 249
           ETI FKV S+EV+K EGKF+THW+ D+KQF LQF FK
Sbjct: 178 ETIGFKVPSREVEKSEGKFWTHWNRDTKQFFLQFAFK 214



>gi|307192848|gb|EFN75902.1| Splicing factor 3A subunit 2 [Harpegnathos saltator]
          Length = 274

 Score =  294 bits (753), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 150/219 (68%), Positives = 170/219 (77%), Gaps = 5/219 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNRPG K G GGVA +SE+N DRRERLR+LALETIDLNKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRPGGKTGGGGVASWSESNRDRRERLRQLALETIDLNKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIK-KNLVKIGRPG 152
           TLH NEGSYLAHTQGKKHQ                  P   A  K +++ K  VKIGRPG
Sbjct: 61  TLHNNEGSYLAHTQGKKHQANLARRAAKEAKEA----PQTLAPEKPRVEPKKFVKIGRPG 116

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTK RDP + Q  L FQ+ YPE+  +VIPRHRFMSAYEQR+EPP++  QYLLFAAEPY
Sbjct: 117 YRVTKQRDPESGQQSLLFQVDYPEVADNVIPRHRFMSAYEQRVEPPDRKWQYLLFAAEPY 176

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKND 251
           ETIAFKV S+EV+K EGKF+THW+ D+KQF LQF FKN+
Sbjct: 177 ETIAFKVPSREVEKAEGKFWTHWNKDTKQFFLQFAFKNE 215



>gi|344243435|gb|EGV99538.1| Splicing factor 3A subunit 2 [Cricetulus griseus]
          Length = 520

 Score =  294 bits (753), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|195021731|ref|XP_001985451.1| GH14494 [Drosophila grimshawi]
 gi|193898933|gb|EDV97799.1| GH14494 [Drosophila grimshawi]
          Length = 260

 Score =  294 bits (752), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 166/217 (76%), Gaps = 4/217 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR G K GSGGVA +SETN +R+ERLR+LALETIDLNKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRAGGKTGSGGVASWSETNRERKERLRQLALETIDLNKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIK-KNLVKIGRPG 152
           TLH NEGSYLAHTQGKKHQ                   +L A  K +++ K  VKIGRPG
Sbjct: 61  TLHNNEGSYLAHTQGKKHQENLARRAAKEAKESPS---SLLAPEKPRVEPKKFVKIGRPG 117

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTK R+P   Q  L FQI YPEI   ++PRHRFMSAYEQ+IEPP++  QYLLFAAEPY
Sbjct: 118 YRVTKQREPSNNQQSLLFQIDYPEISDGIVPRHRFMSAYEQKIEPPDRKWQYLLFAAEPY 177

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFK 249
           ETI FKV S+EV+K EGKF+THW+ D+KQF LQF FK
Sbjct: 178 ETIGFKVPSREVEKMEGKFWTHWNRDTKQFFLQFAFK 214



>gi|195128531|ref|XP_002008716.1| GI13650 [Drosophila mojavensis]
 gi|193920325|gb|EDW19192.1| GI13650 [Drosophila mojavensis]
          Length = 260

 Score =  294 bits (752), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 166/217 (76%), Gaps = 4/217 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR G K GSGGVA +SETN +R+ERLR+LALETIDLNKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRAGGKTGSGGVASWSETNRERKERLRQLALETIDLNKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIK-KNLVKIGRPG 152
           TLH NEGSYLAHTQGKKHQ                   +L A  K +++ K  VKIGRPG
Sbjct: 61  TLHNNEGSYLAHTQGKKHQENLARRAAKEAKDAPS---SLLAPEKPRVEPKKFVKIGRPG 117

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTK R+P   Q  L FQI YPEI   ++PRHRFMSAYEQ+IEPP++  QYLLFAAEPY
Sbjct: 118 YRVTKQREPTNGQQSLLFQIDYPEISEGIVPRHRFMSAYEQKIEPPDRKWQYLLFAAEPY 177

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFK 249
           ETI FKV S+EV+K EGKF+THW+ D+KQF LQF FK
Sbjct: 178 ETIGFKVPSREVEKTEGKFWTHWNRDTKQFFLQFAFK 214



>gi|195379390|ref|XP_002048462.1| GJ13983 [Drosophila virilis]
 gi|27374358|gb|AAO01098.1| CG10754-PA [Drosophila virilis]
 gi|194155620|gb|EDW70804.1| GJ13983 [Drosophila virilis]
          Length = 260

 Score =  293 bits (751), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 166/217 (76%), Gaps = 4/217 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR G K GSGGVA +SETN +R+ERLR+LALETIDLNKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRAGGKTGSGGVASWSETNRERKERLRQLALETIDLNKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIK-KNLVKIGRPG 152
           TLH NEGSYLAHTQGKKHQ                   +L A  K +++ K  VKIGRPG
Sbjct: 61  TLHNNEGSYLAHTQGKKHQENLARRAAKEAKDAPS---SLLAPEKPRVEPKKFVKIGRPG 117

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTK R+P   Q  L FQI YPEI   ++PRHRFMSAYEQ+IEPP++  QYLLFAAEPY
Sbjct: 118 YRVTKQREPTNGQQSLLFQIDYPEISDGIVPRHRFMSAYEQKIEPPDRKWQYLLFAAEPY 177

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFK 249
           ETI FKV S+EV+K EGKF+THW+ D+KQF LQF FK
Sbjct: 178 ETIGFKVPSREVEKTEGKFWTHWNRDTKQFFLQFAFK 214



>gi|52138695|ref|NP_001004397.1| splicing factor 3A subunit 2 [Gallus gallus]
 gi|326934345|ref|XP_003213251.1| PREDICTED: splicing factor 3A subunit 2-like [Meleagris gallopavo]
 gi|51594275|gb|AAU08170.1| splicing factor 3a subunit 2 [Gallus gallus]
          Length = 315

 Score =  293 bits (751), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 150/219 (68%), Positives = 167/219 (76%), Gaps = 3/219 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASASESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RDP T Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDPETGQQSLLFQIDYPEIAESIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDR 252
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEK 216



>gi|153792445|ref|NP_001093340.1| uncharacterized protein LOC100101277 [Xenopus laevis]
 gi|76779951|gb|AAI06398.1| LOC100101277 protein [Xenopus laevis]
          Length = 405

 Score =  293 bits (750), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 154/235 (65%), Positives = 172/235 (73%), Gaps = 5/235 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+R G K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRAGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RDP   Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDPEMAQQSLLFQIDYPEIAESIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEG--IPPGIER 266
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P         PPGI+R
Sbjct: 178 TIAFKVPSREIDKVEGKFWTHWNRETKQFFLQFHFKMEKPPTAPTMPLAPPGIKR 232



>gi|118344168|ref|NP_001071907.1| zinc finger protein [Ciona intestinalis]
 gi|92081492|dbj|BAE93293.1| zinc finger protein [Ciona intestinalis]
          Length = 349

 Score =  293 bits (750), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 148/216 (68%), Positives = 167/216 (77%), Gaps = 3/216 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR G K GSGGVA  S+ N DRRERLR+LALETIDLNKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRAGGKTGSGGVASLSDANRDRRERLRQLALETIDLNKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQ+               IQPA   +  V++KK  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQSNLAKRAARDAKEAP-IQPA-PVKPMVEVKK-FVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK R P T Q  L FQ+ YPEI   + PRHRFMSAYEQ IEPP+++ QYLLFAAEPYE
Sbjct: 118 KVTKQRVPETGQQSLLFQVDYPEIVETIQPRHRFMSAYEQHIEPPDRSWQYLLFAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFK 249
           T+AFKV S+E+DKGE KF+T+W+ D+KQF LQF +K
Sbjct: 178 TVAFKVPSREIDKGESKFWTYWNKDTKQFFLQFHYK 213



>gi|147900053|ref|NP_001080140.1| splicing factor 3a, subunit 2, 66kDa [Xenopus laevis]
 gi|27371271|gb|AAH41254.1| Sf3a2-prov protein [Xenopus laevis]
          Length = 405

 Score =  293 bits (750), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 155/242 (64%), Positives = 175/242 (72%), Gaps = 7/242 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+R G K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRAGGKTGSGGVASASESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RDP   Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDPEMGQQSLLFQIDYPEIAESIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSE--GIPPGIER--APM 269
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P         PPG++R   P 
Sbjct: 178 TIAFKVPSREIDKVEGKFWTHWNRETKQFFLQFHFKTEKPPQAPTLPPAPPGVKRPVPPA 237

Query: 270 VN 271
           +N
Sbjct: 238 IN 239



>gi|58865548|ref|NP_001011986.1| splicing factor 3A subunit 2 [Rattus norvegicus]
 gi|81884469|sp|Q6AXT8.1|SF3A2_RAT RecName: Full=Splicing factor 3A subunit 2
 gi|50926213|gb|AAH79320.1| Splicing factor 3a, subunit 2 [Rattus norvegicus]
          Length = 471

 Score =  293 bits (749), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   V+PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAEGVMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|452989822|gb|EME89577.1| hypothetical protein MYCFIDRAFT_32749 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 235

 Score =  293 bits (749), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 141/229 (61%), Positives = 168/229 (73%), Gaps = 2/229 (0%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA  S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASQSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           T+H N+GSYLAHTQG+KHQT                +        V IK+N+VKIGRPGY
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAKDAQLGKKHEGEYTGANAVHIKRNVVKIGRPGY 120

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIE-PPNKAHQYLLFAAEPY 212
            +TK RDPITRQ GL F +QYPEI   + PR RFMSAYEQ++E PP+KA QYLL AAEPY
Sbjct: 121 SITKTRDPITRQEGLLFSLQYPEISQGIEPRVRFMSAYEQKVEDPPDKAFQYLLVAAEPY 180

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIP 261
           ET  FK+Q++EVD+ E K++T WD DSKQF +Q  FK +R   +S G+P
Sbjct: 181 ETCGFKIQAREVDRREDKYWTWWDQDSKQFWIQINFKTERDERFS-GVP 228



>gi|345786790|ref|XP_855016.2| PREDICTED: splicing factor 3A subunit 2 [Canis lupus familiaris]
          Length = 478

 Score =  293 bits (749), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|291222755|ref|XP_002731380.1| PREDICTED: splicing factor 3a, subunit 2-like [Saccoglossus
           kowalevskii]
          Length = 299

 Score =  293 bits (749), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 148/218 (67%), Positives = 169/218 (77%), Gaps = 3/218 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR G K GSGGVA  SE+N DRRERLR+LALETIDL KDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRAGGKTGSGGVASASESNRDRRERLRQLALETIDLTKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQ+                QPA + + +V++KK  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQSNLGRRAAKEAKDEP-AQPAPE-KPRVEVKK-FVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD  + Q  L FQ+ YPEI   ++PRHRFMSAYEQ+IEPP++  QYLLFAAEPYE
Sbjct: 118 KVTKQRDAESGQQSLLFQVDYPEIVDGILPRHRFMSAYEQKIEPPDRKWQYLLFAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKND 251
           TI+FKV S+EVDK EGKF+T W+ ++KQF LQF FK D
Sbjct: 178 TISFKVPSREVDKVEGKFWTQWNKETKQFFLQFAFKMD 215



>gi|354480886|ref|XP_003502634.1| PREDICTED: splicing factor 3A subunit 2-like isoform 2 [Cricetulus
           griseus]
          Length = 485

 Score =  293 bits (749), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|471381522|ref|XP_004378553.1| PREDICTED: uncharacterized protein LOC101349631 [Trichechus manatus
           latirostris]
          Length = 492

 Score =  293 bits (749), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEVGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|378729422|gb|EHY55881.1| hypothetical protein HMPREF1120_03995 [Exophiala dermatitidis
           NIH/UT8656]
          Length = 236

 Score =  293 bits (749), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 138/232 (59%), Positives = 172/232 (74%), Gaps = 3/232 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA +S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASHSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXI-QPALQAQTKVQIKKNLVKIGRPG 152
           T+H N+GSYLAHTQG+KHQT                    L     VQ++KN+VKIGRPG
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAREQKEMQKDGNQMLPGMMGVQVRKNVVKIGRPG 120

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           YK+TK+RDP+TRQ+GL FQ+ YPEI   V PR RFMSA+EQ++E P++ +QYLL AAEPY
Sbjct: 121 YKITKIRDPLTRQVGLLFQLLYPEIAPGVQPRVRFMSAFEQKVEEPDRDYQYLLVAAEPY 180

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSE--GIPP 262
           ET  FK+QS+E+D+ EG+++T WD D+K+F  Q  FK +R   YS   G+ P
Sbjct: 181 ETCGFKLQSREIDRREGRYWTWWDADAKEFWCQILFKTERDERYSNVPGLAP 232



>gi|354480888|ref|XP_003502635.1| PREDICTED: splicing factor 3A subunit 2-like isoform 3 [Cricetulus
           griseus]
          Length = 478

 Score =  293 bits (749), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|116283242|gb|AAH15804.1| SF3A2 protein [Homo sapiens]
          Length = 481

 Score =  292 bits (748), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|158749553|ref|NP_038679.3| splicing factor 3A subunit 2 [Mus musculus]
 gi|148699550|gb|EDL31497.1| splicing factor 3a, subunit 2, isoform CRA_b [Mus musculus]
          Length = 485

 Score =  292 bits (748), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|21361376|ref|NP_009096.2| splicing factor 3A subunit 2 [Homo sapiens]
 gi|114674504|ref|XP_001150618.1| PREDICTED: splicing factor 3A subunit 2 isoform 4 [Pan troglodytes]
 gi|114674506|ref|XP_001150681.1| PREDICTED: splicing factor 3A subunit 2 isoform 5 [Pan troglodytes]
 gi|20141793|sp|Q15428.2|SF3A2_HUMAN RecName: Full=Splicing factor 3A subunit 2; AltName: Full=SF3a66;
           AltName: Full=Spliceosome-associated protein 62;
           Short=SAP 62
 gi|3289979|gb|AAC25613.1| SP62_HUMAN [Homo sapiens]
 gi|13325230|gb|AAH04434.1| Splicing factor 3a, subunit 2, 66kDa [Homo sapiens]
 gi|14602787|gb|AAH09903.1| Splicing factor 3a, subunit 2, 66kDa [Homo sapiens]
 gi|119589804|gb|EAW69398.1| splicing factor 3a, subunit 2, 66kDa, isoform CRA_a [Homo sapiens]
 gi|119589806|gb|EAW69400.1| splicing factor 3a, subunit 2, 66kDa, isoform CRA_a [Homo sapiens]
 gi|119589807|gb|EAW69401.1| splicing factor 3a, subunit 2, 66kDa, isoform CRA_a [Homo sapiens]
 gi|119589808|gb|EAW69402.1| splicing factor 3a, subunit 2, 66kDa, isoform CRA_a [Homo sapiens]
 gi|124000543|gb|ABM87780.1| splicing factor 3a, subunit 2, 66kDa [synthetic construct]
 gi|189054563|dbj|BAG37338.1| unnamed protein product [Homo sapiens]
 gi|307684548|dbj|BAJ20314.1| splicing factor 3a, subunit 2, 66kDa [synthetic construct]
          Length = 464

 Score =  292 bits (748), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|194870079|ref|XP_001972582.1| GG13802 [Drosophila erecta]
 gi|195327235|ref|XP_002030327.1| GM24628 [Drosophila sechellia]
 gi|195493943|ref|XP_002094630.1| GE20095 [Drosophila yakuba]
 gi|195589928|ref|XP_002084701.1| GD12694 [Drosophila simulans]
 gi|190654365|gb|EDV51608.1| GG13802 [Drosophila erecta]
 gi|194119270|gb|EDW41313.1| GM24628 [Drosophila sechellia]
 gi|194180731|gb|EDW94342.1| GE20095 [Drosophila yakuba]
 gi|194196710|gb|EDX10286.1| GD12694 [Drosophila simulans]
          Length = 264

 Score =  292 bits (748), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 145/217 (66%), Positives = 165/217 (76%), Gaps = 4/217 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR G K GSGGVA +SETN DR+ERLR+LALETIDLNKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRAGGKTGSGGVASWSETNRDRKERLRQLALETIDLNKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIK-KNLVKIGRPG 152
           TLH NEGSYLAHTQGKKHQ                   +L A  K +++ K  VKIGRPG
Sbjct: 61  TLHNNEGSYLAHTQGKKHQDNLARRAAKEAKEAPS---SLLAPEKPRVEPKKFVKIGRPG 117

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTK R+    Q  L FQ+ YPEI   ++PRHRFMSAYEQ+IEPP++  QYLLFAAEPY
Sbjct: 118 YRVTKQRELSNGQQSLLFQVDYPEITESIVPRHRFMSAYEQKIEPPDRKWQYLLFAAEPY 177

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFK 249
           ETI FKV S+EV+K EGKF+THW+ D+KQF LQF FK
Sbjct: 178 ETIGFKVPSREVEKSEGKFWTHWNRDTKQFFLQFAFK 214



>gi|354480884|ref|XP_003502633.1| PREDICTED: splicing factor 3A subunit 2-like isoform 1 [Cricetulus
           griseus]
          Length = 464

 Score =  292 bits (748), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|24663500|ref|NP_648603.1| CG10754 [Drosophila melanogaster]
 gi|7294535|gb|AAF49876.1| CG10754 [Drosophila melanogaster]
 gi|21430304|gb|AAM50830.1| LD47455p [Drosophila melanogaster]
 gi|220944472|gb|ACL84779.1| CG10754-PA [synthetic construct]
 gi|220954270|gb|ACL89678.1| CG10754-PA [synthetic construct]
          Length = 264

 Score =  292 bits (748), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 145/217 (66%), Positives = 165/217 (76%), Gaps = 4/217 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR G K GSGGVA +SETN DR+ERLR+LALETIDLNKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRAGGKTGSGGVASWSETNRDRKERLRQLALETIDLNKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIK-KNLVKIGRPG 152
           TLH NEGSYLAHTQGKKHQ                   +L A  K +++ K  VKIGRPG
Sbjct: 61  TLHNNEGSYLAHTQGKKHQDNLARRAAKEAKEAPS---SLLAPEKPRVEPKKFVKIGRPG 117

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTK R+    Q  L FQ+ YPEI   ++PRHRFMSAYEQ+IEPP++  QYLLFAAEPY
Sbjct: 118 YRVTKQRELSNGQQSLLFQVDYPEITESIVPRHRFMSAYEQKIEPPDRKWQYLLFAAEPY 177

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFK 249
           ETI FKV S+EV+K EGKF+THW+ D+KQF LQF FK
Sbjct: 178 ETIGFKVPSREVEKSEGKFWTHWNRDTKQFFLQFAFK 214



>gi|478534534|ref|XP_004441399.1| PREDICTED: splicing factor 3A subunit 2 [Ceratotherium simum simum]
          Length = 478

 Score =  292 bits (748), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 148/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPE+   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEVAEGIVPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|512863414|ref|XP_004890399.1| PREDICTED: splicing factor 3A subunit 2 [Heterocephalus glaber]
          Length = 428

 Score =  292 bits (747), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|403291739|ref|XP_003936925.1| PREDICTED: splicing factor 3A subunit 2-like [Saimiri boliviensis
           boliviensis]
          Length = 464

 Score =  292 bits (747), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|52345468|ref|NP_001004782.1| splicing factor 3a, subunit 2, 66kDa [Xenopus (Silurana)
           tropicalis]
 gi|49250573|gb|AAH74517.1| splicing factor 3a, subunit 2, 66kDa [Xenopus (Silurana)
           tropicalis]
          Length = 412

 Score =  292 bits (747), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 155/242 (64%), Positives = 175/242 (72%), Gaps = 7/242 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+R G K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRAGGKTGSGGVASASESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RDP   Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDPEMAQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSE--GIPPGIER--APM 269
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P         PPG++R   P 
Sbjct: 178 TIAFKVPSREIDKVEGKFWTHWNRETKQFFLQFHFKMEKPPQAPTLPPAPPGVKRPVPPA 237

Query: 270 VN 271
           +N
Sbjct: 238 IN 239



>gi|513009034|ref|XP_004865942.1| PREDICTED: splicing factor 3A subunit 2 [Heterocephalus glaber]
          Length = 450

 Score =  292 bits (747), Expect = 8e-77,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|472351526|ref|XP_004395446.1| PREDICTED: splicing factor 3A subunit 2 [Odobenus rosmarus
           divergens]
          Length = 471

 Score =  292 bits (747), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|297703020|ref|XP_002828453.1| PREDICTED: splicing factor 3A subunit 2 [Pongo abelii]
          Length = 457

 Score =  292 bits (747), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|348550143|ref|XP_003460892.1| PREDICTED: splicing factor 3A subunit 2-like [Cavia porcellus]
          Length = 450

 Score =  291 bits (746), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|395831337|ref|XP_003788759.1| PREDICTED: splicing factor 3A subunit 2 [Otolemur garnettii]
          Length = 464

 Score =  291 bits (746), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|301781072|ref|XP_002925957.1| PREDICTED: hypothetical protein LOC100464683 [Ailuropoda
           melanoleuca]
 gi|281347282|gb|EFB22866.1| hypothetical protein PANDA_015535 [Ailuropoda melanoleuca]
          Length = 464

 Score =  291 bits (746), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|149643081|ref|NP_001092681.1| splicing factor 3A subunit 2 [Bos taurus]
 gi|182687966|sp|A5PJN8.1|SF3A2_BOVIN RecName: Full=Splicing factor 3A subunit 2
 gi|148743822|gb|AAI42186.1| SF3A2 protein [Bos taurus]
 gi|440912177|gb|ELR61769.1| Splicing factor 3A subunit 2 [Bos grunniens mutus]
          Length = 477

 Score =  291 bits (746), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|507541948|ref|XP_004654970.1| PREDICTED: splicing factor 3A subunit 2 [Jaculus jaculus]
          Length = 469

 Score =  291 bits (745), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|296485635|tpg|DAA27750.1| TPA: splicing factor 3A subunit 2 [Bos taurus]
          Length = 431

 Score =  291 bits (745), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|466088572|ref|XP_004286406.1| PREDICTED: splicing factor 3A subunit 2 [Orcinus orca]
          Length = 464

 Score =  291 bits (745), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|470605958|ref|XP_004314032.1| PREDICTED: splicing factor 3A subunit 2 [Tursiops truncatus]
          Length = 464

 Score =  291 bits (745), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|511983275|ref|XP_004809450.1| PREDICTED: splicing factor 3A subunit 2 isoform X3 [Mustela
           putorius furo]
          Length = 457

 Score =  291 bits (745), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 165/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   V PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAEGVTPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|511917570|ref|XP_004778057.1| PREDICTED: splicing factor 3A subunit 2 isoform X3 [Mustela
           putorius furo]
          Length = 464

 Score =  291 bits (745), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 165/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   V PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAEGVTPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|507696980|ref|XP_004714348.1| PREDICTED: splicing factor 3A subunit 2 [Echinops telfairi]
          Length = 425

 Score =  291 bits (745), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|498943601|ref|XP_004542563.1| PREDICTED: splicing factor 3A subunit 2-like [Maylandia zebra]
          Length = 294

 Score =  291 bits (745), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 153/237 (64%), Positives = 171/237 (72%), Gaps = 5/237 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+R G K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRAGGKTGSGGVASASESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA          K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PAKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RDP   Q  L FQI YPEI   + PRHRFMSAYEQRIEPP++  QYLLFAAEPYE
Sbjct: 118 KVTKQRDPEMGQQSLLFQIDYPEIAEGIGPRHRFMSAYEQRIEPPDRRWQYLLFAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIPPG--IERAP 268
           TIAFKV S+E+DK E +F+THW+ ++KQF LQF FK ++P   S G  P   ++R P
Sbjct: 178 TIAFKVPSREIDKAENRFWTHWNKETKQFFLQFHFKMEKPVTQSSGPAPAATVKRPP 234



>gi|505843016|ref|XP_004615008.1| PREDICTED: splicing factor 3A subunit 2 [Sorex araneus]
          Length = 540

 Score =  291 bits (745), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASASESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTDMGQQSLLFQIDYPEIAEAIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|507651009|ref|XP_004632756.1| PREDICTED: splicing factor 3A subunit 2 [Octodon degus]
          Length = 449

 Score =  291 bits (744), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|221121042|ref|XP_002156054.1| PREDICTED: uncharacterized protein LOC100197572 [Hydra
           magnipapillata]
          Length = 501

 Score =  291 bits (744), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 166/216 (76%), Gaps = 3/216 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR G K GSGGVA +SETN DRRERLR+LALETIDLNKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRVGGKTGSGGVASWSETNKDRRERLRQLALETIDLNKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQ                 QPA + Q +V +KK  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQQNLARRAAKDAKETPS-QPAPEKQ-RVTLKK-FVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK  D  + Q  L FQI YPEI  D+ P+HRFMSAYEQR+EPP+K+ QYLL AAEPYE
Sbjct: 118 KVTKQSDVDSGQHSLLFQIDYPEIVDDMPPKHRFMSAYEQRVEPPDKSWQYLLVAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFK 249
           TI FK+ S+E+DK E KF++ W+ D+KQF LQF+FK
Sbjct: 178 TIGFKIPSREIDKSEQKFWSFWNKDTKQFFLQFYFK 213



>gi|504172826|ref|XP_004595988.1| PREDICTED: splicing factor 3A subunit 2 [Ochotona princeps]
          Length = 465

 Score =  291 bits (744), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 165/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   + PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEVGQQSLLFQIDYPEIAEGITPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|397496945|ref|XP_003819281.1| PREDICTED: splicing factor 3A subunit 2 isoform 1 [Pan paniscus]
          Length = 315

 Score =  291 bits (744), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|126323518|ref|XP_001364347.1| PREDICTED: splicing factor 3A subunit 2-like [Monodelphis
           domestica]
          Length = 473

 Score =  291 bits (744), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 148/219 (67%), Positives = 165/219 (75%), Gaps = 3/219 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAESIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDR 252
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEK 216



>gi|390478347|ref|XP_003735484.1| PREDICTED: splicing factor 3A subunit 2-like [Callithrix jacchus]
          Length = 315

 Score =  291 bits (744), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|351703665|gb|EHB06584.1| Splicing factor 3A subunit 2 [Heterocephalus glaber]
          Length = 385

 Score =  291 bits (744), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|431922245|gb|ELK19336.1| Splicing factor 3A subunit 2 [Pteropus alecto]
          Length = 443

 Score =  291 bits (744), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|30931324|gb|AAH52697.1| Sf3a2 protein [Mus musculus]
          Length = 485

 Score =  290 bits (743), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 148/220 (67%), Positives = 165/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMS YEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAEGIMPRHRFMSVYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|426229203|ref|XP_004023503.1| PREDICTED: LOW QUALITY PROTEIN: splicing factor 3A subunit 2 [Ovis
           aries]
          Length = 451

 Score =  290 bits (743), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|149034494|gb|EDL89231.1| rCG29232, isoform CRA_a [Rattus norvegicus]
          Length = 325

 Score =  290 bits (742), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 150/220 (68%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   V+PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAEGVMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|355702948|gb|EHH29439.1| Spliceosome-associated protein 62 [Macaca mulatta]
          Length = 325

 Score =  290 bits (742), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|156062160|ref|XP_001597002.1| hypothetical protein SS1G_01195 [Sclerotinia sclerotiorum 1980]
 gi|154696532|gb|EDN96270.1| hypothetical protein SS1G_01195 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 239

 Score =  290 bits (742), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 138/234 (58%), Positives = 169/234 (72%), Gaps = 7/234 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA  S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASTSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXX-IQPAL-----QAQTKVQIKKNLVK 147
           T+H N+GSYLAHTQG+KHQT                I P           +V ++KN+VK
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAREEKEGRAGIDPITGLPVGMVGAQVSVRKNMVK 120

Query: 148 IGRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLF 207
           IGRPGYK+TK RDP+TRQ GL FQ+QYPEI  DV PR RFMSAYEQ++E P+K  QY+L 
Sbjct: 121 IGRPGYKITKTRDPVTRQQGLLFQLQYPEIAADVQPRIRFMSAYEQKVEDPDKDFQYMLV 180

Query: 208 AAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIP 261
           AAEPYET  FK+Q++E+D+   +++T WD D K+F +Q  FK +R   YS G+P
Sbjct: 181 AAEPYETCGFKLQAREIDRSNDRYWTWWDSDLKEFWVQIMFKTEREERYS-GVP 233



>gi|409219|gb|AAA60301.1| spiceosomal protein [Homo sapiens]
          Length = 464

 Score =  290 bits (742), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 148/220 (67%), Positives = 165/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRE LR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRREPLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|397496947|ref|XP_003819282.1| PREDICTED: splicing factor 3A subunit 2 isoform 2 [Pan paniscus]
          Length = 408

 Score =  290 bits (742), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDSEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|507967666|ref|XP_004689436.1| PREDICTED: splicing factor 3A subunit 2 [Condylura cristata]
          Length = 315

 Score =  290 bits (741), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 149/220 (67%), Positives = 166/220 (75%), Gaps = 3/220 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTDMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFKMEKP 217



>gi|212542377|ref|XP_002151343.1| splicing factor 3a subunit 2, putative [Talaromyces marneffei ATCC
           18224]
 gi|210066250|gb|EEA20343.1| splicing factor 3a subunit 2, putative [Talaromyces marneffei ATCC
           18224]
          Length = 234

 Score =  289 bits (740), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 139/229 (60%), Positives = 171/229 (74%), Gaps = 2/229 (0%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA  S TN DRRERLRKLALETIDL KDPYF KNHLGS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASQSATNADRRERLRKLALETIDLAKDPYFFKNHLGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           T+H N+GSYLAHTQG+KHQT                   +     VQ+KKN+VKIGRPGY
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAREQKEGKAQDGVVPGAMGVQVKKNVVKIGRPGY 120

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRI-EPPNKAHQYLLFAAEPY 212
           K+TK RDP+TRQLGL FQ+QY EI   V+PR RFMSA+EQ++ +PP+K  QYLL AAEPY
Sbjct: 121 KITKTRDPMTRQLGLLFQLQYQEITPGVVPRVRFMSAFEQKVDDPPDKNFQYLLVAAEPY 180

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIP 261
           +T  FK+Q++E+D+ EG+++T +D DSK+F +Q  FK +R   YS G+P
Sbjct: 181 QTCGFKLQAREIDRREGRYWTWFDEDSKEFWIQIMFKTEREERYS-GVP 228



>gi|242768747|ref|XP_002341631.1| splicing factor 3a subunit 2, putative [Talaromyces stipitatus ATCC
           10500]
 gi|218724827|gb|EED24244.1| splicing factor 3a subunit 2, putative [Talaromyces stipitatus ATCC
           10500]
          Length = 234

 Score =  289 bits (740), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 139/229 (60%), Positives = 171/229 (74%), Gaps = 2/229 (0%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA  S TN DRRERLRKLALETIDL KDPYF KNHLGS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASQSATNADRRERLRKLALETIDLAKDPYFFKNHLGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           T+H N+GSYLAHTQG+KHQT                   L     VQ+KKN+VKIGRPGY
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAREQKEGKAQDGVLPGAMGVQVKKNVVKIGRPGY 120

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRI-EPPNKAHQYLLFAAEPY 212
           K+TK RDP+TRQLGL FQ+QY EI   V+PR RFMSA+EQ++ +PP+K  QYLL AAEPY
Sbjct: 121 KITKTRDPLTRQLGLLFQLQYQEITPGVVPRVRFMSAFEQKVDDPPDKNFQYLLVAAEPY 180

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIP 261
           +T  FK+Q++++D+ EG+++T +D DSK+F +Q  FK +R   YS G+P
Sbjct: 181 QTCGFKLQARDIDRREGRYWTWFDEDSKEFWIQIMFKTEREERYS-GVP 228



>gi|41054840|ref|NP_957337.1| splicing factor 3A subunit 2 [Danio rerio]
 gi|28278443|gb|AAH45907.1| Splicing factor 3a, subunit 2 [Danio rerio]
 gi|42542937|gb|AAH66469.1| Splicing factor 3a, subunit 2 [Danio rerio]
 gi|182891928|gb|AAI65546.1| Sf3a2 protein [Danio rerio]
          Length = 278

 Score =  289 bits (739), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 152/245 (62%), Positives = 176/245 (71%), Gaps = 4/245 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+R G K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRAGGKTGSGGVASASESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQ+                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQSNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RDP   Q  L FQI YPEI   + PRHRFMSAYEQRIEPP++  QYLLFAAEPYE
Sbjct: 118 KVTKQRDPEIGQQSLLFQIDYPEIAEGIGPRHRFMSAYEQRIEPPDRRWQYLLFAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIPPGIERAP-MVNP 272
           TIAFKV S+E+DK E +F+THW+ ++KQF LQF FK ++  +   G P G++  P ++  
Sbjct: 178 TIAFKVPSREIDKAETRFWTHWNRETKQFFLQFHFKMEKALVAPSGPPVGVKHPPSLITG 237

Query: 273 LNPYN 277
           L P +
Sbjct: 238 LGPRD 242



>gi|91080581|ref|XP_973561.1| PREDICTED: similar to AGAP011035-PA [Tribolium castaneum]
 gi|270005516|gb|EFA01964.1| hypothetical protein TcasGA2_TC007585 [Tribolium castaneum]
          Length = 271

 Score =  288 bits (738), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 154/236 (65%), Positives = 171/236 (72%), Gaps = 12/236 (5%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNRPG K G GGVA +SETN DRRERLR+LALETIDL KDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRPGGKTGGGGVASWSETNRDRRERLRQLALETIDLQKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQ                +   LQ +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQANLARRAAKEAKDAPTL---LQPEKPRVEPKRFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           +VTK RDP T Q  L FQI YPEI  +VIPRHRFMSAYEQ+IEPP++  QYLLFAAEPYE
Sbjct: 118 RVTKQRDPETGQQSLLFQIDYPEITDNVIPRHRFMSAYEQKIEPPDRKWQYLLFAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKND---------RPGMYSEGI 260
           TIAFKV S+EV+K + KF+THW+ D+KQF LQF FKN+         RPG    G+
Sbjct: 178 TIAFKVPSREVEKTDNKFWTHWNIDTKQFFLQFAFKNEAKKPTTIIARPGGMMGGV 233



>gi|452848355|gb|EME50287.1| hypothetical protein DOTSEDRAFT_77331 [Dothistroma septosporum
           NZE10]
          Length = 233

 Score =  288 bits (738), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 140/229 (61%), Positives = 166/229 (72%), Gaps = 2/229 (0%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA  S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASQSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           T+H N+GSYLAHTQG+KHQT                +        VQ+K+N+VKIGRPGY
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAKDAQLGKKQEEGYTGANAVQVKRNVVKIGRPGY 120

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIE-PPNKAHQYLLFAAEPY 212
            + K RDPITRQ GL F +QYPEI   V P+ RFMSAYEQ+ E PP+KA QYLL AAEPY
Sbjct: 121 SIVKTRDPITRQEGLLFSLQYPEIAQGVEPKVRFMSAYEQKQEDPPDKAFQYLLVAAEPY 180

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIP 261
           ET  FK+Q++EVD+ E K++T +D DSKQF  Q  FK +R   YS G+P
Sbjct: 181 ETCGFKIQAREVDRREDKYWTWFDADSKQFWCQINFKTEREERYS-GVP 228



>gi|494830929|gb|EON67440.1| hypothetical protein W97_06694 [Coniosporium apollinis CBS 100218]
          Length = 238

 Score =  288 bits (738), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 141/233 (60%), Positives = 175/233 (75%), Gaps = 4/233 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA  S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASQSSTNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTK-VQIKKNLVKIGRPG 152
           T+H N+GSYLAHTQG+KHQT                +  L    + VQ+++N+VKIGRPG
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAREAKEGRDREGLLPGIGQGVQVRRNVVKIGRPG 120

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRI-EPPNKAHQYLLFAAEP 211
           YK+TKVRDP+TRQ GL FQ+QYPEI   V+PR RFMSA+EQ++ +PP+K  QYLL AAEP
Sbjct: 121 YKITKVRDPLTRQNGLLFQLQYPEITPGVVPRVRFMSAFEQKVDDPPDKTFQYLLVAAEP 180

Query: 212 YETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSE--GIPP 262
           YET  FK+Q++EVD+ EG+F+T +D DSK+F +Q  FK +R   YS   G+ P
Sbjct: 181 YETCGFKLQAREVDRREGRFWTWFDEDSKEFWIQVLFKTERDERYSNVPGLAP 233



>gi|259155264|ref|NP_001158873.1| splicing factor 3A subunit 2 [Salmo salar]
 gi|223647794|gb|ACN10655.1| Splicing factor 3A subunit 2 [Salmo salar]
          Length = 308

 Score =  288 bits (737), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 153/237 (64%), Positives = 173/237 (72%), Gaps = 5/237 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+R G K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRAGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RDP + Q  L FQI YPEI   + PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDPESGQQSLLFQIDYPEIAEGIGPRHRFMSAYEQRIEPPDRRWQYLLLAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEG-IPP-GIERAP 268
           TIAFKV S+E+DK E +F+THW+ D+KQF LQF FK ++      G +PP G++R P
Sbjct: 178 TIAFKVPSREIDKAESRFWTHWNKDTKQFFLQFHFKMEKSLAPPSGPVPPMGVKRPP 234



>gi|395513272|ref|XP_003760851.1| PREDICTED: splicing factor 3A subunit 2 [Sarcophilus harrisii]
          Length = 261

 Score =  288 bits (736), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 148/219 (67%), Positives = 165/219 (75%), Gaps = 3/219 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAESIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDR 252
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK ++
Sbjct: 178 TIAFKVPSREIDKTEGKFWTHWNRETKQFFLQFHFKMEK 216



>gi|321465384|gb|EFX76386.1| putative splicing factor 3A subunit 2 [Daphnia pulex]
          Length = 260

 Score =  288 bits (736), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 148/218 (67%), Positives = 171/218 (78%), Gaps = 3/218 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR G K G GGVA +SE+N DRRERLR+LALETIDLNKDPYFMKNHLG+YECKLCL
Sbjct: 1   MDFQNRVGGKTGGGGVASWSESNRDRRERLRQLALETIDLNKDPYFMKNHLGTYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQ+               IQP+L+ + +V I+K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQSNLARRAAKDAKDSP-IQPSLE-KARVDIRK-FVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           +VTK RDP +    + FQ+ YPEI   V P+HRFMSAYEQRIEPP++  QYLLFAAEPYE
Sbjct: 118 RVTKQRDPNSGHQSMLFQVDYPEIAEGVAPKHRFMSAYEQRIEPPDRRWQYLLFAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKND 251
           TIAFK+ S+EVDK EGKF+THW+ D++QF LQF FK D
Sbjct: 178 TIAFKIPSREVDKSEGKFWTHWNKDARQFFLQFSFKLD 215



>gi|410950027|ref|XP_003981715.1| PREDICTED: splicing factor 3A subunit 2 [Felis catus]
          Length = 335

 Score =  287 bits (735), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 149/216 (68%), Positives = 163/216 (75%), Gaps = 3/216 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   V+PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAEGVMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFK 249
           TIAFKV S+E+DK EGKF+THW+ ++KQF LQF FK
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQFFLQFHFK 213



>gi|340371467|ref|XP_003384267.1| PREDICTED: splicing factor 3A subunit 2-like [Amphimedon
           queenslandica]
          Length = 232

 Score =  287 bits (734), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 142/229 (62%), Positives = 173/229 (75%), Gaps = 3/229 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+Q+R GSK G GGVA YSE++ DR+ERL+KLA+ETID+ KDPYFMKNHLG YECKLCL
Sbjct: 1   MDYQHRVGSKTGGGGVASYSESSKDRKERLKKLAMETIDITKDPYFMKNHLGQYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           T+H  EGSYLAHTQGKKHQ+               + PAL+ + +V IKK  +KIGRPGY
Sbjct: 61  TIHNTEGSYLAHTQGKKHQSNLAQRAAKEASETQML-PALE-KPRVDIKK-FIKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD  T Q  LFFQ+ YPEI   + PRHRFMSAYEQR+E P+KA Q+LLFAAEPYE
Sbjct: 118 KVTKQRDTATGQHSLFFQVDYPEIVDGLRPRHRFMSAYEQRMEAPDKAWQFLLFAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIPP 262
           TIAFK+ S+E+DK EGK +T W+ ++KQF LQF FK+D   + +  +PP
Sbjct: 178 TIAFKIPSREIDKSEGKLWTQWNNETKQFFLQFHFKSDYSQVPAAPLPP 226



>gi|332375997|gb|AEE63139.1| unknown [Dendroctonus ponderosae]
          Length = 268

 Score =  286 bits (733), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 150/228 (65%), Positives = 167/228 (73%), Gaps = 5/228 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNRPG K G GGVA +SE+N DRRERLR+LALETIDL KDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRPGGKTGGGGVASWSESNRDRRERLRQLALETIDLQKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQ                +   LQ +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQANLARRAAKEAKDAPTM---LQPEKPRVEPKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           +VTK RDP   Q  L FQI YPEI   V+PRHRFMSAYEQ+IEPP++  QYLLFAAEPYE
Sbjct: 118 RVTKQRDPENGQQSLLFQIDYPEIADHVLPRHRFMSAYEQKIEPPDRKWQYLLFAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFK--NDRPGMYSEG 259
           TIAFKV S+EV+K + KF+THW+ D+KQF LQF FK  N +P M S  
Sbjct: 178 TIAFKVPSREVEKTDNKFWTHWNRDTKQFFLQFAFKAENKKPTMVSRA 225



>gi|119500174|ref|XP_001266844.1| splicing factor 3a subunit 2, putative [Neosartorya fischeri NRRL
           181]
 gi|119415009|gb|EAW24947.1| splicing factor 3a subunit 2, putative [Neosartorya fischeri NRRL
           181]
          Length = 238

 Score =  286 bits (733), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 142/238 (59%), Positives = 178/238 (74%), Gaps = 6/238 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA +S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASHSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPA-LQAQTKVQIKKNLVKIGRPG 152
           T+H N+GSYLAHTQG+KHQT                 PA L     VQ+KK  +KIGRPG
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAREQREGKNQDPAMLPGAMGVQVKKQAIKIGRPG 120

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRI-EPPNKAHQYLLFAAEP 211
           YK+TK+RDP+TRQLGL FQ+QY EI   V PR RFMSA+EQ++ EPP+K  QYL+ AAEP
Sbjct: 121 YKITKIRDPLTRQLGLLFQLQYQEIAPGVKPRVRFMSAFEQKVEEPPDKNFQYLVVAAEP 180

Query: 212 YETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIPPGIERAPM 269
           Y+T  FK+Q++E+D+ EG+++T +D DSK+F +Q  FK +R   +S G+ PG+  APM
Sbjct: 181 YQTCGFKLQAREIDRREGRYWTWFDEDSKEFWIQIMFKTEREERFS-GV-PGL--APM 234



>gi|303311265|ref|XP_003065644.1| Splicing factor 3A subunit 2 , putative [Coccidioides posadasii
           C735 delta SOWgp]
 gi|240105306|gb|EER23499.1| Splicing factor 3A subunit 2 , putative [Coccidioides posadasii
           C735 delta SOWgp]
 gi|320039470|gb|EFW21404.1| splicing factor 3a subunit 2 [Coccidioides posadasii str. Silveira]
          Length = 239

 Score =  286 bits (733), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 141/231 (61%), Positives = 173/231 (74%), Gaps = 4/231 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA +S TN DRRERLRKLALE IDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRVGSKFGGGGVASHSATNADRRERLRKLALEHIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPA--LQAQTKVQIKKNLVKIGRP 151
           T+H N+GSYLAHTQG+KHQT                     L A   VQ+K+N VKIGRP
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAREQKEGKSQADGSLLPAGMGVQVKRNTVKIGRP 120

Query: 152 GYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRI-EPPNKAHQYLLFAAE 210
           GYK+TK+RDP+TRQ GL FQ+QY EI  DV+PR RFMSA+EQ++ +PP+K  QYLL AAE
Sbjct: 121 GYKITKIRDPLTRQHGLLFQLQYQEITPDVVPRVRFMSAFEQKVDDPPDKNFQYLLVAAE 180

Query: 211 PYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIP 261
           PY+T  FK+Q++EVD+ EGKF+T +D DSK+F +Q  FK +R   YS G+P
Sbjct: 181 PYQTCGFKLQAREVDRREGKFWTWFDEDSKEFWVQILFKTEREERYS-GVP 230



>gi|154318157|ref|XP_001558397.1| conserved hypothetical protein [Botryotinia fuckeliana B05.10]
 gi|347441675|emb|CCD34596.1| similar to splicing factor 3a subunit 2 [Botryotinia fuckeliana T4]
 gi|472244015|gb|EMR88651.1| putative splicing factor 3a subunit 2 protein [Botryotinia
           fuckeliana BcDW1]
          Length = 239

 Score =  286 bits (732), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 137/234 (58%), Positives = 169/234 (72%), Gaps = 7/234 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA  S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASTSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXX-IQPAL-----QAQTKVQIKKNLVK 147
           T+H N+GSYLAHTQG+KHQT                I P           +V ++KN+VK
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAREEKEGRSGIDPITGLPVGMVGAQVSVRKNMVK 120

Query: 148 IGRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLF 207
           IGRPGYK+TK RDP+TRQ GL FQ+QYPEI  DV PR RFMSA+EQ++E P+K  QY+L 
Sbjct: 121 IGRPGYKITKTRDPVTRQQGLLFQLQYPEIVSDVQPRVRFMSAFEQKVEDPDKDFQYMLV 180

Query: 208 AAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIP 261
           AAEPYET  FK+Q++E+D+   +++T WD D K+F +Q  FK +R   YS G+P
Sbjct: 181 AAEPYETCGFKLQAREIDRSNERYWTWWDSDLKEFWVQIMFKTEREERYS-GVP 233



>gi|115391101|ref|XP_001213055.1| hypothetical protein ATEG_03877 [Aspergillus terreus NIH2624]
 gi|114193979|gb|EAU35679.1| hypothetical protein ATEG_03877 [Aspergillus terreus NIH2624]
          Length = 238

 Score =  286 bits (731), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 142/240 (59%), Positives = 178/240 (74%), Gaps = 6/240 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR GSK G GGVA  S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDFQNRAGSKFGGGGVASQSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPA-LQAQTKVQIKKNLVKIGRPG 152
           T+H N+GSYLAHTQG+KHQT                 P+ L     VQ+KK  +KIGRPG
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAREQREGKNQDPSTLPGAMGVQVKKQTIKIGRPG 120

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIE-PPNKAHQYLLFAAEP 211
           YK+TK+RDP+TRQLGL FQ+QY EI   V PR RFMSA+EQ++E PP+K  QYL+ AAEP
Sbjct: 121 YKITKIRDPLTRQLGLLFQLQYQEITPGVQPRVRFMSAFEQKVEDPPDKNFQYLVVAAEP 180

Query: 212 YETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIPPGIERAPMVN 271
           Y+T  FK+Q++E+D+ EG+++T +D DSK+F +Q  FK +R   +S G+ PG+  APM +
Sbjct: 181 YQTCGFKLQAREIDRREGRYWTWFDEDSKEFWIQIMFKTEREERFS-GV-PGL--APMAS 236



>gi|70993590|ref|XP_751642.1| splicing factor 3a subunit 2 [Aspergillus fumigatus Af293]
 gi|66849276|gb|EAL89604.1| splicing factor 3a subunit 2, putative [Aspergillus fumigatus
           Af293]
 gi|159125434|gb|EDP50551.1| splicing factor 3a subunit 2, putative [Aspergillus fumigatus
           A1163]
          Length = 238

 Score =  286 bits (731), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 142/238 (59%), Positives = 178/238 (74%), Gaps = 6/238 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA +S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASHSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPA-LQAQTKVQIKKNLVKIGRPG 152
           T+H N+GSYLAHTQG+KHQT                 PA L     VQ+KK  +KIGRPG
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAREQREGKNQDPAMLPGAMGVQVKKQAIKIGRPG 120

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRI-EPPNKAHQYLLFAAEP 211
           YK+TK+RDP+TRQLGL FQ+QY EI   V PR RFMSA+EQ++ EPP+K  QYL+ AAEP
Sbjct: 121 YKITKIRDPLTRQLGLLFQLQYQEITPGVKPRVRFMSAFEQKVEEPPDKNFQYLVVAAEP 180

Query: 212 YETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIPPGIERAPM 269
           Y+T  FK+Q++E+D+ EG+++T +D DSK+F +Q  FK +R   +S G+ PG+  APM
Sbjct: 181 YQTCGFKLQAREIDRREGRYWTWFDEDSKEFWIQIMFKTEREERFS-GV-PGL--APM 234



>gi|410924461|ref|XP_003975700.1| PREDICTED: splicing factor 3A subunit 2-like [Takifugu rubripes]
          Length = 289

 Score =  286 bits (731), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 147/219 (67%), Positives = 164/219 (74%), Gaps = 3/219 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+R G K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRAGGKTGSGGVASTSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA          K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PAKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RDP T Q  L FQI YPE+   + PRHRFMSAYEQRIEPP++  QYLLFAAEPYE
Sbjct: 118 KVTKQRDPETGQQSLLFQIDYPEVAEGIGPRHRFMSAYEQRIEPPDRRWQYLLFAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDR 252
           TIAFKV S+E+DK E +F+THW+ ++KQF LQF FK ++
Sbjct: 178 TIAFKVPSREIDKAETRFWTHWNRETKQFFLQFHFKMEK 216



>gi|391346408|ref|XP_003747466.1| PREDICTED: splicing factor 3A subunit 2-like [Metaseiulus
           occidentalis]
          Length = 220

 Score =  285 bits (730), Expect = 7e-75,   Method: Compositional matrix adjust.
 Identities = 146/221 (66%), Positives = 170/221 (76%), Gaps = 4/221 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+R G K G+GGVA +SETN DRRERLR+LALETIDL KDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRAGGKTGTGGVASWSETNRDRRERLRQLALETIDLQKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQ                +QPA  A+ +V IKK  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQ-QNLARRAAREARDNPVQPA-PAKPRVDIKK-FVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           +VTK RD  T Q  L FQ+ YPEI  +++PRHRFMSAYEQ+IEPP++  QYLLFAAEPYE
Sbjct: 118 RVTKQRDSETGQQSLLFQVDYPEISDNIVPRHRFMSAYEQKIEPPDRKWQYLLFAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEG-KFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+EVDK +  +F+T W+ ++KQF LQF +K  +P
Sbjct: 178 TIAFKVPSREVDKSDSERFWTLWNKETKQFFLQFSYKLPKP 218



>gi|296420560|ref|XP_002839837.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295636043|emb|CAZ84028.1| unnamed protein product [Tuber melanosporum]
          Length = 239

 Score =  285 bits (730), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 140/235 (59%), Positives = 177/235 (75%), Gaps = 9/235 (3%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           M ++ R GS+ G GGVA +S +N DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MAYEGRVGSRFGGGGVASHSVSNQDRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQP------ALQAQTKVQIKKNLVK 147
           T+H N+GSYLAHTQG+KHQT               + P       +  Q  +  KK+L K
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAREAKEGRNLDPITGLPQGMIGQQLIAPKKHL-K 119

Query: 148 IGRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIE-PPNKAHQYLL 206
           IGRPGYK+TK+RDP+TRQLGL FQ+QYPEIG ++ PR+RFMSA+EQR+E P +K  QYLL
Sbjct: 120 IGRPGYKITKLRDPVTRQLGLLFQLQYPEIGTEIKPRYRFMSAFEQRVEVPADKNFQYLL 179

Query: 207 FAAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIP 261
            AAEPYETI+FK+Q++EVD+  GKF+TH+D DSK+F LQ FFK +R   Y+ G+P
Sbjct: 180 VAAEPYETISFKLQAREVDRSPGKFWTHFDSDSKEFFLQLFFKTEREERYA-GVP 233



>gi|295669464|ref|XP_002795280.1| splicing factor 3a [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226285214|gb|EEH40780.1| splicing factor 3a [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 236

 Score =  285 bits (728), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 139/230 (60%), Positives = 171/230 (74%), Gaps = 3/230 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA YS TN DRRERLRKLALE IDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASYSATNADRRERLRKLALENIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQ-AQTKVQIKKNLVKIGRPG 152
           T+H N+GSYLAHTQG+KHQT                  +L  A   VQ+K+N VKIGRPG
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAREQKEGKGQDGSLLPASMGVQVKRNTVKIGRPG 120

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIE-PPNKAHQYLLFAAEP 211
           YK+TK RDP TRQ GL FQ+QY EI   V+PR RFMSA+EQ+++ PP+K  QYLL AAEP
Sbjct: 121 YKITKTRDPFTRQHGLLFQLQYQEITPGVVPRVRFMSAFEQKVDNPPDKNFQYLLVAAEP 180

Query: 212 YETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIP 261
           Y+T  FK+Q++E+D+ EGKF+T +D D+K+F +Q  FK +R   YS G+P
Sbjct: 181 YQTCGFKLQARELDRSEGKFWTWFDEDNKEFWIQIMFKTEREERYS-GVP 229



>gi|170586560|ref|XP_001898047.1| sf3a2-prov protein [Brugia malayi]
 gi|158594442|gb|EDP33026.1| sf3a2-prov protein, putative [Brugia malayi]
          Length = 250

 Score =  285 bits (728), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 148/225 (65%), Positives = 167/225 (74%), Gaps = 3/225 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR G K G GGVA +S+ NVDRRERLR+LALETIDL KDPYFMKNHLG YECKLCL
Sbjct: 1   MDFQNRAGGKTGGGGVASWSDANVDRRERLRQLALETIDLQKDPYFMKNHLGGYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQ+               +   L  Q KV+ KK  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQSNLARRAAKEATDQPYM--PLPQQVKVEPKK-FVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RDP T Q  L FQI YPEI   V PRHRFMSAYEQ+++PP+K  QY+LFAAEPYE
Sbjct: 118 KVTKERDPATGQQALLFQIDYPEIAESVTPRHRFMSAYEQKVQPPDKRWQYILFAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSE 258
           TIAFK+ S+EVDK E KF+T W+ D+KQF +QF F+ DR   + E
Sbjct: 178 TIAFKIPSREVDKTEDKFWTLWNKDTKQFFMQFAFRFDRISQHDE 222



>gi|312083676|ref|XP_003143962.1| hypothetical protein LOAG_08382 [Loa loa]
 gi|307760875|gb|EFO20109.1| hypothetical protein LOAG_08382 [Loa loa]
          Length = 250

 Score =  284 bits (727), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 148/225 (65%), Positives = 167/225 (74%), Gaps = 3/225 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR G K G GGVA +S+ NVDRRERLR+LALETIDL KDPYFMKNHLG YECKLCL
Sbjct: 1   MDFQNRAGGKTGGGGVASWSDANVDRRERLRQLALETIDLQKDPYFMKNHLGGYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQ+               +   L  Q KV+ KK  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQSNLARRAAKEATDQPYM--PLPQQVKVEPKK-FVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RDP T Q  L FQI YPEI   V PRHRFMSAYEQ+++PP+K  QY+LFAAEPYE
Sbjct: 118 KVTKERDPATGQQALLFQIDYPEIAEGVTPRHRFMSAYEQKVQPPDKRWQYILFAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSE 258
           TIAFK+ S+EVDK E KF+T W+ D+KQF +QF F+ DR   + E
Sbjct: 178 TIAFKIPSREVDKAEDKFWTLWNKDTKQFFMQFAFRFDRMSQHDE 222



>gi|67538720|ref|XP_663134.1| hypothetical protein AN5530.2 [Aspergillus nidulans FGSC A4]
 gi|40743500|gb|EAA62690.1| hypothetical protein AN5530.2 [Aspergillus nidulans FGSC A4]
 gi|259485015|tpe|CBF81728.1| TPA: splicing factor 3a subunit 2, putative (AFU_orthologue;
           AFUA_4G11880) [Aspergillus nidulans FGSC A4]
          Length = 237

 Score =  284 bits (727), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 140/238 (58%), Positives = 177/238 (74%), Gaps = 6/238 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA +S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASHSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPA-LQAQTKVQIKKNLVKIGRPG 152
           T+H N+GSYLAHTQG+KHQT                 PA L     VQ++K  +KIGRPG
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAREQREGKNADPASLPGAMGVQVRKQTIKIGRPG 120

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRI-EPPNKAHQYLLFAAEP 211
           YK+TK+RDP+TRQ GL FQ+QY EI   V PR RFMSA+EQ++ EPP+K  QYL+ AAEP
Sbjct: 121 YKITKIRDPLTRQFGLLFQLQYQEITPGVKPRVRFMSAFEQKVEEPPDKNFQYLVIAAEP 180

Query: 212 YETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIPPGIERAPM 269
           Y+T  FK+Q++E+D+ EG+++T +D DSK+F +Q  FK +R   +S G+ PG+  APM
Sbjct: 181 YQTCGFKLQAREIDRREGRYWTWFDEDSKEFWVQIMFKTEREERFS-GV-PGL--APM 234



>gi|242022601|ref|XP_002431728.1| Splicing factor 3A subunit, putative [Pediculus humanus corporis]
 gi|212517043|gb|EEB18990.1| Splicing factor 3A subunit, putative [Pediculus humanus corporis]
          Length = 301

 Score =  284 bits (727), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 148/216 (68%), Positives = 168/216 (77%), Gaps = 3/216 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR G K G GGVA +SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRAGGKTGGGGVATWSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQ                 QPA + + +V +KK  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQANLARRAAKDAKDAPQ-QPAPE-KPRVDVKK-FVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           +VTK RDP + Q  L FQI YPEI   V+PRHRFMSAYEQR+EPP++  QYLLFAAEPYE
Sbjct: 118 RVTKQRDPDSGQQSLLFQIDYPEIVEGVLPRHRFMSAYEQRVEPPDRKWQYLLFAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFK 249
           TI+FKV S+EVDK + KF+THW+ D+KQF LQF FK
Sbjct: 178 TISFKVPSREVDKSDTKFWTHWNKDTKQFFLQFSFK 213



>gi|512196423|gb|EPE25260.1| hypothetical protein GLAREA_11841 [Glarea lozoyensis ATCC 20868]
          Length = 244

 Score =  284 bits (727), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 137/242 (56%), Positives = 172/242 (71%), Gaps = 14/242 (5%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA  S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASTSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQ------PALQAQTKVQIKKNLVK 147
           T+H N+GSYLAHTQG+KHQT                       P      +V ++KN+VK
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAREQKEGRAGTDPVTGLPIGMVGAQVNVRKNVVK 120

Query: 148 IGRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRI-EPPNKAHQYLL 206
           IGRPGYK+TK+RDP+TRQ GL FQ+QYPEI ++V P+ RFMSA+EQ++ +PP+K  QY+L
Sbjct: 121 IGRPGYKITKIRDPVTRQQGLLFQLQYPEISVEVQPKVRFMSAFEQKVDDPPDKNFQYML 180

Query: 207 FAAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDR-------PGMYSEG 259
            AAEPYET  FK+Q++EVD+   +F+T WD D K+F +Q  FK +R       PG+   G
Sbjct: 181 IAAEPYETCGFKLQAREVDRTNDRFWTWWDSDLKEFWVQVMFKTEREERYSGVPGLAPSG 240

Query: 260 IP 261
           IP
Sbjct: 241 IP 242



>gi|225682714|gb|EEH20998.1| splicing factor 3a [Paracoccidioides brasiliensis Pb03]
          Length = 259

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 139/230 (60%), Positives = 171/230 (74%), Gaps = 3/230 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA YS TN DRRERLRKLALE IDL+KDPYF KNH+GS+EC+LCL
Sbjct: 24  MDYQNRAGSKFGGGGVASYSATNADRRERLRKLALENIDLDKDPYFFKNHVGSFECRLCL 83

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQ-AQTKVQIKKNLVKIGRPG 152
           T+H N+GSYLAHTQG+KHQT                  +L  A   VQ+K+N VKIGRPG
Sbjct: 84  TVHQNDGSYLAHTQGRKHQTNLARRAAREQKEGKGQDGSLLPASMGVQVKRNTVKIGRPG 143

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIE-PPNKAHQYLLFAAEP 211
           YK+TK RDP TRQ GL FQ+QY EI   V+PR RFMSA+EQ+++ PP+K  QYLL AAEP
Sbjct: 144 YKITKTRDPFTRQHGLLFQLQYQEITPGVVPRVRFMSAFEQKVDNPPDKNFQYLLVAAEP 203

Query: 212 YETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIP 261
           Y+T  FK+Q++E+D+ EGKF+T +D D+K+F +Q  FK +R   YS G+P
Sbjct: 204 YQTCGFKLQARELDRSEGKFWTWFDEDNKEFWIQIMFKTEREERYS-GVP 252



>gi|226290149|gb|EEH45633.1| splicing factor 3a subunit 2 [Paracoccidioides brasiliensis Pb18]
          Length = 259

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 139/230 (60%), Positives = 171/230 (74%), Gaps = 3/230 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA YS TN DRRERLRKLALE IDL+KDPYF KNH+GS+EC+LCL
Sbjct: 24  MDYQNRAGSKFGGGGVASYSATNADRRERLRKLALENIDLDKDPYFFKNHVGSFECRLCL 83

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQ-AQTKVQIKKNLVKIGRPG 152
           T+H N+GSYLAHTQG+KHQT                  +L  A   VQ+K+N VKIGRPG
Sbjct: 84  TVHQNDGSYLAHTQGRKHQTNLARRAAREQKEGKGQDGSLLPASMGVQVKRNTVKIGRPG 143

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIE-PPNKAHQYLLFAAEP 211
           YK+TK RDP TRQ GL FQ+QY EI   V+PR RFMSA+EQ+++ PP+K  QYLL AAEP
Sbjct: 144 YKITKTRDPFTRQHGLLFQLQYQEITPGVVPRVRFMSAFEQKVDNPPDKNFQYLLVAAEP 203

Query: 212 YETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIP 261
           Y+T  FK+Q++E+D+ EGKF+T +D D+K+F +Q  FK +R   YS G+P
Sbjct: 204 YQTCGFKLQARELDRSEGKFWTWFDEDNKEFWIQIMFKTEREERYS-GVP 252



>gi|170033891|ref|XP_001844809.1| splicing factor 3A subunit 2 [Culex quinquefasciatus]
 gi|167875054|gb|EDS38437.1| splicing factor 3A subunit 2 [Culex quinquefasciatus]
          Length = 251

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 148/217 (68%), Positives = 165/217 (76%), Gaps = 5/217 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR G K G GGVA +SE+N DRRERLR+LALETIDLNKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRAGGKTGGGGVASWSESNRDRRERLRQLALETIDLNKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIK-KNLVKIGRPG 152
           TLH NEGSYLAHTQGKKHQ                  P+     K +I+ K  VKIGRPG
Sbjct: 61  TLHNNEGSYLAHTQGKKHQANLARRAAKEAKEA----PSSMQPEKPRIEPKKFVKIGRPG 116

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTK R+P   Q  L FQI YPEI   +IPRHRFMSAYEQ+IEPP++  QYLLFAAEPY
Sbjct: 117 YRVTKQREPDNHQQSLLFQIDYPEIQDGIIPRHRFMSAYEQKIEPPDRKWQYLLFAAEPY 176

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFK 249
           ETIAFKV S+EV+K EGKF+THW+ D+KQF LQF FK
Sbjct: 177 ETIAFKVPSREVEKTEGKFWTHWNKDTKQFFLQFSFK 213



>gi|406860079|gb|EKD13139.1| splicing factor 3a [Marssonina brunnea f. sp. 'multigermtubi'
           MB_m1]
          Length = 244

 Score =  284 bits (726), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 136/235 (57%), Positives = 170/235 (72%), Gaps = 8/235 (3%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA  S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASTSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXX------XIQPALQAQTKVQIKKNLVK 147
           T+H N+GSYLAHTQG+KHQT                       P      +V +++N+VK
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAKEQKEGRTGLDPVTGLPVGMVGAQVAVRRNVVK 120

Query: 148 IGRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRI-EPPNKAHQYLL 206
           IGRPGYK+TK RDP+TRQ GL FQ+QYPEI  DV P+ RFMSA+EQ++ +PP+K  QY+L
Sbjct: 121 IGRPGYKITKTRDPVTRQQGLVFQLQYPEIAPDVTPKVRFMSAFEQKVDDPPDKNFQYML 180

Query: 207 FAAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIP 261
            AAEPYET  FK+Q++EVD+   +++T WDPD K+F +Q  FK +R   YS G+P
Sbjct: 181 VAAEPYETCGFKLQAREVDRTNERYYTWWDPDLKEFWVQVMFKTEREERYS-GVP 234



>gi|483494043|gb|EOA93398.1| Splicing factor 3A subunit 2, partial [Anas platyrhynchos]
          Length = 205

 Score =  283 bits (725), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 159/208 (76%), Gaps = 3/208 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASASESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RDP T Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDPETGQQSLLFQIDYPEIAESIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQ 241
           TIAFKV S+E+DK EGKF+THW+ ++KQ
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQ 205



>gi|313224972|emb|CBY20764.1| unnamed protein product [Oikopleura dioica]
          Length = 235

 Score =  283 bits (725), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 144/222 (64%), Positives = 164/222 (73%), Gaps = 2/222 (0%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR G K G+GG A +S+ N DRRERLR+LALETIDL KDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRAGGKTGTGGQASWSDMNKDRRERLRQLALETIDLAKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQ                 Q A  A+  V +KK  +KIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQANLARRAAKEAKEMGGPQIA-PARPNVPLKK-FIKIGRPGY 118

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK R P T Q  L FQ+ YPEI   + PRHRFMSAYEQ IEPP++  QYLLFAAEPYE
Sbjct: 119 KVTKQRCPHTGQQSLLFQVDYPEIVDGLEPRHRFMSAYEQHIEPPDRKWQYLLFAAEPYE 178

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGM 255
           TI FK+ S+E+DK E KF+THW P+S+QF LQF++K D+  M
Sbjct: 179 TIGFKLPSREIDKSEEKFWTHWIPESRQFFLQFYYKIDKGDM 220



>gi|119194461|ref|XP_001247834.1| conserved hypothetical protein [Coccidioides immitis RS]
 gi|392862929|gb|EAS36390.2| splicing factor 3a subunit 2 [Coccidioides immitis RS]
          Length = 239

 Score =  283 bits (725), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 140/231 (60%), Positives = 172/231 (74%), Gaps = 4/231 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA +S TN DRRERLRKLALE IDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRVGSKFGGGGVASHSATNADRRERLRKLALEHIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPA--LQAQTKVQIKKNLVKIGRP 151
           T+H N+GSYLAHTQG+KHQT                     L A   VQ+K+N VKIGRP
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAREQKEGKSQADGSLLPAGMGVQVKRNTVKIGRP 120

Query: 152 GYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRI-EPPNKAHQYLLFAAE 210
           GYK+TK+RDP+TRQ GL FQ+QY EI   V+PR RFMSA+EQ++ +PP+K  QYLL AAE
Sbjct: 121 GYKITKIRDPLTRQHGLLFQLQYQEITPGVVPRVRFMSAFEQKVDDPPDKNFQYLLVAAE 180

Query: 211 PYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIP 261
           PY+T  FK+Q++EVD+ EGKF+T +D DSK+F +Q  FK +R   YS G+P
Sbjct: 181 PYQTCGFKLQAREVDRREGKFWTWFDEDSKEFWVQILFKTEREERYS-GVP 230



>gi|121708157|ref|XP_001272046.1| splicing factor 3a subunit 2, putative [Aspergillus clavatus NRRL
           1]
 gi|119400194|gb|EAW10620.1| splicing factor 3a subunit 2, putative [Aspergillus clavatus NRRL
           1]
          Length = 272

 Score =  283 bits (724), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 136/230 (59%), Positives = 173/230 (75%), Gaps = 3/230 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA +S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 35  MDYQNRAGSKFGGGGVASHSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 94

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPA-LQAQTKVQIKKNLVKIGRPG 152
           T+H N+GSYLAHTQG+KHQT                 P+ L     VQ+KK  +KIGRPG
Sbjct: 95  TVHQNDGSYLAHTQGRKHQTNLARRAAREQREGKNQDPSMLPGAMGVQVKKQTIKIGRPG 154

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRI-EPPNKAHQYLLFAAEP 211
           YK+TK+RDP+TRQLGL FQ+QY EI   V PR RFMSA+EQ++ EPP+K  QYL+ AAEP
Sbjct: 155 YKITKIRDPLTRQLGLLFQLQYQEITPGVTPRVRFMSAFEQKVEEPPDKNFQYLVVAAEP 214

Query: 212 YETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIP 261
           Y+T  FK+Q++E+D+ +G+++T +D DSK+F +Q  FK +R   +S G+P
Sbjct: 215 YQTCGFKLQAREIDRRDGRYWTWFDEDSKEFWIQIMFKTEREERFS-GVP 263



>gi|449491768|ref|XP_002191731.2| PREDICTED: splicing factor 3A subunit 2 [Taeniopygia guttata]
          Length = 269

 Score =  283 bits (724), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 144/210 (68%), Positives = 160/210 (76%), Gaps = 3/210 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASASESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RDP T Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDPETGQQSLLFQIDYPEIAESIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFS 243
           TIAFKV S+E+DK EGKF+THW+ ++KQ +
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQCT 207



>gi|326431245|gb|EGD76815.1| splicing factor 3a [Salpingoeca sp. ATCC 50818]
          Length = 233

 Score =  283 bits (723), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 138/224 (61%), Positives = 164/224 (73%), Gaps = 4/224 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR GSK G GG A +SE+N  R+ERL  LA+ETIDL KDPYFMKNHLG YECKLCL
Sbjct: 1   MDFQNRVGSKFGGGGPASFSESNRQRKERLMALAMETIDLAKDPYFMKNHLGKYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGK+HQ                ++P +    +V+IKK  +K+GRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKRHQENLRIRAIKEAKDTPTMKPDM---PQVEIKK-FLKVGRPGY 116

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RDP T Q  LFFQI YPEI  DV+PRHRFMSAYEQR+E P+   Q+++FAAEPYE
Sbjct: 117 KVTKQRDPATGQYSLFFQIDYPEIAEDVLPRHRFMSAYEQRVEAPDSNFQFIVFAAEPYE 176

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYS 257
           TIAFK+ S E+D+  GK +T W+P +KQF LQF FK +R   Y+
Sbjct: 177 TIAFKIPSSEIDQAPGKLWTRWNPSTKQFFLQFHFKTERVPEYA 220



>gi|449281964|gb|EMC88905.1| Splicing factor 3A subunit 2 [Columba livia]
          Length = 211

 Score =  283 bits (723), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 159/208 (76%), Gaps = 3/208 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASASESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAP-AQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RDP T Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDPETGQQSLLFQIDYPEIAESIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQ 241
           TIAFKV S+E+DK EGKF+THW+ ++KQ
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQ 205



>gi|225559794|gb|EEH08076.1| splicing factor 3a [Ajellomyces capsulatus G186AR]
 gi|240276332|gb|EER39844.1| splicing factor 3a [Ajellomyces capsulatus H143]
          Length = 236

 Score =  283 bits (723), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 139/230 (60%), Positives = 170/230 (73%), Gaps = 3/230 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA +S TN DRRERLRKLALE IDL KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASHSATNADRRERLRKLALENIDLEKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQ-AQTKVQIKKNLVKIGRPG 152
           T+H N+GSYLAHTQG+KHQT                  +L  A   VQ+K+N VKIGRPG
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAREQKEGKGQDGSLLPAAMGVQVKRNTVKIGRPG 120

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRI-EPPNKAHQYLLFAAEP 211
           YK+TK RDP+TRQ GL FQ+QY EI    +PR RFMSA+EQ++ +PP+K  QYLL AAEP
Sbjct: 121 YKITKTRDPLTRQHGLLFQLQYQEITPGEVPRVRFMSAFEQKVDDPPDKNFQYLLVAAEP 180

Query: 212 YETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIP 261
           Y+T  FK+Q++EVD+ EGKF+T +D DSK+F +Q  FK +R   YS G+P
Sbjct: 181 YQTCGFKLQAREVDRSEGKFWTWFDEDSKEFWIQVMFKTEREERYS-GVP 229



>gi|268536640|ref|XP_002633455.1| Hypothetical protein CBG06223 [Caenorhabditis briggsae]
          Length = 222

 Score =  282 bits (722), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 143/220 (65%), Positives = 162/220 (73%), Gaps = 6/220 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR G K GSGGVA  ++  VDRRERLR+LALETIDL KDPYFM+NH+G+YECKLCL
Sbjct: 1   MDFQNRAGGKTGSGGVASAADAGVDRRERLRQLALETIDLQKDPYFMRNHIGTYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIK-KNLVKIGRPG 152
           TLH NEGSYLAHTQGKKHQ                 QP L A  K  I+ K  VKIGRPG
Sbjct: 61  TLHNNEGSYLAHTQGKKHQANLARRAAKEQSE----QPFLPAPQKAAIETKKFVKIGRPG 116

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           YKVT+ RDP + Q  L FQI YPEI   + PRHRFMSAYEQ+I+PP+K  QYLLFAAEPY
Sbjct: 117 YKVTRERDPGSGQQALLFQIDYPEITDGIAPRHRFMSAYEQKIQPPDKRWQYLLFAAEPY 176

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDR 252
           ETI FK+ S+EVDK E KF+T W+ D+KQF LQ  FK +R
Sbjct: 177 ETIGFKIPSREVDKSE-KFWTMWNKDTKQFFLQVAFKMER 215



>gi|17539744|ref|NP_502290.1| Protein REPO-1 [Caenorhabditis elegans]
 gi|15718190|emb|CAA92593.2| Protein REPO-1 [Caenorhabditis elegans]
          Length = 222

 Score =  282 bits (722), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 143/220 (65%), Positives = 161/220 (73%), Gaps = 6/220 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR G K GSGGVA  ++  VDRRERLR+LALETIDL KDPYFM+NH+G+YECKLCL
Sbjct: 1   MDFQNRAGGKTGSGGVASAADAGVDRRERLRQLALETIDLQKDPYFMRNHIGTYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIK-KNLVKIGRPG 152
           TLH NEGSYLAHTQGKKHQ                 QP L A  K  ++ K  VKIGRPG
Sbjct: 61  TLHNNEGSYLAHTQGKKHQANLARRAAKEQSE----QPFLPAPQKAAVETKKFVKIGRPG 116

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           YKVTK RDP   Q  L FQI YPEI   + PRHRFMSAYEQ+I+PP+K  QYLLFAAEPY
Sbjct: 117 YKVTKERDPGAGQQALLFQIDYPEIADGIAPRHRFMSAYEQKIQPPDKRWQYLLFAAEPY 176

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDR 252
           ETI FK+ S+EVDK E KF+T W+ D+KQF LQ  FK +R
Sbjct: 177 ETIGFKIPSREVDKSE-KFWTMWNKDTKQFFLQVAFKLER 215



>gi|453089634|gb|EMF17674.1| splicing factor 3a subunit 2 [Mycosphaerella populorum SO2202]
          Length = 238

 Score =  282 bits (722), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 137/234 (58%), Positives = 167/234 (71%), Gaps = 4/234 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA  S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASQSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTX-XXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPG 152
           T+H N+GSYLAHTQG+KHQT                          +QIK+N+VKIGRPG
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAKESQMGKKNADDGYTGANSIQIKRNVVKIGRPG 120

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRI-EPPNKAHQYLLFAAEP 211
           Y + K RDPITRQ GL F +Q PEIG  V PR RFMSAYEQ++ +PP+KA QYLL AAEP
Sbjct: 121 YSIKKTRDPITRQEGLLFSLQLPEIGQGVEPRVRFMSAYEQKVDDPPDKAFQYLLVAAEP 180

Query: 212 YETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSE--GIPPG 263
           Y+   FK+Q++++D+ E K++T WD DSKQF +Q  FK +R   +S   G+ PG
Sbjct: 181 YDICGFKIQARDIDRREEKYWTWWDQDSKQFWVQINFKTEREERFSGVPGLAPG 234



>gi|325089809|gb|EGC43119.1| splicing factor 3A [Ajellomyces capsulatus H88]
          Length = 236

 Score =  282 bits (722), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 139/230 (60%), Positives = 170/230 (73%), Gaps = 3/230 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA +S TN DRRERLRKLALE IDL KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASHSATNADRRERLRKLALENIDLEKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQ-AQTKVQIKKNLVKIGRPG 152
           T+H N+GSYLAHTQG+KHQT                  +L  A   VQ+K+N VKIGRPG
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAREQKEGKGQDGSLLPAAMGVQVKRNTVKIGRPG 120

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRI-EPPNKAHQYLLFAAEP 211
           YK+TK RDP+TRQ GL FQ+QY EI    +PR RFMSA+EQ++ +PP+K  QYLL AAEP
Sbjct: 121 YKITKTRDPLTRQHGLLFQLQYQEITPGEVPRVRFMSAFEQKVDDPPDKNFQYLLVAAEP 180

Query: 212 YETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIP 261
           Y+T  FK+Q++EVD+ EGKF+T +D DSK+F +Q  FK +R   YS G+P
Sbjct: 181 YQTCGFKLQAREVDRSEGKFWTWFDEDSKEFWIQVMFKTEREERYS-GVP 229



>gi|261191813|ref|XP_002622314.1| splicing factor 3a subunit 2 [Ajellomyces dermatitidis SLH14081]
 gi|239589630|gb|EEQ72273.1| splicing factor 3a subunit 2 [Ajellomyces dermatitidis SLH14081]
 gi|239608628|gb|EEQ85615.1| splicing factor 3a subunit 2 [Ajellomyces dermatitidis ER-3]
 gi|327353764|gb|EGE82621.1| splicing factor 3a [Ajellomyces dermatitidis ATCC 18188]
          Length = 236

 Score =  282 bits (722), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 139/230 (60%), Positives = 170/230 (73%), Gaps = 3/230 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA +S TN DRRERLRKLALE IDL KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASHSATNADRRERLRKLALENIDLEKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQ-AQTKVQIKKNLVKIGRPG 152
           T+H N+GSYLAHTQG+KHQT                  +L  A   VQ+K+N VKIGRPG
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAREQKEGKGQDGSLLPAAMGVQVKRNTVKIGRPG 120

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRI-EPPNKAHQYLLFAAEP 211
           YK+TK RDP+TRQ GL FQ+QY EI    +PR RFMSA+EQ++ +PP+K  QYLL AAEP
Sbjct: 121 YKITKTRDPLTRQHGLLFQLQYQEITPGEVPRVRFMSAFEQKVDDPPDKDFQYLLVAAEP 180

Query: 212 YETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIP 261
           Y+T  FK+Q++EVD+ EGKF+T +D DSK+F +Q  FK +R   YS G+P
Sbjct: 181 YQTCGFKLQAREVDRSEGKFWTWFDQDSKEFWIQVMFKTEREERYS-GVP 229



>gi|358367002|dbj|GAA83622.1| splicing factor 3a subunit 2 [Aspergillus kawachii IFO 4308]
          Length = 236

 Score =  282 bits (722), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 134/230 (58%), Positives = 173/230 (75%), Gaps = 3/230 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA +S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASHSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQP-ALQAQTKVQIKKNLVKIGRPG 152
           T+H N+GSYLAHTQG+KHQT                 P ++     VQ+KK  +KIGRPG
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAREQREGKNQDPSSIPGAMGVQVKKQTIKIGRPG 120

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRI-EPPNKAHQYLLFAAEP 211
           YK+TK+RDP+TRQLG+ FQ+QY EI   V P+ RFMSA+EQ++ EPP+K  QYL+ AAEP
Sbjct: 121 YKITKIRDPLTRQLGMLFQLQYQEITPGVTPKVRFMSAFEQKVEEPPDKNFQYLVVAAEP 180

Query: 212 YETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIP 261
           Y+T  FK+Q++E+D+ EG+++T +D DSK+F +Q  FK +R   +S G+P
Sbjct: 181 YQTCGFKLQAREIDRREGRYWTWFDEDSKEFWVQIMFKTEREERFS-GVP 229



>gi|341884181|gb|EGT40116.1| hypothetical protein CAEBREN_22766 [Caenorhabditis brenneri]
 gi|341893365|gb|EGT49300.1| hypothetical protein CAEBREN_18328 [Caenorhabditis brenneri]
          Length = 222

 Score =  282 bits (722), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 142/220 (64%), Positives = 162/220 (73%), Gaps = 6/220 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR G K GSGGVA  ++  VDRRERLR+LALETIDL KDPYFM+NH+G+YECKLCL
Sbjct: 1   MDFQNRAGGKTGSGGVASAADAGVDRRERLRQLALETIDLQKDPYFMRNHIGTYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIK-KNLVKIGRPG 152
           TLH NEGSYLAHTQGKKHQ                 QP L A  K  ++ K  VKIGRPG
Sbjct: 61  TLHNNEGSYLAHTQGKKHQANLARRAAKEQSE----QPFLPAPQKAAVETKKFVKIGRPG 116

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           YKVT+ RDP + Q  L FQI YPEI   + PRHRFMSAYEQ+I+PP+K  QYLLFAAEPY
Sbjct: 117 YKVTRERDPGSGQQALLFQIDYPEITDGIAPRHRFMSAYEQKIQPPDKRWQYLLFAAEPY 176

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDR 252
           ETI FK+ S+EVDK E KF+T W+ D+KQF LQ  FK +R
Sbjct: 177 ETIGFKIPSREVDKSE-KFWTMWNKDTKQFFLQVAFKMER 215



>gi|145229665|ref|XP_001389141.1| CWF complex protein sap62 [Aspergillus niger CBS 513.88]
 gi|134055250|emb|CAK43836.1| unnamed protein product [Aspergillus niger]
 gi|350638246|gb|EHA26602.1| hypothetical protein ASPNIDRAFT_46576 [Aspergillus niger ATCC 1015]
          Length = 238

 Score =  282 bits (722), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 138/240 (57%), Positives = 179/240 (74%), Gaps = 6/240 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA +S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASHSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQP-ALQAQTKVQIKKNLVKIGRPG 152
           T+H N+GSYLAHTQG+KHQT                 P ++     VQ+KK  +KIGRPG
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAREQREGKNQDPSSIPGAMGVQVKKQTIKIGRPG 120

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRI-EPPNKAHQYLLFAAEP 211
           YK+TK+RDP+TRQLG+ FQ+QY EI   V P+ RFMSA+EQ++ EPP+K  QYL+ AAEP
Sbjct: 121 YKITKIRDPLTRQLGMLFQLQYQEITPGVTPKVRFMSAFEQKVEEPPDKNFQYLVVAAEP 180

Query: 212 YETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIPPGIERAPMVN 271
           Y+T  FK+Q++E+D+ EG+++T +D DSK+F +Q  FK +R   +S G+ PG+  AP+ N
Sbjct: 181 YQTCGFKLQAREIDRREGRYWTWFDEDSKEFWVQIMFKTEREERFS-GV-PGL--APIEN 236



>gi|308477121|ref|XP_003100775.1| CRE-REPO-1 protein [Caenorhabditis remanei]
 gi|308264587|gb|EFP08540.1| CRE-REPO-1 protein [Caenorhabditis remanei]
          Length = 222

 Score =  282 bits (721), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 142/220 (64%), Positives = 162/220 (73%), Gaps = 6/220 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR G K GSGGVA  ++  VDRRERLR+LALETIDL KDPYFM+NH+G+YECKLCL
Sbjct: 1   MDFQNRAGGKTGSGGVASAADAGVDRRERLRQLALETIDLQKDPYFMRNHIGTYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIK-KNLVKIGRPG 152
           TLH NEGSYLAHTQGKKHQ                 QP L A  K  ++ K  VKIGRPG
Sbjct: 61  TLHNNEGSYLAHTQGKKHQANLARRAAKEQSE----QPFLPAPQKAAVETKKFVKIGRPG 116

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           YKVT+ RDP + Q  L FQI YPEI   + PRHRFMSAYEQ+I+PP+K  QYLLFAAEPY
Sbjct: 117 YKVTRERDPGSGQQALLFQIDYPEITDGIAPRHRFMSAYEQKIQPPDKRWQYLLFAAEPY 176

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDR 252
           ETI FK+ S+EVDK E KF+T W+ D+KQF LQ  FK +R
Sbjct: 177 ETIGFKIPSREVDKSE-KFWTMWNKDTKQFFLQVAFKMER 215



>gi|169771331|ref|XP_001820135.1| CWF complex protein sap62 [Aspergillus oryzae RIB40]
 gi|238486124|ref|XP_002374300.1| splicing factor 3a subunit 2, putative [Aspergillus flavus
           NRRL3357]
 gi|83767994|dbj|BAE58133.1| unnamed protein product [Aspergillus oryzae RIB40]
 gi|220699179|gb|EED55518.1| splicing factor 3a subunit 2, putative [Aspergillus flavus
           NRRL3357]
 gi|391871658|gb|EIT80815.1| splicing factor 3a, subunit 2 [Aspergillus oryzae 3.042]
          Length = 238

 Score =  282 bits (721), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 140/238 (58%), Positives = 177/238 (74%), Gaps = 6/238 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR GSK G GGVA  S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDFQNRAGSKFGGGGVASQSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPA-LQAQTKVQIKKNLVKIGRPG 152
           T+H N+GSYLAHTQG+KHQT                 P+ L     VQ+KK  +KIGRPG
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAREQREGKNQDPSTLPGAMGVQVKKQTIKIGRPG 120

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRI-EPPNKAHQYLLFAAEP 211
           YK+TK+RDP+TRQLGL FQ+QY EI   V PR RFMSA+EQ++ +PP+K  QYL+ AAEP
Sbjct: 121 YKITKIRDPLTRQLGLLFQLQYQEITPGVQPRVRFMSAFEQKVDDPPDKNFQYLVVAAEP 180

Query: 212 YETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIPPGIERAPM 269
           Y+T  FK+Q++E+D+ +G+++T +D DSK+F +Q  FK +R   +S G+ PG+  APM
Sbjct: 181 YQTCGFKLQAREIDRRDGRYWTWFDEDSKEFWVQIMFKTEREERFS-GV-PGL--APM 234



>gi|258567778|ref|XP_002584633.1| hypothetical protein UREG_05322 [Uncinocarpus reesii 1704]
 gi|237906079|gb|EEP80480.1| hypothetical protein UREG_05322 [Uncinocarpus reesii 1704]
          Length = 239

 Score =  281 bits (720), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 139/231 (60%), Positives = 170/231 (73%), Gaps = 4/231 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR GSK G GGVA +S TN DRRERLRKLALE IDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDFQNRAGSKFGGGGVASHSATNADRRERLRKLALEHIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPA--LQAQTKVQIKKNLVKIGRP 151
           T+H N+GSYLAHTQG+KHQT                     L     VQ+K+N VKIGRP
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAREQKEGKAETDGSLLPGAMGVQVKRNTVKIGRP 120

Query: 152 GYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRI-EPPNKAHQYLLFAAE 210
           GYK+TK+RDP+TRQ GL FQ+QY EI   V PR RFMSA+EQ++ +PP+K  QYLL AAE
Sbjct: 121 GYKITKIRDPLTRQHGLLFQLQYQEITPGVTPRVRFMSAFEQKVDDPPDKNFQYLLVAAE 180

Query: 211 PYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIP 261
           PY+T  FK+Q++EVD+ EGKF++ +D DSK+F +Q  FK +R   YS G+P
Sbjct: 181 PYQTCGFKLQAREVDRREGKFWSWFDEDSKEFWVQILFKTEREERYS-GVP 230



>gi|465954153|gb|EMP25739.1| Splicing factor 3A subunit 2 [Chelonia mydas]
          Length = 724

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 143/208 (68%), Positives = 158/208 (75%), Gaps = 3/208 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQT-NLARRAAKEAKEAPAQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RDP   Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDPEMGQQSLLFQIDYPEIAETIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQ 241
           TIAFKV S+E+DK EGKF+THW+ ++KQ
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQ 205



>gi|440637893|gb|ELR07812.1| splicing factor 3A subunit 2 [Geomyces destructans 20631-21]
          Length = 240

 Score =  281 bits (719), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 136/235 (57%), Positives = 169/235 (71%), Gaps = 8/235 (3%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA  S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASTSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQ------PALQAQTKVQIKKNLVK 147
           T+H N+GSYLAHTQG+KHQT                       P      +V +++N+VK
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAREQKEGRVGTDPVTGLPIGMVGAQVSVRRNVVK 120

Query: 148 IGRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIE-PPNKAHQYLL 206
           IGRPGYK+TK RDP+TRQ GL FQ+QYPEI  D+ P+ RFMSA+EQ+IE PP+K  QY+L
Sbjct: 121 IGRPGYKITKTRDPVTRQQGLLFQLQYPEITPDMTPKVRFMSAFEQKIEDPPDKNFQYML 180

Query: 207 FAAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIP 261
            AAEPY+T  FK+Q++EVD+   +F+T WD D K+F +Q  FK +R   YS G+P
Sbjct: 181 VAAEPYQTCGFKLQAREVDRTNDRFWTWWDSDLKEFWVQVMFKTEREERYS-GVP 234



>gi|296808003|ref|XP_002844340.1| splicing factor 3a [Arthroderma otae CBS 113480]
 gi|238843823|gb|EEQ33485.1| splicing factor 3a [Arthroderma otae CBS 113480]
          Length = 241

 Score =  281 bits (718), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 142/242 (58%), Positives = 173/242 (71%), Gaps = 10/242 (4%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA +S TN DRRERLRKLALE IDL KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASHSATNADRRERLRKLALEHIDLAKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQA----QTKVQIKKNLVKIG 149
           T+H N+GSYLAHTQG+KHQT                  A  A       VQ+K+N VKIG
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAREQKEGRAQDGAGGALPAGNMGVQVKRNTVKIG 120

Query: 150 RPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRI-EPPNKAHQYLLFA 208
           RPGYK+TK+RDP+TRQ GL FQ+QY EI   V PR RFMSA+EQ++ +PP+K +QYLL A
Sbjct: 121 RPGYKITKIRDPLTRQHGLLFQLQYQEITPGVTPRIRFMSAFEQKVDDPPDKDYQYLLVA 180

Query: 209 AEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGI----PPGI 264
           AEPY+T  FK+Q++EVD+ EGK +T +D DSK+F +Q  FK +R   YS G+    P GI
Sbjct: 181 AEPYQTCGFKLQAREVDRREGKLWTWFDEDSKEFWIQLLFKTEREERYS-GVPGLAPAGI 239

Query: 265 ER 266
            R
Sbjct: 240 RR 241



>gi|118777492|ref|XP_308101.3| AGAP011035-PA [Anopheles gambiae str. PEST]
 gi|116132739|gb|EAA03861.3| AGAP011035-PA [Anopheles gambiae str. PEST]
          Length = 256

 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 147/217 (67%), Positives = 167/217 (76%), Gaps = 5/217 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR G K G GGVA +SE+N DRRERLR+LALETIDLNKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRAGGKTGGGGVASWSESNRDRRERLRQLALETIDLNKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXX-XXIQPALQAQTKVQIKKNLVKIGRPG 152
           TLH NEGSYL+HTQGKKHQ                 IQP    + +++ KK  VKIGRPG
Sbjct: 61  TLHNNEGSYLSHTQGKKHQANLARRAAKEAKEAPWVIQPE---KPRIEPKK-FVKIGRPG 116

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTK RDP   Q  L FQI YPEI   ++PRHRFMSAYEQ+IEPP++  QYLLFAAEPY
Sbjct: 117 YRVTKQRDPENGQQSLLFQIDYPEITDGIVPRHRFMSAYEQKIEPPDRKWQYLLFAAEPY 176

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFK 249
           ETIAFKV S+EV+K EGKF+THW+ ++KQF LQF FK
Sbjct: 177 ETIAFKVPSREVEKTEGKFWTHWNKNTKQFFLQFSFK 213



>gi|312374536|gb|EFR22075.1| hypothetical protein AND_15803 [Anopheles darlingi]
          Length = 254

 Score =  280 bits (717), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 147/217 (67%), Positives = 167/217 (76%), Gaps = 5/217 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR G K G GGVA +SE+N DRRERLR+LALETIDLNKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRAGGKTGGGGVASWSESNRDRRERLRQLALETIDLNKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXX-XXIQPALQAQTKVQIKKNLVKIGRPG 152
           TLH NEGSYL+HTQGKKHQ                 IQP    + +++ KK  VKIGRPG
Sbjct: 61  TLHNNEGSYLSHTQGKKHQANLARRAAKEAKEAPWVIQPE---KPRIEPKK-FVKIGRPG 116

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTK RDP   Q  L FQI YPEI   ++PRHRFMSAYEQ+IEPP++  QYLLFAAEPY
Sbjct: 117 YRVTKQRDPDNGQQSLLFQIDYPEITDGIVPRHRFMSAYEQKIEPPDRKWQYLLFAAEPY 176

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFK 249
           ETIAFKV S+EV+K EGKF+THW+ ++KQF LQF FK
Sbjct: 177 ETIAFKVPSREVEKTEGKFWTHWNKNTKQFFLQFSFK 213



>gi|226466746|emb|CAX69508.1| Splicing factor 3A subunit 2 [Schistosoma japonicum]
          Length = 358

 Score =  280 bits (716), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 143/219 (65%), Positives = 161/219 (73%), Gaps = 7/219 (3%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+R G K GSGGVA  +E N DRRERLR+LAL+TIDLNKDPYFMKNHLG+YECKLCL
Sbjct: 1   MDFQHRVGGKTGSGGVASEAEANRDRRERLRQLALDTIDLNKDPYFMKNHLGTYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQ-TXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPG 152
           TLH NEGSYLAHTQGKKHQ                 +QP    + KV+ KK  +KIGRPG
Sbjct: 61  TLHNNEGSYLAHTQGKKHQYNLQRRAVEQAREAPSTMQP---ERVKVEPKK-FIKIGRPG 116

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEI--GLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAE 210
           YKVTK +DP   Q  + FQI YPEI     VIPRHRFMSAYEQ +EPP+K  QYLLFAAE
Sbjct: 117 YKVTKQKDPDANQQSMLFQIDYPEIADASGVIPRHRFMSAYEQHVEPPDKRWQYLLFAAE 176

Query: 211 PYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFK 249
           PYETIAFK+ S+EVDK   K +T+W+  SKQF LQF FK
Sbjct: 177 PYETIAFKIPSREVDKDPKKLWTYWNSSSKQFFLQFAFK 215



>gi|488590205|ref|XP_004480381.1| PREDICTED: muellerian-inhibiting factor [Dasypus novemcinctus]
          Length = 510

 Score =  280 bits (715), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 142/211 (67%), Positives = 158/211 (74%), Gaps = 3/211 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQT-NLARRAAKEAKEAPAQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK R+    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRETEMGQQSLLFQIDYPEIAEGIVPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSL 244
           TIAFKV S+E+DK EGKF+THW+ ++KQ  L
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQAPL 208



>gi|511917568|ref|XP_004778056.1| PREDICTED: splicing factor 3A subunit 2 isoform X2 [Mustela
           putorius furo]
          Length = 496

 Score =  279 bits (714), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 144/210 (68%), Positives = 157/210 (74%), Gaps = 3/210 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQT-NLARRAAKEAKEAPAQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   V PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAEGVTPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFS 243
           TIAFKV S+E+DK EGKF+THW+ ++KQ S
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQVS 207



>gi|358338309|dbj|GAA56639.1| splicing factor 3A subunit 2, partial [Clonorchis sinensis]
          Length = 342

 Score =  279 bits (713), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 140/219 (63%), Positives = 162/219 (73%), Gaps = 7/219 (3%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+R G K GSGGVA  +E N DRRERLR+LAL+TIDLNKDPYFMKNHLG+YECKLCL
Sbjct: 1   MDFQHRAGGKTGSGGVASDAEANRDRRERLRQLALDTIDLNKDPYFMKNHLGTYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIK-KNLVKIGRPG 152
           TLH NEGSYLAHTQGKKHQ                  PA     +++I+ K  +KIGRPG
Sbjct: 61  TLHNNEGSYLAHTQGKKHQYNLQRRAVEQAREA----PATMQPERIKIEPKKFIKIGRPG 116

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIG--LDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAE 210
           YKVTK +DP T Q  + FQI YPEI   + V PRHRFMSAYEQR+EPP++  QYLLFAAE
Sbjct: 117 YKVTKQKDPETGQQSMLFQIDYPEIADSVGVQPRHRFMSAYEQRVEPPDRRWQYLLFAAE 176

Query: 211 PYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFK 249
           PYETIAFK+ S+EVDK   K +T+W+P  KQF LQF +K
Sbjct: 177 PYETIAFKIPSREVDKDPKKLWTYWNPSVKQFFLQFAYK 215



>gi|511983273|ref|XP_004809449.1| PREDICTED: splicing factor 3A subunit 2 isoform X2 [Mustela
           putorius furo]
          Length = 489

 Score =  279 bits (713), Expect = 7e-73,   Method: Compositional matrix adjust.
 Identities = 144/210 (68%), Positives = 157/210 (74%), Gaps = 3/210 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQT-NLARRAAKEAKEAPAQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   V PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAEGVTPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFS 243
           TIAFKV S+E+DK EGKF+THW+ ++KQ S
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQVS 207



>gi|302502455|ref|XP_003013218.1| hypothetical protein ARB_00402 [Arthroderma benhamiae CBS 112371]
 gi|302659024|ref|XP_003021207.1| hypothetical protein TRV_04639 [Trichophyton verrucosum HKI 0517]
 gi|327295520|ref|XP_003232455.1| splicing factor 3a subunit 2 [Trichophyton rubrum CBS 118892]
 gi|291176781|gb|EFE32578.1| hypothetical protein ARB_00402 [Arthroderma benhamiae CBS 112371]
 gi|291185095|gb|EFE40589.1| hypothetical protein TRV_04639 [Trichophyton verrucosum HKI 0517]
 gi|326465627|gb|EGD91080.1| splicing factor 3a subunit 2 [Trichophyton rubrum CBS 118892]
 gi|326484614|gb|EGE08624.1| splicing factor 3A subunit 2 [Trichophyton equinum CBS 127.97]
          Length = 241

 Score =  279 bits (713), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 138/233 (59%), Positives = 170/233 (72%), Gaps = 6/233 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA +S TN DRRERLRKLALE IDL KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASHSATNADRRERLRKLALEHIDLAKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQA----QTKVQIKKNLVKIG 149
           T+H N+GSYLAHTQG+KHQT                  +  A       VQ+K+N VKIG
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAREQREGRAQDGSGGALPAGNMGVQVKRNTVKIG 120

Query: 150 RPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRI-EPPNKAHQYLLFA 208
           RPGYK+TK+RDP+TRQ GL FQ+QY EI   V PR RFMSA+EQ++ +PP+K +QYLL A
Sbjct: 121 RPGYKITKIRDPLTRQHGLLFQLQYQEITPGVKPRIRFMSAFEQKVDDPPDKDYQYLLVA 180

Query: 209 AEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIP 261
           AEPY+T  FK+Q++EVD+ EGK +T +D DSK+F +Q  FK +R   YS G+P
Sbjct: 181 AEPYQTCGFKLQAREVDRREGKLWTWFDEDSKEFWIQLLFKTEREERYS-GVP 232



>gi|149476781|ref|XP_001519977.1| PREDICTED: splicing factor 3A subunit 2-like, partial
           [Ornithorhynchus anatinus]
          Length = 205

 Score =  278 bits (712), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 157/208 (75%), Gaps = 3/208 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQT-NLARRAAKEAKEAPAQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTDMGQQSLLFQIDYPEIAESIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQ 241
           TIAFKV S+E+DK EGKF+THW+ ++KQ
Sbjct: 178 TIAFKVPSREIDKAEGKFWTHWNRETKQ 205



>gi|315042764|ref|XP_003170758.1| splicing factor 3A subunit 2 [Arthroderma gypseum CBS 118893]
 gi|311344547|gb|EFR03750.1| splicing factor 3A subunit 2 [Arthroderma gypseum CBS 118893]
          Length = 241

 Score =  278 bits (712), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 138/233 (59%), Positives = 170/233 (72%), Gaps = 6/233 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA +S TN DRRERLRKLALE IDL KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASHSATNADRRERLRKLALEHIDLAKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQA----QTKVQIKKNLVKIG 149
           T+H N+GSYLAHTQG+KHQT                  +  A       VQ+K+N VKIG
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAREQREGRAQDGSGGALPAGNMGVQVKRNTVKIG 120

Query: 150 RPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRI-EPPNKAHQYLLFA 208
           RPGYK+TK+RDP+TRQ GL FQ+QY EI   V PR RFMSA+EQ++ +PP+K +QYLL A
Sbjct: 121 RPGYKITKIRDPLTRQHGLLFQLQYQEITPGVKPRIRFMSAFEQKVDDPPDKDYQYLLVA 180

Query: 209 AEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIP 261
           AEPY+T  FK+Q++EVD+ EGK +T +D DSK+F +Q  FK +R   YS G+P
Sbjct: 181 AEPYQTCGFKLQAREVDRREGKLWTWFDEDSKEFWIQLLFKTEREERYS-GVP 232



>gi|326475694|gb|EGD99703.1| splicing factor 3a subunit 2 [Trichophyton tonsurans CBS 112818]
          Length = 241

 Score =  278 bits (712), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 140/233 (60%), Positives = 171/233 (73%), Gaps = 6/233 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA +S TN DRRERLRKLALE IDL KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASHSATNADRRERLRKLALEHIDLAKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXX---IQPALQA-QTKVQIKKNLVKIG 149
           T+H N+GSYLAHTQG+KHQT                     AL A    VQ+K+N VKIG
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAREQREGRAQDGFGGALPAGNMGVQVKRNTVKIG 120

Query: 150 RPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRI-EPPNKAHQYLLFA 208
           RPGYK+TK+RDP+TRQ GL FQ+QY EI   V PR RFMSA+EQ++ +PP+K +QYLL A
Sbjct: 121 RPGYKITKIRDPLTRQHGLLFQLQYQEITPGVKPRIRFMSAFEQKVDDPPDKDYQYLLVA 180

Query: 209 AEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIP 261
           AEPY+T  FK+Q++EVD+ EGK +T +D DSK+F +Q  FK +R   YS G+P
Sbjct: 181 AEPYQTCGFKLQAREVDRREGKLWTWFDEDSKEFWIQLLFKTEREERYS-GVP 232



>gi|392597568|gb|EIW86890.1| hypothetical protein CONPUDRAFT_86828 [Coniophora puteana
           RWD-64-598 SS2]
          Length = 219

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 138/221 (62%), Positives = 165/221 (74%), Gaps = 9/221 (4%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR GSK G GGVAG SETNVDRRERLRKLALETIDL KDPY ++NHLGS EC+LCL
Sbjct: 1   MDFQNRVGSKFGGGGVAGASETNVDRRERLRKLALETIDLAKDPYILRNHLGSLECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTX-XXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPG 152
           TLHTNEGSYLAHTQGKKHQT                I P   AQ+ VQ +K  +KIGRPG
Sbjct: 61  TLHTNEGSYLAHTQGKKHQTNLARRAARDAKDTQLMIAP---AQSSVQ-RKVFLKIGRPG 116

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTKVRD  T + G+  Q+  P+I  DV+PR RFMSA+EQ+ EPPNKA QYL+ AAEPY
Sbjct: 117 YRVTKVRDKDTGKEGMMVQVHLPQIKADVMPRRRFMSAWEQKREPPNKAFQYLIVAAEPY 176

Query: 213 ETIAFKVQSKEVDKGEGKF----FTHWDPDSKQFSLQFFFK 249
           ETIAF++ ++E+++ E       ++HWDPD+KQ+S QF F+
Sbjct: 177 ETIAFRIPAREIEEEEDDAGYWNWSHWDPDTKQYSFQFMFR 217



>gi|157132537|ref|XP_001656059.1| U2 small nuclear ribonucleoprotein, putative [Aedes aegypti]
 gi|108884354|gb|EAT48579.1| AAEL000394-PA [Aedes aegypti]
          Length = 253

 Score =  278 bits (711), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 147/217 (67%), Positives = 165/217 (76%), Gaps = 5/217 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR G K G GG A +SE+N DRRERLR+LALETIDLNKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRAGGKTGGGGQASWSESNRDRRERLRQLALETIDLNKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQ-TXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPG 152
           TLH NEGSYLAHTQGKKHQ                 +QP    + +++ KK  VKIGRPG
Sbjct: 61  TLHNNEGSYLAHTQGKKHQGNLARRAAKEAKEAPSSMQPE---KPRIEPKK-FVKIGRPG 116

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTK RD    Q  L FQI YPEI   +IPRHRFMSAYEQ+IEPP++  QYLLFAAEPY
Sbjct: 117 YRVTKQRDSDNGQQSLLFQIDYPEITDGIIPRHRFMSAYEQKIEPPDRKWQYLLFAAEPY 176

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFK 249
           ETIAFKV S+EV+K EGKF+THW+ D+KQF LQF FK
Sbjct: 177 ETIAFKVPSREVEKTEGKFWTHWNKDTKQFFLQFSFK 213



>gi|310797039|gb|EFQ32500.1| splicing factor 3A subunit 2 [Glomerella graminicola M1.001]
          Length = 242

 Score =  278 bits (710), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 137/244 (56%), Positives = 170/244 (69%), Gaps = 13/244 (5%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA +S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASFSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQT--XXXXXXXXXXXXXXXIQPALQAQTKV---------QIK 142
           T+H N+GSYLAHTQGKKHQT                 I PA      V           +
Sbjct: 61  TVHQNDGSYLAHTQGKKHQTNLARRAAREQKEGRGQNIDPATGLPVGVVGAGFGAANAQR 120

Query: 143 KNLVKIGRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAH 202
           +NL+KIGRPGYK+TKVRDP+TRQ GL FQ+QYP++  DV P+ + M+A+ QR+E P+K  
Sbjct: 121 RNLIKIGRPGYKITKVRDPVTRQQGLLFQLQYPDVAPDVEPKWQVMNAFTQRVEEPDKNF 180

Query: 203 QYLLFAAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIPP 262
           QYLL AAEPYET  FK+ ++E+DK EGK F++WDPD+K++ LQ  F ++R   Y     P
Sbjct: 181 QYLLVAAEPYETCGFKIPARELDKREGKQFSYWDPDAKEYWLQVMFMSEREERYVAA--P 238

Query: 263 GIER 266
           G  R
Sbjct: 239 GTRR 242



>gi|193688052|ref|XP_001950533.1| PREDICTED: splicing factor 3A subunit 2-like [Acyrthosiphon pisum]
          Length = 277

 Score =  278 bits (710), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 146/216 (67%), Positives = 165/216 (76%), Gaps = 3/216 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNRPG K G GGVA ++ETN DRRERLR+LALETIDL KDPYFMKNHLGSYECKLCL
Sbjct: 1   MDYQNRPGGKTGGGGVASWTETNKDRRERLRQLALETIDLQKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQ                 QPA + + +V+ KK  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQANLARRAAKEAKDAPQ-QPAPE-KPRVETKK-FVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           +VTK +D  T Q  L FQI YPEI  +V PRHRFMSAYEQRIEPP++  QYLLFAAEPYE
Sbjct: 118 RVTKQKDAETGQQSLLFQIDYPEITDNVRPRHRFMSAYEQRIEPPDRKWQYLLFAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFK 249
           TI+FKV S+EVDK E KF+ HW+  +KQF LQF +K
Sbjct: 178 TISFKVPSREVDKSEMKFWAHWNTQAKQFYLQFAYK 213



>gi|322697982|gb|EFY89756.1| splicing factor 3a subunit 2, putative [Metarhizium acridum CQMa
           102]
          Length = 240

 Score =  276 bits (705), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 133/238 (55%), Positives = 168/238 (70%), Gaps = 9/238 (3%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA +S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASHSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTX-XXXXXXXXXXXXXXIQPALQAQTKVQI------KKNLV 146
           T+H N+GSYLAHTQGKKHQT                I PA    + V        ++N V
Sbjct: 61  TVHQNDGSYLAHTQGKKHQTNLARRAAREQREGKANIDPATGLPSSVAASFAGGPRRNAV 120

Query: 147 KIGRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLL 206
           KIGRPGYK+TK+RDP+TRQ GL FQ+QYPE   D+ P+ + M+A+ QR+E P+K  QYLL
Sbjct: 121 KIGRPGYKITKIRDPVTRQQGLLFQLQYPEAAPDMSPKWQVMNAFTQRVEEPDKNFQYLL 180

Query: 207 FAAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIPPGI 264
            AAEPYET+ FK+ ++E+DK EG+ F  WDPD+K+F +Q  F  +R   ++    PG+
Sbjct: 181 VAAEPYETVGFKIPARELDKREGRGFCFWDPDAKEFWIQVMFMTEREERFNAA--PGL 236



>gi|380488401|emb|CCF37399.1| splicing factor 3A subunit 2 [Colletotrichum higginsianum]
          Length = 240

 Score =  276 bits (705), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 137/242 (56%), Positives = 169/242 (69%), Gaps = 11/242 (4%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA +S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASFSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXX-XXXIQPALQAQTKVQ--------IKKN 144
           T+H N+GSYLAHTQGKKHQT                I PA      V         I++N
Sbjct: 61  TVHQNDGSYLAHTQGKKHQTNLARRAAREQKEGKQNIDPATGLPMGVSGAGFGGXGIRRN 120

Query: 145 LVKIGRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQY 204
           ++KIGRPGYK+TKVRDP+TRQ GL FQ+QYP+I  DV P+ + M+A+ QRIE P+K  QY
Sbjct: 121 VIKIGRPGYKITKVRDPVTRQQGLLFQLQYPDIAPDVEPKWQVMNAFTQRIEEPDKNFQY 180

Query: 205 LLFAAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIPPGI 264
           LL AAEPYET  FK+ ++E+DK + K F+ WDPD+K++ LQ  F ++R   Y     PG 
Sbjct: 181 LLVAAEPYETCGFKIPARELDKRDDKQFSFWDPDAKEYWLQVMFMSEREERYVAA--PGT 238

Query: 265 ER 266
            R
Sbjct: 239 RR 240



>gi|396462678|ref|XP_003835950.1| similar to splicing factor 3a subunit 2 [Leptosphaeria maculans
           JN3]
 gi|312212502|emb|CBX92585.1| similar to splicing factor 3a subunit 2 [Leptosphaeria maculans
           JN3]
          Length = 235

 Score =  276 bits (705), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 132/233 (56%), Positives = 168/233 (72%), Gaps = 3/233 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA  S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASQSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQ-TKVQIKKNLVKIGRPG 152
           T+H N+GSYLAHTQG+KHQT                    Q     VQ+KKN++KIGRPG
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAKEQREGKRDDVNQQGLLAGVQVKKNVIKIGRPG 120

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y++TKVRDP TRQ GL FQ Q+P++   + P+ RFMSAYEQ++E P+  +QY + A EPY
Sbjct: 121 YRITKVRDPNTRQNGLLFQFQFPDLNPGITPKVRFMSAYEQKVEDPDPNYQYFIVAGEPY 180

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSE--GIPPG 263
           ET++ K+Q++EVD+ EGKF+T +D D+K+F  Q  FK +R   +S   G+ PG
Sbjct: 181 ETVSVKLQAREVDRREGKFWTWFDEDNKEFWCQILFKTERDERFSAVPGLAPG 233



>gi|393218209|gb|EJD03697.1| hypothetical protein FOMMEDRAFT_27602 [Fomitiporia mediterranea
           MF3/22]
          Length = 220

 Score =  275 bits (704), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 137/222 (61%), Positives = 164/222 (73%), Gaps = 9/222 (4%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR GSK G GGVAG SE NVDRRERLRKLA+ETIDL KDPY ++NHLGSYEC+LCL
Sbjct: 1   MDFQNRVGSKFGGGGVAGASEANVDRRERLRKLAMETIDLAKDPYILRNHLGSYECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTX-XXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPG 152
           TLHTNEGSYLAHTQGKKHQT                I P    QT VQ +K  +KIGRPG
Sbjct: 61  TLHTNEGSYLAHTQGKKHQTNLARRAARDMKDAQLMIAP---TQTNVQ-RKVFLKIGRPG 116

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTKVRDP  RQ G+  Q+  P+I   VIPR RFMSA+EQ+ EPPN+A+QYL+ AAEPY
Sbjct: 117 YRVTKVRDPEMRQEGMMVQVHLPQIKDGVIPRRRFMSAWEQKREPPNRAYQYLIVAAEPY 176

Query: 213 ETIAFKVQSKEVDKGEGKF----FTHWDPDSKQFSLQFFFKN 250
           ETIAF++ ++E++  +       ++HWD D+KQ+S QF FK+
Sbjct: 177 ETIAFRIPAREIEDDDDDEGGWNWSHWDADTKQYSFQFMFKS 218



>gi|242219322|ref|XP_002475442.1| predicted protein [Postia placenta Mad-698-R]
 gi|220725378|gb|EED79368.1| predicted protein [Postia placenta Mad-698-R]
          Length = 220

 Score =  275 bits (703), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 137/221 (61%), Positives = 163/221 (73%), Gaps = 9/221 (4%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVAG SETNVDRRERLRKLALETIDL KDPY ++NHLGS EC+LCL
Sbjct: 1   MDYQNRVGSKFGGGGVAGASETNVDRRERLRKLALETIDLAKDPYILRNHLGSLECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTX-XXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPG 152
           TLHTNEGSYLAHTQGKKHQT                I P   AQ  VQ +K  +KIGRPG
Sbjct: 61  TLHTNEGSYLAHTQGKKHQTNLARRAARDLKETQLMIAP---AQNTVQ-RKVFLKIGRPG 116

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTKVRD  T + G+  Q+  P+I  DVIPR RFMSA+EQ+ EPPNKA+QYL+ AAEPY
Sbjct: 117 YRVTKVRDRDTGKEGMMVQVHLPQIKADVIPRRRFMSAWEQKREPPNKAYQYLIVAAEPY 176

Query: 213 ETIAFKVQSKEVDKGEGKF----FTHWDPDSKQFSLQFFFK 249
           ETIAF++ ++E++          ++HWDPD+KQ+S QF F+
Sbjct: 177 ETIAFRIPAREIEDESDDAGYWNWSHWDPDTKQYSFQFMFR 217



>gi|485921375|gb|EOD47115.1| putative splicing factor 3a subunit protein [Neofusicoccum parvum
           UCRNP2]
          Length = 236

 Score =  275 bits (703), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 170/231 (73%), Gaps = 5/231 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+Q         GGVA  S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQASYYQPDLGGGVASQSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXX---XXXIQPALQAQTKVQIKKNLVKIGR 150
           T+H N+GSYLAHTQG+KHQT                  + P + A + VQ+KKN+VKIGR
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAREQKEGKDKDQLMPGMGA-SGVQVKKNVVKIGR 119

Query: 151 PGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAE 210
           PGYK+TK+RDP+TRQ GL FQ+QYPEI  +V+PR RFMSA+EQ++E P+K+ QYLL AAE
Sbjct: 120 PGYKITKIRDPLTRQHGLLFQLQYPEITPNVVPRVRFMSAFEQKVEEPDKSFQYLLVAAE 179

Query: 211 PYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIP 261
           PYET  FK+Q++E+D+ E +F+T +D D K+F +Q  FK +R   YS G+P
Sbjct: 180 PYETCGFKLQAREIDRRENRFWTWYDEDQKEFWVQILFKTEREERYS-GVP 229



>gi|115764755|ref|XP_781674.2| PREDICTED: splicing factor 3A subunit 2-like [Strongylocentrotus
           purpuratus]
          Length = 233

 Score =  275 bits (702), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 143/212 (67%), Positives = 162/212 (76%), Gaps = 3/212 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR G K G GGVA  SE+N DRRERLR+LALETIDLNKDPYFM+NHLGSYECKLCL
Sbjct: 1   MDFQNRAGGKTGGGGVASQSESNRDRRERLRQLALETIDLNKDPYFMRNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQ+                QPA + +++V+I+K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQS-NLARRAAKEAKDAPAQPAPE-KSRVEIRK-FVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK +D    Q  L FQI YPEI     PRHRFMSAYEQRIEPP+K  QYLLFA+EPYE
Sbjct: 118 KVTKQKDSDNDQQSLLFQIDYPEIAEGTYPRHRFMSAYEQRIEPPDKKWQYLLFASEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQ 245
           TI+FKV S+EVDK E KF+T W+ ++KQF LQ
Sbjct: 178 TISFKVPSREVDKSENKFWTSWNKETKQFFLQ 209



>gi|392571062|gb|EIW64234.1| hypothetical protein TRAVEDRAFT_158285 [Trametes versicolor
           FP-101664 SS1]
          Length = 220

 Score =  274 bits (700), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 138/221 (62%), Positives = 162/221 (73%), Gaps = 9/221 (4%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVAG SETNVDRRERLRKLALETIDL KDPY ++NHLGS EC+LCL
Sbjct: 1   MDYQNRVGSKFGGGGVAGASETNVDRRERLRKLALETIDLAKDPYILRNHLGSLECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTX-XXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPG 152
           TLHTNEGSYLAHTQGKKHQT                I P   AQ  V  KK  +KIGRPG
Sbjct: 61  TLHTNEGSYLAHTQGKKHQTNLARRAARDLKETQLMIAP---AQQNVH-KKVFLKIGRPG 116

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTKVRD  T + G+  Q+  P+I  DVIPR RFMSA+EQR EPPNKA+QYL+ AAEPY
Sbjct: 117 YRVTKVRDRDTGKEGMMVQVHLPQIKGDVIPRRRFMSAWEQRKEPPNKAYQYLIVAAEPY 176

Query: 213 ETIAFKVQSKEVDKGEGKF----FTHWDPDSKQFSLQFFFK 249
           ETIAF++ ++E++          ++HWDPD+KQ+S QF F+
Sbjct: 177 ETIAFRIPAREIEDESDDAGYWNWSHWDPDTKQYSFQFMFR 217



>gi|345570463|gb|EGX53284.1| hypothetical protein AOL_s00006g150 [Arthrobotrys oligospora ATCC
           24927]
          Length = 244

 Score =  273 bits (699), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 143/240 (59%), Positives = 180/240 (75%), Gaps = 8/240 (3%)

Query: 35  DFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCLT 94
           D QNR GSK G GGVAG+S TN DRRERLR+LALETIDL KDPYF KNH+GS+EC+LCLT
Sbjct: 5   DQQNRVGSKFGGGGVAGHSATNADRRERLRRLALETIDLEKDPYFFKNHVGSFECRLCLT 64

Query: 95  LHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQ-----PALQAQTKVQIKKNLVKIG 149
           +H N+GSYLAHTQG+KHQT               I      PA     ++ +KKNL+K+G
Sbjct: 65  VHQNDGSYLAHTQGRKHQTNLSRRAAKEQREGKNIDRITNLPAGMIGQQIAVKKNLLKVG 124

Query: 150 RPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIE-PPNKAHQYLLFA 208
           RPGYK+TK RDP+TRQ GL FQ+QYPEIG ++ PR+RFMSA+EQ++E PP+K +QYLL A
Sbjct: 125 RPGYKITKCRDPVTRQQGLLFQLQYPEIGTEIHPRYRFMSAFEQKVEQPPDKDYQYLLVA 184

Query: 209 AEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSE--GIPPGIER 266
           AEPYET+ FK+Q++EVD+  GKF+TH+D D+K+F LQ FFK +R   Y+   G+ P I +
Sbjct: 185 AEPYETVGFKLQAREVDRTPGKFWTHYDKDTKEFFLQLFFKTEREQRYAGVPGLAPSIRK 244



>gi|256085302|ref|XP_002578861.1| hypothetical protein [Schistosoma mansoni]
 gi|350645821|emb|CCD59583.1| hypothetical protein Smp_076880 [Schistosoma mansoni]
          Length = 218

 Score =  273 bits (698), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 159/219 (72%), Gaps = 7/219 (3%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+R G K GSGGVA  +E N DRRERLR+LAL+TIDLNKDPYFMKNHLG+YECKLCL
Sbjct: 1   MDFQHRVGGKTGSGGVASEAEANRDRRERLRQLALDTIDLNKDPYFMKNHLGTYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQ-TXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPG 152
           TLH NEGSYLAHTQGKKHQ                 +QP    + KV+ KK  +KIGRPG
Sbjct: 61  TLHNNEGSYLAHTQGKKHQYNLQRRAVEQAREAPSTMQP---ERVKVEPKK-FIKIGRPG 116

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEI--GLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAE 210
           YKVTK +DP   Q  + FQI YPEI     VIPRHRFMSAYEQ +EPP+K  QYLLFAAE
Sbjct: 117 YKVTKQKDPDANQQSMLFQIDYPEIADASGVIPRHRFMSAYEQHVEPPDKRWQYLLFAAE 176

Query: 211 PYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFK 249
           PYETIAFK+ S+EVDK   K +T+W+  SKQF LQ   K
Sbjct: 177 PYETIAFKIPSREVDKDPKKLWTYWNSSSKQFFLQVSLK 215



>gi|255947536|ref|XP_002564535.1| Pc22g04980 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211591552|emb|CAP97786.1| Pc22g04980 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 234

 Score =  273 bits (697), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 131/236 (55%), Positives = 172/236 (72%), Gaps = 4/236 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA  S TN DRRERLRKLA+ETID+ KDPY  KNHLG++EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASKSATNADRRERLRKLAMETIDIEKDPYIFKNHLGTFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           T+H N+GSYLAHTQG+KHQT                   +     VQ+KK L+KIGRPGY
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAREAREGKAQDGTMPGVAGVQVKKQLIKIGRPGY 120

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           K+TK+ DP+TRQ GL FQ+Q+ EI   V PR RFMSA+EQ++E P+  +QYL+ AAEPY+
Sbjct: 121 KITKILDPLTRQQGLLFQLQFQEITPGVTPRVRFMSAFEQQVETPDNKYQYLVVAAEPYQ 180

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIPPGIERAPM 269
           T AFK+Q++E+D+ + +++T +D DSK+F +Q  FK +R  ++S G+ PG+  APM
Sbjct: 181 TCAFKLQAREIDRRDERYWTWFDEDSKEFWIQVMFKTEREEIFS-GV-PGL--APM 232



>gi|19924252|sp|Q62203.2|SF3A2_MOUSE RecName: Full=Splicing factor 3A subunit 2; AltName: Full=SF3a66;
           AltName: Full=Spliceosome-associated protein 62;
           Short=SAP 62
 gi|10443237|emb|CAC10449.1| splicing factor 3a, subunit 2 [Mus musculus]
          Length = 475

 Score =  272 bits (696), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 144/220 (65%), Positives = 157/220 (71%), Gaps = 13/220 (5%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQT-NLARRAAKEAKEAPAQPA--PEQVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKFF           LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFFF----------LQFHFKMEKP 207



>gi|477532654|gb|ENH84265.1| splicing factor 3a subunit [Colletotrichum orbiculare MAFF 240422]
          Length = 241

 Score =  272 bits (695), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 134/231 (58%), Positives = 164/231 (70%), Gaps = 8/231 (3%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA  S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASQSSTNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXX-XXXIQPA-------LQAQTKVQIKKNL 145
           T+H N+GSYLAHTQGKKHQT                I PA       + A      +KN+
Sbjct: 61  TVHQNDGSYLAHTQGKKHQTNLARRAAREQKEGKQNIDPATGLPVGLVGAGFGSLARKNV 120

Query: 146 VKIGRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYL 205
           +KIGRPGYK+TKVRDP+TRQ GL FQ+QYP+I  DV P+ + M+A+ Q +E P+K  QYL
Sbjct: 121 IKIGRPGYKITKVRDPVTRQQGLLFQLQYPDISPDVEPKWQVMNAFTQHVEEPDKNFQYL 180

Query: 206 LFAAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMY 256
           L AAEPYET  FK+ ++E+DK E K F+ WDPDSK++ LQ  F ++R   Y
Sbjct: 181 LVAAEPYETCGFKIPARELDKREDKQFSFWDPDSKEYWLQVMFMSEREERY 231



>gi|358057293|dbj|GAA96642.1| hypothetical protein E5Q_03313 [Mixia osmundae IAM 14324]
          Length = 220

 Score =  271 bits (694), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 158/219 (72%), Gaps = 4/219 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD QNR GSK G GG+AG +E  VDRRERLRKLALETIDL KDPY ++NHLG  EC+LCL
Sbjct: 1   MDQQNRVGSKFGGGGIAGANEAGVDRRERLRKLALETIDLAKDPYLLRNHLGGLECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQI----KKNLVKIG 149
           TLHTNEGSYLAHTQGKKHQT                Q  L AQ         KK  +KIG
Sbjct: 61  TLHTNEGSYLAHTQGKKHQTNLARRAAREATDSSVYQSQLLAQQAAAQRLAPKKQFLKIG 120

Query: 150 RPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAA 209
            PGY+ TK++DP + QLGL FQI YPEI  D IP HRFMSAYEQRIE P++ HQYLL AA
Sbjct: 121 LPGYQATKIKDPESGQLGLLFQIFYPEIKPDSIPMHRFMSAYEQRIEAPSRDHQYLLIAA 180

Query: 210 EPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFF 248
           EPY+TIAFKVQS+E+D   GK + H+DPD+K +SLQF F
Sbjct: 181 EPYQTIAFKVQSREIDHQPGKGWKHFDPDTKTYSLQFLF 219



>gi|148699549|gb|EDL31496.1| splicing factor 3a, subunit 2, isoform CRA_a [Mus musculus]
          Length = 475

 Score =  271 bits (694), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 144/220 (65%), Positives = 157/220 (71%), Gaps = 13/220 (5%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQT-NLARRAAKEAKEAPAQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   ++PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAEGIMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           TIAFKV S+E+DK EGKFF           LQF FK ++P
Sbjct: 178 TIAFKVPSREIDKAEGKFFF----------LQFHFKMEKP 207



>gi|340517371|gb|EGR47615.1| predicted protein [Trichoderma reesei QM6a]
          Length = 238

 Score =  271 bits (694), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 129/236 (54%), Positives = 167/236 (70%), Gaps = 7/236 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA +S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASHSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXX-XXXIQPAL----QAQTKVQIKKNLVKI 148
           T+H N+GSYLAHTQGKKHQT                I PA          +  ++N+VKI
Sbjct: 61  TVHQNDGSYLAHTQGKKHQTNLARRAAREQREGKQNIDPATGLPASVAANLTARRNVVKI 120

Query: 149 GRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFA 208
           GRPGYK+TK+RDP+TRQ GL FQ+QYP+   D+ P+ + M+A+ QR E P+K  QYL+ A
Sbjct: 121 GRPGYKITKIRDPVTRQQGLLFQLQYPDATPDLAPKWQVMNAFTQRAEEPDKNFQYLVVA 180

Query: 209 AEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIPPGI 264
           AEPYE++ FK+ ++E+DK E K F+ WDPDSK++ +Q  F  +R   ++    PG+
Sbjct: 181 AEPYESVGFKIPARELDKREDKQFSFWDPDSKEYWIQVMFMTEREERFNAA--PGL 234



>gi|425768865|gb|EKV07376.1| Splicing factor 3a subunit 2, putative [Penicillium digitatum
           PHI26]
 gi|425776370|gb|EKV14589.1| Splicing factor 3a subunit 2, putative [Penicillium digitatum Pd1]
          Length = 235

 Score =  271 bits (693), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 132/237 (55%), Positives = 174/237 (73%), Gaps = 5/237 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA  S TN DRRERLRKLA+ETID+ KDPY  +NHLG++EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASKSATNADRRERLRKLAMETIDIEKDPYIFRNHLGTFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPA-LQAQTKVQIKKNLVKIGRPG 152
           T+H N+GSYLAHTQG+KHQT                 P+ L     VQ+KK L+KIGRPG
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAREAREGKNQDPSSLPGVAGVQVKKQLIKIGRPG 120

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           YK+TK+ DP+TRQ GL FQ+Q+ EI   V PR RFMSA+EQ++E P+  +QYL+ AAEPY
Sbjct: 121 YKITKILDPLTRQQGLLFQLQFQEITPGVTPRVRFMSAFEQQVETPDNKYQYLVVAAEPY 180

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIPPGIERAPM 269
           +T AFK+Q++E+D+ + +++T +D DSK+F +Q  FK +R  ++S G+ PG+  APM
Sbjct: 181 QTCAFKLQAREIDRRDERYWTWFDEDSKEFWIQVMFKTEREEIFS-GV-PGL--APM 233



>gi|170084265|ref|XP_001873356.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164650908|gb|EDR15148.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 220

 Score =  271 bits (692), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 135/221 (61%), Positives = 163/221 (73%), Gaps = 9/221 (4%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVAG SETNVDRRERLRKLALETIDL KDPY ++NHLGS EC+LCL
Sbjct: 1   MDYQNRVGSKFGGGGVAGASETNVDRRERLRKLALETIDLAKDPYILRNHLGSLECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTX-XXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPG 152
           TLHTNEGSYLAHTQGKKHQT                I P   AQ+ +Q +K  +KIGRPG
Sbjct: 61  TLHTNEGSYLAHTQGKKHQTNLARRAARDAKDTQLMIAP---AQSNIQ-RKVFLKIGRPG 116

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTKVRD  T + G+  Q+  P+I   V+PR RFMSA+EQ+ EPPNKA+QYL+ AAEPY
Sbjct: 117 YRVTKVRDRDTGKEGMMVQVHLPQIKDGVVPRRRFMSAWEQKREPPNKAYQYLIVAAEPY 176

Query: 213 ETIAFKVQSKEV----DKGEGKFFTHWDPDSKQFSLQFFFK 249
           ETIAF++ ++E+    D      ++HWDPD+KQ+S QF F+
Sbjct: 177 ETIAFRIPAREIEDEADDAGYWNWSHWDPDTKQYSFQFMFR 217



>gi|500253876|gb|EON97523.1| putative splicing factor 3a subunit 2 protein [Togninia minima
           UCRPA7]
          Length = 247

 Score =  271 bits (692), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 132/245 (53%), Positives = 167/245 (68%), Gaps = 16/245 (6%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA +S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASHSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTX-XXXXXXXXXXXXXXIQPALQAQTKV------------- 139
           T+H N+GSYLAHTQGKKHQT                + P       V             
Sbjct: 61  TVHQNDGSYLAHTQGKKHQTNLARRAAKEQKEGKSQVDPQTGLPMGVVGAGFSALGLGAN 120

Query: 140 QIKKNLVKIGRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPN 199
            +++N+VKIGRPGYK+TKVRDP+TRQ GL FQ+Q+P+I  DV P+ + MSA+ QR+E  +
Sbjct: 121 GVRRNVVKIGRPGYKITKVRDPVTRQQGLLFQLQFPDIASDVTPKWQVMSAFSQRVEEAD 180

Query: 200 KAHQYLLFAAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEG 259
           K  QYLL AAEPYET  FK+ ++E+DK E K F+ WDPD+K++ +Q  F  +R   +  G
Sbjct: 181 KNFQYLLVAAEPYETCGFKIPARELDKREDKQFSFWDPDAKEYWIQVMFMTEREERF--G 238

Query: 260 IPPGI 264
             PG+
Sbjct: 239 AAPGL 243



>gi|400598792|gb|EJP66499.1| splicing factor 3A subunit 2 [Beauveria bassiana ARSEF 2860]
          Length = 243

 Score =  271 bits (692), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 132/242 (54%), Positives = 167/242 (69%), Gaps = 13/242 (5%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA +S TN DRRERLRKLALETIDL+KDPYF KNH+G++EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASHSATNADRRERLRKLALETIDLDKDPYFFKNHVGTFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXX------IQPALQAQTKVQI-----K 142
           T+H N+GSYLAHTQGKKHQT                     I PA    T V       +
Sbjct: 61  TVHQNDGSYLAHTQGKKHQTNLARRAAREQREGKAAAAAAGIDPATGLPTAVAAGIHSSR 120

Query: 143 KNLVKIGRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAH 202
           +N+VKIGRPGYK+TKVRDP +RQ GL FQ+QYPE   +  P+ + M+AY QR+E P++ +
Sbjct: 121 RNMVKIGRPGYKITKVRDPASRQQGLLFQLQYPEATPETKPKWQVMNAYTQRVEEPDRNY 180

Query: 203 QYLLFAAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIPP 262
           QYLL AAEPYET+ FK+ ++E+DK E K F  WDPD+K+F +Q  F  +R   ++    P
Sbjct: 181 QYLLVAAEPYETVGFKIPARELDKREDKQFCFWDPDAKEFWVQVMFMTEREARFNAA--P 238

Query: 263 GI 264
           G+
Sbjct: 239 GL 240



>gi|472584746|gb|EMS22332.1| splicing factor 3A subunit 2 [Rhodosporidium toruloides NP11]
          Length = 220

 Score =  271 bits (692), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 156/218 (71%), Gaps = 4/218 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA   ET +DRRERLRKLALETIDL KDPY ++NHLG  EC+LCL
Sbjct: 1   MDYQNRVGSKFGGGGVARADETAIDRRERLRKLALETIDLAKDPYILRNHLGGIECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXX---XXXIQPALQAQTKVQIKKNLVKIGR 150
           TLHTNEGSYLAHTQGKKHQT                  +      + KVQ K   +KIG 
Sbjct: 61  TLHTNEGSYLAHTQGKKHQTNLARRAARDAHDPNYAAQLAAQAAQKPKVQTK-TFIKIGS 119

Query: 151 PGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAE 210
           PGY+VTKVRDP+T QLGL FQ+ YPEI   + PRHRFMSA+EQ+ E P +  QYLL AAE
Sbjct: 120 PGYQVTKVRDPVTGQLGLLFQVHYPEIKEGIKPRHRFMSAFEQKQEVPARNWQYLLIAAE 179

Query: 211 PYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFF 248
           PY+TI+FK+Q++E+D  EG  + HWD D+K FSLQF F
Sbjct: 180 PYQTISFKIQAREIDSTEGMSWEHWDQDTKTFSLQFLF 217



>gi|451848442|gb|EMD61748.1| hypothetical protein COCSADRAFT_123734 [Bipolaris sorokiniana
           ND90Pr]
          Length = 235

 Score =  270 bits (691), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 133/233 (57%), Positives = 165/233 (70%), Gaps = 3/233 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA  S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASQSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQ-TKVQIKKNLVKIGRPG 152
           T+H N+GSYLAHTQG+KHQT                    Q     V  KKN++KIGRPG
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAKEQREGKRDDVGQQGLLAGVVPKKNVIKIGRPG 120

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y++TKVRDP TRQ GL FQ Q+P++   V P+ R MSAYEQRIE P+  +QYL+ A EPY
Sbjct: 121 YRITKVRDPNTRQNGLLFQFQFPDLTPGVTPKVRIMSAYEQRIEEPDPNYQYLIVAGEPY 180

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSE--GIPPG 263
           ET+A K+QS+++D+ EGKF+  +D D+K+F  Q  FK +R   +S   G+ PG
Sbjct: 181 ETVAVKLQSRDIDRREGKFWFWYDEDAKEFWCQVLFKTERDERFSAVPGLAPG 233



>gi|346978617|gb|EGY22069.1| splicing factor 3A subunit 2 [Verticillium dahliae VdLs.17]
          Length = 241

 Score =  270 bits (690), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 131/231 (56%), Positives = 166/231 (71%), Gaps = 8/231 (3%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA  S +N DRRERL+KLALETI+L+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASQSASNADRRERLKKLALETINLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXX-XIQPALQ-------AQTKVQIKKNL 145
           T+H N+GSYLAHTQGKKHQT                I PA         A   V  ++NL
Sbjct: 61  TVHQNDGSYLAHTQGKKHQTNLARRAAREQKEGKGAIDPATGLPAGVSGAGFSVGPRRNL 120

Query: 146 VKIGRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYL 205
           VKIGRPGYK+TK+RDP+TRQ GL FQ+QYP+I  DV PR + M+A+ QR+E P++  QYL
Sbjct: 121 VKIGRPGYKITKIRDPMTRQQGLLFQLQYPDIAPDVEPRWQVMNAFTQRVEDPDRNFQYL 180

Query: 206 LFAAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMY 256
           L AAEPYET  FK+ ++E+DK + K F++WDPDSK++ +Q  F ++R   Y
Sbjct: 181 LVAAEPYETCGFKIPARELDKRDDKQFSYWDPDSKEYWVQVMFMSEREERY 231



>gi|301114113|ref|XP_002998826.1| splicing factor 3A subunit, putative [Phytophthora infestans T30-4]
 gi|262110920|gb|EEY68972.1| splicing factor 3A subunit, putative [Phytophthora infestans T30-4]
          Length = 244

 Score =  270 bits (690), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 137/221 (61%), Positives = 157/221 (71%), Gaps = 6/221 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR GSK GSGGVA  S++NVDRRERLRKLALET+DL KDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRVGSKPGSGGVASDSQSNVDRRERLRKLALETVDLAKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXX------XIQPALQAQTKVQIKKNLVK 147
           TLH NEG+YLAHTQGK+HQ+                     +Q A  A      K   +K
Sbjct: 61  TLHNNEGNYLAHTQGKRHQSNLARRAAKEAADASHSTAAANLQAARAAAAAAASKPRALK 120

Query: 148 IGRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLF 207
           IG PGYKVTK RDP T    L FQI YPEI   + PRHRFMSA+EQ++E P+K  QYLLF
Sbjct: 121 IGLPGYKVTKQRDPDTGARILLFQIAYPEIADKLQPRHRFMSAFEQKVEAPDKRWQYLLF 180

Query: 208 AAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFF 248
           A EPYET+AFK+ + +VDK EGKFF++WD D K F+LQ  F
Sbjct: 181 ACEPYETVAFKIPNDDVDKSEGKFFSNWDKDGKTFTLQLTF 221



>gi|511917566|ref|XP_004778055.1| PREDICTED: splicing factor 3A subunit 2 isoform X1 [Mustela
           putorius furo]
          Length = 509

 Score =  270 bits (690), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 144/223 (64%), Positives = 157/223 (70%), Gaps = 16/223 (7%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQT-NLARRAAKEAKEAPAQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 K-------------VTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNK 200
           K             VTK RD    Q  L FQI YPEI   V PRHRFMSAYEQRIEPP++
Sbjct: 118 KGQGGWDLRASCVAVTKQRDTEMGQQSLLFQIDYPEIAEGVTPRHRFMSAYEQRIEPPDR 177

Query: 201 AHQYLLFAAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFS 243
             QYLL AAEPYETIAFKV S+E+DK EGKF+THW+ ++KQ S
Sbjct: 178 RWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQVS 220



>gi|409083835|gb|EKM84192.1| hypothetical protein AGABI1DRAFT_110756 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 220

 Score =  270 bits (689), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 135/222 (60%), Positives = 163/222 (73%), Gaps = 9/222 (4%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVAG SE+NVDRRERLRKLALETIDL KDPY ++NHLGS EC+LCL
Sbjct: 1   MDYQNRVGSKFGGGGVAGASESNVDRRERLRKLALETIDLAKDPYILRNHLGSLECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTX-XXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPG 152
           TLHTNEGSYLAHTQGKKHQT                I P   AQ+ VQ +K  +KIGRPG
Sbjct: 61  TLHTNEGSYLAHTQGKKHQTNLARRAARDAKETQLMIAP---AQSNVQ-RKVFLKIGRPG 116

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTKVRD  T + G+  Q+  P+I   V PR RFMSA+EQ+ EPPNKA+QYL+ AAEPY
Sbjct: 117 YRVTKVRDRDTGKEGMMVQVHLPQIKSGVTPRRRFMSAWEQKREPPNKAYQYLIVAAEPY 176

Query: 213 ETIAFKVQSKEV----DKGEGKFFTHWDPDSKQFSLQFFFKN 250
           ETIAF++ ++E+    D      ++HWDPD+KQ+S QF F++
Sbjct: 177 ETIAFRIPAREIEDETDDAGYWNWSHWDPDTKQYSFQFMFRS 218



>gi|471571536|gb|EMR70288.1| putative splicing factor 3a subunit protein [Eutypa lata UCREL1]
          Length = 250

 Score =  270 bits (689), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 137/245 (55%), Positives = 168/245 (68%), Gaps = 18/245 (7%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA +S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASHSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXX-------IQP--------ALQAQTK 138
           T+H N+GSYLAHTQGKKHQT                      I P               
Sbjct: 61  TVHQNDGSYLAHTQGKKHQTNLARRAAREQKEGRQGGPGGGQIDPNTGLPVGVVGAGFGG 120

Query: 139 VQIKKNLVKIGRPGYKVTKVRDPITRQLGLFFQIQYPE-IGLDVIPRHRFMSAYEQRIE- 196
           V IKKN+VKIGRPGYK+TKVRD +TRQ GL FQ+QYPE +  D  P+ RFMSA+EQR++ 
Sbjct: 121 VGIKKNVVKIGRPGYKITKVRDTVTRQQGLLFQLQYPEMVAPDATPKVRFMSAFEQRVDD 180

Query: 197 PPNKAHQYLLFAAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMY 256
           PP+K  QY+L AAEPYET  FK+Q++E+D+ E +++T WD D K+F +Q  F  +R   Y
Sbjct: 181 PPDKNFQYMLVAAEPYETCGFKLQAREIDRSEDRYWTWWDADLKEFWVQVMFLTEREERY 240

Query: 257 SEGIP 261
             G+P
Sbjct: 241 V-GVP 244



>gi|342320986|gb|EGU12924.1| Splicing factor 3a [Rhodotorula glutinis ATCC 204091]
          Length = 235

 Score =  270 bits (689), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 132/217 (60%), Positives = 156/217 (71%), Gaps = 4/217 (1%)

Query: 35  DFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCLT 94
           D+QNR GSK G GGVA   ET +DRRERLRKLALETIDL KDPY ++NHLG  EC+LCLT
Sbjct: 17  DYQNRVGSKFGGGGVARADETAIDRRERLRKLALETIDLAKDPYILRNHLGGIECRLCLT 76

Query: 95  LHTNEGSYLAHTQGKKHQTXXXXXXXXXXXX---XXXIQPALQAQTKVQIKKNLVKIGRP 151
           LHTNEGSYLAHTQGKKHQT                  +      + KVQ K   +KIG P
Sbjct: 77  LHTNEGSYLAHTQGKKHQTNLARRAARDAHDPNYAAQLAAQAAQKPKVQTK-TFIKIGSP 135

Query: 152 GYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEP 211
           GY+VTKVRDP+T QLGL FQ+ YPEI   + PRHRFMSA+EQ+ E P++  QYLL AAEP
Sbjct: 136 GYQVTKVRDPVTGQLGLLFQVHYPEIKEGIKPRHRFMSAFEQKQEVPDRNWQYLLIAAEP 195

Query: 212 YETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFF 248
           Y+TI+FK+Q++E+D  EG  + HWD D+K FSLQF F
Sbjct: 196 YQTISFKIQAREIDSTEGMSWEHWDQDTKTFSLQFLF 232



>gi|302412174|ref|XP_003003920.1| splicing factor 3A subunit 2 [Verticillium albo-atrum VaMs.102]
 gi|261357825|gb|EEY20253.1| splicing factor 3A subunit 2 [Verticillium albo-atrum VaMs.102]
          Length = 241

 Score =  270 bits (689), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 130/231 (56%), Positives = 166/231 (71%), Gaps = 8/231 (3%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA  S +N DRRERL+KLALETI+L+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASQSASNADRRERLKKLALETINLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXX-XIQPALQ-------AQTKVQIKKNL 145
           T+H N+GSYLAHTQGKKHQT                I PA         A   V  ++NL
Sbjct: 61  TVHQNDGSYLAHTQGKKHQTNLARRAAREQKEGKGAIDPATGLPAGVSGAGFSVGPRRNL 120

Query: 146 VKIGRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYL 205
           VKIGRPGYK+TK+RDP+TRQ GL FQ+QYP+I  D+ PR + M+A+ QR+E P++  QYL
Sbjct: 121 VKIGRPGYKITKIRDPMTRQQGLLFQLQYPDIAPDIEPRWQVMNAFTQRVEDPDRNFQYL 180

Query: 206 LFAAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMY 256
           L AAEPYET  FK+ ++E+DK + K F++WDPDSK++ +Q  F ++R   Y
Sbjct: 181 LVAAEPYETCGFKIPARELDKRDDKQFSYWDPDSKEYWVQVMFMSEREERY 231



>gi|511983271|ref|XP_004809448.1| PREDICTED: splicing factor 3A subunit 2 isoform X1 [Mustela
           putorius furo]
          Length = 502

 Score =  270 bits (689), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 144/223 (64%), Positives = 157/223 (70%), Gaps = 16/223 (7%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQT-NLARRAAKEAKEAPAQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 K-------------VTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNK 200
           K             VTK RD    Q  L FQI YPEI   V PRHRFMSAYEQRIEPP++
Sbjct: 118 KGQGGWDLRASCVAVTKQRDTEMGQQSLLFQIDYPEIAEGVTPRHRFMSAYEQRIEPPDR 177

Query: 201 AHQYLLFAAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFS 243
             QYLL AAEPYETIAFKV S+E+DK EGKF+THW+ ++KQ S
Sbjct: 178 RWQYLLMAAEPYETIAFKVPSREIDKAEGKFWTHWNRETKQVS 220



>gi|358395891|gb|EHK45278.1| hypothetical protein TRIATDRAFT_243608 [Trichoderma atroviride IMI
           206040]
          Length = 238

 Score =  270 bits (689), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 129/236 (54%), Positives = 167/236 (70%), Gaps = 7/236 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR GSK G GGVA +S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDFQNRAGSKFGGGGVASHSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXX-XXXIQPALQAQTKVQ----IKKNLVKI 148
           T+H N+GSYLAHTQGKKHQT                I PA    T V      ++N+VKI
Sbjct: 61  TVHQNDGSYLAHTQGKKHQTNLARRAAREQKEGKQSIDPATGLPTSVAASLTARRNIVKI 120

Query: 149 GRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFA 208
           GRPGYK+TK+RDP+TRQ GL FQ++YP+   ++ P+ + M+A+ QR E P++  QYL+ A
Sbjct: 121 GRPGYKITKIRDPVTRQQGLLFQLEYPDATPELAPKWQVMNAFTQRAEEPDRNFQYLVVA 180

Query: 209 AEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIPPGI 264
           AEPYE++ FK+ ++E+DK E K F  WDPDSK++ +Q  F  +R   ++    PG+
Sbjct: 181 AEPYESVGFKIPARELDKREDKQFAFWDPDSKEYWIQVMFMTEREERFNAA--PGL 234



>gi|399163730|emb|CCE35251.1| related to splicing factor 3A subunit 2 [Claviceps purpurea 20.1]
          Length = 255

 Score =  269 bits (688), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 131/240 (54%), Positives = 163/240 (67%), Gaps = 21/240 (8%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA +S +N DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASFSSSNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXX------XXIQPALQAQTKV-------- 139
           T+H N+GSYLAHTQGKKHQT                     I P     T V        
Sbjct: 61  TVHQNDGSYLAHTQGKKHQTNLARRAAREQREGGGGNRHAGIDPVTGLPTSVVASFGGGG 120

Query: 140 -------QIKKNLVKIGRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYE 192
                   +K+N VKIGRPGYK+TK+RDP+TRQ GL FQ+QYP+ G+D+ P+ + M+AY 
Sbjct: 121 NGVAGGAGVKRNAVKIGRPGYKITKIRDPVTRQQGLLFQLQYPDAGVDMTPKWQVMNAYA 180

Query: 193 QRIEPPNKAHQYLLFAAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDR 252
           QR+E P+K  QYLL AAEPYET+ FK+  +E+DK E + F  WDPD+K+F +Q  F  +R
Sbjct: 181 QRVEDPDKNFQYLLVAAEPYETVGFKIPVRELDKREERQFCFWDPDAKEFWIQVMFMTER 240



>gi|409051812|gb|EKM61288.1| hypothetical protein PHACADRAFT_24495 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 221

 Score =  269 bits (688), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 134/221 (60%), Positives = 160/221 (72%), Gaps = 8/221 (3%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVAG SETNVDRRERLRKLALETIDL KDPY ++NHLGS EC+LCL
Sbjct: 1   MDYQNRVGSKFGGGGVAGASETNVDRRERLRKLALETIDLAKDPYILRNHLGSLECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTX-XXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPG 152
           TLHTNEGSYLAHTQGKKHQT                I P  Q Q     +K  +KIGRPG
Sbjct: 61  TLHTNEGSYLAHTQGKKHQTNLARRAARDLKETQLMIAPNAQNQVP---RKVFLKIGRPG 117

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTKVRD  T + G+  Q+  P+I   VIPR RFMSA+EQ+ EPPNKA+QYL+ AAEPY
Sbjct: 118 YRVTKVRDRDTGKEGMMVQVHLPQIKPGVIPRRRFMSAWEQKREPPNKAYQYLIVAAEPY 177

Query: 213 ETIAFKVQSKEVDKGEGKF----FTHWDPDSKQFSLQFFFK 249
           ETIAF++ ++E++          ++HWDPD+KQ+S QF F+
Sbjct: 178 ETIAFRIPAREIEDESDDAGYWNWSHWDPDTKQYSFQFMFR 218



>gi|367022022|ref|XP_003660296.1| hypothetical protein MYCTH_2298434 [Myceliophthora thermophila ATCC
           42464]
 gi|347007563|gb|AEO55051.1| hypothetical protein MYCTH_2298434 [Myceliophthora thermophila ATCC
           42464]
          Length = 247

 Score =  269 bits (688), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 132/233 (56%), Positives = 161/233 (69%), Gaps = 14/233 (6%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA +S TN DRRERLRKLALE IDL+KDPY  KNHLGS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASHSMTNADRRERLRKLALEQIDLDKDPYIFKNHLGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXX-XIQPALQAQTKVQI----------- 141
           T+H N+GSYLAHTQGKKHQT                I P       V             
Sbjct: 61  TVHQNDGSYLAHTQGKKHQTNLARRAAREQREGKGDIDPHTGLPVGVVGAGFAALGLGGG 120

Query: 142 --KKNLVKIGRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPN 199
             +KN++KIGRPGYK+TKVRDPITRQ GL FQ+QYP+IG  + P+ + MSA+ QR+E P+
Sbjct: 121 GPRKNVIKIGRPGYKITKVRDPITRQQGLLFQLQYPDIGTGITPKWQVMSAFSQRVEEPD 180

Query: 200 KAHQYLLFAAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDR 252
           +  QYLL AAEPYET  FK+ ++E+DK EG+ F +WDPD+K+F LQ  F  +R
Sbjct: 181 RNFQYLLVAAEPYETCGFKIPARELDKREGRQFEYWDPDAKEFWLQIMFMTER 233



>gi|482804799|gb|EOA81898.1| hypothetical protein SETTUDRAFT_165460 [Setosphaeria turcica Et28A]
          Length = 235

 Score =  269 bits (687), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 131/233 (56%), Positives = 165/233 (70%), Gaps = 3/233 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA  S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASQSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQ-TKVQIKKNLVKIGRPG 152
           T+H N+GSYLAHTQG+KHQT                    Q     V  KKN++KIGRPG
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAKEQREGKRDDVGQQGLLAGVVPKKNVIKIGRPG 120

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y++TKVRDP TRQ GL FQ Q+P++   + P+ R MSAYEQR+E P+  +QYL+ A EPY
Sbjct: 121 YRITKVRDPNTRQNGLLFQFQFPDLTPGITPKVRIMSAYEQRVEEPDPNYQYLIVAGEPY 180

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSE--GIPPG 263
           ET+A K+QS+++D+ EGKF+  +D D+K+F  Q  FK +R   +S   G+ PG
Sbjct: 181 ETVAVKLQSRDIDRREGKFWFWFDEDAKEFWCQILFKTERDERFSAVPGLAPG 233



>gi|358388846|gb|EHK26439.1| hypothetical protein TRIVIDRAFT_188750 [Trichoderma virens Gv29-8]
          Length = 238

 Score =  269 bits (687), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 128/236 (54%), Positives = 166/236 (70%), Gaps = 7/236 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA +S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASHSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXX-XXXIQPAL----QAQTKVQIKKNLVKI 148
           T+H N+GSYLAHTQGKKHQT                I PA          +  ++N+VKI
Sbjct: 61  TVHQNDGSYLAHTQGKKHQTNLARRAAREQKEGKQNIDPATGLPASVAANLNARRNVVKI 120

Query: 149 GRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFA 208
           GRPGYK+TK+RDP+TRQ GL FQ+QYP+   ++ P+ + M+A+ QR E P+K  QYL+ A
Sbjct: 121 GRPGYKITKIRDPVTRQQGLLFQLQYPDATPELAPKWQVMNAFTQRAEEPDKNFQYLVVA 180

Query: 209 AEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIPPGI 264
           AEPYE++ FK+ ++E+DK E K F  WDPDSK++ +Q  F  +R   ++    PG+
Sbjct: 181 AEPYESVGFKIPARELDKREDKQFCFWDPDSKEYWIQVMFMTEREERFNAA--PGL 234



>gi|169844733|ref|XP_001829087.1| splicing factor 3a [Coprinopsis cinerea okayama7#130]
 gi|116509827|gb|EAU92722.1| splicing factor 3a [Coprinopsis cinerea okayama7#130]
          Length = 220

 Score =  268 bits (686), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 133/221 (60%), Positives = 163/221 (73%), Gaps = 9/221 (4%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVAG SE+NVDRRERLRKLALETIDL KDPY ++NHLGS EC+LCL
Sbjct: 1   MDYQNRVGSKFGGGGVAGASESNVDRRERLRKLALETIDLAKDPYILRNHLGSLECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTX-XXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPG 152
           TLHTNEGSYLAHTQGKKHQT                + P   AQ+ VQ +K  +KIGRPG
Sbjct: 61  TLHTNEGSYLAHTQGKKHQTNLARRAARDAKETQLTVTP---AQSNVQ-RKVFLKIGRPG 116

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTK+RD  T + G+  Q+  P+I   V+PR RFMSA+EQ+ EPPNKA+QYL+ AAEPY
Sbjct: 117 YRVTKIRDRDTGKEGMMVQVHLPQIKPGVMPRRRFMSAWEQKREPPNKAYQYLIVAAEPY 176

Query: 213 ETIAFKVQSKEV----DKGEGKFFTHWDPDSKQFSLQFFFK 249
           ETIAF++ ++E+    D      ++HWDPD+KQ+S QF F+
Sbjct: 177 ETIAFRIPAREIEDESDDAGHWNWSHWDPDTKQYSFQFMFR 217



>gi|85068275|ref|XP_962153.1| hypothetical protein NCU07299 [Neurospora crassa OR74A]
 gi|28923750|gb|EAA32917.1| hypothetical protein NCU07299 [Neurospora crassa OR74A]
 gi|336471497|gb|EGO59658.1| hypothetical protein NEUTE1DRAFT_121415 [Neurospora tetrasperma
           FGSC 2508]
 gi|350292598|gb|EGZ73793.1| hypothetical protein NEUTE2DRAFT_108736 [Neurospora tetrasperma
           FGSC 2509]
          Length = 247

 Score =  268 bits (686), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 131/233 (56%), Positives = 161/233 (69%), Gaps = 14/233 (6%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA +S TN DRRERLRKLALETIDL+KDPY  +NHLGS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASHSATNADRRERLRKLALETIDLDKDPYIFRNHLGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTX-XXXXXXXXXXXXXXIQPALQAQTKV------------- 139
           T+H N+GSYLAHTQGKKHQT                + P       V             
Sbjct: 61  TVHQNDGSYLAHTQGKKHQTNLARRAAREQKEGKGEVDPQTGLPVGVVGAGFAALGLGAG 120

Query: 140 QIKKNLVKIGRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPN 199
            ++KN+VKIGRPGYK+TKVRDPITRQ GL FQ+QYP+I   V P+ + MSA+ QR+E P+
Sbjct: 121 GVRKNVVKIGRPGYKITKVRDPITRQQGLLFQLQYPDIAPGVTPKWQVMSAFSQRVEEPD 180

Query: 200 KAHQYLLFAAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDR 252
           + +QYLL AAEPYET  FK+ ++E+DK E K F  WDPDSK++ +Q  F  +R
Sbjct: 181 RNYQYLLVAAEPYETCGFKIPARELDKREDKQFEFWDPDSKEYWVQIMFMTER 233



>gi|451998906|gb|EMD91369.1| hypothetical protein COCHEDRAFT_1203665 [Bipolaris maydis C5]
 gi|477591799|gb|ENI08871.1| hypothetical protein COCC4DRAFT_188692 [Bipolaris maydis ATCC
           48331]
          Length = 235

 Score =  268 bits (686), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 132/233 (56%), Positives = 164/233 (70%), Gaps = 3/233 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA  S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASQSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQA-QTKVQIKKNLVKIGRPG 152
           T+H N+GSYLAHTQG+KHQT                    Q     V  KKN++KIGRPG
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAKEQREGKRDDVGQQGLLAGVVPKKNVIKIGRPG 120

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y +TKVRDP TRQ GL FQ Q+P++   V P+ R MSAYEQR+E P+  +QYL+ A EPY
Sbjct: 121 YHITKVRDPNTRQNGLLFQFQFPDLTPGVTPKVRIMSAYEQRVEEPDPNYQYLIVAGEPY 180

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSE--GIPPG 263
           ET+A K+QS+++D+ EGKF+  +D D+K+F  Q  FK +R   +S   G+ PG
Sbjct: 181 ETVAVKLQSRDIDRREGKFWFWYDEDAKEFWCQVLFKTERDERFSAVPGLAPG 233



>gi|346321002|gb|EGX90602.1| splicing factor 3a subunit 2 [Cordyceps militaris CM01]
          Length = 249

 Score =  268 bits (686), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 127/248 (51%), Positives = 166/248 (66%), Gaps = 19/248 (7%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA +S TN DRRERLRKLALETIDL+KDPYF KNH+G++EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASFSATNADRRERLRKLALETIDLDKDPYFFKNHVGTFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKV-------------- 139
           T+H N+GSYLAHTQGKKHQT                   L   T +              
Sbjct: 61  TVHQNDGSYLAHTQGKKHQTNLARRAAREQREGKAAAAGLDPATGLPAGLLLNGAGGAGG 120

Query: 140 --QIKKNLVKIGRPGYKVTKVRDPITRQLGLFFQIQYPE-IGLDVIPRHRFMSAYEQRIE 196
               ++N+V+IGRPGYK+TKVRDP++RQ GL FQ+QYPE    D  P+ + M+AY QR+E
Sbjct: 121 IHSSRRNMVRIGRPGYKITKVRDPVSRQQGLLFQLQYPEATAADAAPKWQVMNAYAQRVE 180

Query: 197 PPNKAHQYLLFAAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMY 256
            P++A QYLL AA+PYET+ FK+ ++E+D+ E + F  WDPD+K+F +Q  F  +R   +
Sbjct: 181 EPDRAFQYLLVAADPYETVGFKIPARELDRREDRQFCFWDPDAKEFWVQVMFMTEREARF 240

Query: 257 SEGIPPGI 264
           +    PG+
Sbjct: 241 NAA--PGL 246



>gi|390604644|gb|EIN14035.1| hypothetical protein PUNSTDRAFT_95548 [Punctularia strigosozonata
           HHB-11173 SS5]
          Length = 220

 Score =  268 bits (685), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 131/220 (59%), Positives = 160/220 (72%), Gaps = 7/220 (3%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVAG SE+NVDRRERLRKLALETIDL KDPY ++NHLGS EC+LCL
Sbjct: 1   MDYQNRVGSKFGGGGVAGASESNVDRRERLRKLALETIDLAKDPYILRNHLGSLECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLHTNEGSYLAHTQGKKHQT               + P  Q+  +   +K  +KIGRPGY
Sbjct: 61  TLHTNEGSYLAHTQGKKHQTNLARRAARDMKETQLMVPPTQSSVQ---RKVFLKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           +VTKVRD  T + G+  Q+  P+I   VIPR RFMSA+EQ+ EPPNK +QYL+ AAEPYE
Sbjct: 118 RVTKVRDRDTGKEGMMVQVHLPQIKPGVIPRRRFMSAWEQKREPPNKNYQYLIVAAEPYE 177

Query: 214 TIAFKVQSKEV----DKGEGKFFTHWDPDSKQFSLQFFFK 249
           TIAF++ ++E+    D      ++HWDPD+KQ+S QF F+
Sbjct: 178 TIAFRIPAREIEDETDDAGYWNWSHWDPDTKQYSFQFMFR 217



>gi|299473576|emb|CBN77971.1| conserved unknown protein [Ectocarpus siliculosus]
          Length = 301

 Score =  268 bits (685), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 129/231 (55%), Positives = 163/231 (70%), Gaps = 11/231 (4%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           +DFQ+R GSK G GGV    +  VDRRERLRKLA ET+DLNKDPYFM+NHLG YECKLCL
Sbjct: 80  IDFQHREGSKFGGGGVMSEGQAAVDRRERLRKLAQETVDLNKDPYFMRNHLGKYECKLCL 139

Query: 94  TLHTNEGSYLAHTQGKKHQ-TXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPG 152
           TLH NEG+YLAHTQGK+HQ                  QPA+  QT+     N++KIGRPG
Sbjct: 140 TLHNNEGNYLAHTQGKRHQQNLARRAAMEAKNALVKPQPAITVQTR-----NVIKIGRPG 194

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           YKVTK RD  + Q  L F++ YPE      PRHRFMSAYEQ++E P+K +QYLLFA +PY
Sbjct: 195 YKVTKARDLSSNQRSLLFEVDYPEAEDGAQPRHRFMSAYEQKVEAPDKGYQYLLFACDPY 254

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIPPG 263
           ETI FKV + ++DK EG+FFT+W+ ++K+F+LQ +F+++     +   PPG
Sbjct: 255 ETIGFKVPNLKIDKQEGRFFTNWEKEAKKFTLQLYFEDE-----ANAAPPG 300



>gi|395334533|gb|EJF66909.1| hypothetical protein DICSQDRAFT_95783 [Dichomitus squalens LYAD-421
           SS1]
          Length = 220

 Score =  267 bits (683), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 131/220 (59%), Positives = 158/220 (71%), Gaps = 7/220 (3%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVAG SETNVDRRERLRKLALETIDL KDPY ++NHLGS EC+LCL
Sbjct: 1   MDYQNRVGSKFGGGGVAGASETNVDRRERLRKLALETIDLAKDPYILRNHLGSLECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLHTNEGSYLAHTQGKKHQT               +    Q       KK  +KIGRPGY
Sbjct: 61  TLHTNEGSYLAHTQGKKHQTNLARRAARDLKETQLMIAPTQQNVH---KKVFLKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           +VTKVRD  T + G+  Q+  P+I   +IPR RFMSA+EQ+ EPPNKA+QYL+ AAEPYE
Sbjct: 118 RVTKVRDRDTGKEGMMVQVHLPQIKPGIIPRRRFMSAWEQKREPPNKAYQYLIVAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKF----FTHWDPDSKQFSLQFFFK 249
           TIAF++ ++E++          ++HWDPD+KQ+S QF F+
Sbjct: 178 TIAFRIPAREIEDESDDAGYWNWSHWDPDTKQYSFQFMFR 217



>gi|189188870|ref|XP_001930774.1| splicing factor 3a subunit 2 [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187972380|gb|EDU39879.1| splicing factor 3a subunit 2 [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 235

 Score =  267 bits (683), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 131/225 (58%), Positives = 160/225 (71%), Gaps = 1/225 (0%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA  S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LC 
Sbjct: 1   MDYQNRAGSKFGGGGVASQSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCT 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQ-TKVQIKKNLVKIGRPG 152
           T+H N+GSYLAHTQGKKHQT                    Q     V  KKN++KIGRPG
Sbjct: 61  TVHQNDGSYLAHTQGKKHQTNLARRFAKEQREGKRDDANQQGLLAGVLPKKNVIKIGRPG 120

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y++TKVRDP TRQ GL FQ QYP+I   V P+ R MSAYEQR+E P+  +QYL+ A EPY
Sbjct: 121 YRITKVRDPNTRQNGLLFQFQYPDITPGVSPKVRIMSAYEQRVEDPDPNYQYLIVAGEPY 180

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYS 257
           ET+A K+QS+++D+ EGKF+  +D D+K+F  Q  FK +R   +S
Sbjct: 181 ETVAVKLQSRDIDRREGKFWFWFDEDAKEFWCQILFKTERDERFS 225



>gi|367045150|ref|XP_003652955.1| hypothetical protein THITE_2114832 [Thielavia terrestris NRRL 8126]
 gi|347000217|gb|AEO66619.1| hypothetical protein THITE_2114832 [Thielavia terrestris NRRL 8126]
          Length = 248

 Score =  266 bits (681), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 131/234 (55%), Positives = 161/234 (68%), Gaps = 15/234 (6%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA +S TN DRRERLRKLALE IDL+KDPY  KNHLGS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASHSITNADRRERLRKLALEQIDLDKDPYIFKNHLGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXX-XIQPALQAQTKVQI----------- 141
           T+H N+GSYL+HTQGKKHQT                + P       V             
Sbjct: 61  TVHQNDGSYLSHTQGKKHQTNLARRAAREQREGKGEVDPHTGLPVGVVGAGFAALGLGGA 120

Query: 142 ---KKNLVKIGRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPP 198
              +KN+VKIGRPGYK+TKVRDPITRQ GL FQ+QYP+IG  V P+ + MSA+ QR+E P
Sbjct: 121 GGPRKNVVKIGRPGYKITKVRDPITRQQGLLFQLQYPDIGTGVTPKWQVMSAFSQRVEEP 180

Query: 199 NKAHQYLLFAAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDR 252
           ++  QYLL AAEPYET  FK+ ++E+DK EG+ F +WDPD+K+F +Q  F  +R
Sbjct: 181 DRNFQYLLIAAEPYETCGFKIPARELDKREGRQFEYWDPDAKEFWVQIMFMTER 234



>gi|470296429|ref|XP_004345333.1| splicing factor 3a subunit 2 [Capsaspora owczarzaki ATCC 30864]
 gi|320164553|gb|EFW41452.1| splicing factor 3a subunit 2 [Capsaspora owczarzaki ATCC 30864]
          Length = 266

 Score =  266 bits (681), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 129/216 (59%), Positives = 159/216 (73%), Gaps = 3/216 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR  +  G GG+A  +E+N+ R+ RLR+LA E ID+ KDPY +++HLG+YECKLCL
Sbjct: 1   MDFQNRAKASFGGGGMASAAESNLARKRRLRELASEVIDVTKDPYLLRSHLGTYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH+NEGSYLAH+QGKKHQ                   A  A+ + ++KK  +KIGRPGY
Sbjct: 61  TLHSNEGSYLAHSQGKKHQEQLAKRAARDARDNPT--QAAPAKPRSELKK-FLKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
            VTK RDP T Q  LFFQ+  PEI   VIP HRFMSA+EQR+E P++A QYLL AAEPYE
Sbjct: 118 NVTKQRDPQTGQHSLFFQVDLPEIAEGVIPYHRFMSAFEQRVENPDRAWQYLLVAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFK 249
           TIAF++ S+EVDK +GK FTHW+PD+KQFSLQF FK
Sbjct: 178 TIAFRLPSREVDKADGKTFTHWNPDTKQFSLQFHFK 213



>gi|330928328|ref|XP_003302223.1| hypothetical protein PTT_13951 [Pyrenophora teres f. teres 0-1]
 gi|311322590|gb|EFQ89713.1| hypothetical protein PTT_13951 [Pyrenophora teres f. teres 0-1]
          Length = 235

 Score =  266 bits (680), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 130/225 (57%), Positives = 160/225 (71%), Gaps = 1/225 (0%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA  S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LC 
Sbjct: 1   MDYQNRAGSKFGGGGVASQSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCT 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQ-TKVQIKKNLVKIGRPG 152
           T+H N+GSYLAHTQG+KHQT                    Q     V  KKN++KIGRPG
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRFAKEQREGKRDDANQQGLLAGVLPKKNVIKIGRPG 120

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y++TKVRDP TRQ GL FQ QYP+I   V P+ R MSAYEQR+E P+  +QYL+ A EPY
Sbjct: 121 YRITKVRDPNTRQNGLLFQFQYPDITPGVSPKVRIMSAYEQRVEDPDPNYQYLIVAGEPY 180

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYS 257
           ET+A K+QS+++D+ EGKF+  +D D+K+F  Q  FK +R   +S
Sbjct: 181 ETVAVKLQSRDIDRREGKFWFWFDEDAKEFWCQILFKTERDERFS 225



>gi|336376098|gb|EGO04433.1| hypothetical protein SERLA73DRAFT_128512 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336389184|gb|EGO30327.1| hypothetical protein SERLADRAFT_375560 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 227

 Score =  266 bits (680), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 162/221 (73%), Gaps = 9/221 (4%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVAG SE+N+DRRERLRKLALETIDL KDPY ++NHLGS EC+LCL
Sbjct: 1   MDYQNRVGSKFGGGGVAGASESNIDRRERLRKLALETIDLAKDPYILRNHLGSLECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTX-XXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPG 152
           TLHTNEGSYLAHTQGKKHQT                I P    Q+ VQ +K  +KIGRPG
Sbjct: 61  TLHTNEGSYLAHTQGKKHQTNLARRAARDAKDTQLMIAP---TQSNVQ-RKVFLKIGRPG 116

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTKVRD  T + G+  Q+  P++  DVIPR RFMSA+EQ+ EPPNKA+QYL+ AAEPY
Sbjct: 117 YRVTKVRDVDTGKEGMMVQVHLPQMKPDVIPRRRFMSAWEQKREPPNKAYQYLVVAAEPY 176

Query: 213 ETIAFKVQSKEVDKGEGKF----FTHWDPDSKQFSLQFFFK 249
           ET+AF++ ++E++          ++HWD D+KQ+S QF F+
Sbjct: 177 ETVAFRIPAREIEDESDDAGYWNWSHWDTDTKQYSFQFMFR 217



>gi|389751236|gb|EIM92309.1| splicing factor 3a [Stereum hirsutum FP-91666 SS1]
          Length = 220

 Score =  265 bits (678), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 131/220 (59%), Positives = 159/220 (72%), Gaps = 7/220 (3%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR GSK G GGVAG SE+NVDRRERLRKLALETIDL KDPY ++NHLGS EC+LCL
Sbjct: 1   MDFQNRVGSKFGGGGVAGASESNVDRRERLRKLALETIDLAKDPYILRNHLGSLECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLHTNEGSYLAHTQGKKHQT                Q  +  Q +   +K  +KIGRPGY
Sbjct: 61  TLHTNEGSYLAHTQGKKHQTNLARRAARDMKDS---QLQVAPQQQAVQRKVFLKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           +VTKVRD  T + G+  Q+  P+I   V PR RFMSA+EQ+ EPPNKA+QYL+ AAEPYE
Sbjct: 118 RVTKVRDTDTGKEGMMVQVHLPQIKPGVTPRRRFMSAWEQKREPPNKAYQYLIVAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKF----FTHWDPDSKQFSLQFFFK 249
           TIAF++ ++E++          ++HWDPD+KQ+S QF F+
Sbjct: 178 TIAFRIPAREIEDESDDAGYWNWSHWDPDTKQYSFQFMFR 217



>gi|116195670|ref|XP_001223647.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51]
 gi|88180346|gb|EAQ87814.1| conserved hypothetical protein [Chaetomium globosum CBS 148.51]
          Length = 250

 Score =  265 bits (678), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 131/236 (55%), Positives = 160/236 (67%), Gaps = 17/236 (7%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA +S TN DRRERLRKLALE IDL+KDPY  KNHLGS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASHSATNADRRERLRKLALEQIDLDKDPYIFKNHLGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXX-XIQPALQAQTKVQI----------- 141
           T+H N+GSYLAHTQGKKHQT                + P       V             
Sbjct: 61  TVHQNDGSYLAHTQGKKHQTNLARRAAREQKEGKGEVDPHTGLPVGVVGAGFAALGLGGA 120

Query: 142 -----KKNLVKIGRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIE 196
                +KN+VKIGRPGYK+TKVRDPITRQ GL FQ+QYP+IG  V P+ + MSA+ QR+E
Sbjct: 121 GAGGPRKNVVKIGRPGYKITKVRDPITRQQGLLFQLQYPDIGTGVAPKWQVMSAFSQRVE 180

Query: 197 PPNKAHQYLLFAAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDR 252
            P++  QYLL AAEPYET  FK+ ++E+DK E + F +WDPDSK++ +Q  F  +R
Sbjct: 181 DPDRNFQYLLVAAEPYETCGFKIPARELDKREDRQFEYWDPDSKEYWVQIMFMTER 236



>gi|347975971|ref|XP_003437315.1| unnamed protein product [Podospora anserina S mat+]
 gi|170940173|emb|CAP65400.1| unnamed protein product [Podospora anserina S mat+]
          Length = 248

 Score =  265 bits (678), Expect = 9e-69,   Method: Compositional matrix adjust.
 Identities = 133/234 (56%), Positives = 161/234 (68%), Gaps = 15/234 (6%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA +S TN DRRERLRKLALE IDL+KDPY  KNHLGS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASHSATNADRRERLRKLALEQIDLDKDPYIFKNHLGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTX-XXXXXXXXXXXXXXIQPALQAQTKV------------- 139
           T+H N+GSYLAHTQGKKHQT                I P       V             
Sbjct: 61  TVHQNDGSYLAHTQGKKHQTNLARRAAREQKEGKGEIDPTTGLPVGVVGAGFAALGLGAG 120

Query: 140 QIKKNLVKIGRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPN 199
             +KN+VKIGRPGYK+TKVRDPITRQ GL FQ+QYP+IG+ V P+ + MSA+ QR+E P+
Sbjct: 121 GPRKNVVKIGRPGYKITKVRDPITRQQGLLFQLQYPDIGVGVTPKWQVMSAFTQRVEEPD 180

Query: 200 KAHQYLLFAAEPYETIAFKVQSKEVDKGE-GKFFTHWDPDSKQFSLQFFFKNDR 252
           +  QYLL AAEPYET  FK+ ++E+DK E G+ F  WDPDSK++ +Q  F  +R
Sbjct: 181 RNFQYLLVAAEPYETCGFKIPARELDKREDGRQFEFWDPDSKEYWVQIMFMTER 234



>gi|323451351|gb|EGB07228.1| hypothetical protein AURANDRAFT_28099 [Aureococcus anophagefferens]
          Length = 238

 Score =  265 bits (677), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 129/234 (55%), Positives = 158/234 (67%), Gaps = 4/234 (1%)

Query: 37  QNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCLTLH 96
           Q+R  S+ G GGV    + NVDRRERLRKLALET+DLNKDPYFM+NHLG+YECKLCLTLH
Sbjct: 4   QDRVNSRHGGGGVQSSEQANVDRRERLRKLALETVDLNKDPYFMRNHLGTYECKLCLTLH 63

Query: 97  TNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGYKVT 156
             EG+YLAHTQGK+HQ                  P   A T+   K++ +KIGRPGYKVT
Sbjct: 64  NTEGNYLAHTQGKRHQQNLARRAFKEARDA----PIAPAATRYVEKRHTIKIGRPGYKVT 119

Query: 157 KVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYETIA 216
           K RD  T Q  L F++ YPE      PRHRFMSAYEQR+EPP+KA+QYLLFA EPYETI 
Sbjct: 120 KSRDAATSQRCLLFEVDYPEADDASQPRHRFMSAYEQRVEPPDKAYQYLLFACEPYETIG 179

Query: 217 FKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIPPGIERAPMV 270
           FK+ + +VDK +G+FFT+WD   K+F+L   F +D     ++    G  RA + 
Sbjct: 180 FKIPNHDVDKDQGRFFTNWDVVGKKFTLSLQFDDDAKPAPAQAASAGRHRADLT 233



>gi|340960451|gb|EGS21632.1| splicing factor 3a subunit 2-like protein [Chaetomium thermophilum
           var. thermophilum DSM 1495]
          Length = 247

 Score =  265 bits (677), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 132/233 (56%), Positives = 160/233 (68%), Gaps = 14/233 (6%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA +S TN DRRERLRKLALE IDL+KDPY  KNHLGS+EC+LCL
Sbjct: 1   MDYQNRVGSKFGGGGVASHSITNADRRERLRKLALEQIDLDKDPYIFKNHLGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTX-XXXXXXXXXXXXXXIQP-------------ALQAQTKV 139
           T+H N+GSYLAHTQGKKHQT                + P             A      V
Sbjct: 61  TVHQNDGSYLAHTQGKKHQTNLARRAAREQKEGKGEVDPNTGLPVGVVGAGFAALGLGGV 120

Query: 140 QIKKNLVKIGRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPN 199
             K+N+VKIGRPGYK+TKVRDPITRQ+GL FQ+QYP+I   V P+ + MSA+ QR+E P+
Sbjct: 121 GPKRNVVKIGRPGYKITKVRDPITRQVGLLFQLQYPDISPGVTPKWQVMSAFSQRVEEPD 180

Query: 200 KAHQYLLFAAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDR 252
           +  QYLL AAEPYET  FK+ ++E+DK E K F  WDPD+K+F +Q  F  +R
Sbjct: 181 RNFQYLLVAAEPYETCGFKIPARELDKREDKQFEFWDPDAKEFWIQIMFMTER 233



>gi|403417508|emb|CCM04208.1| predicted protein [Fibroporia radiculosa]
          Length = 238

 Score =  265 bits (676), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 132/214 (61%), Positives = 158/214 (73%), Gaps = 9/214 (4%)

Query: 41  GSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCLTLHTNEG 100
           GSK G GGVAG SETNVDRRERLRKLALETIDL KDPY ++NHLGS EC+LCLTLHTNEG
Sbjct: 26  GSKFGGGGVAGASETNVDRRERLRKLALETIDLAKDPYILRNHLGSLECRLCLTLHTNEG 85

Query: 101 SYLAHTQGKKHQT-XXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGYKVTKVR 159
           SYLAHTQGKKHQT                I P   AQ+ VQ +K  +KIGRPGY+VTKVR
Sbjct: 86  SYLAHTQGKKHQTNLARRAARDLKETQLMIAP---AQSNVQ-RKVFLKIGRPGYRVTKVR 141

Query: 160 DPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYETIAFKV 219
           D  T + G+  Q+  P+I  DVIPR RFMSA+EQ+ EPPNKA+QYL+ AAEPYETIAF++
Sbjct: 142 DRDTGKEGMMVQVHLPQIKADVIPRRRFMSAWEQKREPPNKAYQYLIVAAEPYETIAFRI 201

Query: 220 QSKEVDKGEGKF----FTHWDPDSKQFSLQFFFK 249
            ++E++          ++HWDPD+KQ+S QF F+
Sbjct: 202 PAREIEDESDDAGYWNWSHWDPDTKQYSFQFMFR 235



>gi|46108610|ref|XP_381363.1| hypothetical protein FG01187.1 [Fusarium graminearum PH-1]
 gi|408398912|gb|EKJ78038.1| hypothetical protein FPSE_01826 [Fusarium pseudograminearum CS3096]
          Length = 240

 Score =  265 bits (676), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 128/228 (56%), Positives = 161/228 (70%), Gaps = 11/228 (4%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR GSK G GGVA  S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDFQNRAGSKFGGGGVASQSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQI---------KKN 144
           T+H N+GSYLAHTQGKKHQT                Q A+   T + I         ++N
Sbjct: 61  TVHQNDGSYLAHTQGKKHQTNLARRAAREQKEGR--QGAIDPATGLPIGVTGAGFAQRRN 118

Query: 145 LVKIGRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQY 204
           +VKIGRPGYK+TK+RDP++RQ GL FQ+QYP+   +  P+ + M+A+ Q IE P+K  QY
Sbjct: 119 IVKIGRPGYKITKIRDPVSRQQGLLFQLQYPDATPETSPKWQVMNAFTQHIEEPDKNFQY 178

Query: 205 LLFAAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDR 252
           LL AAEPYET+ FK+ ++E+DK E K F  WDPD+K++ +Q  F  +R
Sbjct: 179 LLVAAEPYETVGFKIPARELDKREDKQFAFWDPDAKEYWIQVMFMTER 226



>gi|302925732|ref|XP_003054153.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256735094|gb|EEU48440.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 240

 Score =  265 bits (676), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 129/240 (53%), Positives = 166/240 (69%), Gaps = 13/240 (5%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR GSK G GGVA  S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDFQNRAGSKFGGGGVASQSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQI---------KKN 144
           T+H N+GSYLAHTQGKKHQT                Q A+   T + +         ++N
Sbjct: 61  TVHQNDGSYLAHTQGKKHQTNLARRAAREQKEGR--QGAVDPATGLPVGVTGAGFAQRRN 118

Query: 145 LVKIGRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQY 204
           +VKIGRPGYK+TK+RDP+TRQ GL FQ+QYP+   +  P+ + M+A+ Q IE P+K  QY
Sbjct: 119 VVKIGRPGYKITKIRDPVTRQQGLLFQLQYPDATPETTPKWQVMNAFTQHIEEPDKNFQY 178

Query: 205 LLFAAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIPPGI 264
           LL AAEPYET+ FK+ ++E+DK E + F  WDPD+K++ +Q  F  +R   ++    PG+
Sbjct: 179 LLVAAEPYETVGFKIPARELDKREDRQFCFWDPDAKEYWIQVMFMTEREERFNAA--PGL 236



>gi|302695565|ref|XP_003037461.1| hypothetical protein SCHCODRAFT_46991 [Schizophyllum commune H4-8]
 gi|300111158|gb|EFJ02559.1| hypothetical protein SCHCODRAFT_46991, partial [Schizophyllum
           commune H4-8]
          Length = 217

 Score =  264 bits (675), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 158/218 (72%), Gaps = 9/218 (4%)

Query: 37  QNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCLTLH 96
           QNR GSK G GGVAG SE+NVDRRERLRKLALETIDL KDPY ++NHLGS EC+LCLTLH
Sbjct: 1   QNRVGSKFGGGGVAGASESNVDRRERLRKLALETIDLAKDPYILRNHLGSLECRLCLTLH 60

Query: 97  TNEGSYLAHTQGKKHQTX-XXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGYKV 155
           TNEGSYLAHTQGKKHQT                I P    Q  VQ +K  +KIGRPGY+V
Sbjct: 61  TNEGSYLAHTQGKKHQTNLARRAARDAKDAQLMIAP---TQQNVQ-RKVFLKIGRPGYRV 116

Query: 156 TKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYETI 215
           TKVRD  T + GL  Q+  P+I   VIPR RFMSA+EQ+ EPPNKAHQYL+ AAEPYETI
Sbjct: 117 TKVRDVDTGKEGLMVQVHLPQIKPGVIPRRRFMSAFEQKKEPPNKAHQYLIVAAEPYETI 176

Query: 216 AFKVQSKEVDKGEGKF----FTHWDPDSKQFSLQFFFK 249
           AF++ ++E++          ++HWDPD+KQ+S QF F+
Sbjct: 177 AFRIPAREIEDETDDAGYWNWSHWDPDTKQYSFQFMFR 214



>gi|471881829|emb|CCO34413.1| Splicing factor 3A subunit 2 [Rhizoctonia solani AG-1 IB]
          Length = 234

 Score =  263 bits (673), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 132/236 (55%), Positives = 161/236 (68%), Gaps = 13/236 (5%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVAG SE NVDRRERLRKLALETIDL KDPY ++NHLGS EC+LCL
Sbjct: 1   MDYQNRVGSKFGGGGVAGASEANVDRRERLRKLALETIDLAKDPYILRNHLGSLECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLHTNEGSYLAHTQGKKHQT               I     A T    +K  +KIGRPGY
Sbjct: 61  TLHTNEGSYLAHTQGKKHQTNLARRAARDAKETQLITAPAPAATVP--RKMFIKIGRPGY 118

Query: 154 KVTKVRDPI--------TRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYL 205
           +VTKVRDP+          + G+  Q+  P+I  DVIPR RFMSA+EQ+ E PN+A+QYL
Sbjct: 119 RVTKVRDPLMAAAAGGGGAKEGMMVQVHLPQIKEDVIPRRRFMSAWEQKKEQPNRAYQYL 178

Query: 206 LFAAEPYETIAFKVQSKEVDKGEGK---FFTHWDPDSKQFSLQFFFKNDRPGMYSE 258
           + AAEPYE+IAF++ ++E++  E      ++HWD D+KQ+S QF FK      Y +
Sbjct: 179 IVAAEPYESIAFRIPAREIEDPEENPDWNWSHWDADTKQYSFQFMFKTSSLAPYGQ 234



>gi|342876172|gb|EGU77830.1| hypothetical protein FOXB_11694 [Fusarium oxysporum Fo5176]
 gi|475664496|gb|EMT62291.1| CWF complex protein sap62 [Fusarium oxysporum f. sp. cubense race
           4]
 gi|477507391|gb|ENH60685.1| CWF complex protein sap62 [Fusarium oxysporum f. sp. cubense race
           1]
          Length = 240

 Score =  263 bits (673), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 129/240 (53%), Positives = 166/240 (69%), Gaps = 13/240 (5%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNR GSK G GGVA  S TN DRRERLRKLALETIDL+KDPYF KNH+GS+EC+LCL
Sbjct: 1   MDFQNRAGSKFGGGGVASQSATNADRRERLRKLALETIDLDKDPYFFKNHVGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQI---------KKN 144
           T+H N+GSYLAHTQGKKHQT                Q A+   T + I         ++N
Sbjct: 61  TVHQNDGSYLAHTQGKKHQTNLARRAAREQKEGR--QGAVDPATGLPIGVTGAGFAQRRN 118

Query: 145 LVKIGRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQY 204
           +VKIGRPGYK+TK+RDP++RQ GL FQ+QYP+   +  P+ + M+A+ Q +E P+K  QY
Sbjct: 119 VVKIGRPGYKITKIRDPVSRQQGLLFQLQYPDATPETSPKWQVMNAFTQHVEEPDKNFQY 178

Query: 205 LLFAAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIPPGI 264
           LL AAEPYET+ FK+ ++E+DK E K F  WDPD+K++ +Q  F  +R   ++    PG+
Sbjct: 179 LLVAAEPYETVGFKIPARELDKREDKQFAFWDPDAKEYWIQVMFMTEREERFNAA--PGL 236



>gi|449550991|gb|EMD41955.1| hypothetical protein CERSUDRAFT_129207 [Ceriporiopsis subvermispora
           B]
          Length = 220

 Score =  263 bits (672), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 133/221 (60%), Positives = 160/221 (72%), Gaps = 9/221 (4%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           M  QNR GSK G GGVAG SETNVDRRERLRKLALETIDL KDPY ++NHLGS EC+LCL
Sbjct: 1   MGDQNRVGSKFGGGGVAGASETNVDRRERLRKLALETIDLAKDPYILRNHLGSLECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTX-XXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPG 152
           TLHTNEGSYLAHTQGKKHQT                I P   AQ+ +Q +K  +KIGRPG
Sbjct: 61  TLHTNEGSYLAHTQGKKHQTNLARRAARDLKETQLMIAP---AQSNIQ-RKVFLKIGRPG 116

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTKVRD  T + G+  Q+  P+I   V PR RFMSA+EQ+ EPPNKA+QYL+ AAEPY
Sbjct: 117 YRVTKVRDRDTGKEGMMVQVHLPQIKPGVTPRRRFMSAFEQKREPPNKAYQYLIVAAEPY 176

Query: 213 ETIAFKVQSKEVDKGEGKF----FTHWDPDSKQFSLQFFFK 249
           ETIAF++ ++E++          ++HWDPD+KQ+S QF F+
Sbjct: 177 ETIAFRIPAREIEDESDDAGYWNWSHWDPDTKQYSFQFMFR 217



>gi|426201106|gb|EKV51029.1| hypothetical protein AGABI2DRAFT_140137 [Agaricus bisporus var.
           bisporus H97]
          Length = 228

 Score =  263 bits (671), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 135/230 (58%), Positives = 163/230 (70%), Gaps = 17/230 (7%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVAG SE+NVDRRERLRKLALETIDL KDPY ++NHLGS EC+LCL
Sbjct: 1   MDYQNRVGSKFGGGGVAGASESNVDRRERLRKLALETIDLAKDPYILRNHLGSLECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTX-XXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPG 152
           TLHTNEGSYLAHTQGKKHQT                I P   AQ+ VQ +K  +KIGRPG
Sbjct: 61  TLHTNEGSYLAHTQGKKHQTNLARRAARDAKETQLMIAP---AQSNVQ-RKVFLKIGRPG 116

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLL------ 206
           Y+VTKVRD  T + G+  Q+  P+I   V PR RFMSA+EQ+ EPPNKA+QYL+      
Sbjct: 117 YRVTKVRDRDTGKEGMMVQVHLPQIKSGVTPRRRFMSAWEQKREPPNKAYQYLITSVTHD 176

Query: 207 --FAAEPYETIAFKVQSKEV----DKGEGKFFTHWDPDSKQFSLQFFFKN 250
              AAEPYETIAF++ ++E+    D      ++HWDPD+KQ+S QF F++
Sbjct: 177 LKVAAEPYETIAFRIPAREIEDETDDAGYWNWSHWDPDTKQYSFQFMFRS 226



>gi|389625135|ref|XP_003710221.1| splicing factor 3a subunit 2 [Magnaporthe oryzae 70-15]
 gi|351649750|gb|EHA57609.1| splicing factor 3a subunit 2 [Magnaporthe oryzae 70-15]
 gi|440464824|gb|ELQ34189.1| splicing factor 3a [Magnaporthe oryzae Y34]
 gi|440490546|gb|ELQ70091.1| splicing factor 3a [Magnaporthe oryzae P131]
          Length = 247

 Score =  262 bits (670), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 124/233 (53%), Positives = 159/233 (68%), Gaps = 14/233 (6%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA +S TN DRRERLRKLALE IDL+KDPY  KNHLG++EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASHSATNADRRERLRKLALEHIDLDKDPYIFKNHLGAFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQI------------ 141
           T+H N+GSYLAHTQG+KHQT                    Q    V +            
Sbjct: 61  TVHQNDGSYLAHTQGRKHQTNLARRAAQEKRDGRDKNIDPQTGLPVGVVGAGFSALGLGG 120

Query: 142 --KKNLVKIGRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPN 199
             +KN VKIGRPGYK+TK+RDP+TR  GL FQ+Q+P+I    +P+ + MSA+ QR+E P+
Sbjct: 121 GARKNAVKIGRPGYKITKIRDPVTRAEGLLFQLQFPDISPGTVPKWQVMSAFSQRVEEPD 180

Query: 200 KAHQYLLFAAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDR 252
           + +QYLL AAEPYET  FKV ++E+DK EG+ F +WDPD+K++ +Q  F  +R
Sbjct: 181 RNYQYLLVAAEPYETCGFKVPARELDKREGRMFEYWDPDAKEYWVQVMFMTER 233



>gi|357627577|gb|EHJ77230.1| hypothetical protein KGM_02786 [Danaus plexippus]
          Length = 261

 Score =  262 bits (669), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 141/217 (64%), Positives = 157/217 (72%), Gaps = 5/217 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNRPG K G GG      +  DRRERLR+LALETIDLNKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRPGGKTGGGGHRSTRLSFRDRRERLRQLALETIDLNKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIK-KNLVKIGRPG 152
           TLH NEGSYLAHTQGKKHQ                  P   A  K +I+ K  VKIGRPG
Sbjct: 61  TLHNNEGSYLAHTQGKKHQANLARRAAKEAKEA----PQQLAPEKPRIEPKKFVKIGRPG 116

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+VTK +D    Q  L FQ+ YPEI   V PRHRFMSAYEQ+IEPP++  QYLLFAAEPY
Sbjct: 117 YRVTKQKDQENGQQSLLFQVDYPEIAEGVQPRHRFMSAYEQKIEPPDRRWQYLLFAAEPY 176

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFK 249
           ETIAFKV S+EV+K + KF+THW+ D+KQF LQF FK
Sbjct: 177 ETIAFKVPSREVEKHDAKFWTHWNKDTKQFFLQFAFK 213



>gi|58266582|ref|XP_570447.1| hypothetical protein [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|134111072|ref|XP_775678.1| hypothetical protein CNBD4070 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50258342|gb|EAL21031.1| hypothetical protein CNBD4070 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57226680|gb|AAW43140.1| conserved hypothetical protein [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 218

 Score =  261 bits (667), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 129/219 (58%), Positives = 154/219 (70%), Gaps = 4/219 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR G+  GSGGVAG SET VDRRERLRKLALETIDL KDPY ++ HLG+ EC+LCL
Sbjct: 1   MDYQNRAGANKGSGGVAGASETAVDRRERLRKLALETIDLAKDPYILRTHLGTLECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT               +  A  A  +V+ KK  VKIGRPGY
Sbjct: 61  TLHVNEGSYLAHTQGKKHQTNLARRAAKDNKDQTLMIQAPTAAQQVK-KKVFVKIGRPGY 119

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           K+ K+R+P+++++GL F +  PEI     PR RFMSA+EQR E PNKA QYL+ AAEPYE
Sbjct: 120 KIIKIREPVSQRMGLLFTVSLPEIKAGERPRRRFMSAFEQRREIPNKAFQYLVLAAEPYE 179

Query: 214 TIAFKVQSKE---VDKGEGKFFTHWDPDSKQFSLQFFFK 249
           TIAF + SKE   VD+     + HWD D K +S QF +K
Sbjct: 180 TIAFAIPSKEMVDVDEDPESTWEHWDADEKVYSCQFLYK 218



>gi|501753326|emb|CCG82952.1| CWF complex protein sap62 [Taphrina deformans PYCC 5710]
          Length = 232

 Score =  261 bits (666), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 127/230 (55%), Positives = 167/230 (72%), Gaps = 10/230 (4%)

Query: 38  NRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCLTLHT 97
           +R GSK G GGVAG SETN DRRERL+KLALETIDLNKDPYF +NHLG+YECKLCLT H 
Sbjct: 4   DRVGSKFGGGGVAGRSETNADRRERLKKLALETIDLNKDPYFFRNHLGTYECKLCLTAHA 63

Query: 98  NEGSYLAHTQGKKHQTXXXXXXXXXXXXXX--XIQPA----LQAQTKVQIKKNLVKIGRP 151
           N+GSYLAHTQGKKHQT                 I P     L A + V +K+N+++IGRP
Sbjct: 64  NDGSYLAHTQGKKHQTNLARRAARDQALANPLGIDPTTGLPLNAASNVPVKRNVIRIGRP 123

Query: 152 GYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEP 211
           GYK+ K+RD   R +GLFFQ+ +P+I  D  PR+RFMSAYEQ++E P++  QYL+ +A+P
Sbjct: 124 GYKIQKIRDEKGR-IGLFFQLFFPDIEKDNKPRYRFMSAYEQKVEAPDRNWQYLVISADP 182

Query: 212 YETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIP 261
           Y+ +AFK++SKE+D+ EG FF +WD  +  +SLQFF+ ++    + +G+P
Sbjct: 183 YDAVAFKIESKEIDRSEGNFFDYWDKPT--YSLQFFWSSETEARF-KGVP 229



>gi|405120272|gb|AFR95043.1| zinc finger protein Sap62 [Cryptococcus neoformans var. grubii H99]
          Length = 226

 Score =  259 bits (663), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 128/218 (58%), Positives = 153/218 (70%), Gaps = 4/218 (1%)

Query: 35  DFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCLT 94
           D+QNR G+  GSGGVAG SET VDRRERLRKLALETIDL KDPY ++ HLG+ EC+LCLT
Sbjct: 10  DYQNRAGANKGSGGVAGASETAVDRRERLRKLALETIDLAKDPYILRTHLGTLECRLCLT 69

Query: 95  LHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGYK 154
           LH NEGSYLAHTQGKKHQT               +  A  A  +V+ KK  VKIGRPGYK
Sbjct: 70  LHVNEGSYLAHTQGKKHQTNLARRAAKDNKDQALMIQAPTAAQQVK-KKVFVKIGRPGYK 128

Query: 155 VTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYET 214
           + K+R+P+++++GL F +  PEI     PR RFMSA+EQR E PNKA QYL+ AAEPYET
Sbjct: 129 IIKIREPVSQRMGLLFTVSLPEIKAGERPRRRFMSAFEQRREIPNKAFQYLVLAAEPYET 188

Query: 215 IAFKVQSKE---VDKGEGKFFTHWDPDSKQFSLQFFFK 249
           IAF + SKE   VD+     + HWD D K +S QF +K
Sbjct: 189 IAFAIPSKEMVDVDEDPESTWEHWDADEKVYSCQFLYK 226



>gi|320589222|gb|EFX01684.1| splicing factor 3a subunit [Grosmannia clavigera kw1407]
          Length = 251

 Score =  258 bits (660), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 127/251 (50%), Positives = 165/251 (65%), Gaps = 20/251 (7%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA  S TN DRRERLRK+ALE+I+L+ DPYF KNHLG+YEC+LCL
Sbjct: 1   MDYQNRVGSKFGGGGVASQSATNSDRRERLRKIALESINLDSDPYFFKNHLGTYECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXX--XXXIQPALQAQTKVQ----------- 140
           T H NEGSYLAHTQGKKHQT                 I PA      V            
Sbjct: 61  TGHQNEGSYLAHTQGKKHQTNLARRAAKEQREGLRRDIDPATGLPMGVAGAGFSALGFGD 120

Query: 141 -----IKKNLVKIGRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRI 195
                 ++  V+IGRPGYK+ KVRDP+TRQ+GL FQ+QYP+IG DV PR +  SA+ QR+
Sbjct: 121 GGQGAARRLAVRIGRPGYKIMKVRDPVTRQMGLLFQLQYPDIGQDVTPRWQVTSAFSQRV 180

Query: 196 EPPNKAHQYLLFAAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGM 255
           E P++ +QYLL AA+PYET  FK+ ++E+D+ EG+ F +WD D++++ +Q  F  +R   
Sbjct: 181 EDPDRNYQYLLVAADPYETCGFKIPARELDRREGRTFDYWDRDAREYWVQVLFVTEREER 240

Query: 256 YSEGIPPGIER 266
           ++    PG+ R
Sbjct: 241 FN--AAPGLTR 249



>gi|19113377|ref|NP_596585.1| zinc finger protein Sap62 [Schizosaccharomyces pombe 972h-]
 gi|74698336|sp|Q9P7L8.1|SAP62_SCHPO RecName: Full=Pre-mRNA-splicing factor sap62; AltName:
           Full=Spliceosome-associated protein 62
 gi|7106070|emb|CAB76041.1| zinc finger protein Sap62 [Schizosaccharomyces pombe]
          Length = 217

 Score =  257 bits (656), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 122/218 (55%), Positives = 159/218 (72%), Gaps = 10/218 (4%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR G + G GGVAGY ETN  RRERLRKLALETIDL+KDPY MKNHLG++EC+LCL
Sbjct: 1   MDYQNRAGVRFGGGGVAGYQETNAARRERLRKLALETIDLSKDPYLMKNHLGTFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQ---AQTKVQIKKNLVKIGR 150
           T H NE SYL HTQGKKHQT                 P +    +Q+ VQ+KK++VKIGR
Sbjct: 61  TTHANENSYLTHTQGKKHQTNLARRQALENKKSQENAPQVLLGISQSHVQVKKSVVKIGR 120

Query: 151 PGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAE 210
           PGYKV+K+R+  + + GL FQI+YP+I ++  PR+R MSAYEQR+E P++  QYL+ AAE
Sbjct: 121 PGYKVSKIREAESGKFGLRFQIKYPDIEVNAKPRYRIMSAYEQRVEAPDRKFQYLVVAAE 180

Query: 211 PYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFF 248
           PYE+IAFK     +D+  GKF+++WD  +  +++QFF+
Sbjct: 181 PYESIAFK-----IDRAPGKFWSYWDAPT--YTIQFFY 211



>gi|393244264|gb|EJD51776.1| hypothetical protein AURDEDRAFT_111390 [Auricularia delicata
           TFB-10046 SS5]
          Length = 223

 Score =  255 bits (652), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 157/221 (71%), Gaps = 7/221 (3%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVAG SE+NVDRRERLRKLALETIDL KDPY ++NHLGS EC+LCL
Sbjct: 1   MDYQNRVGSKFGGGGVAGASESNVDRRERLRKLALETIDLAKDPYILRNHLGSLECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLHTNEGSYLAHTQGKKHQT                     A  +   +K  +KIGRPGY
Sbjct: 61  TLHTNEGSYLAHTQGKKHQTNLARRAARDMKDASVAVAPAPAAVQ---RKVFLKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           +VTKVRD      G+  Q+  P I  DVIPR RFMS +EQ+ EPPN+A+QYL+ AAEPYE
Sbjct: 118 RVTKVRDRTANAEGMLVQVHLPNIKPDVIPRKRFMSCWEQKKEPPNRAYQYLIVAAEPYE 177

Query: 214 TIAFKVQSKEVDKGEGKF----FTHWDPDSKQFSLQFFFKN 250
           ++AF++ ++E+++   +     + HWDP++KQFS QF FK+
Sbjct: 178 SVAFRIPAREIEEDSEESDAWNWQHWDPETKQFSFQFMFKS 218



>gi|237834251|ref|XP_002366423.1| splicing factor 3A subunit 2, putative [Toxoplasma gondii ME49]
 gi|211964087|gb|EEA99282.1| splicing factor 3A subunit 2, putative [Toxoplasma gondii ME49]
 gi|221486648|gb|EEE24909.1| splicing factor 3A subunit, putative [Toxoplasma gondii GT1]
 gi|221508405|gb|EEE33992.1| splicing factor 3A subunit, putative [Toxoplasma gondii VEG]
          Length = 242

 Score =  254 bits (649), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 123/217 (56%), Positives = 157/217 (72%), Gaps = 5/217 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           +D+QNR G K GSG  A   E N++R+ERLR+LALET+DLNKDPYFMKNHLG +EC+LCL
Sbjct: 4   IDYQNRVGHKTGSGAPATAQEWNLERKERLRRLALETVDLNKDPYFMKNHLGHFECRLCL 63

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQ-PALQAQTKVQIKKNLVKIGRPG 152
           TLH NEGSYLAHTQG+KHQT                  PA  A ++V      VKIGRPG
Sbjct: 64  TLHVNEGSYLAHTQGRKHQTNLARRKEKEKAESAVAPVPAKVAPSRVGF---TVKIGRPG 120

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIE-PPNKAHQYLLFAAEP 211
           Y+V+K+RDP + Q  L F+I YPEI     P HRFMS++EQR+E PP+  +Q+LLFAA+P
Sbjct: 121 YRVSKLRDPDSLQKALLFEIDYPEINEGAKPYHRFMSSFEQRVESPPDTKYQFLLFAADP 180

Query: 212 YETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFF 248
           YETIAFK+ + EVD+ EGKF+++WD + K +++Q FF
Sbjct: 181 YETIAFKIPNMEVDRSEGKFYSNWDAEKKVYTIQLFF 217



>gi|512193333|gb|EPE09090.1| splicing factor 3a subunit 2 [Ophiostoma piceae UAMH 11346]
          Length = 253

 Score =  253 bits (647), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 123/239 (51%), Positives = 160/239 (66%), Gaps = 20/239 (8%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA  S TN DRR+RLRKLALE+IDL+KDPYF +NHLG +EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASSSATNADRRDRLRKLALESIDLDKDPYFFRNHLGYFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQT--XXXXXXXXXXXXXXXIQPAL------------------ 133
           T+H N+GSYLAHTQGKKHQT                 I PA                   
Sbjct: 61  TVHQNDGSYLAHTQGKKHQTNLARRAAKEQREGMRRDIDPATGLPIGVAGAGFGALGFGE 120

Query: 134 QAQTKVQIKKNLVKIGRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQ 193
            A    + +  +V+IGRPGYK+ KVRDP+TRQ+GL FQ+QYP+IG DV PR +  SA+ Q
Sbjct: 121 DADADAKRRAAMVRIGRPGYKIMKVRDPVTRQVGLLFQLQYPDIGHDVTPRWQVTSAFSQ 180

Query: 194 RIEPPNKAHQYLLFAAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDR 252
           ++E P++  QYLL AA+PYET  FKV ++E+D+ EG+ F +WD D++++ +Q  F  +R
Sbjct: 181 KMEAPDRQFQYLLVAADPYETCGFKVPARELDRREGRTFDYWDRDAREYWVQVMFMTER 239



>gi|321257417|ref|XP_003193581.1| hypothetical protein CGB_D4720C [Cryptococcus gattii WM276]
 gi|317460051|gb|ADV21794.1| Conserved hypothetical protein [Cryptococcus gattii WM276]
          Length = 218

 Score =  253 bits (646), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 126/219 (57%), Positives = 152/219 (69%), Gaps = 4/219 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           M +QNR G+  GSGGVAG SET VDRRERLRKLALETIDL KDPY ++ HLG+ EC+LCL
Sbjct: 1   MYYQNRAGANKGSGGVAGASETAVDRRERLRKLALETIDLAKDPYILRTHLGTLECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT               +  A  A  +V+ KK  VKIGRPGY
Sbjct: 61  TLHVNEGSYLAHTQGKKHQTNLARRAAKDNKDQALMIQAPTAAQQVK-KKVFVKIGRPGY 119

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           K+ K+R+P+++++GL F +  PEI     P  RFMSA+EQR E PNKA QYL+ AAEPYE
Sbjct: 120 KIIKIREPVSQRMGLLFTVSLPEIKAGERPLRRFMSAFEQRREIPNKAFQYLVLAAEPYE 179

Query: 214 TIAFKVQSKE---VDKGEGKFFTHWDPDSKQFSLQFFFK 249
           TIAF + SKE   VD+     + HWD D + +S QF +K
Sbjct: 180 TIAFAIPSKEMVDVDEDPESTWEHWDADERVYSCQFLYK 218



>gi|507113284|emb|CDF36919.1| unnamed protein product [Chondrus crispus]
          Length = 258

 Score =  253 bits (646), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 118/220 (53%), Positives = 153/220 (69%)

Query: 41  GSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCLTLHTNEG 100
           G+K G GGVA     N+ R+ERLR+LA+ET+DL  DPYFM+NHLG+YECKLCLTLH NEG
Sbjct: 7   GAKTGGGGVASKEHENLARKERLRELAMETVDLKNDPYFMRNHLGTYECKLCLTLHGNEG 66

Query: 101 SYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGYKVTKVRD 160
           +YLAH QG++HQ                   A  A T     +  +KIGRPGY++TK RD
Sbjct: 67  NYLAHAQGRRHQGNLRRRAALESKKQAAKPRAPIAATARATMRRRMKIGRPGYQITKQRD 126

Query: 161 PITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYETIAFKVQ 220
           P T+Q  L FQI+YPEI   + PRHRFMSA+EQ+ E PN  +QYLLFAAEPYET+AF++ 
Sbjct: 127 PNTKQFSLLFQIRYPEITEGLQPRHRFMSAFEQKREKPNGKYQYLLFAAEPYETVAFRIP 186

Query: 221 SKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGI 260
           ++ +DKGEGKF+T+WD +   F+LQ +F+N + G  + G 
Sbjct: 187 NQPIDKGEGKFYTNWDKNFLNFTLQLYFENRKAGKDTAGT 226



>gi|485613258|gb|EOD11345.1| hypothetical protein EMIHUDRAFT_357810 [Emiliania huxleyi CCMP1516]
          Length = 240

 Score =  253 bits (645), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 150/210 (71%), Gaps = 5/210 (2%)

Query: 41  GSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCLTLHTNEG 100
           G K G GGVA   +  VDRRERLR+LAL+T+DL KDPYFMKNHLGSYECKLCLTLH NEG
Sbjct: 9   GVKSGGGGVASDIQAKVDRRERLRQLALQTVDLMKDPYFMKNHLGSYECKLCLTLHNNEG 68

Query: 101 SYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPAL-QAQTKVQIKKNLVKIGRPGYKVTKVR 159
           +YLAHTQGK+HQ                  P L QA ++    +  VKIGRPGY+VTK  
Sbjct: 69  NYLAHTQGKRHQQNLARRAAKEALN----NPTLPQANSRTVKARKTVKIGRPGYRVTKQL 124

Query: 160 DPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYETIAFKV 219
           DP T+Q  L F++ YPEI   + PRHRFMSA+EQR+EPP+K  QYLL AAEPYET+AFK+
Sbjct: 125 DPETQQRSLLFEVDYPEIEESLQPRHRFMSAFEQRVEPPDKEWQYLLVAAEPYETVAFKI 184

Query: 220 QSKEVDKGEGKFFTHWDPDSKQFSLQFFFK 249
            + E+DK  GKF + W+ ++K F++Q +FK
Sbjct: 185 PNTEIDKAHGKFHSAWNDETKTFTVQLYFK 214



>gi|357017581|gb|AET50819.1| hypothetical protein [Eimeria tenella]
          Length = 245

 Score =  251 bits (642), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 119/221 (53%), Positives = 155/221 (70%), Gaps = 1/221 (0%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR G K+GSG  A + E N++R+ERLR+LALETIDLNKDPYFM+NHLG +EC+LCL
Sbjct: 5   MDYQNRVGHKLGSGAPATWQEVNLERKERLRRLALETIDLNKDPYFMRNHLGQFECRLCL 64

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLHTNEGSYL+HTQGKKHQT                   L+  +      + V+IGRPGY
Sbjct: 65  TLHTNEGSYLSHTQGKKHQTNLSRRLAKEKADAVVAPMPLKTSSGPGRSTDRVRIGRPGY 124

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIE-PPNKAHQYLLFAAEPY 212
           +VTK+RD  TRQ  L  +++YPEI     P HRFMSA+EQR+E PP+  +Q+LLFAAEPY
Sbjct: 125 RVTKLRDERTRQFALLCEVEYPEIVRGTKPYHRFMSAFEQRVETPPDGNYQFLLFAAEPY 184

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           ETIAFK+ + E+D+ + +    WD + K +++Q FF   +P
Sbjct: 185 ETIAFKIPNMEIDRDDPRHHAAWDEEKKVYTMQIFFSKRQP 225



>gi|405974254|gb|EKC38913.1| Splicing factor 3A subunit 2 [Crassostrea gigas]
          Length = 204

 Score =  251 bits (641), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 128/186 (68%), Positives = 141/186 (75%), Gaps = 3/186 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+R G K G GGVA  SE+N DRRERLR+LALETIDLNKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRAGGKTGVGGVASASESNRDRRERLRQLALETIDLNKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQ                 QPA + + +V IKK  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQANLARRAAKEAKEAPA-QPAPE-KARVDIKK-FVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RDP   Q  L FQI YPEI   + PRHRFM+AYEQ++EPP++  QYLLFAAEPYE
Sbjct: 118 KVTKQRDPDNGQQSLLFQIDYPEIVEGIAPRHRFMAAYEQKVEPPDRKWQYLLFAAEPYE 177

Query: 214 TIAFKV 219
           TIAFK+
Sbjct: 178 TIAFKI 183



>gi|428173492|gb|EKX42394.1| hypothetical protein GUITHDRAFT_159853 [Guillardia theta CCMP2712]
          Length = 219

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 148/206 (71%), Gaps = 3/206 (1%)

Query: 41  GSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCLTLHTNEG 100
           G K GSG  +  S+ N  RRERLRKLALETIDLN+DPYFMKNHLG+YECKLCLT+HTNEG
Sbjct: 12  GGKTGSGRQSSESQENQMRRERLRKLALETIDLNRDPYFMKNHLGTYECKLCLTIHTNEG 71

Query: 101 SYLAHTQGKKHQ-TXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGYKVTKVR 159
           +YLAHTQGK+HQ                  QPA   + KVQ K    KIGRPGY+VTK R
Sbjct: 72  NYLAHTQGKRHQQNIARRLAKDAYEQGLGFQPAAPKEMKVQRKS--AKIGRPGYRVTKQR 129

Query: 160 DPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYETIAFKV 219
           DP T Q  L F I YPEI   + PRHRFMSAYEQR+EP +K +QY+L AA+PYETIAFKV
Sbjct: 130 DPETGQRSLLFLIDYPEIEQGLQPRHRFMSAYEQRVEPADKNYQYILVAADPYETIAFKV 189

Query: 220 QSKEVDKGEGKFFTHWDPDSKQFSLQ 245
            ++E+D    KFFT+WD D+K F++Q
Sbjct: 190 PNQEIDNSPSKFFTNWDFDTKTFTMQ 215



>gi|452821654|gb|EME28682.1| splicing factor 3A subunit 2 [Galdieria sulphuraria]
          Length = 248

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 146/201 (72%), Gaps = 4/201 (1%)

Query: 49  VAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCLTLHTNEGSYLAHTQG 108
           VA   +T V RRERLR+LALETIDL KDPYFM+NHLG YECKLCLTLHTNEG+YLAHTQG
Sbjct: 14  VASSEQTEVSRRERLRQLALETIDLKKDPYFMRNHLGGYECKLCLTLHTNEGNYLAHTQG 73

Query: 109 KKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGYKVTKVRDPITRQLGL 168
           ++HQ                 +P   A     + K  +KIGRPGY++ K RDP T QL L
Sbjct: 74  RRHQMNLARRAAREAKE----KPQTVAPPPKIVPKKTIKIGRPGYRIIKQRDPETDQLSL 129

Query: 169 FFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYETIAFKVQSKEVDKGE 228
            FQIQYPEI  DV PRHRFMS++EQ++E P+  +Q+LLFAAEPYETIAFK+ + E++K E
Sbjct: 130 LFQIQYPEIAEDVQPRHRFMSSFEQKVERPDPKYQFLLFAAEPYETIAFKIPNWEIEKSE 189

Query: 229 GKFFTHWDPDSKQFSLQFFFK 249
           G ++ HWD D+K F+LQ +FK
Sbjct: 190 GNYYLHWDKDNKTFTLQIYFK 210



>gi|397575383|gb|EJK49665.1| hypothetical protein THAOC_31429 [Thalassiosira oceanica]
          Length = 231

 Score =  251 bits (640), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 120/225 (53%), Positives = 159/225 (70%), Gaps = 7/225 (3%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           +D QNR GSK G GGV+   +T  +R+ERLR+LA+ET+DL +DPY M+NHLG+YECKLCL
Sbjct: 2   VDRQNRVGSKFGGGGVSSAQQTERERKERLRQLAMETVDLARDPYLMRNHLGTYECKLCL 61

Query: 94  TLHTNEGSYLAHTQGKKHQT-----XXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKI 148
           TLHTNE +YL+HTQGKKHQ                     +  AL+A T+V   ++ VKI
Sbjct: 62  TLHTNEANYLSHTQGKKHQAGLARRAAMEAKMAKQNEATDVMMALRAGTQVSQAQSKVKI 121

Query: 149 GRPGYKVTKVRDPITRQLGLFFQIQYPEI-GLDVIPRHRFMSAYEQRIE-PPNKAHQYLL 206
           GRPGY+V+K RDP T    L F++ YPE+ G +  PRHRFMSAYEQR+E PP+  +QYLL
Sbjct: 122 GRPGYEVSKSRDPDTNARCLTFELHYPELDGGNRQPRHRFMSAYEQRVETPPDNNYQYLL 181

Query: 207 FAAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFKND 251
            A +PYET+ FK+ ++++DKGEGKF T+WD DS+ F+L   F ++
Sbjct: 182 IACDPYETVGFKIPNEKIDKGEGKFVTNWDVDSRMFTLTLHFVDE 226



>gi|325184636|emb|CCA19128.1| splicing factor 3A subunit putative [Albugo laibachii Nc14]
          Length = 323

 Score =  249 bits (637), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 128/221 (57%), Positives = 152/221 (68%), Gaps = 6/221 (2%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           +D+QNR GSK GSGGVA  S+ N+DRRERLRKLALETIDL+KDPYFMKNHLGSYECKLCL
Sbjct: 78  IDYQNRVGSKPGSGGVASESQANIDRRERLRKLALETIDLSKDPYFMKNHLGSYECKLCL 137

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXX------XXXXIQPALQAQTKVQIKKNLVK 147
           TLH NEG+YLAHTQGK+HQT                        A  A      +   ++
Sbjct: 138 TLHNNEGNYLAHTQGKRHQTNLARRAAKEASEAASSIAQANFLEATAAAAAAAARPRPLR 197

Query: 148 IGRPGYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLF 207
           IG PGYKV K RDP T    L FQI YPE    + PRHRFMSAYEQ++EP +K  QYLLF
Sbjct: 198 IGLPGYKVMKQRDPNTNARMLTFQILYPEYDRKLQPRHRFMSAYEQKMEPADKNFQYLLF 257

Query: 208 AAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFF 248
           A EPYETI FK+ + E+D+ + KFF++WD ++K F+LQ  F
Sbjct: 258 ACEPYETIGFKIPNLELDRRKEKFFSNWDKEAKTFTLQLSF 298



>gi|392580549|gb|EIW73676.1| hypothetical protein TREMEDRAFT_59849 [Tremella mesenterica DSM
           1558]
          Length = 218

 Score =  249 bits (637), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 150/221 (67%), Gaps = 8/221 (3%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR G+  G GGVAG SET VDRRERLRKLALETIDL KDPY ++ HLG+ EC+LCL
Sbjct: 1   MDYQNRAGANKGGGGVAGDSETAVDRRERLRKLALETIDLAKDPYILRTHLGTLECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQT--XXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRP 151
           TLH NEGSYLAHTQGKKHQT                  +P  Q Q +   KK  VKIGRP
Sbjct: 61  TLHINEGSYLAHTQGKKHQTNLARRAARDNRDQNLSIARPTPQQQVR---KKVFVKIGRP 117

Query: 152 GYKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEP 211
           GYK+ K+RDP + +LGL F +  PEI     PR RFMSA+EQR E PN+A QY + AAEP
Sbjct: 118 GYKIIKIRDPSSGRLGLLFTVSLPEIKQGEQPRRRFMSAFEQRREVPNRAFQYFVLAAEP 177

Query: 212 YETIAFKVQSKE-VDKGE--GKFFTHWDPDSKQFSLQFFFK 249
           YETIAF + +KE VD  E  G  + HWD D K +S QF +K
Sbjct: 178 YETIAFAIPAKEMVDPEEDPGSTWEHWDADEKVYSCQFLYK 218



>gi|402080310|gb|EJT75455.1| splicing factor 3a subunit 2 [Gaeumannomyces graminis var. tritici
           R3-111a-1]
          Length = 256

 Score =  249 bits (636), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 127/260 (48%), Positives = 165/260 (63%), Gaps = 30/260 (11%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVA  S TN DRRERLRKLALE IDL+KDPY  KNHLGS+EC+LCL
Sbjct: 1   MDYQNRAGSKFGGGGVASQSATNADRRERLRKLALEHIDLDKDPYIFKNHLGSFECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQI------------ 141
           T+H N+GSYLAHTQG+KHQT               ++  +  QT + +            
Sbjct: 61  TVHQNDGSYLAHTQGRKHQT---NLARRAAQEKRDVRRDIDPQTGLPVGVVGAGFGALGL 117

Query: 142 ------KKNLVKIGRPGYKVTKVRDPITRQLGLFFQIQYPEIGLD-------VIPRHRFM 188
                 ++  VKIGRPGYK+TKVRDP+TR  GL FQ+Q PEI  D         P+ + +
Sbjct: 118 GGNGKGRRPAVKIGRPGYKITKVRDPVTRAEGLIFQLQLPEISRDAAAAGGGGGPKWQVV 177

Query: 189 SAYEQRIEPPNKAHQYLLFAAEPYETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFF 248
           SA+ QR+E P++  QYLL AAEPYET  FK+ S+E+D+ EG+ F +WDPD+K++ +Q  F
Sbjct: 178 SAFSQRVEDPDRNFQYLLVAAEPYETCGFKIPSRELDRREGRTFEYWDPDAKEYWIQIMF 237

Query: 249 KNDRPGMYSEGIPPGIERAP 268
             +R   ++    PG+   P
Sbjct: 238 MTEREERFNAA--PGLVGGP 255



>gi|291510296|gb|ADE10104.1| PRP11 [Tremella fuciformis]
          Length = 218

 Score =  249 bits (636), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 124/219 (56%), Positives = 151/219 (68%), Gaps = 4/219 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR G+  G GGVAG SET VDRRERLRKLALETIDL KDPY ++ HLG+ EC+LCL
Sbjct: 1   MDYQNRAGANKGGGGVAGASETAVDRRERLRKLALETIDLAKDPYILRTHLGTLECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                  A  +  +V+ KK  VKIGRPGY
Sbjct: 61  TLHINEGSYLAHTQGKKHQTNLARRAARDNRDSMMTMAAAPSAPQVR-KKVFVKIGRPGY 119

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           K+ K+R+P ++++GL F I  PEI     PR RFMSA+EQ+ E PN+A QY++ AAEPYE
Sbjct: 120 KIIKIREPESQRMGLLFTISLPEIKSGERPRRRFMSAFEQKREVPNRAFQYMVLAAEPYE 179

Query: 214 TIAFKVQSKE-VDKGEG--KFFTHWDPDSKQFSLQFFFK 249
           TIAF + +K+ VD+ E     + HWD D K +S Q  FK
Sbjct: 180 TIAFAIPAKDMVDREEDPESVWEHWDNDEKVYSCQLLFK 218



>gi|302803829|ref|XP_002983667.1| hypothetical protein SELMODRAFT_180432 [Selaginella moellendorffii]
 gi|300148504|gb|EFJ15163.1| hypothetical protein SELMODRAFT_180432 [Selaginella moellendorffii]
          Length = 241

 Score =  249 bits (635), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 128/210 (60%), Positives = 147/210 (70%), Gaps = 4/210 (1%)

Query: 41  GSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCLTLHTNEG 100
           GSK GSGG A      +DRRERLR+LA+ETIDL KDPYFM+NHLGSYECKLCLTLH NEG
Sbjct: 6   GSKPGSGGAASAQNEAIDRRERLRRLAIETIDLGKDPYFMRNHLGSYECKLCLTLHNNEG 65

Query: 101 SYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGYKVTKVRD 160
           +YLAHTQGK+HQT               IQP  Q   +    +  VKIGRPGYKVTK  D
Sbjct: 66  NYLAHTQGKRHQT-NLAKRAARDAKDQPIQP--QPLKRKLNPRKTVKIGRPGYKVTKQYD 122

Query: 161 PITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYETIAFKVQ 220
             T+Q  L FQI YPEI  +  PR+R MS++EQ++EP  K  QYLLFAAEPYE IAFK+ 
Sbjct: 123 AETQQRSLLFQIAYPEIEDNAKPRYRLMSSFEQKLEPNEKEWQYLLFAAEPYEIIAFKIP 182

Query: 221 SKEVDK-GEGKFFTHWDPDSKQFSLQFFFK 249
           S E+DK    KFF HWD DSKQF+LQ +FK
Sbjct: 183 STEIDKSANDKFFFHWDQDSKQFTLQLYFK 212



>gi|353236539|emb|CCA68531.1| related to PRP11-pre-mRNA splicing factor [Piriformospora indica
           DSM 11827]
          Length = 223

 Score =  248 bits (633), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 127/224 (56%), Positives = 154/224 (68%), Gaps = 12/224 (5%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD+QNR GSK G GGVAG SETNVDRRERLRKLALETIDL KDPY ++NHLGS EC+LCL
Sbjct: 1   MDYQNRVGSKFGGGGVAGASETNVDRRERLRKLALETIDLAKDPYILRNHLGSLECRLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLHTNEGSYLAHTQGKKHQT                  ++        +K  ++IGRPGY
Sbjct: 61  TLHTNEGSYLAHTQGKKHQTNLARRAAKDMKESSL---SVAPPPNTVQRKLFLRIGRPGY 117

Query: 154 KVTKVRDPIT-----RQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFA 208
           +VTK+RDP       R  GL  Q+  P+I   VIPR R MS +EQ+ E PN+ HQYL+ A
Sbjct: 118 RVTKIRDPDGTGGEPRAEGLLVQVYLPQIKDGVIPRKRIMSGWEQKKELPNRNHQYLIVA 177

Query: 209 AEPYETIAFKVQSKEV-DKGEGKF---FTHWDPDSKQFSLQFFF 248
           AEPYETIAF++  + + ++ E +F   ++HWD D+KQFS QF F
Sbjct: 178 AEPYETIAFRIPPRRIMEEDEDQFGWTWSHWDKDTKQFSFQFMF 221



>gi|343427374|emb|CBQ70901.1| related to PRP11-pre-mRNA splicing factor [Sporisorium reilianum
           SRZ2]
          Length = 237

 Score =  246 bits (627), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 127/239 (53%), Positives = 155/239 (64%), Gaps = 25/239 (10%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDF +R G+K    G+AG SE+NVDRR+RLRKLALETIDL KDPY +KNHLG  EC+LCL
Sbjct: 1   MDFSSRGGNK--GAGIAGASESNVDRRDRLRKLALETIDLAKDPYLLKNHLGGLECRLCL 58

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQI--KKNLVKIGRP 151
           TLHTNEGSYLAHTQGKKHQT                   L   +  +   KK  +KIGRP
Sbjct: 59  TLHTNEGSYLAHTQGKKHQTNLARRAAREAKENAYDSNKLITASAAETVPKKQFIKIGRP 118

Query: 152 GYKVTKVRDPITR-----QLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLL 206
           GYKV+KVR+P+       +LGL FQI  PEI   V P HRFM A+EQ++E P++ +QYL+
Sbjct: 119 GYKVSKVREPLLEGEEGGRLGLLFQISLPEIKEGVTPMHRFMGAFEQKVETPDRNYQYLV 178

Query: 207 FAAEPYETIAFKVQSKEVDKGEGKFFT----------------HWDPDSKQFSLQFFFK 249
            AAEPYETIAFK+QSKE+D+ +    T                ++DPD K FS+Q  FK
Sbjct: 179 VAAEPYETIAFKLQSKEIDRRDTGLVTSSAPGSRPRPEPSTWSYFDPDGKTFSIQVMFK 237



>gi|350580739|ref|XP_003123077.3| PREDICTED: splicing factor 3A subunit 2-like [Sus scrofa]
          Length = 285

 Score =  245 bits (626), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 140/194 (72%), Gaps = 3/194 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQTNLARRAAKEAKEAPA-QPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPE+   + PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEVAEGITPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFKVQSKEVDKG 227
           TIAFKV  + +  G
Sbjct: 178 TIAFKVACQPLWGG 191



>gi|356550634|ref|XP_003543690.1| PREDICTED: splicing factor 3A subunit 2-like [Glycine max]
          Length = 350

 Score =  245 bits (626), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 134/213 (62%), Positives = 157/213 (73%), Gaps = 3/213 (1%)

Query: 41  GSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCLTLHTNEG 100
           GSK GSGG A      +DRRERLR+LALETIDL KDPYFM+NHLGSYECKLCLTLH NEG
Sbjct: 6   GSKPGSGGAASAQNEAIDRRERLRRLALETIDLAKDPYFMRNHLGSYECKLCLTLHNNEG 65

Query: 101 SYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGYKVTKVRD 160
           +YLAHTQGK+HQT                QP    + KV ++K  VKIGRPGY+VTK  D
Sbjct: 66  NYLAHTQGKRHQTNLAKRAAREAKDSP-AQPQPHKR-KVTLRKT-VKIGRPGYRVTKQYD 122

Query: 161 PITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYETIAFKVQ 220
           P T+Q  L FQI+YPEI     PRHRFMS+YEQR++P +K++QYLLFAAEPYE +AFKV 
Sbjct: 123 PETKQRSLLFQIEYPEIEDLTKPRHRFMSSYEQRVQPFDKSYQYLLFAAEPYEIVAFKVP 182

Query: 221 SKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           S E+DK   KFF+HWDPDSK F+LQ +FK+  P
Sbjct: 183 STEIDKSTPKFFSHWDPDSKMFTLQLYFKSKPP 215



>gi|149034495|gb|EDL89232.1| rCG29232, isoform CRA_b [Rattus norvegicus]
 gi|149034496|gb|EDL89233.1| rCG29232, isoform CRA_b [Rattus norvegicus]
          Length = 212

 Score =  245 bits (625), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 129/185 (69%), Positives = 137/185 (74%), Gaps = 3/185 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQ+RPG K GSGGVA  SE+N DRRERLR+LALETID+NKDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQHRPGGKTGSGGVASSSESNRDRRERLRQLALETIDINKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQT                QPA   +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQT-NLARRAAKEAKEAPAQPA--PEKVKVEVKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           KVTK RD    Q  L FQI YPEI   V+PRHRFMSAYEQRIEPP++  QYLL AAEPYE
Sbjct: 118 KVTKQRDTEMGQQSLLFQIDYPEIAEGVMPRHRFMSAYEQRIEPPDRRWQYLLMAAEPYE 177

Query: 214 TIAFK 218
           TIAFK
Sbjct: 178 TIAFK 182



>gi|255556836|ref|XP_002519451.1| Splicing factor 3A subunit, putative [Ricinus communis]
 gi|223541314|gb|EEF42865.1| Splicing factor 3A subunit, putative [Ricinus communis]
          Length = 327

 Score =  244 bits (624), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 135/224 (60%), Positives = 156/224 (69%), Gaps = 5/224 (2%)

Query: 41  GSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCLTLHTNEG 100
           GSK GSGG A      +DRRERLR+LALETIDL KDPYFM+NHLGSYECKLCLTLH NEG
Sbjct: 6   GSKPGSGGAASAQNEAIDRRERLRRLALETIDLAKDPYFMRNHLGSYECKLCLTLHNNEG 65

Query: 101 SYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIK-KNLVKIGRPGYKVTKVR 159
           +YLAHTQGK+HQT                 PAL    K +I  +  VKIGRPGY+VTK  
Sbjct: 66  NYLAHTQGKRHQTNLAKRAAREAKES----PALPQPNKRKINIRKTVKIGRPGYRVTKQF 121

Query: 160 DPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYETIAFKV 219
           D  T+Q  L FQI+YPEI  +  PRHRFMS++EQR++P +K +QYLLFAAEPYE IAFKV
Sbjct: 122 DHETKQRSLLFQIEYPEIEDNTKPRHRFMSSFEQRMQPYDKRYQYLLFAAEPYEIIAFKV 181

Query: 220 QSKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRPGMYSEGIPPG 263
            S E+DK   KFF+HWDPDSK F+LQ +FK   P       PP 
Sbjct: 182 PSTEIDKSTPKFFSHWDPDSKMFTLQLYFKTKPPEANKSQAPPA 225



>gi|224140247|ref|XP_002323495.1| predicted protein [Populus trichocarpa]
 gi|222868125|gb|EEF05256.1| predicted protein [Populus trichocarpa]
          Length = 334

 Score =  244 bits (623), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 136/211 (64%), Positives = 154/211 (72%), Gaps = 7/211 (3%)

Query: 41  GSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCLTLHTNEG 100
           GSK GSGG A      +DRRERLR+LALETIDL KDPYFM+NHLGSYECKLCLTLH NEG
Sbjct: 6   GSKPGSGGAASAQNEAIDRRERLRRLALETIDLAKDPYFMRNHLGSYECKLCLTLHNNEG 65

Query: 101 SYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQA--QTKVQIKKNLVKIGRPGYKVTKV 158
           +YLAHTQGK+HQT                 PAL    + KV I+K  VKIGRPGY+VTK 
Sbjct: 66  NYLAHTQGKRHQTNLAKRAAREAKDA----PALPQPNKRKVNIRKT-VKIGRPGYRVTKQ 120

Query: 159 RDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYETIAFK 218
            DP T+Q  L FQI+YPEI  +  PRHRFMS+YEQRIE  +K  QYLLF+AEPYE IAFK
Sbjct: 121 FDPETKQRSLLFQIEYPEIEDNTKPRHRFMSSYEQRIEANDKRFQYLLFSAEPYEIIAFK 180

Query: 219 VQSKEVDKGEGKFFTHWDPDSKQFSLQFFFK 249
           V S E+DK   KFF+HWDPDSK F+LQ +FK
Sbjct: 181 VPSTEIDKSTPKFFSHWDPDSKMFTLQLYFK 211



>gi|482563477|gb|EOA27667.1| hypothetical protein CARUB_v10023821mg [Capsella rubella]
          Length = 277

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 132/213 (61%), Positives = 154/213 (72%), Gaps = 3/213 (1%)

Query: 41  GSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCLTLHTNEG 100
           GSK GSGG A      +DRRERLR+LALETIDL KDPYFM+NHLGSYECKLCLTLH NEG
Sbjct: 6   GSKPGSGGAASGQNEAIDRRERLRRLALETIDLAKDPYFMRNHLGSYECKLCLTLHNNEG 65

Query: 101 SYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGYKVTKVRD 160
           +YLAHTQGK+HQT                   L+ +  V   +  VKIGRPGY+VTK  D
Sbjct: 66  NYLAHTQGKRHQTNLAKRAAREAKEAVSQPQPLKRKVSV---RRTVKIGRPGYRVTKQYD 122

Query: 161 PITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYETIAFKVQ 220
           P  +Q  L FQI+YPEI  ++ PRHRFMS+YEQ++EP +K +QYLLFAAEPYE IAFKV 
Sbjct: 123 PELQQRSLLFQIEYPEIEDNIKPRHRFMSSYEQKVEPYDKRYQYLLFAAEPYEIIAFKVP 182

Query: 221 SKEVDKGEGKFFTHWDPDSKQFSLQFFFKNDRP 253
           S EVDK   KFF+HWDPDSK F+LQ +FK  +P
Sbjct: 183 STEVDKSTPKFFSHWDPDSKMFTLQVYFKPTKP 215



>gi|403368451|gb|EJY84061.1| Splicing factor 3A subunit 2, putative [Oxytricha trifallax]
          Length = 220

 Score =  244 bits (622), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 118/217 (54%), Positives = 151/217 (69%), Gaps = 8/217 (3%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MD QNR GSK  S  VA  SE N+  +ERLR+L +ET D++ DPY M+NHLGS+EC+LCL
Sbjct: 1   MDMQNRAGSK--SSAVASQSEQNLQHKERLRRLHVETADVSNDPYIMRNHLGSFECRLCL 58

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXI-QPALQAQTKVQIKKNLVKIGRPG 152
           TLHTNE SYLAHT GKKHQT               + QP ++ Q     KKN +KIGRPG
Sbjct: 59  TLHTNEASYLAHTTGKKHQTNLHRRQLRENKDNNNLPQPKIKLQ-----KKNTIKIGRPG 113

Query: 153 YKVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPY 212
           Y+V K +DP   Q  L F+++YPEI   + PR+R MSAYEQ++E P+  +QYLLFAA+PY
Sbjct: 114 YRVIKQKDPDNGQKSLLFEVEYPEIESKLQPRYRIMSAYEQKVETPDDKYQYLLFAADPY 173

Query: 213 ETIAFKVQSKEVDKGEGKFFTHWDPDSKQFSLQFFFK 249
           ETIAFK+ + E+D  EGK+F  WD D ++++LQ FFK
Sbjct: 174 ETIAFKIPNLEIDFSEGKYFDAWDKDQRKYTLQIFFK 210



>gi|478262956|gb|ENN81367.1| hypothetical protein YQE_02233, partial [Dendroctonus ponderosae]
          Length = 183

 Score =  244 bits (622), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 128/186 (68%), Positives = 138/186 (74%), Gaps = 3/186 (1%)

Query: 34  MDFQNRPGSKVGSGGVAGYSETNVDRRERLRKLALETIDLNKDPYFMKNHLGSYECKLCL 93
           MDFQNRPG K G GGVA +SE+N DRRERLR+LALETIDL KDPYFMKNHLGSYECKLCL
Sbjct: 1   MDFQNRPGGKTGGGGVASWSESNRDRRERLRQLALETIDLQKDPYFMKNHLGSYECKLCL 60

Query: 94  TLHTNEGSYLAHTQGKKHQTXXXXXXXXXXXXXXXIQPALQAQTKVQIKKNLVKIGRPGY 153
           TLH NEGSYLAHTQGKKHQ                +   LQ +      K  VKIGRPGY
Sbjct: 61  TLHNNEGSYLAHTQGKKHQANLARRAAKEAKDAPTM---LQPEKPRVEPKKFVKIGRPGY 117

Query: 154 KVTKVRDPITRQLGLFFQIQYPEIGLDVIPRHRFMSAYEQRIEPPNKAHQYLLFAAEPYE 213
           +VTK RDP   Q  L FQI YPEI   V+PRHRFMSAYEQ+IEPP++  QYLLFAAEPYE
Sbjct: 118 RVTKQRDPENGQQSLLFQIDYPEIADHVLPRHRFMSAYEQKIEPPDRKWQYLLFAAEPYE 177

Query: 214 TIAFKV 219
           TIAFKV
Sbjct: 178 TIAFKV 183