BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10229_c0_seq1-m.89 5prime_partial 189-1115(-) 309 (-)
         (308 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|384490290|gb|EIE81512.1| hypothetical protein RO3G_06217 [Rhi...   167   3e-39   Rhizopus delemar RA 99-880
gi|384500881|gb|EIE91372.1| hypothetical protein RO3G_16083 [Rhi...   154   2e-35   Rhizopus delemar RA 99-880
gi|511005447|gb|EPB86787.1| hypothetical protein HMPREF1544_0640...   153   5e-35   Mucor circinelloides f. circinelloides 1006PhL
gi|358055238|dbj|GAA98746.1| hypothetical protein E5Q_05434 [Mix...   133   6e-29   Mixia osmundae IAM 14324
gi|345561577|gb|EGX44665.1| hypothetical protein AOL_s00188g3 [A...   123   6e-26   Arthrobotrys oligospora ATCC 24927
gi|296410832|ref|XP_002835139.1| hypothetical protein [Tuber mel...   119   8e-25   Tuber melanosporum Mel28
gi|367025969|ref|XP_003662269.1| hypothetical protein MYCTH_2302...   118   2e-24   Myceliophthora thermophila ATCC 42464
gi|440634411|gb|ELR04330.1| hypothetical protein GMDG_06712 [Geo...   118   2e-24   Pseudogymnoascus destructans 20631-21
gi|170093734|ref|XP_001878088.1| predicted protein [Laccaria bic...   117   4e-24   Laccaria bicolor S238N-H82
gi|494825658|gb|EON62812.1| hypothetical protein W97_02037 [Coni...   116   1e-23   Coniosporium apollinis CBS 100218
gi|353240391|emb|CCA72263.1| related to PEX19 protein [Piriformo...   115   2e-23   Serendipita indica DSM 11827
gi|170103893|ref|XP_001883161.1| predicted protein [Laccaria bic...   115   2e-23   Laccaria bicolor S238N-H82
gi|390596059|gb|EIN05462.1| Pex19 protein, partial [Punctularia ...   114   2e-23   Punctularia strigosozonata HHB-11173 SS5
gi|340914950|gb|EGS18291.1| hypothetical protein CTHT_0063150 [C...   114   4e-23   Chaetomium thermophilum var. thermophilum DSM 1495
gi|322707930|gb|EFY99508.1| peroxin [Metarhizium anisopliae ARSE...   114   5e-23   Metarhizium robertsii ARSEF 23
gi|358388721|gb|EHK26314.1| hypothetical protein TRIVIDRAFT_1560...   113   6e-23   Trichoderma virens Gv29-8
gi|358395775|gb|EHK45162.1| hypothetical protein TRIATDRAFT_2998...   113   6e-23   Trichoderma atroviride IMI 206040
gi|336269081|ref|XP_003349302.1| hypothetical protein SMAC_05585...   112   1e-22   Sordaria macrospora k-hell
gi|156043287|ref|XP_001588200.1| hypothetical protein SS1G_10647...   112   1e-22   Sclerotinia sclerotiorum 1980 UF-70
gi|472588542|gb|EMS26014.1| peroxisomal biogenesis factor 19 [Rh...   111   3e-22   Rhodotorula toruloides NP11
gi|347835211|emb|CCD49783.1| hypothetical protein BofuT4_P094910...   111   3e-22   Botrytis cinerea T4
gi|472242315|gb|EMR87014.1| putative pex19 family protein [Botry...   111   3e-22   Botrytis cinerea BcDW1
gi|367038997|ref|XP_003649879.1| hypothetical protein THITE_2108...   110   3e-22   Thielavia terrestris NRRL 8126
gi|336472100|gb|EGO60260.1| hypothetical protein NEUTE1DRAFT_119...   110   4e-22   Neurospora tetrasperma FGSC 2508
gi|395329208|gb|EJF61596.1| Pex19-domain-containing protein [Dic...   110   4e-22   Dichomitus squalens LYAD-421 SS1
gi|393247077|gb|EJD54585.1| Pex19 protein [Auricularia delicata ...   110   4e-22   Auricularia subglabra TFB-10046 SS5
gi|154316506|ref|XP_001557574.1| hypothetical protein BC1G_04184...   110   4e-22   Botrytis cinerea B05.10
gi|85101095|ref|XP_961091.1| hypothetical protein NCU04301 [Neur...   110   4e-22   Neurospora crassa OR74A
gi|320592023|gb|EFX04462.1| peroxisomal membrane protein recepto...   110   4e-22   Grosmannia clavigera kw1407
gi|449541398|gb|EMD32382.1| hypothetical protein CERSUDRAFT_1187...   110   5e-22   Gelatoporia subvermispora B
gi|116784489|gb|ABK23361.1| unknown [Picea sitchensis]                110   6e-22   Picea sitchensis
gi|471566447|gb|EMR66756.1| putative pex19-domain-containing pro...   110   7e-22   Eutypa lata UCREL1
gi|116197773|ref|XP_001224698.1| hypothetical protein CHGG_07042...   110   7e-22   Chaetomium globosum CBS 148.51
gi|460392800|ref|XP_004242001.1| PREDICTED: peroxisome biogenesi...   109   1e-21   Solanum lycopersicum
gi|295671258|ref|XP_002796176.1| conserved hypothetical protein ...   106   6e-21   Paracoccidioides lutzii Pb01
gi|512208026|gb|EPE36843.1| hypothetical protein GLAREA_09006 [G...   106   7e-21   Glarea lozoyensis ATCC 20868
gi|340517551|gb|EGR47795.1| hypothetical protein TRIREDRAFT_1224...   106   8e-21   Trichoderma reesei QM6a
gi|15228571|ref|NP_186999.1| peroxin 19-1 [Arabidopsis thaliana]...   105   1e-20   Arabidopsis thaliana [mouse-ear cress]
gi|403418595|emb|CCM05295.1| predicted protein [Fibroporia radic...   105   2e-20   Fibroporia radiculosa
gi|320038389|gb|EFW20325.1| conserved hypothetical protein [Cocc...   105   2e-20   Coccidioides posadasii str. Silveira
gi|328859756|gb|EGG08864.1| hypothetical protein MELLADRAFT_7137...   105   2e-20   Melampsora larici-populina 98AG31
gi|408397561|gb|EKJ76702.1| hypothetical protein FPSE_03113 [Fus...   105   2e-20   Fusarium pseudograminearum CS3096
gi|346326257|gb|EGX95853.1| peroxin [Cordyceps militaris CM01]        104   3e-20   Cordyceps militaris CM01
gi|46136841|ref|XP_390112.1| hypothetical protein FG09936.1 [Fus...   104   3e-20   
gi|409043509|gb|EKM52991.1| hypothetical protein PHACADRAFT_2591...   104   3e-20   Phanerochaete carnosa HHB-10118-sp
gi|400597189|gb|EJP64924.1| Pex19 family protein [Beauveria bass...   104   4e-20   Beauveria bassiana ARSEF 2860
gi|443690044|gb|ELT92282.1| hypothetical protein CAPTEDRAFT_2247...   103   4e-20   Capitella teleta
gi|320582956|gb|EFW97173.1| peroxin19 Pex19p [Ogataea parapolymo...   103   5e-20   
gi|393223026|gb|EJD08510.1| Pex19-domain-containing protein [Fom...   103   5e-20   Fomitiporia mediterranea MF3/22
gi|477529971|gb|ENH81713.1| pex19 family protein [Colletotrichum...   103   5e-20   Colletotrichum orbiculare MAFF 240422
gi|500261044|gb|EOO03447.1| putative pex19-domain-containing pro...   103   6e-20   Phaeoacremonium minimum UCRPA7
gi|392871066|gb|EAS32928.2| peroxin 19 [Coccidioides immitis RS]      103   7e-20   
gi|260814193|ref|XP_002601800.1| hypothetical protein BRAFLDRAFT...   103   7e-20   Branchiostoma floridae
gi|15088515|gb|AAK84070.1|AF176708_1 peroxin19 Pex19p [Ogataea a...   103   7e-20   Ogataea angusta
gi|242063020|ref|XP_002452799.1| hypothetical protein SORBIDRAFT...   103   8e-20   Sorghum bicolor [broomcorn]
gi|405960503|gb|EKC26424.1| Peroxisomal biogenesis factor 19 [Cr...   102   9e-20   Crassostrea gigas
gi|351727995|ref|NP_001236156.1| uncharacterized protein LOC1005...   102   1e-19   Glycine max [soybeans]
gi|224138592|ref|XP_002326641.1| predicted protein [Populus tric...   102   1e-19   
gi|392562985|gb|EIW56165.1| Pex19-domain-containing protein [Tra...   102   1e-19   Trametes versicolor FP-101664 SS1
gi|226502104|ref|NP_001149245.1| peroxisomal biogenesis factor 1...   102   2e-19   Zea mays [maize]
gi|224074153|ref|XP_002304276.1| predicted protein [Populus tric...   102   2e-19   Populus trichocarpa [western balsam poplar]
gi|512192403|gb|EPE08162.1| pex19 family protein [Ophiostoma pic...   102   2e-19   Ophiostoma piceae UAMH 11346
gi|297833004|ref|XP_002884384.1| peroxisomal protein PEX19 famil...   101   2e-19   Arabidopsis lyrata subsp. lyrata
gi|242784369|ref|XP_002480373.1| peroxisomal membrane protein re...   101   3e-19   Talaromyces stipitatus ATCC 10500
gi|169857129|ref|XP_001835217.1| peroxin19 Pex19p [Coprinopsis c...   101   3e-19   Coprinopsis cinerea okayama7#130
gi|502152386|ref|XP_004508903.1| PREDICTED: peroxisome biogenesi...   101   3e-19   Cicer arietinum [garbanzo]
gi|413923356|gb|AFW63288.1| peroxisomal biogenesis factor 19 [Ze...   101   3e-19   Zea mays [maize]
gi|402085757|gb|EJT80655.1| hypothetical protein GGTG_00649 [Gae...   101   3e-19   Gaeumannomyces graminis var. tritici R3-111a-1
gi|219887619|gb|ACL54184.1| unknown [Zea mays]                        101   3e-19   Zea mays [maize]
gi|451855131|gb|EMD68423.1| hypothetical protein COCSADRAFT_1676...   101   3e-19   Bipolaris sorokiniana ND90Pr
gi|413923355|gb|AFW63287.1| hypothetical protein ZEAMMB73_457398...   100   4e-19   Zea mays [maize]
gi|477509404|gb|ENH62696.1| Peroxisomal biogenesis factor 19 [Fu...   100   4e-19   Fusarium oxysporum f. sp. cubense race 1
gi|475665919|gb|EMT63711.1| Peroxisomal biogenesis factor 19 [Fu...   100   4e-19   Fusarium oxysporum f. sp. cubense race 4
gi|342879022|gb|EGU80299.1| hypothetical protein FOXB_09226 [Fus...   100   5e-19   Fusarium oxysporum Fo5176
gi|328767816|gb|EGF77864.1| hypothetical protein BATDEDRAFT_2717...   100   5e-19   Batrachochytrium dendrobatidis JAM81
gi|392562993|gb|EIW56173.1| Pex19-domain-containing protein [Tra...   100   5e-19   Trametes versicolor FP-101664 SS1
gi|70999616|ref|XP_754525.1| peroxisomal membrane protein recept...   100   5e-19   Aspergillus fumigatus Af293
gi|508777085|gb|EOY24341.1| Peroxin 19-2 [Theobroma cacao]            100   6e-19   Theobroma cacao [chocolate]
gi|326512292|dbj|BAJ96127.1| predicted protein [Hordeum vulgare ...   100   7e-19   Hordeum vulgare subsp. vulgare [barley]
gi|410986679|ref|XP_003999637.1| PREDICTED: peroxisomal biogenes...   100   8e-19   Felis catus [cat]
gi|403158426|ref|XP_003307718.2| hypothetical protein PGTG_00668...   100   8e-19   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|449458948|ref|XP_004147208.1| PREDICTED: peroxisome biogenesi...   100   1e-18   
gi|392562988|gb|EIW56168.1| Pex19 protein [Trametes versicolor F...    99   1e-18   Trametes versicolor FP-101664 SS1
gi|351721206|ref|NP_001235410.1| uncharacterized protein LOC1005...    99   1e-18   Glycine max [soybeans]
gi|296810696|ref|XP_002845686.1| farnesylated protein PEX19 [Art...    99   1e-18   Arthroderma otae CBS 113480
gi|259490611|ref|NP_001158959.1| LOC100303903 [Zea mays] >gi|195...    99   1e-18   Zea mays [maize]
gi|357476851|ref|XP_003608711.1| Peroxisomal biogenesis factor [...    99   1e-18   Medicago truncatula
gi|62903182|sp|Q9QYU1.1|PEX19_RAT RecName: Full=Peroxisomal biog...    99   1e-18   Rattus norvegicus [brown rat]
gi|406602298|emb|CCH46136.1| Peroxisomal biogenesis factor 19 [W...    99   1e-18   Wickerhamomyces ciferrii
gi|459369874|gb|EMG48134.1| Peroxisomal (Biogenesis) protein, pu...    99   2e-18   Candida maltosa Xu316
gi|440471025|gb|ELQ40062.1| hypothetical protein OOU_Y34scaffold...    99   2e-18   Magnaporthe oryzae Y34
gi|389640693|ref|XP_003717979.1| hypothetical protein MGG_00971 ...    99   2e-18   Magnaporthe oryzae 70-15
gi|452004161|gb|EMD96617.1| hypothetical protein COCHEDRAFT_1086...    99   2e-18   Bipolaris maydis C5
gi|119491739|ref|XP_001263364.1| peroxisomal membrane protein re...    99   2e-18   Aspergillus fischeri NRRL 181
gi|444514550|gb|ELV10582.1| Peroxisomal biogenesis factor 19 [Tu...    99   2e-18   Tupaia chinensis
gi|406860753|gb|EKD13810.1| peroxin [Marssonina brunnea f. sp. '...    99   2e-18   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|462405258|gb|EMJ10722.1| hypothetical protein PRUPE_ppa010581...    98   2e-18   Prunus persica
gi|475566300|gb|EMT15000.1| Peroxisomal biogenesis factor 19 [Ae...    98   2e-18   Aegilops tauschii
gi|12849757|dbj|BAB28468.1| unnamed protein product [Mus musculus]     98   2e-18   Mus musculus [mouse]
gi|448527720|ref|XP_003869563.1| Pex19 protein [Candida orthopsi...    98   2e-18   Candida orthopsilosis Co 90-125
gi|157817320|ref|NP_001100845.1| peroxisomal biogenesis factor 1...    98   2e-18   Rattus norvegicus [brown rat]
gi|293343148|ref|XP_001054818.2| PREDICTED: peroxisomal biogenes...    98   3e-18   
gi|212527684|ref|XP_002143999.1| peroxisomal membrane protein re...    98   3e-18   Talaromyces marneffei ATCC 18224
gi|431892928|gb|ELK03356.1| Peroxisomal biogenesis factor 19 [Pt...    98   3e-18   Pteropus alecto
gi|384246224|gb|EIE19715.1| Pex19-domain-containing protein [Coc...    98   3e-18   Coccomyxa subellipsoidea C-169
gi|470126938|ref|XP_004299437.1| PREDICTED: peroxisome biogenesi...    98   3e-18   Fragaria vesca subsp. vesca
gi|326477515|gb|EGE01525.1| hypothetical protein TEQG_08579 [Tri...    98   4e-18   Trichophyton equinum CBS 127.97
gi|396461541|ref|XP_003835382.1| hypothetical protein LEMA_P0472...    98   4e-18   Leptosphaeria maculans JN3
gi|115447729|ref|NP_001047644.1| Os02g0661000 [Oryza sativa Japo...    97   4e-18   
gi|322701179|gb|EFY92930.1| peroxin [Metarhizium acridum CQMa 102]     97   4e-18   Metarhizium acridum CQMa 102
gi|302653091|ref|XP_003018377.1| peroxisomal membrane protein re...    97   4e-18   Trichophyton verrucosum HKI 0517
gi|315051480|ref|XP_003175114.1| farnesylated protein PEX19 [Art...    97   4e-18   Microsporum gypseum CBS 118893
gi|473842984|gb|EMS47357.1| Peroxisome biogenesis protein 19-1 [...    97   4e-18   Triticum urartu
gi|504154356|ref|XP_004589136.1| PREDICTED: peroxisomal biogenes...    97   5e-18   Ochotona princeps [southern American pika]
gi|121705668|ref|XP_001271097.1| peroxisomal membrane protein re...    97   5e-18   Aspergillus clavatus NRRL 1
gi|512909415|ref|XP_004901586.1| PREDICTED: peroxisomal biogenes...    97   5e-18   
gi|426216941|ref|XP_004002715.1| PREDICTED: peroxisomal biogenes...    97   7e-18   
gi|6010213|emb|CAA70256.1| PxF protein [Mus musculus] >gi|601021...    97   7e-18   Mus musculus [mouse]
gi|327287434|ref|XP_003228434.1| PREDICTED: peroxisomal biogenes...    97   8e-18   Anolis carolinensis [Carolina anole]
gi|15214770|gb|AAH12517.1| Pex19 protein [Mus musculus]                97   8e-18   Mus musculus [mouse]
gi|226958490|ref|NP_075528.3| peroxisomal biogenesis factor 19 i...    97   8e-18   Mus musculus [mouse]
gi|466081196|ref|XP_004284480.1| PREDICTED: peroxisomal biogenes...    96   8e-18   Orcinus orca [Orca]
gi|507575250|ref|XP_004671170.1| PREDICTED: peroxisomal biogenes...    96   9e-18   Jaculus jaculus
gi|488512879|ref|XP_004448482.1| PREDICTED: DDB1- and CUL4-assoc...    96   9e-18   Dasypus novemcinctus
gi|90076598|dbj|BAE87979.1| unnamed protein product [Macaca fasc...    96   9e-18   Macaca fascicularis [crab eating macaque]
gi|355558636|gb|EHH15416.1| hypothetical protein EGK_01502 [Maca...    96   9e-18   Macaca mulatta [rhesus macaque]
gi|395845368|ref|XP_003795411.1| PREDICTED: DDB1- and CUL4-assoc...    96   9e-18   
gi|425768790|gb|EKV07303.1| Peroxin 19 [Penicillium digitatum Pd...    96   1e-17   Penicillium digitatum Pd1
gi|194035837|ref|XP_001928904.1| PREDICTED: peroxisomal biogenes...    96   1e-17   Sus scrofa [pigs]
gi|507575248|ref|XP_004671169.1| PREDICTED: peroxisomal biogenes...    96   1e-17   Jaculus jaculus
gi|336366190|gb|EGN94538.1| hypothetical protein SERLA73DRAFT_18...    96   1e-17   Serpula lacrymans var. lacrymans S7.3
gi|346970135|gb|EGY13587.1| peroxin 19 [Verticillium dahliae VdL...    96   1e-17   Verticillium dahliae VdLs.17
gi|478537470|ref|XP_004442849.1| PREDICTED: peroxisomal biogenes...    96   1e-17   Ceratotherium simum simum [southern square-lipped rhinoceros]
gi|125583152|gb|EAZ24083.1| hypothetical protein OsJ_07819 [Oryz...    96   1e-17   Oryza sativa Japonica Group [Japonica rice]
gi|440899072|gb|ELR50441.1| Peroxisomal biogenesis factor 19 [Bo...    96   1e-17   Bos mutus
gi|74006307|ref|XP_536130.2| PREDICTED: peroxisomal biogenesis f...    96   1e-17   Canis lupus familiaris [dogs]
gi|219110003|ref|XP_002176754.1| predicted protein [Phaeodactylu...    96   1e-17   Phaeodactylum tricornutum CCAP 1055/1
gi|255082432|ref|XP_002504202.1| integral membrane peroxisomal p...    96   1e-17   Micromonas commoda
gi|512909408|ref|XP_004901585.1| PREDICTED: peroxisomal biogenes...    96   1e-17   
gi|30584565|gb|AAP36535.1| Homo sapiens peroxisomal farnesylated...    96   1e-17   synthetic construct
gi|4506339|ref|NP_002848.1| peroxisomal biogenesis factor 19 iso...    96   2e-17   Homo sapiens [man]
gi|348561630|ref|XP_003466615.1| PREDICTED: peroxisomal biogenes...    96   2e-17   Cavia porcellus [guinea pig]
gi|426332321|ref|XP_004027754.1| PREDICTED: peroxisomal biogenes...    96   2e-17   Gorilla gorilla gorilla [lowland gorilla]
gi|403294001|ref|XP_003937996.1| PREDICTED: peroxisomal biogenes...    96   2e-17   Saimiri boliviensis boliviensis
gi|326475478|gb|EGD99487.1| hypothetical protein TESG_06919 [Tri...    96   2e-17   Trichophyton tonsurans CBS 112818
gi|171693789|ref|XP_001911819.1| hypothetical protein [Podospora...    96   2e-17   Podospora anserina S mat+
gi|77736027|ref|NP_001029712.1| peroxisomal biogenesis factor 19...    96   2e-17   Bos taurus [bovine]
gi|399165265|emb|CCE33876.1| related to PEX19 protein [Claviceps...    95   2e-17   Claviceps purpurea 20.1
gi|472377001|ref|XP_004407934.1| PREDICTED: peroxisomal biogenes...    95   2e-17   Odobenus rosmarus divergens
gi|225681772|gb|EEH20056.1| predicted protein [Paracoccidioides ...    95   2e-17   Paracoccidioides brasiliensis Pb03
gi|281346470|gb|EFB22054.1| hypothetical protein PANDA_018451 [A...    95   2e-17   Ailuropoda melanoleuca
gi|465963149|gb|EMP30006.1| Peroxisomal biogenesis factor 19, pa...    95   2e-17   Chelonia mydas [green seaturtle]
gi|194210541|ref|XP_001491475.2| PREDICTED: peroxisomal biogenes...    95   2e-17   
gi|149040724|gb|EDL94681.1| rCG20208, isoform CRA_c [Rattus norv...    95   2e-17   Rattus norvegicus [brown rat]
gi|125540572|gb|EAY86967.1| hypothetical protein OsI_08359 [Oryz...    95   2e-17   Oryza sativa Indica Group [Indian rice]
gi|302912783|ref|XP_003050776.1| hypothetical protein NECHADRAFT...    95   3e-17   Nectria haematococca mpVI 77-13-4
gi|482557247|gb|EOA21439.1| hypothetical protein CARUB_v10001820...    95   3e-17   Capsella rubella
gi|225426981|ref|XP_002269360.1| PREDICTED: peroxisome biogenesi...    95   3e-17   Vitis vinifera
gi|507683221|ref|XP_004639989.1| PREDICTED: peroxisomal biogenes...    94   3e-17   Octodon degus
gi|504154358|ref|XP_004589137.1| PREDICTED: peroxisomal biogenes...    94   3e-17   Ochotona princeps [southern American pika]
gi|482567131|gb|EOA31320.1| hypothetical protein CARUB_v10014492...    94   3e-17   Capsella rubella
gi|258563966|ref|XP_002582728.1| predicted protein [Uncinocarpus...    94   3e-17   Uncinocarpus reesii 1704
gi|482815476|gb|EOA92151.1| hypothetical protein SETTUDRAFT_3062...    94   4e-17   Setosphaeria turcica Et28A
gi|197102946|ref|NP_001126269.1| peroxisomal biogenesis factor 1...    94   4e-17   Pongo abelii [Orang-utan]
gi|330934877|ref|XP_003304745.1| hypothetical protein PTT_17403 ...    94   4e-17   Pyrenophora teres f. teres 0-1
gi|511913139|ref|XP_004775906.1| PREDICTED: peroxisomal biogenes...    94   4e-17   Mustela putorius furo [black ferret]
gi|255576048|ref|XP_002528919.1| Peroxisomal biogenesis factor, ...    94   4e-17   Ricinus communis
gi|426216943|ref|XP_004002716.1| PREDICTED: peroxisomal biogenes...    94   4e-17   
gi|332219221|ref|XP_003258755.1| PREDICTED: peroxisomal biogenes...    94   4e-17   Nomascus leucogenys [White-cheeked Gibbon]
gi|302422286|ref|XP_003008973.1| Pex19 family protein [Verticill...    94   4e-17   Verticillium alfalfae VaMs.102
gi|389742825|gb|EIM84011.1| Pex19-domain-containing protein [Ste...    94   4e-17   Stereum hirsutum FP-91666 SS1
gi|466081201|ref|XP_004284481.1| PREDICTED: peroxisomal biogenes...    94   5e-17   
gi|189195650|ref|XP_001934163.1| peroxin [Pyrenophora tritici-re...    94   5e-17   Pyrenophora tritici-repentis Pt-1C-BFP
gi|149040726|gb|EDL94683.1| rCG20208, isoform CRA_e [Rattus norv...    94   6e-17   Rattus norvegicus [brown rat]
gi|149040728|gb|EDL94685.1| rCG20208, isoform CRA_g [Rattus norv...    94   6e-17   Rattus norvegicus [brown rat]
gi|149040722|gb|EDL94679.1| rCG20208, isoform CRA_a [Rattus norv...    94   6e-17   Rattus norvegicus [brown rat]
gi|311254007|ref|XP_003125714.1| PREDICTED: peroxisomal biogenes...    94   6e-17   
gi|410986681|ref|XP_003999638.1| PREDICTED: peroxisomal biogenes...    94   6e-17   
gi|254569068|ref|XP_002491644.1| PEX19; peroxisomal biogenesis p...    94   6e-17   Komagataella phaffii GS115
gi|198041740|ref|NP_001128249.1| peroxisomal biogenesis factor 1...    94   6e-17   Rattus norvegicus [brown rat]
gi|302497699|ref|XP_003010849.1| peroxisomal membrane protein re...    94   6e-17   Arthroderma benhamiae CBS 112371
gi|357136887|ref|XP_003570034.1| PREDICTED: peroxisome biogenesi...    94   7e-17   Brachypodium distachyon [annual false brome]
gi|226289027|gb|EEH44539.1| hypothetical protein PADG_00828 [Par...    94   7e-17   Paracoccidioides brasiliensis Pb18
gi|149238602|ref|XP_001525177.1| conserved hypothetical protein ...    94   7e-17   Lodderomyces elongisporus NRRL YB-4239
gi|348690224|gb|EGZ30038.1| hypothetical protein PHYSODRAFT_3101...    93   7e-17   Phytophthora sojae
gi|327296093|ref|XP_003232741.1| hypothetical protein TERG_06732...    93   7e-17   Trichophyton rubrum CBS 118892
gi|478537472|ref|XP_004442850.1| PREDICTED: peroxisomal biogenes...    93   7e-17   
gi|302782856|ref|XP_002973201.1| hypothetical protein SELMODRAFT...    93   7e-17   Selaginella moellendorffii
gi|471417482|ref|XP_004390250.1| PREDICTED: peroxisomal biogenes...    93   8e-17   Trichechus manatus latirostris
gi|291397628|ref|XP_002715312.1| PREDICTED: DDB1 and CUL4 associ...    93   8e-17   
gi|239607086|gb|EEQ84073.1| peroxisomal membrane protein recepto...    93   9e-17   Blastomyces dermatitidis ER-3
gi|507964728|ref|XP_004688436.1| PREDICTED: peroxisomal biogenes...    93   9e-17   Condylura cristata
gi|149040725|gb|EDL94682.1| rCG20208, isoform CRA_d [Rattus norv...    93   9e-17   Rattus norvegicus [brown rat]
gi|261201137|ref|XP_002626969.1| peroxisomal membrane protein re...    93   9e-17   Blastomyces gilchristii SLH14081
gi|156381001|ref|XP_001632055.1| predicted protein [Nematostella...    93   1e-16   Nematostella vectensis
gi|403294003|ref|XP_003937997.1| PREDICTED: peroxisomal biogenes...    93   1e-16   Saimiri boliviensis boliviensis
gi|18418341|ref|NP_568351.1| peroxin 19-2 [Arabidopsis thaliana]...    93   1e-16   Arabidopsis thaliana [mouse-ear cress]
gi|354546206|emb|CCE42935.1| hypothetical protein CPAR2_205780 [...    92   1e-16   Candida parapsilosis
gi|9755780|emb|CAC01899.1| putative protein [Arabidopsis thaliana]     92   1e-16   Arabidopsis thaliana [mouse-ear cress]
gi|114560657|ref|XP_001171897.1| PREDICTED: peroxisomal biogenes...    92   1e-16   
gi|426332323|ref|XP_004027755.1| PREDICTED: peroxisomal biogenes...    92   1e-16   Gorilla gorilla gorilla [lowland gorilla]
gi|302370946|ref|NP_001180573.1| peroxisomal biogenesis factor 1...    92   1e-16   Homo sapiens [man]
gi|488512881|ref|XP_004448483.1| PREDICTED: DDB1- and CUL4-assoc...    92   1e-16   
gi|148707090|gb|EDL39037.1| peroxisome biogenesis factor 19, iso...    92   1e-16   Mus musculus [mouse]
gi|310793518|gb|EFQ28979.1| Pex19 protein family [Glomerella gra...    92   2e-16   Colletotrichum graminicola M1.001
gi|297811905|ref|XP_002873836.1| peroxisomal protein PEX19 famil...    92   2e-16   Arabidopsis lyrata subsp. lyrata
gi|302789762|ref|XP_002976649.1| hypothetical protein SELMODRAFT...    92   2e-16   Selaginella moellendorffii
gi|119187471|ref|XP_001244342.1| hypothetical protein CIMG_03783...    92   3e-16   
gi|148707093|gb|EDL39040.1| peroxisome biogenesis factor 19, iso...    91   3e-16   Mus musculus [mouse]
gi|501753966|emb|CCG82505.1| Putative uncharacterized protein [T...    91   3e-16   Taphrina deformans PYCC 5710
gi|348561632|ref|XP_003466616.1| PREDICTED: peroxisomal biogenes...    91   3e-16   
gi|332219223|ref|XP_003258756.1| PREDICTED: peroxisomal biogenes...    91   3e-16   Nomascus leucogenys [White-cheeked Gibbon]
gi|260946193|ref|XP_002617394.1| hypothetical protein CLUG_02838...    91   3e-16   Clavispora lusitaniae ATCC 42720
gi|504154362|ref|XP_004589139.1| PREDICTED: peroxisomal biogenes...    91   4e-16   Ochotona princeps [southern American pika]
gi|429854412|gb|ELA29427.1| pex19 family protein [Colletotrichum...    91   4e-16   Colletotrichum gloeosporioides Nara gc5
gi|350537351|ref|NP_001233665.1| peroxisomal biogenesis factor 1...    91   4e-16   Cricetulus griseus [Chinese hamsters]
gi|504154360|ref|XP_004589138.1| PREDICTED: peroxisomal biogenes...    91   4e-16   Ochotona princeps [southern American pika]
gi|507964731|ref|XP_004688437.1| PREDICTED: peroxisomal biogenes...    91   5e-16   
gi|301119633|ref|XP_002907544.1| conserved hypothetical protein ...    91   5e-16   Phytophthora infestans T30-4
gi|388857018|emb|CCF49438.1| related to PEX19-required for bioge...    91   5e-16   Ustilago hordei
gi|302673959|ref|XP_003026665.1| hypothetical protein SCHCODRAFT...    91   5e-16   Schizophyllum commune H4-8
gi|385302922|gb|EIF47027.1| putative peroxisomal biogenesis prot...    91   5e-16   Brettanomyces bruxellensis AWRI1499
gi|426216945|ref|XP_004002717.1| PREDICTED: peroxisomal biogenes...    91   5e-16   
gi|71023173|ref|XP_761816.1| hypothetical protein UM05669.1 [Ust...    91   5e-16   
gi|145232863|ref|XP_001399804.1| peroxisomal membrane protein re...    91   6e-16   Aspergillus niger CBS 513.88
gi|471874247|emb|CCO36074.1| Peroxisome biogenesis protein 19-1 ...    91   6e-16   Rhizoctonia solani AG-1 IB
gi|471882858|emb|CCO34151.1| Peroxisome biogenesis protein 19-1 ...    91   6e-16   Rhizoctonia solani AG-1 IB
gi|471417484|ref|XP_004390251.1| PREDICTED: peroxisomal biogenes...    90   6e-16   Trichechus manatus latirostris
gi|507575252|ref|XP_004671171.1| PREDICTED: peroxisomal biogenes...    90   7e-16   Jaculus jaculus
gi|407928582|gb|EKG21436.1| Pex19 protein [Macrophomina phaseoli...    90   7e-16   Macrophomina phaseolina MS6
gi|358365473|dbj|GAA82095.1| peroxisomal membrane protein recept...    90   7e-16   Aspergillus kawachii IFO 4308
gi|297280448|ref|XP_002808293.1| PREDICTED: LOW QUALITY PROTEIN:...    90   8e-16   
gi|402856799|ref|XP_003892967.1| PREDICTED: LOW QUALITY PROTEIN:...    90   8e-16   
gi|168062621|ref|XP_001783277.1| predicted protein [Physcomitrel...    90   8e-16   Physcomitrella patens
gi|512909419|ref|XP_004901587.1| PREDICTED: peroxisomal biogenes...    90   9e-16   
gi|226958492|ref|NP_001152997.1| peroxisomal biogenesis factor 1...    90   9e-16   Mus musculus [mouse]
gi|403294005|ref|XP_003937998.1| PREDICTED: peroxisomal biogenes...    90   9e-16   
gi|344303666|gb|EGW33915.1| hypothetical protein SPAPADRAFT_5928...    89   1e-15   Spathaspora passalidarum NRRL Y-27907
gi|470431848|ref|XP_004338438.1| peroxisomal biogenesis protein ...    89   1e-15   Acanthamoeba castellanii str. Neff
gi|397611570|gb|EJK61386.1| hypothetical protein THAOC_18139 [Th...    89   1e-15   Thalassiosira oceanica
gi|332810931|ref|XP_003308595.1| PREDICTED: peroxisomal biogenes...    89   1e-15   Pan troglodytes
gi|452984447|gb|EME84204.1| hypothetical protein MYCFIDRAFT_2146...    89   1e-15   Cercospora fijiensis CIRAD86
gi|302799914|ref|XP_002981715.1| hypothetical protein SELMODRAFT...    89   1e-15   Selaginella moellendorffii
gi|169770665|ref|XP_001819802.1| peroxisomal membrane protein re...    89   2e-15   Aspergillus oryzae RIB40
gi|345479326|ref|XP_003423927.1| PREDICTED: peroxisomal biogenes...    89   2e-15   Nasonia vitripennis
gi|426193340|gb|EKV43274.1| hypothetical protein AGABI2DRAFT_195...    89   2e-15   Agaricus bisporus var. bisporus H97
gi|432119419|gb|ELK38494.1| Peroxisomal biogenesis factor 19 [My...    89   2e-15   Myotis davidii
gi|345479328|ref|XP_001605956.2| PREDICTED: peroxisomal biogenes...    88   2e-15   
gi|507683229|ref|XP_004639991.1| PREDICTED: peroxisomal biogenes...    88   2e-15   Octodon degus
gi|325183213|emb|CCA17672.1| conserved hypothetical protein [Alb...    88   2e-15   Albugo laibachii Nc14
gi|225560179|gb|EEH08461.1| peroxin 19 [Ajellomyces capsulatus G...    88   2e-15   Histoplasma capsulatum G186AR
gi|332219225|ref|XP_003258757.1| PREDICTED: peroxisomal biogenes...    88   3e-15   Nomascus leucogenys [White-cheeked Gibbon]
gi|343426037|emb|CBQ69569.1| related to PEX19-required for bioge...    88   3e-15   Sporisorium reilianum SRZ2
gi|241959266|ref|XP_002422352.1| peroxisomal (biogenesis) protei...    88   3e-15   Candida dubliniensis CD36
gi|507706896|ref|XP_004716565.1| PREDICTED: peroxisomal biogenes...    88   3e-15   Echinops telfairi [lesser hedgehog tenrec]
gi|380491040|emb|CCF35598.1| Pex19 protein family [Colletotrichu...    88   3e-15   Colletotrichum higginsianum
gi|501305535|dbj|GAC94659.1| hypothetical protein PHSY_002232 [P...    88   4e-15   Pseudozyma hubeiensis SY62
gi|507683225|ref|XP_004639990.1| PREDICTED: peroxisomal biogenes...    87   4e-15   Octodon degus
gi|409077470|gb|EKM77836.1| hypothetical protein AGABI1DRAFT_115...    87   4e-15   Agaricus bisporus var. burnettii JB137-S8
gi|50408932|ref|XP_456824.1| DEHA2A11308p [Debaryomyces hansenii...    87   4e-15   Debaryomyces hansenii CBS767
gi|410033975|ref|XP_003949663.1| PREDICTED: peroxisomal biogenes...    87   4e-15   
gi|299688794|pdb|2WL8|A Chain A, X-Ray Crystal Structure Of Pex1...    87   5e-15   Homo sapiens [man]
gi|470363857|ref|XP_004365730.1| predicted protein [Capsaspora o...    87   5e-15   Capsaspora owczarzaki ATCC 30864
gi|296229369|ref|XP_002807741.1| PREDICTED: LOW QUALITY PROTEIN:...    87   5e-15   
gi|344286976|ref|XP_003415232.1| PREDICTED: LOW QUALITY PROTEIN:...    87   5e-15   Loxodonta africana [African bush elephant]
gi|507706904|ref|XP_004716567.1| PREDICTED: peroxisomal biogenes...    87   6e-15   Echinops telfairi [lesser hedgehog tenrec]
gi|147907142|ref|NP_001089075.1| peroxisomal biogenesis factor 1...    87   7e-15   Xenopus laevis [clawed frog]
gi|115396316|ref|XP_001213797.1| conserved hypothetical protein ...    87   7e-15   Aspergillus terreus NIH2624
gi|410929794|ref|XP_003978284.1| PREDICTED: peroxisomal biogenes...    87   7e-15   Takifugu rubripes [tiger puffer]
gi|62026746|gb|AAH92106.1| LOC733180 protein [Xenopus laevis]          87   7e-15   Xenopus laevis [clawed frog]
gi|303317004|ref|XP_003068504.1| hypothetical protein CPC735_005...    87   7e-15   Coccidioides posadasii C735 delta SOWgp
gi|398389314|ref|XP_003848118.1| hypothetical protein MYCGRDRAFT...    87   8e-15   Zymoseptoria tritici IPO323
gi|238880254|gb|EEQ43892.1| conserved hypothetical protein [Cand...    86   9e-15   Candida albicans WO-1
gi|169604238|ref|XP_001795540.1| hypothetical protein SNOG_20052...    86   1e-14   Parastagonospora nodorum SN15
gi|194861361|ref|XP_001969767.1| GG23764 [Drosophila erecta] >gi...    86   1e-14   Drosophila erecta
gi|240278927|gb|EER42433.1| peroxin 19 [Ajellomyces capsulatus H...    86   1e-14   Histoplasma capsulatum H143
gi|62899043|ref|NP_001017399.1| peroxisomal biogenesis factor 19...    86   1e-14   Danio rerio [leopard danio]
gi|449301708|gb|EMC97719.1| hypothetical protein BAUCODRAFT_6815...    86   1e-14   Baudoinia panamericana UAMH 10762
gi|34784026|gb|AAH56815.1| Pex19 protein [Danio rerio]                 86   1e-14   Danio rerio [leopard danio]
gi|453080565|gb|EMF08616.1| Pex19-domain-containing protein [Myc...    86   1e-14   
gi|67537458|ref|XP_662503.1| hypothetical protein AN4899.2 [Aspe...    86   1e-14   
gi|395531683|ref|XP_003767903.1| PREDICTED: peroxisomal biogenes...    85   2e-14   
gi|507706900|ref|XP_004716566.1| PREDICTED: peroxisomal biogenes...    85   2e-14   
gi|405120184|gb|AFR94955.1| peroxin19 Pex19p [Cryptococcus neofo...    85   2e-14   
gi|68479481|ref|XP_716272.1| potential peroxisomal biogenesis pr...    85   2e-14   
gi|154288146|ref|XP_001544868.1| predicted protein [Ajellomyces ...    85   2e-14   
gi|126307281|ref|XP_001379396.1| PREDICTED: peroxisomal biogenes...    85   2e-14   
gi|290973051|ref|XP_002669263.1| predicted protein [Naegleria gr...    85   3e-14   
gi|298713307|emb|CBJ27003.1| conserved unknown protein [Ectocarp...    85   3e-14   
gi|392586141|gb|EIW75478.1| Pex19 protein [Coniophora puteana RW...    84   3e-14   
gi|505840919|ref|XP_004613975.1| PREDICTED: DDB1- and CUL4-assoc...    84   3e-14   
gi|325090187|gb|EGC43497.1| peroxin 19 [Ajellomyces capsulatus H88]    84   4e-14   
gi|255942335|ref|XP_002561936.1| peroxin-19 Pex19-Penicillium ch...    84   4e-14   
gi|291231501|ref|XP_002735703.1| PREDICTED: peroxisomal biogenes...    84   4e-14   
gi|397481387|ref|XP_003811929.1| PREDICTED: DDB1- and CUL4-assoc...    84   5e-14   
gi|221040450|dbj|BAH11932.1| unnamed protein product [Homo sapiens]    84   5e-14   
gi|448114126|ref|XP_004202499.1| Piso0_001337 [Millerozyma farin...    84   7e-14   
gi|448111576|ref|XP_004201874.1| Piso0_001337 [Millerozyma farin...    84   7e-14   
gi|147898626|ref|NP_001088821.1| uncharacterized protein LOC4960...    84   7e-14   
gi|378729193|gb|EHY55652.1| hypothetical protein HMPREF1120_0378...    84   7e-14   
gi|187607321|ref|NP_001120089.1| peroxisomal biogenesis factor 1...    83   7e-14   
gi|302768781|ref|XP_002967810.1| hypothetical protein SELMODRAFT...    83   1e-13   
gi|432911339|ref|XP_004078631.1| PREDICTED: peroxisomal biogenes...    83   1e-13   
gi|307183485|gb|EFN70284.1| Peroxisomal biogenesis factor 19 [Ca...    82   2e-13   
gi|321257627|ref|XP_003193656.1| peroxisome biogenesis protein p...    82   2e-13   
gi|348519990|ref|XP_003447512.1| PREDICTED: peroxisomal biogenes...    82   2e-13   
gi|499002517|ref|XP_004555249.1| PREDICTED: peroxisomal biogenes...    82   3e-13   
gi|323457342|gb|EGB13208.1| hypothetical protein AURANDRAFT_1883...    82   3e-13   
gi|195350995|ref|XP_002042022.1| GM26722 [Drosophila sechellia] ...    81   3e-13   
gi|195578677|ref|XP_002079190.1| GD23815 [Drosophila simulans] >...    81   3e-13   
gi|443899910|dbj|GAC77238.1| 40 kDa farnesylated protein associa...    81   3e-13   
gi|126139191|ref|XP_001386118.1| 40 kDa farnesylated protein ass...    81   3e-13   
gi|17861924|gb|AAL39439.1| GM14611p [Drosophila melanogaster]          81   4e-13   
gi|225708730|gb|ACO10211.1| Peroxisomal biogenesis factor 19 [Ca...    81   4e-13   
gi|328775928|ref|XP_003249086.1| PREDICTED: peroxisomal biogenes...    81   4e-13   
gi|195472309|ref|XP_002088443.1| GE18569 [Drosophila yakuba] >gi...    81   4e-13   
gi|359279996|gb|AEV12232.1| FI16608p1 [Drosophila melanogaster]        81   5e-13   
gi|24583827|ref|NP_609547.2| peroxin 19, isoform A [Drosophila m...    80   5e-13   
gi|94418627|gb|ABF18651.1| PEX19 chaperone-like protein [Candida...    80   5e-13   
gi|340722499|ref|XP_003399642.1| PREDICTED: peroxisomal biogenes...    80   6e-13   
gi|512905612|ref|XP_004925988.1| PREDICTED: peroxisomal biogenes...    80   7e-13   
gi|194765993|ref|XP_001965109.1| GF21559 [Drosophila ananassae] ...    80   8e-13   
gi|344234864|gb|EGV66732.1| Pex19 protein [Candida tenuis ATCC 1...    80   9e-13   
gi|344234863|gb|EGV66731.1| hypothetical protein CANTEDRAFT_1170...    80   9e-13   
gi|302848309|ref|XP_002955687.1| hypothetical protein VOLCADRAFT...    80   1e-12   
gi|452836578|gb|EME38522.1| hypothetical protein DOTSEDRAFT_7589...    80   1e-12   
gi|472380725|ref|XP_004409762.1| PREDICTED: peroxisomal biogenes...    79   1e-12   
gi|242023314|ref|XP_002432079.1| Peroxisomal biogenesis factor, ...    79   1e-12   
gi|94418631|gb|ABF18653.1| PEX19 chaperone-like protein [Candida...    79   2e-12   
gi|159488857|ref|XP_001702417.1| Pex19-like protein [Chlamydomon...    79   2e-12   
gi|401886939|gb|EJT50950.1| peroxisome biogenesis protein peroxi...    78   3e-12   
gi|406695351|gb|EKC98659.1| peroxisome biogenesis protein peroxi...    78   3e-12   
gi|50547523|ref|XP_501231.1| YALI0B22660p [Yarrowia lipolytica] ...    78   3e-12   
gi|428177214|gb|EKX46095.1| hypothetical protein GUITHDRAFT_7084...    78   4e-12   
gi|380014384|ref|XP_003691212.1| PREDICTED: LOW QUALITY PROTEIN:...    78   4e-12   
gi|164661395|ref|XP_001731820.1| hypothetical protein MGL_1088 [...    78   4e-12   
gi|505757855|gb|EOR01965.1| Peroxisome biosis protein 19-1 [Wall...    77   4e-12   
gi|195442998|ref|XP_002069226.1| GK21085 [Drosophila willistoni]...    77   4e-12   
gi|485927545|gb|EOD51520.1| putative pex19 protein [Neofusicoccu...    77   4e-12   
gi|195387882|ref|XP_002052621.1| GJ17649 [Drosophila virilis] >g...    77   5e-12   
gi|350418557|ref|XP_003491896.1| PREDICTED: peroxisomal biogenes...    77   5e-12   
gi|149040727|gb|EDL94684.1| rCG20208, isoform CRA_f [Rattus norv...    77   5e-12   
gi|94418625|gb|ABF18650.1| PEX19 chaperone-like protein [Candida...    77   6e-12   
gi|350418554|ref|XP_003491895.1| PREDICTED: peroxisomal biogenes...    77   6e-12   
gi|195114570|ref|XP_002001840.1| GI17065 [Drosophila mojavensis]...    77   6e-12   
gi|17553610|ref|NP_498947.1| Protein PRX-19 [Caenorhabditis eleg...    76   9e-12   
gi|332376091|gb|AEE63186.1| unknown [Dendroctonus ponderosae]          76   1e-11   
gi|498960532|ref|XP_004524655.1| PREDICTED: peroxisomal biogenes...    76   1e-11   
gi|157108222|ref|XP_001650131.1| house keepingprotein, putative ...    76   1e-11   
gi|148707092|gb|EDL39039.1| peroxisome biogenesis factor 19, iso...    76   1e-11   
gi|193591710|ref|XP_001944784.1| PREDICTED: peroxisomal biogenes...    76   1e-11   
gi|157108224|ref|XP_001650132.1| house keepingprotein, putative ...    76   1e-11   
gi|125986768|ref|XP_001357147.1| GA18805 [Drosophila pseudoobscu...    75   2e-11   
gi|91084677|ref|XP_968216.1| PREDICTED: similar to house keeping...    75   2e-11   
gi|312372781|gb|EFR20667.1| hypothetical protein AND_19715 [Anop...    75   2e-11   
gi|308471851|ref|XP_003098155.1| CRE-PRX-19 protein [Caenorhabdi...    75   2e-11   
gi|224011132|ref|XP_002294523.1| predicted protein [Thalassiosir...    75   2e-11   
gi|357617828|gb|EHJ71014.1| peroxisomal biogenesis factor 19 [Da...    75   3e-11   
gi|511913135|ref|XP_004775904.1| PREDICTED: peroxisomal biogenes...    74   4e-11   
gi|195160034|ref|XP_002020881.1| GL16215 [Drosophila persimilis]...    74   4e-11   
gi|198419988|ref|XP_002126808.1| PREDICTED: peroxisomal biogenes...    74   4e-11   
gi|255727747|ref|XP_002548799.1| hypothetical protein CTRG_03096...    74   5e-11   
gi|332022765|gb|EGI63039.1| Peroxisomal biogenesis factor 19 [Ac...    74   7e-11   
gi|478251874|gb|ENN72313.1| hypothetical protein YQE_11056, part...    74   7e-11   
gi|511913137|ref|XP_004775905.1| PREDICTED: peroxisomal biogenes...    74   7e-11   
gi|322800267|gb|EFZ21297.1| hypothetical protein SINV_08080 [Sol...    73   9e-11   
gi|389610181|dbj|BAM18702.1| peroxisomal farnesylated protein [P...    73   9e-11   


>gi|384490290|gb|EIE81512.1| hypothetical protein RO3G_06217 [Rhizopus delemar RA 99-880]
          Length = 277

 Score =  167 bits (424), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 99/246 (40%), Positives = 145/246 (58%), Gaps = 29/246 (11%)

Query: 68  DEYVKLLTADMEDFVKEFD-ENELSIAMQGLMKNFGEVDEDNLNGTDFDNTGRSTVESNG 126
           DE+ K L A MED + +F+ E EL    + +  +     E N          R   +++ 
Sbjct: 56  DEFAKQLAAGMEDLMGQFEKEGELKDTFEKVWASLDNTPEKN----------REASKASP 105

Query: 127 TSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIM-EMMKQIENMANLSGFAENDFEEMFG 185
            SFQ+ I +TMNKL++SS+++D+ I + S D  M E+MKQ+E++A+              
Sbjct: 106 QSFQEAIGKTMNKLKDSSKEIDSSIAEDSEDAFMAELMKQMESLAD-------------- 151

Query: 186 SGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINK 245
           +G  E +LE MM  L +K+ LYEPMK+ AQKYP+WLE+NK KV  EDY +Y +Q     +
Sbjct: 152 NGEFESVLEGMMSQLMSKELLYEPMKDLAQKYPEWLENNKDKVKAEDYDKYRQQQTICQQ 211

Query: 246 IIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMEL-NEQGIP--SDL 302
           I+  Y+APDFD  NE Q K + +LM ++Q+ GQPP E+L+E+APGM   N   +P   DL
Sbjct: 212 IVAVYEAPDFDEKNEAQAKKVTDLMTKMQDLGQPPSELLDEMAPGMNFGNPNAVPDMKDL 271

Query: 303 TSCKNM 308
            +C  M
Sbjct: 272 ENCNIM 277



>gi|384500881|gb|EIE91372.1| hypothetical protein RO3G_16083 [Rhizopus delemar RA 99-880]
          Length = 272

 Score =  154 bits (390), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 100/249 (40%), Positives = 150/249 (60%), Gaps = 33/249 (13%)

Query: 67  DDEYVKLLTADMEDFVKEFDENELSIAMQGLMKNFGEVDEDNLNGTDFDNTGRSTVESNG 126
           +DE+ K L A ME  + +F++       +G MKN  E   D+     FD   ++   S  
Sbjct: 50  NDEFAKQLAAGMEHLMGQFEQ-------EGEMKNTFEKVWDS-----FDTPEKNREASKA 97

Query: 127 T---SFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIM-EMMKQIENMANLSGFAENDFEE 182
           T   SFQ+ I +TM+KL++SS+++D+ I + S +  M E+MKQ+E++A+           
Sbjct: 98  TQPQSFQEAIGKTMDKLKDSSKEIDSSIAEDSEEAFMAELMKQMESLAD----------- 146

Query: 183 MFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEY 242
              +G  E +LE MM  L +K+ LYEPMK+ +QKYP+WLE+NK KV  EDYA+Y +Q   
Sbjct: 147 ---NGEFENVLEGMMSQLMSKELLYEPMKDLSQKYPEWLENNKDKVKAEDYAKYRQQQVI 203

Query: 243 INKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMEL-NEQGIP-- 299
             +I+  Y+APDFD  NE Q K +++LM ++Q+ GQPP E+L+E+APGM   N   +P  
Sbjct: 204 WQQIVAIYEAPDFDEKNEVQAKNVMDLMTKMQDLGQPPAELLDEMAPGMNFGNPNAVPDI 263

Query: 300 SDLTSCKNM 308
            DL +C  M
Sbjct: 264 KDLENCNVM 272



>gi|511005447|gb|EPB86787.1| hypothetical protein HMPREF1544_06403 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 316

 Score =  153 bits (387), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 83/185 (44%), Positives = 121/185 (65%), Gaps = 18/185 (9%)

Query: 128 SFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIM-EMMKQIENMANLSGFAENDFEEMFGS 186
           SFQD I +TMNKL++SS+++D+ I + S D  M E+MKQ+E++A+              +
Sbjct: 146 SFQDTIGKTMNKLKDSSKEIDSSIAEESEDAFMAELMKQMESLAD--------------N 191

Query: 187 GGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKI 246
           G  E +LE MM  L +K+ LYEPMK+ AQKYP WLE++K      DY +Y++Q     +I
Sbjct: 192 GEFEGVLEGMMSQLMSKELLYEPMKDLAQKYPAWLEEHKDTADKADYEKYKQQHVICQQI 251

Query: 247 IEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMEL-NEQGIP--SDLT 303
           + KY+AP+FD  NE Q K I++LM ++Q+ GQPP E+L+E+APGM   N +G+P   DL 
Sbjct: 252 VAKYEAPNFDEKNEAQGKEIMDLMTKMQDLGQPPAELLDEMAPGMNFGNPEGMPDMKDLE 311

Query: 304 SCKNM 308
           +C  M
Sbjct: 312 NCNIM 316



>gi|358055238|dbj|GAA98746.1| hypothetical protein E5Q_05434 [Mixia osmundae IAM 14324]
          Length = 348

 Score =  133 bits (335), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 71/183 (38%), Positives = 109/183 (59%), Gaps = 22/183 (12%)

Query: 129 FQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEMFGSGG 188
           FQ+ I QTM KL+ SS+ + A++   SND +  ++ Q                 M GSG 
Sbjct: 185 FQETIRQTMEKLKGSSDSVKADLDATSNDPMAALLAQ-----------------MSGSGS 227

Query: 189 MEKM---LESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINK 245
            E++   +ESMM  L +KD LYEP+KE + KYP+WL DN+ K+   +  RY  Q E +++
Sbjct: 228 EEELQAAIESMMGQLMSKDLLYEPLKELSTKYPQWLRDNESKIEASEVQRYRAQQEVVDE 287

Query: 246 IIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQGIPSDLTSC 305
           I+  Y++P F+ ++E Q K I+ LM ++QE G PP E++ E+ PGM L+   +PSD+ +C
Sbjct: 288 IVRSYESPKFNDDDEAQQKHIVELMSKMQESGAPPTELMGEMPPGMNLDN--LPSDMENC 345

Query: 306 KNM 308
             M
Sbjct: 346 TIM 348



>gi|345561577|gb|EGX44665.1| hypothetical protein AOL_s00188g3 [Arthrobotrys oligospora ATCC
           24927]
          Length = 376

 Score =  123 bits (309), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 79/255 (30%), Positives = 132/255 (51%), Gaps = 30/255 (11%)

Query: 66  LDDEYVKLLTADMEDFVKEFDEN-----ELSIAMQGLMKNFGEVDEDNLNGTDFDNTGRS 120
           LDD++ K L   M D +KE +E+     +    +Q L K+ G       NG    +T  +
Sbjct: 134 LDDDFAKQLQQGMADLLKEMEESPEFQAQFDSLVQELDKSAGSAPNPPGNGKGAMSTPGT 193

Query: 121 T---------VESNGTSFQDKINQTMNKLQNSSEQLDAEIIDG-SNDQIMEMMKQIENMA 170
           +         V    +SF D I +TM +++ S  ++D E+ D  S+D + EM++Q++   
Sbjct: 194 SERQPQIDDEVAQGASSFHDTIAKTMERMKESGAEIDTEMADSQSDDFLAEMLRQMQTTT 253

Query: 171 NLSGFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPP 230
              G ++ DF          KML  MME L  K+ LYEPMKE  +K+P WL +N+GK   
Sbjct: 254 GRGG-SDEDFS---------KMLMGMMEQLTNKEILYEPMKELDEKFPNWLVENEGKHSA 303

Query: 231 EDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPG 290
           E+   + +Q+  + +I+ K++ P F  ++E   + I+  MQ++Q  G PP E+L ++  G
Sbjct: 304 EEMDNFREQARLVREIVMKFEQPSFSDSSEIDREYIVERMQKMQAVGSPPAELLGDMGQG 363

Query: 291 MELNEQGIPSDLTSC 305
                 G+P D+ +C
Sbjct: 364 -----DGLPPDIENC 373



>gi|296410832|ref|XP_002835139.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295627914|emb|CAZ79260.1| unnamed protein product [Tuber melanosporum]
          Length = 288

 Score =  119 bits (299), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 77/243 (31%), Positives = 131/243 (53%), Gaps = 19/243 (7%)

Query: 66  LDDEYVKLLTADMEDFVKEF-DENELSIAMQGLMKNFGEVDEDNLNGTDFDNTGRSTVES 124
           LDD++ + L   M+D + E  D  EL    + L+K   +      +      +     + 
Sbjct: 59  LDDDFARQLQLGMQDLLGEMQDSKELQDQFEHLVKELNDATA-VPSPMPSAPSSSRPSDQ 117

Query: 125 NGTSFQDKINQTMNKLQNSSEQLDAEIIDG-SNDQIMEMMKQIENMANLSGFAENDFEEM 183
              +FQD+I QTM+++++S  ++DA +    + D + EM+KQ++  A   G ++ DF   
Sbjct: 118 AAANFQDRIKQTMDRMKSSGAEVDAAVAGSEAEDFLSEMLKQMQGAAG-EGESDEDFS-- 174

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
                  KML +MME L +K+ LYEPMKE  +KYP WL  N+ K P ED  +Y +Q   +
Sbjct: 175 -------KMLLNMMEQLTSKEILYEPMKELNEKYPDWLRSNESKQPAEDLQQYREQYGVV 227

Query: 244 NKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQGIPSDLT 303
            +I+ K++ P++   +++  + II+ MQ++Q  G PP E++ E+  G+      IP D+ 
Sbjct: 228 KEIVAKFEEPEYRDESDKDREFIIDRMQKMQAAGAPPTELMGEMGQGL-----SIPPDVD 282

Query: 304 S-C 305
           S C
Sbjct: 283 SNC 285



>gi|367025969|ref|XP_003662269.1| hypothetical protein MYCTH_2302721 [Myceliophthora thermophila ATCC
           42464]
 gi|347009537|gb|AEO57024.1| hypothetical protein MYCTH_2302721 [Myceliophthora thermophila ATCC
           42464]
          Length = 326

 Score =  118 bits (296), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 77/234 (32%), Positives = 125/234 (53%), Gaps = 25/234 (10%)

Query: 67  DDEYVKLLTADMEDFVKEFDEN-ELSIAMQGLMKNFGEVDEDN-----------LNGTDF 114
           ++E+ + L A M D + E +++ E+    + + K  G     N             G+  
Sbjct: 88  EEEFARQLQAGMADLLGELEKSPEMQAQFESIFKELGAAASANADPASSAPTPPAAGSSS 147

Query: 115 DNTGRSTVESNGTSFQDKINQTMNKLQNSSEQLDAEII-DGSNDQIMEMMKQIENMANLS 173
             +G +  E+   SFQ+ I +TM ++Q S EQ  A    +GS+D + E++KQ++N     
Sbjct: 148 SKSGPTGAEA---SFQETIRRTMERMQASGEQATAAAAAEGSDDFLAELLKQMQN----G 200

Query: 174 GFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDY 233
           GF     EE F      KML  MME L  K+ LYEPMKE   K+P+WLE N+ K P E++
Sbjct: 201 GFDGEGSEEEFS-----KMLMGMMEQLTNKEILYEPMKELDDKFPEWLEKNRDKTPAEEF 255

Query: 234 ARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNEL 287
            RYE+Q   + +I+ K++ P F  +N    + I++ MQ++Q  G PP +++ E+
Sbjct: 256 KRYEEQQVLVREIVRKFEEPTFSDSNAADREYIVDRMQKMQASGSPPSDLVGEM 309



>gi|440634411|gb|ELR04330.1| hypothetical protein GMDG_06712 [Geomyces destructans 20631-21]
          Length = 346

 Score =  118 bits (295), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 85/257 (33%), Positives = 127/257 (49%), Gaps = 22/257 (8%)

Query: 56  SRDQADLPSQLDDEYVKLLTADMEDFVKEFDEN-ELSIAMQGLMKNF----GEVDEDNLN 110
           S + ADL    ++++ K L ADM + +   + N EL+   + +M       GE   D   
Sbjct: 95  SDEMADLNGMSEEDFAKHLQADMANLLGGMNSNPELAAQFKEMMSKIATEGGEGPGDFGA 154

Query: 111 GTD----FDNTGRSTVESNGT-SFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIM-EMMK 164
             D    +  + +S   S    SFQD I +TM K+Q S EQ  A   +   D I+ E+MK
Sbjct: 155 HPDAAGAYQQSAKSAAPSTAEESFQDTIRKTMEKIQASGEQATAACKEEDTDDILAELMK 214

Query: 165 QIENMANLSGFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDN 224
           Q+++        E DF          KML  MME L  KD LYEPMKE   K+P W+E N
Sbjct: 215 QMQSSGLGGEGGEEDFS---------KMLLGMMEQLTNKDILYEPMKELHDKFPAWMEKN 265

Query: 225 KGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEIL 284
           K     ED  RYE+Q + + +I++K++ P +   +    + I+ LMQ +Q  G PP +++
Sbjct: 266 KAATSKEDLKRYEEQQKVVAEIVKKFEEPTYTDASPTDREYIVGLMQLMQAAGSPPSDLV 325

Query: 285 NELAPGMELNEQGIPSD 301
            ++A   E    G P D
Sbjct: 326 GDMASAQEAF--GAPPD 340



>gi|170093734|ref|XP_001878088.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164646542|gb|EDR10787.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 332

 Score =  117 bits (293), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 99/175 (56%), Gaps = 9/175 (5%)

Query: 120 STVESNGTSFQDKINQTMNKLQNSSEQL--DAEIIDGSNDQIMEMMKQIENMANLSGFAE 177
           +T E  G  FQDKI Q M+KL+ S   L  D+   D ++ + +E + +        G   
Sbjct: 151 TTAEGAGGGFQDKIKQAMDKLKESETNLQGDSSTADTTSPESLEALLKSLGDLGGLGEGG 210

Query: 178 NDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYE 237
           ++ E       +   LE+MM  L +K+ LYEP+KE A+ +P +L +    + PED +RYE
Sbjct: 211 DENE-------LAGFLETMMGQLMSKEVLYEPLKELAEGFPPYLTNPPSPLSPEDRSRYE 263

Query: 238 KQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGME 292
           KQ E + +I+  +D P +   NE+ NK I++LM E+Q +G PP EI+  L PG++
Sbjct: 264 KQEECVKRILAVFDKPGYSDANEESNKVIVDLMSEMQSYGSPPAEIMGPLPPGLD 318



>gi|494825658|gb|EON62812.1| hypothetical protein W97_02037 [Coniosporium apollinis CBS 100218]
          Length = 319

 Score =  116 bits (290), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 71/239 (29%), Positives = 121/239 (50%), Gaps = 29/239 (12%)

Query: 67  DDEYVKLLTADMEDFVKEFDEN-ELSIAMQGLMKN-------------FGEVDEDNLNGT 112
           +D++ + L A M D + E + + E+    + L+K               G++ E   +  
Sbjct: 71  EDDFARQLQAGMADLLGELESSPEMQKQFEELVKGLGEAAVAGAAGSETGQIPEVTASAA 130

Query: 113 DFDNTGR----STVESNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIE- 167
                G+    S  ++   SFQ++I +TM+++Q+SS   D     G++D + +++K++E 
Sbjct: 131 QAPTAGKEKAGSAAKAAEDSFQEQIRKTMDRMQHSSSTADTAAASGADDPLAQLLKEMEA 190

Query: 168 -NMANLSGFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKG 226
            N     G  + DF          KML  MME L  K+ LYEPMKE   K+P+WLE NK 
Sbjct: 191 GNFPGADGGGDEDFS---------KMLLGMMEQLTNKEILYEPMKELHDKFPEWLEKNKD 241

Query: 227 KVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILN 285
           K    D  RYE+Q   +N+I+ K++   +  +N    + I+  MQ++Q  G PPP+++ 
Sbjct: 242 KTDKGDLERYEEQQRLVNEIVGKFEEKGYSDDNAAHREYIVERMQKMQAAGSPPPDLVG 300



>gi|353240391|emb|CCA72263.1| related to PEX19 protein [Piriformospora indica DSM 11827]
          Length = 312

 Score =  115 bits (288), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 60/173 (34%), Positives = 100/173 (57%), Gaps = 13/173 (7%)

Query: 128 SFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEMFGSG 187
           +FQ+ +   M+KL+ S E   A++ +G    +            LS F+  +F+   G  
Sbjct: 145 AFQNAVKSAMDKLKKSDESNKADLNEGDLSSL------------LSAFSNLNFDGE-GGD 191

Query: 188 GMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKII 247
           G++ +LE++M  L +K+ LYEP+KE   K+P++LE N+  +  ED  RY+KQ   I+++I
Sbjct: 192 GVQGVLETLMGQLMSKEILYEPLKELNDKFPEYLETNRSLISTEDQVRYDKQKSIISEVI 251

Query: 248 EKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQGIPS 300
             +++PD+   N   +  II LM E+QE+G PP EI+  L PG ++   G+PS
Sbjct: 252 AIFESPDYSDTNPATSAEIIKLMSEMQEYGSPPAEIMGTLPPGFDVGSDGLPS 304



>gi|170103893|ref|XP_001883161.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164642042|gb|EDR06300.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 346

 Score =  115 bits (287), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 62/178 (34%), Positives = 98/178 (55%), Gaps = 9/178 (5%)

Query: 117 TGRSTVESNGTSFQDKINQTMNKLQNSSEQL--DAEIIDGSNDQIMEMMKQIENMANLSG 174
            G+ST       FQ+KI Q M+KL+ S   L  D+   D S+ + +E + +         
Sbjct: 162 VGKSTTAEGAGGFQEKIKQAMDKLKESESNLQGDSSTADASSPESLEALLKSLGGVGGLD 221

Query: 175 FAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYA 234
              ++ E       +   LE+MM  L +KD LYEP+KE A+ +P +L +   ++  ED +
Sbjct: 222 EGGDENE-------LAGFLETMMGQLMSKDVLYEPLKELAEGFPPYLTNPPAQLSLEDRS 274

Query: 235 RYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGME 292
           RYEKQ E + +I+  +D P +   NE+ NK I++LM E+Q +G PP EI+  L PG++
Sbjct: 275 RYEKQEECVKRILAVFDKPGYTDANEESNKIIVDLMSEMQSYGSPPAEIMGPLPPGLD 332



>gi|390596059|gb|EIN05462.1| Pex19 protein, partial [Punctularia strigosozonata HHB-11173 SS5]
          Length = 253

 Score =  114 bits (286), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 74/257 (28%), Positives = 122/257 (47%), Gaps = 28/257 (10%)

Query: 66  LDDEYVKLLTADMEDFVKEF---DENELSIAMQG--------------LMKNFGEVDEDN 108
           LD ++ +    +ME F+K+          +A  G              LM  +  +  + 
Sbjct: 5   LDSDFARAFAKEMESFMKDLGGQHPGATGVAGTGQEGGGESSDVEKERLMAAWEAMLVEG 64

Query: 109 LNGTDFDNTGRSTVESNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIEN 168
           +NG   +     TV +    FQ  I +TM+K++ S E L         D +  ++ Q++ 
Sbjct: 65  MNGMS-EGAPTGTVPAEDNDFQKTIRETMDKMKQSEEALKEADNAPPPDSLEALLAQLK- 122

Query: 169 MANLSGFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKV 228
           +   +G  E DF+          +LESMM  L +KD LYEP+KE   K+P +L +N  K+
Sbjct: 123 LDGENGETEEDFQ---------SILESMMTQLMSKDVLYEPLKELHDKFPDYLAENSAKL 173

Query: 229 PPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELA 288
              D  RYE+Q   + +I+E ++ P +   + Q+   I+ LM E+Q  G PPPEI+  L 
Sbjct: 174 STADKDRYERQYSCVQQIVEVFEDPSYSDEDAQKGTRIVTLMNEMQSHGSPPPEIMGPLP 233

Query: 289 PGMELNEQGIPSDLTSC 305
           PG+++   G+P     C
Sbjct: 234 PGLDVGPDGLPKLPDGC 250



>gi|340914950|gb|EGS18291.1| hypothetical protein CTHT_0063150 [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 361

 Score =  114 bits (284), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 63/168 (37%), Positives = 99/168 (58%), Gaps = 16/168 (9%)

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIM-EMMKQIENMANLSGFAENDFEE 182
           ++  SFQ+ I +T+ ++Q S EQ  A       D  + E++KQ+++ A            
Sbjct: 189 ADAASFQETIRKTIERMQQSGEQATAAAAAEGADDFLTELLKQMQSGA------------ 236

Query: 183 MFGSGGME---KMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQ 239
           + G GG E   KML  MME L  K+ LYEPMKE  +K+P+W+E N+GKV  ED  RYE+Q
Sbjct: 237 LDGEGGEEEFSKMLLGMMEQLTNKEILYEPMKELHEKFPEWIEKNRGKVSAEDLQRYEEQ 296

Query: 240 SEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNEL 287
             Y+ +I+ K++ P +   N+   + II+ MQ++Q  GQPP +++ E+
Sbjct: 297 QTYVREIVAKFEEPTYSDENKADREYIIDRMQKMQATGQPPADLVGEM 344



>gi|322707930|gb|EFY99508.1| peroxin [Metarhizium anisopliae ARSEF 23]
          Length = 337

 Score =  114 bits (284), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 75/232 (32%), Positives = 120/232 (51%), Gaps = 15/232 (6%)

Query: 67  DDEYVKLLTADMEDFVKEFDEN-ELSIAMQGLMKNFGEVDEDNLNGTDFDNTGRSTVESN 125
           ++++ K L A M D + E +++ E+    + + K       D   GT    +  +   + 
Sbjct: 103 EEDFAKQLQAGMADLLGELEQSPEMQQQFEDMFKQMAAASGDAAPGTGAAGSSSAKAGAP 162

Query: 126 GT----SFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIM-EMMKQIENMANLSGFAENDF 180
           GT    SFQ+ I +TM ++Q S +Q  A     S D  M E++KQ+ +  +L+G      
Sbjct: 163 GTASEASFQETIRRTMERMQASGDQATAAAATSSGDDFMSELLKQMSS-GDLNG---EGS 218

Query: 181 EEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQS 240
           EE F      KML  MME L  KD LYEPMKE   K+P+W E NK   P ED  RYE+Q 
Sbjct: 219 EEEFS-----KMLMGMMEQLTNKDILYEPMKELDDKFPEWFEKNKSSTPAEDLKRYEEQR 273

Query: 241 EYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGME 292
             + +I+ K++   +  +N    + I++ MQ++Q  G PP +++ ++A   E
Sbjct: 274 VLVREIVAKFEESSYSDSNASDREYIVDRMQKMQAAGSPPSDLVGDMASAQE 325



>gi|358388721|gb|EHK26314.1| hypothetical protein TRIVIDRAFT_15606, partial [Trichoderma virens
           Gv29-8]
          Length = 358

 Score =  113 bits (283), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 61/170 (35%), Positives = 94/170 (55%), Gaps = 11/170 (6%)

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIM-EMMKQIENMANLSGFAENDFEE 182
           S+G +FQD I +TM ++Q+S +Q  A    G  D  + EM+KQ+      +G +E DF  
Sbjct: 187 SSGAAFQDTIRRTMERMQSSGDQATAAAAAGGEDDFLAEMLKQL-TAGEFAGGSEEDFS- 244

Query: 183 MFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEY 242
                   KML  MME L  K+ LYEPMKE   K+P WL  NK   P +D  RY +Q   
Sbjct: 245 --------KMLMGMMEQLTNKEILYEPMKELHDKFPAWLAKNKDSTPADDLKRYMEQKTI 296

Query: 243 INKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGME 292
           + +I+ K++ P +  +N    + I++ MQ++Q  G PP +++ ++A   E
Sbjct: 297 VEEIVAKFNEPTYSDSNAADREYIVDRMQKMQAAGSPPSDLVGDMASAQE 346



>gi|358395775|gb|EHK45162.1| hypothetical protein TRIATDRAFT_299866 [Trichoderma atroviride IMI
           206040]
          Length = 368

 Score =  113 bits (283), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 96/171 (56%), Gaps = 11/171 (6%)

Query: 123 ESNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIM-EMMKQIENMANLSGFAENDFE 181
           E +G +FQD I +TM ++Q+S EQ  A    G +D  + EM+KQ+    + +G +E DF 
Sbjct: 196 EKSGAAFQDTIRRTMERMQSSGEQATAAAAAGGDDDFLTEMLKQL-TAGDFAGGSEEDFS 254

Query: 182 EMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSE 241
                    KML  MME L  K+ LYEPMKE   K+P WL  NK   P ED  RY +Q  
Sbjct: 255 ---------KMLMGMMEQLTNKEILYEPMKELHDKFPAWLAKNKDSTPAEDLKRYAEQQA 305

Query: 242 YINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGME 292
            + +I+ K+D P +  +N    + I++ MQ++Q  G PP +++ ++A   E
Sbjct: 306 IVAEIVAKFDEPGYSDSNATDREYIVDRMQKMQAAGSPPSDLVGDMASAQE 356



>gi|336269081|ref|XP_003349302.1| hypothetical protein SMAC_05585 [Sordaria macrospora k-hell]
 gi|380089875|emb|CCC12408.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 332

 Score =  112 bits (281), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 73/251 (29%), Positives = 131/251 (52%), Gaps = 32/251 (12%)

Query: 67  DDEYVKLLTADMEDFVKEFDEN-ELSIAMQGLMKNFGEVDE--------------DNLNG 111
           ++E+ K L A M D + + D + EL    + + K  G                  + L  
Sbjct: 82  EEEFAKQLQAGMADLLGDMDNSPELQAQFESIFKELGAAAAASDAETPGIPTPKAETLTK 141

Query: 112 TDFDNTGRSTVESNGTS-------FQDKINQTMNKLQNSSEQLDAEII-DGSNDQIMEMM 163
           T   ++ R++  ++ +S       FQ+ I +TM ++Q S EQ  A    +GS+D + E++
Sbjct: 142 TPPSSSRRASTAASPSSKNAAEASFQETIRRTMERMQTSGEQATAAAAAEGSDDFLAELL 201

Query: 164 KQIENMANLSGFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLED 223
           KQ+++       +E +F          KML  MME L  KD LYEPMKE  +K+P WLE 
Sbjct: 202 KQMQSGGLEGEGSEEEFS---------KMLMGMMEQLTHKDILYEPMKELHEKFPGWLEK 252

Query: 224 NKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEI 283
           N+     ED  RYE Q + +++I+ K++ P++   +++ ++ I++ MQ++Q+ GQPP ++
Sbjct: 253 NRAATSKEDLERYELQQKLVSEIVAKFEEPNYADTSKEHHEYIVDRMQKMQDAGQPPNDL 312

Query: 284 LNELAPGMELN 294
           + ++     L+
Sbjct: 313 VGDMPSAQNLD 323



>gi|156043287|ref|XP_001588200.1| hypothetical protein SS1G_10647 [Sclerotinia sclerotiorum 1980]
 gi|154695034|gb|EDN94772.1| hypothetical protein SS1G_10647 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 335

 Score =  112 bits (280), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 75/246 (30%), Positives = 122/246 (49%), Gaps = 22/246 (8%)

Query: 67  DDEYVKLLTADMEDFVKEFDEN-ELSIAMQGLMKNFGEVDEDNLNGTDFDNT------GR 119
           DD++ K L A M + + E + + E+    + ++K  G + E                  +
Sbjct: 99  DDDFAKQLQAGMAELMGELETSPEMQAQFESMLKEMGGLGETGPAPPPPSAPKPGSSKSK 158

Query: 120 STVESNGT-SFQDKINQTMNKLQNSSEQLDAEII-DGSNDQIMEMMKQIENMANLSGFAE 177
           +T  S G  SFQ+ I +TM ++Q S +Q  A    D S+D + EMMK +    +  G +E
Sbjct: 159 TTAGSAGEESFQETIKKTMERMQASGDQATAAAAEDNSDDLLSEMMKAMAGGMDGDG-SE 217

Query: 178 NDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYE 237
            DF          KML  MME L  K+ LYEPMKE   K+P WLE N    P +D  RY+
Sbjct: 218 EDFS---------KMLLGMMEQLTNKEILYEPMKELDDKFPAWLEKNSASTPADDLKRYK 268

Query: 238 KQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGME---LN 294
           +Q  ++ +I+ +++   +   N    + I+  MQ++Q  G PP +++ ++A   E     
Sbjct: 269 EQQVFVREIVARFEQKTYKDENAADREYIVERMQKMQAAGSPPADLVGDMAAAQEAFGAP 328

Query: 295 EQGIPS 300
           E+G P+
Sbjct: 329 EEGCPT 334



>gi|472588542|gb|EMS26014.1| peroxisomal biogenesis factor 19 [Rhodosporidium toruloides NP11]
          Length = 389

 Score =  111 bits (277), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 66/197 (33%), Positives = 107/197 (54%), Gaps = 24/197 (12%)

Query: 116 NTGRSTVESNGTSFQDKINQTMNKLQNSSEQLDAEI---IDGSNDQIMEMMKQIENMANL 172
           ++G ST  +N   FQ+ I  +M+KL++SS   +A       G N  +  M+ Q+  M +L
Sbjct: 196 SSGPSTQPAN---FQEAIAASMSKLRDSSTSANAAAESSRPGDNAGMAAMLAQMAGMPDL 252

Query: 173 SGFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPED 232
                 D EE     G++ ML+ MM+ L ++D LYEP+KE A KYP +LE ++  +   D
Sbjct: 253 GNI---DSEE-----GLQDMLDEMMKQLMSRDMLYEPLKELADKYPAYLEQHRSTLSAAD 304

Query: 233 YARYEKQSEYINKIIEKYDAPDFD----------GNNEQQNKAIINLMQELQEFGQPPPE 282
             RYEKQ   + +I++K++ P  D               +  A+++L+ ++ E G PP E
Sbjct: 305 IERYEKQRTIVRQIVDKFEEPGADKQPPYTPEEEAQRSARLDAVVDLVAKMNECGAPPNE 364

Query: 283 ILNELAPGMELNEQGIP 299
           I+ E+ PGM+L   G+P
Sbjct: 365 IMGEMPPGMDLGADGMP 381



>gi|347835211|emb|CCD49783.1| hypothetical protein BofuT4_P094910.1 [Botryotinia fuckeliana T4]
          Length = 336

 Score =  111 bits (277), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 75/247 (30%), Positives = 122/247 (49%), Gaps = 23/247 (9%)

Query: 67  DDEYVKLLTADMEDFVKEFDEN-ELSIAMQGLMK---NFGEVDEDNLNGTDFDNTGRSTV 122
           DD++ K L A M + + E + + E+    + ++K     GE        +        T 
Sbjct: 99  DDDFAKQLQAGMAELMGELETSPEMQAQFESMLKEMGGLGETGPAPPPPSAPKPGPSKTK 158

Query: 123 ESNGTS----FQDKINQTMNKLQNSSEQLDAEII-DGSNDQIMEMMKQIENMANLSG-FA 176
            + G++    FQ+ I +TM ++Q S +Q  A    D S+D + EMMK +     + G  +
Sbjct: 159 AAPGSASEETFQETIKKTMERMQASGDQATAAAAEDNSDDLLAEMMKAM-GAGGMDGEGS 217

Query: 177 ENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARY 236
           E DF          KML  MME L  K+ LYEPMKE   KYP WLE N   VP +D  RY
Sbjct: 218 EEDFS---------KMLLGMMEQLTNKEILYEPMKELDDKYPAWLEKNSASVPADDLKRY 268

Query: 237 EKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGME---L 293
           ++Q  ++ +I+ +++   +   N    + I+  MQ++Q  G PP +++ ++A   E    
Sbjct: 269 KEQQVFVREIVARFEQKTYKDENASDREYIVERMQKMQAAGSPPADLVGDMAAAQEAFGA 328

Query: 294 NEQGIPS 300
            E+G P+
Sbjct: 329 PEEGCPT 335



>gi|472242315|gb|EMR87014.1| putative pex19 family protein [Botryotinia fuckeliana BcDW1]
          Length = 336

 Score =  111 bits (277), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 75/247 (30%), Positives = 122/247 (49%), Gaps = 23/247 (9%)

Query: 67  DDEYVKLLTADMEDFVKEFDEN-ELSIAMQGLMK---NFGEVDEDNLNGTDFDNTGRSTV 122
           DD++ K L A M + + E + + E+    + ++K     GE        +        T 
Sbjct: 99  DDDFAKQLQAGMAELMGELETSPEMQAQFESMLKEMGGLGETGPAPPPPSAPKPGPSKTK 158

Query: 123 ESNGT----SFQDKINQTMNKLQNSSEQLDAEII-DGSNDQIMEMMKQIENMANLSG-FA 176
            + G+    +FQ+ I +TM ++Q S +Q  A    D S+D + EMMK +     + G  +
Sbjct: 159 AAPGSASEETFQETIKKTMERMQASGDQATAAAAEDNSDDLLAEMMKAM-GAGGMDGEGS 217

Query: 177 ENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARY 236
           E DF          KML  MME L  K+ LYEPMKE   KYP WLE N   VP +D  RY
Sbjct: 218 EEDFS---------KMLLGMMEQLTNKEILYEPMKELDDKYPAWLEKNSASVPADDLKRY 268

Query: 237 EKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGME---L 293
           ++Q  ++ +I+ +++   +   N    + I+  MQ++Q  G PP +++ ++A   E    
Sbjct: 269 KEQQVFVREIVARFEQKTYKDENASDREYIVERMQKMQAAGSPPADLVGDMAAAQEAFGA 328

Query: 294 NEQGIPS 300
            E+G P+
Sbjct: 329 PEEGCPT 335



>gi|367038997|ref|XP_003649879.1| hypothetical protein THITE_2108960 [Thielavia terrestris NRRL 8126]
 gi|346997140|gb|AEO63543.1| hypothetical protein THITE_2108960 [Thielavia terrestris NRRL 8126]
          Length = 326

 Score =  110 bits (276), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 74/232 (31%), Positives = 120/232 (51%), Gaps = 23/232 (9%)

Query: 67  DDEYVKLLTADMEDFVKEFDENELSIAMQGLMKN-FGEVDEDNLNGTDFDNTG------- 118
           DDE+ K L A M + + E    E S  MQ   ++ F E++       D  +T        
Sbjct: 90  DDEFAKQLQAGMAELLGEL---ENSPEMQAQFESIFKELESAAPPSADQASTAPNPPGPG 146

Query: 119 --RSTVESNGTSFQDKINQTMNKLQNSSEQLDAEII-DGSNDQIMEMMKQIENMANLSGF 175
               +    G SFQ+ I +T+ ++Q S +Q  A    +GS D + E++KQ++      G 
Sbjct: 147 ASSGSTAGGGASFQETIRRTIERMQASGDQATAAATAEGSADFMAELLKQMQG----GGL 202

Query: 176 AENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYAR 235
                EE F      KML  MME L TK+ LYEPMKE  +K+P+WLE NK K   ED  R
Sbjct: 203 DGEGSEEEFS-----KMLMGMMEQLTTKEILYEPMKELHEKFPEWLEKNKEKTSAEDLRR 257

Query: 236 YEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNEL 287
           Y +Q   +++I+ K++   +  ++ +  + I++ MQ++Q  G PP +++ ++
Sbjct: 258 YREQQTLVSEIVLKFEEATYSDSSTKDREYIVDRMQKMQATGSPPSDLVGDM 309



>gi|336472100|gb|EGO60260.1| hypothetical protein NEUTE1DRAFT_119474 [Neurospora tetrasperma
           FGSC 2508]
 gi|350294693|gb|EGZ75778.1| Pex19-domain-containing protein [Neurospora tetrasperma FGSC 2509]
          Length = 326

 Score =  110 bits (276), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 63/176 (35%), Positives = 104/176 (59%), Gaps = 13/176 (7%)

Query: 127 TSFQDKINQTMNKLQNSSEQLDAEII-DGSNDQIMEMMKQIENMANLSGFAENDFEEMFG 185
            SFQ+ I +TM ++Q S EQ  A    +GS+D + E++KQ+++     G      EE F 
Sbjct: 158 ASFQETIRRTMERMQTSGEQATAAAAAEGSDDFLAELLKQMQS----GGLDGEGSEEEFS 213

Query: 186 SGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINK 245
                KML  MME L  KD LYEPMKE  +K+P WLE N+     ED  RYE Q + +++
Sbjct: 214 -----KMLMGMMEQLTHKDILYEPMKELHEKFPGWLEKNRATTSKEDLERYELQQKLVSE 268

Query: 246 IIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQGIPSD 301
           I+ K++ P++   +++ ++ I++ MQ++Q+ GQPP +++ ++     L+   +P D
Sbjct: 269 IVAKFEEPNYADTSKEHHEYIVDRMQKMQDAGQPPNDLVGDMPSAQNLD---LPDD 321



>gi|395329208|gb|EJF61596.1| Pex19-domain-containing protein [Dichomitus squalens LYAD-421 SS1]
          Length = 343

 Score =  110 bits (276), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 60/178 (33%), Positives = 102/178 (57%), Gaps = 12/178 (6%)

Query: 128 SFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEMFGSG 187
           SFQ+ I + M+KL+ S+++ D     G+   + +M  ++ NM +     ++  EEM G  
Sbjct: 175 SFQENIERAMHKLKESNQKADEASATGAGG-LEDMFARLANMTS-----QDSEEEMKG-- 226

Query: 188 GMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKII 247
               MLE+MM +L +KD LYEP+KE  +K+P +L+++   +  ED  RY+ Q + + +I+
Sbjct: 227 ----MLETMMSSLMSKDVLYEPLKELHEKFPGYLKEHDATLSAEDKTRYQTQFKIVAQIV 282

Query: 248 EKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQGIPSDLTSC 305
             ++ P +  ++ Q    ++ LMQE+Q+ G PP EI+  L PG EL   G+P     C
Sbjct: 283 TIFEDPSYSEDDPQSGVKVVELMQEMQDHGSPPSEIMGPLPPGFELGTDGLPKLPEGC 340



>gi|393247077|gb|EJD54585.1| Pex19 protein [Auricularia delicata TFB-10046 SS5]
          Length = 307

 Score =  110 bits (276), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 69/249 (27%), Positives = 130/249 (52%), Gaps = 12/249 (4%)

Query: 65  QLDDEYVKLLTADMEDFVKEF--DENELSIAMQGLMKNF-----GEVDEDNLNGTDFDNT 117
           +LDD +V+ L A ME+ +++   D+ E   AM+     +     G  +     G     +
Sbjct: 60  ELDDAFVRDLAAGMENLMRDLAGDDKEAQQAMESSRAEWEQALKGLQEAAATTGPSAAAS 119

Query: 118 GRSTVESNGTSFQDKINQTMNKLQNSSEQLDAEIIDG-SNDQIMEMMKQIENMANLSGFA 176
           G +   +   SFQ  +  T++KL+NS + L A+  DG S D   ++   + ++A   G  
Sbjct: 120 GSTPSAAADASFQASLRATLDKLKNSEDTLKADEADGASADSFAQLQDLLASLAGDVGEG 179

Query: 177 ENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARY 236
               ++   SG    +L+ +M++L +KD LYEPMK+ + KYP+++E +K  +  ++  RY
Sbjct: 180 GEGEDDGQLSG----VLQGLMQSLMSKDILYEPMKDLSAKYPEYIEQHKDTLKADELNRY 235

Query: 237 EKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQ 296
           ++QS  + +I+  ++   +   +  ++  ++ LM E+Q  G PP EI+ ++ PG E    
Sbjct: 236 QEQSALVGRIVAIFETQGYSDEDPVRSAEVLALMNEMQALGSPPQEIMGDMPPGFEAGPD 295

Query: 297 GIPSDLTSC 305
           G+P    +C
Sbjct: 296 GLPKMPDNC 304



>gi|154316506|ref|XP_001557574.1| hypothetical protein BC1G_04184 [Botryotinia fuckeliana B05.10]
          Length = 336

 Score =  110 bits (276), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 74/246 (30%), Positives = 120/246 (48%), Gaps = 21/246 (8%)

Query: 67  DDEYVKLLTADMEDFVKEFDEN-ELSIAMQGLMK---NFGEVDEDNLNGTDFDNTGRSTV 122
           DD++ K L A M + + E + + E+    + ++K     GE        +        T 
Sbjct: 99  DDDFAKQLQAGMAELMGELETSPEMQAQFESMLKEMGGLGETGPAPPPPSAPKPGPSKTK 158

Query: 123 ESNGT----SFQDKINQTMNKLQNSSEQLDAEII-DGSNDQIMEMMKQIENMANLSGFAE 177
            + G+    +FQ+ I +TM ++Q S +Q  A    D S+D + EMMK +         +E
Sbjct: 159 AAPGSASEETFQETIKKTMERMQASGDQATAAAAEDNSDDLLAEMMKAMGAGGMDGEGSE 218

Query: 178 NDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYE 237
            DF          KML  MME L  K+ LYEPMKE   KYP WLE N   VP +D  RY+
Sbjct: 219 EDFS---------KMLLGMMEQLTNKEILYEPMKELDDKYPAWLEKNSASVPADDLKRYK 269

Query: 238 KQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGME---LN 294
           +Q  ++ +I+ +++   +   N    + I+  MQ++Q  G PP +++ ++A   E     
Sbjct: 270 EQQVFVREIVARFEQKTYKDENASDREYIVERMQKMQAAGSPPADLVGDMAAAQEAFGAP 329

Query: 295 EQGIPS 300
           E+G P+
Sbjct: 330 EEGCPT 335



>gi|85101095|ref|XP_961091.1| hypothetical protein NCU04301 [Neurospora crassa OR74A]
 gi|28922629|gb|EAA31855.1| conserved hypothetical protein [Neurospora crassa OR74A]
 gi|28950162|emb|CAD71030.1| related to PEX19 protein [Neurospora crassa]
          Length = 326

 Score =  110 bits (276), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 63/176 (35%), Positives = 104/176 (59%), Gaps = 13/176 (7%)

Query: 127 TSFQDKINQTMNKLQNSSEQLDAEII-DGSNDQIMEMMKQIENMANLSGFAENDFEEMFG 185
            SFQ+ I +TM ++Q S EQ  A    +GS+D + E++KQ+++     G      EE F 
Sbjct: 158 ASFQETIRRTMERMQTSGEQATAAAAAEGSDDFLAELLKQMQS----GGLDGEGSEEEFS 213

Query: 186 SGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINK 245
                KML  MME L  KD LYEPMKE  +K+P WLE N+     ED  RYE Q + +++
Sbjct: 214 -----KMLMGMMEQLTHKDILYEPMKELHEKFPGWLEKNRATTSKEDLERYELQQKLVSE 268

Query: 246 IIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQGIPSD 301
           I+ K++ P++   +++ ++ I++ MQ++Q+ GQPP +++ ++     L+   +P D
Sbjct: 269 IVAKFEEPNYADTSKEHHEYIVDRMQKMQDAGQPPNDLVGDMPSAQNLD---LPDD 321



>gi|320592023|gb|EFX04462.1| peroxisomal membrane protein receptor [Grosmannia clavigera kw1407]
          Length = 369

 Score =  110 bits (275), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 59/169 (34%), Positives = 94/169 (55%), Gaps = 13/169 (7%)

Query: 127 TSFQDKINQTMNKLQNSSEQLDAEIIDGSN---DQIMEMMKQIENMANLSGFAENDFEEM 183
            SFQ+ I +TM ++Q S EQ  A     +N   D + E MKQ+++    SG  E++    
Sbjct: 198 ASFQETIRRTMERMQASGEQATAAATADTNSADDLLTEFMKQMQSGGLGSGANEDE---- 253

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
                + KML  MME L  ++ LYEPMKE + K+P WLE N+    P D  RYE+Q   +
Sbjct: 254 -----LSKMLVGMMEELTNREILYEPMKELSDKFPAWLEQNRAATAPADLKRYEEQQAIV 308

Query: 244 NKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGME 292
             I+ +++ P +   N    + I++ MQ++Q  G PPP+++ ++ PG +
Sbjct: 309 RDIVARFELPTYSDTNPADREYIVDRMQKMQAAGSPPPDLVGDM-PGAQ 356



>gi|449541398|gb|EMD32382.1| hypothetical protein CERSUDRAFT_118745 [Ceriporiopsis subvermispora
           B]
          Length = 333

 Score =  110 bits (275), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 68/211 (32%), Positives = 114/211 (54%), Gaps = 16/211 (7%)

Query: 102 GEVDEDNLNGTDFDNT-GRSTVESNGTS------FQDKINQTMNKLQNSSEQLDAEIIDG 154
           G +D D ++G+D  +  G+ T    G +      FQ+ I + M+KL+ S   L A+   G
Sbjct: 129 GRMDPDGISGSDAASAKGKETPGQAGKAPGAEQPFQETIRKAMDKLKESDSNLQADASAG 188

Query: 155 SNDQIMEMMKQIENMANLSGFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFA 214
           S D +  ++ Q E +A  SG +E +         +  +L++MM  L +KD LYEP+KE  
Sbjct: 189 SADSLEALLAQFEGLAEGSGESEEE---------LHGVLQTMMGHLMSKDVLYEPLKELH 239

Query: 215 QKYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQ 274
            K+P +LE++  K+  +D  RYE Q   ++KII  +D P +  ++  +   I+ LM ++Q
Sbjct: 240 DKFPSYLEEHGSKLGADDKRRYESQYSTVSKIIAVFDDPSYSDDDPLKGVHIVELMNQMQ 299

Query: 275 EFGQPPPEILNELAPGMELNEQGIPSDLTSC 305
            +G PP E++  + PGME+   G+P     C
Sbjct: 300 TYGSPPAEVMGPMPPGMEVGADGMPKIPEGC 330



>gi|116784489|gb|ABK23361.1| unknown [Picea sitchensis]
          Length = 254

 Score =  110 bits (274), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 81/123 (65%), Gaps = 10/123 (8%)

Query: 180 FEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQ 239
           FEE+ G+  M+ ++++MM  L +K+ L+EPMKE  ++YPKWLE+ K  +  EDY RY  Q
Sbjct: 124 FEEIGGTQDMQSVVDTMMRQLLSKEILHEPMKEIGERYPKWLEERKSTISKEDYERYSCQ 183

Query: 240 SEYINKIIEKYDA-PD-FDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQG 297
            E I ++ + Y+A PD FD         I+ LMQ++Q+ GQPP +I+ ELAPG+ L  +G
Sbjct: 184 YELIKQLCKVYEAEPDNFD--------KIVELMQKMQDCGQPPSDIVQELAPGLNLGSEG 235

Query: 298 IPS 300
            P+
Sbjct: 236 GPA 238



>gi|471566447|gb|EMR66756.1| putative pex19-domain-containing protein [Eutypa lata UCREL1]
          Length = 317

 Score =  110 bits (274), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 74/238 (31%), Positives = 124/238 (52%), Gaps = 24/238 (10%)

Query: 67  DDEYVKLLTADMEDFVKEFDENELSIAMQ--------GLMKNFGEVDEDNLNGTDFDNTG 118
           ++E+ K L A M + + +    E S  MQ        GL    G  D ++ +G    ++ 
Sbjct: 82  EEEFEKQLQAGMAELMNDL---ESSTDMQAQFEDIFKGLGATAGATDPESQSGNTPGSSA 138

Query: 119 RSTVE-SNGTSFQDKINQTMNKLQNSSEQLDAEII-DGSNDQ-IMEMMKQIENMANLSGF 175
           ++  + S   +FQ+ I +TM ++Q S +Q  A    +GS D  I EMMK ++++    G 
Sbjct: 139 QTAADLSQDATFQETIRRTMARMQESGDQATAAATAEGSEDDFIAEMMKAMKDLPGNEG- 197

Query: 176 AENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYAR 235
           +E DF          KML  MME L  K+ LYEPMKE   KYP+WL  NK  +  +D  R
Sbjct: 198 SEEDFS---------KMLMGMMEHLTNKEILYEPMKELNAKYPEWLTKNKDTLSQDDLKR 248

Query: 236 YEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMEL 293
           Y+ Q  Y+++++ K++ P +  +     + I+  MQ++QE G PP +++ ++    E+
Sbjct: 249 YQGQQVYVSEMVAKFEEPSYSDDKSADRQYIVERMQKMQEAGSPPHDLIGDMPSAKEV 306



>gi|116197773|ref|XP_001224698.1| hypothetical protein CHGG_07042 [Chaetomium globosum CBS 148.51]
 gi|88178321|gb|EAQ85789.1| hypothetical protein CHGG_07042 [Chaetomium globosum CBS 148.51]
          Length = 334

 Score =  110 bits (274), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 71/229 (31%), Positives = 119/229 (51%), Gaps = 20/229 (8%)

Query: 70  YVKLLTADMEDFVKEF-DENELSIAMQGLMKNFGEVDEDNLNGTDFDNT----GRSTVES 124
           + K L A M D +    D  E+    + + K  G     + N T  + T    G S+  +
Sbjct: 98  FAKQLQAGMADLLGGLGDSAEMQAQFETIFKELGASASASANNTSTNPTPPTAGGSSSTA 157

Query: 125 NGT----SFQDKINQTMNKLQNSSEQLDAEI-IDGSNDQIMEMMKQIENMA-NLSGFAEN 178
             T    SFQ+ I +TM ++Q+S +Q  A    +G+ D + E+MKQ++    +     E 
Sbjct: 158 GATNADSSFQETIRRTMERMQSSGDQATAAASAEGTEDFLAELMKQMQGAGVDGGEGGEE 217

Query: 179 DFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEK 238
           +F          KML  MM+ L TK+ LYEPMKE   K+P+WLE N  K   ED  RY++
Sbjct: 218 EFS---------KMLMGMMDQLTTKEILYEPMKELDDKFPEWLEKNSEKTSAEDLKRYKE 268

Query: 239 QSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNEL 287
           Q   + +I+ K++ P +  +++   + I++ MQ++Q  G PPP+++ ++
Sbjct: 269 QQTLVKEIVLKFEEPGYADSHKADREYIVDRMQQMQASGSPPPDLVGDM 317



>gi|460392800|ref|XP_004242001.1| PREDICTED: peroxisome biogenesis protein 19-1-like [Solanum
           lycopersicum]
          Length = 248

 Score =  109 bits (272), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 61/161 (37%), Positives = 94/161 (58%), Gaps = 18/161 (11%)

Query: 149 AEIIDGSNDQIMEMMKQIENMANLSGFAEN------------DFEEMFGSGGMEKMLESM 196
           +E +D   +Q  E +K +E++A      EN             FEE+ GS  ME ++E+M
Sbjct: 78  SEALDKLREQTREAVKGLESVAGPRPSVENFGSDPMMEDWVKQFEELAGSQDMESIVETM 137

Query: 197 MEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFD 256
           M+ L +K+ L+EPM+E  ++YPKWLEDNK K+  E+Y RY +Q E I  + + Y+    +
Sbjct: 138 MQQLLSKEILHEPMREIGERYPKWLEDNKAKLSGEEYDRYRQQYELIRDLNKVYETEPSN 197

Query: 257 GNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQG 297
            N       I+ LMQ++QE GQPP +I+ ELAP  +++  G
Sbjct: 198 FNK------IVELMQKMQECGQPPNDIVQELAPDFDISTLG 232



>gi|295671258|ref|XP_002796176.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226284309|gb|EEH39875.1| conserved hypothetical protein [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 423

 Score =  106 bits (265), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 66/179 (36%), Positives = 100/179 (55%), Gaps = 15/179 (8%)

Query: 126 GTSFQDKINQTMNKLQNSSEQLDAEII-DGSNDQIMEMMKQIENMANLSGFAENDFEEMF 184
           G  FQ+ I +TM ++Q S E+  A    DG +D +++++K +E+ A   G   ND E + 
Sbjct: 243 GDKFQETIRKTMERMQASGEKATAAATEDGGDDMLVKLLKAMESGAGAGGG--NDEESL- 299

Query: 185 GSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYIN 244
                +K+   +ME L+ KD LYEPMKE    +  WLE+N+GKVP ED  RYE Q+  + 
Sbjct: 300 -----DKIFMGIMEQLSNKDMLYEPMKELHNNFGPWLEENRGKVPKEDMERYELQAVVVR 354

Query: 245 KIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEIL-NELAPGMELNEQGIPSDL 302
           +I+EK+D   +  +  +    I   MQ++Q  G PP  ++ N LA     +E GI S L
Sbjct: 355 EIVEKFDEEGYSDDKPEHRAYIWEKMQKMQAAGSPPDALVSNPLA-----DELGISSTL 408



>gi|512208026|gb|EPE36843.1| hypothetical protein GLAREA_09006 [Glarea lozoyensis ATCC 20868]
          Length = 340

 Score =  106 bits (265), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 74/257 (28%), Positives = 128/257 (49%), Gaps = 34/257 (13%)

Query: 67  DDEYVKLLTADMEDFVKEFDEN-ELSIAMQGLMKNFGEVDE-------DNLNGTDFDNTG 118
           D ++ + L + M   ++  D + +++   Q +MK FG++         + L  ++     
Sbjct: 92  DAQFAEQLESSMAQLLQGLDSDPDMAAQFQDMMKQFGDLGSTEPSQATNPLPASEPAAKS 151

Query: 119 RSTVESNGTS----------FQDKINQTMNKLQNSSEQLDAEI-IDGSNDQIMEMMKQIE 167
           +ST    G S          FQ+ I +TM +++ S +Q  A    +  +D + E+MK ++
Sbjct: 152 KSTGSKAGASTTPNVGGEESFQETIKKTMERMRESGDQATAAANTESGDDMLAEIMKAMQ 211

Query: 168 NMANLSGF--AENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNK 225
           + + L G   +E DF          KML  MME L  K+ LYEPMKE   KYP W++ N 
Sbjct: 212 S-SGLDGAEGSEEDFS---------KMLLGMMEQLTNKEILYEPMKELDDKYPDWIDKNA 261

Query: 226 GKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILN 285
           GKV   D  RY++Q  Y+ +I  +++   +  +N    + I+  MQ++Q  G PPP+++ 
Sbjct: 262 GKVDEADMKRYKEQQVYVREITARFERKGYSDDNAADREYIVERMQKMQAAGSPPPDLVG 321

Query: 286 ELAPGME---LNEQGIP 299
           ++A   E     E+G P
Sbjct: 322 DMAAAQEAFGAPEEGCP 338



>gi|340517551|gb|EGR47795.1| hypothetical protein TRIREDRAFT_122431 [Trichoderma reesei QM6a]
          Length = 370

 Score =  106 bits (264), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 61/170 (35%), Positives = 94/170 (55%), Gaps = 11/170 (6%)

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIM-EMMKQIENMANLSGFAENDFEE 182
           S G +FQD I +TM ++  S EQ  A    G +D  + EM+KQ+ +    +G +E DF  
Sbjct: 199 SGGAAFQDTIRRTMERMHASGEQATAAAAAGGDDDFLSEMLKQLTS-GEFAGGSEEDFS- 256

Query: 183 MFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEY 242
                   KML  MME L  K+ LYEPMKE   K+P W+  NK  VP +D  RY +Q   
Sbjct: 257 --------KMLMGMMEQLTNKEILYEPMKELHDKFPAWIAKNKDSVPADDLKRYMEQKVI 308

Query: 243 INKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGME 292
           + +I+ K++ P +  +N    + I++ MQ++Q  G PP +++ ++A   E
Sbjct: 309 VEEIVAKFNEPTYSDSNAADREYIVDRMQKMQAAGSPPSDLVGDMASAQE 358



>gi|15228571|ref|NP_186999.1| peroxin 19-1 [Arabidopsis thaliana]
 gi|75313803|sp|Q9SRQ3.1|PE191_ARATH RecName: Full=Peroxisome biogenesis protein 19-1; AltName:
           Full=Peroxin-19-1; Short=AtPEX19-1; AltName:
           Full=Peroxisomal membrane protein import receptor
           PEX19-1; Flags: Precursor
 gi|6017103|gb|AAF01586.1|AC009895_7 unknown protein [Arabidopsis thaliana]
 gi|46931296|gb|AAT06452.1| At3g03490 [Arabidopsis thaliana]
 gi|66392759|emb|CAD91898.1| peroxisomal membrane protein Pex19p [Arabidopsis thaliana]
 gi|332640429|gb|AEE73950.1| peroxin 19-1 [Arabidopsis thaliana]
          Length = 248

 Score =  105 bits (263), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 64/189 (33%), Positives = 105/189 (55%), Gaps = 18/189 (9%)

Query: 120 STVESNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAEND 179
           S V+  G    D  ++   K + S E   AE +D   +Q  E +K +E++++    A +D
Sbjct: 51  SGVQGLGMGLPDMRSKKRGKQKVSKEDHVAEALDKLREQTRETVKGLESISSKQLPASDD 110

Query: 180 ----------FEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVP 229
                     FE++ GS  +E ++E+MM+ L +KD L+EPMKE   +YPKWL++N+  + 
Sbjct: 111 DGMVEDFLKQFEDLAGSKDLESIVETMMQQLLSKDILHEPMKELGARYPKWLKENEASLS 170

Query: 230 PEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKA-IINLMQELQEFGQPPPEILNELA 288
            EDY RY +Q + I ++   Y+       NE  N + I+ +MQ++QE GQPP +I+ E+ 
Sbjct: 171 KEDYKRYSQQYKLIEELNAVYE-------NEPNNSSKIMEIMQKMQECGQPPSDIVKEID 223

Query: 289 PGMELNEQG 297
           PG +    G
Sbjct: 224 PGFDFASLG 232



>gi|403418595|emb|CCM05295.1| predicted protein [Fibroporia radiculosa]
          Length = 338

 Score =  105 bits (261), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 57/179 (31%), Positives = 97/179 (54%), Gaps = 14/179 (7%)

Query: 128 SFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQI-ENMANLSGFAENDFEEMFGS 186
           +FQ  I + M KL+ S    D+ +   + D I  +M Q+ + + +LSG ++ D       
Sbjct: 170 AFQASIKKAMEKLKES----DSNMQTDAQDPIEALMAQLTDGLGDLSGESDED------- 218

Query: 187 GGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKI 246
             ++K LE MM  L +K+ LYEP+KE   K+P++L+D+   +  +D  RYE Q     +I
Sbjct: 219 --LQKFLEGMMSQLMSKEVLYEPLKELHTKFPEYLKDSAATLSADDKKRYEAQYALSEQI 276

Query: 247 IEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQGIPSDLTSC 305
           +  +D P +  ++ Q++  ++ L+ E+Q  G PPP+I+  L PG+E    G P     C
Sbjct: 277 VAIFDDPAYSDDDPQKSSQVVALVTEMQSHGSPPPDIMGSLPPGLEFGADGSPKLPEGC 335



>gi|320038389|gb|EFW20325.1| conserved hypothetical protein [Coccidioides posadasii str.
           Silveira]
          Length = 345

 Score =  105 bits (261), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 58/172 (33%), Positives = 99/172 (57%), Gaps = 9/172 (5%)

Query: 118 GRSTVESNGT---SFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSG 174
           G S+ + +G    +FQ  I +TM ++Q S ++  A + D ++D ++  M +    A + G
Sbjct: 163 GESSKDQSGKPEETFQATIRKTMERMQESGDKATAAVNDSADDDVLVQMLKAMEAAGMGG 222

Query: 175 FAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYA 234
             + D E      G EKML  +ME L+TK+ LYEP+KE  +K+  WLE+NK K+  ED+ 
Sbjct: 223 DGQEDDE------GFEKMLMGVMEQLSTKEILYEPVKELHEKFGPWLEENKEKLSKEDFE 276

Query: 235 RYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNE 286
           R+ KQ+  +  +++K+D P +  +  +    I   MQE+Q  G PP E++++
Sbjct: 277 RHVKQAGLMADVMKKFDEPGYSDDKPEHRAYIWEKMQEMQSTGTPPKELVSD 328



>gi|328859756|gb|EGG08864.1| hypothetical protein MELLADRAFT_71370 [Melampsora larici-populina
           98AG31]
          Length = 341

 Score =  105 bits (261), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 76/269 (28%), Positives = 126/269 (46%), Gaps = 52/269 (19%)

Query: 66  LDDEYVKLLTADMEDFV---KEFDENELSIAMQGLMKN------------FGEVDEDNLN 110
           L D++ + L   ME  +   KE D  E    ++ +M               G + E +  
Sbjct: 82  LPDDFARDLAEGMEALLSSMKEEDGGEFKKHLEAMMATDGDPTSVNIFQALGAMAEADTT 141

Query: 111 GTDFDNTGRSTVESNGTS------FQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMK 164
                 T ++   S GT+      FQD I  TM+KL+ S       +   S+D       
Sbjct: 142 SPKAPPTPQAGSSSAGTASGAPQNFQDAIKNTMDKLKESDVSAKENVAPSSSD------- 194

Query: 165 QIENMANLSGFAENDFEEMFGSGG-------MEKMLESMMEALATKDYLYEPMKEFAQKY 217
             + +A L       FE+M  + G       ++ ML+  ME L +K  +YEP+KE  ++Y
Sbjct: 195 --DQLAAL-------FEQMMSAQGGLPDESQLQTMLQGFMEELMSKQIMYEPLKEMNRQY 245

Query: 218 PKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNE-------QQNKAIINLM 270
           P WL + K  +P ED  RY+ QSE +  ++ K++ P +D + +        + K ++NL+
Sbjct: 246 PGWLNERKATLPKEDVDRYQTQSEIVAAVVNKFEDPAWDEDEKAGGDKFAARQKEVVNLL 305

Query: 271 QELQEFGQPPPEILNELAPGMELNEQGIP 299
            ++Q+ G PP E+L E+ PG+ L E G+P
Sbjct: 306 TKMQDCGSPPQELLGEMPPGL-LGEDGMP 333



>gi|408397561|gb|EKJ76702.1| hypothetical protein FPSE_03113 [Fusarium pseudograminearum CS3096]
          Length = 492

 Score =  105 bits (261), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 69/224 (30%), Positives = 113/224 (50%), Gaps = 9/224 (4%)

Query: 67  DDEYVKLLTADMEDFVKEFDEN-ELSIAMQGLMKNFGEVDEDNLNGTDFDNTG-RSTVES 124
           ++E+ K L A M D + E +++ ++    + + K+    +          + G  S    
Sbjct: 258 EEEFAKQLQAGMADLLGELEQSPDMQAQFEDIFKHIAAAEGAGDAPPPSSSKGPASQPPP 317

Query: 125 NGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIM-EMMKQIENMANLSGFAENDFEEM 183
              SFQD I +TM ++Q S +Q  A    GS D  M EM+KQ+ +        E   EE 
Sbjct: 318 EDASFQDTIKRTMERMQASGDQATAAAASGSGDDFMSEMLKQLSSGDLGDLGGEGSEEEF 377

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
                  KML  MME L  K+ LYEPMKE  +K+P+WL  N+   P ED  RYE+Q   +
Sbjct: 378 ------SKMLMGMMEQLTNKEILYEPMKELDEKFPEWLIKNRDATPKEDLKRYEEQQSIV 431

Query: 244 NKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNEL 287
            +I+ K++   +  +N    + I++ MQ++Q  G PP +++ ++
Sbjct: 432 RQIVAKFEEKTYSDSNATDREFIVDKMQKMQAAGSPPSDLVGDM 475



>gi|346326257|gb|EGX95853.1| peroxin [Cordyceps militaris CM01]
          Length = 341

 Score =  104 bits (259), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 61/161 (37%), Positives = 91/161 (56%), Gaps = 8/161 (4%)

Query: 128 SFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIM-EMMKQIENMANLSGFAENDFEEMFGS 186
           SFQD I +TM ++QNS EQ  A    GS+D  M E++KQ+   A        D EE F  
Sbjct: 171 SFQDTIRRTMERMQNSGEQATAAAASGSSDDFMSELLKQMAGGAGGP--GGEDSEEAFS- 227

Query: 187 GGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKI 246
               KML  MME L  K+ LYEPMKE   K+P WL  +  K P ++  RY+ Q   +++I
Sbjct: 228 ----KMLMGMMEQLTNKEILYEPMKELHDKFPAWLATHSDKTPADELKRYQDQHALVDEI 283

Query: 247 IEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNEL 287
           + +++A  +  +N    + I+  MQ++QE G PP +++ +L
Sbjct: 284 VARFEASTYSDSNAADREYIVERMQKMQELGSPPSDLVGDL 324



>gi|46136841|ref|XP_390112.1| hypothetical protein FG09936.1 [Fusarium graminearum PH-1]
          Length = 497

 Score =  104 bits (259), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 69/224 (30%), Positives = 113/224 (50%), Gaps = 9/224 (4%)

Query: 67  DDEYVKLLTADMEDFVKEFDEN-ELSIAMQGLMKNFGEVDEDNLNGTDFDNTG-RSTVES 124
           ++E+ K L A M D + E +++ ++    + + K+    +          + G  S    
Sbjct: 263 EEEFAKQLQAGMADLLGELEQSPDMQAQFEDIFKHIAAAEGAGDAPPPSSSKGPASQPPP 322

Query: 125 NGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIM-EMMKQIENMANLSGFAENDFEEM 183
              SFQD I +TM ++Q S +Q  A    GS D  M EM+KQ+ +        E   EE 
Sbjct: 323 EDASFQDTIKRTMERMQASGDQATAAAASGSGDDFMSEMLKQLSSGDLGDLGGEGSEEEF 382

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
                  KML  MME L  K+ LYEPMKE  +K+P+WL  N+   P ED  RYE+Q   +
Sbjct: 383 ------SKMLMGMMEQLTNKEILYEPMKELDEKFPEWLIKNRDATPKEDLKRYEEQQSIV 436

Query: 244 NKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNEL 287
            +I+ K++   +  +N    + I++ MQ++Q  G PP +++ ++
Sbjct: 437 RQIVAKFEEKTYSDSNATDREFIVDKMQKMQAAGSPPSDLVGDM 480



>gi|409043509|gb|EKM52991.1| hypothetical protein PHACADRAFT_259162 [Phanerochaete carnosa
           HHB-10118-sp]
          Length = 334

 Score =  104 bits (259), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 70/117 (59%)

Query: 189 MEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKIIE 248
           +++MLE+MM  L +KD LYEP+KE  +K+P +L+DN   +  ED  RYE Q   + KI+ 
Sbjct: 215 LQRMLETMMSQLMSKDILYEPLKELHEKFPAYLKDNAATIKAEDKQRYETQQTIVAKIVS 274

Query: 249 KYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQGIPSDLTSC 305
            ++ P +   ++ +   I+ LM  +Q  G PPPEI+  L PG+EL   G+P     C
Sbjct: 275 IFEDPKYTPEDQDKGIQIVTLMNTMQSHGSPPPEIMGPLPPGLELGPDGLPKLPDGC 331



>gi|400597189|gb|EJP64924.1| Pex19 family protein [Beauveria bassiana ARSEF 2860]
          Length = 335

 Score =  104 bits (259), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 56/160 (35%), Positives = 87/160 (54%), Gaps = 7/160 (4%)

Query: 129 FQDKINQTMNKLQNSSEQLDAEIIDGSNDQIM-EMMKQIENMANLSGFAENDFEEMFGSG 187
           FQD I +TM ++Q S EQ  A    G +D  M E++KQ      ++       +   G  
Sbjct: 165 FQDTIRRTMERMQTSGEQATAAAASGGSDSFMSELLKQ------MTSSGGAGADGEGGEE 218

Query: 188 GMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKII 247
              KML  MME L  K+ LYEPMKE   K+P WL  N+ K P E+  RY+ Q   +++I+
Sbjct: 219 EFSKMLMGMMEQLTNKEILYEPMKELHDKFPVWLSANREKTPAEELKRYQDQHALVDEIV 278

Query: 248 EKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNEL 287
            +++A  +  +N    + I+  MQ++QE G PP +++ +L
Sbjct: 279 ARFEASTYSDSNAADREYIVERMQKMQELGSPPSDLVGDL 318



>gi|443690044|gb|ELT92282.1| hypothetical protein CAPTEDRAFT_224754 [Capitella teleta]
          Length = 319

 Score =  103 bits (258), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 57/174 (32%), Positives = 104/174 (59%), Gaps = 11/174 (6%)

Query: 129 FQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEMFGSGG 188
           F + + +T+  L  ++E+L  ++   S D+I++MM Q+      +G      E  F    
Sbjct: 143 FSETLKETLGSLAQNAEELQNDV---SEDEILKMMSQMGLGTGGAGGGGGGGEMDFMP-- 197

Query: 189 MEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKIIE 248
              ++E+MM++L +KD LY  +K+   KYP WL +NK K+  E+Y++Y KQ++ + +I+ 
Sbjct: 198 ---VMENMMKSLLSKDVLYPSLKDITSKYPTWLSENKEKISSEEYSKYAKQNDLMGEIVR 254

Query: 249 KYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQGIP 299
           ++D     D D +   +   I+N+MQ++QE GQPP EI+ ++ PG++L+  G+P
Sbjct: 255 EFDEEKDADSDESKRLRFDRIMNVMQQMQELGQPPKEIVGDMPPGLDLDPNGLP 308



>gi|320582956|gb|EFW97173.1| peroxin19 Pex19p [Ogataea parapolymorpha DL-1]
          Length = 290

 Score =  103 bits (258), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 82/238 (34%), Positives = 132/238 (55%), Gaps = 40/238 (16%)

Query: 97  LMKNFGEVDED---NLNGTDFDNTGRSTVESNG------TSFQDKINQTMNKLQNSSEQL 147
           L+K  G  D D   NL G+  D+ G+    S+        +FQD I++T+N+L+ S EQ+
Sbjct: 63  LLKEIGAQDPDLSKNL-GSFLDDIGKQNSGSSSPQPATKNNFQDVISETINRLKESGEQV 121

Query: 148 DAEII--DGSNDQIMEMMKQIENMANLSGFAENDFEEMFGSGGME---KMLESMMEALAT 202
           D  I   DG+++ I  ++K ++   +L G           +GG+E    +L  M+E L++
Sbjct: 122 DKSIKEEDGNDELITSLLKSLDLNLDLKGLDGQ-------NGGVEDVGNLLVEMLEKLSS 174

Query: 203 KDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQ 262
           K+ LYEP+ +  QK+P WLE N      E+Y++Y++Q   I +II  +D PD +   +++
Sbjct: 175 KNVLYEPLNDLYQKFPAWLE-NPENQQDENYSKYQQQYAVIKEIISTFDLPDHE---DKK 230

Query: 263 NKAIINL-MQELQEFGQPPPEILNE----LAPG----MELNEQGIPSDLT-----SCK 306
           NK IIN  ++ELQE G PP E+LN+    L  G    +EL++  IP D+      +CK
Sbjct: 231 NKDIINTKLEELQELGMPPKELLNDDLKFLNFGGNSELELDDNDIPEDINKELEDTCK 288



>gi|393223026|gb|EJD08510.1| Pex19-domain-containing protein [Fomitiporia mediterranea MF3/22]
          Length = 324

 Score =  103 bits (258), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 79/277 (28%), Positives = 131/277 (47%), Gaps = 33/277 (11%)

Query: 56  SRDQADLPS-QLDDEYVKLLTADMEDFVKEFDENE------------------LSIAMQG 96
           + D   +PS QL DE  K L   ME  ++E  E +                  L   M G
Sbjct: 57  TADTTGIPSGQLPDELAKDLADGMEALMRELAEGQTGQISEEDRKRKEAWEKMLIEGMDG 116

Query: 97  LMKN--FGEVDEDNLNGTDFDNTGRSTVESNGTSFQDKINQTMNKLQNSSEQL--DAEII 152
           ++ N   G  + D  +  + +  G S+ +     FQ  I Q M KL++S   L  DA   
Sbjct: 117 MVDNELLGRNERDKPSTENENAGGSSSSKKAVDDFQASILQAMEKLKDSDSTLHTDASTS 176

Query: 153 DGSNDQIME-MMKQIENMANLSGFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMK 211
              +D  +E ++ Q+ +  + SG    D ++M         LE+MM+ L +K+ LYEP+K
Sbjct: 177 SAPSDDPLEAILNQLGSGLDESGEDNGDLQDM---------LETMMQQLMSKEVLYEPLK 227

Query: 212 EFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQ 271
           E   K+P +L +N  K+  ED  R+  Q   ++ I++ ++ P +  +++++   I++LM 
Sbjct: 228 ELHDKFPGYLSENDEKLSTEDKERFRNQMTRVSAIMQIFEDPSYKEDDQEKGAQIVSLMN 287

Query: 272 ELQEFGQPPPEILNELAPGMELNEQGIPSDLTSCKNM 308
           E+Q FG PP EI+  L  G++    G P     C  M
Sbjct: 288 EMQSFGSPPSEIMGSLPAGLDFGPDGTPKLPDGCTIM 324



>gi|477529971|gb|ENH81713.1| pex19 family protein [Colletotrichum orbiculare MAFF 240422]
          Length = 340

 Score =  103 bits (258), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 61/161 (37%), Positives = 94/161 (58%), Gaps = 11/161 (6%)

Query: 128 SFQDKINQTMNKLQNSSEQLDAEIIDGSN-DQIMEMMKQIENMANLSGFAENDFEEMFGS 186
           SFQ+ I +TM ++Q S EQ  A   + S  D + EMMKQ+ +  NL G  E +F      
Sbjct: 174 SFQETIRKTMERMQASGEQATAAAAESSTEDFLAEMMKQLGD-GNLEGGNEEEFS----- 227

Query: 187 GGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKI 246
               KML  MME L  K+ L+EPMKE  +K+P+WLE N+ K P ED  RYE+Q   + +I
Sbjct: 228 ----KMLMGMMEQLTNKEILHEPMKELNEKFPEWLEKNRDKTPAEDLKRYEEQQALVKEI 283

Query: 247 IEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNEL 287
           + K++   +  +N    + I++ MQ++Q  G PP +++ ++
Sbjct: 284 VAKFEEKTYADSNAADREYIVDRMQKMQAAGSPPSDLVGDM 324



>gi|500261044|gb|EOO03447.1| putative pex19-domain-containing protein [Togninia minima UCRPA7]
          Length = 301

 Score =  103 bits (257), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 72/215 (33%), Positives = 110/215 (51%), Gaps = 17/215 (7%)

Query: 67  DDEYVKLLTADMEDFVKEFDEN-ELSIAMQGLMKNFGEVDEDNLNGTDFDNTGRSTVESN 125
           DDE+ K L A M + + E + + E+    + + K  G    D+   T     G S  +S 
Sbjct: 94  DDEFAKQLQAGMAELMGEIENSPEMQAQFESIFKELGAA-ADSGAETPTAPAGPSATQSA 152

Query: 126 GT-----SFQDKINQTMNKLQNSSEQLDAEII-DGSNDQIMEMMKQIENMANLSGFAEND 179
           G      SFQ+ I +TM ++QNS +Q  A    +GS+D + E+MKQ++      G     
Sbjct: 153 GAATSEASFQETIRKTMERMQNSGDQATAAAAAEGSDDFMAELMKQMQ----AGGLDGEG 208

Query: 180 FEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQ 239
            EE F      KML  MME L  K+ LYEPMKE   K+P W E NK     +D  RYE+Q
Sbjct: 209 SEEEFS-----KMLLGMMEQLTNKEILYEPMKELNDKFPDWFEKNKATTSSDDLKRYEEQ 263

Query: 240 SEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQ 274
              + +I+ K++ P +  +N    + I++ MQ+++
Sbjct: 264 QGLVKEIVAKFEEPTYSDSNAADREYIVDRMQKVR 298



>gi|392871066|gb|EAS32928.2| peroxin 19 [Coccidioides immitis RS]
          Length = 345

 Score =  103 bits (257), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 99/172 (57%), Gaps = 9/172 (5%)

Query: 118 GRSTVESNGT---SFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSG 174
           G S+ + +G    +FQ+ I +TM ++Q S ++  A + D ++D ++  M +    A + G
Sbjct: 163 GESSKDQSGKPEETFQETIRKTMERMQESGDKATAAVNDSADDDVLVQMLKAMEAAGMGG 222

Query: 175 FAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYA 234
             + D E      G EKML  +ME L+ K+ LYEP+KE  +K+  WLE+NK K+  ED+ 
Sbjct: 223 DGQEDDE------GFEKMLMGVMEQLSNKEILYEPVKELHEKFGPWLEENKEKLSKEDFE 276

Query: 235 RYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNE 286
           R+ KQ+  +  +++K+D P +  +  +    I   MQE+Q  G PP E++++
Sbjct: 277 RHVKQAGLMADVMKKFDEPGYSDDKPEHRAYIWEKMQEMQSTGTPPKELVSD 328



>gi|260814193|ref|XP_002601800.1| hypothetical protein BRAFLDRAFT_121162 [Branchiostoma floridae]
 gi|229287102|gb|EEN57812.1| hypothetical protein BRAFLDRAFT_121162 [Branchiostoma floridae]
          Length = 302

 Score =  103 bits (257), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 58/206 (28%), Positives = 111/206 (53%), Gaps = 12/206 (5%)

Query: 97  LMKNFGEVDEDNLNGTDFDNTGRSTVESNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSN 156
           LM  F ++ E     +D +    ++ E   T     ++QT+  +  ++E+L    +  + 
Sbjct: 92  LMAQFSKLAEAAAKASDIEQGPEASPEGGTTELASSLSQTLQSMAQNAEELQNNPL--TE 149

Query: 157 DQIMEMMKQIENMANLSGFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQK 216
           D +++ M  +       G       E  G+  +  M+++MM+ L +K+ LY  +K+  QK
Sbjct: 150 DDLLKAMSDL-------GLGSEGTAEGAGATDLLPMMQTMMKNLLSKEVLYPSLKDICQK 202

Query: 217 YPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDA---PDFDGNNEQQNKAIINLMQEL 273
           YP WLE NK K+  ED  +Y +Q E + +I  ++++    D +    ++ +  ++LMQ++
Sbjct: 203 YPDWLEQNKSKLSQEDNQKYSQQFELMKQICGEFESEAETDAEEVKAKRFEKTLDLMQKM 262

Query: 274 QEFGQPPPEILNELAPGMELNEQGIP 299
           Q+ GQPP E++ E+APG+E +E G+P
Sbjct: 263 QDLGQPPKELVGEMAPGIEFDEHGVP 288



>gi|15088515|gb|AAK84070.1|AF176708_1 peroxin19 Pex19p [Ogataea angusta]
          Length = 290

 Score =  103 bits (256), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 78/230 (33%), Positives = 131/230 (56%), Gaps = 35/230 (15%)

Query: 97  LMKNFGEVDEDNLNGTDFDNTGRSTVE-SNGTSFQDKINQTMNKLQNSSEQLDAEII--D 153
           L KN G      L+     NTG S+ + +   +FQD I++T+N+L+ S EQ+D  I   D
Sbjct: 74  LSKNLGSF----LDDIGKQNTGPSSPQPATKNNFQDVISETINRLKESGEQVDKSIKHED 129

Query: 154 GSNDQIMEMMKQIENMANLSGFAENDFEEMFGSGGME---KMLESMMEALATKDYLYEPM 210
           G+++ I  ++K ++   +L G           +GG+E    +L  M+E L++K+ LYEP+
Sbjct: 130 GNDELITNLLKSLDLNLDLKGLDGQ-------NGGVEDVGNLLVEMLEKLSSKNVLYEPL 182

Query: 211 KEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINL- 269
            +  QK+P WLE  + +   E++++Y++Q   I +II  +D PD +   +++NK IIN+ 
Sbjct: 183 NDLYQKFPAWLEKPENQQ-DENFSKYQQQYAVIREIISTFDLPDHE---DKKNKDIINIK 238

Query: 270 MQELQEFGQPPPEILNE----LAPG----MELNEQGIPSDLT-----SCK 306
           ++ELQE G PP E+LN+    L  G    +EL++  IP D+      +CK
Sbjct: 239 LEELQELGMPPKELLNDDLKFLNFGGNSELELDDNDIPEDINKELEDTCK 288



>gi|242063020|ref|XP_002452799.1| hypothetical protein SORBIDRAFT_04g032760 [Sorghum bicolor]
 gi|241932630|gb|EES05775.1| hypothetical protein SORBIDRAFT_04g032760 [Sorghum bicolor]
          Length = 263

 Score =  103 bits (256), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 49/118 (41%), Positives = 79/118 (66%), Gaps = 6/118 (5%)

Query: 180 FEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQ 239
           FEE  G+  M+ ++E+MM+ L +K+ L+EPMK+  +KYPKWLEDNK K+  E+Y RY  Q
Sbjct: 136 FEEFAGAQDMDSIVETMMQQLLSKEILHEPMKDIVEKYPKWLEDNKDKISKEEYGRYNNQ 195

Query: 240 SEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQG 297
            E + K+IE Y+      N+ +    I ++MQ +QE GQPP +++ ++ P ++L++ G
Sbjct: 196 LELMVKLIEVYE------NDPENMTKIFDIMQNMQECGQPPSDLVQDVVPDLDLSKLG 247



>gi|405960503|gb|EKC26424.1| Peroxisomal biogenesis factor 19 [Crassostrea gigas]
          Length = 282

 Score =  102 bits (255), Expect = 9e-20,   Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 105/192 (54%), Gaps = 17/192 (8%)

Query: 132 KINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMA-NLSGFA----ENDFEEMFGS 186
           K+ + + KL  ++E+ D     GS D        IE+M  NL G      + D  + F S
Sbjct: 93  KMKEQIEKLAEAAEKTDG--AQGSEDFAKTFASTIESMTENLDGLQGDMNDEDLLKAFTS 150

Query: 187 GGMEK-------MLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQ 239
            GME+       M++ MM+ L +K+ LY  +KE +QKYPKW+E+NK KV  +   +Y + 
Sbjct: 151 MGMEEEGEGFMPMMQGMMKTLLSKEILYPSLKELSQKYPKWIEENKNKVEAQQMTKYREH 210

Query: 240 SEYINKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQ 296
              + +I  +++A    D +   + + + I++LMQ++Q  GQPP EI+ ++APG+E +E 
Sbjct: 211 DRIVREICVEFEAEHVSDTEDVKKLRFERIVDLMQQMQNMGQPPKEIVGDMAPGLEFDEN 270

Query: 297 GIPSDLTSCKNM 308
           G+P     C  M
Sbjct: 271 GMPKMPNGCPMM 282



>gi|351727995|ref|NP_001236156.1| uncharacterized protein LOC100500051 [Glycine max]
 gi|255628831|gb|ACU14760.1| unknown [Glycine max]
          Length = 244

 Score =  102 bits (255), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 53/118 (44%), Positives = 76/118 (64%), Gaps = 6/118 (5%)

Query: 180 FEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQ 239
           FE++ GS  ME ++E+MM+ L +K+ L+EPMKE A+KYPKWLE++K  +  E+Y RY  Q
Sbjct: 117 FEQLAGSQDMESIVETMMQQLLSKEILHEPMKEIAEKYPKWLEEHKSSLSKEEYDRYSHQ 176

Query: 240 SEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQG 297
            E I  + E YD      N+      I+ L+Q++QE GQPP +I+ ELAP  +L   G
Sbjct: 177 YELIRNLNEVYD------NDPGNFNKIVELIQKMQECGQPPNDIVQELAPDFDLASLG 228



>gi|224138592|ref|XP_002326641.1| predicted protein [Populus trichocarpa]
 gi|222833963|gb|EEE72440.1| predicted protein [Populus trichocarpa]
          Length = 253

 Score =  102 bits (255), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 60/159 (37%), Positives = 92/159 (57%), Gaps = 17/159 (10%)

Query: 150 EIIDGSNDQIMEMMKQIENMANLS--------GFAEN---DFEEMFGSGGMEKMLESMME 198
           E +D   +Q  E +K +E++   S         F ++    FEE+ GS  ME ++E+MM+
Sbjct: 85  EALDKLREQAREAVKGLESVTAASKPDDSTKDAFTDDWVKQFEELAGSQDMESIVETMMQ 144

Query: 199 ALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGN 258
            L +K+ LYEPMKE  ++YPKWLE++K  +  ED+ RY  Q E I  + + YD+   + N
Sbjct: 145 QLLSKEILYEPMKEIGERYPKWLEEHKASLNKEDHERYSHQYELIKDLNDVYDSDPSNYN 204

Query: 259 NEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQG 297
                  I +LMQ++QE GQPP +I+ ELAP ++    G
Sbjct: 205 K------IFDLMQKMQECGQPPNDIVQELAPDIDFANLG 237



>gi|392562985|gb|EIW56165.1| Pex19-domain-containing protein [Trametes versicolor FP-101664 SS1]
          Length = 323

 Score =  102 bits (254), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 96/180 (53%), Gaps = 16/180 (8%)

Query: 128 SFQDKINQTMNKLQNSSEQLD--AEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEMFG 185
           SFQ+ I + M +++ S  + D      DG +D   ++   ++ M       E++ E    
Sbjct: 155 SFQENIRKAMERMKESDRKADEATSTGDGLDDIFSKLGNGVDGM-------ESEEE---- 203

Query: 186 SGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINK 245
              ++ +LE+MM  L +K  LYEP+KE + K+P +L+DN   +  ED  R+  QS+ + +
Sbjct: 204 ---LQGLLENMMSQLMSKAVLYEPLKELSDKFPSYLKDNAATLSDEDKTRFAAQSKVVAQ 260

Query: 246 IIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQGIPSDLTSC 305
           I+  ++ P +  ++  +   I+ LMQE+QE G PP EI+  L PG +L   G+P     C
Sbjct: 261 IVATFEDPSYTEDDPVKGLKIVELMQEMQEHGSPPAEIMGPLPPGFDLGADGLPKVPEGC 320



>gi|226502104|ref|NP_001149245.1| peroxisomal biogenesis factor 19 [Zea mays]
 gi|195625742|gb|ACG34701.1| peroxisomal biogenesis factor 19 [Zea mays]
 gi|238014332|gb|ACR38201.1| unknown [Zea mays]
 gi|413938109|gb|AFW72660.1| peroxisomal biogenesis factor 19 [Zea mays]
          Length = 253

 Score =  102 bits (253), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 48/118 (40%), Positives = 79/118 (66%), Gaps = 6/118 (5%)

Query: 180 FEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQ 239
           F+E  G+  M+ ++E+MM+ L +K+ L+EPMK+  +KYPKWLEDNK K+  E+Y RY  Q
Sbjct: 126 FQEFAGAQDMDSIVETMMQQLLSKEILHEPMKDIVEKYPKWLEDNKDKISKEEYGRYNNQ 185

Query: 240 SEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQG 297
            E + K+IE Y+      N+ +    I ++MQ +QE GQPP +++ ++ P ++L++ G
Sbjct: 186 LELMVKLIEVYE------NDPENMTRIFDIMQNMQECGQPPSDLVQDIVPDLDLSKLG 237



>gi|224074153|ref|XP_002304276.1| predicted protein [Populus trichocarpa]
 gi|222841708|gb|EEE79255.1| predicted protein [Populus trichocarpa]
          Length = 251

 Score =  102 bits (253), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 92/159 (57%), Gaps = 17/159 (10%)

Query: 150 EIIDGSNDQIMEMMKQIENMANLS--------GFAEN---DFEEMFGSGGMEKMLESMME 198
           E +D   +Q  E +K +E++   S         F ++    FEE+ GS  ME ++E+MM+
Sbjct: 83  EALDKLREQTREAVKGLESVTAASKPDDSSQDAFMDDWVKQFEELAGSQDMESIVETMMQ 142

Query: 199 ALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGN 258
            L +K+ L+EPMKE  ++YPKWLE++K  +  ED+ RY  Q E I  + + Y+      N
Sbjct: 143 QLLSKEILHEPMKEIGERYPKWLEEHKASLSKEDHERYSHQYELIKDLNDVYE------N 196

Query: 259 NEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQG 297
           +   +  I +LMQ++QE GQPP +I+ ELAP ++    G
Sbjct: 197 DPNNHTKIFDLMQKMQECGQPPNDIVQELAPDIDFANLG 235



>gi|512192403|gb|EPE08162.1| pex19 family protein [Ophiostoma piceae UAMH 11346]
          Length = 494

 Score =  102 bits (253), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 68/255 (26%), Positives = 117/255 (45%), Gaps = 46/255 (18%)

Query: 67  DDEYVKLLTADMEDFVKEFDEN-ELSIAMQGLMKNFGEVDEDN----------------- 108
           DD++ K L A M D + EFD++ ++    + L+K FG    D                  
Sbjct: 235 DDDFAKQLQAGMADLLGEFDKSPDVQAQFESLLKEFGMPPSDGSAGGDMAAAAAAATGAT 294

Query: 109 ----------LNGTDFDNTGRSTVESNGTSFQDKINQTMNKLQNSSEQLDAEI---IDGS 155
                        +           ++  SF++ I  TM ++Q S +Q  A      + +
Sbjct: 295 AAAHVAGKQPAAASSTPKAAPGAPAASEASFEETIRLTMERMQASGDQATAAAAADTENT 354

Query: 156 NDQIMEMMKQIENMANLSGFAENDFEEMFGSGG---MEKMLESMMEALATKDYLYEPMKE 212
           +D + E MKQ+++              M G G    + KML  MME L  K+ LYEPMKE
Sbjct: 355 DDMLSEFMKQMQSGG------------MGGPGSEEELSKMLVGMMEELTNKEILYEPMKE 402

Query: 213 FAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQE 272
              K+P W++ NK K P +D  RY++Q   + +I+ +++ P +   N +  + I++ MQ 
Sbjct: 403 LHDKFPAWMDANKDKTPADDLTRYQEQQSIVREIVTRFETPSYSDTNPEDREYIVDRMQR 462

Query: 273 LQEFGQPPPEILNEL 287
           +Q  G PP +++ ++
Sbjct: 463 MQTAGSPPADLVGDM 477



>gi|297833004|ref|XP_002884384.1| peroxisomal protein PEX19 family protein [Arabidopsis lyrata subsp.
           lyrata]
 gi|297330224|gb|EFH60643.1| peroxisomal protein PEX19 family protein [Arabidopsis lyrata subsp.
           lyrata]
          Length = 246

 Score =  101 bits (252), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 57/160 (35%), Positives = 94/160 (58%), Gaps = 18/160 (11%)

Query: 149 AEIIDGSNDQIMEMMKQIENMANLSGFAEND----------FEEMFGSGGMEKMLESMME 198
           AE +D   +Q  E +K +E++++    A +D          FE++ GS  +E ++E+MM+
Sbjct: 78  AEALDKLREQTRETVKGLESISSKQLPASDDDGMVEDLLKQFEDLTGSQDLESIVETMMQ 137

Query: 199 ALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGN 258
            L +KD L+EPMKE   +YPKWL++N+  +  EDY RY +Q + I ++   Y+       
Sbjct: 138 QLLSKDILHEPMKELGARYPKWLKENEASLTKEDYKRYSQQYKLIEELNAVYE------- 190

Query: 259 NEQQNKA-IINLMQELQEFGQPPPEILNELAPGMELNEQG 297
           NE  N + I+ +MQ++QE GQPP +I+ E+ PG +    G
Sbjct: 191 NEPNNSSKIMEIMQKMQECGQPPSDIVKEIDPGFDFASLG 230



>gi|242784369|ref|XP_002480373.1| peroxisomal membrane protein receptor Pex19, putative [Talaromyces
           stipitatus ATCC 10500]
 gi|218720520|gb|EED19939.1| peroxisomal membrane protein receptor Pex19, putative [Talaromyces
           stipitatus ATCC 10500]
          Length = 375

 Score =  101 bits (251), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 68/210 (32%), Positives = 112/210 (53%), Gaps = 38/210 (18%)

Query: 109 LNGTDFDNTGRST------VESNGTSFQDKINQTMNKLQNSSEQLDAE-------IIDGS 155
           L G+D    G ST      V + G  FQD I +T+++++ S +++  E       +ID S
Sbjct: 160 LFGSDGPPAGDSTKGKDKPVTAAGEPFQDTIQRTLDRMKESGDKITVEAQTNQDKLIDAS 219

Query: 156 NDQIMEMMKQIENMANLSGFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQ 215
             ++ME+M    N    SG          GS  +E++   +++ ++ K+ LYEPMKE+  
Sbjct: 220 VMKLMEIM----NETATSG----------GSFNIEEVFSDIIKEMSNKEMLYEPMKEYNV 265

Query: 216 KYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQE 275
           KY  WLE+NK  +  EDY R+EKQ+  + KI+E+++A D+     +   +I +LMQ+++ 
Sbjct: 266 KYGPWLEENKATLSSEDYERFEKQAGVVKKIVERFEAEDYTDEKPECLASIWDLMQQMEA 325

Query: 276 FGQPPPE----------ILNELAPGMELNE 295
            G PPPE          +L  L P ++ NE
Sbjct: 326 CG-PPPEDLIKGSMGDGVLPSLTPFLDRNE 354



>gi|169857129|ref|XP_001835217.1| peroxin19 Pex19p [Coprinopsis cinerea okayama7#130]
 gi|116503669|gb|EAU86564.1| peroxin19 Pex19p [Coprinopsis cinerea okayama7#130]
          Length = 405

 Score =  101 bits (251), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 74/246 (30%), Positives = 124/246 (50%), Gaps = 22/246 (8%)

Query: 67  DDEYVKLLTADMEDFVKEFDENELSIAMQGLMKNFGEVDED-NLNGTDFDNTGRSTVESN 125
           DDE  K L A  E  + E    +   A + L+ + GE+  D + +G     +G S V   
Sbjct: 172 DDETTKALKAAWEAMLVEGMNGK---AGEELLPSLGEILGDKSTSGAAGGPSGESKVVEG 228

Query: 126 GTSFQDKINQTMNKLQNSSEQLD------AEIIDGSNDQIMEMMKQIENMANLSGFAEND 179
              FQ++I Q M+KL+ S ++            DG    + +++K + ++    G  EN+
Sbjct: 229 ---FQERIRQAMDKLKESEDKAREASGQAPSGADGGPQTMEDLLKGLSDLGLQDG--ENE 283

Query: 180 FEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQ 239
            E       +   LESMM  L +K+ LYEP+KE    +P +L +    +  ED +RYEKQ
Sbjct: 284 SE-------LAGFLESMMSQLMSKEILYEPLKELRDSFPGYLANPPKPLSDEDRSRYEKQ 336

Query: 240 SEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQGIP 299
              + +II+ ++ P ++ ++   NKA+I+LM E+Q  G PP E++ +L  G + N  G+ 
Sbjct: 337 HAIVTQIIDLFEKPTYNDSDPASNKAVIDLMSEMQSHGSPPTELMGDLPEGFDGNLPGLD 396

Query: 300 SDLTSC 305
            +   C
Sbjct: 397 PNNPEC 402



>gi|502152386|ref|XP_004508903.1| PREDICTED: peroxisome biogenesis protein 19-2-like [Cicer
           arietinum]
          Length = 247

 Score =  101 bits (251), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 76/120 (63%), Gaps = 10/120 (8%)

Query: 180 FEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQ 239
           FE++ GS  ME ++E+MM+ L +K+ L+EPMKE  ++YPKWLE++K  +  EDY RY  Q
Sbjct: 120 FEDLAGSQDMESIMETMMQQLLSKEILHEPMKEIGERYPKWLEEHKASLSKEDYDRYSHQ 179

Query: 240 SEYINKIIEKY--DAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQG 297
            E I  + E Y  D  +F+         I+ LMQ++QE GQPP +I+ ELAP  +L   G
Sbjct: 180 YELIRNLNEVYEKDPSNFN--------KIVELMQKMQECGQPPNDIVQELAPDFDLASLG 231



>gi|413923356|gb|AFW63288.1| peroxisomal biogenesis factor 19 [Zea mays]
          Length = 252

 Score =  101 bits (251), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 49/118 (41%), Positives = 78/118 (66%), Gaps = 6/118 (5%)

Query: 180 FEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQ 239
           FEE  G+  M+ ++E+MM+ L +K+ L+EPMK+  +KYPKWLEDNK K+  E+Y RY  Q
Sbjct: 125 FEEFAGAQDMDSIVETMMQQLLSKEILHEPMKDIVEKYPKWLEDNKNKISKEEYERYNNQ 184

Query: 240 SEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQG 297
            E + K+IE Y+      N+ +    I ++MQ +QE GQPP +++ +  P ++L++ G
Sbjct: 185 LELMVKLIEVYE------NDPENMTKIFDIMQNMQECGQPPSDLVQDTVPDLDLSKLG 236



>gi|402085757|gb|EJT80655.1| hypothetical protein GGTG_00649 [Gaeumannomyces graminis var.
           tritici R3-111a-1]
          Length = 441

 Score =  101 bits (251), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 71/234 (30%), Positives = 114/234 (48%), Gaps = 22/234 (9%)

Query: 67  DDEYVKLLTADMEDFVKEFDEN-ELSIAMQGLMKNFGEVDEDNLNGTDFDNTGRSTVESN 125
           ++E+ K L A M D + E + + E+    +     F E+   ++       +G     S 
Sbjct: 199 EEEFAKQLQAGMADLLGEMETSPEMKAQFEQFESIFKELGAADVAAESQPPSGAGAAPSQ 258

Query: 126 G--------TSFQDKINQTMNKLQNSSEQLDAEIIDGS---NDQIMEMMKQIENMANLSG 174
           G        ++FQD I +TM ++Q S E   A     S   +D + EM+K + +     G
Sbjct: 259 GAKGAGGPGSTFQDNIRRTMERIQASGESATAAATADSQSADDLLAEMLKSMNSGQGGLG 318

Query: 175 FAEN-DFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDY 233
                DF          KML  MME L  K+ LYEPMKE + KYP+WLE NKG +  ED 
Sbjct: 319 EGGEEDFS---------KMLLGMMEQLTNKEILYEPMKELSDKYPEWLEKNKGTISAEDL 369

Query: 234 ARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNEL 287
           ARY+ Q     +I+ K++   +  +N    + I++ MQ++Q  G PP +++ ++
Sbjct: 370 ARYKVQQRLAGEIVAKFEEKSYADSNAADREYIVDRMQKMQAEGSPPSDLVGDM 423



>gi|219887619|gb|ACL54184.1| unknown [Zea mays]
          Length = 252

 Score =  101 bits (251), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 49/118 (41%), Positives = 78/118 (66%), Gaps = 6/118 (5%)

Query: 180 FEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQ 239
           FEE  G+  M+ ++E+MM+ L +K+ L+EPMK+  +KYPKWLEDNK K+  E+Y RY  Q
Sbjct: 125 FEEFAGAQDMDSIVETMMQQLLSKEILHEPMKDIVEKYPKWLEDNKNKISKEEYERYNNQ 184

Query: 240 SEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQG 297
            E + K+IE Y+      N+ +    I ++MQ +QE GQPP +++ +  P ++L++ G
Sbjct: 185 LELMVKLIEVYE------NDPENMTKIFDIMQNMQECGQPPSDLVQDTVPDLDLSKLG 236



>gi|451855131|gb|EMD68423.1| hypothetical protein COCSADRAFT_167664 [Bipolaris sorokiniana
           ND90Pr]
          Length = 337

 Score =  101 bits (251), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 78/251 (31%), Positives = 122/251 (48%), Gaps = 18/251 (7%)

Query: 58  DQADLPSQLDDEYVKLLTADMEDFVKEFDE--NELSIAMQGL--MKNFGEVDEDNLNGTD 113
           DQ +   QL  E  +LL     DF K+F+E   E+S  M G   +   G    +      
Sbjct: 96  DQEEFQKQLQKEMEQLLGQG--DFQKQFEEIMKEMSEEMGGANPLDAGGHAHSEGQKAAG 153

Query: 114 FDNTG-RSTVESNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANL 172
              +  + TV     SFQ+ I +TM ++Q+SS+   +     S D I+  M        L
Sbjct: 154 ASTSSEKETVAKAEKSFQETIKKTMERMQSSSDTAASAAASSSQDDILAQM--------L 205

Query: 173 SGFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPED 232
           +      F    G     K+L  MME L  KD LYEPMKE   K+PKW+E+N+ KV  +D
Sbjct: 206 ASMESGGFGGEGGDEDFSKVLMGMMEQLTNKDILYEPMKELDDKFPKWMEENRAKVEKDD 265

Query: 233 YARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGME 292
             RYE+Q   + +I+ +++   +  +N Q  + I+  MQ++Q  G PPP+++ ++    E
Sbjct: 266 LKRYEEQQTLVREIVGRFERKGYSDDNAQDREYIVERMQKMQAAGSPPPDLVGDMNAAQE 325

Query: 293 L---NEQGIPS 300
                +QG P+
Sbjct: 326 ALQDMDQGCPT 336



>gi|413923355|gb|AFW63287.1| hypothetical protein ZEAMMB73_457398 [Zea mays]
          Length = 136

 Score =  100 bits (250), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 49/118 (41%), Positives = 78/118 (66%), Gaps = 6/118 (5%)

Query: 180 FEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQ 239
           FEE  G+  M+ ++E+MM+ L +K+ L+EPMK+  +KYPKWLEDNK K+  E+Y RY  Q
Sbjct: 9   FEEFAGAQDMDSIVETMMQQLLSKEILHEPMKDIVEKYPKWLEDNKNKISKEEYERYNNQ 68

Query: 240 SEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQG 297
            E + K+IE Y+      N+ +    I ++MQ +QE GQPP +++ +  P ++L++ G
Sbjct: 69  LELMVKLIEVYE------NDPENMTKIFDIMQNMQECGQPPSDLVQDTVPDLDLSKLG 120



>gi|477509404|gb|ENH62696.1| Peroxisomal biogenesis factor 19 [Fusarium oxysporum f. sp. cubense
           race 1]
          Length = 440

 Score =  100 bits (250), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 69/224 (30%), Positives = 114/224 (50%), Gaps = 9/224 (4%)

Query: 67  DDEYVKLLTADMEDFVKEFDEN-ELSIAMQGLMKNFGEVDEDNLNGTDFDNTGRST-VES 124
           +DE+ K L A M D + E +++ ++    + + K+    +          + G S+    
Sbjct: 206 EDEFAKQLQAGMADLLGELEQSPDMQAQFEDIFKHIAAAEGAGDAPPPSTSKGPSSQAPP 265

Query: 125 NGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIM-EMMKQIENMANLSGFAENDFEEM 183
              SFQD I +TM ++Q S +Q  A    GS D  M EM+KQ+ +        +   EE 
Sbjct: 266 EDASFQDTIKRTMERMQASGDQATAAAASGSADDFMSEMLKQLSSGDLGDLGGDGSEEEF 325

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
                  KML  MME L  K+ LYEPMKE  +K+P+WL  N+   P ED  RYE+Q   +
Sbjct: 326 ------SKMLMGMMEQLTNKEILYEPMKELDEKFPEWLIKNRDSTPKEDLKRYEEQQSIV 379

Query: 244 NKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNEL 287
            +I+ K++   +  +N    + I++ MQ++Q  G PP +++ ++
Sbjct: 380 REIVAKFEEKTYSDSNATDREFIVDKMQKMQAAGSPPSDLVGDM 423



>gi|475665919|gb|EMT63711.1| Peroxisomal biogenesis factor 19 [Fusarium oxysporum f. sp. cubense
           race 4]
          Length = 441

 Score =  100 bits (249), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 69/224 (30%), Positives = 114/224 (50%), Gaps = 9/224 (4%)

Query: 67  DDEYVKLLTADMEDFVKEFDEN-ELSIAMQGLMKNFGEVDEDNLNGTDFDNTGRST-VES 124
           +DE+ K L A M D + E +++ ++    + + K+    +          + G S+    
Sbjct: 207 EDEFAKQLQAGMADLLGELEQSPDMQAQFEDIFKHIAAAEGAGDAPPPSTSKGPSSQAPP 266

Query: 125 NGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIM-EMMKQIENMANLSGFAENDFEEM 183
              SFQD I +TM ++Q S +Q  A    GS D  M EM+KQ+ +        +   EE 
Sbjct: 267 EDASFQDTIKRTMERMQASGDQATAAAASGSADDFMSEMLKQLSSGDLGDLGGDGSEEEF 326

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
                  KML  MME L  K+ LYEPMKE  +K+P+WL  N+   P ED  RYE+Q   +
Sbjct: 327 ------SKMLMGMMEQLTNKEILYEPMKELDEKFPEWLIKNRDSTPKEDLKRYEEQQSIV 380

Query: 244 NKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNEL 287
            +I+ K++   +  +N    + I++ MQ++Q  G PP +++ ++
Sbjct: 381 REIVAKFEEKTYSDSNATDREFIVDKMQKMQAAGSPPSDLVGDM 424



>gi|342879022|gb|EGU80299.1| hypothetical protein FOXB_09226 [Fusarium oxysporum Fo5176]
          Length = 445

 Score =  100 bits (249), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 69/224 (30%), Positives = 114/224 (50%), Gaps = 9/224 (4%)

Query: 67  DDEYVKLLTADMEDFVKEFDEN-ELSIAMQGLMKNFGEVDEDNLNGTDFDNTGRST-VES 124
           +DE+ K L A M D + E +++ ++    + + K+    +          + G S+    
Sbjct: 211 EDEFAKQLQAGMADLLGELEQSPDMQAQFEDIFKHIAAAEGAGDAPPPSTSKGPSSQAPP 270

Query: 125 NGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIM-EMMKQIENMANLSGFAENDFEEM 183
              SFQD I +TM ++Q S +Q  A    GS D  M EM+KQ+ +        +   EE 
Sbjct: 271 EDASFQDTIKRTMERMQASGDQATAAAASGSADDFMSEMLKQLSSGDLGDLGGDGSEEEF 330

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
                  KML  MME L  K+ LYEPMKE  +K+P+WL  N+   P ED  RYE+Q   +
Sbjct: 331 ------SKMLMGMMEQLTNKEILYEPMKELDEKFPEWLIKNRDSTPKEDLKRYEEQQSIV 384

Query: 244 NKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNEL 287
            +I+ K++   +  +N    + I++ MQ++Q  G PP +++ ++
Sbjct: 385 REIVAKFEEKTYSDSNATDREFIVDKMQKMQAAGSPPSDLVGDM 428



>gi|328767816|gb|EGF77864.1| hypothetical protein BATDEDRAFT_27170 [Batrachochytrium
           dendrobatidis JAM81]
          Length = 309

 Score =  100 bits (249), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 62/178 (34%), Positives = 100/178 (56%), Gaps = 21/178 (11%)

Query: 129 FQDKINQTMNKLQNSSEQLDAE----IIDGSN--DQIM-EMMKQIENMANLSGFAENDFE 181
           FQD + QTMNKL+ SS++  A+    +  GS+  D +M +M+K++E M +  GF     E
Sbjct: 136 FQDHVAQTMNKLRESSDKAKAQANEDMRGGSSLDDPLMADMLKELEGMMDSEGF-----E 190

Query: 182 EMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSE 241
           +MFG           ++ L  K++LYEP+K  ++KYP WLE N+  +   D  RYE Q E
Sbjct: 191 DMFGG---------FVDQLMKKEFLYEPLKTLSEKYPPWLEANRSSLTEHDRVRYESQLE 241

Query: 242 YINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQGIP 299
            I +I   Y+    D    +Q+K I++ + ++Q FG PP E++ ++  G  +   G+P
Sbjct: 242 AIYEIKSIYEKLPSDEPTSEQSKEIMDCLAKIQGFGNPPDELMKQMMGGEGVGSDGMP 299



>gi|392562993|gb|EIW56173.1| Pex19-domain-containing protein [Trametes versicolor FP-101664 SS1]
          Length = 326

 Score =  100 bits (249), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 95/180 (52%), Gaps = 16/180 (8%)

Query: 128 SFQDKINQTMNKLQNSSEQLDAEII--DGSNDQIMEMMKQIENMANLSGFAENDFEEMFG 185
           SFQ+ I + M +++ S  + D      DG +D   ++   +  M       E++ E    
Sbjct: 158 SFQENIRKAMERMKESDRKADEATSSGDGLDDIFSKLGDGVNGM-------ESEEE---- 206

Query: 186 SGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINK 245
              ++ +LE+MM  L +K  LYEP+KE + K+P +L+DN   +  ED  R+  QS+ + +
Sbjct: 207 ---LQGLLENMMSQLMSKAVLYEPLKELSDKFPSYLKDNAATLSDEDKTRFAAQSKVVAQ 263

Query: 246 IIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQGIPSDLTSC 305
           I+  ++ P +  ++  +   I+ LMQE+QE G PP EI+  L PG +L   G+P     C
Sbjct: 264 IVATFEDPSYTEDDPVKGLKIVELMQEMQEHGSPPAEIMGPLPPGFDLGADGLPKVPEGC 323



>gi|70999616|ref|XP_754525.1| peroxisomal membrane protein receptor Pex19 [Aspergillus fumigatus
           Af293]
 gi|66852162|gb|EAL92487.1| peroxisomal membrane protein receptor Pex19, putative [Aspergillus
           fumigatus Af293]
 gi|159127538|gb|EDP52653.1| peroxisomal membrane protein receptor Pex19, putative [Aspergillus
           fumigatus A1163]
          Length = 389

 Score =  100 bits (249), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 57/164 (34%), Positives = 96/164 (58%), Gaps = 21/164 (12%)

Query: 128 SFQDKINQTMNKLQNSSEQLDAEII-DG--SNDQIMEMMKQIENMANLSGFAENDFEEMF 184
           SF D I +T+N+++ S ++  A    DG  S D +M+++K +E     +G          
Sbjct: 217 SFNDAIQRTINRMKESGDKATAAATEDGGISEDMLMQLLKGLE-----AGV--------- 262

Query: 185 GSGG----MEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQS 240
           G+GG    + +M+  +ME  + K+ LYEPMKE   K+  WL++NKGKVP ED  RYEKQ+
Sbjct: 263 GNGGDDLDLTQMIAGVMEQFSNKEMLYEPMKELDAKWGPWLKENKGKVPAEDMKRYEKQA 322

Query: 241 EYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEIL 284
           + + +I+ K++  ++   + +  +A+   MQE+Q  G PP E++
Sbjct: 323 KLVTEIVAKFEEEEYTDEDPKYRQAVWEKMQEMQALGSPPEELV 366



>gi|508777085|gb|EOY24341.1| Peroxin 19-2 [Theobroma cacao]
          Length = 245

 Score =  100 bits (248), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 60/160 (37%), Positives = 94/160 (58%), Gaps = 18/160 (11%)

Query: 149 AEIIDGSNDQIMEMMKQIENMANLSG-------FAEN---DFEEMFGSGGMEKMLESMME 198
            E +D   +Q  E +K +E+M+   G         E+    FEE+ GS  ME ++E+MM+
Sbjct: 77  TEALDKLREQTRETVKGLESMSKPGGDDLGKDAMMEDWVKQFEELAGSQDMESIVETMMQ 136

Query: 199 ALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGN 258
            L +K+ L+EPMKE  ++YP+WLE+++  +  E+Y RY  Q E I ++   Y+       
Sbjct: 137 QLLSKEILHEPMKEIGERYPQWLEEHEASLSKEEYERYSHQHELIKELNGVYE------- 189

Query: 259 NEQQN-KAIINLMQELQEFGQPPPEILNELAPGMELNEQG 297
           NE  N   I++LMQ++QE GQPP +I+ ELAP  +L+  G
Sbjct: 190 NEPNNFTRIVDLMQKMQECGQPPNDIVQELAPEFDLSNLG 229



>gi|326512292|dbj|BAJ96127.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 252

 Score =  100 bits (248), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 79/119 (66%), Gaps = 8/119 (6%)

Query: 180 FEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQ 239
           FEE  G+  M+ ++E+MM+ L +K+ LYEPMK+  +KYPKWLEDNK K+  E+Y RY  Q
Sbjct: 125 FEEFAGTQDMDSIVETMMKQLLSKEILYEPMKDIVEKYPKWLEDNKSKISKEEYERYSNQ 184

Query: 240 SEYINKIIEKYDAPDFDGNNEQQNKA-IINLMQELQEFGQPPPEILNELAPGMELNEQG 297
            E + K+ E Y+       +E +N + +  +MQ +QE GQPP +++ ++ P ++L++ G
Sbjct: 185 LELMLKLNEVYE-------HEPENMSKVFEIMQNMQECGQPPSDLVQDIVPDLDLSKLG 236



>gi|410986679|ref|XP_003999637.1| PREDICTED: peroxisomal biogenesis factor 19 isoform 1 [Felis catus]
          Length = 299

 Score = 99.8 bits (247), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 70/244 (28%), Positives = 121/244 (49%), Gaps = 39/244 (15%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDATSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSEE--ELTKAMEGL----GMEEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++G +PPE + +Y++Q   +
Sbjct: 167 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRGSLPPEQFEKYQEQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM-----ELNE 295
            KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ PG+      LN 
Sbjct: 226 GKICEQFEAETPTDSEATQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNL 285

Query: 296 QGIP 299
            G P
Sbjct: 286 SGPP 289



>gi|403158426|ref|XP_003307718.2| hypothetical protein PGTG_00668 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|375163811|gb|EFP74712.2| hypothetical protein PGTG_00668 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 350

 Score = 99.8 bits (247), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 62/197 (31%), Positives = 103/197 (52%), Gaps = 40/197 (20%)

Query: 123 ESNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAEND--- 179
           E    +FQ+ I +TM KL+ S +   A+                   +  SG  E D   
Sbjct: 166 EHESKNFQEAIQETMEKLKRSDDSAKAK-------------------SGPSGAGEEDEKL 206

Query: 180 ---FEEMF-GSGGM------EKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVP 229
              FE+M  G  G+      + +L+S ME L +K+ +YEP+K+  + +P W+E+N+ K+ 
Sbjct: 207 SALFEKMMSGENGLPDETQLQTILQSFMEELMSKEIMYEPLKDMNRLFPDWIEENRSKLS 266

Query: 230 PEDYARYEKQSEYINKIIEKYDAPDFDGNNE-------QQNKAIINLMQELQEFGQPPPE 282
           PED  RYE Q++ I ++IE++D P +D   +        + K +I L+ ++Q+ G PP E
Sbjct: 267 PEDMKRYETQAKIIEQVIERFDDPSWDSEEKAGGDRFLSRQKEVIELLTKMQDCGPPPKE 326

Query: 283 ILNELAPGMELNEQGIP 299
           IL ++ PG+   E G+P
Sbjct: 327 ILGDMPPGV-FGEDGLP 342



>gi|449458948|ref|XP_004147208.1| PREDICTED: peroxisome biogenesis protein 19-1-like [Cucumis
           sativus]
 gi|449504984|ref|XP_004162347.1| PREDICTED: peroxisome biogenesis protein 19-1-like [Cucumis
           sativus]
          Length = 237

 Score = 99.8 bits (247), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 77/236 (32%), Positives = 123/236 (52%), Gaps = 32/236 (13%)

Query: 68  DEYVKLLTADMEDFVKEFDENELSIAMQGLMKNFGEVDEDNLNGTDFDNTGRSTVESNGT 127
           D+  +LL + ++DF K FD N  S++  G             +G +      S V+  G 
Sbjct: 6   DDLHELLDSALDDFQK-FDLNP-SLSRNG-------------DGAESRAVLPSGVQGLGM 50

Query: 128 SFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMAN-------LSGFAENDF 180
              D  ++   K + S E   +E +D   +Q  E +K +E+++        L       F
Sbjct: 51  GLPDLRSKKKGKQKVSKESHVSEALDKLREQTREAVKGLESVSGPKPGEDALMEDWVKQF 110

Query: 181 EEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQS 240
           EEM GS  ME ++E+MM+ L +K+ L+EPMKE  ++YPKWLED+K  +  E+Y RY +Q 
Sbjct: 111 EEMAGSQDMESIVETMMQQLLSKEILHEPMKEIGERYPKWLEDHKASLSKEEYERYSQQY 170

Query: 241 EYIN--KIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELN 294
             I    I+ + +  +F+         I+ LMQ++QE GQPP +I+ ELAP  +L+
Sbjct: 171 NLIKDLNIVYEREPDNFN--------KIVELMQKMQECGQPPNDIVQELAPDFDLS 218



>gi|392562988|gb|EIW56168.1| Pex19 protein [Trametes versicolor FP-101664 SS1]
          Length = 323

 Score = 99.4 bits (246), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 95/180 (52%), Gaps = 16/180 (8%)

Query: 128 SFQDKINQTMNKLQNSSEQLDAEII--DGSNDQIMEMMKQIENMANLSGFAENDFEEMFG 185
           SFQ+ I + M +++ S  + D      DG +D   ++   +  M       E++ E    
Sbjct: 155 SFQENIRKAMERMKESDRKADEATSSGDGLDDIFSKLGDGVNGM-------ESEEE---- 203

Query: 186 SGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINK 245
              ++ +LE+MM  L +K  LYEP+KE + K+P +L+DN   +  ED  R+  QS+ + +
Sbjct: 204 ---LQGLLENMMSQLMSKAVLYEPLKELSDKFPSYLKDNATTLSDEDKTRFAAQSKVVAQ 260

Query: 246 IIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQGIPSDLTSC 305
           I+  ++ P +  ++  +   I+ LMQE+QE G PP EI+  L PG +L   G+P     C
Sbjct: 261 IVATFEDPSYTEDDPVKGLKIVELMQEMQEHGSPPAEIMGPLPPGFDLGADGLPKVPEGC 320



>gi|351721206|ref|NP_001235410.1| uncharacterized protein LOC100527390 [Glycine max]
 gi|255632244|gb|ACU16480.1| unknown [Glycine max]
          Length = 243

 Score = 99.4 bits (246), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 75/118 (63%), Gaps = 6/118 (5%)

Query: 180 FEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQ 239
           FE++ GS  ME ++E+MM  L +K+ L+EPMKE A+KYPKWLE++K  +  E++ RY  Q
Sbjct: 116 FEQLAGSQDMESIVETMMHQLLSKEILHEPMKEIAEKYPKWLEEHKSSLSKEEHERYSLQ 175

Query: 240 SEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQG 297
            E I  + E Y+      N+      I+ LMQ++QE GQPP +I+ ELAP  +L   G
Sbjct: 176 YELIRNLNEVYE------NDPGNFNKIVELMQKMQECGQPPNDIVQELAPDFDLASLG 227



>gi|296810696|ref|XP_002845686.1| farnesylated protein PEX19 [Arthroderma otae CBS 113480]
 gi|238843074|gb|EEQ32736.1| farnesylated protein PEX19 [Arthroderma otae CBS 113480]
          Length = 368

 Score = 99.4 bits (246), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 101/174 (58%), Gaps = 10/174 (5%)

Query: 120 STVESNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQI-MEMMKQIENMANLSGFAEN 178
           ST +    +FQ+ I +TM ++Q S ++  AE+ +  ND + M+++K +E+ + L+G  E 
Sbjct: 189 STTKKGEENFQETIQRTMERMQESGDKATAEVNESGNDDVLMQILKAMES-SGLAGAGEG 247

Query: 179 DFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEK 238
           D       G ++K+   +ME L+ K+ LYEP+KE   K+  WL++NK K+  ED  RYE 
Sbjct: 248 D------DGNLDKLFMGIMEQLSNKEMLYEPLKELDDKFGPWLKENKDKIGKEDLERYEL 301

Query: 239 QSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGME 292
           Q+  +N I+ K++   F  +  +    I   MQ++Q  G PP ++++  AP M+
Sbjct: 302 QASLVNDIVRKFEEKSFSDDKPEDRAYIWEKMQKMQAAGSPPDDLIS--APFMD 353



>gi|259490611|ref|NP_001158959.1| LOC100303903 [Zea mays]
 gi|195611944|gb|ACG27802.1| peroxisomal biogenesis factor 19 [Zea mays]
          Length = 252

 Score = 99.4 bits (246), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 48/118 (40%), Positives = 77/118 (65%), Gaps = 6/118 (5%)

Query: 180 FEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQ 239
           FEE  G+  M+ ++E+MM  L +K+ L+EPMK+  +KYPKWLEDNK K+  E+Y RY  Q
Sbjct: 125 FEEFAGAQDMDSIVETMMRQLLSKEILHEPMKDIVEKYPKWLEDNKNKISKEEYERYNNQ 184

Query: 240 SEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQG 297
            E + K+IE Y+      N+ +    I +++Q +QE GQPP +++ +  P ++L++ G
Sbjct: 185 LELMVKLIEVYE------NDPENMTKIFDIIQNMQECGQPPSDLVQDAVPDLDLSKLG 236



>gi|357476851|ref|XP_003608711.1| Peroxisomal biogenesis factor [Medicago truncatula]
 gi|355509766|gb|AES90908.1| Peroxisomal biogenesis factor [Medicago truncatula]
          Length = 248

 Score = 99.4 bits (246), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 53/120 (44%), Positives = 76/120 (63%), Gaps = 10/120 (8%)

Query: 180 FEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQ 239
           FEE+ GS  ME ++E+MM+ L +K+ L EPMKE  ++YPKWLE++K  +  E+Y RY  Q
Sbjct: 120 FEELAGSQDMESIVETMMQQLLSKEILAEPMKEIGERYPKWLEEHKANLSKEEYDRYSHQ 179

Query: 240 SEYINKIIEKY--DAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQG 297
            E I  + E Y  D+ +F+         I+ LMQ++QE GQPP +I+ ELAP  +L   G
Sbjct: 180 YELIRNLNEVYEKDSGNFN--------KIVELMQKMQECGQPPNDIVQELAPDFDLASLG 231



>gi|62903182|sp|Q9QYU1.1|PEX19_RAT RecName: Full=Peroxisomal biogenesis factor 19; AltName:
           Full=Peroxin-19; AltName: Full=Peroxisomal farnesylated
           protein; Flags: Precursor
 gi|6010291|emb|CAA70258.1| PxF protein [Rattus rattus]
          Length = 299

 Score = 99.0 bits (245), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 70/244 (28%), Positives = 121/244 (49%), Gaps = 39/244 (15%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDASSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSEE--ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNILPIMQSLMQNLLSKDVLYPSLKEITEKYPEWLQSHQESIPPEQFEKYQQQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM-----ELNE 295
            KI E+++A    D +  +  + +A+++LMQ+LQ+ G PP E+  E+ PG+      LN 
Sbjct: 226 GKICEQFEAETPTDSEATHRARFEAVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNL 285

Query: 296 QGIP 299
            G P
Sbjct: 286 SGPP 289



>gi|406602298|emb|CCH46136.1| Peroxisomal biogenesis factor 19 [Wickerhamomyces ciferrii]
          Length = 303

 Score = 99.0 bits (245), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 71/230 (30%), Positives = 122/230 (53%), Gaps = 14/230 (6%)

Query: 78  MEDFVKEFDENELSIAMQGLMKNFGEVDEDNLNG-TDFDNTGRSTVESNGTSFQDKINQT 136
           +ED +K+  E+E   A Q L     +V    LNG +D     +   +SN    +D I+ T
Sbjct: 72  IEDLLKQL-ESESPEARQQLDALLKDVS--TLNGPSDVKPNEQLQKDSNDKDLKDTISST 128

Query: 137 MNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEMFGSGGMEKMLESM 196
           +N+L++S  ++D  I     DQ    +  + N  NL G   N  E+  G   + K+L  M
Sbjct: 129 LNRLKSSGAKVDESIKSEEPDQ---FLNDLFNQLNLDGEG-NPGED--GDFDITKLLGDM 182

Query: 197 MEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFD 256
           +E LA+K+ LY+P+K+ + KYPKW+E+NK K+  E   RY KQS+ +  I++K+D   + 
Sbjct: 183 LEQLASKEILYDPLKDLSSKYPKWIEENKNKITKEKLERYTKQSDIVKSIVDKFDEESYS 242

Query: 257 GNNEQQNKAIINLMQELQEFGQPPPEILNEL----APGMELNEQGIPSDL 302
            +++   + I   ++E+Q  G PP +++ +      PG+      +P +L
Sbjct: 243 DSSKPHKEFISTKLEEMQNSGNPPEDLVGDFNKTGLPGLNFGNDDLPDNL 292



>gi|459369874|gb|EMG48134.1| Peroxisomal (Biogenesis) protein, putative [Candida maltosa Xu316]
          Length = 324

 Score = 99.0 bits (245), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 63/210 (30%), Positives = 115/210 (54%), Gaps = 32/210 (15%)

Query: 113 DFDNTGRSTVES----NGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIM----EMMK 164
           +F+   R TVE+       +F++ + +TM +L+ S E +DA+I    ND +     +++ 
Sbjct: 116 EFETNHRETVEAEEKKTSGNFENVMKETMERLKKSGEDIDAKI---KNDPLSSNPEDLLT 172

Query: 165 QIENMANLSGFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDN 224
           Q+  +A + G    D +       M K+L  M+E L++K+ LYEP+K+   K+P +L++N
Sbjct: 173 QL--LAGMEGINGGDMD-------MSKLLVDMLEQLSSKEVLYEPIKDLNTKFPDYLKEN 223

Query: 225 KGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEIL 284
           K K+  E Y  Y +Q +  N II+ +++  +  +N++Q + +  L++ LQE GQPP E++
Sbjct: 224 KDKLDEEKYKNYTQQYDITNDIIKIFESESYSDDNKEQREQVNALLESLQELGQPPTELV 283

Query: 285 NE------------LAPGMELNEQGIPSDL 302
            E             APG + N++ +P D 
Sbjct: 284 GESGDFLPGLGGKGAAPGFDFNDKDLPPDF 313



>gi|440471025|gb|ELQ40062.1| hypothetical protein OOU_Y34scaffold00462g16 [Magnaporthe oryzae
           Y34]
 gi|440490275|gb|ELQ69850.1| hypothetical protein OOW_P131scaffold00114g13 [Magnaporthe oryzae
           P131]
          Length = 309

 Score = 99.0 bits (245), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 68/225 (30%), Positives = 118/225 (52%), Gaps = 12/225 (5%)

Query: 67  DDEYVKLLTADMEDFVKEFDEN-ELSIAMQGLMKNFGEVDEDNLNGTDFDNTGRSTVESN 125
           +DE+ K L A M + + +   + E+    + + K  G     + +    + +  +   ++
Sbjct: 72  EDEFAKQLQAGMAEMLGDMGSSPEMQAQFESIFKELGAAAAADESS---NPSAGAPPPAS 128

Query: 126 GTSFQDKINQTMNKLQNSSEQLDAEIIDGSN---DQIMEMMKQIENMANLSGFAENDFEE 182
            +SFQD I +TM ++Q S +   A     SN   D + E++KQ++     +G      EE
Sbjct: 129 SSSFQDNIRRTMERMQASGDSATAAATADSNAEDDFMAELLKQMQGGGAGAGLGGEGGEE 188

Query: 183 MFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEY 242
            F      KML  MME L  K+ LYEPMKE   K+P+WLE NK K   ED  RYE+Q   
Sbjct: 189 EFS-----KMLLGMMEQLTNKEILYEPMKELHDKFPEWLERNKDKTSAEDLKRYEEQQRL 243

Query: 243 INKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNEL 287
           +++++ K++ P +  +N    + I++ MQ++Q  G PP +++ ++
Sbjct: 244 VSEMVVKFEEPTYLDSNAADREYIVDRMQKMQATGSPPSDLVGDM 288



>gi|389640693|ref|XP_003717979.1| hypothetical protein MGG_00971 [Magnaporthe oryzae 70-15]
 gi|351640532|gb|EHA48395.1| hypothetical protein MGG_00971 [Magnaporthe oryzae 70-15]
          Length = 338

 Score = 99.0 bits (245), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 68/225 (30%), Positives = 118/225 (52%), Gaps = 12/225 (5%)

Query: 67  DDEYVKLLTADMEDFVKEFDEN-ELSIAMQGLMKNFGEVDEDNLNGTDFDNTGRSTVESN 125
           +DE+ K L A M + + +   + E+    + + K  G     + +    + +  +   ++
Sbjct: 104 EDEFAKQLQAGMAEMLGDMGSSPEMQAQFESIFKELGAAAAADESS---NPSAGAPPPAS 160

Query: 126 GTSFQDKINQTMNKLQNSSEQLDAEIIDGSN---DQIMEMMKQIENMANLSGFAENDFEE 182
            +SFQD I +TM ++Q S +   A     SN   D + E++KQ++     +G      EE
Sbjct: 161 SSSFQDNIRRTMERMQASGDSATAAATADSNAEDDFMAELLKQMQGGGAGAGLGGEGGEE 220

Query: 183 MFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEY 242
            F      KML  MME L  K+ LYEPMKE   K+P+WLE NK K   ED  RYE+Q   
Sbjct: 221 EFS-----KMLLGMMEQLTNKEILYEPMKELHDKFPEWLERNKDKTSAEDLKRYEEQQRL 275

Query: 243 INKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNEL 287
           +++++ K++ P +  +N    + I++ MQ++Q  G PP +++ ++
Sbjct: 276 VSEMVVKFEEPTYLDSNAADREYIVDRMQKMQATGSPPSDLVGDM 320



>gi|452004161|gb|EMD96617.1| hypothetical protein COCHEDRAFT_1086818 [Bipolaris maydis C5]
 gi|477583461|gb|ENI00559.1| hypothetical protein COCC4DRAFT_150311 [Bipolaris maydis ATCC
           48331]
          Length = 337

 Score = 98.6 bits (244), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 79/251 (31%), Positives = 121/251 (48%), Gaps = 18/251 (7%)

Query: 58  DQADLPSQLDDEYVKLLTADMEDFVKEFDE--NELSIAMQG---LMKNFGEVDEDNLNGT 112
           DQ +   QL  E  +LL     DF K+F+E   E+S  M G   L        E      
Sbjct: 96  DQEEFQKQLQKEMEQLLGQG--DFQKQFEEIMKEMSEEMGGANPLDAGAHAHSEGQKAAG 153

Query: 113 DFDNTGRSTVESNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANL 172
              ++ + T      SFQ+ I +TM ++Q+SS+   +     S D I+  M        L
Sbjct: 154 APTSSEKETAAKAEKSFQETIKKTMERMQSSSDTAASAAASSSQDDILAQM--------L 205

Query: 173 SGFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPED 232
           +      F    G     K+L  MME L  KD LYEPMKE   K+PKW+E+NK KV  +D
Sbjct: 206 ASMESGGFGGEGGDEDFSKVLMGMMEQLTNKDILYEPMKELDDKFPKWMEENKAKVEKDD 265

Query: 233 YARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGME 292
             RYE+Q   + +I+ +++   +  +N Q  + I+  MQ++Q  G PPP+++ ++    E
Sbjct: 266 LKRYEEQQTLVREIVGRFERKGYSDDNAQDREYIVERMQKMQAAGSPPPDLVGDMNAAQE 325

Query: 293 L---NEQGIPS 300
                +QG P+
Sbjct: 326 ALQDMDQGCPT 336



>gi|119491739|ref|XP_001263364.1| peroxisomal membrane protein receptor Pex19, putative [Neosartorya
           fischeri NRRL 181]
 gi|119411524|gb|EAW21467.1| peroxisomal membrane protein receptor Pex19, putative [Neosartorya
           fischeri NRRL 181]
          Length = 389

 Score = 98.6 bits (244), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 55/164 (33%), Positives = 93/164 (56%), Gaps = 21/164 (12%)

Query: 128 SFQDKINQTMNKLQNSSEQLDAEII-DG--SNDQIMEMMKQIENMANLSGFAENDFEEMF 184
           SF D I +T+++++ S ++  A    DG  S D +M+++K +E                 
Sbjct: 217 SFNDAIQRTIHRMKESGDKATAAATEDGGISEDMLMQLLKGLEAG--------------V 262

Query: 185 GSGG----MEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQS 240
           G+GG    + +M+  +ME  + K+ LYEPMKE   K+  WL++NKGKVP ED  RYEKQ+
Sbjct: 263 GNGGDDLDLTQMIAGVMEQFSNKEMLYEPMKELDAKWGPWLKENKGKVPAEDMERYEKQA 322

Query: 241 EYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEIL 284
           + + +I+ K++   +   + +  +A+   MQE+Q  G PP E++
Sbjct: 323 KLVTEIVAKFEEEGYTDEDPKYRQAVWEKMQEMQALGSPPEELV 366



>gi|444514550|gb|ELV10582.1| Peroxisomal biogenesis factor 19 [Tupaia chinensis]
          Length = 299

 Score = 98.6 bits (244), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 70/244 (28%), Positives = 121/244 (49%), Gaps = 39/244 (15%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDATSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSEE--ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHAVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM-----ELNE 295
            KI E+++A    D +   + + +A+++LMQ+LQ+ G PP E+  E+ PG+      LN 
Sbjct: 226 GKICEQFEAETPTDSEATQKARFEAVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNL 285

Query: 296 QGIP 299
            G P
Sbjct: 286 SGPP 289



>gi|406860753|gb|EKD13810.1| peroxin [Marssonina brunnea f. sp. 'multigermtubi' MB_m1]
          Length = 342

 Score = 98.6 bits (244), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 59/181 (32%), Positives = 94/181 (51%), Gaps = 17/181 (9%)

Query: 128 SFQDKINQTMNKLQNSSEQLDAEII-DGSNDQIMEMMKQIENMANLSGFAENDFEEMFGS 186
           SFQ+ I +TM ++QNS +Q  A    D ++D + +MMK +E+        E +F      
Sbjct: 170 SFQETIKKTMERMQNSGDQATAAAASDNTDDILAQMMKAMESGGLDGEGGEEEFS----- 224

Query: 187 GGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKI 246
               KML  MME L  K+ LYEPMKE   K+P W+E N   V   D  RY +Q  Y+++I
Sbjct: 225 ----KMLLGMMEQLTNKEILYEPMKELNDKFPGWMEKNAATVDAADLKRYREQQVYVSEI 280

Query: 247 IEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGME-------LNEQGIP 299
           +++++   +   N      I+  MQ++Q  G PP +++ ++A   E         E+G P
Sbjct: 281 VKRFETKTYKDENVADRDYIVERMQKMQAAGSPPADLVGDMASAQEAFGGLDGAPEEGCP 340

Query: 300 S 300
           +
Sbjct: 341 T 341



>gi|462405258|gb|EMJ10722.1| hypothetical protein PRUPE_ppa010581mg [Prunus persica]
          Length = 244

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 63/186 (33%), Positives = 99/186 (53%), Gaps = 16/186 (8%)

Query: 122 VESNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAEN--- 178
           V+  G    +   +   K + S E    E +D   +Q  E +K +E++ +     E+   
Sbjct: 49  VQGLGMGLPEIRTKKKGKQKVSEESHVTEALDKLREQTREAVKGLESVTSTKPGGEDLGK 108

Query: 179 -------DFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPE 231
                   FEE+ GS  ME ++E+MM+ L +KD L+EPMKE  ++YPKWL++++  +  E
Sbjct: 109 DVEDWVKQFEELAGSQDMESIVETMMQQLLSKDILHEPMKEIGERYPKWLKEHEASLSKE 168

Query: 232 DYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM 291
           ++ RY  Q E I  + E Y+    D  N  +   I  LMQ++QE GQPP +I+ ELAP  
Sbjct: 169 EHERYFHQYELIKDLNEVYEK---DSGNFTR---IFELMQKMQECGQPPNDIVQELAPDF 222

Query: 292 ELNEQG 297
           +L   G
Sbjct: 223 DLASLG 228



>gi|475566300|gb|EMT15000.1| Peroxisomal biogenesis factor 19 [Aegilops tauschii]
          Length = 252

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 79/119 (66%), Gaps = 8/119 (6%)

Query: 180 FEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQ 239
           FEE  G+  M+ ++E+MM+ L +K+ LYEPMK+  +KYPKWLEDNK K+  E+Y RY  Q
Sbjct: 125 FEEFAGAQDMDSIVETMMKQLLSKEILYEPMKDIVEKYPKWLEDNKSKISKEEYERYGNQ 184

Query: 240 SEYINKIIEKYDAPDFDGNNEQQNKA-IINLMQELQEFGQPPPEILNELAPGMELNEQG 297
            E + K+ E Y+       +E +N + +  +MQ +QE GQPP +++ ++ P ++L++ G
Sbjct: 185 LELMLKLNEVYE-------HEPENMSKVFEIMQNMQECGQPPSDLVQDIVPDLDLSKLG 236



>gi|12849757|dbj|BAB28468.1| unnamed protein product [Mus musculus]
          Length = 299

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 119/244 (48%), Gaps = 39/244 (15%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L K  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSKAAGRVGSDASSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +   +LQNS          G +++  E+MK +E +    G  E D    
Sbjct: 135 G--------LAKNATELQNS----------GMSEE--ELMKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G   +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++   PPE + +Y++Q   +
Sbjct: 167 -GEASILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHQDSTPPEQFEKYQQQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM-----ELNE 295
            KI E+++A    D +     + +A+++LMQ+LQ  G PP E+  E+ PG+      LN 
Sbjct: 226 VKICEQFEAETPTDSEATQRARFEAMLDLMQQLQALGHPPKELAGEMPPGLNFDLDALNL 285

Query: 296 QGIP 299
            G P
Sbjct: 286 SGPP 289



>gi|448527720|ref|XP_003869563.1| Pex19 protein [Candida orthopsilosis Co 90-125]
 gi|380353916|emb|CCG23428.1| Pex19 protein [Candida orthopsilosis]
          Length = 372

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 61/185 (32%), Positives = 102/185 (55%), Gaps = 14/185 (7%)

Query: 114 FDNTGRSTVESNG---TSFQDKINQTMNKLQNSSEQLDAEII-DGSNDQIMEMMKQIENM 169
           F+   RS  ES      +F   + +TM +L+ S E +D++I  D S     +++ Q+   
Sbjct: 162 FETNHRSEAESGAQQTANFDFVMKETMERLRKSGEDIDSKIKNDSSGTNPEDILTQLLAG 221

Query: 170 ANLSGFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVP 229
            N SG    D +       M K+L  M+E L++K+ LYEP+K+   K+P++LEDNK K+ 
Sbjct: 222 MNESGLGGGDMD-------MSKLLIDMLEQLSSKEVLYEPIKDLNNKFPQYLEDNKDKLD 274

Query: 230 PEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELA- 288
            E YA Y KQ +  N I++ +++  ++ +N+ Q   I  +++ LQE GQPP E++ +   
Sbjct: 275 QEQYANYTKQYDITNDILKVFESDSYNDSNKAQRDQINAMLESLQELGQPPTELVGDTGD 334

Query: 289 --PGM 291
             PG 
Sbjct: 335 FLPGF 339



>gi|157817320|ref|NP_001100845.1| peroxisomal biogenesis factor 19 isoform 1 [Rattus norvegicus]
 gi|392354796|ref|XP_003751852.1| PREDICTED: peroxisomal biogenesis factor 19-like [Rattus
           norvegicus]
 gi|149040723|gb|EDL94680.1| rCG20208, isoform CRA_b [Rattus norvegicus]
          Length = 299

 Score = 98.2 bits (243), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 69/244 (28%), Positives = 121/244 (49%), Gaps = 39/244 (15%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDASSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQN+          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNA----------GMSEE--ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNILPIMQSLMQNLLSKDVLYPSLKEITEKYPEWLQSHQESIPPEQFEKYQQQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM-----ELNE 295
            KI E+++A    D +  +  + +A+++LMQ+LQ+ G PP E+  E+ PG+      LN 
Sbjct: 226 GKICEQFEAETPTDSEATHRARFEAVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNL 285

Query: 296 QGIP 299
            G P
Sbjct: 286 SGPP 289



>gi|293343148|ref|XP_001054818.2| PREDICTED: peroxisomal biogenesis factor 19-like [Rattus
           norvegicus]
          Length = 553

 Score = 98.2 bits (243), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 69/244 (28%), Positives = 121/244 (49%), Gaps = 39/244 (15%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 329 FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDASSQQEFTSCLKETLS 388

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQN+          G +++  E+ K +E +    G  E D    
Sbjct: 389 G--------LAKNATDLQNA----------GMSEE--ELTKAMEGL----GMDEGD---- 420

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 421 -GEGNILPIMQSLMQNLLSKDVLYPSLKEITEKYPEWLQSHQESIPPEQFEKYQQQHSVM 479

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM-----ELNE 295
            KI E+++A    D +  +  + +A+++LMQ+LQ+ G PP E+  E+ PG+      LN 
Sbjct: 480 GKICEQFEAETPTDSEATHRARFEAVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNL 539

Query: 296 QGIP 299
            G P
Sbjct: 540 SGPP 543



>gi|212527684|ref|XP_002143999.1| peroxisomal membrane protein receptor Pex19, putative [Talaromyces
           marneffei ATCC 18224]
 gi|210073397|gb|EEA27484.1| peroxisomal membrane protein receptor Pex19, putative [Talaromyces
           marneffei ATCC 18224]
          Length = 375

 Score = 98.2 bits (243), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 57/191 (29%), Positives = 104/191 (54%), Gaps = 11/191 (5%)

Query: 94  MQGLMKNFGEVDEDNLNGTDFDNTGRSTVESNGTSFQDKINQTMNKLQNSSEQLDAEIID 153
           MQ L +N    D +     +   TG + V   G SF D I +T+ ++Q S E++  E   
Sbjct: 156 MQNLFRNLH--DSEGTGAGNSAPTGPAGVA--GESFPDTIQKTLERMQESGEKVTIEAKT 211

Query: 154 GSNDQIMEMMKQIENMANLSGFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEF 213
             +  I   + ++  MA+ +    + F+       +E++   +++ ++ K+ LYEPMKE+
Sbjct: 212 SQDKLIDASIARLLEMADATAANGDKFD-------VEQVFSDVIKEMSNKEMLYEPMKEY 264

Query: 214 AQKYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQEL 273
             KY  WLE+NK  +  EDYA Y+KQ+  I KI+E +++ D+  +  +   +I +LMQ++
Sbjct: 265 DTKYGPWLEENKATLSAEDYANYKKQAGVIKKIVEAFESKDYSDDKPECLASIWDLMQQM 324

Query: 274 QEFGQPPPEIL 284
           +  G PP +++
Sbjct: 325 EACGAPPADLI 335



>gi|431892928|gb|ELK03356.1| Peroxisomal biogenesis factor 19 [Pteropus alecto]
          Length = 299

 Score = 98.2 bits (243), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 70/245 (28%), Positives = 121/245 (49%), Gaps = 39/245 (15%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDATSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSEE--ELTKAMEGL----GLDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHQESLPPEQFEKYQEQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM-----ELNE 295
            KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ PG+      LN 
Sbjct: 226 GKICEQFEAETSADSEATRKIRFETVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNL 285

Query: 296 QGIPS 300
            G PS
Sbjct: 286 SGPPS 290



>gi|384246224|gb|EIE19715.1| Pex19-domain-containing protein [Coccomyxa subellipsoidea C-169]
          Length = 329

 Score = 97.8 bits (242), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 75/127 (59%), Gaps = 11/127 (8%)

Query: 173 SGFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPED 232
           +G +E D +  F S     + +S+M+ L +KD LY+PMK+   KYP WL   +  +PPE+
Sbjct: 203 TGASEGDADGSFAS-----LADSIMQQLLSKDVLYQPMKDIGAKYPAWLATRRDSLPPEE 257

Query: 233 YARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGME 292
             RYE Q +YI +I   Y+    D +N  Q   +  L+QE+Q  GQPP EI+ +LAPG+ 
Sbjct: 258 LKRYEAQYKYIRQICALYED---DPSNFGQ---LFTLIQEMQACGQPPEEIVQDLAPGLA 311

Query: 293 LNEQGIP 299
             E G+P
Sbjct: 312 FGEDGLP 318



>gi|470126938|ref|XP_004299437.1| PREDICTED: peroxisome biogenesis protein 19-1-like [Fragaria vesca
           subsp. vesca]
          Length = 245

 Score = 97.8 bits (242), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 59/160 (36%), Positives = 89/160 (55%), Gaps = 17/160 (10%)

Query: 149 AEIIDGSNDQIMEMMKQIENMANLSG---FAEN--------DFEEMFGSGGMEKMLESMM 197
            E +D   +Q  E ++ +E+M+   G   F+++         FEE+ G   M  M+E+MM
Sbjct: 76  TEALDKLREQTREAVRGLESMSPQPGADDFSKDLMMEDWVKQFEELAGGQDMGSMVETMM 135

Query: 198 EALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDG 257
           + L +K+ LYEPMKE  +KYPKWL+DN+  +  E+Y R   Q E I ++ E Y+      
Sbjct: 136 QQLLSKEILYEPMKEIGEKYPKWLKDNEATLSKEEYDRCFHQCELIKELNEVYE------ 189

Query: 258 NNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQG 297
           N+      I  +MQ++QE GQPP  I+ ELAP  +L   G
Sbjct: 190 NDSGNYNKIFEIMQKMQECGQPPNAIVQELAPDFDLASLG 229



>gi|326477515|gb|EGE01525.1| hypothetical protein TEQG_08579 [Trichophyton equinum CBS 127.97]
          Length = 372

 Score = 97.8 bits (242), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 67/216 (31%), Positives = 118/216 (54%), Gaps = 12/216 (5%)

Query: 78  MEDFVKEFDENELSIAMQGLMKNFGEVDEDNLNGTDFDNTGRSTVESNGTSFQDKINQTM 137
           M D +K     EL    +G+    G    D  +GT    +  ST +  G +FQ+ I +TM
Sbjct: 153 MADVMKLMMGEELMTGGEGVSGMDGSTIADKASGT-AKQSSPSTKKGEG-NFQETIQKTM 210

Query: 138 NKLQNSSEQLDAEIID-GSNDQIMEMMKQIENMANLSGFAENDFEEMFGSGGMEKMLESM 196
            ++Q S ++  AE+ + G+ D +M+++K +E+ + L+G  E D       G ++K+   +
Sbjct: 211 ERMQESGDKATAEVNESGNEDVLMQILKAMES-SGLAGAGEGD------DGNLDKLFMGI 263

Query: 197 MEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFD 256
           ME L+ K+ LYEP+KE   K+  WL +NK K+  +D  RYE Q+  ++ I+ K++  +F 
Sbjct: 264 MEQLSNKEMLYEPLKELDDKFGPWLRENKEKIGKDDRERYELQASLVSDIVRKFEEKNFS 323

Query: 257 GNNEQQNKAIINLMQELQEFGQPPPEILNELAPGME 292
            +  +    I   MQ++Q  G PP ++++  AP M+
Sbjct: 324 DDKPEDRAYIWEKMQKMQAAGSPPDDLIS--APFMD 357



>gi|396461541|ref|XP_003835382.1| hypothetical protein LEMA_P047230.1 [Leptosphaeria maculans JN3]
 gi|312211933|emb|CBX92017.1| hypothetical protein LEMA_P047230.1 [Leptosphaeria maculans JN3]
          Length = 337

 Score = 97.8 bits (242), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 80/264 (30%), Positives = 129/264 (48%), Gaps = 30/264 (11%)

Query: 60  ADLPSQLDDEYVKLLTADME------DFVKEFDE--NELSIAMQG---LMKNFGEVDEDN 108
           ADL  Q +DE+ K L  +ME      DF K+F++   E+S  M G   L    G+    +
Sbjct: 80  ADLLLQDEDEFAKKLQEEMEQLLGQGDFQKQFEDIMKEMSQEMGGANPLEALAGQAASSS 139

Query: 109 LNGTDFDNTGRSTVESN-GT--------SFQDKINQTMNKLQNSSEQLDAEIIDGSNDQI 159
                 +   +    +N GT        SFQ+ I +TM ++Q+SS+   +     S D I
Sbjct: 140 ETKAKVEPKAKEAATANKGTESSAKAEKSFQETIKKTMERMQSSSDTATSAAASSSQDDI 199

Query: 160 MEMMKQIENMANLSGFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPK 219
           +  M     +A++        E         K+L  MME L  +D LYEPMKE   K+PK
Sbjct: 200 LAQM-----LASMENGNFGGGEGGDEDFS--KILMGMMEQLTNRDILYEPMKELDDKFPK 252

Query: 220 WLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQP 279
           W+++NK KV  +D  RYE+Q   + +I+ +++   +   N Q  + I+  MQ++Q  G P
Sbjct: 253 WMDENKEKVAKDDLTRYEEQQSLVREIVARFEKKGYSDGNAQDREYIVERMQKMQAAGSP 312

Query: 280 PPEILNELAPGMEL---NEQGIPS 300
           PP+++ ++    E     +QG P+
Sbjct: 313 PPDLVGDMNAAQEALSDMDQGCPT 336



>gi|115447729|ref|NP_001047644.1| Os02g0661000 [Oryza sativa Japonica Group]
 gi|49388497|dbj|BAD25621.1| peroxisomal protein PEX19-like [Oryza sativa Japonica Group]
 gi|49388639|dbj|BAD25752.1| peroxisomal protein PEX19-like [Oryza sativa Japonica Group]
 gi|113537175|dbj|BAF09558.1| Os02g0661000 [Oryza sativa Japonica Group]
          Length = 246

 Score = 97.4 bits (241), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 79/119 (66%), Gaps = 8/119 (6%)

Query: 180 FEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQ 239
           FEE  G+  M+ ++E+MM+ L +K+ L+EPMK+  +KYPKWLE+NK K+  E+Y RY  Q
Sbjct: 133 FEEFAGAQDMDSIVETMMQQLLSKEILHEPMKDIVEKYPKWLEENKSKISKEEYERYNNQ 192

Query: 240 SEYINKIIEKYDAPDFDGNNEQQNKA-IINLMQELQEFGQPPPEILNELAPGMELNEQG 297
            E + K+ E Y+        E +N A I  +MQ +QE GQPP +++ ++AP ++L++ G
Sbjct: 193 LELMMKLNEVYE-------KEPENMAKIFEIMQNMQECGQPPSDLVQDIAPDLDLSKLG 244



>gi|322701179|gb|EFY92930.1| peroxin [Metarhizium acridum CQMa 102]
          Length = 386

 Score = 97.4 bits (241), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 59/166 (35%), Positives = 87/166 (52%), Gaps = 10/166 (6%)

Query: 128 SFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIM-EMMKQIENMANLSGFAENDFEEMFGS 186
           SFQ+ I +TM ++     Q  A     S D  M E++KQ+ +      F     EE F  
Sbjct: 218 SFQETIRRTMERMPTPGRQATAAAATSSGDDFMSELLKQMSS----GDFNGEGSEEEFS- 272

Query: 187 GGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKI 246
               KML  MME L  KD LYEPMKE   K+P+W E NK   P ED  RYE+Q   + +I
Sbjct: 273 ----KMLMGMMEQLTNKDILYEPMKELDDKFPEWFEKNKASTPAEDLKRYEEQRVLVREI 328

Query: 247 IEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGME 292
           + K++   +  +N    + I++ MQ++Q  G PP +++ ++A   E
Sbjct: 329 VAKFEESSYSDSNASDREYIVDRMQKMQAAGSPPSDLVGDMASAQE 374



>gi|302653091|ref|XP_003018377.1| peroxisomal membrane protein receptor Pex19, putative [Trichophyton
           verrucosum HKI 0517]
 gi|291182019|gb|EFE37732.1| peroxisomal membrane protein receptor Pex19, putative [Trichophyton
           verrucosum HKI 0517]
          Length = 372

 Score = 97.4 bits (241), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 72/249 (28%), Positives = 129/249 (51%), Gaps = 19/249 (7%)

Query: 52  SPDKSRDQADLPSQLDDEYVKLLTADME-------DFVKEFDENELSIAMQGLMKNFGEV 104
           S +K+ D   +P    +E    LT ++E       D +K     EL    +G+    G  
Sbjct: 120 SKEKTNDIPGMPQSPGNEDWNALTEELEKKGFTMTDVMKLMMGEELMTGGEGVTGMDGST 179

Query: 105 DEDNLNGTDFDNTGRSTVESNGTSFQDKINQTMNKLQNSSEQLDAEIID-GSNDQIMEMM 163
             D  +GT    +   + +    +FQ+ I +TM ++Q S ++  AE+ + G+ D +M+++
Sbjct: 180 TTDKASGTAKQPS--PSTKKGEDNFQETIQRTMERMQESGDKATAEVNESGNEDVLMQIL 237

Query: 164 KQIENMANLSGFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLED 223
           K +E+ + L+G  E D       G ++K+   +ME L+ K+ LYEP+KE   K+  WL +
Sbjct: 238 KAMES-SGLAGAGEGD------DGNLDKLFMGIMEQLSNKEMLYEPLKELDDKFGPWLRE 290

Query: 224 NKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEI 283
           NK K+  ED  RYE Q+  ++ I+ K++  +F  +  +    I   MQ++Q  G PP ++
Sbjct: 291 NKEKIGKEDRERYELQASLVSDIVRKFEEKNFSDDKPEDRAYIWEKMQKMQAAGSPPDDL 350

Query: 284 LNELAPGME 292
           ++  AP M+
Sbjct: 351 IS--APFMD 357



>gi|315051480|ref|XP_003175114.1| farnesylated protein PEX19 [Arthroderma gypseum CBS 118893]
 gi|311340429|gb|EFQ99631.1| farnesylated protein PEX19 [Arthroderma gypseum CBS 118893]
          Length = 372

 Score = 97.4 bits (241), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 63/209 (30%), Positives = 115/209 (55%), Gaps = 9/209 (4%)

Query: 78  MEDFVKEFDENELSIAMQGLMKNFGEVDEDNLNGTDFDNTGRSTVESNGTSFQDKINQTM 137
           M D +K     EL    +G+    G  D    + T+   +  ST +    +FQD I +TM
Sbjct: 152 MADVMKLMMGEELMTGGEGIPGIDGSTDTGKPSSTEKQPSPPSTKKGE-DNFQDTIQKTM 210

Query: 138 NKLQNSSEQLDAEIID-GSNDQIMEMMKQIENMANLSGFAENDFEEMFGSGGMEKMLESM 196
            ++Q S ++  AE+ + G++D +M+++K +E+ +  +G  E D       G ++K+   +
Sbjct: 211 ERMQESGDKATAEVNESGNDDMLMQILKAMES-SGFAGAGEGD------DGNLDKLFMGI 263

Query: 197 MEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFD 256
           ME L+ K+ LYEP+KE   K+  WL++NK K   ED  RYE Q+  ++ I++K++  +F 
Sbjct: 264 MEQLSNKEMLYEPLKELDDKFGPWLKENKDKAGKEDLERYELQASLVSDIVKKFEEKNFS 323

Query: 257 GNNEQQNKAIINLMQELQEFGQPPPEILN 285
            +  +    I + MQ++Q  G PP ++++
Sbjct: 324 DDKPEDRAYIWDKMQKMQSAGSPPDDLIS 352



>gi|473842984|gb|EMS47357.1| Peroxisome biogenesis protein 19-1 [Triticum urartu]
          Length = 254

 Score = 97.4 bits (241), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 78/119 (65%), Gaps = 8/119 (6%)

Query: 180 FEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQ 239
           FEE  G   M+ ++E+MM+ L +K+ LYEPMK+  +KYPKWLEDNK K+  E+Y RY  Q
Sbjct: 127 FEEFAGGQDMDSIVETMMKQLLSKEILYEPMKDIVEKYPKWLEDNKSKISKEEYERYSNQ 186

Query: 240 SEYINKIIEKYDAPDFDGNNEQQNKA-IINLMQELQEFGQPPPEILNELAPGMELNEQG 297
            E + K+ E Y+       +E +N + +  +MQ +QE GQPP +++ ++ P ++L++ G
Sbjct: 187 LELMLKLNEVYE-------HEPENMSKVFEIMQNMQECGQPPSDLVQDIVPDLDLSKLG 238



>gi|504154356|ref|XP_004589136.1| PREDICTED: peroxisomal biogenesis factor 19 isoform X1 [Ochotona
           princeps]
          Length = 299

 Score = 97.1 bits (240), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 70/244 (28%), Positives = 119/244 (48%), Gaps = 39/244 (15%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDATSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSEE--ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE Y +Y +Q   +
Sbjct: 167 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESIPPEQYDKYLEQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM-----ELNE 295
            KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ PG+      LN 
Sbjct: 226 GKICEQFEAETPTDTEATQKARFETVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNL 285

Query: 296 QGIP 299
            G P
Sbjct: 286 SGPP 289



>gi|121705668|ref|XP_001271097.1| peroxisomal membrane protein receptor Pex19, putative [Aspergillus
           clavatus NRRL 1]
 gi|119399243|gb|EAW09671.1| peroxisomal membrane protein receptor Pex19, putative [Aspergillus
           clavatus NRRL 1]
          Length = 403

 Score = 97.1 bits (240), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 90/159 (56%), Gaps = 13/159 (8%)

Query: 129 FQDKINQTMNKLQNSSEQLDAEIIDG---SNDQIMEMMKQIENMANLSGFAENDFEEMFG 185
           F D I +T+++++ S ++  A   +    S D +M+++K +E+ A   G  ++D      
Sbjct: 231 FNDAIQRTIHRMKESGDKATAAATEEGGLSEDVLMQLLKSLEDGA---GAGDDDL----- 282

Query: 186 SGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINK 245
             G  KM+  MME    K+ LYEPMKE   K+  WL++N+GKV  ED  RYEKQ++ + +
Sbjct: 283 --GFTKMIAGMMEQFTNKEMLYEPMKELDGKWGPWLKENRGKVADEDMERYEKQAKLVTQ 340

Query: 246 IIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEIL 284
           I+EK++   +   + +    +   MQE+Q  G PP E++
Sbjct: 341 IVEKFEEEGYTDEDPKHRGYVWERMQEMQALGSPPEELV 379



>gi|512909415|ref|XP_004901586.1| PREDICTED: peroxisomal biogenesis factor 19 isoform X2
           [Heterocephalus glaber]
 gi|512994315|ref|XP_004858775.1| PREDICTED: peroxisomal biogenesis factor 19 isoform X2
           [Heterocephalus glaber]
 gi|351710746|gb|EHB13665.1| Peroxisomal biogenesis factor 19 [Heterocephalus glaber]
          Length = 299

 Score = 97.1 bits (240), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 70/244 (28%), Positives = 120/244 (49%), Gaps = 39/244 (15%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F    + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDATSQQEFTTCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +D+  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSDE--ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q + +
Sbjct: 167 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHKVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM-----ELNE 295
            KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ PG+      LN 
Sbjct: 226 GKICEQFEAETPTDSEAVQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNL 285

Query: 296 QGIP 299
            G P
Sbjct: 286 SGPP 289



>gi|426216941|ref|XP_004002715.1| PREDICTED: peroxisomal biogenesis factor 19 isoform 1 [Ovis aries]
          Length = 299

 Score = 96.7 bits (239), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 69/244 (28%), Positives = 120/244 (49%), Gaps = 39/244 (15%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDATSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSEE--ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGTILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQAHRDSLPPEQFEKYQEQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM-----ELNE 295
            KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ PG+      LN 
Sbjct: 226 GKICEQFEAETPTDTEATQKARFEVVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNL 285

Query: 296 QGIP 299
            G P
Sbjct: 286 SGPP 289



>gi|6010213|emb|CAA70256.1| PxF protein [Mus musculus]
 gi|6010219|emb|CAA70255.1| PxF protein [Mus musculus]
 gi|74206739|dbj|BAE41616.1| unnamed protein product [Mus musculus]
 gi|148707094|gb|EDL39041.1| peroxisome biogenesis factor 19, isoform CRA_e [Mus musculus]
          Length = 299

 Score = 96.7 bits (239), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 70/244 (28%), Positives = 119/244 (48%), Gaps = 39/244 (15%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDASSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +   +LQNS          G +++  E+MK +E +    G  E D    
Sbjct: 135 G--------LAKNATELQNS----------GMSEE--ELMKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G   +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++   PPE + +Y++Q   +
Sbjct: 167 -GEASILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHQDSTPPEQFEKYQQQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM-----ELNE 295
            KI E+++A    D +     + +A+++LMQ+LQ  G PP E+  E+ PG+      LN 
Sbjct: 226 VKICEQFEAETPTDSEATQRARFEAMLDLMQQLQALGHPPKELAGEMPPGLNFDLDALNL 285

Query: 296 QGIP 299
            G P
Sbjct: 286 SGPP 289



>gi|327287434|ref|XP_003228434.1| PREDICTED: peroxisomal biogenesis factor 19-like [Anolis
           carolinensis]
          Length = 292

 Score = 96.7 bits (239), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 67/238 (28%), Positives = 115/238 (48%), Gaps = 34/238 (14%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 68  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDPSSQQEFTSCLKETLS 127

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +  N LQN+S   +            E+ K +E +           E+ 
Sbjct: 128 G--------LAKNANDLQNASVSEE------------ELAKTMEGLG---------LEDG 158

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +P E Y +Y +Q   +
Sbjct: 159 EGDGNLLPLMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPQEQYQKYHQQHSIM 218

Query: 244 NKIIEKYDAPD-FDGNNEQQNK--AIINLMQELQEFGQPPPEILNELAPGMELNEQGI 298
            KI E+++A    DG  E + +   I++LMQ+LQ+ G PP E+  E  PG+  + +G+
Sbjct: 219 GKICEQFEAEQPLDGETEHKARFERILDLMQQLQDLGHPPKELAGESPPGLNFDLEGL 276



>gi|15214770|gb|AAH12517.1| Pex19 protein [Mus musculus]
          Length = 285

 Score = 96.7 bits (239), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 70/244 (28%), Positives = 119/244 (48%), Gaps = 39/244 (15%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 61  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDASSQQEFTSCLKETLS 120

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +   +LQNS          G +++  E+MK +E +    G  E D    
Sbjct: 121 G--------LAKNATELQNS----------GMSEE--ELMKAMEGL----GMDEGD---- 152

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G   +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++   PPE + +Y++Q   +
Sbjct: 153 -GEASILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHQDSTPPEQFEKYQQQHSVM 211

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM-----ELNE 295
            KI E+++A    D +     + +A+++LMQ+LQ  G PP E+  E+ PG+      LN 
Sbjct: 212 VKICEQFEAETPTDSEATQRARFEAMLDLMQQLQALGHPPKELAGEMPPGLNFDLDALNL 271

Query: 296 QGIP 299
            G P
Sbjct: 272 SGPP 275



>gi|226958490|ref|NP_075528.3| peroxisomal biogenesis factor 19 isoform a [Mus musculus]
 gi|62903494|sp|Q8VCI5.1|PEX19_MOUSE RecName: Full=Peroxisomal biogenesis factor 19; AltName:
           Full=Peroxin-19; AltName: Full=Peroxisomal farnesylated
           protein; Short=PxF; Flags: Precursor
 gi|18043902|gb|AAH19767.1| Peroxisomal biogenesis factor 19 [Mus musculus]
 gi|26325334|dbj|BAC26421.1| unnamed protein product [Mus musculus]
 gi|71059939|emb|CAJ18513.1| Pex19 [Mus musculus]
          Length = 299

 Score = 96.7 bits (239), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 70/244 (28%), Positives = 119/244 (48%), Gaps = 39/244 (15%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDASSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +   +LQNS          G +++  E+MK +E +    G  E D    
Sbjct: 135 G--------LAKNATELQNS----------GMSEE--ELMKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G   +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++   PPE + +Y++Q   +
Sbjct: 167 -GEASILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHQDSTPPEQFEKYQQQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM-----ELNE 295
            KI E+++A    D +     + +A+++LMQ+LQ  G PP E+  E+ PG+      LN 
Sbjct: 226 VKICEQFEAETPTDSEATQRARFEAMLDLMQQLQALGHPPKELAGEMPPGLNFDLDALNL 285

Query: 296 QGIP 299
            G P
Sbjct: 286 SGPP 289



>gi|466081196|ref|XP_004284480.1| PREDICTED: peroxisomal biogenesis factor 19 isoform 1 [Orcinus
           orca]
 gi|470601909|ref|XP_004312713.1| PREDICTED: peroxisomal biogenesis factor 19 isoform 1 [Tursiops
           truncatus]
          Length = 299

 Score = 96.3 bits (238), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 65/231 (28%), Positives = 116/231 (50%), Gaps = 34/231 (14%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDATSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSEE--ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGTILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQTHRESLPPEQFEKYQEQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM 291
            KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ PG+
Sbjct: 226 GKICEQFEAETPTDSEATQKARFEVVLDLMQQLQDLGHPPKELAGEMPPGL 276



>gi|507575250|ref|XP_004671170.1| PREDICTED: peroxisomal biogenesis factor 19 isoform X2 [Jaculus
           jaculus]
          Length = 257

 Score = 96.3 bits (238), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 70/244 (28%), Positives = 121/244 (49%), Gaps = 39/244 (15%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 33  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDANSQQEFTSCLKETLS 92

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +  N LQNS          G +++  E+ K +E +    G  E D    
Sbjct: 93  G--------LAKNANDLQNS----------GMSEE--ELTKAMEGL----GMDEAD---- 124

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 125 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESIPPEQFEKYQEQHSVM 183

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM-----ELNE 295
            KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ PG+      LN 
Sbjct: 184 VKICEQFEAETPTDTEATQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNL 243

Query: 296 QGIP 299
            G P
Sbjct: 244 SGPP 247



>gi|488512879|ref|XP_004448482.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform 12
           [Dasypus novemcinctus]
          Length = 299

 Score = 96.3 bits (238), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 70/244 (28%), Positives = 120/244 (49%), Gaps = 39/244 (15%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSEE--ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y+KQ   +
Sbjct: 167 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQKQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM-----ELNE 295
            KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ PG+      LN 
Sbjct: 226 GKICEQFEAETPTDDEATQKTRFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNL 285

Query: 296 QGIP 299
            G P
Sbjct: 286 SGPP 289



>gi|90076598|dbj|BAE87979.1| unnamed protein product [Macaca fascicularis]
 gi|355745811|gb|EHH50436.1| hypothetical protein EGM_01267 [Macaca fascicularis]
          Length = 299

 Score = 96.3 bits (238), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 72/245 (29%), Positives = 121/245 (49%), Gaps = 41/245 (16%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +D+  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSDE--ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVM 225

Query: 244 NKIIEKYDAPDFDGNNEQQNKA----IINLMQELQEFGQPPPEILNELAPGM-----ELN 294
            KI E+++A +   ++E   KA    +++LMQ+LQ+ G PP E+  E+ PG+      LN
Sbjct: 226 CKICEQFEA-ETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALN 284

Query: 295 EQGIP 299
             G P
Sbjct: 285 LSGPP 289



>gi|355558636|gb|EHH15416.1| hypothetical protein EGK_01502 [Macaca mulatta]
          Length = 299

 Score = 96.3 bits (238), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 72/245 (29%), Positives = 121/245 (49%), Gaps = 41/245 (16%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +D+  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSDE--ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVM 225

Query: 244 NKIIEKYDAPDFDGNNEQQNKA----IINLMQELQEFGQPPPEILNELAPGM-----ELN 294
            KI E+++A +   ++E   KA    +++LMQ+LQ+ G PP E+  E+ PG+      LN
Sbjct: 226 CKICEQFEA-ETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALN 284

Query: 295 EQGIP 299
             G P
Sbjct: 285 LSGPP 289



>gi|395845368|ref|XP_003795411.1| PREDICTED: DDB1- and CUL4-associated factor 8 [Otolemur garnettii]
          Length = 997

 Score = 96.3 bits (238), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 68/244 (27%), Positives = 120/244 (49%), Gaps = 39/244 (15%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 76  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDATSQQEFTSCLKETLS 135

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +++  E+ K +E +    G  E D    
Sbjct: 136 G--------LAKNATDLQNS----------GMSEE--ELTKAMEGL----GMDEGD---- 167

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 168 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVM 226

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM-----ELNE 295
            KI E+++     D +   + + + +++LMQ+LQ+ G PP E+  E+ PG+      LN 
Sbjct: 227 GKICEQFETETPTDSEATQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNL 286

Query: 296 QGIP 299
            G+P
Sbjct: 287 SGLP 290



>gi|425768790|gb|EKV07303.1| Peroxin 19 [Penicillium digitatum Pd1]
 gi|425770194|gb|EKV08667.1| Peroxin 19 [Penicillium digitatum PHI26]
          Length = 375

 Score = 96.3 bits (238), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 91/162 (56%), Gaps = 14/162 (8%)

Query: 128 SFQDKINQTMNKLQNSSEQLDAEI--IDGSNDQIMEMMKQIENMANLSGFAENDFEEMFG 185
           SF D I +TM +++ S ++  A I   D S D + +++K +E  A  SG  E+       
Sbjct: 202 SFNDAIKRTMGRMKESGDKATAAINEDDISEDMLAQLLKAVE--AGASGAGED------- 252

Query: 186 SGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNK--GKVPPEDYARYEKQSEYI 243
            G + KM   MME L+ K+ LYEPMKE   K+  W+E NK  GKV  ED  R+E Q+  +
Sbjct: 253 -GDLSKMFMGMMEQLSNKEMLYEPMKELDVKFGPWIEKNKGSGKVSAEDMQRFETQARVV 311

Query: 244 NKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILN 285
            +I+ K++  +F  ++ +  + +   MQE+Q  G PP E+++
Sbjct: 312 KQIVAKFEEKNFSDDDPKCREYVWERMQEMQAAGSPPEELVS 353



>gi|194035837|ref|XP_001928904.1| PREDICTED: peroxisomal biogenesis factor 19 isoform 1 [Sus scrofa]
          Length = 299

 Score = 96.3 bits (238), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 65/231 (28%), Positives = 116/231 (50%), Gaps = 34/231 (14%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDATSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSEE--ELTKAMEGL----GMEEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGTILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQVHRESLPPEQFEKYQEQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM 291
            KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ PG+
Sbjct: 226 GKICEQFEAETPTDSEATQKARFEVVLDLMQQLQDLGHPPKELAGEMPPGL 276



>gi|507575248|ref|XP_004671169.1| PREDICTED: peroxisomal biogenesis factor 19 isoform X1 [Jaculus
           jaculus]
          Length = 299

 Score = 96.3 bits (238), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 70/244 (28%), Positives = 121/244 (49%), Gaps = 39/244 (15%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDANSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +  N LQNS          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNANDLQNS----------GMSEE--ELTKAMEGL----GMDEAD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESIPPEQFEKYQEQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM-----ELNE 295
            KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ PG+      LN 
Sbjct: 226 VKICEQFEAETPTDTEATQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNL 285

Query: 296 QGIP 299
            G P
Sbjct: 286 SGPP 289



>gi|336366190|gb|EGN94538.1| hypothetical protein SERLA73DRAFT_188497 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336378862|gb|EGO20019.1| hypothetical protein SERLADRAFT_478629 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 284

 Score = 95.9 bits (237), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 54/171 (31%), Positives = 91/171 (53%), Gaps = 5/171 (2%)

Query: 129 FQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEMFGSGG 188
           +Q +I  TMNKL+ S   L+      S+D +  ++ Q+              EE      
Sbjct: 108 YQARIRATMNKLKESESTLNQSQNQASSDPLEALLAQLGQGGLEGLGEGEGGEEQ----- 162

Query: 189 MEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKIIE 248
           ++ MLE+MM  L +KD LYEP+KE + K+P +L  N   +   D +RYE Q   I +++ 
Sbjct: 163 LQGMLETMMGQLMSKDVLYEPLKELSDKFPAYLTKNAATLSASDKSRYEAQVSCIERLLV 222

Query: 249 KYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQGIP 299
            +DAP +  +N+++ + +++ M ELQ  G PP +++  L PG  +   G+P
Sbjct: 223 IFDAPGYKDDNKEKKEEVLHAMSELQSHGSPPEDLMGPLPPGFSMGADGLP 273



>gi|346970135|gb|EGY13587.1| peroxin 19 [Verticillium dahliae VdLs.17]
          Length = 341

 Score = 95.9 bits (237), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 74/245 (30%), Positives = 117/245 (47%), Gaps = 28/245 (11%)

Query: 67  DDEYVKLLTADMEDFVKEFDEN-ELSIAMQGLMKNFGEVDEDNLNGTDFDNTGRSTVESN 125
           D+E+ K L A M D + E ++N    I    +   F ++ +     T  D TG      +
Sbjct: 94  DEEFAKQLQAGMSDLLGELEKNASFPILGPEMQTQFDDMFKSMAAATAQDATGEGARPGS 153

Query: 126 GTS----------------FQDKINQTMNKLQNSSEQLDAEIIDGSNDQIM-EMMKQIEN 168
            +                 FQ+ I +TM ++Q S +   A   D S+D  + E+MKQ+  
Sbjct: 154 SSGPAQPGASADAQAADASFQETIRRTMERMQASGDSATAAAADSSSDDFLAELMKQMGE 213

Query: 169 MANLSGFAEN-DFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGK 227
              L G     DF          KML  MME L  K+ LYEPMKE   K+P+W+E NK K
Sbjct: 214 GGGLDGAGGEEDFS---------KMLMGMMEQLTNKEILYEPMKELHDKFPEWMEKNKDK 264

Query: 228 VPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNEL 287
            P ED  RY++Q   + +I+ K++ P +  +     + I+  MQ++Q+ G PP +++ ++
Sbjct: 265 TPAEDLKRYQEQQVIVKEIVAKFEQPTYSDSTPADREYIVQRMQKMQDAGSPPSDLVGDM 324

Query: 288 APGME 292
           A   E
Sbjct: 325 ASAQE 329



>gi|478537470|ref|XP_004442849.1| PREDICTED: peroxisomal biogenesis factor 19 isoform 1
           [Ceratotherium simum simum]
          Length = 299

 Score = 95.9 bits (237), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 69/244 (28%), Positives = 120/244 (49%), Gaps = 39/244 (15%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDATSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSEE--ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM-----ELNE 295
            KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ PG+      LN 
Sbjct: 226 GKICEQFEAETPTDSEATQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNL 285

Query: 296 QGIP 299
            G P
Sbjct: 286 SGPP 289



>gi|125583152|gb|EAZ24083.1| hypothetical protein OsJ_07819 [Oryza sativa Japonica Group]
          Length = 121

 Score = 95.9 bits (237), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 79/119 (66%), Gaps = 8/119 (6%)

Query: 180 FEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQ 239
           FEE  G+  M+ ++E+MM+ L +K+ L+EPMK+  +KYPKWLE+NK K+  E+Y RY  Q
Sbjct: 8   FEEFAGAQDMDSIVETMMQQLLSKEILHEPMKDIVEKYPKWLEENKSKISKEEYERYNNQ 67

Query: 240 SEYINKIIEKYDAPDFDGNNEQQNKA-IINLMQELQEFGQPPPEILNELAPGMELNEQG 297
            E + K+ E Y+        E +N A I  +MQ +QE GQPP +++ ++AP ++L++ G
Sbjct: 68  LELMMKLNEVYE-------KEPENMAKIFEIMQNMQECGQPPSDLVQDIAPDLDLSKLG 119



>gi|440899072|gb|ELR50441.1| Peroxisomal biogenesis factor 19 [Bos grunniens mutus]
          Length = 299

 Score = 95.9 bits (237), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 68/244 (27%), Positives = 120/244 (49%), Gaps = 39/244 (15%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDATSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSEE--ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L ++D LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGTILPIMQSIMQNLLSRDVLYPSLKEITEKYPEWLQAHRDSLPPEQFEKYQEQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM-----ELNE 295
            KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ PG+      LN 
Sbjct: 226 GKICEQFEAETPTDSEATQKARFEVVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNL 285

Query: 296 QGIP 299
            G P
Sbjct: 286 SGPP 289



>gi|74006307|ref|XP_536130.2| PREDICTED: peroxisomal biogenesis factor 19 [Canis lupus
           familiaris]
          Length = 299

 Score = 95.9 bits (237), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 69/244 (28%), Positives = 120/244 (49%), Gaps = 39/244 (15%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDATSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSEE--ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM-----ELNE 295
            KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ PG+      LN 
Sbjct: 226 GKICEQFEAETPTDSEATQKARFELVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNL 285

Query: 296 QGIP 299
            G P
Sbjct: 286 SGPP 289



>gi|219110003|ref|XP_002176754.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217411289|gb|EEC51217.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 321

 Score = 95.9 bits (237), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 57/165 (34%), Positives = 90/165 (54%), Gaps = 32/165 (19%)

Query: 166 IENMANLSG---FAENDFEE-------MFGSGGM------EKMLESMMEALATKDYLYEP 209
           IE+MA  +G   F ++D  +       M G  GM      + +++ MME L +KD +YEP
Sbjct: 162 IEDMAKQAGTDEFGKDDSSDETMLNDLMQGFAGMGEGFDTDAVIDGMMEQLVSKDLMYEP 221

Query: 210 MKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKA-IIN 268
           MK+ A K+P WL++ K  +  ++Y+   KQS+   +++  Y+        E  N   ++N
Sbjct: 222 MKQVALKFPSWLKEKKDSITEQEYSNRCKQSKCFERLVHVYE-------TEPTNTGKLMN 274

Query: 269 LMQELQEFGQPPPEILNELAPGME--------LNEQGIPSDLTSC 305
           LMQ +Q +GQPP EI+ E+APG+E        L+  GIP+D   C
Sbjct: 275 LMQNVQAYGQPPREIIQEIAPGLEMDVDGMPKLDASGIPTDSDCC 319



>gi|255082432|ref|XP_002504202.1| integral membrane peroxisomal protein importer-2 family [Micromonas
           sp. RCC299]
 gi|226519470|gb|ACO65460.1| integral membrane peroxisomal protein importer-2 family [Micromonas
           sp. RCC299]
          Length = 354

 Score = 95.9 bits (237), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/103 (43%), Positives = 69/103 (66%), Gaps = 4/103 (3%)

Query: 185 GSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYIN 244
           G  GM++M+++M++ L +KD LYEPM E A  YP W++ NK K+P E+  RYE Q   + 
Sbjct: 225 GQKGMQEMMDTMLQQLLSKDVLYEPMVEIAAMYPPWIKKNKKKLPAEEIVRYEAQLAKVK 284

Query: 245 KIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNEL 287
            I+E+++ P+     E Q + ++ L+QE+Q FGQPP EI+ EL
Sbjct: 285 SIVEEFEKPE----GETQFQTVVTLLQEMQSFGQPPEEIMKEL 323



>gi|512909408|ref|XP_004901585.1| PREDICTED: peroxisomal biogenesis factor 19 isoform X1
           [Heterocephalus glaber]
 gi|512994312|ref|XP_004858774.1| PREDICTED: peroxisomal biogenesis factor 19 isoform X1
           [Heterocephalus glaber]
          Length = 306

 Score = 95.5 bits (236), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 67/232 (28%), Positives = 121/232 (52%), Gaps = 29/232 (12%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLN-GTDFDNTGRSTV 122
            D E     TA+ E  +KE  E E  +    Q L +  G V E+  N G+D         
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGEETPNKGSD--------- 125

Query: 123 ESNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEE 182
            ++   F   + +T++ L  ++  L      G +D+  E+ K +E +    G  E D   
Sbjct: 126 ATSQQEFTTCLKETLSGLAKNATDLQN---SGMSDE--ELTKAMEGL----GMDEGD--- 173

Query: 183 MFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEY 242
             G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q + 
Sbjct: 174 --GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHKV 231

Query: 243 INKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM 291
           + KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ PG+
Sbjct: 232 MGKICEQFEAETPTDSEAVQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGL 283



>gi|30584565|gb|AAP36535.1| Homo sapiens peroxisomal farnesylated protein [synthetic construct]
 gi|61369573|gb|AAX43353.1| peroxisomal biogenesis factor 19 [synthetic construct]
 gi|61369580|gb|AAX43354.1| peroxisomal biogenesis factor 19 [synthetic construct]
          Length = 300

 Score = 95.5 bits (236), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 71/245 (28%), Positives = 119/245 (48%), Gaps = 41/245 (16%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNSS   +            E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNSSMSEE------------ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVM 225

Query: 244 NKIIEKYDAPDFDGNNEQQNKA----IINLMQELQEFGQPPPEILNELAPGM-----ELN 294
            KI E+++A +   ++E   KA    +++LMQ+LQ+ G PP E+  E+ PG+      LN
Sbjct: 226 CKICEQFEA-ETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALN 284

Query: 295 EQGIP 299
             G P
Sbjct: 285 LSGPP 289



>gi|4506339|ref|NP_002848.1| peroxisomal biogenesis factor 19 isoform a [Homo sapiens]
 gi|114560653|ref|XP_001171920.1| PREDICTED: peroxisomal biogenesis factor 19 isoform 5 [Pan
           troglodytes]
 gi|729723|sp|P40855.1|PEX19_HUMAN RecName: Full=Peroxisomal biogenesis factor 19; AltName: Full=33
           kDa housekeeping protein; AltName: Full=Peroxin-19;
           AltName: Full=Peroxisomal farnesylated protein; Flags:
           Precursor
 gi|551250|emb|CAA53225.1| house keeping gene 33 [Homo sapiens]
 gi|2570023|emb|CAA70257.1| PxF protein [Homo sapiens]
 gi|4521235|dbj|BAA76291.1| PEX19 [Homo sapiens]
 gi|12653449|gb|AAH00496.1| Peroxisomal biogenesis factor 19 [Homo sapiens]
 gi|30582597|gb|AAP35525.1| peroxisomal farnesylated protein [Homo sapiens]
 gi|61359509|gb|AAX41729.1| peroxisomal biogenesis factor 19 [synthetic construct]
 gi|119573113|gb|EAW52728.1| peroxisomal biogenesis factor 19, isoform CRA_b [Homo sapiens]
 gi|119573114|gb|EAW52729.1| peroxisomal biogenesis factor 19, isoform CRA_b [Homo sapiens]
 gi|123981028|gb|ABM82343.1| peroxisomal biogenesis factor 19 [synthetic construct]
 gi|123995831|gb|ABM85517.1| peroxisomal biogenesis factor 19 [synthetic construct]
 gi|261860258|dbj|BAI46651.1| peroxisomal biogenesis factor 19 [synthetic construct]
          Length = 299

 Score = 95.5 bits (236), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 71/245 (28%), Positives = 119/245 (48%), Gaps = 41/245 (16%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNSS   +            E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNSSMSEE------------ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVM 225

Query: 244 NKIIEKYDAPDFDGNNEQQNKA----IINLMQELQEFGQPPPEILNELAPGM-----ELN 294
            KI E+++A +   ++E   KA    +++LMQ+LQ+ G PP E+  E+ PG+      LN
Sbjct: 226 CKICEQFEA-ETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALN 284

Query: 295 EQGIP 299
             G P
Sbjct: 285 LSGPP 289



>gi|348561630|ref|XP_003466615.1| PREDICTED: peroxisomal biogenesis factor 19-like isoform 1 [Cavia
           porcellus]
          Length = 299

 Score = 95.5 bits (236), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 70/244 (28%), Positives = 119/244 (48%), Gaps = 39/244 (15%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F    + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDATSQQEFTTCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +D+  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSDE--ELNKAMEGL----GVDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNIFPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHNVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM-----ELNE 295
            KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ PG+      LN 
Sbjct: 226 GKICEQFEAETPTDSEAAQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNL 285

Query: 296 QGIP 299
            G P
Sbjct: 286 SGPP 289



>gi|426332321|ref|XP_004027754.1| PREDICTED: peroxisomal biogenesis factor 19 isoform 1 [Gorilla
           gorilla gorilla]
 gi|426332333|ref|XP_004027760.1| PREDICTED: peroxisomal biogenesis factor 19-like isoform 1 [Gorilla
           gorilla gorilla]
          Length = 299

 Score = 95.5 bits (236), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 71/245 (28%), Positives = 119/245 (48%), Gaps = 41/245 (16%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNSS   +            E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNSSMSEE------------ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVM 225

Query: 244 NKIIEKYDAPDFDGNNEQQNKA----IINLMQELQEFGQPPPEILNELAPGM-----ELN 294
            KI E+++A +   ++E   KA    +++LMQ+LQ+ G PP E+  E+ PG+      LN
Sbjct: 226 CKICEQFEA-ETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALN 284

Query: 295 EQGIP 299
             G P
Sbjct: 285 LSGPP 289



>gi|403294001|ref|XP_003937996.1| PREDICTED: peroxisomal biogenesis factor 19 isoform 1 [Saimiri
           boliviensis boliviensis]
          Length = 299

 Score = 95.5 bits (236), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/244 (28%), Positives = 120/244 (49%), Gaps = 39/244 (15%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSEE--ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM-----ELNE 295
            KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ PG+      LN 
Sbjct: 226 CKICEQFEAETPTDSEATQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNL 285

Query: 296 QGIP 299
            G P
Sbjct: 286 SGPP 289



>gi|326475478|gb|EGD99487.1| hypothetical protein TESG_06919 [Trichophyton tonsurans CBS 112818]
          Length = 372

 Score = 95.5 bits (236), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 64/216 (29%), Positives = 117/216 (54%), Gaps = 12/216 (5%)

Query: 78  MEDFVKEFDENELSIAMQGLMKNFGEVDEDNLNGTDFDNTGRSTVESNGTSFQDKINQTM 137
           M D +K     EL    +G+    G    D  +GT   ++   + +    +FQ+ I +TM
Sbjct: 153 MADVMKLMMGEELMTGGEGVSGMDGSTIADKASGTAKQSS--PSTKKGEDNFQETIQKTM 210

Query: 138 NKLQNSSEQLDAEIID-GSNDQIMEMMKQIENMANLSGFAENDFEEMFGSGGMEKMLESM 196
            ++Q S ++  AE+ + G+ D +M+++K +E+ + L+G  E D       G ++K+   +
Sbjct: 211 ERMQESGDKATAEVNESGNEDVLMQILKAMES-SGLAGAGEGD------DGNLDKLFMGI 263

Query: 197 MEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFD 256
           ME L+ K+ LYEP+KE   K+  WL +NK K+  +D  RYE Q+  ++ I+ K++  +F 
Sbjct: 264 MEQLSNKEMLYEPLKELDDKFGPWLRENKEKIGKDDRERYELQASLVSDIVRKFEEKNFS 323

Query: 257 GNNEQQNKAIINLMQELQEFGQPPPEILNELAPGME 292
            +  +    I   MQ++Q  G PP ++++  AP M+
Sbjct: 324 DDKPEDRAYIWEKMQKMQAAGSPPDDLIS--APFMD 357



>gi|171693789|ref|XP_001911819.1| hypothetical protein [Podospora anserina S mat+]
 gi|170946843|emb|CAP73647.1| unnamed protein product [Podospora anserina S mat+]
          Length = 375

 Score = 95.5 bits (236), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 58/161 (36%), Positives = 91/161 (56%), Gaps = 7/161 (4%)

Query: 129 FQDKINQTMNKLQNSSEQLDAEII-DGSNDQIMEMMKQIENMANLSGFAENDF-EEMFGS 186
           FQ+ I +TM ++Q S EQ  A    +GS+D + E++KQ++      G    +  EE F  
Sbjct: 203 FQETIRRTMERMQTSGEQATAAAAAEGSDDFLAELLKQMQAGGGGLGDLGGEGSEEEFS- 261

Query: 187 GGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKI 246
               KML  MME L  K+ LYEPMKE   K+P+WLE N+ K   ED  RYE+Q   + +I
Sbjct: 262 ----KMLLGMMEQLTNKEILYEPMKELHDKFPEWLEKNRDKTSAEDLKRYEEQQGLVAEI 317

Query: 247 IEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNEL 287
           + K++   +        + I++ MQ++Q  GQPP +++ ++
Sbjct: 318 VGKFEEAGYSDEKPADREYIVDRMQKMQASGQPPADLVGDM 358



>gi|77736027|ref|NP_001029712.1| peroxisomal biogenesis factor 19 [Bos taurus]
 gi|116248573|sp|Q3SZD1.1|PEX19_BOVIN RecName: Full=Peroxisomal biogenesis factor 19; AltName:
           Full=Peroxin-19; AltName: Full=Peroxisomal farnesylated
           protein; Flags: Precursor
 gi|74267818|gb|AAI02950.1| Peroxisomal biogenesis factor 19 [Bos taurus]
 gi|296489867|tpg|DAA31980.1| TPA: peroxisomal biogenesis factor 19 [Bos taurus]
          Length = 299

 Score = 95.5 bits (236), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 68/244 (27%), Positives = 119/244 (48%), Gaps = 39/244 (15%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDATSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSEE--ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L ++D LY  +KE  +KYP+WL  ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGTILPIMQSIMQNLLSRDVLYPSLKEITEKYPEWLRAHRDSLPPEQFEKYQEQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM-----ELNE 295
            KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ PG+      LN 
Sbjct: 226 GKICEQFEAETPTDSEATQKARFEVVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNL 285

Query: 296 QGIP 299
            G P
Sbjct: 286 SGPP 289



>gi|399165265|emb|CCE33876.1| related to PEX19 protein [Claviceps purpurea 20.1]
          Length = 355

 Score = 95.1 bits (235), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 93/174 (53%), Gaps = 13/174 (7%)

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIM-EMMKQIENMANLSGF---AEND 179
           S   SFQ+ I +TM ++Q S E+  A    GS D  M E++KQ+ +          +E D
Sbjct: 180 SRDASFQETIRRTMERMQTSGEEATAAASAGSGDNFMAELLKQMGSGDLGDLGGEGSEED 239

Query: 180 FEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQ 239
           F          KML  MME L  K+ LYEP+KE   K+P+W E N+    PED  R+E+Q
Sbjct: 240 FS---------KMLMGMMEQLTNKEILYEPIKELDDKFPEWFEKNRASTSPEDLKRFEEQ 290

Query: 240 SEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMEL 293
              + +I+ K++   +  +N    + I+N MQ++Q  G PP +++ ++A   ++
Sbjct: 291 RGLVREIVAKFEEASYSDDNPADREYIVNRMQKMQAAGSPPSDLMGDMAAAQDM 344



>gi|472377001|ref|XP_004407934.1| PREDICTED: peroxisomal biogenesis factor 19 [Odobenus rosmarus
           divergens]
          Length = 299

 Score = 95.1 bits (235), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 65/231 (28%), Positives = 116/231 (50%), Gaps = 34/231 (14%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDATSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSEE--ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHGVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM 291
            KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ PG+
Sbjct: 226 GKICEQFEAESPTDSEATQKARFELVLDLMQQLQDLGHPPKELAGEMPPGL 276



>gi|225681772|gb|EEH20056.1| predicted protein [Paracoccidioides brasiliensis Pb03]
          Length = 423

 Score = 95.1 bits (235), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 58/165 (35%), Positives = 92/165 (55%), Gaps = 10/165 (6%)

Query: 126 GTSFQDKINQTMNKLQNSSEQLDAEII-DGSNDQIMEMMKQIENMANLSGFAENDFEEMF 184
           G  FQ+ I +TM ++Q S E+  A    DG +D +++++K +E+ A   G    +     
Sbjct: 243 GDKFQETIRKTMERMQVSGEKATAAATEDGGDDMLVKLLKAMESGAGAGGGNGEES---- 298

Query: 185 GSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYIN 244
               ++K+   +ME L+ KD LYEPMKE    +  WLE+N+GKVP ED  RYE Q+  + 
Sbjct: 299 ----LDKIFMGIMEQLSNKDMLYEPMKELHNNFGPWLEENRGKVPKEDMERYELQAVVVR 354

Query: 245 KIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEIL-NELA 288
           +I+EK+D   +  +  +    I   MQ++Q  G PP  ++ N LA
Sbjct: 355 EIVEKFDEEGYSDDKPEHRAYIWEKMQKMQAAGSPPDALVSNPLA 399



>gi|281346470|gb|EFB22054.1| hypothetical protein PANDA_018451 [Ailuropoda melanoleuca]
          Length = 267

 Score = 95.1 bits (235), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 116/231 (50%), Gaps = 34/231 (14%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 43  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDATSQQEFTSCLKETLS 102

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +++  E+ K +E +    G  E D    
Sbjct: 103 G--------LAKNATDLQNS----------GMSEE--ELTKAMEGL----GMDEGD---- 134

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +K+  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 135 -GDGNILPIMQSIMQNLLSKDVLYPSLKDITEKYPEWLQSHRESLPPEQFEKYQEQHSVM 193

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM 291
            KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ PG+
Sbjct: 194 GKICEQFEAETPTDCEATQKARFELVLDLMQQLQDLGHPPKELAGEMPPGL 244



>gi|465963149|gb|EMP30006.1| Peroxisomal biogenesis factor 19, partial [Chelonia mydas]
          Length = 822

 Score = 95.1 bits (235), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 66/238 (27%), Positives = 115/238 (48%), Gaps = 34/238 (14%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 598 FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDTTSQQEFTSCLKETLS 657

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +  N LQNSS   +            E+ K +E +    G  E D    
Sbjct: 658 G--------LAKNANDLQNSSMSEE------------ELAKAMEGL----GLEEGD---- 689

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL  ++  +P E + +Y++Q   +
Sbjct: 690 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLRSHRDTLPEEQFEKYQEQHSIM 748

Query: 244 NKIIEKYD---APDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQGI 298
            KI ++++   A D D   + + + +++LMQ+LQ+ G PP E+  E  PG+  +  G+
Sbjct: 749 GKICQQFEAEQATDSDAEQKARFEMVLDLMQQLQDLGHPPKELAGESPPGLNFDLDGL 806



>gi|194210541|ref|XP_001491475.2| PREDICTED: peroxisomal biogenesis factor 19-like [Equus caballus]
          Length = 299

 Score = 95.1 bits (235), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/244 (28%), Positives = 120/244 (49%), Gaps = 39/244 (15%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDATSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSEE--ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHQESLPPEQFEKYQEQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM-----ELNE 295
            KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ PG+      LN 
Sbjct: 226 GKICEQFEAETPTDSEATQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNL 285

Query: 296 QGIP 299
            G P
Sbjct: 286 SGPP 289



>gi|149040724|gb|EDL94681.1| rCG20208, isoform CRA_c [Rattus norvegicus]
          Length = 303

 Score = 95.1 bits (235), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 64/229 (27%), Positives = 115/229 (50%), Gaps = 34/229 (14%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDASSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQN+          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNA----------GMSEE--ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNILPIMQSLMQNLLSKDVLYPSLKEITEKYPEWLQSHQESIPPEQFEKYQQQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAP 289
            KI E+++A    D +  +  + +A+++LMQ+LQ+ G PP E+  E+ P
Sbjct: 226 GKICEQFEAETPTDSEATHRARFEAVLDLMQQLQDLGHPPKELAGEMKP 274



>gi|125540572|gb|EAY86967.1| hypothetical protein OsI_08359 [Oryza sativa Indica Group]
          Length = 187

 Score = 94.7 bits (234), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 78/119 (65%), Gaps = 8/119 (6%)

Query: 180 FEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQ 239
           FEE  G+  M+ ++E+MM+ L +K+ L+EPMK+  +KYPKWLE+NK K+  E+Y RY  Q
Sbjct: 74  FEEFAGAQDMDSIVETMMQQLLSKEILHEPMKDIVEKYPKWLEENKSKISKEEYERYNNQ 133

Query: 240 SEYINKIIEKYDAPDFDGNNEQQNKA-IINLMQELQEFGQPPPEILNELAPGMELNEQG 297
            E + K+ E Y+        E +N   I  +MQ +QE GQPP +++ ++AP ++L++ G
Sbjct: 134 LELMMKLNEVYE-------KEPENMVKIFEIMQNMQECGQPPSDLVQDIAPDLDLSKLG 185



>gi|302912783|ref|XP_003050776.1| hypothetical protein NECHADRAFT_40805 [Nectria haematococca mpVI
           77-13-4]
 gi|256731714|gb|EEU45063.1| hypothetical protein NECHADRAFT_40805 [Nectria haematococca mpVI
           77-13-4]
          Length = 497

 Score = 94.7 bits (234), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 62/181 (34%), Positives = 95/181 (52%), Gaps = 13/181 (7%)

Query: 127 TSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIM-EMMKQIENMANLSGFAENDFEEMFG 185
            SFQ+ I +TM ++Q S +Q  A   +G  D  M EM+KQ+ +        +        
Sbjct: 325 ASFQETIRRTMERMQASGDQATAAAAEGPADDFMSEMLKQLSSGDLGGLGGDG------S 378

Query: 186 SGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINK 245
                KML  MME L  K+ LYEPMKE   K+P+WL  N+   P ED  RYE+Q   + +
Sbjct: 379 EEEFSKMLMGMMEQLTNKEILYEPMKELDDKFPEWLAKNRNSTPKEDLKRYEEQQSVVRE 438

Query: 246 IIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGME-LNEQGIPSDLTS 304
           I+ K++   +  +N    + I++ MQ++Q  G PP +++ ++A   E LN    PSD  +
Sbjct: 439 IVAKFEEKTYSDSNAADREFIVDKMQKMQAAGSPPSDLVGDMASAQEALN----PSD-EA 493

Query: 305 C 305
           C
Sbjct: 494 C 494



>gi|482557247|gb|EOA21439.1| hypothetical protein CARUB_v10001820mg [Capsella rubella]
          Length = 245

 Score = 94.7 bits (234), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 58/188 (30%), Positives = 101/188 (53%), Gaps = 16/188 (8%)

Query: 120 STVESNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAEND 179
           S V+  G    D  ++   K + + E   AE +D   +Q  E +K +E+++       +D
Sbjct: 48  SGVQGLGMGLPDMRSKKKGKQKIAKEDHVAEALDKLREQTRETVKGLESLSPKQHPTGSD 107

Query: 180 ----------FEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVP 229
                     FE++ GS  +E ++++MM+ L +KD L+EPMKE   +YPKWLE+++  + 
Sbjct: 108 DAMVEDWIKQFEDLAGSNDLESIVDTMMQQLLSKDILHEPMKEIGARYPKWLEEHETSLD 167

Query: 230 PEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAP 289
            E++ RY +Q E I ++   Y+      N    +  I+ +MQ++QE GQPP +I+ E+ P
Sbjct: 168 KEEFERYSRQYELIKELNLVYE------NEPNNSTKIMEIMQKMQECGQPPSDIVQEMDP 221

Query: 290 GMELNEQG 297
           G +    G
Sbjct: 222 GFDFASLG 229



>gi|225426981|ref|XP_002269360.1| PREDICTED: peroxisome biogenesis protein 19-1 [Vitis vinifera]
 gi|297741197|emb|CBI31928.3| unnamed protein product [Vitis vinifera]
          Length = 243

 Score = 94.7 bits (234), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 89/161 (55%), Gaps = 18/161 (11%)

Query: 149 AEIIDGSNDQIMEMMKQIENMANLSGFAE------------NDFEEMFGSGGMEKMLESM 196
           AE +D   +Q  E +K++E++       +              FEE+ GS  ME ++E+M
Sbjct: 73  AEALDKLREQTREAVKELESVTGAQPGGDELGKDAMMEDWVKQFEELAGSQDMESIVETM 132

Query: 197 MEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFD 256
           M+ L +K+ L+EPMKE  ++YPKWL++++  +  E++ RY  Q   I  + E Y+     
Sbjct: 133 MQQLLSKEILHEPMKEIGERYPKWLKEHEAGLSKEEFERYSHQYGLIKNLNEVYE----- 187

Query: 257 GNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQG 297
            N+      I+ LMQ++QE GQPP +I+ ELAP  +L   G
Sbjct: 188 -NDPGNFTKIVELMQQMQECGQPPNDIVQELAPDFDLANLG 227



>gi|507683221|ref|XP_004639989.1| PREDICTED: peroxisomal biogenesis factor 19 isoform X1 [Octodon
           degus]
          Length = 299

 Score = 94.4 bits (233), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 72/245 (29%), Positives = 119/245 (48%), Gaps = 41/245 (16%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F    + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDATSQQEFTTCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +D+  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSDE--ELNKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHNVM 225

Query: 244 NKIIEKYDAPDFDGNNEQQNKA----IINLMQELQEFGQPPPEILNELAPGM-----ELN 294
            KI E+++A +    +E   KA    +++LMQ+LQ+ G PP E+  E+ PG+      LN
Sbjct: 226 GKICEQFEA-ETPTESEAAQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALN 284

Query: 295 EQGIP 299
             G P
Sbjct: 285 LSGPP 289



>gi|504154358|ref|XP_004589137.1| PREDICTED: peroxisomal biogenesis factor 19 isoform X2 [Ochotona
           princeps]
          Length = 279

 Score = 94.4 bits (233), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 113/229 (49%), Gaps = 34/229 (14%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDATSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSEE--ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE Y +Y +Q   +
Sbjct: 167 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESIPPEQYDKYLEQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAP 289
            KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ P
Sbjct: 226 GKICEQFEAETPTDTEATQKARFETVLDLMQQLQDLGHPPKELAGEMVP 274



>gi|482567131|gb|EOA31320.1| hypothetical protein CARUB_v10014492mg [Capsella rubella]
          Length = 245

 Score = 94.4 bits (233), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 54/160 (33%), Positives = 92/160 (57%), Gaps = 18/160 (11%)

Query: 149 AEIIDGSNDQIMEMMKQIENMANLSGFAEND----------FEEMFGSGGMEKMLESMME 198
            E +D   +Q  E +K +E++++    A +D          FE++ GS  +E ++E+MM+
Sbjct: 77  TEALDKLREQTRETVKGLESISSKQQPASDDDGMVEDFLKQFEDLAGSKDLESIVETMMQ 136

Query: 199 ALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGN 258
            L +KD L+EPMKE   +Y KWL++N+  +  ED+ RY +Q + I ++   Y+       
Sbjct: 137 QLLSKDILHEPMKEIGARYTKWLKENEASLSKEDFNRYSQQYKLIEELNVVYE------- 189

Query: 259 NEQQNKA-IINLMQELQEFGQPPPEILNELAPGMELNEQG 297
           NE  N + I+ +MQ++QE GQPP +I+ E+ PG +    G
Sbjct: 190 NEPNNSSKIMEIMQKMQECGQPPSDIVKEIDPGFDFASLG 229



>gi|258563966|ref|XP_002582728.1| predicted protein [Uncinocarpus reesii 1704]
 gi|237908235|gb|EEP82636.1| predicted protein [Uncinocarpus reesii 1704]
          Length = 247

 Score = 94.4 bits (233), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 98/161 (60%), Gaps = 7/161 (4%)

Query: 128 SFQDKINQTMNKLQNSSEQLDAEIIDGS-NDQIMEMMKQIENM-ANLSGFAENDFEEMFG 185
           +FQ+ I +TM+++Q S ++  A + D + ND +++M+K +E M A+  G    D +E F 
Sbjct: 75  TFQETIRKTMDRMQESGDKATAAVNDSADNDVLVQMLKAMEAMDASGLGGDGQDDDEKF- 133

Query: 186 SGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINK 245
               E ++   ME L+ K+ LYEP+KE  +K+  WL++NK K+  EDY RY KQ++ +  
Sbjct: 134 ----ENLIMRAMEQLSNKEILYEPVKELHEKFGPWLKENKEKLSKEDYERYGKQAQLMAD 189

Query: 246 IIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNE 286
           +++K+D P +  +  +    I   MQE+Q  G PP +++++
Sbjct: 190 VMKKFDEPGYSDDKPEHRNYIWEKMQEMQSTGTPPKDLVSD 230



>gi|482815476|gb|EOA92151.1| hypothetical protein SETTUDRAFT_30622 [Setosphaeria turcica Et28A]
          Length = 360

 Score = 94.4 bits (233), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 75/250 (30%), Positives = 122/250 (48%), Gaps = 18/250 (7%)

Query: 58  DQADLPSQLDDEYVKLLTADMEDFVKEFDE--NELSIAMQGL--MKNFGEVDEDNLNGTD 113
           DQ +   QL  E  +LL     DF K+F++   E+S  + G   +   G        G  
Sbjct: 121 DQEEFQKQLQKEMEQLLGQG--DFQKQFEDIMKEMSAELGGANPLDAAGPAGP-KAEGAA 177

Query: 114 FDNTGRSTVESNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLS 173
             ++ + T      +FQ+ I +TM ++Q+SS+   +     + D I+  M        L+
Sbjct: 178 ATSSEKETAAKAEKNFQETIKKTMERMQSSSDTATSAAASSAQDDILAQM--------LA 229

Query: 174 GFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDY 233
                 F    G     K+L  MME L  KD LYEPMKE   K+PKW+E+NK KV  +D 
Sbjct: 230 SMESGGFGGEGGDEDFSKVLMGMMEQLTNKDILYEPMKELDDKFPKWMEENKEKVDKDDL 289

Query: 234 ARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMEL 293
            RYE+Q   + +I+ +++   +  +N Q  + I+  MQ++Q  G PPP+++ ++    E 
Sbjct: 290 KRYEEQQTLVREIVGRFERKGYSDDNAQDREYIVERMQKMQAAGSPPPDLVGDMNAAQEA 349

Query: 294 NE---QGIPS 300
            +   QG P+
Sbjct: 350 LQDIDQGCPT 359



>gi|197102946|ref|NP_001126269.1| peroxisomal biogenesis factor 19 [Pongo abelii]
 gi|75041464|sp|Q5R7U2.1|PEX19_PONAB RecName: Full=Peroxisomal biogenesis factor 19; AltName:
           Full=Peroxin-19; AltName: Full=Peroxisomal farnesylated
           protein; Flags: Precursor
 gi|55730899|emb|CAH92168.1| hypothetical protein [Pongo abelii]
          Length = 299

 Score = 94.4 bits (233), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 71/245 (28%), Positives = 121/245 (49%), Gaps = 41/245 (16%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSEE--ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVM 225

Query: 244 NKIIEKYDAPDFDGNNEQQNKA----IINLMQELQEFGQPPPEILNELAPGM-----ELN 294
            KI E+++A +   ++E   KA    +++LMQ+LQ+ G PP E+  E+ PG+      LN
Sbjct: 226 CKICEQFEA-ETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALN 284

Query: 295 EQGIP 299
             G P
Sbjct: 285 LSGPP 289



>gi|330934877|ref|XP_003304745.1| hypothetical protein PTT_17403 [Pyrenophora teres f. teres 0-1]
 gi|311318527|gb|EFQ87158.1| hypothetical protein PTT_17403 [Pyrenophora teres f. teres 0-1]
          Length = 341

 Score = 94.4 bits (233), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 76/254 (29%), Positives = 124/254 (48%), Gaps = 27/254 (10%)

Query: 68  DEYVKLLTADME------DFVKEFDE--NELSIAMQGL----MKNFGEVDEDNLNGTDFD 115
           DE+ K L  +ME      DF K+F++   E+S  M G     +   G  D     GT   
Sbjct: 93  DEFQKQLQKEMENLLGQGDFQKQFEDIMKEMSEEMGGANPLAVPGHGHADAPKAEGTSTP 152

Query: 116 N-TGRSTVESNGT-----SFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENM 169
             T   ++E + +     SFQ+ I +TM ++Q+SS+   +     S D I+  M     +
Sbjct: 153 KATAGPSIEKDTSAKAEKSFQETIKKTMERMQSSSDTATSAAASSSQDDILAQM-----L 207

Query: 170 ANLSGFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVP 229
           A++         E        K+L  MME L  KD LYEPMKE   K+P+W+E N+ K  
Sbjct: 208 ASMESGGFGGGAEGGEED-FSKVLMGMMEQLTNKDILYEPMKELDDKFPQWMEKNREKTE 266

Query: 230 PEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAP 289
            ED  R+E+Q   + +I+ +++   +  +N Q  + I+  MQ++Q  G PPP+++ ++  
Sbjct: 267 KEDLKRFEEQQTLVREIVGRFERKGYSDDNAQDREYIVERMQKMQAAGSPPPDLVGDMNA 326

Query: 290 GMEL---NEQGIPS 300
             E     +QG P+
Sbjct: 327 AQEALQDMDQGCPT 340



>gi|511913139|ref|XP_004775906.1| PREDICTED: peroxisomal biogenesis factor 19 isoform X3 [Mustela
           putorius furo]
 gi|512004731|ref|XP_004819836.1| PREDICTED: peroxisomal biogenesis factor 19 [Mustela putorius furo]
          Length = 299

 Score = 94.4 bits (233), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 67/244 (27%), Positives = 119/244 (48%), Gaps = 39/244 (15%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDATSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +++  E+ K +E +           +E 
Sbjct: 135 G--------LAKNATDLQNS----------GMSEE--ELTKAMEGLG---------MDEG 165

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 166 EGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM-----ELNE 295
            KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ PG+      LN 
Sbjct: 226 GKICEQFEAETPTDSEATQKARFELVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNL 285

Query: 296 QGIP 299
            G P
Sbjct: 286 SGPP 289



>gi|255576048|ref|XP_002528919.1| Peroxisomal biogenesis factor, putative [Ricinus communis]
 gi|223531621|gb|EEF33448.1| Peroxisomal biogenesis factor, putative [Ricinus communis]
          Length = 249

 Score = 94.4 bits (233), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 84/147 (57%), Gaps = 22/147 (14%)

Query: 152 IDGSNDQIMEMMKQIENMANLSGFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMK 211
           +D SND + + +KQ              FEE+  +  M  ++E+MM+ L +K+ L+EPMK
Sbjct: 108 VDFSNDLMDDWVKQ--------------FEELADTRDMNSIVETMMQQLLSKEILHEPMK 153

Query: 212 EFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQN-KAIINLM 270
           E  ++YP WLE+NK ++  EDY RY +Q E I  + E Y+       NE  N   I +LM
Sbjct: 154 EIGERYPIWLEENKARLTNEDYGRYTQQYELIKNLNEVYE-------NEPNNFTKITDLM 206

Query: 271 QELQEFGQPPPEILNELAPGMELNEQG 297
            ++QE GQPP +I+ ELAP ++    G
Sbjct: 207 LKMQECGQPPNDIVQELAPEIDFANLG 233



>gi|426216943|ref|XP_004002716.1| PREDICTED: peroxisomal biogenesis factor 19 isoform 2 [Ovis aries]
          Length = 279

 Score = 94.0 bits (232), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 64/229 (27%), Positives = 114/229 (49%), Gaps = 34/229 (14%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDATSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSEE--ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGTILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQAHRDSLPPEQFEKYQEQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAP 289
            KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ P
Sbjct: 226 GKICEQFEAETPTDTEATQKARFEVVLDLMQQLQDLGHPPKELAGEMVP 274



>gi|332219221|ref|XP_003258755.1| PREDICTED: peroxisomal biogenesis factor 19 isoform 1 [Nomascus
           leucogenys]
          Length = 299

 Score = 94.0 bits (232), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 71/245 (28%), Positives = 121/245 (49%), Gaps = 41/245 (16%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSEE--ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHQESLPPEQFEKYQEQHSVM 225

Query: 244 NKIIEKYDAPDFDGNNEQQNKA----IINLMQELQEFGQPPPEILNELAPGM-----ELN 294
            KI E+++A +   ++E   KA    +++LMQ+LQ+ G PP E+  E+ PG+      LN
Sbjct: 226 CKICEQFEA-ETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALN 284

Query: 295 EQGIP 299
             G P
Sbjct: 285 LSGPP 289



>gi|302422286|ref|XP_003008973.1| Pex19 family protein [Verticillium albo-atrum VaMs.102]
 gi|261352119|gb|EEY14547.1| Pex19 family protein [Verticillium albo-atrum VaMs.102]
          Length = 359

 Score = 94.0 bits (232), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 76/245 (31%), Positives = 116/245 (47%), Gaps = 28/245 (11%)

Query: 67  DDEYVKLLTADMEDFVKEFDEN-ELSIAMQGLMKNFGEVDEDNLNGTDFDNT---GRSTV 122
           D+E+ K L A M D + E ++N  L I    +   F ++ +     T  D T    R   
Sbjct: 112 DEEFAKQLQAGMSDLLGELEKNASLPILGPEMQTQFDDMFKSMAAATAQDATSEEARPGA 171

Query: 123 ESNGT-------------SFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIM-EMMKQIEN 168
            S                SFQ+ I +TM ++Q S +   A   D S+D  + E+MKQ+  
Sbjct: 172 SSGPAQPGASADAQAADASFQETIRRTMERMQASGDSATAAAADSSSDDFLAELMKQMGE 231

Query: 169 MANLSGFAEN-DFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGK 227
                G     DF          KML  MME L  K+ LYEPMKE   K+P W+E NK K
Sbjct: 232 GGGPDGAGGEEDFS---------KMLMGMMEQLTNKEILYEPMKELHDKFPGWMEKNKDK 282

Query: 228 VPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNEL 287
            P ED  RY++Q   + +I+ K++ P +  +     + I+  MQ++Q+ G PP +++ ++
Sbjct: 283 TPAEDLKRYQEQQVIVKEIVAKFEQPTYSDSTPADREYIVQRMQKMQDAGSPPSDLVGDM 342

Query: 288 APGME 292
           A   E
Sbjct: 343 ASAQE 347



>gi|389742825|gb|EIM84011.1| Pex19-domain-containing protein [Stereum hirsutum FP-91666 SS1]
          Length = 391

 Score = 94.0 bits (232), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 100/213 (46%), Gaps = 20/213 (9%)

Query: 106 EDNLNGTDFDNTGRSTVESNGTSFQDKINQT-------------MNKLQNSSEQLDAEII 152
           E+ + G   D T   +  + G + Q K  QT             +  ++ + E+L     
Sbjct: 183 EEAMAGLKLDPTAEGSATAAGANGQGKERQTRSLPEGADVEDEFLKSVRQAQEKLKESEA 242

Query: 153 DGSNDQIMEMMKQIENMANLSGFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKE 212
           +    + M M   +E +    G  E D EE  G      +LE MM +L +KD LYEP+KE
Sbjct: 243 NLRASESMSMPDDLEKLIAQLGSGEAD-EEFSG------ILEGMMGSLMSKDILYEPLKE 295

Query: 213 FAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQE 272
              K+P +L +NK K+  ED  R+  Q E I KI+  ++   +   + ++   ++ LM E
Sbjct: 296 LHDKFPPYLSENKDKLSTEDNERFVAQQECITKIVAIFEDVKYSDEDVEKKTEVMQLMTE 355

Query: 273 LQEFGQPPPEILNELAPGMELNEQGIPSDLTSC 305
           +Q  G PP EI+  L PG+++   G+P     C
Sbjct: 356 MQSHGSPPAEIMGALPPGLDMGADGMPELPDGC 388



>gi|466081201|ref|XP_004284481.1| PREDICTED: peroxisomal biogenesis factor 19 isoform 2 [Orcinus
           orca]
 gi|470601912|ref|XP_004312714.1| PREDICTED: peroxisomal biogenesis factor 19 isoform 2 [Tursiops
           truncatus]
          Length = 279

 Score = 94.0 bits (232), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 64/229 (27%), Positives = 114/229 (49%), Gaps = 34/229 (14%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDATSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSEE--ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGTILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQTHRESLPPEQFEKYQEQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAP 289
            KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ P
Sbjct: 226 GKICEQFEAETPTDSEATQKARFEVVLDLMQQLQDLGHPPKELAGEMVP 274



>gi|189195650|ref|XP_001934163.1| peroxin [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|187980042|gb|EDU46668.1| peroxin [Pyrenophora tritici-repentis Pt-1C-BFP]
          Length = 340

 Score = 94.0 bits (232), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 77/257 (29%), Positives = 126/257 (49%), Gaps = 34/257 (13%)

Query: 68  DEYVKLLTADME------DFVKEFDE--NELSIAMQGL----MKNFGEVDEDNLNGTDFD 115
           DE+ K L  +ME      DF K+F++   E+S  M G     +   G  D     GT   
Sbjct: 93  DEFQKQLQKEMENLLGQGDFQKQFEDIMKEMSEEMGGANPLAVPGHGHSDASKPEGT--- 149

Query: 116 NTGRSTVESNG---------TSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQI 166
           NT +++   +           SFQ+ I +TM ++Q+SS+   +     S D I+  M  +
Sbjct: 150 NTAKASAGPSAEKETSAKAEKSFQETIKKTMERMQSSSDTATSAAASSSQDDILAQM--L 207

Query: 167 ENMANLSGFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKG 226
            +M +         EE F      K+L  MME L  KD LYEPMKE   K+P+W+E N+ 
Sbjct: 208 ASMESGGFGGGEGGEEDFS-----KVLMGMMEQLTNKDILYEPMKELDDKFPQWMEKNRE 262

Query: 227 KVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNE 286
           K   +D  R+E+Q   + +I+ +++   +  +N Q  + I+  MQ++Q  G PPP+++ +
Sbjct: 263 KTEKDDLKRFEEQQTLVREIVGRFERKGYSDDNPQDREYIVERMQKMQAAGSPPPDLVGD 322

Query: 287 LAPGMEL---NEQGIPS 300
           +    E     +QG P+
Sbjct: 323 MNAAQEALQDMDQGCPT 339



>gi|149040726|gb|EDL94683.1| rCG20208, isoform CRA_e [Rattus norvegicus]
          Length = 295

 Score = 93.6 bits (231), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 66/239 (27%), Positives = 120/239 (50%), Gaps = 35/239 (14%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDASSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQN+          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNA----------GMSEE--ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNILPIMQSLMQNLLSKDVLYPSLKEITEKYPEWLQSHQESIPPEQFEKYQQQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQGIP 299
            KI E+++A    D +  +  + +A+++LMQ+LQ+ G PP E+  E+   M+ +  G+P
Sbjct: 226 GKICEQFEAETPTDSEATHRARFEAVLDLMQQLQDLGHPPKELAGEMCSIMQ-DIPGVP 283



>gi|149040728|gb|EDL94685.1| rCG20208, isoform CRA_g [Rattus norvegicus]
          Length = 207

 Score = 93.6 bits (231), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 73/110 (66%), Gaps = 3/110 (2%)

Query: 185 GSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYIN 244
           G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   + 
Sbjct: 75  GEGNILPIMQSLMQNLLSKDVLYPSLKEITEKYPEWLQSHQESIPPEQFEKYQQQHSVMG 134

Query: 245 KIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM 291
           KI E+++A    D +  +  + +A+++LMQ+LQ+ G PP E+  E+ PG+
Sbjct: 135 KICEQFEAETPTDSEATHRARFEAVLDLMQQLQDLGHPPKELAGEMPPGL 184



>gi|149040722|gb|EDL94679.1| rCG20208, isoform CRA_a [Rattus norvegicus]
          Length = 267

 Score = 93.6 bits (231), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 68/246 (27%), Positives = 120/246 (48%), Gaps = 39/246 (15%)

Query: 52  SPDKSRDQADLPSQ-----LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEV 104
           +PD S  Q   P        D E     TA+ E  +KE  E E  +    Q L +  G V
Sbjct: 44  APDASGPQKRSPGDTAKELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRV 103

Query: 105 DEDNLNGTDFDNTGRSTVESNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMK 164
             D  +  +F +  + T+          + +    LQN+          G +++  E+ K
Sbjct: 104 GSDASSQQEFTSCLKETLSG--------LAKNATDLQNA----------GMSEE--ELTK 143

Query: 165 QIENMANLSGFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDN 224
            +E +    G  E D     G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ +
Sbjct: 144 AMEGL----GMDEGD-----GEGNILPIMQSLMQNLLSKDVLYPSLKEITEKYPEWLQSH 194

Query: 225 KGKVPPEDYARYEKQSEYINKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPP 281
           +  +PPE + +Y++Q   + KI E+++A    D +  +  + +A+++LMQ+LQ+ G PP 
Sbjct: 195 QESIPPEQFEKYQQQHSVMGKICEQFEAETPTDSEATHRARFEAVLDLMQQLQDLGHPPK 254

Query: 282 EILNEL 287
           E+  E+
Sbjct: 255 ELAGEM 260



>gi|311254007|ref|XP_003125714.1| PREDICTED: peroxisomal biogenesis factor 19 isoform 2 [Sus scrofa]
          Length = 279

 Score = 93.6 bits (231), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 64/229 (27%), Positives = 114/229 (49%), Gaps = 34/229 (14%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDATSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSEE--ELTKAMEGL----GMEEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGTILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQVHRESLPPEQFEKYQEQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAP 289
            KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ P
Sbjct: 226 GKICEQFEAETPTDSEATQKARFEVVLDLMQQLQDLGHPPKELAGEMVP 274



>gi|410986681|ref|XP_003999638.1| PREDICTED: peroxisomal biogenesis factor 19 isoform 2 [Felis catus]
          Length = 209

 Score = 93.6 bits (231), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 41/115 (35%), Positives = 75/115 (65%), Gaps = 3/115 (2%)

Query: 180 FEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQ 239
            EE  G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++G +PPE + +Y++Q
Sbjct: 72  MEEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRGSLPPEQFEKYQEQ 131

Query: 240 SEYINKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM 291
              + KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ PG+
Sbjct: 132 HSVMGKICEQFEAETPTDSEATQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGL 186



>gi|254569068|ref|XP_002491644.1| PEX19; peroxisomal biogenesis protein [Komagataella pastoris GS115]
 gi|5453266|gb|AAD43507.1|AF133271_1 Pex19 protein [Komagataella pastoris]
 gi|238031441|emb|CAY69364.1| PEX19; peroxisomal biogenesis protein [Komagataella pastoris GS115]
 gi|328351851|emb|CCA38250.1| Peroxisomal biogenesis factor 19 [Komagataella pastoris CBS 7435]
          Length = 300

 Score = 93.6 bits (231), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 101/176 (57%), Gaps = 4/176 (2%)

Query: 113 DFDNTGRSTVESNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANL 172
           D + +   +   +   F+  I++T+NK+++  +++D +I     D+++  + +  ++ +L
Sbjct: 80  DLEGSATPSSTKDKKDFKSVISETVNKIRDGGDKIDEQIKSEQPDELLSQLLKNLDIGDL 139

Query: 173 SGFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKG--KVPP 230
                ND E   G+  + KML  M++ L++K  LYEP+KE   KYP WLE +K   K+  
Sbjct: 140 GDLL-ND-EGGDGNDNIGKMLVEMLDQLSSKKILYEPIKELYDKYPAWLEAHKTDEKISK 197

Query: 231 EDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNE 286
           E+++ Y+ Q   +  I+E++D  ++D NN +  + I   ++ELQE G PP E+ N+
Sbjct: 198 EEFSNYQNQYSIVTLIVERFDKQNYDDNNTEDKEFISTKLEELQELGMPPTELANQ 253



>gi|198041740|ref|NP_001128249.1| peroxisomal biogenesis factor 19 isoform 2 [Rattus norvegicus]
          Length = 293

 Score = 93.6 bits (231), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 64/230 (27%), Positives = 115/230 (50%), Gaps = 34/230 (14%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDASSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQN+          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNA----------GMSEE--ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNILPIMQSLMQNLLSKDVLYPSLKEITEKYPEWLQSHQESIPPEQFEKYQQQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPG 290
            KI E+++A    D +  +  + +A+++LMQ+LQ+ G PP E+  E+  G
Sbjct: 226 GKICEQFEAETPTDSEATHRARFEAVLDLMQQLQDLGHPPKELAGEMYTG 275



>gi|302497699|ref|XP_003010849.1| peroxisomal membrane protein receptor Pex19, putative [Arthroderma
           benhamiae CBS 112371]
 gi|291174394|gb|EFE30209.1| peroxisomal membrane protein receptor Pex19, putative [Arthroderma
           benhamiae CBS 112371]
          Length = 451

 Score = 93.6 bits (231), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 97/165 (58%), Gaps = 10/165 (6%)

Query: 129 FQDKINQTMNKLQNSSEQLDAEIID-GSNDQIMEMMKQIENMANLSGFAENDFEEMFGSG 187
           FQ+ I +TM +++ S ++  AE+ + G+ D +M+++K +E+ + L+G  E D       G
Sbjct: 200 FQETIQKTMERMRESGDKATAEVNESGNEDVLMQILKAMES-SGLAGAGEGD------DG 252

Query: 188 GMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKII 247
            ++K+   +ME L+ K+ LYEP+KE   K+  WL +NK K+  ED  RYE Q+  ++ I+
Sbjct: 253 NLDKLFMGIMEQLSNKEMLYEPLKELDDKFGPWLRENKEKIGEEDRERYELQASLVSDIV 312

Query: 248 EKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGME 292
            K++  +F     +    I   MQ++Q  G PP ++++  AP M+
Sbjct: 313 RKFEEKNFSDEKPEDRAYIWEKMQKMQAAGSPPDDLIS--APFMD 355



>gi|357136887|ref|XP_003570034.1| PREDICTED: peroxisome biogenesis protein 19-1-like [Brachypodium
           distachyon]
          Length = 246

 Score = 93.6 bits (231), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 78/119 (65%), Gaps = 8/119 (6%)

Query: 180 FEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQ 239
           FEE  G+  M+ ++E MM+ L +K+ L+EPMK+  +KYPKWLEDNK K+  E++ RY  Q
Sbjct: 119 FEEFAGAQDMDSIVEKMMKQLLSKEILHEPMKDIVEKYPKWLEDNKSKISKEEHERYSNQ 178

Query: 240 SEYINKIIEKYDAPDFDGNNEQQNKA-IINLMQELQEFGQPPPEILNELAPGMELNEQG 297
            E + K+ + Y+       +E +N + I  +MQ +QE GQPP +++ ++ P ++L++ G
Sbjct: 179 LELMLKLNDVYE-------HEPENMSKIFEIMQNMQECGQPPSDLVQDIVPDLDLSKLG 230



>gi|226289027|gb|EEH44539.1| hypothetical protein PADG_00828 [Paracoccidioides brasiliensis
           Pb18]
          Length = 424

 Score = 93.6 bits (231), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 57/162 (35%), Positives = 91/162 (56%), Gaps = 10/162 (6%)

Query: 129 FQDKINQTMNKLQNSSEQLDAEII-DGSNDQIMEMMKQIENMANLSGFAENDFEEMFGSG 187
           FQ+ I +TM ++Q S E+  A    DG +D +++++K +E+ A   G    +        
Sbjct: 247 FQETIRKTMERMQVSGEKATAAATEDGGDDMLVKLLKAMESGAGAGGGNGEES------- 299

Query: 188 GMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKII 247
            ++K+   +ME L+ KD LYEPMKE    +  WLE+N+GKVP ED  RYE Q+  + +I+
Sbjct: 300 -LDKIFMGIMEQLSNKDMLYEPMKELHNNFGPWLEENRGKVPKEDMERYELQAVVVREIV 358

Query: 248 EKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEIL-NELA 288
           EK+D   +  +  +    I   MQ++Q  G PP  ++ N LA
Sbjct: 359 EKFDEEGYSDDKPEHRAYIWEKMQKMQAAGSPPDALVSNPLA 400



>gi|149238602|ref|XP_001525177.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146450670|gb|EDK44926.1| conserved hypothetical protein [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 383

 Score = 93.6 bits (231), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 60/181 (33%), Positives = 108/181 (59%), Gaps = 18/181 (9%)

Query: 114 FDNTGRSTVE---SNGTSFQDKINQTMNKLQNSSEQLDAEIID---GSNDQIMEMMKQIE 167
           F+   R  VE   +   +F+  + +TM +L+ S E +D++I +   GSN +  +++ Q+ 
Sbjct: 165 FETEHREEVEKESAKPANFEYVMKETMERLRKSGEDIDSKIKNDHLGSNPE--DLLTQL- 221

Query: 168 NMANLSGFAENDFEEMFGSGGME--KMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNK 225
               L+G  EN    + G+G M+  K+L  M+E L++K+ LYEP+K+  QK+P++L++NK
Sbjct: 222 ----LAGMGENG---LGGAGDMDMSKLLVEMLEQLSSKEVLYEPIKDLNQKFPEYLKENK 274

Query: 226 GKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILN 285
            K+    Y  Y KQ E   +I++ +++ D+   N+QQ   +  L++ LQE GQPP +++ 
Sbjct: 275 DKLESLKYDNYNKQYEITQEIVDIFESKDYSDANKQQRDQVNTLLESLQELGQPPVDLVG 334

Query: 286 E 286
           E
Sbjct: 335 E 335



>gi|348690224|gb|EGZ30038.1| hypothetical protein PHYSODRAFT_310116 [Phytophthora sojae]
          Length = 564

 Score = 93.2 bits (230), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 80/128 (62%), Gaps = 15/128 (11%)

Query: 180 FEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQK-------YPKWLEDNKGKVPPED 232
           FEEM      + +++ MM+ L +KD +Y+PMK+  ++       YP+WL + +  +  ED
Sbjct: 307 FEEMGEKNDFQDLVDGMMQQLLSKDVMYDPMKQICERVRNGARLYPEWLAEKESLLSKED 366

Query: 233 YARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIIN-LMQELQEFGQPPPEILNELAPGM 291
           Y RY KQ +Y  +I+  Y++       E  N A ++ LMQE+QE GQPP EI+N+LAPG+
Sbjct: 367 YERYGKQYQYFQQIVAVYES-------EPDNFARLSELMQEVQETGQPPSEIVNDLAPGL 419

Query: 292 ELNEQGIP 299
           + +++G+P
Sbjct: 420 QFDDEGMP 427



>gi|327296093|ref|XP_003232741.1| hypothetical protein TERG_06732 [Trichophyton rubrum CBS 118892]
 gi|326465052|gb|EGD90505.1| hypothetical protein TERG_06732 [Trichophyton rubrum CBS 118892]
          Length = 372

 Score = 93.2 bits (230), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 54/165 (32%), Positives = 98/165 (59%), Gaps = 10/165 (6%)

Query: 129 FQDKINQTMNKLQNSSEQLDAEIID-GSNDQIMEMMKQIENMANLSGFAENDFEEMFGSG 187
           FQ+ I +TM ++Q S ++  AE+ + G+ D +M+++K +E+ + L+G  E +       G
Sbjct: 202 FQETIQKTMERMQESGDKATAEVNESGNEDVLMQILKAMES-SGLAGTGEGE------DG 254

Query: 188 GMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKII 247
            ++K+   +ME L+ K+ LYEP+KE   K+  WL +NK K+  ED  RYE Q+  ++ I+
Sbjct: 255 NLDKLFMGIMEQLSNKEMLYEPLKELDDKFGPWLRENKEKIGKEDRERYELQASLVSDIV 314

Query: 248 EKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGME 292
            K++  +F  +  +    I   MQ++Q  G PP ++++  AP M+
Sbjct: 315 RKFEEKNFSDDKPEDRAYIWEKMQKMQAAGSPPDDLIS--APFMD 357



>gi|478537472|ref|XP_004442850.1| PREDICTED: peroxisomal biogenesis factor 19 isoform 2
           [Ceratotherium simum simum]
          Length = 279

 Score = 93.2 bits (230), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 64/229 (27%), Positives = 114/229 (49%), Gaps = 34/229 (14%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDATSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSEE--ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAP 289
            KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ P
Sbjct: 226 GKICEQFEAETPTDSEATQKARFEMVLDLMQQLQDLGHPPKELAGEMVP 274



>gi|302782856|ref|XP_002973201.1| hypothetical protein SELMODRAFT_99133 [Selaginella moellendorffii]
 gi|300158954|gb|EFJ25575.1| hypothetical protein SELMODRAFT_99133 [Selaginella moellendorffii]
          Length = 98

 Score = 93.2 bits (230), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 47/105 (44%), Positives = 65/105 (61%), Gaps = 10/105 (9%)

Query: 197 MEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAP--D 254
           M+ + +K+ L+EPMKE  ++YP WLE NK K+  ED+ R+ KQ + I ++   YD    D
Sbjct: 1   MQQILSKEILHEPMKEIGERYPSWLEANKSKLSKEDHDRFSKQHQLILELCRVYDTTPGD 60

Query: 255 FDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQGIP 299
           FD         I  LMQ +Q  GQPP EI+ ELAPG++L E G+P
Sbjct: 61  FD--------KITELMQSMQGCGQPPAEIVAELAPGLQLGEDGLP 97



>gi|471417482|ref|XP_004390250.1| PREDICTED: peroxisomal biogenesis factor 19 isoform 1 [Trichechus
           manatus latirostris]
          Length = 299

 Score = 93.2 bits (230), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 69/244 (28%), Positives = 120/244 (49%), Gaps = 39/244 (15%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDASSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSEE--ELNKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM-----ELNE 295
            KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ PG+      LN 
Sbjct: 226 GKICEQFEAETPTDSEDTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNL 285

Query: 296 QGIP 299
            G P
Sbjct: 286 SGPP 289



>gi|291397628|ref|XP_002715312.1| PREDICTED: DDB1 and CUL4 associated factor 8 [Oryctolagus
           cuniculus]
          Length = 755

 Score = 93.2 bits (230), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 86/148 (58%), Gaps = 19/148 (12%)

Query: 161 EMMKQIENMANLSGFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKW 220
           E+ K +E +    G  E D     G G +  +++S+M+ L +KD LY  +KE  +KYP+W
Sbjct: 5   ELTKAMEGL----GMDEGD-----GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEW 55

Query: 221 LEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKA----IINLMQELQEF 276
           L+ ++  +PPE Y +Y++Q   + KI E+++A +   +NE   KA    +++LMQ+LQ+ 
Sbjct: 56  LQSHRESLPPEQYEKYQEQHSVMGKICEQFEA-ETPTDNEATQKARFEMVLDLMQQLQDL 114

Query: 277 GQPPPEILNELAPGM-----ELNEQGIP 299
           G PP E+  E+ PG+      LN  G P
Sbjct: 115 GHPPKELAGEMPPGLNFDLDALNLSGPP 142



>gi|239607086|gb|EEQ84073.1| peroxisomal membrane protein receptor Pex19 [Ajellomyces
           dermatitidis ER-3]
 gi|327351038|gb|EGE79895.1| peroxisomal membrane protein receptor Pex19 [Ajellomyces
           dermatitidis ATCC 18188]
          Length = 425

 Score = 93.2 bits (230), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 57/175 (32%), Positives = 90/175 (51%), Gaps = 7/175 (4%)

Query: 112 TDFDNTGRSTVESNGTSFQDKINQTMNKLQNSSEQLDAEII-DGSNDQIMEMMKQIENMA 170
           T     G S+       FQ+ I +TM ++Q S ++  A    DG +D +M+++K +E+ A
Sbjct: 229 TAAGTAGSSSASKAEDGFQETIRKTMERMQASGDKATAAATEDGGDDMLMQLLKAMESGA 288

Query: 171 NLSGFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPP 230
              G    D E +      +K+   +ME L+ K+ LYEPMKE   K+  WL +N+ KVP 
Sbjct: 289 GAGGAGGGDDENL------DKIFMGIMEQLSNKEMLYEPMKELHAKFGPWLLENRDKVPK 342

Query: 231 EDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILN 285
           ED  RYE QS  + +I+ K+D   +          I   MQ++Q  G PP  +++
Sbjct: 343 EDLERYELQSVLVAEIVGKFDEEGYSDEKPADRAYIWEKMQKMQAAGSPPDALVS 397



>gi|507964728|ref|XP_004688436.1| PREDICTED: peroxisomal biogenesis factor 19 isoform X1 [Condylura
           cristata]
          Length = 298

 Score = 93.2 bits (230), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 67/244 (27%), Positives = 119/244 (48%), Gaps = 39/244 (15%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 74  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDATSQQEFTSCLKETLS 133

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +++  E+ K +E +    G  + D    
Sbjct: 134 G--------LAKNATDLQNS----------GMSEE--ELTKAMEGL----GMDDGD---- 165

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 166 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVM 224

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM-----ELNE 295
            KI  +++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ PG+      LN 
Sbjct: 225 GKICAQFEAETPTDSEATQKARFETVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNL 284

Query: 296 QGIP 299
            G P
Sbjct: 285 SGPP 288



>gi|149040725|gb|EDL94682.1| rCG20208, isoform CRA_d [Rattus norvegicus]
          Length = 279

 Score = 92.8 bits (229), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 63/227 (27%), Positives = 114/227 (50%), Gaps = 34/227 (14%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDASSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQN+          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNA----------GMSEE--ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNILPIMQSLMQNLLSKDVLYPSLKEITEKYPEWLQSHQESIPPEQFEKYQQQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNEL 287
            KI E+++A    D +  +  + +A+++LMQ+LQ+ G PP E+  E+
Sbjct: 226 GKICEQFEAETPTDSEATHRARFEAVLDLMQQLQDLGHPPKELAGEM 272



>gi|261201137|ref|XP_002626969.1| peroxisomal membrane protein receptor Pex19 [Ajellomyces
           dermatitidis SLH14081]
 gi|239594041|gb|EEQ76622.1| peroxisomal membrane protein receptor Pex19 [Ajellomyces
           dermatitidis SLH14081]
          Length = 426

 Score = 92.8 bits (229), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 57/175 (32%), Positives = 90/175 (51%), Gaps = 7/175 (4%)

Query: 112 TDFDNTGRSTVESNGTSFQDKINQTMNKLQNSSEQLDAEII-DGSNDQIMEMMKQIENMA 170
           T     G S+       FQ+ I +TM ++Q S ++  A    DG +D +M+++K +E+ A
Sbjct: 230 TAAGTAGSSSASKAEDGFQETIRKTMERMQASGDKATAAATEDGGDDMLMQLLKAMESGA 289

Query: 171 NLSGFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPP 230
              G    D E +      +K+   +ME L+ K+ LYEPMKE   K+  WL +N+ KVP 
Sbjct: 290 GAGGAGGGDDENL------DKIFMGIMEQLSNKEMLYEPMKELHAKFGPWLLENRDKVPK 343

Query: 231 EDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILN 285
           ED  RYE QS  + +I+ K+D   +          I   MQ++Q  G PP  +++
Sbjct: 344 EDLERYELQSVLVAEIVGKFDEEGYSDEKPADRAYIWEKMQKMQAAGSPPDALVS 398



>gi|156381001|ref|XP_001632055.1| predicted protein [Nematostella vectensis]
 gi|156219105|gb|EDO39992.1| predicted protein [Nematostella vectensis]
          Length = 307

 Score = 92.8 bits (229), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 60/189 (31%), Positives = 105/189 (55%), Gaps = 24/189 (12%)

Query: 128 SFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEMFGSG 187
           SF+  ++QT++ L  +++  D E +D   +  ++          L+G + +D +   G  
Sbjct: 131 SFESNLSQTLSDLAQNTK--DMENMDPMGEDFLKA---------LTGMSLDDED---GDL 176

Query: 188 GMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKII 247
            M  +++ MM+ L +K+ LY  +KE  +KYP WLE+ K     E +AR+ KQ EY+N I 
Sbjct: 177 DMMPLMQGMMKNLLSKEILYPSLKELNEKYPPWLENKKSSHSDEVHARFTKQHEYVNMIC 236

Query: 248 EKYDAPDFDGNNEQQNK---AIINLMQELQEFGQPPPEILNELAPGMELNEQG------- 297
           ++++A   D + + + K    I++LMQ++QE GQPP E++ ++APGM    +        
Sbjct: 237 QEFEAEKPDDSEDIKKKRFQKIMSLMQQMQECGQPPEELVGQMAPGMPFGTEPSIGDMPE 296

Query: 298 IPSDLTSCK 306
           +P DL  CK
Sbjct: 297 LPKDLQECK 305



>gi|403294003|ref|XP_003937997.1| PREDICTED: peroxisomal biogenesis factor 19 isoform 2 [Saimiri
           boliviensis boliviensis]
          Length = 279

 Score = 92.8 bits (229), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 64/229 (27%), Positives = 114/229 (49%), Gaps = 34/229 (14%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSEE--ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAP 289
            KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ P
Sbjct: 226 CKICEQFEAETPTDSEATQKARFEMVLDLMQQLQDLGHPPKELAGEMVP 274



>gi|18418341|ref|NP_568351.1| peroxin 19-2 [Arabidopsis thaliana]
 gi|75165417|sp|Q94EI3.1|PE192_ARATH RecName: Full=Peroxisome biogenesis protein 19-2; AltName:
           Full=Peroxin-19-2; Short=AtPEX19-2; AltName:
           Full=Peroxisomal membrane protein import receptor
           PEX19-2; Flags: Precursor
 gi|15294212|gb|AAK95283.1|AF410297_1 AT5g17550/K10A8_30 [Arabidopsis thaliana]
 gi|23506147|gb|AAN31085.1| At5g17550/K10A8_30 [Arabidopsis thaliana]
 gi|332005059|gb|AED92442.1| peroxin 19-2 [Arabidopsis thaliana]
          Length = 245

 Score = 92.8 bits (229), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 89/159 (55%), Gaps = 16/159 (10%)

Query: 149 AEIIDGSNDQIMEMMKQIENMANLSGFAEND----------FEEMFGSGGMEKMLESMME 198
            E +D   +Q  E +K +E++++      +D          FE + GS  +E ++++MM+
Sbjct: 77  TEALDKLREQTRETVKGLESLSSKQQPTGSDDAMVEDWIKQFENLTGSNDLESIVDTMMQ 136

Query: 199 ALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGN 258
            L +KD L+EPMKE   +YPKWLE+++  +  E++ RY +Q E I ++   Y+      N
Sbjct: 137 QLLSKDILHEPMKEIGARYPKWLEEHESSLNKEEFDRYSRQYELIKELNLVYE------N 190

Query: 259 NEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQG 297
               +  I+ +MQ++QE GQPP +I+ E+ PG +    G
Sbjct: 191 EPNNSTKIMEIMQKMQECGQPPSDIVQEMDPGFDFASLG 229



>gi|354546206|emb|CCE42935.1| hypothetical protein CPAR2_205780 [Candida parapsilosis]
          Length = 356

 Score = 92.4 bits (228), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 64/192 (33%), Positives = 104/192 (54%), Gaps = 22/192 (11%)

Query: 114 FDNTGRSTVESNG---TSFQDKINQTMNKLQNSSEQLDAEII-DGSNDQIMEMMKQIENM 169
           F+   RS  ES      +F   + +TM +L+ S E +D++I  D S     +++ Q+   
Sbjct: 146 FETDHRSEAESGAQQSANFDFVMKETMERLRKSGEDIDSKIKNDSSGTNPEDILTQL--- 202

Query: 170 ANLSGFAENDFEEMFGSGG----MEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNK 225
             L+G  EN      G GG    M K+L  M+E L++K+ LYEP+K+   K+P++LEDNK
Sbjct: 203 --LAGMNEN------GLGGGDMDMSKLLIDMLEQLSSKEVLYEPIKDLNTKFPQYLEDNK 254

Query: 226 GKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILN 285
            K+  E Y+ Y KQ E    I++ +++  +  +N+ Q   I  +++ LQE GQPP E++ 
Sbjct: 255 NKLDQEQYSNYTKQYEMTKDILKVFESDGYSDSNKAQRDQINAMLESLQELGQPPVELVG 314

Query: 286 ELA---PGMELN 294
           +     PG   N
Sbjct: 315 DTGDFLPGFGGN 326



>gi|9755780|emb|CAC01899.1| putative protein [Arabidopsis thaliana]
          Length = 274

 Score = 92.4 bits (228), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 89/159 (55%), Gaps = 16/159 (10%)

Query: 149 AEIIDGSNDQIMEMMKQIENMANLSGFAEND----------FEEMFGSGGMEKMLESMME 198
            E +D   +Q  E +K +E++++      +D          FE + GS  +E ++++MM+
Sbjct: 106 TEALDKLREQTRETVKGLESLSSKQQPTGSDDAMVEDWIKQFENLTGSNDLESIVDTMMQ 165

Query: 199 ALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGN 258
            L +KD L+EPMKE   +YPKWLE+++  +  E++ RY +Q E I ++   Y+      N
Sbjct: 166 QLLSKDILHEPMKEIGARYPKWLEEHESSLNKEEFDRYSRQYELIKELNLVYE------N 219

Query: 259 NEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQG 297
               +  I+ +MQ++QE GQPP +I+ E+ PG +    G
Sbjct: 220 EPNNSTKIMEIMQKMQECGQPPSDIVQEMDPGFDFASLG 258



>gi|114560657|ref|XP_001171897.1| PREDICTED: peroxisomal biogenesis factor 19 isoform 3 [Pan
           troglodytes]
          Length = 279

 Score = 92.4 bits (228), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 66/230 (28%), Positives = 113/230 (49%), Gaps = 36/230 (15%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNSS   +            E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNSSMSEE------------ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVM 225

Query: 244 NKIIEKYDAPDFDGNNEQQNKA----IINLMQELQEFGQPPPEILNELAP 289
            KI E+++A +   ++E   KA    +++LMQ+LQ+ G PP E+  E+ P
Sbjct: 226 CKICEQFEA-ETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMVP 274



>gi|426332323|ref|XP_004027755.1| PREDICTED: peroxisomal biogenesis factor 19 isoform 2 [Gorilla
           gorilla gorilla]
 gi|426332339|ref|XP_004027763.1| PREDICTED: peroxisomal biogenesis factor 19-like isoform 4 [Gorilla
           gorilla gorilla]
          Length = 279

 Score = 92.4 bits (228), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 66/230 (28%), Positives = 113/230 (49%), Gaps = 36/230 (15%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNSS   +            E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNSSMSEE------------ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVM 225

Query: 244 NKIIEKYDAPDFDGNNEQQNKA----IINLMQELQEFGQPPPEILNELAP 289
            KI E+++A +   ++E   KA    +++LMQ+LQ+ G PP E+  E+ P
Sbjct: 226 CKICEQFEA-ETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMVP 274



>gi|302370946|ref|NP_001180573.1| peroxisomal biogenesis factor 19 isoform c [Homo sapiens]
          Length = 279

 Score = 92.4 bits (228), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 66/230 (28%), Positives = 113/230 (49%), Gaps = 36/230 (15%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNSS   +            E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNSSMSEE------------ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVM 225

Query: 244 NKIIEKYDAPDFDGNNEQQNKA----IINLMQELQEFGQPPPEILNELAP 289
            KI E+++A +   ++E   KA    +++LMQ+LQ+ G PP E+  E+ P
Sbjct: 226 CKICEQFEA-ETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMVP 274



>gi|488512881|ref|XP_004448483.1| PREDICTED: DDB1- and CUL4-associated factor 8-like isoform 13
           [Dasypus novemcinctus]
          Length = 294

 Score = 92.4 bits (228), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 65/228 (28%), Positives = 114/228 (50%), Gaps = 34/228 (14%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSEE--ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y+KQ   +
Sbjct: 167 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQKQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELA 288
            KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+A
Sbjct: 226 GKICEQFEAETPTDDEATQKTRFEMVLDLMQQLQDLGHPPKELAGEMA 273



>gi|148707090|gb|EDL39037.1| peroxisome biogenesis factor 19, isoform CRA_a [Mus musculus]
          Length = 267

 Score = 92.4 bits (228), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 70/246 (28%), Positives = 120/246 (48%), Gaps = 39/246 (15%)

Query: 52  SPDKS----RDQADLPSQL-DDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEV 104
           +PD S    R   D   +L D E     TA+ E  +KE  E E  +    Q L +  G V
Sbjct: 44  APDASGPQKRASGDTAKELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRV 103

Query: 105 DEDNLNGTDFDNTGRSTVESNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMK 164
             D  +  +F +  + T+          + +   +LQNS          G +++  E+MK
Sbjct: 104 GSDASSQQEFTSCLKETLSG--------LAKNATELQNS----------GMSEE--ELMK 143

Query: 165 QIENMANLSGFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDN 224
            +E +    G  E D     G   +  +++S+M+ L +KD LY  +KE  +KYP+WL+ +
Sbjct: 144 AMEGL----GMDEGD-----GEASILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSH 194

Query: 225 KGKVPPEDYARYEKQSEYINKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPP 281
           +   PPE + +Y++Q   + KI E+++A    D +     + +A+++LMQ+LQ  G PP 
Sbjct: 195 QDSTPPEQFEKYQQQHSVMVKICEQFEAETPTDSEATQRARFEAMLDLMQQLQALGHPPK 254

Query: 282 EILNEL 287
           E+  E+
Sbjct: 255 ELAGEM 260



>gi|310793518|gb|EFQ28979.1| Pex19 protein family [Glomerella graminicola M1.001]
          Length = 338

 Score = 92.4 bits (228), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 70/239 (29%), Positives = 112/239 (46%), Gaps = 22/239 (9%)

Query: 68  DEYVKLLTADMEDFVKEFDEN-ELSIAMQGLMKNFGEV------------DEDNLNGTDF 114
           D++ K L A M D + E ++N E+      ++K  G                     T  
Sbjct: 97  DDFAKQLQAGMADLIGELEKNPEMQAQFDSVLKQMGAAAGEAGPSQAPAATPAAPRPTSS 156

Query: 115 DNTGRSTVESNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSN-DQIMEMMKQIENMANLS 173
            +   ++      SFQ+ I +TM ++Q S +Q  A   + S  D + EMMKQ+       
Sbjct: 157 SSKAPASDPIADGSFQETIKKTMERMQASGQQATAAAAESSTEDFLAEMMKQLGEGGMEG 216

Query: 174 GFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDY 233
           G +  +           KML  MME L  K+ LYEPMKE   K+P+W E N+ K P ED 
Sbjct: 217 GGSSEE--------EFSKMLMGMMEQLTNKEILYEPMKELNDKFPQWFEKNRDKTPAEDL 268

Query: 234 ARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGME 292
            RYE+Q  Y+ +I+ K++   +  +N    + I+  MQ++Q  G PP +++ ++    E
Sbjct: 269 KRYEEQQAYVKEIVAKFEEKTYADSNAADREYIVERMQKMQAAGSPPSDLVGDMPSAQE 327



>gi|297811905|ref|XP_002873836.1| peroxisomal protein PEX19 family protein [Arabidopsis lyrata subsp.
           lyrata]
 gi|297319673|gb|EFH50095.1| peroxisomal protein PEX19 family protein [Arabidopsis lyrata subsp.
           lyrata]
          Length = 245

 Score = 92.0 bits (227), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 56/188 (29%), Positives = 101/188 (53%), Gaps = 16/188 (8%)

Query: 120 STVESNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAEND 179
           S V+  G    D  ++   K + + E    E +D   +Q  E +K +E++++      +D
Sbjct: 48  SGVQGLGMGLPDMRSKKKGKQKIAKEDHVTEALDKLREQTRETVKGLESLSSKQQPTGSD 107

Query: 180 ----------FEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVP 229
                     FE++ GS  +E ++++MM+ L +KD L+EPMKE   +YPKWL++++  + 
Sbjct: 108 DAMVEDWIKQFEDLAGSNDLESIVDTMMQQLLSKDILHEPMKEIGARYPKWLKEHESSLN 167

Query: 230 PEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAP 289
            E++ RY +Q E I ++   Y+      N    +  I+ +MQ++QE GQPP +I+ E+ P
Sbjct: 168 KEEFERYSRQYELIKELNLVYE------NEPNNSTKIMEIMQKMQECGQPPSDIVQEMDP 221

Query: 290 GMELNEQG 297
           G +    G
Sbjct: 222 GFDFASLG 229



>gi|302789762|ref|XP_002976649.1| hypothetical protein SELMODRAFT_105720 [Selaginella moellendorffii]
 gi|300155687|gb|EFJ22318.1| hypothetical protein SELMODRAFT_105720 [Selaginella moellendorffii]
          Length = 98

 Score = 91.7 bits (226), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 47/105 (44%), Positives = 64/105 (60%), Gaps = 10/105 (9%)

Query: 197 MEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAP--D 254
           M+ + +K+ L+EPMKE  ++YP WLE NK K+  ED  R+ KQ + I ++   YD    D
Sbjct: 1   MQQILSKEILHEPMKEIGERYPSWLEANKSKLSKEDRDRFSKQHQLILELCRVYDTTPGD 60

Query: 255 FDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQGIP 299
           FD         I  LMQ +Q  GQPP EI+ ELAPG++L E G+P
Sbjct: 61  FD--------KITELMQSMQGCGQPPAEIVAELAPGLQLGEDGLP 97



>gi|119187471|ref|XP_001244342.1| hypothetical protein CIMG_03783 [Coccidioides immitis RS]
          Length = 329

 Score = 91.7 bits (226), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 52/158 (32%), Positives = 89/158 (56%), Gaps = 9/158 (5%)

Query: 118 GRSTVESNGT---SFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSG 174
           G S+ + +G    +FQ+ I +TM ++Q S ++  A + D ++D ++  M +    A + G
Sbjct: 163 GESSKDQSGKPEETFQETIRKTMERMQESGDKATAAVNDSADDDVLVQMLKAMEAAGMGG 222

Query: 175 FAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYA 234
             + D E      G EKML  +ME L+ K+ LYEP+KE  +K+  WLE+NK K+  ED+ 
Sbjct: 223 DGQEDDE------GFEKMLMGVMEQLSNKEILYEPVKELHEKFGPWLEENKEKLSKEDFE 276

Query: 235 RYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQE 272
           R+ KQ+  +  +++K+D P +  +  +    I   MQE
Sbjct: 277 RHVKQAGLMADVMKKFDEPGYSDDKPEHRAYIWEKMQE 314



>gi|148707093|gb|EDL39040.1| peroxisome biogenesis factor 19, isoform CRA_d [Mus musculus]
          Length = 279

 Score = 91.3 bits (225), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 112/227 (49%), Gaps = 34/227 (14%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDASSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +   +LQNS          G +++  E+MK +E +    G  E D    
Sbjct: 135 G--------LAKNATELQNS----------GMSEE--ELMKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G   +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++   PPE + +Y++Q   +
Sbjct: 167 -GEASILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHQDSTPPEQFEKYQQQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNEL 287
            KI E+++A    D +     + +A+++LMQ+LQ  G PP E+  E+
Sbjct: 226 VKICEQFEAETPTDSEATQRARFEAMLDLMQQLQALGHPPKELAGEM 272



>gi|501753966|emb|CCG82505.1| Putative uncharacterized protein [Taphrina deformans PYCC 5710]
          Length = 280

 Score = 91.3 bits (225), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 113/231 (48%), Gaps = 20/231 (8%)

Query: 62  LPSQLDDEYVKLLTADMEDFVKEFDENELSIA-MQGLMK--NFGEVDEDNLNGTDFDNTG 118
           LP+   D++ K L   MED ++E D +  + A  + LM   N   +D      T + N  
Sbjct: 47  LPNLGPDDFAKQLQNGMEDLMRELDTSPAARADFEQLMAQMNAATLDTAPQATTSYPNNP 106

Query: 119 RSTVESNGT-SFQDKINQTMNKLQNSSEQLDAEIIDGSNDQ--IMEMMKQIENMANLSGF 175
             T  +    +FQD I   + +++ S  Q+  E    +++   + EMM+Q +  A   G 
Sbjct: 107 SKTASTPAAKNFQDSIEANLQRMKASESQIKEEGAAATDEDTFMAEMMRQFQESAGGEG- 165

Query: 176 AENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYAR 235
                      G   ++LE MM  L +K+ LYEP+ E  QKYP W+ ++      E    
Sbjct: 166 ----------GGDFSQVLEGMMSQLMSKEILYEPLLELHQKYPTWIAEHPKD---EKIET 212

Query: 236 YEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNE 286
           Y+KQS  + KI+ K++  ++   +  + + +++LM ++Q+ G PP  I++E
Sbjct: 213 YKKQSALVAKIVAKFEDREYRDEDASKKEEVMDLMSQMQDLGSPPAAIMSE 263



>gi|348561632|ref|XP_003466616.1| PREDICTED: peroxisomal biogenesis factor 19-like isoform 2 [Cavia
           porcellus]
          Length = 279

 Score = 91.3 bits (225), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 112/229 (48%), Gaps = 34/229 (14%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F    + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDATSQQEFTTCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +D+  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSDE--ELNKAMEGL----GVDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNIFPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHNVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAP 289
            KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E  P
Sbjct: 226 GKICEQFEAETPTDSEAAQKARFEMVLDLMQQLQDLGHPPKELAGERVP 274



>gi|332219223|ref|XP_003258756.1| PREDICTED: peroxisomal biogenesis factor 19 isoform 2 [Nomascus
           leucogenys]
          Length = 279

 Score = 91.3 bits (225), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 66/230 (28%), Positives = 115/230 (50%), Gaps = 36/230 (15%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSEE--ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHQESLPPEQFEKYQEQHSVM 225

Query: 244 NKIIEKYDAPDFDGNNEQQNKA----IINLMQELQEFGQPPPEILNELAP 289
            KI E+++A +   ++E   KA    +++LMQ+LQ+ G PP E+  E+ P
Sbjct: 226 CKICEQFEA-ETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMVP 274



>gi|260946193|ref|XP_002617394.1| hypothetical protein CLUG_02838 [Clavispora lusitaniae ATCC 42720]
 gi|238849248|gb|EEQ38712.1| hypothetical protein CLUG_02838 [Clavispora lusitaniae ATCC 42720]
          Length = 326

 Score = 91.3 bits (225), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 65/245 (26%), Positives = 126/245 (51%), Gaps = 34/245 (13%)

Query: 74  LTADMEDFVKEF--DENELSIAMQGLMKNFGEVDEDNLNGTDFDNTGRSTVESNGTS--F 129
           LT D+E  +K+   ++ E     + L+K F + +      ++        V++N T   F
Sbjct: 89  LTHDIEKLIKDLKIEDPEAKAQFEQLVKQFEQTEGPKTAASN------EKVQNNTTPAPF 142

Query: 130 QDKINQTMNKLQNSSEQLDAEIIDGSNDQIM----EMMKQIENMANLSGFAENDFEEMFG 185
            + +  TM +L+ S + +D ++    ND +     +M+ Q+     LSG    +     G
Sbjct: 143 DNVMRDTMQRLRQSGQNIDEQL---KNDPVSANPEDMLAQL-----LSGMGSGES----G 190

Query: 186 SGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINK 245
              M K+L  M+E L++K+ LY+P+K+   K+P++L++ KG +P +++  Y KQ E   +
Sbjct: 191 DVDMSKLLTDMLEQLSSKEVLYDPIKDLNTKFPEYLKEKKGVLPDDEHHTYTKQYELTTE 250

Query: 246 IIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNE--------LAPGMELNEQG 297
           I+  ++AP+++G++E     +  L++ LQE G PP E++ E           G++ N + 
Sbjct: 251 IVAVFEAPEYNGDDEATRDKVNALLESLQELGSPPTELVGEDKDFPGFGGEEGLDFNSKD 310

Query: 298 IPSDL 302
           +P D 
Sbjct: 311 LPPDF 315



>gi|504154362|ref|XP_004589139.1| PREDICTED: peroxisomal biogenesis factor 19 isoform X4 [Ochotona
           princeps]
          Length = 207

 Score = 90.9 bits (224), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 71/110 (64%), Gaps = 3/110 (2%)

Query: 185 GSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYIN 244
           G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE Y +Y +Q   + 
Sbjct: 75  GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESIPPEQYDKYLEQHSVMG 134

Query: 245 KIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM 291
           KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ PG+
Sbjct: 135 KICEQFEAETPTDTEATQKARFETVLDLMQQLQDLGHPPKELAGEMPPGL 184



>gi|429854412|gb|ELA29427.1| pex19 family protein [Colletotrichum gloeosporioides Nara gc5]
          Length = 304

 Score = 90.9 bits (224), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 70/227 (30%), Positives = 109/227 (48%), Gaps = 32/227 (14%)

Query: 68  DEYVKLLTADMEDFVKEFDEN-ELSIAMQGLMKNFGEVDEDNLNGTDFDNTGRSTVESNG 126
           D++ K L A M D + E ++N E+      + K        N    + D+T +   E   
Sbjct: 97  DDFAKQLQAGMADLIGELEKNPEMQAQFDDMFKQI------NAAAQEVDSTPQQPAE--- 147

Query: 127 TSFQDKINQTMNKLQNSSEQLDAEIIDGSN-DQIMEMMKQIENMANLSGFAENDFEEMFG 185
                       ++Q S +Q  A   + S  D + EMMKQ+ +  N+ G      EE F 
Sbjct: 148 ------------RMQASGDQATAAAAESSTEDFLAEMMKQLGD-GNMDGAGS---EEEFS 191

Query: 186 SGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINK 245
                KML  MME L  K+ LYEPMKE   K+P+WLE N+ K P ED  RYE+Q   + +
Sbjct: 192 -----KMLMGMMEQLTNKEILYEPMKELNDKFPEWLEKNREKTPAEDLKRYEEQQALVKE 246

Query: 246 IIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGME 292
           I+ K++   +   N    + I++ MQ++Q  G PP +++ ++    E
Sbjct: 247 IVAKFEEKTYADGNAADREYIVDRMQKMQAAGSPPSDLVGDMPSAQE 293



>gi|350537351|ref|NP_001233665.1| peroxisomal biogenesis factor 19 [Cricetulus griseus]
 gi|3024491|sp|Q60415.1|PEX19_CRIGR RecName: Full=Peroxisomal biogenesis factor 19; AltName:
           Full=Peroxin-19; AltName: Full=Peroxisomal farnesylated
           protein; Flags: Precursor
 gi|529146|gb|AAA20595.1| PxF [Cricetulus griseus]
 gi|344237294|gb|EGV93397.1| Peroxisomal biogenesis factor 19 [Cricetulus griseus]
          Length = 299

 Score = 90.9 bits (224), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 37/103 (35%), Positives = 70/103 (67%), Gaps = 3/103 (2%)

Query: 192 MLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYD 251
           +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   + KI E+++
Sbjct: 174 IMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHQESIPPEQFEKYQEQHSVMGKICEQFE 233

Query: 252 A---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM 291
           A    D +  +  + +A+++LMQ+LQ+ G PP E+  E+ PG+
Sbjct: 234 AETPTDSEATHRARFEAVLDLMQQLQDLGHPPKELAGEMPPGL 276



>gi|504154360|ref|XP_004589138.1| PREDICTED: peroxisomal biogenesis factor 19 isoform X3 [Ochotona
           princeps]
          Length = 209

 Score = 90.9 bits (224), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 71/110 (64%), Gaps = 3/110 (2%)

Query: 185 GSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYIN 244
           G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE Y +Y +Q   + 
Sbjct: 77  GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESIPPEQYDKYLEQHSVMG 136

Query: 245 KIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM 291
           KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ PG+
Sbjct: 137 KICEQFEAETPTDTEATQKARFETVLDLMQQLQDLGHPPKELAGEMPPGL 186



>gi|507964731|ref|XP_004688437.1| PREDICTED: peroxisomal biogenesis factor 19 isoform X2 [Condylura
           cristata]
          Length = 278

 Score = 90.5 bits (223), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 62/229 (27%), Positives = 113/229 (49%), Gaps = 34/229 (14%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 74  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDATSQQEFTSCLKETLS 133

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +++  E+ K +E +    G  + D    
Sbjct: 134 G--------LAKNATDLQNS----------GMSEE--ELTKAMEGL----GMDDGD---- 165

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 166 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVM 224

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAP 289
            KI  +++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ P
Sbjct: 225 GKICAQFEAETPTDSEATQKARFETVLDLMQQLQDLGHPPKELAGEMVP 273



>gi|301119633|ref|XP_002907544.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gi|262106056|gb|EEY64108.1| conserved hypothetical protein [Phytophthora infestans T30-4]
          Length = 583

 Score = 90.5 bits (223), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 47/127 (37%), Positives = 77/127 (60%), Gaps = 14/127 (11%)

Query: 180 FEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQK------YPKWLEDNKGKVPPEDY 233
           FEEM      + +++ MM+ L +KD +Y+PMK+  ++      YP+WL + +  +  EDY
Sbjct: 335 FEEMGEKSDFQDLVDGMMQQLLSKDVMYDPMKQICERVRSTGTYPEWLAEKESLLSKEDY 394

Query: 234 ARYEKQSEYINKIIEKYDA-PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGME 292
            RY KQ +Y  +I+  Y++ PD           +  LMQE+QE GQPP EI+ +LAPG++
Sbjct: 395 ERYGKQYQYFQQIVAVYESEPD-------NYTRLSELMQEMQETGQPPSEIVKDLAPGLQ 447

Query: 293 LNEQGIP 299
            +++G+P
Sbjct: 448 FDDEGMP 454



>gi|388857018|emb|CCF49438.1| related to PEX19-required for biogenesis of peroxisomes (peroxin)
           [Ustilago hordei]
          Length = 384

 Score = 90.5 bits (223), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 44/101 (43%), Positives = 68/101 (67%), Gaps = 3/101 (2%)

Query: 189 MEKMLESMMEALATKDYLYEPMKEFAQKYPKWL--EDNKGKVPPEDYARYEKQSEYINKI 246
           + KMLE MM+ L ++D LYEP+KE   KYP +L  E++KG +  ED  RYE QS+YI++I
Sbjct: 262 LTKMLEGMMDELMSRDILYEPLKELRDKYPAYLAGEESKG-ISEEDRKRYELQSKYIDEI 320

Query: 247 IEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNEL 287
           +  ++ P +D  N++Q   I  LM ++Q+ G PP EI+ ++
Sbjct: 321 VRIFEQPGYDAKNKEQGGRIQELMNQMQDCGSPPKEIVGDM 361



>gi|302673959|ref|XP_003026665.1| hypothetical protein SCHCODRAFT_70996 [Schizophyllum commune H4-8]
 gi|300100349|gb|EFI91762.1| hypothetical protein SCHCODRAFT_70996 [Schizophyllum commune H4-8]
          Length = 354

 Score = 90.5 bits (223), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 60/185 (32%), Positives = 97/185 (52%), Gaps = 21/185 (11%)

Query: 129 FQDKINQTMNKLQNSSEQLDAEIIDGSN------DQIMEMMKQIENMANLSGFAENDFE- 181
           FQ KI Q   KL+ S   +++    G+       D +  ++K +    +L    + D E 
Sbjct: 179 FQAKIRQATQKLRESESNMNSSASGGAGPSSADVDSLEALLKSL----DLDNLPDGDEEK 234

Query: 182 EMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSE 241
           E+ G       LESMM +L +K+ LYEPMKE  +K P +LE+    +   D  RY+ Q  
Sbjct: 235 ELTG------FLESMMSSLMSKEVLYEPMKELEEKMPAYLENPSEPLQAGDKERYQSQLI 288

Query: 242 YINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELA---PGMELNEQGI 298
            + KII  +D P +   +  ++K I++LM E+Q++G PP  I+ ++    PGM  + Q +
Sbjct: 289 CVRKIIATFDEPGYSDEDPARSKKIVDLMSEMQDYGPPPSAIIGQMPAGFPGMGADGQ-L 347

Query: 299 PSDLT 303
           P+D T
Sbjct: 348 PADCT 352



>gi|385302922|gb|EIF47027.1| putative peroxisomal biogenesis protein pex19 [Dekkera bruxellensis
           AWRI1499]
          Length = 334

 Score = 90.5 bits (223), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 58/203 (28%), Positives = 110/203 (54%), Gaps = 12/203 (5%)

Query: 89  ELSIAMQGLMKNFGEVDEDNLNGTDFDNTGRSTVESNG---TSFQDKINQTMNKLQNSSE 145
           ELS  ++  +K+  EVD+ N +G    +T       +G    +FQ+ I++T+++L+ S  
Sbjct: 100 ELSAELRSFIKDISEVDKGNYSGKSVQSTSVGDKAVSGLKKKNFQEAISETVHRLKRSGS 159

Query: 146 QLDAEIIDGS-NDQIME-MMKQIENMANLSGFAENDFEEMFGSGGMEKMLESMMEALATK 203
           Q+D  I + + ND ++E +MK +    N     E D + +        +L  M++ L++K
Sbjct: 160 QVDESIRNETKNDNMLETLMKSLSMEPNAKSGKEGDXDXI------NSLLAEMLDQLSSK 213

Query: 204 DYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQN 263
             LYEP+ +   K+  WL+D   K+ PE Y++Y++Q   +  ++ ++    ++ NN    
Sbjct: 214 SVLYEPLNDLYLKFGPWLQDPAKKLDPE-YSKYQRQYGLVKALVLRFQQQTYNDNNAGDK 272

Query: 264 KAIINLMQELQEFGQPPPEILNE 286
           K I + ++ LQE G PP E++N+
Sbjct: 273 KFINDNLESLQELGLPPKELMND 295



>gi|426216945|ref|XP_004002717.1| PREDICTED: peroxisomal biogenesis factor 19 isoform 3 [Ovis aries]
          Length = 209

 Score = 90.5 bits (223), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 72/110 (65%), Gaps = 3/110 (2%)

Query: 185 GSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYIN 244
           G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   + 
Sbjct: 77  GEGTILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQAHRDSLPPEQFEKYQEQHSVMG 136

Query: 245 KIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM 291
           KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ PG+
Sbjct: 137 KICEQFEAETPTDTEATQKARFEVVLDLMQQLQDLGHPPKELAGEMPPGL 186



>gi|71023173|ref|XP_761816.1| hypothetical protein UM05669.1 [Ustilago maydis 521]
 gi|46100839|gb|EAK86072.1| hypothetical protein UM05669.1 [Ustilago maydis 521]
          Length = 417

 Score = 90.5 bits (223), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 65/223 (29%), Positives = 108/223 (48%), Gaps = 23/223 (10%)

Query: 83  KEFDENELSIAMQGLMKNFGEVDEDNLNGTDFDNTGRSTVESN---GTS----FQDKINQ 135
           +EF+E EL    + +M  FG   +     TD   + RS    +   GT+    F D I  
Sbjct: 176 QEFNEQELMKQFEAMMAGFGGAGDAAAPTTDAGPSRRSAAAGSTGSGTAKPGNFNDAIAA 235

Query: 136 TMNKLQNSSEQLD----------AEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEMFG 185
           TM KL+ S               A +     +++ +++  +    +LSG      E    
Sbjct: 236 TMAKLKESDASATADSASSDNPFAGLSGAEGEEMAKLLAALGGSGDLSGL-----EGAMD 290

Query: 186 SGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLED-NKGKVPPEDYARYEKQSEYIN 244
           +  + KMLE MM+ L ++D LYEP+KE   KYP +L       +  ED  RYE+QS YI 
Sbjct: 291 NPELTKMLEGMMDELMSRDILYEPLKELRDKYPAYLAGPESASISAEDRKRYEEQSRYIT 350

Query: 245 KIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNEL 287
           +I++ +D P +D  ++ +   +  LM ++Q+ G PP +I+ ++
Sbjct: 351 EIVKIFDEPGYDAKDKVKAARVQELMNQMQDCGSPPKQIVGDM 393



>gi|145232863|ref|XP_001399804.1| peroxisomal membrane protein receptor Pex19 [Aspergillus niger CBS
           513.88]
 gi|134056724|emb|CAL00666.1| unnamed protein product [Aspergillus niger]
          Length = 364

 Score = 90.5 bits (223), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 96/169 (56%), Gaps = 14/169 (8%)

Query: 128 SFQDKINQTMNKLQNSSEQLDAEII--DGSNDQIMEMMKQIENMANLSGFAENDFEEMFG 185
           +F D I +T+ +++ S ++  A     D S+D + +++K IE  A+ SG       E   
Sbjct: 186 TFNDTIQRTIERMKESGDKATAAASEDDMSDDLVAQLIKAIEAGAS-SG-------EGGD 237

Query: 186 SGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGK--VPPEDYARYEKQSEYI 243
            G + KM   MME L+ K+ LYEP+KE   K+  W+++NKGK  V  ED ARYE+Q+  +
Sbjct: 238 EGDLTKMFMGMMEQLSNKEILYEPIKELDTKFGPWIKENKGKGKVSEEDMARYERQAGVV 297

Query: 244 NKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGME 292
            +I+ K++   +   + +  + +   MQE+Q  G PP E+++  AP ME
Sbjct: 298 RQIVSKFEEKGYSDEDPKCREYVWEKMQEMQAAGNPPDELIS--APWME 344



>gi|471874247|emb|CCO36074.1| Peroxisome biogenesis protein 19-1 AltName: Full=Peroxin-19-1
           [Rhizoctonia solani AG-1 IB]
          Length = 315

 Score = 90.5 bits (223), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 52/168 (30%), Positives = 90/168 (53%), Gaps = 14/168 (8%)

Query: 127 TSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEMFGS 186
           T FQ  I Q M+KL++S E   A    G+ D   + +KQ+ +     G    D       
Sbjct: 145 TEFQRTIRQAMDKLKSSDENARASG-SGNEDDFADFLKQLSD----GGDGNED------- 192

Query: 187 GGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKI 246
            G++ M+E+MM  L  K+ LYEP+ E   K+P +  ++   +P  D  R++ Q   + ++
Sbjct: 193 -GLQGMIENMMGQLMGKEILYEPLVEMNDKFPGYFAEHP-NLPEADLKRHKAQQAIVKQL 250

Query: 247 IEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELN 294
           +E Y  P++  ++++  K ++ LM E+QE G PP E++ E+ PG + N
Sbjct: 251 VEIYQKPNYSDDDKETGKEVLRLMNEMQELGSPPTEVMGEVPPGFDFN 298



>gi|471882858|emb|CCO34151.1| Peroxisome biogenesis protein 19-1 AltName: Full=Peroxin-19-1
           [Rhizoctonia solani AG-1 IB]
          Length = 315

 Score = 90.5 bits (223), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 52/168 (30%), Positives = 90/168 (53%), Gaps = 14/168 (8%)

Query: 127 TSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEMFGS 186
           T FQ  I Q M+KL++S E   A    G+ D   + +KQ+ +     G    D       
Sbjct: 145 TEFQRTIRQAMDKLKSSDENARASG-SGNEDDFADFLKQLSD----GGDGNED------- 192

Query: 187 GGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKI 246
            G++ M+E+MM  L  K+ LYEP+ E   K+P +  ++   +P  D  R++ Q   + ++
Sbjct: 193 -GLKGMIENMMGQLMGKEILYEPLVEMNDKFPGYFAEHP-NLPEADLKRHKAQQAIVKQL 250

Query: 247 IEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELN 294
           +E Y  P++  ++++  K ++ LM E+QE G PP E++ E+ PG + N
Sbjct: 251 VEIYQKPNYSDDDKETGKEVLRLMNEMQELGSPPTEVMGEVPPGFDFN 298



>gi|471417484|ref|XP_004390251.1| PREDICTED: peroxisomal biogenesis factor 19 isoform 2 [Trichechus
           manatus latirostris]
          Length = 279

 Score = 90.1 bits (222), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 64/229 (27%), Positives = 114/229 (49%), Gaps = 34/229 (14%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDASSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +++  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSEE--ELNKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAP 289
            KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ P
Sbjct: 226 GKICEQFEAETPTDSEDTQKARFEMVLDLMQQLQDLGHPPKELAGEMVP 274



>gi|507575252|ref|XP_004671171.1| PREDICTED: peroxisomal biogenesis factor 19 isoform X3 [Jaculus
           jaculus]
          Length = 207

 Score = 90.1 bits (222), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 72/110 (65%), Gaps = 3/110 (2%)

Query: 185 GSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYIN 244
           G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   + 
Sbjct: 75  GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESIPPEQFEKYQEQHSVMV 134

Query: 245 KIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM 291
           KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ PG+
Sbjct: 135 KICEQFEAETPTDTEATQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGL 184



>gi|407928582|gb|EKG21436.1| Pex19 protein [Macrophomina phaseolina MS6]
          Length = 337

 Score = 90.1 bits (222), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 94/182 (51%), Gaps = 17/182 (9%)

Query: 119 RSTVESNGT-SFQDKINQTMNKLQNSSEQLDAEIIDGSN--DQIMEMMKQIENMANLSGF 175
           ++T +S G  +FQ++I +TM ++Q S EQ  A     SN  D + +M+ ++E        
Sbjct: 153 QATADSGGGDNFQEQIRKTMERMQASGEQASAAAASSSNPDDILAQMLAEMEKGGFGGEG 212

Query: 176 -----AENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPP 230
                ++ DF          KML  MME L  K+ LYEPMKE   K+P WL  N+ K   
Sbjct: 213 GADFGSDEDFS---------KMLMGMMEQLTNKEILYEPMKELYDKFPDWLAKNREKTDK 263

Query: 231 EDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPG 290
            D  RYE+Q   +  I+E+++ P +  ++    + I+  MQ++Q  G PP +++ ++   
Sbjct: 264 ADLERYEEQQRCVKDIVERFERPQYSDDSSADREFIVERMQKMQAAGSPPQDLVGDMTAA 323

Query: 291 ME 292
            E
Sbjct: 324 QE 325



>gi|358365473|dbj|GAA82095.1| peroxisomal membrane protein receptor Pex19 [Aspergillus kawachii
           IFO 4308]
          Length = 398

 Score = 90.1 bits (222), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 58/169 (34%), Positives = 96/169 (56%), Gaps = 14/169 (8%)

Query: 128 SFQDKINQTMNKLQNSSEQLDAEII--DGSNDQIMEMMKQIENMANLSGFAENDFEEMFG 185
           +F D I +T+ +++ S ++  A     D S+D + +++K IE  A+ SG       E   
Sbjct: 220 TFNDTIQRTIERMKESGDKATAAASEDDMSDDLVAQLIKAIEAGAS-SG-------EGGD 271

Query: 186 SGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGK--VPPEDYARYEKQSEYI 243
            G + KM   MME L+ K+ LYEP+KE   K+  W+++NKGK  V  ED ARYE+Q+  +
Sbjct: 272 EGDLTKMFMGMMEQLSNKEILYEPIKELDTKFGPWIKENKGKGKVSDEDMARYERQAGVV 331

Query: 244 NKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGME 292
            +I+ K++   +   + +  + +   MQE+Q  G PP E+++  AP ME
Sbjct: 332 RQIVSKFEEKGYSDEDPKCREYVWEKMQEMQAAGNPPDELIS--APWME 378



>gi|297280448|ref|XP_002808293.1| PREDICTED: LOW QUALITY PROTEIN: DDB1- and CUL4-associated factor
           8-like [Macaca mulatta]
          Length = 898

 Score = 90.1 bits (222), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 113/227 (49%), Gaps = 34/227 (14%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +D+  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSDE--ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNEL 287
            KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+
Sbjct: 226 CKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEM 272



>gi|402856799|ref|XP_003892967.1| PREDICTED: LOW QUALITY PROTEIN: DDB1- and CUL4-associated factor 8
           [Papio anubis]
          Length = 898

 Score = 89.7 bits (221), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 113/227 (49%), Gaps = 34/227 (14%)

Query: 66  LDDEYVKLLTADMEDFVKEFDENELSIA--MQGLMKNFGEVDEDNLNGTDFDNTGRSTVE 123
            D E     TA+ E  +KE  E E  +    Q L +  G V  D  +  +F +  + T+ 
Sbjct: 75  FDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLS 134

Query: 124 SNGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEM 183
                    + +    LQNS          G +D+  E+ K +E +    G  E D    
Sbjct: 135 G--------LAKNATDLQNS----------GMSDE--ELTKAMEGL----GMDEGD---- 166

Query: 184 FGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYI 243
            G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   +
Sbjct: 167 -GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVM 225

Query: 244 NKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNEL 287
            KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+
Sbjct: 226 CKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEM 272



>gi|168062621|ref|XP_001783277.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162665195|gb|EDQ51887.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 87

 Score = 89.7 bits (221), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 62/93 (66%), Gaps = 8/93 (8%)

Query: 206 LYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYD-APDFDGNNEQQNK 264
           LY+PMKE   +YP+WLE +K ++  ED ARY KQ ++I ++   Y+  PD         +
Sbjct: 2   LYDPMKEIGDRYPEWLESHKSELSSEDMARYTKQYDFIKQLCHAYETTPD-------DFQ 54

Query: 265 AIINLMQELQEFGQPPPEILNELAPGMELNEQG 297
            +++LMQ +QE GQPPP+I+ ELAPG+EL E G
Sbjct: 55  KVVDLMQNMQECGQPPPDIVRELAPGLELGEDG 87



>gi|512909419|ref|XP_004901587.1| PREDICTED: peroxisomal biogenesis factor 19 isoform X3
           [Heterocephalus glaber]
 gi|512994317|ref|XP_004858776.1| PREDICTED: peroxisomal biogenesis factor 19 isoform X3
           [Heterocephalus glaber]
          Length = 207

 Score = 89.7 bits (221), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 73/110 (66%), Gaps = 3/110 (2%)

Query: 185 GSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYIN 244
           G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q + + 
Sbjct: 75  GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHKVMG 134

Query: 245 KIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM 291
           KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ PG+
Sbjct: 135 KICEQFEAETPTDSEAVQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGL 184



>gi|226958492|ref|NP_001152997.1| peroxisomal biogenesis factor 19 isoform b [Mus musculus]
 gi|26324406|dbj|BAC25957.1| unnamed protein product [Mus musculus]
 gi|148707091|gb|EDL39038.1| peroxisome biogenesis factor 19, isoform CRA_b [Mus musculus]
          Length = 207

 Score = 89.7 bits (221), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 45/134 (33%), Positives = 79/134 (58%), Gaps = 12/134 (8%)

Query: 161 EMMKQIENMANLSGFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKW 220
           E+MK +E +    G  E D     G   +  +++S+M+ L +KD LY  +KE  +KYP+W
Sbjct: 60  ELMKAMEGL----GMDEGD-----GEASILPIMQSIMQNLLSKDVLYPSLKEITEKYPEW 110

Query: 221 LEDNKGKVPPEDYARYEKQSEYINKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFG 277
           L+ ++   PPE + +Y++Q   + KI E+++A    D +     + +A+++LMQ+LQ  G
Sbjct: 111 LQSHQDSTPPEQFEKYQQQHSVMVKICEQFEAETPTDSEATQRARFEAMLDLMQQLQALG 170

Query: 278 QPPPEILNELAPGM 291
            PP E+  E+ PG+
Sbjct: 171 HPPKELAGEMPPGL 184



>gi|403294005|ref|XP_003937998.1| PREDICTED: peroxisomal biogenesis factor 19 isoform 3 [Saimiri
           boliviensis boliviensis]
          Length = 209

 Score = 89.7 bits (221), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 72/110 (65%), Gaps = 3/110 (2%)

Query: 185 GSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYIN 244
           G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   + 
Sbjct: 77  GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMC 136

Query: 245 KIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM 291
           KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ PG+
Sbjct: 137 KICEQFEAETPTDSEATQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGL 186



>gi|344303666|gb|EGW33915.1| hypothetical protein SPAPADRAFT_59288 [Spathaspora passalidarum
           NRRL Y-27907]
          Length = 318

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 64/213 (30%), Positives = 113/213 (53%), Gaps = 30/213 (14%)

Query: 114 FDNTGRSTVES---NGTSFQDKINQTMNKLQNSSEQLDAEII-DGSNDQIMEMMKQIENM 169
           F+   R+ VE+      +F+  + +TM +L+NS + +D +I  DG+     +++ Q+  +
Sbjct: 114 FETEHRAEVEAQERKPANFEHVMKETMERLKNSGKDIDDKISGDGAGIGGEDLLTQM--L 171

Query: 170 ANLSGFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVP 229
           A L G  +N          M K+L  M+E L++++ LYEP+K+   K+P +L++NK K+ 
Sbjct: 172 AGLGGDGDN--------LDMNKLLVEMLEQLSSREVLYEPIKDLNTKFPDYLKENKDKLD 223

Query: 230 PEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEIL--NEL 287
              Y  Y KQ E   +II  ++A D+  +N+ +   +  L++ LQE GQPP E++   E 
Sbjct: 224 EAKYTTYNKQYEITTEIITIFEAADYSDDNKAKRDQVNELLESLQELGQPPEELVGNGEF 283

Query: 288 APG---------MELNEQGIPSDLT-----SCK 306
            PG         ++ N++ +P DL       CK
Sbjct: 284 LPGFGGGGAGNDLDFNDKDLPEDLAKDLEQGCK 316



>gi|470431848|ref|XP_004338438.1| peroxisomal biogenesis protein Pex19, putative [Acanthamoeba
           castellanii str. Neff]
 gi|440795295|gb|ELR16425.1| peroxisomal biogenesis protein Pex19, putative [Acanthamoeba
           castellanii str. Neff]
          Length = 252

 Score = 89.4 bits (220), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/161 (32%), Positives = 86/161 (53%), Gaps = 19/161 (11%)

Query: 147 LDAEIIDGSNDQIMEMMKQIENMANLSG--------FAENDFEEMFGSGGMEKMLESMME 198
           L  E++DG    + E+    E  A + G          +   E++ GS     ++E MM 
Sbjct: 75  LPPELMDGLKKLVEELSINKEGGAGVPGDLGLGSEEMMKEALEQLEGSPEFASIMEKMMG 134

Query: 199 ALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGN 258
           +L +K+ LYEP+K+  +KYP WL +N+ KV  E++ARY KQ EY+ ++   Y++      
Sbjct: 135 SLLSKEVLYEPIKQMKEKYPAWLANNRDKVSAEEFARYSKQFEYVQRLCVLYES------ 188

Query: 259 NEQQNKAIINLMQELQEFGQPPPEILNELAPGMELNEQGIP 299
               +  +  +M  +QE GQPP +I+ E+APG  L  +G P
Sbjct: 189 ----DSTMAEIMN-MQEHGQPPEDIVQEMAPGFNLGAEGGP 224



>gi|397611570|gb|EJK61386.1| hypothetical protein THAOC_18139 [Thalassiosira oceanica]
          Length = 393

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 71/117 (60%), Gaps = 8/117 (6%)

Query: 179 DFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEK 238
           DFE+  GS   +  ++ +M+ L +KD +YEPMKE + ++PKWL +NK  +  EDY +Y  
Sbjct: 255 DFEKFGGSKDSDDAIDGVMKQLLSKDLMYEPMKEVSARFPKWLAENKEDLSEEDYQKYGT 314

Query: 239 QSEYINKIIEKYDA-PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMELN 294
           Q ++  +I+  Y+  PD           I  LMQ++Q+FGQPP +I+  LAP +E +
Sbjct: 315 QYQFFQRIVHVYETEPD-------NFPRIQELMQQIQDFGQPPVDIIRSLAPELEFD 364



>gi|332810931|ref|XP_003308595.1| PREDICTED: peroxisomal biogenesis factor 19 [Pan troglodytes]
 gi|426332325|ref|XP_004027756.1| PREDICTED: peroxisomal biogenesis factor 19 isoform 3 [Gorilla
           gorilla gorilla]
 gi|426332335|ref|XP_004027761.1| PREDICTED: peroxisomal biogenesis factor 19-like isoform 2 [Gorilla
           gorilla gorilla]
 gi|21104398|dbj|BAB93469.1| peroxisomal farnesylated protein [Homo sapiens]
 gi|119573112|gb|EAW52727.1| peroxisomal biogenesis factor 19, isoform CRA_a [Homo sapiens]
 gi|221043188|dbj|BAH13271.1| unnamed protein product [Homo sapiens]
          Length = 209

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 38/110 (34%), Positives = 72/110 (65%), Gaps = 3/110 (2%)

Query: 185 GSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYIN 244
           G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   + 
Sbjct: 77  GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMC 136

Query: 245 KIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGM 291
           KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+ PG+
Sbjct: 137 KICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGL 186



>gi|452984447|gb|EME84204.1| hypothetical protein MYCFIDRAFT_214650 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 318

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 62/244 (25%), Positives = 113/244 (46%), Gaps = 25/244 (10%)

Query: 67  DDEYVKLLTADMEDFVKEFDEN-ELSIAMQGLMKNF---GEVDEDNLNGTDFDNTGRSTV 122
           ++++   L A M + + E  EN E+    + +M+     G    D   G       ++  
Sbjct: 70  EEDFAAQLQAGMSNLISELGENPEMQAEFEKMMQELVAAGAAGSDQKAGEHLRAAAQAAP 129

Query: 123 ES--------------NGTSFQDKINQTMNKLQNSSEQLDAEIIDGSNDQIMEMMKQIEN 168
           +S               G  F D I +TM ++Q S           SN    +++ Q+  
Sbjct: 130 KSPEQKAKEPSKKSAAKGEDFNDTIRKTMERMQASDSTAKQSTTSQSNMSEEDILAQM-- 187

Query: 169 MANLSGFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKV 228
           M  L+       EE F +     ML +MM  L  K+ LYEPMKE   K+P+W+  N+GK 
Sbjct: 188 MRELTEGGGEGGEEGFNA-----MLMNMMAHLTNKEILYEPMKELHDKFPEWMNKNEGKT 242

Query: 229 PPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELA 288
           P ++  RY++Q + + +I+ +++  ++   NE   + I+  MQ++Q  G PP +++ +++
Sbjct: 243 PKDEMQRYKEQQKLVGEIVARFERKEYSDENEDDREYIVERMQKMQAAGSPPSDLVGDMS 302

Query: 289 PGME 292
              E
Sbjct: 303 AAQE 306



>gi|302799914|ref|XP_002981715.1| hypothetical protein SELMODRAFT_179107 [Selaginella moellendorffii]
 gi|300150547|gb|EFJ17197.1| hypothetical protein SELMODRAFT_179107 [Selaginella moellendorffii]
          Length = 233

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 41/115 (35%), Positives = 70/115 (60%), Gaps = 6/115 (5%)

Query: 179 DFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEK 238
           +FE   G+  ++ ++ + M+ L +KD LY+PM E  ++YP+WL  NK K+  E++ RY +
Sbjct: 102 EFESYLGTEDLQSVMGTFMQQLLSKDVLYQPMLEIGERYPEWLSANKSKLSQEEFDRYSR 161

Query: 239 QSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGMEL 293
           Q + I ++   Y+    + N       I+ LMQ +Q  GQPP E++ ELAPG+++
Sbjct: 162 QHDLIKQLCHVYETTPDNFN------VIMELMQSMQSCGQPPAEMIEELAPGLQI 210



>gi|169770665|ref|XP_001819802.1| peroxisomal membrane protein receptor Pex19 [Aspergillus oryzae
           RIB40]
 gi|238486888|ref|XP_002374682.1| peroxisomal membrane protein receptor Pex19, putative [Aspergillus
           flavus NRRL3357]
 gi|83767661|dbj|BAE57800.1| unnamed protein product [Aspergillus oryzae RIB40]
 gi|220699561|gb|EED55900.1| peroxisomal membrane protein receptor Pex19, putative [Aspergillus
           flavus NRRL3357]
 gi|391867448|gb|EIT76694.1| peroxisomal membrane protein receptor Pex19 [Aspergillus oryzae
           3.042]
          Length = 383

 Score = 89.0 bits (219), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 90/160 (56%), Gaps = 13/160 (8%)

Query: 128 SFQDKINQTMNKLQNSSEQLDAEII-DGSNDQIMEMMKQIENMANLSGFAENDFEEMFGS 186
           SF D I QTMN+++ S ++  A    D  ND + ++MK +    N+ G  E+        
Sbjct: 214 SFNDAIQQTMNRMKESGDKATAAASEDDPNDLMAQLMKAV--ALNVDGEEED-------- 263

Query: 187 GGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKG--KVPPEDYARYEKQSEYIN 244
           GG   ++ S+ME L+ K+ LYEPMKE   K+  WL +NKG  K   E++ R+EKQ+   +
Sbjct: 264 GGFMNLVSSLMEQLSNKEMLYEPMKELNGKFGPWLLENKGNKKFTDEEWERFEKQAAISS 323

Query: 245 KIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEIL 284
           +I+ K++ P +   + +  + +   MQE+Q  G PP E++
Sbjct: 324 QIVAKFEEPGYTDEDPKCREYVWQKMQEMQAAGSPPEELV 363



>gi|345479326|ref|XP_003423927.1| PREDICTED: peroxisomal biogenesis factor 19-like isoform 2 [Nasonia
           vitripennis]
          Length = 301

 Score = 88.6 bits (218), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/144 (31%), Positives = 82/144 (56%), Gaps = 10/144 (6%)

Query: 167 ENMANLSGFAENDFEEMFGSGGME-------KMLESMMEALATKDYLYEPMKEFAQKYPK 219
           EN+ N+   +E D   MFG   +E         ++ MM++L +KD LY  +K+   +YP 
Sbjct: 137 ENLQNVPNISEADLAAMFGQASLEDGGSDFLPFMQGMMQSLLSKDVLYPSLKDLVDRYPA 196

Query: 220 WLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNK---AIINLMQELQEF 276
           WL++ +  +PP D  RYEKQ + + K+  + ++   D + E + K   + ++LMQE+Q  
Sbjct: 197 WLDEKRSTLPPADLTRYEKQLDLMTKVCHELESEKEDDSEEVKKKRFESTLSLMQEMQGC 256

Query: 277 GQPPPEILNELAPGMELNEQGIPS 300
           GQPP +++ E    ++L+ +G P+
Sbjct: 257 GQPPDDLITEQQSVLQLDGEGNPT 280



>gi|426193340|gb|EKV43274.1| hypothetical protein AGABI2DRAFT_195459 [Agaricus bisporus var.
           bisporus H97]
          Length = 367

 Score = 88.6 bits (218), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 58/170 (34%), Positives = 90/170 (52%), Gaps = 12/170 (7%)

Query: 129 FQDKINQTMNKLQNSSEQL----DAEIIDGSNDQIMEMMKQIENMANLSGFAENDFEEMF 184
           FQ +I Q M KL+ S   L    +   +D  +D +  ++K + +  +L    END     
Sbjct: 193 FQWQIKQAMEKLKESESNLKTSSNTPGVDPQSDVLQNLLKSLGDF-DLEKNGENDE---- 247

Query: 185 GSGGME--KMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEY 242
            S G E    LE++M  L  KD LYEP+K+    +P +L +    + P    RYE Q  Y
Sbjct: 248 -SNGAEIAATLENVMGQLMAKDILYEPLKDLGDNFPGFLANPPKPLDPALRTRYENQYSY 306

Query: 243 INKIIEKYDAPDFDGNNEQQNKAIINLMQELQEFGQPPPEILNELAPGME 292
           I +II  +++P+FD +N +  K I+ LM ++Q  G PPPEI+  + P +E
Sbjct: 307 IKQIIAVFESPNFDESNMETTKKILGLMNDMQSQGSPPPEIMGPMPPLLE 356



>gi|432119419|gb|ELK38494.1| Peroxisomal biogenesis factor 19 [Myotis davidii]
          Length = 250

 Score = 88.6 bits (218), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/137 (33%), Positives = 79/137 (57%), Gaps = 19/137 (13%)

Query: 171 NLSGFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPP 230
            LSG A+N  +           L+S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PP
Sbjct: 115 TLSGLAKNATD-----------LQSIMQNLLSKDVLYPSLKEITEKYPEWLQGHRESLPP 163

Query: 231 EDYARYEKQSEYINKIIEKYDA---PDFDGNNEQQNKAIINLMQELQEFGQPPPEILNEL 287
           E + +Y++Q   + KI E+++A    D +   + + + +++LMQ+LQ+ G PP E+  E+
Sbjct: 164 EQFEKYQEQHSVMGKICEQFEAETPTDSEATQKARFETVLDLMQQLQDLGHPPKELAGEM 223

Query: 288 APGM-----ELNEQGIP 299
            PG+      LN  G P
Sbjct: 224 PPGLNFDLDALNLSGPP 240



>gi|345479328|ref|XP_001605956.2| PREDICTED: peroxisomal biogenesis factor 19-like isoform 1 [Nasonia
           vitripennis]
          Length = 269

 Score = 88.2 bits (217), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/144 (31%), Positives = 82/144 (56%), Gaps = 10/144 (6%)

Query: 167 ENMANLSGFAENDFEEMFGSGGME-------KMLESMMEALATKDYLYEPMKEFAQKYPK 219
           EN+ N+   +E D   MFG   +E         ++ MM++L +KD LY  +K+   +YP 
Sbjct: 105 ENLQNVPNISEADLAAMFGQASLEDGGSDFLPFMQGMMQSLLSKDVLYPSLKDLVDRYPA 164

Query: 220 WLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNK---AIINLMQELQEF 276
           WL++ +  +PP D  RYEKQ + + K+  + ++   D + E + K   + ++LMQE+Q  
Sbjct: 165 WLDEKRSTLPPADLTRYEKQLDLMTKVCHELESEKEDDSEEVKKKRFESTLSLMQEMQGC 224

Query: 277 GQPPPEILNELAPGMELNEQGIPS 300
           GQPP +++ E    ++L+ +G P+
Sbjct: 225 GQPPDDLITEQQSVLQLDGEGNPT 248



>gi|507683229|ref|XP_004639991.1| PREDICTED: peroxisomal biogenesis factor 19 isoform X3 [Octodon
           degus]
          Length = 207

 Score = 88.2 bits (217), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 72/111 (64%), Gaps = 5/111 (4%)

Query: 185 GSGGMEKMLESMMEALATKDYLYEPMKEFAQKYPKWLEDNKGKVPPEDYARYEKQSEYIN 244
           G G +  +++S+M+ L +KD LY  +KE  +KYP+WL+ ++  +PPE + +Y++Q   + 
Sbjct: 75  GEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHNVMG 134

Query: 245 KIIEKYDAPDFDGNNEQQNKA----IINLMQELQEFGQPPPEILNELAPGM 291
           KI E+++A +    +E   KA    +++LMQ+LQ+ G PP E+  E+ PG+
Sbjct: 135 KICEQFEA-ETPTESEAAQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGL 184



>gi|325183213|emb|CCA17672.1| conserved hypothetical protein [Albugo laibachii Nc14]
          Length = 970

 Score = 88.2 bits (217), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 106/203 (52%), Gaps = 27/203 (13%)

Query: 103 EVDEDNLNGTDFD--NTGRSTVESNGTSFQDKINQTMNKLQNSSEQ---LDAEIIDGSND 157
           E  E N   T  D  N G S  E  G   + K+ +T+  +  ++E+   L++  +D   +
Sbjct: 65  ETHERNSKHTSVDEANDGPSDAEP-GLDVESKVAETLKNMAKAAEEAGGLESTDVDQMGE 123

Query: 158 QIMEMMKQIENMANLSGFAENDFEEMFGSGGMEKMLESMMEALATKDYLYEPMKEFAQKY 217
              EMMK++     L G  E     M   G  + ++++MM+ L  K+ +Y+P+K+   +Y
Sbjct: 124 ---EMMKEM-----LEGLGE-----MGDKGNFQDLVDNMMQQLLNKEVMYDPIKQICDRY 170

Query: 218 PKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIIN-LMQELQEF 276
           P+WL + K  +  EDY R+  Q +   ++++ Y +       E +N   ++ LMQE+Q+ 
Sbjct: 171 PEWLVEKKSTLSKEDYERFWFQYQLFQQVVDVYAS-------EPENYTKLSELMQEIQDC 223

Query: 277 GQPPPEILNELAPGMELNEQGIP 299
           G PP EI+ ELAPG++    G+P
Sbjct: 224 GHPPTEIVKELAPGLQFGADGMP 246