BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10229_c0_seq2-m.90 5prime_partial 189-518(-) 110 (-)
         (109 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|384490290|gb|EIE81512.1| hypothetical protein RO3G_06217 [Rhi...    94   2e-17   Rhizopus delemar RA 99-880
gi|511005447|gb|EPB86787.1| hypothetical protein HMPREF1544_0640...    89   3e-16   Mucor circinelloides f. circinelloides 1006PhL
gi|358055238|dbj|GAA98746.1| hypothetical protein E5Q_05434 [Mix...    88   8e-16   Mixia osmundae IAM 14324
gi|384500881|gb|EIE91372.1| hypothetical protein RO3G_16083 [Rhi...    88   9e-16   Rhizopus delemar RA 99-880
gi|353240391|emb|CCA72263.1| related to PEX19 protein [Piriformo...    80   2e-13   Serendipita indica DSM 11827
gi|443690044|gb|ELT92282.1| hypothetical protein CAPTEDRAFT_2247...    77   1e-12   Capitella teleta
gi|168062621|ref|XP_001783277.1| predicted protein [Physcomitrel...    76   3e-12   Physcomitrella patens
gi|302782856|ref|XP_002973201.1| hypothetical protein SELMODRAFT...    74   1e-11   Selaginella moellendorffii
gi|116784489|gb|ABK23361.1| unknown [Picea sitchensis]                 74   1e-11   Picea sitchensis
gi|170093734|ref|XP_001878088.1| predicted protein [Laccaria bic...    74   1e-11   Laccaria bicolor S238N-H82
gi|302789762|ref|XP_002976649.1| hypothetical protein SELMODRAFT...    73   2e-11   Selaginella moellendorffii
gi|403158426|ref|XP_003307718.2| hypothetical protein PGTG_00668...    72   5e-11   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|156381001|ref|XP_001632055.1| predicted protein [Nematostella...    72   6e-11   Nematostella vectensis
gi|340914950|gb|EGS18291.1| hypothetical protein CTHT_0063150 [C...    71   8e-11   Chaetomium thermophilum var. thermophilum DSM 1495
gi|390596059|gb|EIN05462.1| Pex19 protein, partial [Punctularia ...    71   8e-11   Punctularia strigosozonata HHB-11173 SS5
gi|260814193|ref|XP_002601800.1| hypothetical protein BRAFLDRAFT...    71   1e-10   Branchiostoma floridae


>gi|384490290|gb|EIE81512.1| hypothetical protein RO3G_06217 [Rhizopus delemar RA 99-880]
          Length = 277

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 46/96 (47%), Positives = 63/96 (65%), Gaps = 3/96 (3%)

Query: 17  KYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQE 76
           KYP+WLE+NK KV  EDY +Y +Q     +I+  Y+APDFD  NE Q K + +LM ++Q+
Sbjct: 182 KYPEWLENNKDKVKAEDYDKYRQQQTICQQIVAVYEAPDFDEKNEAQAKKVTDLMTKMQD 241

Query: 77  FGQPPPEILNELAPGMEL-NEQGIP--SDLTSCKNM 109
            GQPP E+L+E+APGM   N   +P   DL +C  M
Sbjct: 242 LGQPPSELLDEMAPGMNFGNPNAVPDMKDLENCNIM 277



>gi|511005447|gb|EPB86787.1| hypothetical protein HMPREF1544_06403 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 316

 Score = 89.4 bits (220), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 64/96 (66%), Gaps = 3/96 (3%)

Query: 17  KYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQE 76
           KYP WLE++K      DY +Y++Q     +I+ KY+AP+FD  NE Q K I++LM ++Q+
Sbjct: 221 KYPAWLEEHKDTADKADYEKYKQQHVICQQIVAKYEAPNFDEKNEAQGKEIMDLMTKMQD 280

Query: 77  FGQPPPEILNELAPGMEL-NEQGIP--SDLTSCKNM 109
            GQPP E+L+E+APGM   N +G+P   DL +C  M
Sbjct: 281 LGQPPAELLDEMAPGMNFGNPEGMPDMKDLENCNIM 316



>gi|358055238|dbj|GAA98746.1| hypothetical protein E5Q_05434 [Mixia osmundae IAM 14324]
          Length = 348

 Score = 87.8 bits (216), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 61/94 (64%), Gaps = 2/94 (2%)

Query: 16  VKYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQ 75
            KYP+WL DN+ K+   +  RY  Q E +++I+  Y++P F+ ++E Q K I+ LM ++Q
Sbjct: 257 TKYPQWLRDNESKIEASEVQRYRAQQEVVDEIVRSYESPKFNDDDEAQQKHIVELMSKMQ 316

Query: 76  EFGQPPPEILNELAPGMELNEQGIPSDLTSCKNM 109
           E G PP E++ E+ PGM L+   +PSD+ +C  M
Sbjct: 317 ESGAPPTELMGEMPPGMNLD--NLPSDMENCTIM 348



>gi|384500881|gb|EIE91372.1| hypothetical protein RO3G_16083 [Rhizopus delemar RA 99-880]
          Length = 272

 Score = 87.8 bits (216), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 47/96 (48%), Positives = 65/96 (67%), Gaps = 3/96 (3%)

Query: 17  KYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQE 76
           KYP+WLE+NK KV  EDYA+Y +Q     +I+  Y+APDFD  NE Q K +++LM ++Q+
Sbjct: 177 KYPEWLENNKDKVKAEDYAKYRQQQVIWQQIVAIYEAPDFDEKNEVQAKNVMDLMTKMQD 236

Query: 77  FGQPPPEILNELAPGMEL-NEQGIPS--DLTSCKNM 109
            GQPP E+L+E+APGM   N   +P   DL +C  M
Sbjct: 237 LGQPPAELLDEMAPGMNFGNPNAVPDIKDLENCNVM 272



>gi|353240391|emb|CCA72263.1| related to PEX19 protein [Piriformospora indica DSM 11827]
          Length = 312

 Score = 80.1 bits (196), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 54/85 (63%)

Query: 17  KYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQE 76
           K+P++LE N+  +  ED  RY+KQ   I+++I  +++PD+   N   +  II LM E+QE
Sbjct: 220 KFPEYLETNRSLISTEDQVRYDKQKSIISEVIAIFESPDYSDTNPATSAEIIKLMSEMQE 279

Query: 77  FGQPPPEILNELAPGMELNEQGIPS 101
           +G PP EI+  L PG ++   G+PS
Sbjct: 280 YGSPPAEIMGTLPPGFDVGSDGLPS 304



>gi|443690044|gb|ELT92282.1| hypothetical protein CAPTEDRAFT_224754 [Capitella teleta]
          Length = 319

 Score = 77.4 bits (189), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 59/87 (67%), Gaps = 3/87 (3%)

Query: 17  KYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDA---PDFDGNNEQQNKAIINLMQE 73
           KYP WL +NK K+  E+Y++Y KQ++ + +I+ ++D     D D +   +   I+N+MQ+
Sbjct: 222 KYPTWLSENKEKISSEEYSKYAKQNDLMGEIVREFDEEKDADSDESKRLRFDRIMNVMQQ 281

Query: 74  LQEFGQPPPEILNELAPGMELNEQGIP 100
           +QE GQPP EI+ ++ PG++L+  G+P
Sbjct: 282 MQELGQPPKEIVGDMPPGLDLDPNGLP 308



>gi|168062621|ref|XP_001783277.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162665195|gb|EDQ51887.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 87

 Score = 75.9 bits (185), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 55/84 (65%), Gaps = 10/84 (11%)

Query: 17 KYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAP--DFDGNNEQQNKAIINLMQEL 74
          +YP+WLE +K ++  ED ARY KQ ++I ++   Y+    DF        + +++LMQ +
Sbjct: 12 RYPEWLESHKSELSSEDMARYTKQYDFIKQLCHAYETTPDDF--------QKVVDLMQNM 63

Query: 75 QEFGQPPPEILNELAPGMELNEQG 98
          QE GQPPP+I+ ELAPG+EL E G
Sbjct: 64 QECGQPPPDIVRELAPGLELGEDG 87



>gi|302782856|ref|XP_002973201.1| hypothetical protein SELMODRAFT_99133 [Selaginella moellendorffii]
 gi|300158954|gb|EFJ25575.1| hypothetical protein SELMODRAFT_99133 [Selaginella moellendorffii]
          Length = 98

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 51/86 (59%), Gaps = 10/86 (11%)

Query: 17  KYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAP--DFDGNNEQQNKAIINLMQEL 74
           +YP WLE NK K+  ED+ R+ KQ + I ++   YD    DFD         I  LMQ +
Sbjct: 20  RYPSWLEANKSKLSKEDHDRFSKQHQLILELCRVYDTTPGDFD--------KITELMQSM 71

Query: 75  QEFGQPPPEILNELAPGMELNEQGIP 100
           Q  GQPP EI+ ELAPG++L E G+P
Sbjct: 72  QGCGQPPAEIVAELAPGLQLGEDGLP 97



>gi|116784489|gb|ABK23361.1| unknown [Picea sitchensis]
          Length = 254

 Score = 73.9 bits (180), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/87 (44%), Positives = 55/87 (63%), Gaps = 10/87 (11%)

Query: 17  KYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDA-PD-FDGNNEQQNKAIINLMQEL 74
           +YPKWLE+ K  +  EDY RY  Q E I ++ + Y+A PD FD         I+ LMQ++
Sbjct: 160 RYPKWLEERKSTISKEDYERYSCQYELIKQLCKVYEAEPDNFD--------KIVELMQKM 211

Query: 75  QEFGQPPPEILNELAPGMELNEQGIPS 101
           Q+ GQPP +I+ ELAPG+ L  +G P+
Sbjct: 212 QDCGQPPSDIVQELAPGLNLGSEGGPA 238



>gi|170093734|ref|XP_001878088.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164646542|gb|EDR10787.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 332

 Score = 73.9 bits (180), Expect = 1e-11,   Method: Composition-based stats.
 Identities = 31/76 (40%), Positives = 49/76 (64%)

Query: 18  YPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQEF 77
           +P +L +    + PED +RYEKQ E + +I+  +D P +   NE+ NK I++LM E+Q +
Sbjct: 243 FPPYLTNPPSPLSPEDRSRYEKQEECVKRILAVFDKPGYSDANEESNKVIVDLMSEMQSY 302

Query: 78  GQPPPEILNELAPGME 93
           G PP EI+  L PG++
Sbjct: 303 GSPPAEIMGPLPPGLD 318



>gi|302789762|ref|XP_002976649.1| hypothetical protein SELMODRAFT_105720 [Selaginella moellendorffii]
 gi|300155687|gb|EFJ22318.1| hypothetical protein SELMODRAFT_105720 [Selaginella moellendorffii]
          Length = 98

 Score = 73.2 bits (178), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 50/86 (58%), Gaps = 10/86 (11%)

Query: 17  KYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAP--DFDGNNEQQNKAIINLMQEL 74
           +YP WLE NK K+  ED  R+ KQ + I ++   YD    DFD         I  LMQ +
Sbjct: 20  RYPSWLEANKSKLSKEDRDRFSKQHQLILELCRVYDTTPGDFD--------KITELMQSM 71

Query: 75  QEFGQPPPEILNELAPGMELNEQGIP 100
           Q  GQPP EI+ ELAPG++L E G+P
Sbjct: 72  QGCGQPPAEIVAELAPGLQLGEDGLP 97



>gi|403158426|ref|XP_003307718.2| hypothetical protein PGTG_00668 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|375163811|gb|EFP74712.2| hypothetical protein PGTG_00668 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 350

 Score = 72.0 bits (175), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 56/90 (62%), Gaps = 8/90 (8%)

Query: 18  YPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNE-------QQNKAIINL 70
           +P W+E+N+ K+ PED  RYE Q++ I ++IE++D P +D   +        + K +I L
Sbjct: 254 FPDWIEENRSKLSPEDMKRYETQAKIIEQVIERFDDPSWDSEEKAGGDRFLSRQKEVIEL 313

Query: 71  MQELQEFGQPPPEILNELAPGMELNEQGIP 100
           + ++Q+ G PP EIL ++ PG+   E G+P
Sbjct: 314 LTKMQDCGPPPKEILGDMPPGV-FGEDGLP 342



>gi|156381001|ref|XP_001632055.1| predicted protein [Nematostella vectensis]
 gi|156219105|gb|EDO39992.1| predicted protein [Nematostella vectensis]
          Length = 307

 Score = 71.6 bits (174), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 39/101 (38%), Positives = 60/101 (59%), Gaps = 10/101 (9%)

Query: 17  KYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNK---AIINLMQE 73
           KYP WLE+ K     E +AR+ KQ EY+N I ++++A   D + + + K    I++LMQ+
Sbjct: 205 KYPPWLENKKSSHSDEVHARFTKQHEYVNMICQEFEAEKPDDSEDIKKKRFQKIMSLMQQ 264

Query: 74  LQEFGQPPPEILNELAPGMELNEQ-------GIPSDLTSCK 107
           +QE GQPP E++ ++APGM    +        +P DL  CK
Sbjct: 265 MQECGQPPEELVGQMAPGMPFGTEPSIGDMPELPKDLQECK 305



>gi|340914950|gb|EGS18291.1| hypothetical protein CTHT_0063150 [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 361

 Score = 71.2 bits (173), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 49/72 (68%)

Query: 17  KYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQE 76
           K+P+W+E N+GKV  ED  RYE+Q  Y+ +I+ K++ P +   N+   + II+ MQ++Q 
Sbjct: 273 KFPEWIEKNRGKVSAEDLQRYEEQQTYVREIVAKFEEPTYSDENKADREYIIDRMQKMQA 332

Query: 77  FGQPPPEILNEL 88
            GQPP +++ E+
Sbjct: 333 TGQPPADLVGEM 344



>gi|390596059|gb|EIN05462.1| Pex19 protein, partial [Punctularia strigosozonata HHB-11173 SS5]
          Length = 253

 Score = 71.2 bits (173), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 51/90 (56%)

Query: 17  KYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDAPDFDGNNEQQNKAIINLMQELQE 76
           K+P +L +N  K+   D  RYE+Q   + +I+E ++ P +   + Q+   I+ LM E+Q 
Sbjct: 161 KFPDYLAENSAKLSTADKDRYERQYSCVQQIVEVFEDPSYSDEDAQKGTRIVTLMNEMQS 220

Query: 77  FGQPPPEILNELAPGMELNEQGIPSDLTSC 106
            G PPPEI+  L PG+++   G+P     C
Sbjct: 221 HGSPPPEIMGPLPPGLDVGPDGLPKLPDGC 250



>gi|260814193|ref|XP_002601800.1| hypothetical protein BRAFLDRAFT_121162 [Branchiostoma floridae]
 gi|229287102|gb|EEN57812.1| hypothetical protein BRAFLDRAFT_121162 [Branchiostoma floridae]
          Length = 302

 Score = 70.9 bits (172), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 33/87 (37%), Positives = 57/87 (65%), Gaps = 3/87 (3%)

Query: 17  KYPKWLEDNKGKVPPEDYARYEKQSEYINKIIEKYDA---PDFDGNNEQQNKAIINLMQE 73
           KYP WLE NK K+  ED  +Y +Q E + +I  ++++    D +    ++ +  ++LMQ+
Sbjct: 202 KYPDWLEQNKSKLSQEDNQKYSQQFELMKQICGEFESEAETDAEEVKAKRFEKTLDLMQK 261

Query: 74  LQEFGQPPPEILNELAPGMELNEQGIP 100
           +Q+ GQPP E++ E+APG+E +E G+P
Sbjct: 262 MQDLGQPPKELVGEMAPGIEFDEHGVP 288