BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10245_c0_seq1-m.92 internal 1-414(-) 138 (-)
         (138 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|388580069|gb|EIM20387.1| ADP-ribosylation factor 6 [Wallemia ...   282   2e-74   Wallemia mellicola CBS 633.66
gi|403418375|emb|CCM05075.1| predicted protein [Fibroporia radic...   282   3e-74   Fibroporia radiculosa
gi|393217530|gb|EJD03019.1| CPS1 protein [Fomitiporia mediterran...   281   3e-74   Fomitiporia mediterranea MF3/22
gi|505756092|gb|EOR00273.1| ADP-ribosylation factor 6 [Wallemia ...   280   7e-74   Wallemia ichthyophaga EXF-994
gi|443898286|dbj|GAC75623.1| cystathionine beta-lyases [Pseudozy...   280   8e-74   Moesziomyces antarcticus T-34
gi|302681379|ref|XP_003030371.1| hypothetical protein SCHCODRAFT...   280   1e-73   Schizophyllum commune H4-8
gi|169847686|ref|XP_001830552.1| CPS1 protein [Coprinopsis ciner...   279   1e-73   Coprinopsis cinerea okayama7#130
gi|402224123|gb|EJU04186.1| CPS1 protein [Dacryopinax sp. DJM-73...   279   2e-73   Dacryopinax primogenitus
gi|392569697|gb|EIW62870.1| ARF/SAR [Trametes versicolor FP-1016...   278   3e-73   Trametes versicolor FP-101664 SS1
gi|336371732|gb|EGO00072.1| hypothetical protein SERLA73DRAFT_18...   278   4e-73   Serpula lacrymans var. lacrymans S7.3
gi|449546742|gb|EMD37711.1| ADP-ribosylation factor 6 [Ceriporio...   278   4e-73   Gelatoporia subvermispora B
gi|343426461|emb|CBQ69991.1| probable ADP-ribosylation factor 6 ...   278   4e-73   Sporisorium reilianum SRZ2
gi|71022995|ref|XP_761727.1| ADP-ribosylation factor 6 [Ustilago...   278   5e-73   
gi|388856005|emb|CCF50382.1| probable ADP-ribosylation factor 6 ...   278   5e-73   Ustilago hordei
gi|170092205|ref|XP_001877324.1| predicted protein [Laccaria bic...   278   5e-73   Laccaria bicolor S238N-H82
gi|471898997|emb|CCO30537.1| ADP-ribosylation factor 6 [Rhizocto...   277   5e-73   Rhizoctonia solani AG-1 IB
gi|392593500|gb|EIW82825.1| ARF SAR [Coniophora puteana RWD-64-5...   277   8e-73   Coniophora puteana RWD-64-598 SS2
gi|501306275|dbj|GAC95345.1| potential ADP-ribosylation factor [...   276   1e-72   Pseudozyma hubeiensis SY62
gi|389741634|gb|EIM82822.1| CPS1 protein [Stereum hirsutum FP-91...   276   1e-72   Stereum hirsutum FP-91666 SS1
gi|409080546|gb|EKM80906.1| hypothetical protein AGABI1DRAFT_112...   275   4e-72   Agaricus bisporus var. burnettii JB137-S8
gi|401880776|gb|EJT45088.1| soluble GTPase with a role in regula...   273   1e-71   Trichosporon asahii var. asahii CBS 2479
gi|392579042|gb|EIW72169.1| hypothetical protein TREMEDRAFT_7064...   271   3e-71   Tremella mesenterica DSM 1558
gi|58261552|ref|XP_568186.1| put. CPS1 protein [Cryptococcus neo...   270   1e-70   Cryptococcus neoformans var. neoformans JEC21
gi|321254910|ref|XP_003193241.1| soluble GTPase with a role in r...   269   1e-70   Cryptococcus gattii WM276
gi|405119446|gb|AFR94218.1| cps1 protein [Cryptococcus neoforman...   268   3e-70   Cryptococcus neoformans var. grubii H99
gi|511000353|gb|EPB81900.1| ADP-ribosylation factor 6 [Mucor cir...   267   6e-70   Mucor circinelloides f. circinelloides 1006PhL
gi|328861454|gb|EGG10557.1| hypothetical protein MELLADRAFT_4218...   266   1e-69   Melampsora larici-populina 98AG31
gi|331238290|ref|XP_003331800.1| ADP-ribosylation factor [Puccin...   265   4e-69   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|511000722|gb|EPB82240.1| ADP-ribosylation factor 6 [Mucor cir...   264   6e-69   Mucor circinelloides f. circinelloides 1006PhL
gi|472580341|gb|EMS18151.1| ADP-ribosylation factor 6 [Rhodospor...   261   4e-68   Rhodotorula toruloides NP11
gi|358059944|dbj|GAA94374.1| hypothetical protein E5Q_01025 [Mix...   258   4e-67   Mixia osmundae IAM 14324
gi|353234356|emb|CCA66382.1| probable ADP-ribosylation factor 6 ...   256   2e-66   Serendipita indica DSM 11827
gi|443914935|gb|ELU36610.1| CPS1 protein [Rhizoctonia solani AG-...   254   4e-66   Rhizoctonia solani AG-1 IA
gi|291403824|ref|XP_002718343.1| PREDICTED: mCG3164-like [Orycto...   251   4e-65   
gi|430812660|emb|CCJ29933.1| unnamed protein product [Pneumocyst...   250   7e-65   Pneumocystis jirovecii
gi|301773242|ref|XP_002922050.1| PREDICTED: hypothetical protein...   250   8e-65   
gi|241620380|ref|XP_002408659.1| GTP-binding ADP-ribosylation fa...   249   1e-64   Ixodes scapularis [blacklegged tick]
gi|345567569|gb|EGX50499.1| hypothetical protein AOL_s00075g228 ...   249   1e-64   Arthrobotrys oligospora ATCC 24927
gi|321459580|gb|EFX70632.1| hypothetical protein DAPPUDRAFT_3093...   249   2e-64   Daphnia pulex
gi|332375212|gb|AEE62747.1| unknown [Dendroctonus ponderosae] >g...   249   2e-64   Dendroctonus ponderosae
gi|410898053|ref|XP_003962513.1| PREDICTED: ADP-ribosylation fac...   248   3e-64   
gi|443731182|gb|ELU16419.1| hypothetical protein CAPTEDRAFT_1387...   248   4e-64   Capitella teleta
gi|297787706|pdb|3LVQ|E Chain E, The Crystal Structure Of Asap3 ...   248   4e-64   Homo sapiens [man]
gi|483515729|gb|EOB02895.1| ADP-ribosylation factor 6, partial [...   248   4e-64   Anas platyrhynchos [duck]
gi|209155786|gb|ACI34125.1| ADP-ribosylation factor 6 [Salmo salar]   248   4e-64   Salmo salar
gi|296415710|ref|XP_002837529.1| hypothetical protein [Tuber mel...   248   4e-64   Tuber melanosporum Mel28
gi|126165220|ref|NP_001075174.1| ADP-ribosylation factor 6 [Gall...   248   4e-64   Gallus gallus [bantam]
gi|197128327|gb|ACH44825.1| putative ADP-ribosylation factor 6 v...   248   5e-64   Taeniopygia guttata
gi|322785548|gb|EFZ12210.1| hypothetical protein SINV_14695 [Sol...   248   5e-64   Solenopsis invicta [imported red fire ant]
gi|41053393|ref|NP_956287.1| ADP-ribosylation factor 6a [Danio r...   248   5e-64   Danio rerio [leopard danio]
gi|511828105|ref|XP_004738796.1| PREDICTED: ADP-ribosylation fac...   248   5e-64   
gi|307192533|gb|EFN75721.1| ADP-ribosylation factor 6 [Harpegnat...   248   5e-64   Harpegnathos saltator
gi|45361671|ref|NP_989412.1| ADP-ribosylation factor 6 [Xenopus ...   247   6e-64   Xenopus tropicalis [western clawed frog]
gi|340721293|ref|XP_003399058.1| PREDICTED: ADP-ribosylation fac...   247   6e-64   Bombus terrestris [large earth bumblebee]
gi|62531207|gb|AAH93345.1| Zgc:77665 protein, partial [Danio rerio]   247   6e-64   Danio rerio [leopard danio]
gi|470361996|ref|XP_004365245.1| ADP-ribosylation factor [Capsas...   247   6e-64   Capsaspora owczarzaki ATCC 30864
gi|158286685|ref|XP_308867.3| AGAP006890-PB [Anopheles gambiae s...   247   7e-64   Anopheles gambiae str. PEST
gi|470319997|gb|EMR11593.1| hypothetical protein PNEG_00037 [Pne...   247   7e-64   Pneumocystis murina B123
gi|170057334|ref|XP_001864438.1| conserved hypothetical protein ...   247   8e-64   Culex quinquefasciatus
gi|54696596|gb|AAV38670.1| ADP-ribosylation factor 6 [synthetic ...   247   9e-64   synthetic construct
gi|326921282|ref|XP_003206890.1| PREDICTED: ADP-ribosylation fac...   247   9e-64   
gi|431895868|gb|ELK05286.1| ADP-ribosylation factor 6 [Pteropus ...   247   9e-64   Pteropus alecto
gi|157107947|ref|XP_001650010.1| adp-ribosylation factor, arf [A...   246   1e-63   Aedes aegypti
gi|55741926|ref|NP_001006797.1| ADP-ribosylation factor 6 [Xenop...   246   1e-63   Xenopus tropicalis [western clawed frog]
gi|209153529|gb|ACI33167.1| ADP-ribosylation factor 6 [Salmo salar]   246   1e-63   Salmo salar
gi|4502211|ref|NP_001654.1| ADP-ribosylation factor 6 [Homo sapi...   246   1e-63   Homo sapiens [man]
gi|291226696|ref|XP_002733332.1| PREDICTED: mCG3164-like [Saccog...   246   1e-63   Saccoglossus kowalevskii
gi|318887826|ref|NP_001187339.1| ADP-ribosylation factor 6 [Icta...   246   1e-63   Ictalurus punctatus
gi|194207356|ref|XP_001916100.1| PREDICTED: ADP-ribosylation fac...   246   1e-63   
gi|221327936|gb|ACM17704.1| ADP-ribosylation factor 6 [Sus scrofa]    246   1e-63   Sus scrofa [pigs]
gi|303325077|pdb|3N5C|A Chain A, Crystal Structure Of Arf6delta1...   246   1e-63   Homo sapiens [man]
gi|148704663|gb|EDL36610.1| mCG3164 [Mus musculus]                    246   1e-63   Mus musculus [mouse]
gi|7767049|pdb|1E0S|A Chain A, Small G Protein Arf6-Gdp               246   1e-63   Homo sapiens [man]
gi|149582964|ref|XP_001512800.1| PREDICTED: ADP-ribosylation fac...   246   1e-63   Ornithorhynchus anatinus [duck-billed platypus]
gi|89269023|emb|CAJ82515.1| novel protein similar to ADP-ribosyl...   246   1e-63   Xenopus tropicalis [western clawed frog]
gi|91076080|ref|XP_967713.1| PREDICTED: similar to ADP-ribosylat...   246   1e-63   Tribolium castaneum [rust-red flour beetle]
gi|357629652|gb|EHJ78283.1| hypothetical protein KGM_17559 [Dana...   246   1e-63   Danaus plexippus [American monarch]
gi|403072083|pdb|4FME|C Chain C, Espg-Rab1-Arf6 Complex >gi|4030...   246   1e-63   Homo sapiens [man]
gi|54696598|gb|AAV38671.1| ADP-ribosylation factor 6 [Homo sapie...   246   1e-63   Homo sapiens [man]
gi|498983627|ref|XP_004530164.1| PREDICTED: ADP-ribosylation fac...   246   2e-63   Ceratitis capitata
gi|49456833|emb|CAG46737.1| ARF6 [Homo sapiens]                       246   2e-63   Homo sapiens [man]
gi|378734550|gb|EHY61009.1| ADP-ribosylation factor 6 [Exophiala...   246   2e-63   Exophiala dermatitidis NIH/UT8656
gi|340371389|ref|XP_003384228.1| PREDICTED: ADP-ribosylation fac...   246   2e-63   Amphimedon queenslandica
gi|327287372|ref|XP_003228403.1| PREDICTED: ADP-ribosylation fac...   246   2e-63   
gi|258572951|ref|XP_002540657.1| ADP-ribosylation factor 6 [Unci...   246   2e-63   Uncinocarpus reesii 1704
gi|147899653|ref|NP_001086677.1| ADP-ribosylation factor 6 [Xeno...   246   2e-63   Xenopus laevis [clawed frog]
gi|242009948|ref|XP_002425743.1| ADP-ribosylation factor, putati...   246   2e-63   Pediculus humanus corporis [human body lice]
gi|195027485|ref|XP_001986613.1| GH20425 [Drosophila grimshawi] ...   246   2e-63   Drosophila grimshawi
gi|410916219|ref|XP_003971584.1| PREDICTED: ADP-ribosylation fac...   245   2e-63   
gi|58702058|gb|AAH90206.1| Arf6 protein [Xenopus laevis]              245   3e-63   Xenopus laevis [clawed frog]
gi|195119858|ref|XP_002004446.1| GI19608 [Drosophila mojavensis]...   244   4e-63   Drosophila mojavensis
gi|148230515|ref|NP_001084094.1| ADP-ribosylation factor 6 [Xeno...   244   4e-63   Xenopus laevis [clawed frog]
gi|195426543|ref|XP_002061387.1| GK20891 [Drosophila willistoni]...   244   5e-63   Drosophila willistoni
gi|296214950|ref|XP_002753924.1| PREDICTED: ADP-ribosylation fac...   244   5e-63   
gi|295667691|ref|XP_002794395.1| ADP-ribosylation factor [Paraco...   244   5e-63   Paracoccidioides lutzii Pb01
gi|148226220|ref|NP_001079550.1| ADP-ribosylation factor 6 [Xeno...   244   6e-63   Xenopus laevis [clawed frog]
gi|75766050|pdb|2A5G|A Chain A, Cholera Toxin A1 Subunit Bound T...   244   6e-63   Homo sapiens [man]
gi|119191334|ref|XP_001246273.1| ADP-ribosylation factor 6 [Cocc...   244   7e-63   Coccidioides immitis RS
gi|254220871|pdb|2W83|A Chain A, Crystal Structure Of The Arf6 G...   244   8e-63   Homo sapiens [man]
gi|387766221|pdb|3VHX|A Chain A, The Crystal Structure Of Arf6-m...   244   8e-63   Mus musculus [mouse]
gi|225680155|gb|EEH18439.1| ADP-ribosylation factor 6 [Paracocci...   243   1e-62   Paracoccidioides brasiliensis Pb03
gi|170595361|ref|XP_001902349.1| ADP-ribosylation factor 6 [Brug...   243   1e-62   Brugia malayi [agent of lymphatic filariasis]
gi|296823082|ref|XP_002850388.1| ADP-ribosylation factor 6 [Arth...   243   1e-62   Arthroderma otae CBS 113480
gi|89258463|gb|ABD65455.1| Arf6 [Suberites domuncula]                 242   2e-62   Suberites domuncula
gi|470319998|gb|EMR11594.1| hypothetical protein, variant [Pneum...   242   2e-62   
gi|340514847|gb|EGR45106.1| ADP-ribosylation factor [Trichoderma...   242   2e-62   Trichoderma reesei QM6a
gi|261193427|ref|XP_002623119.1| ADP-ribosylation factor 6 [Ajel...   242   2e-62   Blastomyces gilchristii SLH14081
gi|346318101|gb|EGX87706.1| ADP-ribosylation factor 6 [Cordyceps...   242   3e-62   Cordyceps militaris CM01
gi|240275073|gb|EER38588.1| ADP-ribosylation factor [Ajellomyces...   242   3e-62   Histoplasma capsulatum H143
gi|194754962|ref|XP_001959761.1| GF13030 [Drosophila ananassae] ...   241   4e-62   Drosophila ananassae
gi|125809938|ref|XP_001361286.1| GA20856 [Drosophila pseudoobscu...   241   4e-62   Drosophila pseudoobscura pseudoobscura
gi|24653827|ref|NP_523751.2| ADP ribosylation factor 51F, isofor...   241   5e-62   Drosophila melanogaster
gi|316983334|pdb|3PCR|B Chain B, Structure Of Espg-Arf6 Complex       241   5e-62   Homo sapiens [man]
gi|193599058|ref|XP_001945303.1| PREDICTED: ADP-ribosylation fac...   241   5e-62   Acyrthosiphon pisum
gi|389636504|ref|XP_003715902.1| ADP-ribosylation factor 6 [Magn...   240   7e-62   Magnaporthe oryzae 70-15
gi|440634612|gb|ELR04531.1| ADP-ribosylation factor 6 [Geomyces ...   240   8e-62   Pseudogymnoascus destructans 20631-21
gi|164659844|ref|XP_001731046.1| hypothetical protein MGL_2045 [...   240   1e-61   Malassezia globosa CBS 7966
gi|358390019|gb|EHK39425.1| hypothetical protein TRIATDRAFT_1465...   239   1e-61   Trichoderma atroviride IMI 206040
gi|390340158|ref|XP_796400.3| PREDICTED: ADP-ribosylation factor...   239   2e-61   Strongylocentrotus purpuratus [purple urchin]
gi|310796005|gb|EFQ31466.1| ADP-ribosylation factor family prote...   239   2e-61   Colletotrichum graminicola M1.001
gi|46117282|ref|XP_384659.1| hypothetical protein FG04483.1 [Fus...   239   2e-61   
gi|402074038|gb|EJT69590.1| ADP-ribosylation factor 6 [Gaeumanno...   239   2e-61   Gaeumannomyces graminis var. tritici R3-111a-1
gi|221119538|ref|XP_002159809.1| PREDICTED: ADP-ribosylation fac...   239   2e-61   Hydra vulgaris
gi|302901282|ref|XP_003048403.1| predicted protein [Nectria haem...   238   4e-61   Nectria haematococca mpVI 77-13-4
gi|475664813|gb|EMT62607.1| ADP-ribosylation factor 6 [Fusarium ...   238   4e-61   Fusarium oxysporum f. sp. cubense race 4
gi|429852943|gb|ELA28053.1| ADP-ribosylation factor, partial [Co...   238   5e-61   Colletotrichum gloeosporioides Nara gc5
gi|19113614|ref|NP_596822.1| ADP-ribosylation factor, Arf family...   238   5e-61   Schizosaccharomyces pombe 972h-
gi|465793288|emb|CCU98417.1| unnamed protein product [Malassezia...   238   5e-61   Malassezia sympodialis ATCC 42132
gi|477530458|gb|ENH82188.1| ADP-ribosylation factor [Colletotric...   238   5e-61   Colletotrichum orbiculare MAFF 240422
gi|507234|gb|AAA28378.1| ADP ribosylation factor 3 [Drosophila m...   238   6e-61   Drosophila melanogaster
gi|322699408|gb|EFY91170.1| ADP-ribosylation factor [Metarhizium...   237   6e-61   Metarhizium acridum CQMa 102
gi|225558629|gb|EEH06913.1| ADP-ribosylation factor [Ajellomyces...   237   6e-61   Histoplasma capsulatum G186AR
gi|330935313|ref|XP_003304906.1| hypothetical protein PTT_17639 ...   237   7e-61   Pyrenophora teres f. teres 0-1
gi|320587020|gb|EFW99667.1| ADP-ribosylation factor [Grosmannia ...   237   8e-61   Grosmannia clavigera kw1407
gi|399167124|emb|CCE32098.1| probable ADP-ribosylation factor 6 ...   236   1e-60   Claviceps purpurea 20.1
gi|189207987|ref|XP_001940327.1| ADP-ribosylation factor 6 [Pyre...   236   1e-60   Pyrenophora tritici-repentis Pt-1C-BFP
gi|501753289|emb|CCG82976.1| ADP-ribosylation factor 3 [Taphrina...   236   1e-60   Taphrina deformans PYCC 5710
gi|195996183|ref|XP_002107960.1| conserved hypothetical protein ...   236   1e-60   Trichoplax adhaerens
gi|302420247|ref|XP_003007954.1| ADP-ribosylation factor 6 [Vert...   236   1e-60   Verticillium alfalfae VaMs.102
gi|512186868|gb|EPE02653.1| adp-ribosylation factor 6 [Ophiostom...   236   1e-60   Ophiostoma piceae UAMH 11346
gi|322704957|gb|EFY96547.1| ADP-ribosylation factor [Metarhizium...   236   1e-60   Metarhizium robertsii ARSEF 23
gi|512198417|gb|EPE27252.1| P-loop containing nucleoside triphos...   236   2e-60   Glarea lozoyensis ATCC 20868
gi|471562561|gb|EMR64035.1| putative adp-ribosylation factor 6 p...   236   2e-60   Eutypa lata UCREL1
gi|156383600|ref|XP_001632921.1| predicted protein [Nematostella...   236   2e-60   Nematostella vectensis
gi|326426994|gb|EGD72564.1| ADP-ribosylation factor 6 [Salpingoe...   236   2e-60   Salpingoeca rosetta
gi|17538186|ref|NP_503011.1| Protein ARF-6 [Caenorhabditis elega...   236   2e-60   Caenorhabditis elegans [roundworm]
gi|268534394|ref|XP_002632328.1| C. briggsae CBR-ARF-6 protein [...   235   3e-60   Caenorhabditis briggsae
gi|156066107|ref|XP_001598975.1| conserved hypothetical protein ...   235   3e-60   Sclerotinia sclerotiorum 1980 UF-70
gi|391326553|ref|XP_003737777.1| PREDICTED: ADP-ribosylation fac...   235   3e-60   Metaseiulus occidentalis
gi|154294278|ref|XP_001547581.1| conserved hypothetical protein ...   234   4e-60   Botrytis cinerea B05.10
gi|494827014|gb|EON64030.1| ADP-ribosylation factor 6 [Coniospor...   233   9e-60   Coniosporium apollinis CBS 100218
gi|342874882|gb|EGU76789.1| hypothetical protein FOXB_12686 [Fus...   233   1e-59   Fusarium oxysporum Fo5176
gi|400599827|gb|EJP67518.1| ADP-ribosylation factor 6 [Beauveria...   233   1e-59   Beauveria bassiana ARSEF 2860
gi|156383688|ref|XP_001632965.1| predicted protein [Nematostella...   231   6e-59   Nematostella vectensis
gi|171676547|ref|XP_001903226.1| hypothetical protein [Podospora...   230   1e-58   Podospora anserina S mat+
gi|145233077|ref|XP_001399911.1| ADP-ribosylation factor 6 [Aspe...   228   3e-58   Aspergillus niger CBS 513.88
gi|242782755|ref|XP_002480063.1| ADP-ribosylation factor 6, puta...   228   3e-58   Talaromyces stipitatus ATCC 10500
gi|169770883|ref|XP_001819911.1| ADP-ribosylation factor 6 [Aspe...   228   6e-58   Aspergillus oryzae RIB40
gi|210075497|ref|XP_501834.2| YALI0C14586p [Yarrowia lipolytica]...   227   8e-58   Yarrowia lipolytica CLIB122
gi|67537700|ref|XP_662624.1| hypothetical protein AN5020.2 [Aspe...   227   8e-58   Aspergillus nidulans FGSC A4
gi|115396584|ref|XP_001213931.1| ADP-ribosylation factor 6 [Aspe...   227   8e-58   Aspergillus terreus NIH2624
gi|212527138|ref|XP_002143726.1| ADP-ribosylation factor 6, puta...   226   1e-57   Talaromyces marneffei ATCC 18224
gi|121705884|ref|XP_001271205.1| ADP-ribosylation factor 6, puta...   226   1e-57   Aspergillus clavatus NRRL 1
gi|449303399|gb|EMC99407.1| hypothetical protein BAUCODRAFT_3172...   226   1e-57   Baudoinia panamericana UAMH 10762
gi|367026273|ref|XP_003662421.1| hypothetical protein MYCTH_2303...   226   1e-57   Myceliophthora thermophila ATCC 42464
gi|452847539|gb|EME49471.1| hypothetical protein DOTSEDRAFT_3070...   226   2e-57   Dothistroma septosporum NZE10
gi|452988220|gb|EME87975.1| hypothetical protein MYCFIDRAFT_2629...   226   2e-57   Cercospora fijiensis CIRAD86
gi|425768456|gb|EKV06978.1| ADP-ribosylation factor 6, putative ...   226   2e-57   Penicillium digitatum Pd1
gi|167518131|ref|XP_001743406.1| hypothetical protein [Monosiga ...   226   2e-57   Monosiga brevicollis MX1
gi|398411346|ref|XP_003857013.1| hypothetical protein MYCGRDRAFT...   225   3e-57   Zymoseptoria tritici IPO323
gi|255942213|ref|XP_002561875.1| Pc18g00280 [Penicillium chrysog...   225   3e-57   Penicillium rubens Wisconsin 54-1255
gi|453089810|gb|EMF17850.1| ADP-ribosylation factor 6 [Mycosphae...   225   3e-57   Sphaerulina musiva SO2202
gi|56756693|gb|AAW26519.1| SJCHGC04671 protein [Schistosoma japo...   225   3e-57   Schistosoma japonicum
gi|340939081|gb|EGS19703.1| putative ADP-ribosylation factor [Ch...   225   3e-57   Chaetomium thermophilum var. thermophilum DSM 1495
gi|70999388|ref|XP_754413.1| ADP-ribosylation factor 6 [Aspergil...   224   6e-57   Aspergillus fumigatus Af293
gi|451847155|gb|EMD60463.1| hypothetical protein COCSADRAFT_2432...   223   1e-56   Bipolaris sorokiniana ND90Pr
gi|336259625|ref|XP_003344613.1| hypothetical protein SMAC_06922...   223   1e-56   Sordaria macrospora k-hell
gi|238486636|ref|XP_002374556.1| ADP-ribosylation factor 6, puta...   223   2e-56   Aspergillus flavus NRRL3357
gi|294947932|ref|XP_002785532.1| ADP ribosylation factor 1, puta...   222   2e-56   Perkinsus marinus ATCC 50983
gi|221482979|gb|EEE21303.1| ADP-ribosylation factor, arf, putati...   222   3e-56   
gi|125546170|gb|EAY92309.1| hypothetical protein OsI_14032 [Oryz...   221   4e-56   Oryza sativa Indica Group [Indian rice]
gi|85084903|ref|XP_957398.1| ADP-ribosylation factor 6 [Neurospo...   221   4e-56   Neurospora crassa OR74A
gi|317134997|gb|ADV03061.1| ADP ribosylation factor 1 [Amphidini...   221   4e-56   Amphidinium carterae
gi|396485413|ref|XP_003842165.1| similar to ADP-ribosylation fac...   221   4e-56   Leptosphaeria maculans JN3
gi|112253200|gb|ABI14189.1| ADP-ribosylation factor [Pfiesteria ...   221   5e-56   Pfiesteria piscicida
gi|413932673|gb|AFW67224.1| hypothetical protein ZEAMMB73_332083...   221   5e-56   Zea mays [maize]
gi|198420010|ref|XP_002129929.1| PREDICTED: ADP-ribosylation fac...   221   5e-56   Ciona intestinalis [sea vase]
gi|29124979|gb|AAO63779.1| ADP-ribosylation factor 1 [Populus tr...   220   8e-56   Populus tremuloides
gi|222636687|gb|EEE66819.1| hypothetical protein OsJ_23579 [Oryz...   220   9e-56   Oryza sativa Japonica Group [Japonica rice]
gi|242056935|ref|XP_002457613.1| hypothetical protein SORBIDRAFT...   220   9e-56   Sorghum bicolor [broomcorn]
gi|242037651|ref|XP_002466220.1| hypothetical protein SORBIDRAFT...   220   9e-56   Sorghum bicolor [broomcorn]
gi|145353078|ref|XP_001420856.1| predicted protein [Ostreococcus...   220   9e-56   Ostreococcus lucimarinus CCE9901
gi|115456151|ref|NP_001051676.1| Os03g0811900 [Oryza sativa Japo...   220   1e-55   
gi|115435820|ref|NP_001042668.1| Os01g0265100 [Oryza sativa Japo...   220   1e-55   
gi|297578415|gb|ADI46685.1| ADP-ribosylation factor [Monascus pu...   220   1e-55   Monascus purpureus
gi|357111133|ref|XP_003557369.1| PREDICTED: ADP-ribosylation fac...   220   1e-55   Brachypodium distachyon [annual false brome]
gi|194693624|gb|ACF80896.1| unknown [Zea mays] >gi|413932674|gb|...   220   1e-55   Zea mays [maize]
gi|115471217|ref|NP_001059207.1| Os07g0223400 [Oryza sativa Japo...   220   1e-55   
gi|112253198|gb|ABI14188.1| ADP-ribosylation factor [Pfiesteria ...   220   1e-55   Pfiesteria piscicida
gi|222636686|gb|EEE66818.1| hypothetical protein OsJ_23578 [Oryz...   220   1e-55   Oryza sativa Japonica Group [Japonica rice]
gi|424513379|emb|CCO66001.1| ADP-ribosylation factor [Bathycoccu...   220   1e-55   Bathycoccus prasinos
gi|195618900|gb|ACG31280.1| ADP-ribosylation factor 1 [Zea mays]      220   1e-55   Zea mays [maize]
gi|357495837|ref|XP_003618207.1| ADP-ribosylation factor [Medica...   220   1e-55   
gi|384245653|gb|EIE19146.1| ADP-ribosylation factor 1 [Coccomyxa...   220   1e-55   Coccomyxa subellipsoidea C-169
gi|357485863|ref|XP_003613219.1| ADP-ribosylation factor [Medica...   220   1e-55   
gi|148909114|gb|ABR17658.1| unknown [Picea sitchensis] >gi|22428...   219   1e-55   Picea sitchensis
gi|393241064|gb|EJD48588.1| ARF/SAR [Auricularia delicata TFB-10...   219   1e-55   Auricularia subglabra TFB-10046 SS5
gi|353441154|gb|AEQ94161.1| ADP-ribosylation factor [Elaeis guin...   219   1e-55   Elaeis guineensis
gi|219957610|gb|ACL67836.1| ADP ribosylation factor [Jatropha cu...   219   1e-55   Jatropha curcas
gi|159465365|ref|XP_001690893.1| small ARF-related GTPase [Chlam...   219   2e-55   Chlamydomonas reinhardtii
gi|460365320|ref|XP_004228551.1| PREDICTED: ADP-ribosylation fac...   219   2e-55   Solanum lycopersicum
gi|297736783|emb|CBI25984.3| unnamed protein product [Vitis vini...   219   2e-55   Vitis vinifera
gi|224101491|ref|XP_002312302.1| predicted protein [Populus tric...   219   2e-55   Populus trichocarpa [western balsam poplar]
gi|357511441|ref|XP_003626009.1| ADP-ribosylation factor-like pr...   219   2e-55   
gi|310006471|gb|ADP00406.1| ADP-ribosylation factor [Actinidia c...   219   2e-55   Actinidia chinensis
gi|402226057|gb|EJU06117.1| ARF/SAR [Dacryopinax sp. DJM-731 SS1]     219   2e-55   Dacryopinax primogenitus
gi|47026845|gb|AAT08648.1| ADP-ribosylation factor [Hyacinthus o...   219   2e-55   Hyacinthus orientalis [common hyacinth]
gi|224108844|ref|XP_002314987.1| predicted protein [Populus tric...   219   2e-55   Populus trichocarpa [western balsam poplar]
gi|6573751|gb|AAF17671.1|AC009398_20 F20B24.7 [Arabidopsis thali...   219   2e-55   Arabidopsis thaliana [mouse-ear cress]
gi|3182915|sp|P91924.3|ARF_DUGJA RecName: Full=ADP-ribosylation ...   219   2e-55   Dugesia japonica
gi|470137765|ref|XP_004304633.1| PREDICTED: ADP-ribosylation fac...   219   2e-55   Fragaria vesca subsp. vesca
gi|217072662|gb|ACJ84691.1| unknown [Medicago truncatula] >gi|38...   219   2e-55   Medicago truncatula
gi|462401623|gb|EMJ07180.1| hypothetical protein PRUPE_ppa012138...   219   2e-55   Prunus persica
gi|30681825|ref|NP_172533.2| ADP-ribosylation factor A1F [Arabid...   219   2e-55   Arabidopsis thaliana [mouse-ear cress]
gi|76160966|gb|ABA40446.1| unknown [Solanum tuberosum]                219   2e-55   Solanum tuberosum [potatoes]
gi|413932675|gb|AFW67226.1| hypothetical protein ZEAMMB73_332083...   219   2e-55   Zea mays [maize]
gi|224122864|ref|XP_002318935.1| predicted protein [Populus tric...   219   2e-55   Populus trichocarpa [western balsam poplar]
gi|4324967|gb|AAD17207.1| ADP-ribosylation factor [Glycine max]       219   2e-55   Glycine max [soybeans]
gi|357495841|ref|XP_003618209.1| ADP-ribosylation factor [Medica...   219   2e-55   Medicago truncatula
gi|58269752|ref|XP_572032.1| ARF small monomeric GTPase [Cryptoc...   219   2e-55   Cryptococcus neoformans var. neoformans JEC21
gi|449446863|ref|XP_004141190.1| PREDICTED: ADP-ribosylation fac...   219   2e-55   
gi|224068638|ref|XP_002302788.1| predicted protein [Populus tric...   219   2e-55   Populus trichocarpa [western balsam poplar]
gi|297849408|ref|XP_002892585.1| ADP-ribosylation factor [Arabid...   219   2e-55   Arabidopsis lyrata subsp. lyrata
gi|219363613|ref|NP_001136508.1| uncharacterized protein LOC1002...   219   2e-55   Zea mays [maize]
gi|168023699|ref|XP_001764375.1| Arf1_5/ArfA-family small GTPase...   219   2e-55   Physcomitrella patens
gi|357111135|ref|XP_003557370.1| PREDICTED: ADP-ribosylation fac...   219   2e-55   Brachypodium distachyon [annual false brome]
gi|222820383|gb|ACM67554.1| ADP-ribosylation factor-like protein...   219   2e-55   Musa acuminata AAA Group [Cavendish banana]
gi|255633096|gb|ACU16903.1| unknown [Glycine max]                     219   2e-55   Glycine max [soybeans]
gi|297807485|ref|XP_002871626.1| ADP-ribosylation factor A1B [Ar...   219   2e-55   Arabidopsis lyrata subsp. lyrata
gi|168024354|ref|XP_001764701.1| Arf1_5/ArfA-family small GTPase...   219   2e-55   Physcomitrella patens
gi|351734536|ref|NP_001236384.1| uncharacterized protein LOC1003...   219   2e-55   Glycine max [soybeans]
gi|15223164|ref|NP_177206.1| ARF GTPase family protein [Arabidop...   219   2e-55   Arabidopsis thaliana [mouse-ear cress]
gi|326510419|dbj|BAJ87426.1| predicted protein [Hordeum vulgare ...   219   2e-55   Hordeum vulgare subsp. vulgare [barley]
gi|168047377|ref|XP_001776147.1| Arf1_5/ArfA-family small GTPase...   219   2e-55   Physcomitrella patens
gi|340924278|gb|EGS19181.1| hypothetical protein CTHT_0058060 [C...   219   2e-55   Chaetomium thermophilum var. thermophilum DSM 1495
gi|462401436|gb|EMJ06993.1| hypothetical protein PRUPE_ppa010615...   219   2e-55   Prunus persica
gi|303272103|ref|XP_003055413.1| predicted protein [Micromonas p...   219   3e-55   Micromonas pusilla CCMP1545
gi|7643794|gb|AAF65512.1| ADP-ribosylation factor [Capsicum annu...   219   3e-55   Capsicum annuum
gi|17154685|emb|CAD12855.1| ADP-ribosylation factor [Gossypium h...   219   3e-55   Gossypium hirsutum [American cotton]
gi|460385926|ref|XP_004238651.1| PREDICTED: ADP-ribosylation fac...   219   3e-55   
gi|326529143|dbj|BAK00965.1| predicted protein [Hordeum vulgare ...   219   3e-55   Hordeum vulgare subsp. vulgare [barley]
gi|15228723|ref|NP_191788.1| ADP-ribosylation factor A1E [Arabid...   219   3e-55   Arabidopsis thaliana [mouse-ear cress]
gi|255625573|gb|ACU13131.1| unknown [Glycine max]                     219   3e-55   Glycine max [soybeans]
gi|475592749|gb|EMT22177.1| ADP-ribosylation factor [Aegilops ta...   219   3e-55   Aegilops tauschii
gi|15226521|ref|NP_182239.1| ADP-ribosylation factor 1 [Arabidop...   219   3e-55   Arabidopsis thaliana [mouse-ear cress]
gi|460383064|ref|XP_004237252.1| PREDICTED: ADP-ribosylation fac...   219   3e-55   
gi|15241463|ref|NP_196971.1| ADP-ribosylation factor A1B [Arabid...   219   3e-55   Arabidopsis thaliana [mouse-ear cress]
gi|148908804|gb|ABR17508.1| unknown [Picea sitchensis] >gi|14890...   219   3e-55   Picea sitchensis
gi|297841801|ref|XP_002888782.1| hypothetical protein ARALYDRAFT...   219   3e-55   Arabidopsis lyrata subsp. lyrata
gi|469647093|gb|AGH68504.1| ADP-ribosylation factor, partial [Ip...   219   3e-55   Ipomoea batatas [batate]
gi|125525297|gb|EAY73411.1| hypothetical protein OsI_01294 [Oryz...   219   3e-55   Oryza sativa Indica Group [Indian rice]
gi|297841175|ref|XP_002888469.1| ADP-ribosylation factor [Arabid...   218   3e-55   Arabidopsis lyrata subsp. lyrata
gi|406607180|emb|CCH41441.1| ADP-ribosylation factor 1 [Wickerha...   218   3e-55   Wickerhamomyces ciferrii
gi|320089750|pdb|3AQ4|A Chain A, Molecular Insights Into Plant C...   218   3e-55   Arabidopsis thaliana [mouse-ear cress]
gi|449489463|ref|XP_004158320.1| PREDICTED: ADP-ribosylation fac...   218   3e-55   
gi|297817572|ref|XP_002876669.1| ADP-ribosylation factor [Arabid...   218   3e-55   Arabidopsis lyrata subsp. lyrata
gi|357495839|ref|XP_003618208.1| ADP-ribosylation factor [Medica...   218   3e-55   
gi|4056469|gb|AAC98042.1| Strong similarity to gb|M95166 ADP-rib...   218   3e-55   Arabidopsis thaliana [mouse-ear cress]
gi|482557461|gb|EOA21653.1| hypothetical protein CARUB_v10002073...   218   3e-55   Capsella rubella
gi|11131026|sp|O48920.3|ARF_VIGUN RecName: Full=ADP-ribosylation...   218   3e-55   Vigna unguiculata
gi|502112805|ref|XP_004494449.1| PREDICTED: ADP-ribosylation fac...   218   3e-55   Cicer arietinum [garbanzo]
gi|357442151|ref|XP_003591353.1| ADP ribosylation factor [Medica...   218   3e-55   
gi|449434939|ref|XP_004135253.1| PREDICTED: ADP-ribosylation fac...   218   3e-55   
gi|168047307|ref|XP_001776112.1| Arf1_5/ArfA-family small GTPase...   218   3e-55   Physcomitrella patens
gi|482564847|gb|EOA29037.1| hypothetical protein CARUB_v10025292...   218   3e-55   Capsella rubella
gi|367052461|ref|XP_003656609.1| hypothetical protein THITE_2171...   218   3e-55   Thielavia terrestris NRRL 8126
gi|302757603|ref|XP_002962225.1| ARF family GTPase [Selaginella ...   218   3e-55   Selaginella moellendorffii
gi|462411203|gb|EMJ16252.1| hypothetical protein PRUPE_ppa012153...   218   3e-55   Prunus persica
gi|388502586|gb|AFK39359.1| unknown [Medicago truncatula]             218   3e-55   Medicago truncatula
gi|187936039|gb|ACD37536.1| putative ADP-ribosylation factor [Br...   218   3e-55   
gi|356534998|ref|XP_003536036.1| PREDICTED: ADP-ribosylation fac...   218   3e-55   
gi|428174761|gb|EKX43655.1| hypothetical protein GUITHDRAFT_9533...   218   3e-55   
gi|76160984|gb|ABA40455.1| ARF-like small GTPase-like protein [S...   218   3e-55   
gi|171695462|ref|XP_001912655.1| hypothetical protein [Podospora...   218   3e-55   
gi|296788279|gb|ADH44695.1| ADP-ribosylation factor [Salvia milt...   218   4e-55   
gi|460370932|ref|XP_004231302.1| PREDICTED: uncharacterized prot...   218   4e-55   
gi|52548250|gb|AAU82112.1| ADP-ribosylation factor [Triticum aes...   218   4e-55   
gi|374256009|gb|AEZ00866.1| putative ADP-ribosylation factor pro...   218   4e-55   
gi|297744026|emb|CBI36996.3| unnamed protein product [Vitis vini...   218   4e-55   
gi|294949510|ref|XP_002786233.1| ADP ribosylation factor 1, puta...   218   4e-55   
gi|296089819|emb|CBI39638.3| unnamed protein product [Vitis vini...   218   4e-55   
gi|168024352|ref|XP_001764700.1| predicted protein [Physcomitrel...   218   4e-55   
gi|359488689|ref|XP_002277054.2| PREDICTED: ADP-ribosylation fac...   218   4e-55   
gi|255071175|ref|XP_002507669.1| predicted protein [Micromonas s...   218   4e-55   
gi|301103608|ref|XP_002900890.1| ADP-ribosylation factor family ...   218   4e-55   
gi|371574835|gb|AEX49947.1| ADP-ribosylation factor 1 [Haloxylon...   218   4e-55   
gi|116182034|ref|XP_001220866.1| ADP-ribosylation factor [Chaeto...   218   4e-55   
gi|114329244|gb|ABI64151.1| ADP-ribosylation factor [Arachis dio...   218   5e-55   
gi|165973134|gb|ABY76246.1| ADP-ribosylation factor [Brassica na...   218   5e-55   
gi|1703376|sp|P51824.2|ARF1_SOLTU RecName: Full=ADP-ribosylation...   218   5e-55   
gi|482574351|gb|EOA38538.1| hypothetical protein CARUB_v10010344...   218   5e-55   
gi|384501122|gb|EIE91613.1| ADP-ribosylation factor 6 [Rhizopus ...   218   5e-55   
gi|291190528|ref|NP_001167030.1| ADP-ribosylation factor 1 like ...   218   5e-55   
gi|85117380|ref|XP_965243.1| ADP-ribosylation factor 1 [Neurospo...   218   5e-55   
gi|224084398|ref|XP_002307284.1| predicted protein [Populus tric...   218   5e-55   
gi|301103610|ref|XP_002900891.1| ADP-ribosylation factor family ...   218   5e-55   
gi|162458318|ref|NP_001105897.1| ADP-ribosylation factor [Zea ma...   218   5e-55   
gi|428174627|gb|EKX43522.1| hypothetical protein GUITHDRAFT_1638...   218   5e-55   
gi|348522342|ref|XP_003448684.1| PREDICTED: ADP-ribosylation fac...   218   5e-55   
gi|367039315|ref|XP_003650038.1| hypothetical protein THITE_2153...   218   5e-55   
gi|413946966|gb|AFW79615.1| hypothetical protein ZEAMMB73_444016...   218   6e-55   
gi|388508800|gb|AFK42466.1| unknown [Lotus japonicus]                 218   6e-55   
gi|410895261|ref|XP_003961118.1| PREDICTED: ADP-ribosylation fac...   218   6e-55   
gi|298704815|emb|CBJ48963.1| Arf1, ARF family GTPase [Ectocarpus...   218   6e-55   
gi|485608849|gb|EOD07999.1| ADP-ribosylation factor [Emiliania h...   217   6e-55   
gi|302783252|ref|XP_002973399.1| ARF family GTPase [Selaginella ...   217   7e-55   
gi|475575700|gb|EMT17349.1| ADP-ribosylation factor 2 [Aegilops ...   217   7e-55   
gi|77999251|gb|ABB16972.1| ADP-ribosylation factor 1-like protei...   217   7e-55   
gi|157093559|gb|ABV22434.1| ADP-ribosylation factor 1 [Oxyrrhis ...   217   7e-55   
gi|68465627|ref|XP_723175.1| potential ADP-ribosylation factor [...   217   7e-55   
gi|296816461|ref|XP_002848567.1| ADP-ribosylation factor [Arthro...   217   7e-55   
gi|126140196|ref|XP_001386620.1| hypothetical protein PICST_7995...   217   7e-55   
gi|460415182|ref|XP_004252939.1| PREDICTED: ADP-ribosylation fac...   217   7e-55   
gi|115440639|ref|NP_001044599.1| Os01g0813400 [Oryza sativa Japo...   217   7e-55   
gi|470103896|ref|XP_004288363.1| PREDICTED: ADP-ribosylation fac...   217   7e-55   
gi|357161160|ref|XP_003578999.1| PREDICTED: ADP-ribosylation fac...   217   7e-55   
gi|296087648|emb|CBI34904.3| unnamed protein product [Vitis vini...   217   7e-55   
gi|293337233|ref|NP_001168955.1| uncharacterized protein LOC1003...   217   7e-55   
gi|225425567|ref|XP_002265983.1| PREDICTED: ADP-ribosylation fac...   217   7e-55   
gi|115464585|ref|NP_001055892.1| Os05g0489600 [Oryza sativa Japo...   217   7e-55   
gi|260948406|ref|XP_002618500.1| ADP-ribosylation factor 1 [Clav...   217   8e-55   
gi|293335521|ref|NP_001170436.1| uncharacterized protein LOC1003...   217   8e-55   
gi|170588901|ref|XP_001899212.1| ADP-ribosylation factor 4 [Brug...   217   8e-55   
gi|225560088|gb|EEH08370.1| ADP-ribosylation factor [Ajellomyces...   217   8e-55   
gi|344301104|gb|EGW31416.1| hypothetical protein SPAPADRAFT_6198...   217   8e-55   
gi|407927987|gb|EKG20865.1| Ras small GTPase Rab type [Macrophom...   217   8e-55   
gi|326475818|gb|EGD99827.1| ADP-ribosylation factor [Trichophyto...   217   8e-55   
gi|508699647|gb|EOX91543.1| ADP-ribosylation factor A1F isoform ...   217   9e-55   
gi|1703375|sp|P51822.2|ARF1_DAUCA RecName: Full=ADP-ribosylation...   217   9e-55   
gi|226532652|ref|NP_001149117.1| ADP-ribosylation factor [Zea ma...   217   9e-55   
gi|115501471|dbj|BAF34209.1| ADP ribosylation factor [Nicotiana ...   217   9e-55   
gi|448522757|ref|XP_003868774.1| Arf2 ADP-ribosylation factor [C...   217   9e-55   
gi|312069676|ref|XP_003137793.1| Arf5 protein [Loa loa] >gi|3077...   217   9e-55   
gi|70995568|ref|XP_752539.1| ADP-ribosylation factor [Aspergillu...   217   9e-55   
gi|1703374|sp|P51821.2|ARF1_CHLRE RecName: Full=ADP-ribosylation...   217   9e-55   
gi|372477769|gb|AEX97079.1| ADP-ribosylation factor [Malus domes...   217   1e-54   
gi|320590023|gb|EFX02468.1| ADP-ribosylation factor [Grosmannia ...   217   1e-54   
gi|167534539|ref|XP_001748945.1| hypothetical protein [Monosiga ...   217   1e-54   
gi|413946970|gb|AFW79619.1| hypothetical protein ZEAMMB73_444016...   217   1e-54   
gi|413945808|gb|AFW78457.1| hypothetical protein ZEAMMB73_418055...   217   1e-54   
gi|256070423|ref|XP_002571542.1| ADP-ribosylation factor family ...   217   1e-54   
gi|121701675|ref|XP_001269102.1| ADP-ribosylation factor, putati...   216   1e-54   
gi|351721791|ref|NP_001238245.1| uncharacterized protein LOC1003...   216   1e-54   
gi|126139103|ref|XP_001386074.1| hypothetical protein PICST_6297...   216   1e-54   
gi|169781474|ref|XP_001825200.1| ADP-ribosylation factor [Asperg...   216   1e-54   
gi|448116680|ref|XP_004203082.1| Piso0_000680 [Millerozyma farin...   216   1e-54   
gi|315050045|ref|XP_003174397.1| ADP-ribosylation factor [Arthro...   216   1e-54   
gi|474369193|gb|EMS63688.1| ADP-ribosylation factor 2 [Triticum ...   216   1e-54   
gi|413945813|gb|AFW78462.1| hypothetical protein ZEAMMB73_418055...   216   1e-54   
gi|89475524|gb|ABD73294.1| ADP-ribosylation factor-like protein ...   216   1e-54   
gi|255965596|gb|ACU45101.1| ADP ribosylation factor 1 [Pfiesteri...   216   1e-54   
gi|29028256|gb|AAO62347.1| ARF1-like GTP-binding protein [Gossyp...   216   1e-54   
gi|297739060|emb|CBI28549.3| unnamed protein product [Vitis vini...   216   1e-54   
gi|378729038|gb|EHY55497.1| ADP-ribosylation factor [Exophiala d...   216   1e-54   
gi|485917198|gb|EOD44242.1| putative adp-ribosylation factor 6 p...   216   1e-54   
gi|149391403|gb|ABR25719.1| ADP-ribosylation factor 1 [Oryza sat...   216   1e-54   
gi|327293980|ref|XP_003231686.1| ADP-ribosylation factor [Tricho...   216   1e-54   
gi|20161472|dbj|BAB90396.1| ADP-ribosylation factor [Oryza sativ...   216   1e-54   
gi|345561937|gb|EGX45009.1| hypothetical protein AOL_s00173g110 ...   216   1e-54   
gi|291242133|ref|XP_002740962.1| PREDICTED: ADP ribosylation fac...   216   2e-54   
gi|209155400|gb|ACI33932.1| ADP-ribosylation factor 1 [Salmo sal...   216   2e-54   
gi|119184364|ref|XP_001243102.1| ADP-ribosylation factor [Coccid...   216   2e-54   
gi|47026876|gb|AAT08663.1| ADP-ribosylation factor [Hyacinthus o...   216   2e-54   
gi|303320341|ref|XP_003070170.1| ADP-ribosylation factor family ...   216   2e-54   
gi|390601498|gb|EIN10892.1| ARF/SAR [Punctularia strigosozonata ...   216   2e-54   
gi|258568860|ref|XP_002585174.1| ADP-ribosylation factor [Uncino...   216   2e-54   
gi|261203473|ref|XP_002628950.1| conserved hypothetical protein ...   216   2e-54   
gi|255560878|ref|XP_002521452.1| ADP-ribosylation factor, arf, p...   216   2e-54   
gi|451848414|gb|EMD61720.1| hypothetical protein COCSADRAFT_9683...   216   2e-54   
gi|398410846|ref|XP_003856771.1| hypothetical protein MYCGRDRAFT...   216   2e-54   
gi|255567885|ref|XP_002524920.1| ADP-ribosylation factor, arf, p...   216   2e-54   
gi|295659691|ref|XP_002790403.1| ADP-ribosylation factor [Paraco...   216   2e-54   
gi|225679576|gb|EEH17860.1| ADP-ribosylation factor [Paracoccidi...   216   2e-54   
gi|222820381|gb|ACM67553.1| ADP-ribosylation factor-like protein...   216   2e-54   
gi|328854209|gb|EGG03343.1| hypothetical protein MELLADRAFT_1173...   216   2e-54   
gi|169607641|ref|XP_001797240.1| hypothetical protein SNOG_06879...   216   2e-54   
gi|452847618|gb|EME49550.1| hypothetical protein DOTSEDRAFT_1436...   216   2e-54   
gi|389631761|ref|XP_003713533.1| ADP-ribosylation factor [Magnap...   216   2e-54   
gi|148298726|ref|NP_001091755.1| ADP-ribosylation factor [Bombyx...   216   2e-54   
gi|310790948|gb|EFQ26481.1| ADP-ribosylation factor family prote...   216   2e-54   
gi|37932258|gb|AAP69821.1| ARF [Oryza sativa Japonica Group]          216   2e-54   
gi|401884521|gb|EJT48679.1| ARF small monomeric GTPase [Trichosp...   216   2e-54   
gi|46108264|ref|XP_381190.1| ARF_AJECA ADP-RIBOSYLATION FACTOR [...   216   2e-54   
gi|472585355|gb|EMS22909.1| ADP-ribosylation factor [Rhodosporid...   216   2e-54   
gi|398359541|gb|AFO83996.1| ADP-ribosylation factor, partial [An...   216   2e-54   
gi|291406307|ref|XP_002719499.1| PREDICTED: ADP-ribosylation fac...   216   2e-54   
gi|473964672|gb|EMS51203.1| ADP-ribosylation factor 2 [Triticum ...   216   2e-54   
gi|500259241|gb|EOO02071.1| putative adp-ribosylation factor pro...   216   2e-54   
gi|384495954|gb|EIE86445.1| ADP-ribosylation factor [Rhizopus de...   216   2e-54   
gi|147810961|emb|CAN59803.1| hypothetical protein VITISV_038875 ...   216   2e-54   
gi|296420495|ref|XP_002839805.1| hypothetical protein [Tuber mel...   215   2e-54   
gi|357482765|ref|XP_003611669.1| ADP-ribosylation factor [Medica...   215   2e-54   
gi|471574515|gb|EMR72354.1| putative adp-ribosylation factor pro...   215   2e-54   
gi|367018718|ref|XP_003658644.1| hypothetical protein MYCTH_2313...   215   2e-54   
gi|146417366|ref|XP_001484652.1| ADP-ribosylation factor 1 [Meye...   215   2e-54   
gi|440631828|gb|ELR01747.1| ADP-ribosylation factor [Geomyces de...   215   3e-54   
gi|115491645|ref|XP_001210450.1| ADP-ribosylation factor [Asperg...   215   3e-54   
gi|170091656|ref|XP_001877050.1| predicted protein [Laccaria bic...   215   3e-54   
gi|241709503|ref|XP_002413376.1| ADP-ribosylation factor [Ixodes...   215   3e-54   
gi|67517899|ref|XP_658730.1| ARF_AJECA ADP-RIBOSYLATION FACTOR [...   215   3e-54   
gi|260951115|ref|XP_002619854.1| ADP-ribosylation factor 1 [Clav...   215   3e-54   
gi|145239679|ref|XP_001392486.1| ADP-ribosylation factor [Asperg...   215   3e-54   
gi|403418875|emb|CCM05575.1| predicted protein [Fibroporia radic...   215   3e-54   
gi|147903248|ref|NP_001086694.1| ADP-ribosylation factor 3 [Xeno...   215   3e-54   
gi|470103130|ref|XP_004287997.1| PREDICTED: ADP-ribosylation fac...   215   3e-54   
gi|302694113|ref|XP_003036735.1| ADP-ribosylation facter [Schizo...   215   3e-54   
gi|511005568|gb|EPB86904.1| ADP-ribosylation factor [Mucor circi...   215   3e-54   
gi|30585213|gb|AAP36879.1| Homo sapiens ADP-ribosylation factor ...   215   3e-54   
gi|268571801|ref|XP_002641152.1| C. briggsae CBR-ARF-1.2 protein...   215   3e-54   
gi|425767237|gb|EKV05811.1| hypothetical protein PDIG_80080 [Pen...   215   3e-54   
gi|4502203|ref|NP_001650.1| ADP-ribosylation factor 3 [Homo sapi...   215   3e-54   
gi|17551730|ref|NP_498235.1| Protein ARF-1.2 [Caenorhabditis ele...   215   3e-54   
gi|284433800|gb|ADB85106.1| ADP ribosylation factor 002 [Jatroph...   215   3e-54   
gi|169860757|ref|XP_001837013.1| ADP-ribosylation factor Arf1 [C...   215   3e-54   
gi|41393165|ref|NP_958912.1| ADP-ribosylation factor 2 [Danio re...   215   3e-54   
gi|262400973|gb|ACY66389.1| ADP ribosylation factor [Scylla para...   215   3e-54   
gi|89258459|gb|ABD65453.1| Arf1 [Suberites domuncula]                 215   3e-54   
gi|512198361|gb|EPE27196.1| P-loop containing nucleoside triphos...   215   3e-54   
gi|511003226|gb|EPB84634.1| ADP-ribosylation factor 1 [Mucor cir...   215   3e-54   
gi|406862816|gb|EKD15865.1| ADP-ribosylation factor 1 [Marssonin...   215   3e-54   
gi|190692109|gb|ACE87829.1| ADP-ribosylation factor 3 protein [s...   215   3e-54   
gi|325303338|tpg|DAA34070.1| TPA_exp: ADP ribosylation factor 79...   215   3e-54   
gi|326436043|gb|EGD81613.1| ADP-ribosylation factor 5 [Salpingoe...   215   3e-54   
gi|403332758|gb|EJY65422.1| ADP-ribosylation factor, arf, putati...   215   3e-54   
gi|213406485|ref|XP_002174014.1| ADP-ribosylation factor, Arf fa...   215   3e-54   
gi|42794005|gb|AAH66632.1| ADP-ribosylation factor 2 [Danio rerio]    215   3e-54   
gi|317134949|gb|ADV03037.1| ADP ribosylation factor [Karlodinium...   215   3e-54   
gi|154318287|ref|XP_001558462.1| ADP-ribosylation factor [Botryo...   215   4e-54   
gi|146421540|ref|XP_001486715.1| ADP-ribosylation factor [Meyero...   215   4e-54   
gi|384487571|gb|EIE79751.1| ADP-ribosylation factor [Rhizopus de...   215   4e-54   
gi|340369230|ref|XP_003383151.1| PREDICTED: ADP-ribosylation fac...   215   4e-54   
gi|168047375|ref|XP_001776146.1| predicted protein [Physcomitrel...   215   4e-54   
gi|513027248|ref|XP_004874773.1| PREDICTED: ADP-ribosylation fac...   215   4e-54   
gi|170596696|ref|XP_001902862.1| ADP-ribosylation factor 1 [Brug...   215   4e-54   
gi|322708710|gb|EFZ00287.1| ADP-ribosylation factor 1 [Metarhizi...   215   4e-54   
gi|255936981|ref|XP_002559517.1| Pc13g10970 [Penicillium chrysog...   215   4e-54   
gi|51010973|ref|NP_001003441.1| ADP-ribosylation factor 3 [Danio...   215   4e-54   
gi|1065361|pdb|1HUR|A Chain A, Human Adp-Ribosylation Factor 1 C...   215   4e-54   
gi|147899450|ref|NP_001080474.1| ADP-ribosylation factor 1 [Xeno...   215   4e-54   
gi|4502201|ref|NP_001649.1| ADP-ribosylation factor 1 [Homo sapi...   215   4e-54   
gi|50054431|ref|NP_001001905.1| ADP-ribosylation factor 1 [Xenop...   215   4e-54   
gi|74207616|dbj|BAE40054.1| unnamed protein product [Mus musculus]    215   4e-54   
gi|302833537|ref|XP_002948332.1| small Arf-related GTPase [Volvo...   215   4e-54   
gi|213514506|ref|NP_001133306.1| ADP-ribosylation factor 3 [Salm...   214   4e-54   
gi|402581780|gb|EJW75727.1| ADP-ribosylation factor 1 [Wuchereri...   214   4e-54   
gi|294949512|ref|XP_002786234.1| ADP ribosylation factor 1, puta...   214   4e-54   
gi|17136866|ref|NP_476955.1| ADP ribosylation factor 79F, isofor...   214   4e-54   
gi|66549728|ref|XP_392990.2| PREDICTED: ADP-ribosylation factor ...   214   4e-54   
gi|392568296|gb|EIW61470.1| ARF/SAR [Trametes versicolor FP-1016...   214   4e-54   
gi|501293324|dbj|BAN20585.1| ADP-ribosylation factor, arf [Ripto...   214   4e-54   
gi|383853152|ref|XP_003702087.1| PREDICTED: ADP-ribosylation fac...   214   4e-54   
gi|432114501|gb|ELK36349.1| ADP-ribosylation factor 3 [Myotis da...   214   4e-54   
gi|55824592|gb|AAV66416.1| ADP-ribosylation factor 1 [Macaca fas...   214   4e-54   
gi|292807619|gb|ADE42873.1| ADP-ribosylation factor 1 [Marsupena...   214   4e-54   
gi|351722214|ref|NP_001237492.1| uncharacterized protein LOC1004...   214   4e-54   
gi|45360689|ref|NP_989018.1| ADP-ribosylation factor 5 [Xenopus ...   214   5e-54   
gi|323453500|gb|EGB09371.1| ADP-ribosylation factor [Aureococcus...   214   5e-54   
gi|224122860|ref|XP_002318934.1| predicted protein [Populus tric...   214   5e-54   
gi|41393117|ref|NP_958888.1| ADP-ribosylation factor 1 like [Dan...   214   5e-54   
gi|40889633|pdb|1RE0|A Chain A, Structure Of Arf1-Gdp Bound To S...   214   5e-54   
gi|465966974|gb|EMP31237.1| ADP-ribosylation factor 3 [Chelonia ...   214   5e-54   
gi|469664327|gb|AGH70118.1| ADP-ribosylation factor 1 [Placozoa ...   214   5e-54   
gi|114153122|gb|ABI52727.1| ADP ribosylation factor 79F [Argas m...   214   5e-54   
gi|505755889|gb|EOR00083.1| ADP-ribosylation factor [Wallemia ic...   214   5e-54   
gi|344231029|gb|EGV62914.1| ARF/SAR superfamily protein [Candida...   214   5e-54   
gi|358255256|dbj|GAA56974.1| ADP-ribosylation factor 6 [Clonorch...   214   5e-54   
gi|221125830|ref|XP_002162887.1| PREDICTED: ADP-ribosylation fac...   214   5e-54   
gi|74223608|dbj|BAE28685.1| unnamed protein product [Mus musculus]    214   5e-54   
gi|156387456|ref|XP_001634219.1| predicted protein [Nematostella...   214   5e-54   
gi|268552783|ref|XP_002634374.1| C. briggsae CBR-ARF-3 protein [...   214   6e-54   
gi|397510982|ref|XP_003825862.1| PREDICTED: ADP-ribosylation fac...   214   6e-54   
gi|296211546|ref|XP_002752447.1| PREDICTED: ADP-ribosylation fac...   214   6e-54   
gi|425780035|gb|EKV18057.1| hypothetical protein PDIP_28470 [Pen...   214   6e-54   
gi|294914495|ref|XP_002778290.1| ADP ribosylation factor 1, puta...   214   6e-54   
gi|507542347|ref|XP_004655168.1| PREDICTED: ADP-ribosylation fac...   214   6e-54   
gi|6671571|ref|NP_031503.1| ADP-ribosylation factor 2 [Mus muscu...   214   6e-54   
gi|466038003|ref|XP_004275737.1| PREDICTED: ADP-ribosylation fac...   214   6e-54   
gi|17538184|ref|NP_501336.1| Protein ARF-3 [Caenorhabditis elega...   214   6e-54   
gi|312078752|ref|XP_003141875.1| ADP-ribosylation factor 1 [Loa ...   214   6e-54   
gi|57091007|ref|XP_537606.1| PREDICTED: ADP-ribosylation factor ...   214   6e-54   
gi|448121507|ref|XP_004204223.1| Piso0_000052 [Millerozyma farin...   214   6e-54   
gi|512888498|ref|XP_004896721.1| PREDICTED: ADP-ribosylation fac...   214   6e-54   
gi|242247459|ref|NP_001156017.1| ADP-ribosylation factor 3 [Ovis...   214   6e-54   
gi|326428344|gb|EGD73914.1| adp-ribosylation factor [Salpingoeca...   214   7e-54   
gi|223634467|ref|NP_001138692.1| ADP-ribosylation factor 4 [Sus ...   214   7e-54   
gi|126697438|gb|ABO26676.1| ADP-ribosylation factor 2 [Haliotis ...   214   7e-54   
gi|402078100|gb|EJT73449.1| ADP-ribosylation factor [Gaeumannomy...   214   7e-54   
gi|167536423|ref|XP_001749883.1| hypothetical protein [Monosiga ...   214   7e-54   
gi|392575064|gb|EIW68198.1| hypothetical protein TREMEDRAFT_7420...   214   7e-54   
gi|196001831|ref|XP_002110783.1| ADP-ribosylation factor 1 [Tric...   214   7e-54   


>gi|388580069|gb|EIM20387.1| ADP-ribosylation factor 6 [Wallemia sebi CBS 633.66]
          Length = 182

 Score =  282 bits (721), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 130/138 (94%), Positives = 136/138 (98%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFV+DSQ
Sbjct: 36  KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVIDSQ 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+I+ DREMRDCLLLVFANKQDL GAMSPAEVTEKLGLH+M+ERSWYV
Sbjct: 96  DRDRIDEARQELHRILGDREMRDCLLLVFANKQDLPGAMSPAEVTEKLGLHKMRERSWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
           HPSCATTGEGLFEGL+WL
Sbjct: 156 HPSCATTGEGLFEGLSWL 173



>gi|403418375|emb|CCM05075.1| predicted protein [Fibroporia radiculosa]
          Length = 301

 Score =  282 bits (721), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 129/138 (93%), Positives = 136/138 (98%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ
Sbjct: 155 KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 214

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEA+QELH+I+SDREM+DCLLLVFANKQDL GAMSP+EVTEKLGLHRM++RSWYV
Sbjct: 215 DRDRIDEAKQELHRILSDREMKDCLLLVFANKQDLPGAMSPSEVTEKLGLHRMRDRSWYV 274

Query: 121 HPSCATTGEGLFEGLNWL 138
           HPSCATTGEGLFEGL WL
Sbjct: 275 HPSCATTGEGLFEGLQWL 292



>gi|393217530|gb|EJD03019.1| CPS1 protein [Fomitiporia mediterranea MF3/22]
          Length = 183

 Score =  281 bits (720), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 130/138 (94%), Positives = 136/138 (98%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ
Sbjct: 36  KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+DEARQELH+I+SDREM+DCLLLVFANKQDL GAMSPAEVTEKLGLHRM++RSWYV
Sbjct: 96  DRDRVDEARQELHRILSDREMKDCLLLVFANKQDLPGAMSPAEVTEKLGLHRMRDRSWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
           HPSCATTGEGLFEGL WL
Sbjct: 156 HPSCATTGEGLFEGLQWL 173



>gi|505756092|gb|EOR00273.1| ADP-ribosylation factor 6 [Wallemia ichthyophaga EXF-994]
          Length = 182

 Score =  280 bits (717), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 129/138 (93%), Positives = 136/138 (98%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFV+DSQ
Sbjct: 36  KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVIDSQ 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRI+EARQELH+I+ DREMRDCLLLVFANKQDL GAMSPAEVTEKLGLH+M+ERSWYV
Sbjct: 96  DRDRIEEARQELHRILGDREMRDCLLLVFANKQDLPGAMSPAEVTEKLGLHKMRERSWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
           HPSCATTGEGLFEGL+WL
Sbjct: 156 HPSCATTGEGLFEGLSWL 173



>gi|443898286|dbj|GAC75623.1| cystathionine beta-lyases [Pseudozyma antarctica T-34]
          Length = 688

 Score =  280 bits (716), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 128/138 (92%), Positives = 135/138 (97%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSVTTIPTVGFNVETV YKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ
Sbjct: 542 KLKLNQSVTTIPTVGFNVETVQYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 601

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II DREMRDCLLLVFANKQDL GAMSPAEVTEKLGLHRM++RSW+V
Sbjct: 602 DRDRIDEARQELHRIIGDREMRDCLLLVFANKQDLPGAMSPAEVTEKLGLHRMRDRSWFV 661

Query: 121 HPSCATTGEGLFEGLNWL 138
           HPSCAT+GEGL+EGL+WL
Sbjct: 662 HPSCATSGEGLYEGLSWL 679



>gi|302681379|ref|XP_003030371.1| hypothetical protein SCHCODRAFT_77388 [Schizophyllum commune H4-8]
 gi|300104062|gb|EFI95468.1| hypothetical protein SCHCODRAFT_77388 [Schizophyllum commune H4-8]
          Length = 182

 Score =  280 bits (715), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 129/138 (93%), Positives = 136/138 (98%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ
Sbjct: 36  KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+DEA+QELH+I+SDREM+DCLLLVFANKQDL GAMSPAEVTEKLGLHRM++RSWYV
Sbjct: 96  DRDRVDEAKQELHRILSDREMKDCLLLVFANKQDLPGAMSPAEVTEKLGLHRMRDRSWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
           HPSCATTGEGLFEGL WL
Sbjct: 156 HPSCATTGEGLFEGLQWL 173



>gi|169847686|ref|XP_001830552.1| CPS1 protein [Coprinopsis cinerea okayama7#130]
 gi|116508288|gb|EAU91183.1| CPS1 protein [Coprinopsis cinerea okayama7#130]
          Length = 182

 Score =  279 bits (714), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 129/138 (93%), Positives = 136/138 (98%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ
Sbjct: 36  KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR+RIDEA+QELH+I+SDREM+DCLLLVFANKQDL GAMSPAEVTEKLGLHRM++RSWYV
Sbjct: 96  DRERIDEAKQELHRILSDREMKDCLLLVFANKQDLPGAMSPAEVTEKLGLHRMRDRSWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
           HPSCATTGEGLFEGL WL
Sbjct: 156 HPSCATTGEGLFEGLQWL 173



>gi|402224123|gb|EJU04186.1| CPS1 protein [Dacryopinax sp. DJM-731 SS1]
          Length = 182

 Score =  279 bits (713), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 129/138 (93%), Positives = 135/138 (97%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ
Sbjct: 36  KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR+RIDEARQELH+I++DREMRDCLLLVFANKQDL  AMSPAEVTEKLGLHRM++RSWYV
Sbjct: 96  DRERIDEARQELHRILADREMRDCLLLVFANKQDLPSAMSPAEVTEKLGLHRMRDRSWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
           HPSCATTGEGLFEGL WL
Sbjct: 156 HPSCATTGEGLFEGLQWL 173



>gi|392569697|gb|EIW62870.1| ARF/SAR [Trametes versicolor FP-101664 SS1]
          Length = 182

 Score =  278 bits (711), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 128/138 (92%), Positives = 136/138 (98%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ
Sbjct: 36  KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR+RIDEA+QELH+I+SDREM++CLLLVFANKQDL GAMSPAEVTEKLGLHRM++RSWYV
Sbjct: 96  DRERIDEAKQELHRILSDREMKECLLLVFANKQDLPGAMSPAEVTEKLGLHRMRDRSWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
           HPSCATTGEGLFEGL WL
Sbjct: 156 HPSCATTGEGLFEGLQWL 173



>gi|336371732|gb|EGO00072.1| hypothetical protein SERLA73DRAFT_180475 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336384487|gb|EGO25635.1| hypothetical protein SERLADRAFT_466093 [Serpula lacrymans var.
           lacrymans S7.9]
 gi|390602244|gb|EIN11637.1| CPS1 protein [Punctularia strigosozonata HHB-11173 SS5]
 gi|395333135|gb|EJF65513.1| CPS1 protein [Dichomitus squalens LYAD-421 SS1]
          Length = 182

 Score =  278 bits (710), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 128/138 (92%), Positives = 136/138 (98%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ
Sbjct: 36  KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR+RIDEA+QELH+I+SDREM++CLLLVFANKQDL GAMSPAEVTEKLGLHRM++RSWYV
Sbjct: 96  DRERIDEAKQELHRILSDREMKECLLLVFANKQDLPGAMSPAEVTEKLGLHRMRDRSWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
           HPSCATTGEGLFEGL WL
Sbjct: 156 HPSCATTGEGLFEGLQWL 173



>gi|449546742|gb|EMD37711.1| ADP-ribosylation factor 6 [Ceriporiopsis subvermispora B]
          Length = 182

 Score =  278 bits (710), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 128/138 (92%), Positives = 136/138 (98%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ
Sbjct: 36  KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR+RIDEA+QELH+I+SDREM++CLLLVFANKQDL GAMSPAEVTEKLGLHRM++RSWYV
Sbjct: 96  DRERIDEAKQELHRILSDREMKECLLLVFANKQDLPGAMSPAEVTEKLGLHRMRDRSWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
           HPSCATTGEGLFEGL WL
Sbjct: 156 HPSCATTGEGLFEGLQWL 173



>gi|343426461|emb|CBQ69991.1| probable ADP-ribosylation factor 6 [Sporisorium reilianum SRZ2]
          Length = 182

 Score =  278 bits (710), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 128/138 (92%), Positives = 135/138 (97%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSVTTIPTVGFNVETV YKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ
Sbjct: 36  KLKLNQSVTTIPTVGFNVETVQYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II DREMRDCLLLVFANKQDL GAMSPAEVTEKLGLHRM++RSW+V
Sbjct: 96  DRDRIDEARQELHRIIGDREMRDCLLLVFANKQDLPGAMSPAEVTEKLGLHRMRDRSWFV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
           HPSCAT+GEGL+EGL+WL
Sbjct: 156 HPSCATSGEGLYEGLSWL 173



>gi|71022995|ref|XP_761727.1| ADP-ribosylation factor 6 [Ustilago maydis 521]
 gi|46101213|gb|EAK86446.1| ARF6_CHICK ADP-RIBOSYLATION FACTOR 6 [Ustilago maydis 521]
          Length = 182

 Score =  278 bits (710), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 128/138 (92%), Positives = 135/138 (97%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSVTTIPTVGFNVETV YKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ
Sbjct: 36  KLKLNQSVTTIPTVGFNVETVQYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II DREMRDCLLLVFANKQDL GAMSPAEVTEKLGLHRM++RSW+V
Sbjct: 96  DRDRIDEARQELHRIIGDREMRDCLLLVFANKQDLPGAMSPAEVTEKLGLHRMRDRSWFV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
           HPSCAT+GEGL+EGL+WL
Sbjct: 156 HPSCATSGEGLYEGLSWL 173



>gi|388856005|emb|CCF50382.1| probable ADP-ribosylation factor 6 [Ustilago hordei]
          Length = 182

 Score =  278 bits (710), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 128/138 (92%), Positives = 135/138 (97%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSVTTIPTVGFNVETV YKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ
Sbjct: 36  KLKLNQSVTTIPTVGFNVETVQYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II DREMRDCLLLVFANKQDL GAMSPAEVTEKLGLHRM++RSW+V
Sbjct: 96  DRDRIDEARQELHRIIGDREMRDCLLLVFANKQDLPGAMSPAEVTEKLGLHRMRDRSWFV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
           HPSCAT+GEGL+EGL+WL
Sbjct: 156 HPSCATSGEGLYEGLSWL 173



>gi|170092205|ref|XP_001877324.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164647183|gb|EDR11427.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 182

 Score =  278 bits (710), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 128/138 (92%), Positives = 136/138 (98%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ
Sbjct: 36  KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR+RIDEA+QELH+I+SDREM++CLLLVFANKQDL GAMSPAEVTEKLGLHRM++RSWYV
Sbjct: 96  DRERIDEAKQELHRILSDREMKECLLLVFANKQDLPGAMSPAEVTEKLGLHRMRDRSWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
           HPSCATTGEGLFEGL WL
Sbjct: 156 HPSCATTGEGLFEGLQWL 173



>gi|471898997|emb|CCO30537.1| ADP-ribosylation factor 6 [Rhizoctonia solani AG-1 IB]
          Length = 182

 Score =  277 bits (709), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 136/138 (98%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ
Sbjct: 36  KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR+RIDEA+QELH+I++DREM++CLLLVFANKQDL GAMSPAEVTEKLGLHRM++RSWYV
Sbjct: 96  DRERIDEAKQELHRILADREMKECLLLVFANKQDLPGAMSPAEVTEKLGLHRMRDRSWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
           HPSCATTGEGLFEGL WL
Sbjct: 156 HPSCATTGEGLFEGLQWL 173



>gi|392593500|gb|EIW82825.1| ARF SAR [Coniophora puteana RWD-64-598 SS2]
          Length = 182

 Score =  277 bits (708), Expect = 8e-73,   Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 136/138 (98%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ
Sbjct: 36  KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR+R+DEA+QELH+I+SDREM++CLLLVFANKQDL GAMSPAEVTEKLGLHRM++RSWYV
Sbjct: 96  DRERVDEAKQELHRILSDREMKECLLLVFANKQDLPGAMSPAEVTEKLGLHRMRDRSWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
           HPSCATTGEGLFEGL WL
Sbjct: 156 HPSCATTGEGLFEGLQWL 173



>gi|501306275|dbj|GAC95345.1| potential ADP-ribosylation factor [Pseudozyma hubeiensis SY62]
          Length = 182

 Score =  276 bits (706), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 127/138 (92%), Positives = 135/138 (97%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSVTTIPTVGFNVETV YKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ
Sbjct: 36  KLKLNQSVTTIPTVGFNVETVQYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II DREM+DCLLLVFANKQDL GAMSPAEVTEKLGLHRM++RSW+V
Sbjct: 96  DRDRIDEARQELHRIIGDREMKDCLLLVFANKQDLPGAMSPAEVTEKLGLHRMRDRSWFV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
           HPSCAT+GEGL+EGL+WL
Sbjct: 156 HPSCATSGEGLYEGLSWL 173



>gi|389741634|gb|EIM82822.1| CPS1 protein [Stereum hirsutum FP-91666 SS1]
          Length = 182

 Score =  276 bits (706), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 136/138 (98%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ
Sbjct: 36  KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR+R+DEA+QELH+I+SDREM++CLLLVFANKQDL GAMSPAEVTEKLGLHRM++R+WYV
Sbjct: 96  DRERVDEAKQELHRILSDREMKECLLLVFANKQDLPGAMSPAEVTEKLGLHRMRDRAWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
           HPSCATTGEGLFEGL WL
Sbjct: 156 HPSCATTGEGLFEGLQWL 173



>gi|409080546|gb|EKM80906.1| hypothetical protein AGABI1DRAFT_112621 [Agaricus bisporus var.
           burnettii JB137-S8]
 gi|426197467|gb|EKV47394.1| ADP-ribosylation factor 6 [Agaricus bisporus var. bisporus H97]
          Length = 182

 Score =  275 bits (702), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 126/138 (91%), Positives = 135/138 (97%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ
Sbjct: 36  KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR+RIDEA+ ELH+I+SDREM++CLLLVFANKQDL GAMSPAEVTEKLGLH+M++RSWYV
Sbjct: 96  DRERIDEAKHELHRILSDREMKECLLLVFANKQDLPGAMSPAEVTEKLGLHKMRDRSWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
           HPSCATTGEGLFEGL WL
Sbjct: 156 HPSCATTGEGLFEGLQWL 173



>gi|401880776|gb|EJT45088.1| soluble GTPase with a role in regulation of membrane traffic and
           potassium influx, Arl1p [Trichosporon asahii var. asahii
           CBS 2479]
 gi|406697239|gb|EKD00504.1| soluble GTPase with a role in regulation of membrane traffic and
           potassium influx, Arl1p [Trichosporon asahii var. asahii
           CBS 8904]
          Length = 182

 Score =  273 bits (697), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 123/138 (89%), Positives = 134/138 (97%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FV+DS 
Sbjct: 36  KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVIDSA 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEAR EL +I++DREM+DCLL+VFANKQD+QGAMSPAEVTEKLGLH+M++RSWYV
Sbjct: 96  DRDRIDEARLELERILADREMKDCLLMVFANKQDIQGAMSPAEVTEKLGLHKMRDRSWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
           HPSCATTGEGLFEGL WL
Sbjct: 156 HPSCATTGEGLFEGLQWL 173



>gi|392579042|gb|EIW72169.1| hypothetical protein TREMEDRAFT_70641 [Tremella mesenterica DSM
           1558]
          Length = 182

 Score =  271 bits (694), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 123/138 (89%), Positives = 134/138 (97%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FV+DS 
Sbjct: 36  KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVIDSA 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR+RIDEARQEL +I++DREMR+CLL+VFANKQDL GAMSPAEVTEKLGLH+M++RSWYV
Sbjct: 96  DRERIDEARQELERILADREMRECLLMVFANKQDLPGAMSPAEVTEKLGLHKMRDRSWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
           HPSCATTGEGLFEGL WL
Sbjct: 156 HPSCATTGEGLFEGLQWL 173



>gi|58261552|ref|XP_568186.1| put. CPS1 protein [Cryptococcus neoformans var. neoformans JEC21]
 gi|134115389|ref|XP_773656.1| hypothetical protein CNBI0220 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50256283|gb|EAL19009.1| hypothetical protein CNBI0220 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57230268|gb|AAW46669.1| put. CPS1 protein, putative [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 182

 Score =  270 bits (689), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 123/138 (89%), Positives = 133/138 (96%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSVTTIPTVGFNVETVTY+NV+FNVWDVGGQDKIRPLWRHYYTGTQGL+FV+DS 
Sbjct: 36  KLKLNQSVTTIPTVGFNVETVTYRNVRFNVWDVGGQDKIRPLWRHYYTGTQGLIFVIDSG 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEAR EL +I++DREMR+CLL+VFANKQDL GAMSPAEVTEKLGLHRMK+RSWYV
Sbjct: 96  DRDRIDEARLELERILADREMRECLLMVFANKQDLPGAMSPAEVTEKLGLHRMKDRSWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
           HPSCATTGEGLFEGL WL
Sbjct: 156 HPSCATTGEGLFEGLQWL 173



>gi|321254910|ref|XP_003193241.1| soluble GTPase with a role in regulation of membrane traffic and
           potassium influx; Arl1p [Cryptococcus gattii WM276]
 gi|317459711|gb|ADV21454.1| Soluble GTPase with a role in regulation of membrane traffic and
           potassium influx, putative; Arl1p [Cryptococcus gattii
           WM276]
          Length = 182

 Score =  269 bits (688), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 123/138 (89%), Positives = 133/138 (96%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSVTTIPTVGFNVETVTY+NVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FV+DS 
Sbjct: 36  KLKLNQSVTTIPTVGFNVETVTYRNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVIDSG 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEAR EL +I++DREM++CLL+VFANKQDL GAMSPAEVTEKLGLHRMK+RSWYV
Sbjct: 96  DRDRIDEARLELERILADREMKECLLMVFANKQDLPGAMSPAEVTEKLGLHRMKDRSWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
           HPSCATTGEGLFEGL WL
Sbjct: 156 HPSCATTGEGLFEGLQWL 173



>gi|405119446|gb|AFR94218.1| cps1 protein [Cryptococcus neoformans var. grubii H99]
          Length = 182

 Score =  268 bits (686), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 133/138 (96%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSVTTIPTVGFNVETVTY+NV+FNVWDVGGQDKIRPLWRHYYTGTQGL+FV+DS 
Sbjct: 36  KLKLNQSVTTIPTVGFNVETVTYRNVRFNVWDVGGQDKIRPLWRHYYTGTQGLIFVIDSG 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEAR EL +I++DREM++CLL+VFANKQDL GAMSPAEVTEKLGLHRMK+RSWYV
Sbjct: 96  DRDRIDEARLELERILADREMKECLLMVFANKQDLPGAMSPAEVTEKLGLHRMKDRSWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
           HPSCATTGEGLFEGL WL
Sbjct: 156 HPSCATTGEGLFEGLQWL 173



>gi|511000353|gb|EPB81900.1| ADP-ribosylation factor 6 [Mucor circinelloides f. circinelloides
           1006PhL]
          Length = 180

 Score =  267 bits (683), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 123/138 (89%), Positives = 132/138 (95%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSVTTIPTVGFNVE+VTYKNVKFNVWDVGGQDKIR LWRHYYTGTQGL+FV+DSQ
Sbjct: 36  KLKLNQSVTTIPTVGFNVESVTYKNVKFNVWDVGGQDKIRNLWRHYYTGTQGLIFVIDSQ 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+I+SDREM+DCLLLVFANKQDL GAM P EVTEKLGL +MKER WYV
Sbjct: 96  DRDRIDEARQELHRILSDREMKDCLLLVFANKQDLPGAMLPQEVTEKLGLDKMKERPWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
           +PSCATTGEGLF+GLNWL
Sbjct: 156 YPSCATTGEGLFQGLNWL 173



>gi|328861454|gb|EGG10557.1| hypothetical protein MELLADRAFT_42185 [Melampsora larici-populina
           98AG31]
          Length = 186

 Score =  266 bits (681), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 123/138 (89%), Positives = 132/138 (95%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ
Sbjct: 36  KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR+RI+EARQELH+I+SDREM+DCLLLVFANKQDL GAMSP EVTE+LGLHRMK+RSWY 
Sbjct: 96  DRERIEEARQELHRILSDREMKDCLLLVFANKQDLPGAMSPTEVTERLGLHRMKDRSWYC 155

Query: 121 HPSCATTGEGLFEGLNWL 138
           HPS A  G+GLFEGL+WL
Sbjct: 156 HPSNALAGDGLFEGLSWL 173



>gi|331238290|ref|XP_003331800.1| ADP-ribosylation factor [Puccinia graminis f. sp. tritici CRL
           75-36-700-3]
 gi|309310790|gb|EFP87381.1| ADP-ribosylation factor [Puccinia graminis f. sp. tritici CRL
           75-36-700-3]
          Length = 184

 Score =  265 bits (676), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 122/138 (88%), Positives = 132/138 (95%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ
Sbjct: 36  KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR+RI+EARQELH+I+SDREM+DCLLLVFANKQDL GAMSP EVTE+LGLH+MK+RSWY 
Sbjct: 96  DRERIEEARQELHRILSDREMKDCLLLVFANKQDLPGAMSPTEVTERLGLHKMKDRSWYC 155

Query: 121 HPSCATTGEGLFEGLNWL 138
           HPS A  G+GLFEGL+WL
Sbjct: 156 HPSNALAGDGLFEGLSWL 173



>gi|511000722|gb|EPB82240.1| ADP-ribosylation factor 6 [Mucor circinelloides f. circinelloides
           1006PhL]
          Length = 184

 Score =  264 bits (674), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 120/138 (86%), Positives = 132/138 (95%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSVTTIPTVGFNVE+VTYKNVKFNVWDVGGQDKIR LWRHYYTGTQGL+FV+DSQ
Sbjct: 36  KLKLNQSVTTIPTVGFNVESVTYKNVKFNVWDVGGQDKIRNLWRHYYTGTQGLIFVIDSQ 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRI+EA+QELH+IISDREMRDCLLL+FANKQDL GA +P+EVTE LGL +M++R WYV
Sbjct: 96  DRDRIEEAKQELHRIISDREMRDCLLLIFANKQDLPGAFTPSEVTEILGLSKMRDRLWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
           HPSCATTGEGLFEGLNWL
Sbjct: 156 HPSCATTGEGLFEGLNWL 173



>gi|472580341|gb|EMS18151.1| ADP-ribosylation factor 6 [Rhodosporidium toruloides NP11]
          Length = 181

 Score =  261 bits (667), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 123/138 (89%), Positives = 129/138 (93%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ
Sbjct: 36  KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEAR ELHKI++DREM+DCLLLVFANKQDL  AM+P EVTEKLGL RMK+RSWY 
Sbjct: 96  DRDRIDEARTELHKILNDREMKDCLLLVFANKQDLPDAMTPTEVTEKLGLLRMKDRSWYC 155

Query: 121 HPSCATTGEGLFEGLNWL 138
           HPS A  G+GLFEGLNWL
Sbjct: 156 HPSNALNGDGLFEGLNWL 173



>gi|358059944|dbj|GAA94374.1| hypothetical protein E5Q_01025 [Mixia osmundae IAM 14324]
          Length = 183

 Score =  258 bits (659), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 118/138 (85%), Positives = 130/138 (94%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSVTTIPTVGFNVETV+YKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFV+DSQ
Sbjct: 36  KLKLNQSVTTIPTVGFNVETVSYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVIDSQ 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEA+QELH+I++DREM++CLLLVFANKQDL GAMSP EVTE+LGL RM++RSWY 
Sbjct: 96  DRDRIDEAKQELHRILADREMKECLLLVFANKQDLPGAMSPTEVTERLGLQRMRDRSWYC 155

Query: 121 HPSCATTGEGLFEGLNWL 138
           HPS A  G+GLFEGL WL
Sbjct: 156 HPSNALQGDGLFEGLAWL 173



>gi|353234356|emb|CCA66382.1| probable ADP-ribosylation factor 6 [Piriformospora indica DSM
           11827]
          Length = 224

 Score =  256 bits (653), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 124/157 (78%), Positives = 132/157 (84%), Gaps = 19/157 (12%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL+QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHY+TGTQGLV+VVDS 
Sbjct: 58  KLKLDQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYFTGTQGLVYVVDSC 117

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQG-------------------AMSP 101
           DR+RIDEARQELH+I+SDREM  CLLLVFANKQDL G                   AMSP
Sbjct: 118 DRERIDEARQELHRILSDREMATCLLLVFANKQDLPGGLSKHHPYAITELTSTPHLAMSP 177

Query: 102 AEVTEKLGLHRMKERSWYVHPSCATTGEGLFEGLNWL 138
           AEVTEKLGLHRM++R WYVHPSCATTGEGLFEGL WL
Sbjct: 178 AEVTEKLGLHRMRDRLWYVHPSCATTGEGLFEGLQWL 214



>gi|443914935|gb|ELU36610.1| CPS1 protein [Rhizoctonia solani AG-1 IA]
          Length = 218

 Score =  254 bits (650), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 127/174 (72%), Positives = 136/174 (78%), Gaps = 36/174 (20%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYY------------- 47
           KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYY             
Sbjct: 36  KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTNIDYFLSLLG 95

Query: 48  -----TGTQGLVFVVDSQDRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQG----- 97
                TGTQGLVFVVDSQDR+RIDEA+QELH+I++DREM++CLLLVFANKQDL G     
Sbjct: 96  ANPWSTGTQGLVFVVDSQDRERIDEAKQELHRILADREMKECLLLVFANKQDLPGGMLLI 155

Query: 98  -------------AMSPAEVTEKLGLHRMKERSWYVHPSCATTGEGLFEGLNWL 138
                        AMSPAEVTEKLGLHRM++RSWYVHPSCATTGEGLFEGL WL
Sbjct: 156 VDVRLLLITLRRLAMSPAEVTEKLGLHRMRDRSWYVHPSCATTGEGLFEGLQWL 209



>gi|291403824|ref|XP_002718343.1| PREDICTED: mCG3164-like [Oryctolagus cuniculus]
          Length = 507

 Score =  251 bits (642), Expect = 4e-65,   Method: Composition-based stats.
 Identities = 112/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 364 KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 423

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 424 DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 483

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCAT+G+GL+EGL WL
Sbjct: 484 QPSCATSGDGLYEGLTWL 501



>gi|430812660|emb|CCJ29933.1| unnamed protein product [Pneumocystis jirovecii]
          Length = 178

 Score =  250 bits (639), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 126/135 (93%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSVTTIPTVGFNVETV YKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FV+DS 
Sbjct: 36  KLKLNQSVTTIPTVGFNVETVVYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVIDSA 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEAR+ELH+II+DREM+D +LLVFANKQDL  AMSPAEVTEKL L++ K++ WYV
Sbjct: 96  DRDRIDEARKELHRIIADREMKDSILLVFANKQDLSEAMSPAEVTEKLQLYKFKDKMWYV 155

Query: 121 HPSCATTGEGLFEGL 135
           +PSCA TGEGLFEGL
Sbjct: 156 YPSCAKTGEGLFEGL 170



>gi|301773242|ref|XP_002922050.1| PREDICTED: hypothetical protein LOC100473890 [Ailuropoda
           melanoleuca]
          Length = 370

 Score =  250 bits (639), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 227 KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 286

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 287 DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 346

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCAT+G+GL+EGL WL
Sbjct: 347 QPSCATSGDGLYEGLTWL 364



>gi|241620380|ref|XP_002408659.1| GTP-binding ADP-ribosylation factor ARF6, putative [Ixodes
           scapularis]
 gi|215503018|gb|EEC12512.1| GTP-binding ADP-ribosylation factor ARF6, putative [Ixodes
           scapularis]
          Length = 201

 Score =  249 bits (637), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 58  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 117

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELHKII+DREMRD ++LVFANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 118 DRDRIDEARQELHKIINDREMRDAIILVFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 177

Query: 121 HPSCATTGEGLFEGLNWL 138
            P+CATTG+GLFEGL WL
Sbjct: 178 QPACATTGDGLFEGLTWL 195



>gi|345567569|gb|EGX50499.1| hypothetical protein AOL_s00075g228 [Arthrobotrys oligospora ATCC
           24927]
          Length = 185

 Score =  249 bits (637), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQ VTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 36  KLKLNQGVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR+RIDEARQELH+II DREM++ LLLVFANKQDL GAMSP EVTEKL L ++K+R WYV
Sbjct: 96  DRERIDEARQELHRIIQDREMKESLLLVFANKQDLPGAMSPQEVTEKLQLSKLKDRIWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTGEGL EGL WL
Sbjct: 156 VPSCATTGEGLIEGLGWL 173



>gi|321459580|gb|EFX70632.1| hypothetical protein DAPPUDRAFT_309391 [Daphnia pulex]
          Length = 175

 Score =  249 bits (636), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 113/138 (81%), Positives = 127/138 (92%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDLQ AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLQDAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            P+CATTG+GL+EGL WL
Sbjct: 152 QPACATTGDGLYEGLTWL 169



>gi|332375212|gb|AEE62747.1| unknown [Dendroctonus ponderosae]
 gi|478253787|gb|ENN74079.1| hypothetical protein YQE_09052, partial [Dendroctonus ponderosae]
          Length = 175

 Score =  249 bits (636), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 114/138 (82%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL RM++R+WYV
Sbjct: 92  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPEAMKPHEIQEKLGLTRMRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            P+CATTG+GLFEGL WL
Sbjct: 152 QPACATTGDGLFEGLTWL 169



>gi|410898053|ref|XP_003962513.1| PREDICTED: ADP-ribosylation factor 6-like [Takifugu rubripes]
 gi|410932915|ref|XP_003979838.1| PREDICTED: ADP-ribosylation factor 6-like [Takifugu rubripes]
          Length = 175

 Score =  248 bits (634), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 113/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+IISDREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIISDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCAT+G+GL+EGL WL
Sbjct: 152 QPSCATSGDGLYEGLTWL 169



>gi|443731182|gb|ELU16419.1| hypothetical protein CAPTEDRAFT_138728 [Capitella teleta]
          Length = 175

 Score =  248 bits (633), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 113/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTG+GL+EGL WL
Sbjct: 152 QPSCATTGDGLYEGLTWL 169



>gi|297787706|pdb|3LVQ|E Chain E, The Crystal Structure Of Asap3 In Complex With Arf6 In
           Trans State
 gi|297787707|pdb|3LVR|E Chain E, The Crystal Structure Of Asap3 In Complex With Arf6 In
           Trans State Soaked With Calcium
          Length = 497

 Score =  248 bits (633), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 341 KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 400

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 401 DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 460

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCAT+G+GL+EGL WL
Sbjct: 461 QPSCATSGDGLYEGLTWL 478



>gi|483515729|gb|EOB02895.1| ADP-ribosylation factor 6, partial [Anas platyrhynchos]
          Length = 179

 Score =  248 bits (633), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 113/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 36  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 96  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTG+GL+EGL WL
Sbjct: 156 QPSCATTGDGLYEGLTWL 173



>gi|209155786|gb|ACI34125.1| ADP-ribosylation factor 6 [Salmo salar]
          Length = 176

 Score =  248 bits (633), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 113/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 33  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 92

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 93  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 152

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTG+GL+EGL WL
Sbjct: 153 QPSCATTGDGLYEGLTWL 170



>gi|296415710|ref|XP_002837529.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295633401|emb|CAZ81720.1| unnamed protein product [Tuber melanosporum]
          Length = 168

 Score =  248 bits (633), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 113/138 (81%), Positives = 127/138 (92%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLK++Q VTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 19  KLKIDQDVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSH 78

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II DREM++ LLLVFANKQD+ G M P+EVTEKL LH++K+R WYV
Sbjct: 79  DRDRIDEARQELHRIIQDREMKESLLLVFANKQDIPGCMPPSEVTEKLQLHKLKDRVWYV 138

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTGEGLFEGL WL
Sbjct: 139 VPSCATTGEGLFEGLGWL 156



>gi|126165220|ref|NP_001075174.1| ADP-ribosylation factor 6 [Gallus gallus]
 gi|224052005|ref|XP_002200661.1| PREDICTED: ADP-ribosylation factor 6 [Taeniopygia guttata]
 gi|505773898|ref|XP_004601775.1| PREDICTED: ADP-ribosylation factor 6 [Sorex araneus]
 gi|114128|sp|P26990.3|ARF6_CHICK RecName: Full=ADP-ribosylation factor 6
 gi|63335|emb|CAA27317.1| unnamed protein product [Gallus gallus]
 gi|449279781|gb|EMC87257.1| ADP-ribosylation factor 6 [Columba livia]
          Length = 175

 Score =  248 bits (632), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 113/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTG+GL+EGL WL
Sbjct: 152 QPSCATTGDGLYEGLTWL 169



>gi|197128327|gb|ACH44825.1| putative ADP-ribosylation factor 6 variant 3 [Taeniopygia guttata]
          Length = 175

 Score =  248 bits (632), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 113/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTG+GL+EGL WL
Sbjct: 152 QPSCATTGDGLYEGLTWL 169



>gi|322785548|gb|EFZ12210.1| hypothetical protein SINV_14695 [Solenopsis invicta]
          Length = 180

 Score =  248 bits (632), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 113/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 37  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 96

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 97  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 156

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTG+GL+EGL WL
Sbjct: 157 QPSCATTGDGLYEGLTWL 174



>gi|41053393|ref|NP_956287.1| ADP-ribosylation factor 6a [Danio rerio]
 gi|238624190|ref|NP_001154847.1| ADP-ribosylation factor 6-like [Danio rerio]
 gi|348506309|ref|XP_003440702.1| PREDICTED: ADP-ribosylation factor 6-like [Oreochromis niloticus]
 gi|348531194|ref|XP_003453095.1| PREDICTED: ADP-ribosylation factor 6-like [Oreochromis niloticus]
 gi|432937097|ref|XP_004082352.1| PREDICTED: ADP-ribosylation factor 6-like [Oryzias latipes]
 gi|432945375|ref|XP_004083567.1| PREDICTED: ADP-ribosylation factor 6-like isoform 1 [Oryzias
           latipes]
 gi|432945377|ref|XP_004083568.1| PREDICTED: ADP-ribosylation factor 6-like isoform 2 [Oryzias
           latipes]
 gi|498934369|ref|XP_004540674.1| PREDICTED: ADP-ribosylation factor 6-like [Maylandia zebra]
 gi|498941103|ref|XP_004542158.1| PREDICTED: ADP-ribosylation factor 6-like [Maylandia zebra]
 gi|39795818|gb|AAH64293.1| Zgc:77665 [Danio rerio]
 gi|159155551|gb|AAI54501.1| Zgc:77665 protein [Danio rerio]
 gi|225708488|gb|ACO10090.1| ADP-ribosylation factor 6 [Osmerus mordax]
          Length = 175

 Score =  248 bits (632), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 113/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTG+GL+EGL WL
Sbjct: 152 QPSCATTGDGLYEGLTWL 169



>gi|511828105|ref|XP_004738796.1| PREDICTED: ADP-ribosylation factor 6 isoform X2 [Mustela putorius
           furo]
          Length = 179

 Score =  248 bits (632), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 36  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 96  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCAT+G+GL+EGL WL
Sbjct: 156 QPSCATSGDGLYEGLTWL 173



>gi|307192533|gb|EFN75721.1| ADP-ribosylation factor 6 [Harpegnathos saltator]
          Length = 175

 Score =  248 bits (632), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 113/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTG+GL+EGL WL
Sbjct: 152 QPSCATTGDGLYEGLTWL 169



>gi|45361671|ref|NP_989412.1| ADP-ribosylation factor 6 [Xenopus (Silurana) tropicalis]
 gi|40787685|gb|AAH64861.1| ADP-ribosylation factor 6 [Xenopus (Silurana) tropicalis]
          Length = 175

 Score =  247 bits (631), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 113/138 (81%), Positives = 125/138 (90%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLADAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCA TGEGL+EGL WL
Sbjct: 152 QPSCANTGEGLYEGLMWL 169



>gi|340721293|ref|XP_003399058.1| PREDICTED: ADP-ribosylation factor 6-like [Bombus terrestris]
 gi|345498024|ref|XP_003428126.1| PREDICTED: ADP-ribosylation factor 6-like isoform 2 [Nasonia
           vitripennis]
 gi|345498026|ref|XP_001603804.2| PREDICTED: ADP-ribosylation factor 6-like isoform 1 [Nasonia
           vitripennis]
 gi|350406774|ref|XP_003487878.1| PREDICTED: ADP-ribosylation factor 6-like [Bombus impatiens]
 gi|380019019|ref|XP_003693415.1| PREDICTED: ADP-ribosylation factor 6-like [Apis florea]
 gi|383847271|ref|XP_003699278.1| PREDICTED: ADP-ribosylation factor 6-like [Megachile rotundata]
 gi|512922083|ref|XP_004930032.1| PREDICTED: ADP-ribosylation factor 6-like isoform X1 [Bombyx mori]
 gi|512922087|ref|XP_004930033.1| PREDICTED: ADP-ribosylation factor 6-like isoform X2 [Bombyx mori]
 gi|307169171|gb|EFN61987.1| ADP-ribosylation factor 6 [Camponotus floridanus]
 gi|332017829|gb|EGI58489.1| ADP-ribosylation factor 6 [Acromyrmex echinatior]
          Length = 175

 Score =  247 bits (631), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 113/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTG+GL+EGL WL
Sbjct: 152 QPSCATTGDGLYEGLTWL 169



>gi|62531207|gb|AAH93345.1| Zgc:77665 protein, partial [Danio rerio]
          Length = 160

 Score =  247 bits (631), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 113/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 17  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 76

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 77  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 136

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTG+GL+EGL WL
Sbjct: 137 QPSCATTGDGLYEGLTWL 154



>gi|470361996|ref|XP_004365245.1| ADP-ribosylation factor [Capsaspora owczarzaki ATCC 30864]
 gi|320162950|gb|EFW39849.1| ADP-ribosylation factor [Capsaspora owczarzaki ATCC 30864]
          Length = 175

 Score =  247 bits (631), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 127/138 (92%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETV YKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVDS 
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVQYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDSA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+I++DREMRD ++L+FANKQDL  AM P E+TEKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIVNDREMRDAIILIFANKQDLPHAMKPQEITEKLGLQRVRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCAT+G+GL++GL WL
Sbjct: 152 QPSCATSGDGLYDGLTWL 169



>gi|158286685|ref|XP_308867.3| AGAP006890-PB [Anopheles gambiae str. PEST]
 gi|158286687|ref|XP_001688115.1| AGAP006890-PA [Anopheles gambiae str. PEST]
 gi|157020587|gb|EAA03958.3| AGAP006890-PB [Anopheles gambiae str. PEST]
 gi|157020588|gb|EDO64764.1| AGAP006890-PA [Anopheles gambiae str. PEST]
          Length = 175

 Score =  247 bits (631), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 113/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLLEAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTG+GL+EGL WL
Sbjct: 152 QPSCATTGDGLYEGLTWL 169



>gi|470319997|gb|EMR11593.1| hypothetical protein PNEG_00037 [Pneumocystis murina B123]
          Length = 182

 Score =  247 bits (630), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 126/138 (91%), Gaps = 1/138 (0%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQ+VTTIPTVGFNVETV YKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FV+DS 
Sbjct: 36  KLKLNQTVTTIPTVGFNVETVIYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVIDSA 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEAR+ELH+IISDREMRD +LLVFANKQDL+ AMSP EVTEKL L ++    WYV
Sbjct: 96  DRDRIDEARKELHRIISDREMRDSILLVFANKQDLETAMSPGEVTEKLQLDKIYNL-WYV 154

Query: 121 HPSCATTGEGLFEGLNWL 138
           +PSCATTGEGLFEGL WL
Sbjct: 155 YPSCATTGEGLFEGLAWL 172



>gi|170057334|ref|XP_001864438.1| conserved hypothetical protein [Culex quinquefasciatus]
 gi|94469094|gb|ABF18396.1| ADP-ribosylation factor 6 [Aedes aegypti]
 gi|167876760|gb|EDS40143.1| conserved hypothetical protein [Culex quinquefasciatus]
          Length = 175

 Score =  247 bits (630), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 113/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPEAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTG+GL+EGL WL
Sbjct: 152 QPSCATTGDGLYEGLTWL 169



>gi|54696596|gb|AAV38670.1| ADP-ribosylation factor 6 [synthetic construct]
 gi|61366922|gb|AAX42926.1| ADP-ribosylation factor 6 [synthetic construct]
          Length = 176

 Score =  247 bits (630), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCAT+G+GL+EGL WL
Sbjct: 152 QPSCATSGDGLYEGLTWL 169



>gi|326921282|ref|XP_003206890.1| PREDICTED: ADP-ribosylation factor 6-like, partial [Meleagris
           gallopavo]
          Length = 149

 Score =  247 bits (630), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 113/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 6   KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 65

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 66  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 125

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTG+GL+EGL WL
Sbjct: 126 QPSCATTGDGLYEGLTWL 143



>gi|431895868|gb|ELK05286.1| ADP-ribosylation factor 6 [Pteropus alecto]
          Length = 175

 Score =  247 bits (630), Expect = 9e-64,   Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCAT+G+GL+EGL WL
Sbjct: 152 QPSCATSGDGLYEGLTWL 169



>gi|157107947|ref|XP_001650010.1| adp-ribosylation factor, arf [Aedes aegypti]
 gi|108879449|gb|EAT43674.1| AAEL004913-PA [Aedes aegypti]
          Length = 175

 Score =  246 bits (629), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 113/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIINDREMRDSIILIFANKQDLPEAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTG+GL+EGL WL
Sbjct: 152 QPSCATTGDGLYEGLTWL 169



>gi|55741926|ref|NP_001006797.1| ADP-ribosylation factor 6 [Xenopus (Silurana) tropicalis]
 gi|49898938|gb|AAH76664.1| ADP-ribosylation factor 6 [Xenopus (Silurana) tropicalis]
 gi|89269872|emb|CAJ83809.1| ADP-ribosylation factor 6 [Xenopus (Silurana) tropicalis]
          Length = 175

 Score =  246 bits (629), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCAT+G+GL+EGL WL
Sbjct: 152 QPSCATSGDGLYEGLTWL 169



>gi|209153529|gb|ACI33167.1| ADP-ribosylation factor 6 [Salmo salar]
          Length = 175

 Score =  246 bits (629), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCA+TG+GL+EGL WL
Sbjct: 152 QPSCASTGDGLYEGLTWL 169



>gi|4502211|ref|NP_001654.1| ADP-ribosylation factor 6 [Homo sapiens]
 gi|6680724|ref|NP_031507.1| ADP-ribosylation factor 6 [Mus musculus]
 gi|13162345|ref|NP_077066.1| ADP-ribosylation factor 6 [Rattus norvegicus]
 gi|118403828|ref|NP_001072145.1| ADP-ribosylation factor 6 [Sus scrofa]
 gi|242247471|ref|NP_001156020.1| ADP-ribosylation factor 6 [Ovis aries]
 gi|302563827|ref|NP_001180987.1| ADP-ribosylation factor 6 [Macaca mulatta]
 gi|57090551|ref|XP_547801.1| PREDICTED: ADP-ribosylation factor 6 [Canis lupus familiaris]
 gi|114652897|ref|XP_509935.2| PREDICTED: ADP-ribosylation factor 6 isoform 2 [Pan troglodytes]
 gi|126282786|ref|XP_001370639.1| PREDICTED: ADP-ribosylation factor 6-like [Monodelphis domestica]
 gi|149410355|ref|XP_001514159.1| PREDICTED: ADP-ribosylation factor 6-like [Ornithorhynchus
           anatinus]
 gi|297695048|ref|XP_002824767.1| PREDICTED: ADP-ribosylation factor 6 [Pongo abelii]
 gi|332237028|ref|XP_003267702.1| PREDICTED: ADP-ribosylation factor 6 [Nomascus leucogenys]
 gi|344273599|ref|XP_003408608.1| PREDICTED: ADP-ribosylation factor 6-like [Loxodonta africana]
 gi|348572145|ref|XP_003471854.1| PREDICTED: ADP-ribosylation factor 6-like [Cavia porcellus]
 gi|354507208|ref|XP_003515649.1| PREDICTED: ADP-ribosylation factor 6-like [Cricetulus griseus]
 gi|358414132|ref|XP_003582756.1| PREDICTED: ADP-ribosylation factor 6 [Bos taurus]
 gi|359069516|ref|XP_003586610.1| PREDICTED: ADP-ribosylation factor 6 [Bos taurus]
 gi|395504222|ref|XP_003756455.1| PREDICTED: ADP-ribosylation factor 6-like [Sarcophilus harrisii]
 gi|395838616|ref|XP_003792208.1| PREDICTED: ADP-ribosylation factor 6 [Otolemur garnettii]
 gi|397523538|ref|XP_003831786.1| PREDICTED: ADP-ribosylation factor 6 [Pan paniscus]
 gi|402876101|ref|XP_003901818.1| PREDICTED: ADP-ribosylation factor 6 [Papio anubis]
 gi|403277930|ref|XP_003930595.1| PREDICTED: ADP-ribosylation factor 6 [Saimiri boliviensis
           boliviensis]
 gi|410962214|ref|XP_003987669.1| PREDICTED: ADP-ribosylation factor 6 [Felis catus]
 gi|426376844|ref|XP_004055192.1| PREDICTED: ADP-ribosylation factor 6 [Gorilla gorilla gorilla]
 gi|466010237|ref|XP_004270080.1| PREDICTED: ADP-ribosylation factor 6 [Orcinus orca]
 gi|471360655|ref|XP_004370896.1| PREDICTED: ADP-ribosylation factor 6 [Trichechus manatus
           latirostris]
 gi|472377304|ref|XP_004408080.1| PREDICTED: ADP-ribosylation factor 6 [Odobenus rosmarus divergens]
 gi|478524420|ref|XP_004436409.1| PREDICTED: ADP-ribosylation factor 6 [Ceratotherium simum simum]
 gi|488559820|ref|XP_004470013.1| PREDICTED: ADP-ribosylation factor 6 isoform 1 [Dasypus
           novemcinctus]
 gi|488559823|ref|XP_004470014.1| PREDICTED: ADP-ribosylation factor 6 isoform 2 [Dasypus
           novemcinctus]
 gi|504144867|ref|XP_004584858.1| PREDICTED: ADP-ribosylation factor 6 [Ochotona princeps]
 gi|507530266|ref|XP_004649217.1| PREDICTED: ADP-ribosylation factor 6 [Jaculus jaculus]
 gi|507629130|ref|XP_004698631.1| PREDICTED: ADP-ribosylation factor 6 [Echinops telfairi]
 gi|507677032|ref|XP_004638820.1| PREDICTED: ADP-ribosylation factor 6 [Octodon degus]
 gi|507945652|ref|XP_004681946.1| PREDICTED: ADP-ribosylation factor 6 [Condylura cristata]
 gi|511828103|ref|XP_004738795.1| PREDICTED: ADP-ribosylation factor 6 isoform X1 [Mustela putorius
           furo]
 gi|511947818|ref|XP_004792391.1| PREDICTED: ADP-ribosylation factor 6 [Mustela putorius furo]
 gi|512884390|ref|XP_004895975.1| PREDICTED: ADP-ribosylation factor 6 [Heterocephalus glaber]
 gi|512946301|ref|XP_004835639.1| PREDICTED: ADP-ribosylation factor 6 [Heterocephalus glaber]
 gi|51316984|sp|P62330.2|ARF6_HUMAN RecName: Full=ADP-ribosylation factor 6
 gi|59799156|sp|P62331.2|ARF6_MOUSE RecName: Full=ADP-ribosylation factor 6
 gi|60391730|sp|P62332.2|ARF6_RAT RecName: Full=ADP-ribosylation factor 6
 gi|122131485|sp|Q007T5.1|ARF6_PIG RecName: Full=ADP-ribosylation factor 6
 gi|75766046|pdb|2A5D|A Chain A, Structural Basis For The Activation Of Cholera Toxin By
           Human Arf6-Gtp
 gi|75766048|pdb|2A5F|A Chain A, Cholera Toxin A1 Subunit Bound To Its Substrate, Nad+, And
           Its Human Protein Activator, Arf6
 gi|116668428|pdb|2J5X|A Chain A, Structure Of The Small G Protein Arf6 In Complex With
           Gtpgammas
 gi|116668429|pdb|2J5X|B Chain B, Structure Of The Small G Protein Arf6 In Complex With
           Gtpgammas
 gi|20147663|gb|AAM12599.1|AF493885_1 ADP-ribosylation factor protein 6 [Homo sapiens]
 gi|178989|gb|AAA90928.1| ADP-ribosylation factor [Homo sapiens]
 gi|438872|gb|AAA40690.1| ADP-ribosylation factor 6 [Rattus norvegicus]
 gi|1565217|dbj|BAA13495.1| ARF6 [Mus musculus]
 gi|2911480|gb|AAC39877.1| ADP-ribosylation factor [Homo sapiens]
 gi|13097492|gb|AAH03478.1| ADP-ribosylation factor 6 [Mus musculus]
 gi|14286244|gb|AAH08918.1| ARF6 protein [Homo sapiens]
 gi|31559126|gb|AAP50257.1| ADP-ribosylation factor 6 [Homo sapiens]
 gi|49456883|emb|CAG46762.1| ARF6 [Homo sapiens]
 gi|53237068|gb|AAH83112.1| ADP-ribosylation factor 6 [Mus musculus]
 gi|60552411|gb|AAH91146.1| ADP-ribosylation factor 6 [Rattus norvegicus]
 gi|74147432|dbj|BAE33917.1| unnamed protein product [Mus musculus]
 gi|115522017|gb|ABJ09398.1| ADP-ribosylation factor 6 [Sus scrofa]
 gi|119586144|gb|EAW65740.1| ADP-ribosylation factor 6 [Homo sapiens]
 gi|149051347|gb|EDM03520.1| rCG61996 [Rattus norvegicus]
 gi|189054020|dbj|BAG36527.1| unnamed protein product [Homo sapiens]
 gi|206584548|gb|ACI15389.1| ADP-ribosylation factor 6 [Sus scrofa]
 gi|208965800|dbj|BAG72914.1| ADP-ribosylation factor 6 [synthetic construct]
 gi|238799788|gb|ACR55766.1| ADP-ribosylation factor 6 [Ovis aries]
 gi|281343422|gb|EFB19006.1| hypothetical protein PANDA_010973 [Ailuropoda melanoleuca]
 gi|296483239|tpg|DAA25354.1| TPA: mCG3164-like [Bos taurus]
 gi|344258502|gb|EGW14606.1| ADP-ribosylation factor 6 [Cricetulus griseus]
 gi|351707266|gb|EHB10185.1| ADP-ribosylation factor 6 [Heterocephalus glaber]
 gi|355693258|gb|EHH27861.1| hypothetical protein EGK_18168 [Macaca mulatta]
 gi|355778567|gb|EHH63603.1| hypothetical protein EGM_16604 [Macaca fascicularis]
 gi|432110827|gb|ELK34303.1| ADP-ribosylation factor 6 [Myotis davidii]
 gi|440907235|gb|ELR57404.1| ADP-ribosylation factor 6 [Bos grunniens mutus]
 gi|444705590|gb|ELW46996.1| ADP-ribosylation factor 6 [Tupaia chinensis]
          Length = 175

 Score =  246 bits (629), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCAT+G+GL+EGL WL
Sbjct: 152 QPSCATSGDGLYEGLTWL 169



>gi|291226696|ref|XP_002733332.1| PREDICTED: mCG3164-like [Saccoglossus kowalevskii]
          Length = 175

 Score =  246 bits (629), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIINDREMRDSIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            P+CATTG+GL+EGL WL
Sbjct: 152 QPACATTGDGLYEGLTWL 169



>gi|318887826|ref|NP_001187339.1| ADP-ribosylation factor 6 [Ictalurus punctatus]
 gi|308322757|gb|ADO28516.1| ADP-ribosylation factor 6 [Ictalurus punctatus]
          Length = 175

 Score =  246 bits (629), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 125/138 (90%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WY 
Sbjct: 92  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYA 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTG+GL+EGL WL
Sbjct: 152 QPSCATTGDGLYEGLTWL 169



>gi|194207356|ref|XP_001916100.1| PREDICTED: ADP-ribosylation factor 6-like [Equus caballus]
          Length = 175

 Score =  246 bits (629), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCAT+G+GL+EGL WL
Sbjct: 152 QPSCATSGDGLYEGLTWL 169



>gi|221327936|gb|ACM17704.1| ADP-ribosylation factor 6 [Sus scrofa]
          Length = 175

 Score =  246 bits (629), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCAT+G+GL+EGL WL
Sbjct: 152 QPSCATSGDGLYEGLTWL 169



>gi|303325077|pdb|3N5C|A Chain A, Crystal Structure Of Arf6delta13 Complexed With Gdp
 gi|303325078|pdb|3N5C|B Chain B, Crystal Structure Of Arf6delta13 Complexed With Gdp
          Length = 162

 Score =  246 bits (629), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 19  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 78

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 79  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 138

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCAT+G+GL+EGL WL
Sbjct: 139 QPSCATSGDGLYEGLTWL 156



>gi|148704663|gb|EDL36610.1| mCG3164 [Mus musculus]
          Length = 191

 Score =  246 bits (629), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 48  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 107

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 108 DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 167

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCAT+G+GL+EGL WL
Sbjct: 168 QPSCATSGDGLYEGLTWL 185



>gi|7767049|pdb|1E0S|A Chain A, Small G Protein Arf6-Gdp
          Length = 174

 Score =  246 bits (628), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 31  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 90

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 91  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 150

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCAT+G+GL+EGL WL
Sbjct: 151 QPSCATSGDGLYEGLTWL 168



>gi|149582964|ref|XP_001512800.1| PREDICTED: ADP-ribosylation factor 6-like [Ornithorhynchus
           anatinus]
          Length = 175

 Score =  246 bits (628), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 125/138 (90%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+DEARQELH+II+DREMRD ++LVFANKQDL  AM P EV EKLGL R+++R+WYV
Sbjct: 92  DRDRVDEARQELHRIINDREMRDAIVLVFANKQDLPDAMKPHEVQEKLGLTRVRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTGEGL EGL WL
Sbjct: 152 QPSCATTGEGLCEGLMWL 169



>gi|89269023|emb|CAJ82515.1| novel protein similar to ADP-ribosylation factor 6 arf6 [Xenopus
           (Silurana) tropicalis]
          Length = 229

 Score =  246 bits (628), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 113/138 (81%), Positives = 125/138 (90%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 86  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 145

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 146 DRDRIDEARQELHRIINDREMRDAIILIFANKQDLADAMKPHEIQEKLGLTRIRDRNWYV 205

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCA TGEGL+EGL WL
Sbjct: 206 QPSCANTGEGLYEGLMWL 223



>gi|91076080|ref|XP_967713.1| PREDICTED: similar to ADP-ribosylation factor 6 [Tribolium
           castaneum]
 gi|270014695|gb|EFA11143.1| hypothetical protein TcasGA2_TC004744 [Tribolium castaneum]
          Length = 175

 Score =  246 bits (628), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPEAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            P+CATTG+GL+EGL WL
Sbjct: 152 QPACATTGDGLYEGLTWL 169



>gi|357629652|gb|EHJ78283.1| hypothetical protein KGM_17559 [Danaus plexippus]
          Length = 175

 Score =  246 bits (628), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCAT+G+GL+EGL WL
Sbjct: 152 QPSCATSGDGLYEGLTWL 169



>gi|403072083|pdb|4FME|C Chain C, Espg-Rab1-Arf6 Complex
 gi|403072086|pdb|4FME|F Chain F, Espg-Rab1-Arf6 Complex
          Length = 160

 Score =  246 bits (628), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 19  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 78

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 79  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 138

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCAT+G+GL+EGL WL
Sbjct: 139 QPSCATSGDGLYEGLTWL 156



>gi|54696598|gb|AAV38671.1| ADP-ribosylation factor 6 [Homo sapiens]
 gi|61357141|gb|AAX41340.1| ADP-ribosylation factor 6 [synthetic construct]
          Length = 175

 Score =  246 bits (628), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCAT+G+GL+EGL WL
Sbjct: 152 QPSCATSGDGLYEGLTWL 169



>gi|498983627|ref|XP_004530164.1| PREDICTED: ADP-ribosylation factor 3-like isoform X1 [Ceratitis
           capitata]
 gi|498983631|ref|XP_004530165.1| PREDICTED: ADP-ribosylation factor 3-like isoform X2 [Ceratitis
           capitata]
          Length = 175

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 125/138 (90%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEAR ELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARTELHRIINDREMRDAIILIFANKQDLADAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTG+GL+EGL WL
Sbjct: 152 QPSCATTGDGLYEGLTWL 169



>gi|49456833|emb|CAG46737.1| ARF6 [Homo sapiens]
          Length = 175

 Score =  246 bits (627), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCAT+G+GL+EGL WL
Sbjct: 152 QPSCATSGDGLYEGLTWL 169



>gi|378734550|gb|EHY61009.1| ADP-ribosylation factor 6 [Exophiala dermatitidis NIH/UT8656]
          Length = 180

 Score =  246 bits (627), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 127/138 (92%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQ VTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 29  KLKLNQDVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSN 88

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR RIDEARQELH+II DREM++ LLLVFANKQD+ G+M+P EVTEKL L ++K+R+WYV
Sbjct: 89  DRARIDEARQELHRIILDREMKEALLLVFANKQDIPGSMTPTEVTEKLRLSQLKDRTWYV 148

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTGEGL EGL+WL
Sbjct: 149 VPSCATTGEGLLEGLSWL 166



>gi|340371389|ref|XP_003384228.1| PREDICTED: ADP-ribosylation factor 6-like [Amphimedon
           queenslandica]
          Length = 176

 Score =  246 bits (627), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 127/138 (92%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+DEARQELH+II+DREM+D ++L+FANKQDL  AM+P E+ EK+GL ++++R+WYV
Sbjct: 92  DRDRVDEARQELHRIINDREMKDAIILIFANKQDLPDAMAPVEIQEKMGLAKLRDRTWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCAT+G+GL+EGL WL
Sbjct: 152 QPSCATSGDGLYEGLTWL 169



>gi|327287372|ref|XP_003228403.1| PREDICTED: ADP-ribosylation factor 6-like [Anolis carolinensis]
          Length = 175

 Score =  246 bits (627), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL Q+VTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQAVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCAT+G+GL+EGL WL
Sbjct: 152 QPSCATSGDGLYEGLTWL 169



>gi|258572951|ref|XP_002540657.1| ADP-ribosylation factor 6 [Uncinocarpus reesii 1704]
 gi|237900923|gb|EEP75324.1| ADP-ribosylation factor 6 [Uncinocarpus reesii 1704]
          Length = 186

 Score =  246 bits (627), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 127/138 (92%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQ VTTIPTVGFNVE+VTYKNVKFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 36  KLKLNQDVTTIPTVGFNVESVTYKNVKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR RIDEARQELH+II DREM++ LLLVFANKQD++GAM P EVTEKL L+++K+R W+V
Sbjct: 96  DRSRIDEARQELHRIILDREMKEALLLVFANKQDIKGAMDPKEVTEKLQLNQLKDRIWFV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTGEGLFEGL WL
Sbjct: 156 VPSCATTGEGLFEGLAWL 173



>gi|147899653|ref|NP_001086677.1| ADP-ribosylation factor 6 [Xenopus laevis]
 gi|50418227|gb|AAH77296.1| MGC80156 protein [Xenopus laevis]
 gi|94966422|dbj|BAE94177.1| ADP ribosylation factor 6 [Xenopus laevis]
          Length = 175

 Score =  246 bits (627), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  +M P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDSMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCAT+G+GL+EGL WL
Sbjct: 152 QPSCATSGDGLYEGLTWL 169



>gi|242009948|ref|XP_002425743.1| ADP-ribosylation factor, putative [Pediculus humanus corporis]
 gi|212509647|gb|EEB13005.1| ADP-ribosylation factor, putative [Pediculus humanus corporis]
          Length = 175

 Score =  246 bits (627), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMR+ ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIINDREMREAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTG+GL+EGL WL
Sbjct: 152 QPSCATTGDGLYEGLTWL 169



>gi|195027485|ref|XP_001986613.1| GH20425 [Drosophila grimshawi]
 gi|193902613|gb|EDW01480.1| GH20425 [Drosophila grimshawi]
          Length = 175

 Score =  246 bits (627), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 125/138 (90%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEAR ELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARTELHRIINDREMRDAIILIFANKQDLSSAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCAT+G+GL+EGL WL
Sbjct: 152 QPSCATSGDGLYEGLTWL 169



>gi|410916219|ref|XP_003971584.1| PREDICTED: ADP-ribosylation factor 6-like [Takifugu rubripes]
          Length = 175

 Score =  245 bits (626), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREM++ ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIINDREMKETIILIFANKQDLADAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCAT+G+GLFEGL WL
Sbjct: 152 QPSCATSGDGLFEGLTWL 169



>gi|58702058|gb|AAH90206.1| Arf6 protein [Xenopus laevis]
          Length = 175

 Score =  245 bits (626), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 125/138 (90%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCA +G+GL+EGL WL
Sbjct: 152 QPSCAASGDGLYEGLTWL 169



>gi|195119858|ref|XP_002004446.1| GI19608 [Drosophila mojavensis]
 gi|195402641|ref|XP_002059913.1| GJ14973 [Drosophila virilis]
 gi|193909514|gb|EDW08381.1| GI19608 [Drosophila mojavensis]
 gi|194140779|gb|EDW57250.1| GJ14973 [Drosophila virilis]
          Length = 175

 Score =  244 bits (624), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 125/138 (90%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEAR ELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARTELHRIINDREMRDAIILIFANKQDLADAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCAT+G+GL+EGL WL
Sbjct: 152 QPSCATSGDGLYEGLTWL 169



>gi|148230515|ref|NP_001084094.1| ADP-ribosylation factor 6 [Xenopus laevis]
 gi|1703379|sp|P51645.2|ARF6_XENLA RecName: Full=ADP-ribosylation factor 6
 gi|967253|gb|AAA74952.1| Arf6 [Xenopus laevis]
          Length = 175

 Score =  244 bits (624), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 125/138 (90%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCP 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCA +G+GL+EGL WL
Sbjct: 152 QPSCAASGDGLYEGLTWL 169



>gi|195426543|ref|XP_002061387.1| GK20891 [Drosophila willistoni]
 gi|194157472|gb|EDW72373.1| GK20891 [Drosophila willistoni]
          Length = 175

 Score =  244 bits (624), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 124/138 (89%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEAR ELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARTELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTG+GL EGL WL
Sbjct: 152 QPSCATTGDGLLEGLTWL 169



>gi|296214950|ref|XP_002753924.1| PREDICTED: ADP-ribosylation factor 6 [Callithrix jacchus]
          Length = 175

 Score =  244 bits (623), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 125/138 (90%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCA +G+GL+EGL WL
Sbjct: 152 QPSCAPSGDGLYEGLTWL 169



>gi|295667691|ref|XP_002794395.1| ADP-ribosylation factor [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226286501|gb|EEH42067.1| ADP-ribosylation factor [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 186

 Score =  244 bits (623), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQ VTTIPTVGFNVE+VTYKNVKFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 36  KLKLNQDVTTIPTVGFNVESVTYKNVKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR RI+EARQELH+II DREMRD LLLVFANKQD+ GAM+P EVT+KL L ++K++ WYV
Sbjct: 96  DRSRIEEARQELHRIILDREMRDALLLVFANKQDIPGAMTPQEVTDKLELTQLKDKIWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTGEGLFEGL WL
Sbjct: 156 VPSCATTGEGLFEGLGWL 173



>gi|148226220|ref|NP_001079550.1| ADP-ribosylation factor 6 [Xenopus laevis]
 gi|28278610|gb|AAH44124.1| MGC53624 protein [Xenopus laevis]
          Length = 175

 Score =  244 bits (623), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 124/138 (89%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FV+D  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVIDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCA TGEGL EGL WL
Sbjct: 152 QPSCANTGEGLCEGLMWL 169



>gi|75766050|pdb|2A5G|A Chain A, Cholera Toxin A1 Subunit Bound To Arf6(Q67l)
          Length = 175

 Score =  244 bits (622), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 125/138 (90%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGG DKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGLDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCAT+G+GL+EGL WL
Sbjct: 152 QPSCATSGDGLYEGLTWL 169



>gi|119191334|ref|XP_001246273.1| ADP-ribosylation factor 6 [Coccidioides immitis RS]
 gi|303313667|ref|XP_003066845.1| ADP-ribosylation factor family protein [Coccidioides posadasii C735
           delta SOWgp]
 gi|240106507|gb|EER24700.1| ADP-ribosylation factor family protein [Coccidioides posadasii C735
           delta SOWgp]
 gi|320031503|gb|EFW13465.1| ADP-ribosylation factor [Coccidioides posadasii str. Silveira]
 gi|392864493|gb|EAS34662.2| ADP-ribosylation factor 6 [Coccidioides immitis RS]
          Length = 185

 Score =  244 bits (622), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQ VT IPTVGFNVE+VTYKNVKFNVWDVGGQDKIRPLWRHY+TGTQGL+FV+DS 
Sbjct: 36  KLKLNQDVTAIPTVGFNVESVTYKNVKFNVWDVGGQDKIRPLWRHYFTGTQGLIFVIDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR RI+EARQELH+II DREM++ LLLVFANKQD++GAM P EVTEKL L+++K+R W+V
Sbjct: 96  DRSRIEEARQELHRIILDREMKEALLLVFANKQDIKGAMDPKEVTEKLQLNQLKDRIWFV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTGEGLFEGL WL
Sbjct: 156 VPSCATTGEGLFEGLAWL 173



>gi|254220871|pdb|2W83|A Chain A, Crystal Structure Of The Arf6 Gtpase In Complex With A
           Specific Effector, Jip4
 gi|254220872|pdb|2W83|B Chain B, Crystal Structure Of The Arf6 Gtpase In Complex With A
           Specific Effector, Jip4
 gi|254220875|pdb|2W83|E Chain E, Crystal Structure Of The Arf6 Gtpase In Complex With A
           Specific Effector, Jip4
          Length = 165

 Score =  244 bits (622), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 125/138 (90%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGG DKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 22  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGLDKIRPLWRHYYTGTQGLIFVVDCA 81

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 82  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 141

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCAT+G+GL+EGL WL
Sbjct: 142 QPSCATSGDGLYEGLTWL 159



>gi|387766221|pdb|3VHX|A Chain A, The Crystal Structure Of Arf6-mklp1 (mitotic Kinesin-like
           Protein 1) Complex
 gi|387766223|pdb|3VHX|C Chain C, The Crystal Structure Of Arf6-mklp1 (mitotic Kinesin-like
           Protein 1) Complex
 gi|387766225|pdb|3VHX|E Chain E, The Crystal Structure Of Arf6-mklp1 (mitotic Kinesin-like
           Protein 1) Complex
 gi|387766227|pdb|3VHX|G Chain G, The Crystal Structure Of Arf6-mklp1 (mitotic Kinesin-like
           Protein 1) Complex
          Length = 172

 Score =  244 bits (622), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 125/138 (90%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGG DKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 21  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGLDKIRPLWRHYYTGTQGLIFVVDCA 80

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 81  DRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 140

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCAT+G+GL+EGL WL
Sbjct: 141 QPSCATSGDGLYEGLTWL 158



>gi|225680155|gb|EEH18439.1| ADP-ribosylation factor 6 [Paracoccidioides brasiliensis Pb03]
 gi|226291949|gb|EEH47377.1| ADP-ribosylation factor 6 [Paracoccidioides brasiliensis Pb18]
          Length = 186

 Score =  243 bits (620), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQ VTTIPTVGFNVE+VTYKNVKFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 36  KLKLNQDVTTIPTVGFNVESVTYKNVKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR RI+EARQELH+II DREMR+ LLLVFANKQD+ GAM+P EVT+KL L ++K++ WYV
Sbjct: 96  DRSRIEEARQELHRIILDREMREALLLVFANKQDIPGAMTPQEVTDKLELTQLKDKIWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTGEGLFEGL WL
Sbjct: 156 VPSCATTGEGLFEGLGWL 173



>gi|170595361|ref|XP_001902349.1| ADP-ribosylation factor 6 [Brugia malayi]
 gi|312075419|ref|XP_003140408.1| ADP-ribosylation factor 6 [Loa loa]
 gi|158590010|gb|EDP28792.1| ADP-ribosylation factor 6, putative [Brugia malayi]
 gi|307764427|gb|EFO23661.1| ADP-ribosylation factor 6 [Loa loa]
 gi|402582013|gb|EJW75959.1| ADP-ribosylation factor 6 [Wuchereria bancrofti]
          Length = 175

 Score =  243 bits (620), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKN+KFNVWDVGGQDKIRPLWRHYYTGTQ L+FV+D+ 
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNIKFNVWDVGGQDKIRPLWRHYYTGTQALIFVIDAA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR+R+DEARQELH+II+DREMRD ++LVFANKQDL  AM P E+ +KLGL R+++R+WYV
Sbjct: 92  DRERVDEARQELHRIINDREMRDAIILVFANKQDLSEAMKPHEIQDKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTG+GL+EGL WL
Sbjct: 152 QPSCATTGDGLYEGLTWL 169



>gi|296823082|ref|XP_002850388.1| ADP-ribosylation factor 6 [Arthroderma otae CBS 113480]
 gi|315056041|ref|XP_003177395.1| ADP-ribosylation factor 6 [Arthroderma gypseum CBS 118893]
 gi|327306678|ref|XP_003238030.1| ADP-ribosylation factor [Trichophyton rubrum CBS 118892]
 gi|238837942|gb|EEQ27604.1| ADP-ribosylation factor 6 [Arthroderma otae CBS 113480]
 gi|311339241|gb|EFQ98443.1| ADP-ribosylation factor 6 [Arthroderma gypseum CBS 118893]
 gi|326458286|gb|EGD83739.1| ADP-ribosylation factor [Trichophyton rubrum CBS 118892]
 gi|326472791|gb|EGD96800.1| ADP-ribosylation factor [Trichophyton tonsurans CBS 112818]
 gi|326483877|gb|EGE07887.1| ADP-ribosylation factor 6 [Trichophyton equinum CBS 127.97]
          Length = 178

 Score =  243 bits (620), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 113/138 (81%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQ VTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 36  KLKLNQDVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR RIDEARQELH+II DREM++ LLLVFANKQD+ GAMSP EVTEKL L ++K+R WYV
Sbjct: 96  DRARIDEARQELHRIILDREMKEALLLVFANKQDIPGAMSPQEVTEKLQLSQLKDRIWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            P+CATTGEGLFEGL+ L
Sbjct: 156 VPTCATTGEGLFEGLDHL 173



>gi|89258463|gb|ABD65455.1| Arf6 [Suberites domuncula]
          Length = 176

 Score =  242 bits (618), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 109/138 (78%), Positives = 124/138 (89%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRI+EARQELH+II+DREM+D ++L+FANKQDL  AM P E+ EKL L ++++R WYV
Sbjct: 92  DRDRIEEARQELHRIINDREMKDAIILIFANKQDLPDAMKPVEIQEKLALTKLRDRQWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTG+GL+EGL WL
Sbjct: 152 QPSCATTGDGLYEGLTWL 169



>gi|470319998|gb|EMR11594.1| hypothetical protein, variant [Pneumocystis murina B123]
          Length = 179

 Score =  242 bits (618), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 124/135 (91%), Gaps = 1/135 (0%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQ+VTTIPTVGFNVETV YKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FV+DS 
Sbjct: 36  KLKLNQTVTTIPTVGFNVETVIYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVIDSA 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEAR+ELH+IISDREMRD +LLVFANKQDL+ AMSP EVTEKL L ++    WYV
Sbjct: 96  DRDRIDEARKELHRIISDREMRDSILLVFANKQDLETAMSPGEVTEKLQLDKIYNL-WYV 154

Query: 121 HPSCATTGEGLFEGL 135
           +PSCATTGEGLFEGL
Sbjct: 155 YPSCATTGEGLFEGL 169



>gi|340514847|gb|EGR45106.1| ADP-ribosylation factor [Trichoderma reesei QM6a]
 gi|358388203|gb|EHK25797.1| hypothetical protein TRIVIDRAFT_55119 [Trichoderma virens Gv29-8]
          Length = 186

 Score =  242 bits (617), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 124/138 (89%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL Q VTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 36  KLKLGQDVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSS 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR R+DEARQELH+II+DREM+D LLLVFANKQDL+ AMSP EVTE L L ++K++ WYV
Sbjct: 96  DRARMDEARQELHRIINDREMKDSLLLVFANKQDLKEAMSPQEVTEALQLSKLKDKVWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTGEGL EGL WL
Sbjct: 156 VPSCATTGEGLLEGLAWL 173



>gi|261193427|ref|XP_002623119.1| ADP-ribosylation factor 6 [Ajellomyces dermatitidis SLH14081]
 gi|239588724|gb|EEQ71367.1| ADP-ribosylation factor 6 [Ajellomyces dermatitidis SLH14081]
 gi|239613954|gb|EEQ90941.1| ADP-ribosylation factor 6 [Ajellomyces dermatitidis ER-3]
 gi|327353301|gb|EGE82158.1| ADP-ribosylation factor [Ajellomyces dermatitidis ATCC 18188]
          Length = 186

 Score =  242 bits (617), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 110/138 (79%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQ VTTIPTVGFNVE+VTYKNVKFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 36  KLKLNQDVTTIPTVGFNVESVTYKNVKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR RIDEARQELH+II DREM++ LLLVFANKQD+ GAM+P EVT+KL L ++K++ W+V
Sbjct: 96  DRARIDEARQELHRIILDREMKEALLLVFANKQDIPGAMTPQEVTDKLQLTQLKDKVWFV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTGEGLFEGL WL
Sbjct: 156 VPSCATTGEGLFEGLGWL 173



>gi|346318101|gb|EGX87706.1| ADP-ribosylation factor 6 [Cordyceps militaris CM01]
          Length = 249

 Score =  242 bits (617), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 123/138 (89%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL Q VTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 36  KLKLGQDVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSS 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR RIDEARQELH+II+DREM+D LLLVFANKQDL+ AM P EVTE L L ++K++ WYV
Sbjct: 96  DRARIDEARQELHRIINDREMKDSLLLVFANKQDLKEAMKPQEVTEALQLSKLKDKVWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTGEGL EGL WL
Sbjct: 156 VPSCATTGEGLLEGLAWL 173



>gi|240275073|gb|EER38588.1| ADP-ribosylation factor [Ajellomyces capsulatus H143]
          Length = 186

 Score =  242 bits (617), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 110/138 (79%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQ VTTIPTVGFNVE+VTYKNVKFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 36  KLKLNQDVTTIPTVGFNVESVTYKNVKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR RIDEARQELH+II DREM++ LLLVFANKQD+ GAM+P EVT+KL L ++K++ W+V
Sbjct: 96  DRARIDEARQELHRIILDREMKEALLLVFANKQDIPGAMTPQEVTDKLQLTQLKDKVWFV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTGEGLFEGL WL
Sbjct: 156 VPSCATTGEGLFEGLGWL 173



>gi|194754962|ref|XP_001959761.1| GF13030 [Drosophila ananassae]
 gi|190621059|gb|EDV36583.1| GF13030 [Drosophila ananassae]
          Length = 175

 Score =  241 bits (616), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 124/138 (89%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+DEAR ELH+II+DREMRD ++L+FANKQDL  AM P EV EKLGL R+++R+WYV
Sbjct: 92  DRDRVDEARTELHRIINDREMRDAIILIFANKQDLPNAMKPHEVQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCAT+G+GL EGL WL
Sbjct: 152 QPSCATSGDGLAEGLIWL 169



>gi|125809938|ref|XP_001361286.1| GA20856 [Drosophila pseudoobscura pseudoobscura]
 gi|195155256|ref|XP_002018521.1| GL17751 [Drosophila persimilis]
 gi|54636461|gb|EAL25864.1| GA20856 [Drosophila pseudoobscura pseudoobscura]
 gi|194114317|gb|EDW36360.1| GL17751 [Drosophila persimilis]
          Length = 175

 Score =  241 bits (615), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 110/138 (79%), Positives = 124/138 (89%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           +LKL QSVTTIPTVGFNVETVTY+NVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  RLKLGQSVTTIPTVGFNVETVTYRNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEAR ELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARTELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTG+GL EGL WL
Sbjct: 152 QPSCATTGDGLSEGLTWL 169



>gi|24653827|ref|NP_523751.2| ADP ribosylation factor 51F, isoform A [Drosophila melanogaster]
 gi|24653829|ref|NP_725452.1| ADP ribosylation factor 51F, isoform B [Drosophila melanogaster]
 gi|24653831|ref|NP_725453.1| ADP ribosylation factor 51F, isoform C [Drosophila melanogaster]
 gi|24653833|ref|NP_725454.1| ADP ribosylation factor 51F, isoform D [Drosophila melanogaster]
 gi|24653835|ref|NP_725455.1| ADP ribosylation factor 51F, isoform E [Drosophila melanogaster]
 gi|194882851|ref|XP_001975523.1| GG20511 [Drosophila erecta]
 gi|195334593|ref|XP_002033962.1| GM21603 [Drosophila sechellia]
 gi|195486247|ref|XP_002091424.1| GE13644 [Drosophila yakuba]
 gi|195583614|ref|XP_002081612.1| GD11108 [Drosophila simulans]
 gi|17380432|sp|P40946.3|ARF3_DROME RecName: Full=ADP-ribosylation factor 3
 gi|7303081|gb|AAF58148.1| ADP ribosylation factor 51F, isoform A [Drosophila melanogaster]
 gi|17945365|gb|AAL48738.1| RE16882p [Drosophila melanogaster]
 gi|21627154|gb|AAM68532.1| ADP ribosylation factor 51F, isoform B [Drosophila melanogaster]
 gi|21627155|gb|AAM68533.1| ADP ribosylation factor 51F, isoform C [Drosophila melanogaster]
 gi|21627156|gb|AAM68534.1| ADP ribosylation factor 51F, isoform D [Drosophila melanogaster]
 gi|21627157|gb|AAM68535.1| ADP ribosylation factor 51F, isoform E [Drosophila melanogaster]
 gi|190658710|gb|EDV55923.1| GG20511 [Drosophila erecta]
 gi|194125932|gb|EDW47975.1| GM21603 [Drosophila sechellia]
 gi|194177525|gb|EDW91136.1| GE13644 [Drosophila yakuba]
 gi|194193621|gb|EDX07197.1| GD11108 [Drosophila simulans]
 gi|220948012|gb|ACL86549.1| Arf51F-PA [synthetic construct]
 gi|220957332|gb|ACL91209.1| Arf51F-PA [synthetic construct]
          Length = 175

 Score =  241 bits (615), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 124/138 (89%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEAR ELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARTELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCAT+G+GL EGL WL
Sbjct: 152 QPSCATSGDGLSEGLIWL 169



>gi|316983334|pdb|3PCR|B Chain B, Structure Of Espg-Arf6 Complex
          Length = 162

 Score =  241 bits (615), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 110/138 (79%), Positives = 124/138 (89%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 19  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 78

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DRE RD ++L+FANKQDL  A  P E+ EKLGL R+++R+WYV
Sbjct: 79  DRDRIDEARQELHRIINDREXRDAIILIFANKQDLPDAXKPHEIQEKLGLTRIRDRNWYV 138

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCAT+G+GL+EGL WL
Sbjct: 139 QPSCATSGDGLYEGLTWL 156



>gi|193599058|ref|XP_001945303.1| PREDICTED: ADP-ribosylation factor 6-like [Acyrthosiphon pisum]
          Length = 175

 Score =  241 bits (614), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 110/138 (79%), Positives = 123/138 (89%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETV YKNVK NVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVIYKNVKINVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEA+QELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEAKQELHRIINDREMRDAIILIFANKQDLTNAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTG+GL EGL WL
Sbjct: 152 QPSCATTGDGLHEGLAWL 169



>gi|389636504|ref|XP_003715902.1| ADP-ribosylation factor 6 [Magnaporthe oryzae 70-15]
 gi|351641721|gb|EHA49583.1| ADP-ribosylation factor 6 [Magnaporthe oryzae 70-15]
 gi|440471215|gb|ELQ40246.1| ADP-ribosylation factor 6 [Magnaporthe oryzae Y34]
 gi|440490717|gb|ELQ70244.1| ADP-ribosylation factor 6 [Magnaporthe oryzae P131]
          Length = 186

 Score =  240 bits (613), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 110/138 (79%), Positives = 123/138 (89%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL Q VTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 36  KLKLGQDVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSS 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR R+DEARQELH+II+DREM+D LLLVFANKQDL+ AM P EVTE L L ++K++ WYV
Sbjct: 96  DRKRMDEARQELHRIINDREMKDSLLLVFANKQDLENAMKPQEVTEALQLSKLKDKIWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTGEGL EGL WL
Sbjct: 156 VPSCATTGEGLLEGLAWL 173



>gi|440634612|gb|ELR04531.1| ADP-ribosylation factor 6 [Geomyces destructans 20631-21]
          Length = 187

 Score =  240 bits (613), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 110/138 (79%), Positives = 125/138 (90%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQ VTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYY+GTQGL+FV+DS 
Sbjct: 36  KLKLNQDVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYSGTQGLIFVIDSS 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR+RI+EA QELH+II DREM++ LLLVFANKQD+ GAM+P EVT+KL L+ +K++ WYV
Sbjct: 96  DRERIEEASQELHRIIGDREMKESLLLVFANKQDIPGAMTPQEVTDKLRLNILKDKIWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTGEGL EGL WL
Sbjct: 156 VPSCATTGEGLLEGLAWL 173



>gi|164659844|ref|XP_001731046.1| hypothetical protein MGL_2045 [Malassezia globosa CBS 7966]
 gi|159104944|gb|EDP43832.1| hypothetical protein MGL_2045 [Malassezia globosa CBS 7966]
          Length = 182

 Score =  240 bits (612), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 106/138 (76%), Positives = 124/138 (89%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSV TIPTVGFNVET++Y+N+KFNVWDVGGQD IRPLWRHYYTGTQGL++VVDS+
Sbjct: 36  KLKLRQSVKTIPTVGFNVETISYRNIKFNVWDVGGQDSIRPLWRHYYTGTQGLIYVVDSR 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR RIDEAR+ELH+I+SDREMR C+LLVFANKQDL GAMSP E+T++LGL  M+ R W+V
Sbjct: 96  DRARIDEAREELHRILSDREMRHCVLLVFANKQDLAGAMSPQELTDRLGLQAMQSRPWFV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
           HPSCA +G+GL EGL WL
Sbjct: 156 HPSCAMSGQGLSEGLQWL 173



>gi|358390019|gb|EHK39425.1| hypothetical protein TRIATDRAFT_146579 [Trichoderma atroviride IMI
           206040]
          Length = 186

 Score =  239 bits (611), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 109/138 (78%), Positives = 124/138 (89%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL Q VTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 36  KLKLGQDVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSS 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR R+DEARQELH+II+DREM+D LLLVFANKQDL+ AMSP EVT+ L L ++K++ WYV
Sbjct: 96  DRTRMDEARQELHRIINDREMKDSLLLVFANKQDLKEAMSPQEVTDALQLSKLKDKVWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCAT+GEGL EGL WL
Sbjct: 156 VPSCATSGEGLLEGLAWL 173



>gi|390340158|ref|XP_796400.3| PREDICTED: ADP-ribosylation factor 6-like [Strongylocentrotus
           purpuratus]
          Length = 175

 Score =  239 bits (610), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 107/138 (77%), Positives = 125/138 (90%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVT+KNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTFKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+II+DREM++ ++L+FANKQDL  AM P EV E+LGL ++++R+W+V
Sbjct: 92  DRDRIDEARQELHRIINDREMKEAIILIFANKQDLPDAMKPIEVQERLGLTKIRDRNWFV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            P+CAT+GEGL EGL WL
Sbjct: 152 QPACATSGEGLLEGLTWL 169



>gi|310796005|gb|EFQ31466.1| ADP-ribosylation factor family protein [Glomerella graminicola
           M1.001]
 gi|380471071|emb|CCF47454.1| ADP-ribosylation factor 6 [Colletotrichum higginsianum]
          Length = 186

 Score =  239 bits (609), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 122/138 (88%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL Q VTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 36  KLKLGQDVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSS 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR RI+EA+ ELH+II+DREM+D LLLVFANKQD+ GAM P EVTE L L ++K++ WYV
Sbjct: 96  DRARIEEAKSELHRIINDREMKDSLLLVFANKQDINGAMKPQEVTEALSLSKLKDKVWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTGEGL EGL WL
Sbjct: 156 VPSCATTGEGLLEGLAWL 173



>gi|46117282|ref|XP_384659.1| hypothetical protein FG04483.1 [Fusarium graminearum PH-1]
 gi|408392180|gb|EKJ71539.1| hypothetical protein FPSE_08280 [Fusarium pseudograminearum CS3096]
          Length = 186

 Score =  239 bits (609), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 109/138 (78%), Positives = 124/138 (89%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL Q VTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 36  KLKLGQDVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSS 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           D++R++EARQELH+II+DREM+D LLLVFANKQDL  AMSP EVTE L L ++K++ WYV
Sbjct: 96  DKNRMEEARQELHRIINDREMKDSLLLVFANKQDLAEAMSPQEVTEALQLSKLKDKVWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTGEGL EGL WL
Sbjct: 156 VPSCATTGEGLLEGLAWL 173



>gi|402074038|gb|EJT69590.1| ADP-ribosylation factor 6 [Gaeumannomyces graminis var. tritici
           R3-111a-1]
          Length = 186

 Score =  239 bits (609), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 109/138 (78%), Positives = 123/138 (89%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL Q VTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 36  KLKLGQDVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSS 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR R+DEARQELH+II+DREM+D LLLVFANKQD++ AM P EVTE L L ++K++ WYV
Sbjct: 96  DRKRMDEARQELHRIINDREMKDSLLLVFANKQDVEDAMKPQEVTEALQLSKLKDKIWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTGEGL EGL WL
Sbjct: 156 VPSCATTGEGLLEGLAWL 173



>gi|221119538|ref|XP_002159809.1| PREDICTED: ADP-ribosylation factor 6-like [Hydra magnipapillata]
          Length = 174

 Score =  239 bits (609), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 106/138 (76%), Positives = 125/138 (90%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETV YKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FV+D  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVAYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVIDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           D+DRI+EARQELH+II+DREM+D ++L+FANKQDL  AM P E+ EKLGL ++++R+W+V
Sbjct: 92  DKDRIEEARQELHRIINDREMKDAIILIFANKQDLPEAMKPHEIQEKLGLTKIRDRNWFV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTG+GL+EGL WL
Sbjct: 152 QPSCATTGDGLYEGLTWL 169



>gi|302901282|ref|XP_003048403.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256729336|gb|EEU42690.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 186

 Score =  238 bits (607), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 109/138 (78%), Positives = 123/138 (89%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL Q VTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 36  KLKLGQDVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSS 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR+R+DEARQELH+II+DREM+D LLLVFANKQDL  AM P EVT+ L L ++K++ WYV
Sbjct: 96  DRNRMDEARQELHRIINDREMKDSLLLVFANKQDLAEAMKPQEVTDALQLTKLKDKVWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTGEGL EGL WL
Sbjct: 156 VPSCATTGEGLLEGLAWL 173



>gi|475664813|gb|EMT62607.1| ADP-ribosylation factor 6 [Fusarium oxysporum f. sp. cubense race
           4]
 gi|477518541|gb|ENH70754.1| ADP-ribosylation factor 6 [Fusarium oxysporum f. sp. cubense race
           1]
          Length = 186

 Score =  238 bits (607), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 109/138 (78%), Positives = 123/138 (89%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL Q VTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 36  KLKLGQDVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSS 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR+R++EARQELH+II+DREM+D LLLVFANKQDL  AM P EVTE L L ++K++ WYV
Sbjct: 96  DRNRMEEARQELHRIINDREMKDSLLLVFANKQDLAEAMKPQEVTEALQLSKLKDKVWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTGEGL EGL WL
Sbjct: 156 VPSCATTGEGLLEGLAWL 173



>gi|429852943|gb|ELA28053.1| ADP-ribosylation factor, partial [Colletotrichum gloeosporioides
           Nara gc5]
          Length = 185

 Score =  238 bits (606), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 122/138 (88%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL Q VTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 36  KLKLGQDVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSS 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR RI+EA+ ELH+II+DREM+D LLLVFANKQD+ GAM P EVTE L L ++K++ WYV
Sbjct: 96  DRARIEEAKSELHRIINDREMKDSLLLVFANKQDINGAMKPQEVTEALQLSKLKDKVWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTGEGL EGL WL
Sbjct: 156 VPSCATTGEGLLEGLAWL 173



>gi|19113614|ref|NP_596822.1| ADP-ribosylation factor, Arf family Arf6 [Schizosaccharomyces pombe
           972h-]
 gi|20137584|sp|Q9Y7Z2.1|ARF6_SCHPO RecName: Full=ADP-ribosylation factor 6
 gi|5579053|emb|CAB51340.1| ADP-ribosylation factor, Arf family Arf6 [Schizosaccharomyces
           pombe]
          Length = 184

 Score =  238 bits (606), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 123/138 (89%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSV TIPTVGFNVETVTYKN+KFNVWDVGGQDKIRPLWRHY+TGT+GL+FVVDS 
Sbjct: 40  KLKLNQSVVTIPTVGFNVETVTYKNIKFNVWDVGGQDKIRPLWRHYFTGTKGLIFVVDSA 99

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           D +RI EARQELH+IISDREMRDCLLLV ANKQDL GA+SPA++T+ L L ++K+R W V
Sbjct: 100 DSNRISEARQELHRIISDREMRDCLLLVLANKQDLPGALSPAQITDVLQLDKLKDRLWNV 159

Query: 121 HPSCATTGEGLFEGLNWL 138
            P+CA TG+GL EGL WL
Sbjct: 160 QPTCALTGDGLLEGLAWL 177



>gi|465793288|emb|CCU98417.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 182

 Score =  238 bits (606), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 126/138 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL+++V TIPTVGFNVET+T+KN+KFNVWDVGGQDKIRPLWRHYYTG+QGL+FVVDS+
Sbjct: 36  KLKLHRNVKTIPTVGFNVETITFKNIKFNVWDVGGQDKIRPLWRHYYTGSQGLIFVVDSR 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR R+DEAR+ELH ++SDREM  C+LLVFANKQDL GAMSP EVTE+LGL+ +++R W+V
Sbjct: 96  DRARMDEAREELHHVLSDREMHHCVLLVFANKQDLAGAMSPQEVTERLGLYAIQDRPWFV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
           HPSCA TGEGL EGL W+
Sbjct: 156 HPSCAATGEGLSEGLQWM 173



>gi|477530458|gb|ENH82188.1| ADP-ribosylation factor [Colletotrichum orbiculare MAFF 240422]
          Length = 186

 Score =  238 bits (606), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 107/138 (77%), Positives = 122/138 (88%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL Q VTTIPTVGFN+ETVTYKNVKFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 36  KLKLGQDVTTIPTVGFNIETVTYKNVKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSS 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR RI+EA+ ELH+II+DREM+D LLLVFANKQD+ GAM P EVTE L L ++K++ WYV
Sbjct: 96  DRARIEEAKSELHRIINDREMKDSLLLVFANKQDINGAMKPQEVTEALQLSKLKDKVWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTGEGL EGL WL
Sbjct: 156 VPSCATTGEGLLEGLAWL 173



>gi|507234|gb|AAA28378.1| ADP ribosylation factor 3 [Drosophila melanogaster]
 gi|507236|gb|AAA53668.1| ADP ribosylation factor 3 [Drosophila melanogaster]
          Length = 175

 Score =  238 bits (606), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 110/138 (79%), Positives = 123/138 (89%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTI TVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIGTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEAR ELH+II+DREMRD ++L+FANKQDL  AM P E+ EKLGL R+++R+WYV
Sbjct: 92  DRDRIDEARTELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCAT+G+GL EGL WL
Sbjct: 152 QPSCATSGDGLSEGLIWL 169



>gi|322699408|gb|EFY91170.1| ADP-ribosylation factor [Metarhizium acridum CQMa 102]
          Length = 186

 Score =  237 bits (605), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 123/138 (89%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL Q VTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYY+GTQGL+FV+DS 
Sbjct: 36  KLKLGQDVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYSGTQGLIFVIDSS 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR R++EA+QELH+II+DREM+D LLLVFANKQDL  AM P +VTE L L ++K+++WYV
Sbjct: 96  DRGRMEEAKQELHRIINDREMKDSLLLVFANKQDLNDAMDPKQVTEALELSKIKDKAWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTGEGL EGL WL
Sbjct: 156 VPSCATTGEGLLEGLGWL 173



>gi|225558629|gb|EEH06913.1| ADP-ribosylation factor [Ajellomyces capsulatus G186AR]
 gi|325094426|gb|EGC47736.1| ADP-ribosylation factor [Ajellomyces capsulatus H88]
          Length = 183

 Score =  237 bits (605), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 124/135 (91%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQ VTTIPTVGFNVE+VTYKNVKFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 36  KLKLNQDVTTIPTVGFNVESVTYKNVKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR RIDEARQELH+II DREM++ LLLVFANKQD+ GAM+P EVT+KL L ++K++ W+V
Sbjct: 96  DRARIDEARQELHRIILDREMKEALLLVFANKQDIPGAMTPQEVTDKLQLTQLKDKVWFV 155

Query: 121 HPSCATTGEGLFEGL 135
            PSCATTGEGLFEGL
Sbjct: 156 VPSCATTGEGLFEGL 170



>gi|330935313|ref|XP_003304906.1| hypothetical protein PTT_17639 [Pyrenophora teres f. teres 0-1]
 gi|311318242|gb|EFQ86987.1| hypothetical protein PTT_17639 [Pyrenophora teres f. teres 0-1]
          Length = 185

 Score =  237 bits (605), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 111/139 (79%), Positives = 124/139 (89%), Gaps = 1/139 (0%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL+Q VTTIPTVGFNVETVTYKN KFNVWDVGGQDKIRPLWRHY++GTQGL+FVVDS 
Sbjct: 36  KLKLDQDVTTIPTVGFNVETVTYKNTKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRM-KERSWY 119
           DRDRIDEARQEL +II DREM+D LLLVFANKQDLQGAMSP EV+++L L ++ K+  W 
Sbjct: 96  DRDRIDEARQELMRIIQDREMKDALLLVFANKQDLQGAMSPKEVSDRLQLDKIAKDHVWK 155

Query: 120 VHPSCATTGEGLFEGLNWL 138
           V PSCATTGEG+FEGL WL
Sbjct: 156 VEPSCATTGEGIFEGLAWL 174



>gi|320587020|gb|EFW99667.1| ADP-ribosylation factor [Grosmannia clavigera kw1407]
          Length = 186

 Score =  237 bits (604), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 109/138 (78%), Positives = 123/138 (89%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL Q VTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHY++GTQGL+FVVDS 
Sbjct: 36  KLKLGQDVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVVDSS 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR R+DEARQELH+II+DREM+D LLLVFANKQDL+ +M P +VTE L L ++K++ WYV
Sbjct: 96  DRVRMDEARQELHRIINDREMKDSLLLVFANKQDLENSMKPQDVTEALQLSKLKDKIWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTGEGL EGL WL
Sbjct: 156 VPSCATTGEGLLEGLAWL 173



>gi|399167124|emb|CCE32098.1| probable ADP-ribosylation factor 6 [Claviceps purpurea 20.1]
          Length = 186

 Score =  236 bits (603), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 107/138 (77%), Positives = 124/138 (89%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL Q VTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 36  KLKLGQDVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSS 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR R++EARQELH+II+DREM+D LLLVFANKQDL+ AM+P E+TE L L ++K++ WYV
Sbjct: 96  DRARMEEARQELHRIINDREMKDSLLLVFANKQDLKEAMTPQEITEALQLSKLKDKVWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTGEGL +GL WL
Sbjct: 156 VPSCATTGEGLLDGLAWL 173



>gi|189207987|ref|XP_001940327.1| ADP-ribosylation factor 6 [Pyrenophora tritici-repentis Pt-1C-BFP]
 gi|187976420|gb|EDU43046.1| ADP-ribosylation factor 6 [Pyrenophora tritici-repentis Pt-1C-BFP]
          Length = 185

 Score =  236 bits (603), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 124/139 (89%), Gaps = 1/139 (0%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL+Q VTTIPTVGFNVETVTYKN KFNVWDVGGQDKIRPLWRHY++GTQGL+FVVDS 
Sbjct: 36  KLKLDQDVTTIPTVGFNVETVTYKNTKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRM-KERSWY 119
           DRDR+DEARQEL +II DREM+D LLLVFANKQDLQGAMSP EV+++L L ++ K+  W 
Sbjct: 96  DRDRVDEARQELMRIIQDREMKDALLLVFANKQDLQGAMSPKEVSDRLQLDKIAKDHVWK 155

Query: 120 VHPSCATTGEGLFEGLNWL 138
           V PSCATTGEG+FEGL WL
Sbjct: 156 VEPSCATTGEGIFEGLAWL 174



>gi|501753289|emb|CCG82976.1| ADP-ribosylation factor 3 [Taphrina deformans PYCC 5710]
          Length = 185

 Score =  236 bits (603), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 123/140 (87%), Gaps = 2/140 (1%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FV+DS 
Sbjct: 36  KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVIDSA 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKE--RSW 118
           DR RIDEARQEL +IISDREM++ LLLVFANKQD++G M+P EV EKL L R+    R W
Sbjct: 96  DRARIDEARQELQRIISDREMKEALLLVFANKQDVEGCMTPNEVQEKLQLSRIAGGVRQW 155

Query: 119 YVHPSCATTGEGLFEGLNWL 138
            V PSCATTG+GL+EGL WL
Sbjct: 156 SVKPSCATTGDGLYEGLAWL 175



>gi|195996183|ref|XP_002107960.1| conserved hypothetical protein [Trichoplax adhaerens]
 gi|190588736|gb|EDV28758.1| conserved hypothetical protein [Trichoplax adhaerens]
          Length = 175

 Score =  236 bits (603), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 124/138 (89%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQ L+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQALIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR+RIDEAR ELH+II+DREM+D ++LVFANKQD++ AM P ++ E+LGL ++++R+WYV
Sbjct: 92  DRERIDEARSELHRIINDREMKDAIILVFANKQDMENAMKPQDIQERLGLIKIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCA TG+GL+EGL WL
Sbjct: 152 QPSCAVTGDGLYEGLTWL 169



>gi|302420247|ref|XP_003007954.1| ADP-ribosylation factor 6 [Verticillium albo-atrum VaMs.102]
 gi|261353605|gb|EEY16033.1| ADP-ribosylation factor 6 [Verticillium albo-atrum VaMs.102]
 gi|346977634|gb|EGY21086.1| ADP-ribosylation factor 6 [Verticillium dahliae VdLs.17]
          Length = 186

 Score =  236 bits (603), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 121/138 (87%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL Q VTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 36  KLKLGQDVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSS 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR RI+EAR ELH+II+DREM+D LLLVFANKQD+  AM P EVTE L L ++K++ WYV
Sbjct: 96  DRARIEEARSELHRIINDREMKDSLLLVFANKQDINDAMKPQEVTEALQLSKLKDKVWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTGEGL EGL WL
Sbjct: 156 VPSCATTGEGLLEGLAWL 173



>gi|512186868|gb|EPE02653.1| adp-ribosylation factor 6 [Ophiostoma piceae UAMH 11346]
          Length = 186

 Score =  236 bits (602), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 109/138 (78%), Positives = 122/138 (88%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL Q VTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHY++GTQGL+FVVDS 
Sbjct: 36  KLKLGQDVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVVDSS 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR R+DEARQELH+II+DREM+D LLLVFANKQDL  ++ P EVTE L L ++K++ WYV
Sbjct: 96  DRVRLDEARQELHRIINDREMKDSLLLVFANKQDLDNSLKPQEVTEALQLSKLKDKIWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTGEGL EGL WL
Sbjct: 156 VPSCATTGEGLLEGLAWL 173



>gi|322704957|gb|EFY96547.1| ADP-ribosylation factor [Metarhizium anisopliae ARSEF 23]
          Length = 186

 Score =  236 bits (602), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 107/138 (77%), Positives = 123/138 (89%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL Q VTTIPTVGFNVE+VTYKNVKFNVWDVGGQDKIRPLWRHYY+GTQGL+FV+DS 
Sbjct: 36  KLKLGQDVTTIPTVGFNVESVTYKNVKFNVWDVGGQDKIRPLWRHYYSGTQGLIFVIDSS 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR R++EA+QELH+II+DREM+D LLLVFANKQDL  AM P +VTE L L ++K+++WYV
Sbjct: 96  DRGRMEEAKQELHRIINDREMKDSLLLVFANKQDLNDAMDPKQVTEALELSKIKDKAWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTGEGL EGL WL
Sbjct: 156 VPSCATTGEGLLEGLGWL 173



>gi|512198417|gb|EPE27252.1| P-loop containing nucleoside triphosphate hydrolase [Glarea
           lozoyensis ATCC 20868]
          Length = 187

 Score =  236 bits (602), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 107/138 (77%), Positives = 123/138 (89%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQ VTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 36  KLKLNQDVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSS 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           D+ RIDEAR ELH+II+DREM++ LLLVFANKQD+ GAM P EVT+ L L ++K++ W+V
Sbjct: 96  DKARIDEARSELHRIINDREMKESLLLVFANKQDIPGAMKPQEVTDALKLTQLKDKIWFV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTGEGL EGL WL
Sbjct: 156 VPSCATTGEGLLEGLAWL 173



>gi|471562561|gb|EMR64035.1| putative adp-ribosylation factor 6 protein [Eutypa lata UCREL1]
          Length = 186

 Score =  236 bits (602), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 106/138 (76%), Positives = 125/138 (90%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL Q VTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 36  KLKLGQDVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSS 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           D+ R+DEARQELH+II+DREM+D LLLVFANKQD++ A++P +VTE L L+++K++ WYV
Sbjct: 96  DQQRMDEARQELHRIINDREMKDSLLLVFANKQDIKDALNPTQVTEALQLNKLKDKLWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTGEGL EGL WL
Sbjct: 156 VPSCATTGEGLLEGLQWL 173



>gi|156383600|ref|XP_001632921.1| predicted protein [Nematostella vectensis]
 gi|156219984|gb|EDO40858.1| predicted protein [Nematostella vectensis]
          Length = 175

 Score =  236 bits (602), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 109/138 (78%), Positives = 123/138 (89%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYK VKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKKVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEAR ELH+II+DREM+D ++LVFANKQDL  A+ P E+ E+L L R+K+R+WYV
Sbjct: 92  DRDRIDEARTELHRIINDREMKDSIILVFANKQDLPDALKPHEIQERLQLTRLKDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTG+GL EGL+WL
Sbjct: 152 QPSCATTGDGLCEGLSWL 169



>gi|326426994|gb|EGD72564.1| ADP-ribosylation factor 6 [Salpingoeca sp. ATCC 50818]
          Length = 175

 Score =  236 bits (601), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 106/138 (76%), Positives = 124/138 (89%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETV+YKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVSYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR+R+DEAR+ELHKI++D+EM DC++L+FANKQDL GA++P E+ EKLGL+R+++R WYV
Sbjct: 92  DRERVDEARRELHKILNDQEMSDCVILIFANKQDLHGALTPEEIPEKLGLNRLRDRVWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            P  ATTG GL EGL WL
Sbjct: 152 QPCVATTGAGLQEGLTWL 169



>gi|17538186|ref|NP_503011.1| Protein ARF-6 [Caenorhabditis elegans]
 gi|308486330|ref|XP_003105362.1| CRE-ARF-6 protein [Caenorhabditis remanei]
 gi|5832815|emb|CAB55153.1| Protein ARF-6 [Caenorhabditis elegans]
 gi|308256467|gb|EFP00420.1| CRE-ARF-6 protein [Caenorhabditis remanei]
 gi|341886076|gb|EGT42011.1| CBN-ARF-6 protein [Caenorhabditis brenneri]
          Length = 175

 Score =  236 bits (601), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 124/138 (89%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKN+KFNVWDVGGQDKIRPLWRHYYTGTQ L+FV+D+ 
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNIKFNVWDVGGQDKIRPLWRHYYTGTQALIFVMDAA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+DEAR ELH+II+DREM++ ++LVFANKQDL  AM P E+ +KLGL R+++R+WYV
Sbjct: 92  DRDRVDEARMELHRIINDREMKEAIILVFANKQDLADAMKPHEIQDKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCA+TG+GL EGL WL
Sbjct: 152 QPSCASTGDGLHEGLTWL 169



>gi|268534394|ref|XP_002632328.1| C. briggsae CBR-ARF-6 protein [Caenorhabditis briggsae]
          Length = 175

 Score =  235 bits (600), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 123/138 (89%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVTYKN+KFNVWDVGGQDKIRPLWRHYYTGTQ L+FV+D+ 
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTYKNIKFNVWDVGGQDKIRPLWRHYYTGTQALIFVMDAA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+DEAR ELH+II+DREM++ ++LVFANKQDL  AM P E+ +KLGL R+++R+WYV
Sbjct: 92  DRDRVDEARMELHRIINDREMKEAIILVFANKQDLADAMKPHEIQDKLGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCA TG+GL EGL WL
Sbjct: 152 QPSCAATGDGLHEGLTWL 169



>gi|156066107|ref|XP_001598975.1| conserved hypothetical protein [Sclerotinia sclerotiorum 1980]
 gi|154691923|gb|EDN91661.1| conserved hypothetical protein [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 186

 Score =  235 bits (600), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 108/138 (78%), Positives = 122/138 (88%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL Q VTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 36  KLKLGQDVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSS 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR RI EA+QELH+II+DREM+D LLLVFANKQD+ GAM P EVTE+L L+ +K + W+V
Sbjct: 96  DRARIAEAQQELHRIINDREMQDSLLLVFANKQDIAGAMKPPEVTEQLKLNDLKNKVWFV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTGEGL EGL WL
Sbjct: 156 VPSCATTGEGLMEGLAWL 173



>gi|391326553|ref|XP_003737777.1| PREDICTED: ADP-ribosylation factor 6-like [Metaseiulus
           occidentalis]
          Length = 175

 Score =  235 bits (599), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 107/138 (77%), Positives = 123/138 (89%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLK+ + VTTIPTVGFNVETVTYKNVKF+VWDVGGQDK+RPLWRHYYTGTQ L+FVVDS 
Sbjct: 32  KLKMGEYVTTIPTVGFNVETVTYKNVKFSVWDVGGQDKLRPLWRHYYTGTQALIFVVDSS 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEARQELH+IISDREM+D L+LVFANKQD + AM P E+ EKLGL R+++R WYV
Sbjct: 92  DRDRIDEARQELHRIISDREMKDALILVFANKQDHKDAMRPQEIQEKLGLTRLRDRHWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            P+CAT+G+GL EGL WL
Sbjct: 152 QPACATSGDGLQEGLTWL 169



>gi|154294278|ref|XP_001547581.1| conserved hypothetical protein [Botryotinia fuckeliana B05.10]
 gi|472246629|gb|EMR91161.1| putative adp-ribosylation factor 6 protein [Botryotinia fuckeliana
           BcDW1]
          Length = 186

 Score =  234 bits (598), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 107/138 (77%), Positives = 122/138 (88%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL Q VTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 36  KLKLGQDVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSS 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR RI EA+QELH+II+DREM+D LLLVFANKQD+ GAM P EVTE+L L+ ++ + W+V
Sbjct: 96  DRARIAEAQQELHRIINDREMQDSLLLVFANKQDIAGAMKPPEVTEQLKLNELRNKVWFV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTGEGL EGL WL
Sbjct: 156 VPSCATTGEGLMEGLAWL 173



>gi|494827014|gb|EON64030.1| ADP-ribosylation factor 6 [Coniosporium apollinis CBS 100218]
          Length = 184

 Score =  233 bits (595), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 121/139 (87%), Gaps = 1/139 (0%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL+Q VTTIPTVGFNVETVTYKN KFNVWDVGGQDKIRPLWRHY++GTQGL+FVVDS 
Sbjct: 36  KLKLDQDVTTIPTVGFNVETVTYKNTKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVVDSS 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRM-KERSWY 119
           DRDR+DEAR EL +II DREMRD LLLVFANKQDL GAM P E+++KL L R+ K  +W 
Sbjct: 96  DRDRLDEARTELARIIQDREMRDALLLVFANKQDLAGAMRPKEISDKLELERIAKNHTWK 155

Query: 120 VHPSCATTGEGLFEGLNWL 138
           V PSCATTGEG+FEGL WL
Sbjct: 156 VEPSCATTGEGIFEGLAWL 174



>gi|342874882|gb|EGU76789.1| hypothetical protein FOXB_12686 [Fusarium oxysporum Fo5176]
          Length = 188

 Score =  233 bits (595), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 109/140 (77%), Positives = 123/140 (87%), Gaps = 2/140 (1%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL Q VTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 36  KLKLGQDVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSS 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQ--GAMSPAEVTEKLGLHRMKERSW 118
           DR+R++EARQELH+II+DREM+D LLLVFANKQDL    AM P EVTE L L ++K++ W
Sbjct: 96  DRNRMEEARQELHRIINDREMKDSLLLVFANKQDLAEGTAMKPQEVTEALQLSKLKDKVW 155

Query: 119 YVHPSCATTGEGLFEGLNWL 138
           YV PSCATTGEGL EGL WL
Sbjct: 156 YVVPSCATTGEGLLEGLAWL 175



>gi|400599827|gb|EJP67518.1| ADP-ribosylation factor 6 [Beauveria bassiana ARSEF 2860]
          Length = 191

 Score =  233 bits (594), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 110/143 (76%), Positives = 123/143 (86%), Gaps = 5/143 (3%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL Q VTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 36  KLKLGQDVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSS 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQ-----GAMSPAEVTEKLGLHRMKE 115
           DR RI+EARQELH+II+DREM+D LLLVFANKQDL+      AM P EVTE L L ++K+
Sbjct: 96  DRARIEEARQELHRIINDREMKDSLLLVFANKQDLKEGNLTTAMKPQEVTEALQLSKLKD 155

Query: 116 RSWYVHPSCATTGEGLFEGLNWL 138
           + WYV PSCATTGEGL EGL WL
Sbjct: 156 KVWYVVPSCATTGEGLLEGLAWL 178



>gi|156383688|ref|XP_001632965.1| predicted protein [Nematostella vectensis]
 gi|156220028|gb|EDO40902.1| predicted protein [Nematostella vectensis]
          Length = 175

 Score =  231 bits (588), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 102/138 (73%), Positives = 123/138 (89%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL QSVTTIPTVGFNVETVT++ VKFNVWDVGGQDKIRPLWRHY+ G+QGL+FVVD  
Sbjct: 32  KLKLGQSVTTIPTVGFNVETVTFQKVKFNVWDVGGQDKIRPLWRHYFAGSQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRIDEAR+EL +II+DREM+D ++L+FANKQDL  AM P E+ EK+GL R+++R+WYV
Sbjct: 92  DRDRIDEARKELQRIINDREMKDVIILIFANKQDLPDAMKPHEIQEKMGLTRIRDRNWYV 151

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCATTG+GL++GL WL
Sbjct: 152 QPSCATTGDGLYDGLKWL 169



>gi|171676547|ref|XP_001903226.1| hypothetical protein [Podospora anserina S mat+]
 gi|170936340|emb|CAP60998.1| unnamed protein product [Podospora anserina S mat+]
          Length = 188

 Score =  230 bits (586), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQ++TTIPTVGFNVET TYKN+KFN+WDVGGQDKIRPLWRHYY+GTQGLVFVVDS 
Sbjct: 38  KLKLNQTMTTIPTVGFNVETFTYKNIKFNMWDVGGQDKIRPLWRHYYSGTQGLVFVVDSS 97

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           D  RIDEAR ELH+II+DREM DCLLLVFANKQD+ GAM P EVTEKL L ++K++ W+V
Sbjct: 98  DHARIDEARTELHRIINDREMADCLLLVFANKQDVDGAMKPNEVTEKLQLAKLKDKLWFV 157

Query: 121 HPSCATTGEGLFEGLNWL 138
            P+ A  GEGL EG  WL
Sbjct: 158 QPAIAIDGEGLTEGFGWL 175



>gi|145233077|ref|XP_001399911.1| ADP-ribosylation factor 6 [Aspergillus niger CBS 513.88]
 gi|134056836|emb|CAK37741.1| unnamed protein product [Aspergillus niger]
 gi|350634734|gb|EHA23096.1| hypothetical protein ASPNIDRAFT_47046 [Aspergillus niger ATCC 1015]
 gi|358372313|dbj|GAA88917.1| ADP-ribosylation factor 6 [Aspergillus kawachii IFO 4308]
          Length = 184

 Score =  228 bits (582), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 107/139 (76%), Positives = 121/139 (87%), Gaps = 1/139 (0%)

Query: 1   KLKL-NQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDS 59
           KLKL NQ VTTIPTVGFNVE+VTYKNVKFNVWDVGGQDKIRPLWRHYY+GTQGL+FVVDS
Sbjct: 36  KLKLTNQDVTTIPTVGFNVESVTYKNVKFNVWDVGGQDKIRPLWRHYYSGTQGLIFVVDS 95

Query: 60  QDRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWY 119
            D  R++EAR ELHKII+DREM+D LLLVFANKQD+QG MSP EVT+ L L ++K++ WY
Sbjct: 96  SDTARLEEARSELHKIINDREMKDALLLVFANKQDVQGHMSPEEVTQALQLTKLKDKLWY 155

Query: 120 VHPSCATTGEGLFEGLNWL 138
           V PS AT G G+FEGL WL
Sbjct: 156 VAPSVATEGTGIFEGLAWL 174



>gi|242782755|ref|XP_002480063.1| ADP-ribosylation factor 6, putative [Talaromyces stipitatus ATCC
           10500]
 gi|242782760|ref|XP_002480064.1| ADP-ribosylation factor 6, putative [Talaromyces stipitatus ATCC
           10500]
 gi|218720210|gb|EED19629.1| ADP-ribosylation factor 6, putative [Talaromyces stipitatus ATCC
           10500]
 gi|218720211|gb|EED19630.1| ADP-ribosylation factor 6, putative [Talaromyces stipitatus ATCC
           10500]
          Length = 184

 Score =  228 bits (582), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQ VTTIPTVGFNVE+VTYKNVKFNVWDVGGQDKIRPLWRHYY+GTQGL+FVVDS 
Sbjct: 36  KLKLNQDVTTIPTVGFNVESVTYKNVKFNVWDVGGQDKIRPLWRHYYSGTQGLIFVVDSS 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           D  R++EAR ELHKII+DREM+D LLLVFANKQD  G +SP E+T  L L+++K+R WYV
Sbjct: 96  DTARLNEARSELHKIINDREMKDALLLVFANKQDTPGHLSPEEITNALQLNKLKDRLWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            PS AT G G+FEGL WL
Sbjct: 156 VPSVATEGTGIFEGLAWL 173



>gi|169770883|ref|XP_001819911.1| ADP-ribosylation factor 6 [Aspergillus oryzae RIB40]
 gi|83767770|dbj|BAE57909.1| unnamed protein product [Aspergillus oryzae RIB40]
 gi|391867352|gb|EIT76598.1| GTP-binding ADP-ribosylation factor Arf6 [Aspergillus oryzae 3.042]
          Length = 184

 Score =  228 bits (580), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 121/139 (87%), Gaps = 1/139 (0%)

Query: 1   KLKL-NQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDS 59
           KLKL NQ VTTIPTVGFNVE+VTYKNVKFNVWDVGGQDKIRPLWRHYY+GTQGL+FVVDS
Sbjct: 36  KLKLTNQEVTTIPTVGFNVESVTYKNVKFNVWDVGGQDKIRPLWRHYYSGTQGLIFVVDS 95

Query: 60  QDRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWY 119
            D  R++EAR ELHKII+DREM+D LLLVFANKQD+QG MSP +VT  L L+++K++ WY
Sbjct: 96  SDTARMEEARSELHKIINDREMKDALLLVFANKQDIQGHMSPEDVTNALQLNKLKDKLWY 155

Query: 120 VHPSCATTGEGLFEGLNWL 138
           V PS AT G G+FEGL WL
Sbjct: 156 VAPSVATEGTGIFEGLAWL 174



>gi|210075497|ref|XP_501834.2| YALI0C14586p [Yarrowia lipolytica]
 gi|199425276|emb|CAG82145.2| YALI0C14586p [Yarrowia lipolytica CLIB122]
          Length = 182

 Score =  227 bits (579), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 121/138 (87%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQ ++T+PTVGFNVE +TYKN+KFNVWDVGGQDKIRPLWRHY+TGT+GL+FVVDS 
Sbjct: 36  KLKLNQGISTVPTVGFNVEVLTYKNIKFNVWDVGGQDKIRPLWRHYFTGTEGLIFVVDSA 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR RIDEARQELH+II+DREM+D LLLVFANKQDL+ AM P EVTEKL L+ +K R+W V
Sbjct: 96  DRARIDEARQELHRIINDREMKDVLLLVFANKQDLKEAMHPKEVTEKLQLNSLKGRTWCV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             S A TGEGL EGL+WL
Sbjct: 156 VASTAKTGEGLVEGLSWL 173



>gi|67537700|ref|XP_662624.1| hypothetical protein AN5020.2 [Aspergillus nidulans FGSC A4]
 gi|40741908|gb|EAA61098.1| conserved hypothetical protein [Aspergillus nidulans FGSC A4]
 gi|259482104|tpe|CBF76265.1| TPA: ADP ribosylation factor (Eurofung) [Aspergillus nidulans FGSC
           A4]
          Length = 185

 Score =  227 bits (578), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 119/139 (85%), Gaps = 1/139 (0%)

Query: 1   KLKL-NQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDS 59
           KLKL NQ VTTIPTVGFNVE+VTYKNVKFNVWDVGGQDKIRPLWRHYY+GTQGL+FVVDS
Sbjct: 36  KLKLTNQDVTTIPTVGFNVESVTYKNVKFNVWDVGGQDKIRPLWRHYYSGTQGLIFVVDS 95

Query: 60  QDRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWY 119
            D  R+DEAR ELHKII+DREM+D LLLVFANKQD+ G +SP EV   L LH +K+++WY
Sbjct: 96  SDTARMDEARSELHKIINDREMKDALLLVFANKQDVPGHLSPDEVISALKLHSLKDKTWY 155

Query: 120 VHPSCATTGEGLFEGLNWL 138
           V PS AT G G+FEGL WL
Sbjct: 156 VAPSVATEGTGIFEGLAWL 174



>gi|115396584|ref|XP_001213931.1| ADP-ribosylation factor 6 [Aspergillus terreus NIH2624]
 gi|114193500|gb|EAU35200.1| ADP-ribosylation factor 6 [Aspergillus terreus NIH2624]
          Length = 184

 Score =  227 bits (578), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 107/139 (76%), Positives = 120/139 (86%), Gaps = 1/139 (0%)

Query: 1   KLKL-NQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDS 59
           KLKL NQ VTTIPTVGFNVE+VTYKNVKFNVWDVGGQDKIRPLWRHYY+GTQGL+FVVDS
Sbjct: 36  KLKLTNQEVTTIPTVGFNVESVTYKNVKFNVWDVGGQDKIRPLWRHYYSGTQGLIFVVDS 95

Query: 60  QDRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWY 119
            D  R+DEAR ELHKII+DREM+D LLLVFANKQD+ G +SP EVT  L L+R+K++ WY
Sbjct: 96  SDTARLDEARSELHKIINDREMKDALLLVFANKQDVPGHLSPEEVTNALQLNRLKDKLWY 155

Query: 120 VHPSCATTGEGLFEGLNWL 138
           V PS AT G G+FEGL WL
Sbjct: 156 VAPSVATEGTGIFEGLAWL 174



>gi|212527138|ref|XP_002143726.1| ADP-ribosylation factor 6, putative [Talaromyces marneffei ATCC
           18224]
 gi|212527140|ref|XP_002143727.1| ADP-ribosylation factor 6, putative [Talaromyces marneffei ATCC
           18224]
 gi|210073124|gb|EEA27211.1| ADP-ribosylation factor 6, putative [Talaromyces marneffei ATCC
           18224]
 gi|210073125|gb|EEA27212.1| ADP-ribosylation factor 6, putative [Talaromyces marneffei ATCC
           18224]
          Length = 184

 Score =  226 bits (577), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 118/138 (85%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KL+LNQ VTTIPTVGFNVE VTYKNVKFNVWDVGGQDKIRPLWRHYY+GTQGL+FVVDS 
Sbjct: 36  KLRLNQDVTTIPTVGFNVENVTYKNVKFNVWDVGGQDKIRPLWRHYYSGTQGLIFVVDSS 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           D  R++EAR ELHKII+DREM+D LLLVFANKQD  G +SP E+T  L L+++K+R WYV
Sbjct: 96  DTARLNEARSELHKIINDREMKDALLLVFANKQDTPGHLSPEEITNALQLNKLKDRLWYV 155

Query: 121 HPSCATTGEGLFEGLNWL 138
            PS AT G G+FEGL WL
Sbjct: 156 VPSVATEGTGIFEGLAWL 173



>gi|121705884|ref|XP_001271205.1| ADP-ribosylation factor 6, putative [Aspergillus clavatus NRRL 1]
 gi|119399351|gb|EAW09779.1| ADP-ribosylation factor 6, putative [Aspergillus clavatus NRRL 1]
          Length = 184

 Score =  226 bits (577), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 105/139 (75%), Positives = 121/139 (87%), Gaps = 1/139 (0%)

Query: 1   KLKL-NQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDS 59
           KLKL NQ VTTIPTVGFNVE+VTYKNVKFNVWDVGGQDKIRPLWRHYY+GTQGL+FVVDS
Sbjct: 36  KLKLTNQDVTTIPTVGFNVESVTYKNVKFNVWDVGGQDKIRPLWRHYYSGTQGLIFVVDS 95

Query: 60  QDRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWY 119
            D  R++EAR ELHKII+DREM+D LLLVFANKQD+QG +SP E+T  L L+++K++ WY
Sbjct: 96  SDTARLEEARSELHKIINDREMKDALLLVFANKQDVQGHLSPEEITNALQLNKLKDKLWY 155

Query: 120 VHPSCATTGEGLFEGLNWL 138
           V PS AT G G+FEGL WL
Sbjct: 156 VAPSVATEGTGIFEGLAWL 174



>gi|449303399|gb|EMC99407.1| hypothetical protein BAUCODRAFT_31727 [Baudoinia compniacensis UAMH
           10762]
          Length = 183

 Score =  226 bits (576), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 105/139 (75%), Positives = 120/139 (86%), Gaps = 1/139 (0%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL+  VTTIPTVGFNVETVTYKN KFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 36  KLKLDTDVTTIPTVGFNVETVTYKNTKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHR-MKERSWY 119
           DRDR+DEA++EL +II DREM+D LLLVFANKQD++GAMSP EV+ +L L R  K   W 
Sbjct: 96  DRDRMDEAKKELERIIQDREMKDALLLVFANKQDIRGAMSPKEVSNELELDRTAKGHVWK 155

Query: 120 VHPSCATTGEGLFEGLNWL 138
           V PSCATTGEG+FEGL WL
Sbjct: 156 VEPSCATTGEGIFEGLAWL 174



>gi|367026273|ref|XP_003662421.1| hypothetical protein MYCTH_2303019 [Myceliophthora thermophila ATCC
           42464]
 gi|347009689|gb|AEO57176.1| hypothetical protein MYCTH_2303019 [Myceliophthora thermophila ATCC
           42464]
          Length = 188

 Score =  226 bits (576), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 118/138 (85%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQ++TTIPTVGFNVE  TYKN+KFN+WDVGGQDKIRPLWRHYY+GTQGLVFVVDS 
Sbjct: 38  KLKLNQTMTTIPTVGFNVEAFTYKNIKFNMWDVGGQDKIRPLWRHYYSGTQGLVFVVDSS 97

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           D  RIDEA+ ELH+I++D EM DCLLLVFANKQD+QGAM P  +TE+L L ++KER W+V
Sbjct: 98  DHKRIDEAKTELHRILNDLEMSDCLLLVFANKQDIQGAMDPQTITERLELSKLKERPWFV 157

Query: 121 HPSCATTGEGLFEGLNWL 138
            P+ A  GEGL EG +WL
Sbjct: 158 QPAIAIEGEGLTEGFSWL 175



>gi|452847539|gb|EME49471.1| hypothetical protein DOTSEDRAFT_30701 [Dothistroma septosporum
           NZE10]
          Length = 184

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 104/139 (74%), Positives = 120/139 (86%), Gaps = 1/139 (0%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL+  VTTIPTVGFNVETVTYKN KFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 36  KLKLDTDVTTIPTVGFNVETVTYKNTKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRM-KERSWY 119
           DRDRI+EAR EL +II DREM+D LLLVFANKQD+ GAM P +V++ L L R+ K+ +W 
Sbjct: 96  DRDRIEEARSELGRIIQDREMKDALLLVFANKQDIAGAMRPKDVSDALDLSRIAKDHTWK 155

Query: 120 VHPSCATTGEGLFEGLNWL 138
           V PSCATTGEG+FEGL WL
Sbjct: 156 VEPSCATTGEGIFEGLAWL 174



>gi|452988220|gb|EME87975.1| hypothetical protein MYCFIDRAFT_26297 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 184

 Score =  226 bits (576), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 104/139 (74%), Positives = 120/139 (86%), Gaps = 1/139 (0%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL+  VTTIPTVGFNVETVTYKN KFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 36  KLKLDTDVTTIPTVGFNVETVTYKNTKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRM-KERSWY 119
           DRDR++EAR EL +II DREM+D LLLVFANKQD+ GAM P EV++ L L R+ K+ +W 
Sbjct: 96  DRDRMEEARSELARIIQDREMKDALLLVFANKQDIPGAMRPKEVSDMLELQRIAKDHTWK 155

Query: 120 VHPSCATTGEGLFEGLNWL 138
           V PSCATTGEG+FEGL WL
Sbjct: 156 VEPSCATTGEGIFEGLAWL 174



>gi|425768456|gb|EKV06978.1| ADP-ribosylation factor 6, putative [Penicillium digitatum Pd1]
 gi|425770277|gb|EKV08750.1| ADP-ribosylation factor 6, putative [Penicillium digitatum PHI26]
          Length = 184

 Score =  226 bits (575), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 105/139 (75%), Positives = 121/139 (87%), Gaps = 1/139 (0%)

Query: 1   KLKL-NQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDS 59
           KLKL NQ VTTIPTVGFNVE+VTYKNVKFNVWDVGGQDKIRPLWRHYY+GTQGL+FVVDS
Sbjct: 36  KLKLSNQDVTTIPTVGFNVESVTYKNVKFNVWDVGGQDKIRPLWRHYYSGTQGLIFVVDS 95

Query: 60  QDRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWY 119
            D  R++EAR ELHKII+DREM+D LLLVFANKQD+ G +SP E+TE+L L ++K++ WY
Sbjct: 96  SDTARLEEARSELHKIINDREMKDALLLVFANKQDVAGHLSPEEITEQLHLTKLKDKLWY 155

Query: 120 VHPSCATTGEGLFEGLNWL 138
           V PS AT G G+FEGL WL
Sbjct: 156 VTPSVATDGTGIFEGLAWL 174



>gi|167518131|ref|XP_001743406.1| hypothetical protein [Monosiga brevicollis MX1]
 gi|163778505|gb|EDQ92120.1| predicted protein [Monosiga brevicollis MX1]
          Length = 176

 Score =  226 bits (575), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 104/139 (74%), Positives = 123/139 (88%), Gaps = 1/139 (0%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLN  V+TIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGL+FVVD  
Sbjct: 32  KLKLNNPVSTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCA 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRM-KERSWY 119
           DR+RIDEAR+ELHKI++DREM+D ++L+FANKQD++GA+ P E+ + LGL R+ K+R+WY
Sbjct: 92  DRERIDEARRELHKILNDREMKDAIVLIFANKQDIKGAILPEELPDLLGLTRLTKDRTWY 151

Query: 120 VHPSCATTGEGLFEGLNWL 138
           V P  ATTG+GL EGL WL
Sbjct: 152 VQPCVATTGDGLVEGLTWL 170



>gi|398411346|ref|XP_003857013.1| hypothetical protein MYCGRDRAFT_31461 [Zymoseptoria tritici IPO323]
 gi|339476898|gb|EGP91989.1| hypothetical protein MYCGRDRAFT_31461 [Zymoseptoria tritici IPO323]
          Length = 183

 Score =  225 bits (574), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 104/139 (74%), Positives = 120/139 (86%), Gaps = 1/139 (0%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL+  VTTIPTVGFNVETVTYKN KFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 36  KLKLDTDVTTIPTVGFNVETVTYKNTKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRM-KERSWY 119
           DRDRI+EAR EL +II DREM+D LLLVFANKQD+ GAM P EV++ L L R+ ++ +W 
Sbjct: 96  DRDRIEEARSELARIIQDREMKDALLLVFANKQDVPGAMRPKEVSDALDLGRIARDHTWK 155

Query: 120 VHPSCATTGEGLFEGLNWL 138
           V PSCATTGEG+FEGL WL
Sbjct: 156 VEPSCATTGEGIFEGLAWL 174



>gi|255942213|ref|XP_002561875.1| Pc18g00280 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211586608|emb|CAP94252.1| Pc18g00280 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 184

 Score =  225 bits (573), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 104/139 (74%), Positives = 121/139 (87%), Gaps = 1/139 (0%)

Query: 1   KLKL-NQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDS 59
           KLKL NQ VTTIPTVGFNVE+VTYKNVKFNVWDVGGQDKIRPLWRHYY+GTQGL+FVVDS
Sbjct: 36  KLKLSNQDVTTIPTVGFNVESVTYKNVKFNVWDVGGQDKIRPLWRHYYSGTQGLIFVVDS 95

Query: 60  QDRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWY 119
            D  R++EAR ELHKII+DREM+D LLLVFANKQD+ G +SP E+T++L L ++K++ WY
Sbjct: 96  SDTARVEEARSELHKIINDREMKDALLLVFANKQDIPGHLSPEEITQQLQLTKLKDKLWY 155

Query: 120 VHPSCATTGEGLFEGLNWL 138
           V PS AT G G+FEGL WL
Sbjct: 156 VAPSVATDGTGIFEGLAWL 174



>gi|453089810|gb|EMF17850.1| ADP-ribosylation factor 6 [Mycosphaerella populorum SO2202]
          Length = 184

 Score =  225 bits (573), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 120/139 (86%), Gaps = 1/139 (0%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL+  VTTIPTVGFNVETVTYKN KFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 36  KLKLDTDVTTIPTVGFNVETVTYKNTKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRM-KERSWY 119
           DRDR++EAR EL +II DREM+D LLLVFANKQD+ GAM P EV++ L L R+ ++ +W 
Sbjct: 96  DRDRMEEARSELARIIQDREMKDALLLVFANKQDIPGAMRPKEVSDMLDLQRIARDHTWK 155

Query: 120 VHPSCATTGEGLFEGLNWL 138
           V PSCATTGEG+FEGL WL
Sbjct: 156 VEPSCATTGEGIFEGLAWL 174



>gi|56756693|gb|AAW26519.1| SJCHGC04671 protein [Schistosoma japonicum]
          Length = 177

 Score =  225 bits (573), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 121/139 (87%), Gaps = 1/139 (0%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           +LKL  SV+TIPTVGFNVETVTYKNVKFNVWDVGGQ+KIRPLWRHY+TG+QGL+FVVDS 
Sbjct: 32  RLKLGSSVSTIPTVGFNVETVTYKNVKFNVWDVGGQEKIRPLWRHYFTGSQGLIFVVDSS 91

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKE-RSWY 119
           DRDRI+EARQELH+I +DREM+D ++LVFANKQDL  AM P E+ E+L L ++ + R WY
Sbjct: 92  DRDRIEEARQELHRIAADREMQDAVILVFANKQDLPNAMKPNEIQERLMLAKLSQGRLWY 151

Query: 120 VHPSCATTGEGLFEGLNWL 138
           V PS ATTGEGL+EGL WL
Sbjct: 152 VQPSIATTGEGLYEGLTWL 170



>gi|340939081|gb|EGS19703.1| putative ADP-ribosylation factor [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 188

 Score =  225 bits (573), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 118/138 (85%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKLNQ++TTIPTVGFNVE  TYKN+KFN+WDVGGQDKIRPLWRHYY+GTQ LVFVVDS 
Sbjct: 38  KLKLNQTMTTIPTVGFNVENFTYKNIKFNMWDVGGQDKIRPLWRHYYSGTQALVFVVDSA 97

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           D  RIDEA+ ELH+I++DREM +CLLLVFANKQD+ GAM P ++TEKL LH++ +R WYV
Sbjct: 98  DHARIDEAKTELHRILNDREMSECLLLVFANKQDIAGAMDPQKITEKLELHKLGDRPWYV 157

Query: 121 HPSCATTGEGLFEGLNWL 138
            P+ A  GEGL EG +WL
Sbjct: 158 QPAIAIDGEGLTEGFSWL 175



>gi|70999388|ref|XP_754413.1| ADP-ribosylation factor 6 [Aspergillus fumigatus Af293]
 gi|119491470|ref|XP_001263256.1| ADP-ribosylation factor 6, putative [Neosartorya fischeri NRRL 181]
 gi|66852050|gb|EAL92375.1| ADP-ribosylation factor 6, putative [Aspergillus fumigatus Af293]
 gi|119411416|gb|EAW21359.1| ADP-ribosylation factor 6, putative [Neosartorya fischeri NRRL 181]
 gi|159127429|gb|EDP52544.1| ADP-ribosylation factor 6, putative [Aspergillus fumigatus A1163]
          Length = 184

 Score =  224 bits (571), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 105/139 (75%), Positives = 120/139 (86%), Gaps = 1/139 (0%)

Query: 1   KLKL-NQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDS 59
           KLKL NQ VTTIPTVGFNVE+VTYKNVKFNVWDVGGQDKIRPLWRHYY+GTQGL+FVVDS
Sbjct: 36  KLKLTNQDVTTIPTVGFNVESVTYKNVKFNVWDVGGQDKIRPLWRHYYSGTQGLIFVVDS 95

Query: 60  QDRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWY 119
            D  R++EAR ELHKII+DREM+D LLLVFANKQD+ G +SP EVT  L L+++K++ WY
Sbjct: 96  SDTARMEEARSELHKIINDREMKDALLLVFANKQDVPGHLSPEEVTNALQLNKLKDKLWY 155

Query: 120 VHPSCATTGEGLFEGLNWL 138
           V PS AT G G+FEGL WL
Sbjct: 156 VAPSVATEGTGIFEGLAWL 174



>gi|451847155|gb|EMD60463.1| hypothetical protein COCSADRAFT_243223 [Bipolaris sorokiniana
           ND90Pr]
 gi|451997918|gb|EMD90383.1| hypothetical protein COCHEDRAFT_1139716 [Bipolaris maydis C5]
 gi|477592334|gb|ENI09405.1| hypothetical protein COCC4DRAFT_126506 [Bipolaris maydis ATCC
           48331]
 gi|482813592|gb|EOA90283.1| hypothetical protein SETTUDRAFT_167184 [Setosphaeria turcica Et28A]
          Length = 185

 Score =  223 bits (568), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 104/139 (74%), Positives = 119/139 (85%), Gaps = 1/139 (0%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL+Q VTTIPTVGFNVETVTYKN KFNVWDVGGQDKIRPLWRHY++GTQGL+FV+DS 
Sbjct: 36  KLKLDQDVTTIPTVGFNVETVTYKNTKFNVWDVGGQDKIRPLWRHYFSGTQGLIFVIDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRM-KERSWY 119
           DR RI+EA+ EL +II DREM+D LLLVFANKQDL GAM P EV++ L L ++ K+  W 
Sbjct: 96  DRARIEEAKTELTRIIQDREMKDALLLVFANKQDLSGAMRPKEVSDLLQLDKIAKDHVWK 155

Query: 120 VHPSCATTGEGLFEGLNWL 138
           V PSCATTGEG+FEGL WL
Sbjct: 156 VEPSCATTGEGIFEGLAWL 174



>gi|336259625|ref|XP_003344613.1| hypothetical protein SMAC_06922 [Sordaria macrospora k-hell]
 gi|380088690|emb|CCC13424.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 184

 Score =  223 bits (568), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 102/138 (73%), Positives = 118/138 (85%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL   VTTIPTVGFNVETVT +N+KFN+WDVGGQDKIRPLWRHYY+GTQGL+FVVDS 
Sbjct: 37  KLKLQDHVTTIPTVGFNVETVTLRNIKFNIWDVGGQDKIRPLWRHYYSGTQGLIFVVDSA 96

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           D  RIDEAR ELH+II+DREM+DCLLLVFANKQD+ GAM+PAEVTEKL L+++K+R + V
Sbjct: 97  DHARIDEARVELHRIINDREMKDCLLLVFANKQDIAGAMTPAEVTEKLQLNKLKDRIYAV 156

Query: 121 HPSCATTGEGLFEGLNWL 138
            P+ A    GL EG NWL
Sbjct: 157 QPTIAIDKAGLQEGFNWL 174



>gi|238486636|ref|XP_002374556.1| ADP-ribosylation factor 6, putative [Aspergillus flavus NRRL3357]
 gi|220699435|gb|EED55774.1| ADP-ribosylation factor 6, putative [Aspergillus flavus NRRL3357]
          Length = 286

 Score =  223 bits (567), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 119/136 (87%), Gaps = 1/136 (0%)

Query: 1   KLKL-NQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDS 59
           KLKL NQ VTTIPTVGFNVE+VTYKNVKFNVWDVGGQDKIRPLWRHYY+GTQGL+FVVDS
Sbjct: 36  KLKLTNQEVTTIPTVGFNVESVTYKNVKFNVWDVGGQDKIRPLWRHYYSGTQGLIFVVDS 95

Query: 60  QDRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWY 119
            D  R++EAR ELHKII+DREM+D LLLVFANKQD+QG MSP +VT  L L+++K++ WY
Sbjct: 96  SDTARMEEARSELHKIINDREMKDALLLVFANKQDIQGHMSPEDVTNALQLNKLKDKLWY 155

Query: 120 VHPSCATTGEGLFEGL 135
           V PS AT G G+FEGL
Sbjct: 156 VAPSVATEGTGIFEGL 171



>gi|294947932|ref|XP_002785532.1| ADP ribosylation factor 1, putative [Perkinsus marinus ATCC 50983]
 gi|239899511|gb|EER17328.1| ADP ribosylation factor 1, putative [Perkinsus marinus ATCC 50983]
          Length = 181

 Score =  222 bits (566), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 96/138 (69%), Positives = 120/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHYY  TQG++FVVDS 
Sbjct: 36  KLKLGEVVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYYQNTQGIIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRID+A++ELH+++++ E+RD  +LVFANKQDL  AM+ AEVTEKLGLH ++ R+WY+
Sbjct: 96  DRDRIDDAKEELHRMLNEEELRDACVLVFANKQDLPNAMTAAEVTEKLGLHSLRHRNWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CATTG+GL+EGL+WL
Sbjct: 156 QSACATTGDGLYEGLDWL 173



>gi|221482979|gb|EEE21303.1| ADP-ribosylation factor, arf, putative [Toxoplasma gondii GT1]
          Length = 554

 Score =  222 bits (565), Expect = 3e-56,   Method: Composition-based stats.
 Identities = 91/138 (65%), Positives = 120/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY++ T GL+FV+DS 
Sbjct: 407 KLKLGEVVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFSNTHGLIFVIDSN 466

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRI++AR+ELH+++++ E+RD +LL+FANKQDL  AM+ AEVT+KL LH ++ R+W++
Sbjct: 467 DRDRIEDAREELHRMLNEDELRDAVLLIFANKQDLPNAMTAAEVTDKLHLHSIRHRNWFI 526

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CATTG+GL+EGL+WL
Sbjct: 527 QSTCATTGDGLYEGLDWL 544



>gi|125546170|gb|EAY92309.1| hypothetical protein OsI_14032 [Oryza sativa Indica Group]
          Length = 354

 Score =  221 bits (564), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 96/138 (69%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CATTGEGL+EGL+WL
Sbjct: 156 QSTCATTGEGLYEGLDWL 173



>gi|85084903|ref|XP_957398.1| ADP-ribosylation factor 6 [Neurospora crassa OR74A]
 gi|28918489|gb|EAA28162.1| ADP-ribosylation factor 6 [Neurospora crassa OR74A]
 gi|28950269|emb|CAD71135.1| probable ADP-ribosylation factor 6 [Neurospora crassa]
 gi|336471895|gb|EGO60055.1| hypothetical protein NEUTE1DRAFT_119351 [Neurospora tetrasperma
           FGSC 2508]
 gi|350294911|gb|EGZ75996.1| putative ADP-ribosylation factor 6 [Neurospora tetrasperma FGSC
           2509]
          Length = 184

 Score =  221 bits (564), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 118/138 (85%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL   VTTIPTVGFNVETVT +N+KFN+WDVGGQDKIRPLWRHYY+GTQGL+FVVDS 
Sbjct: 37  KLKLQDHVTTIPTVGFNVETVTLRNIKFNIWDVGGQDKIRPLWRHYYSGTQGLIFVVDSA 96

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           D +RIDEAR ELH+II+DREM+DCLLLVFANKQD+ GAM+P EVTEKL L+++K+R + V
Sbjct: 97  DHNRIDEARVELHRIINDREMKDCLLLVFANKQDIAGAMTPQEVTEKLQLNKLKDRIYAV 156

Query: 121 HPSCATTGEGLFEGLNWL 138
            P+ A    GL EG NWL
Sbjct: 157 QPTIAIDKAGLQEGFNWL 174



>gi|317134997|gb|ADV03061.1| ADP ribosylation factor 1 [Amphidinium carterae]
 gi|317135019|gb|ADV03072.1| ADP ribosylation factor [Amphidinium carterae]
          Length = 181

 Score =  221 bits (564), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 120/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHYYTGT GL+FVVDS 
Sbjct: 36  KLKLGEVVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYYTGTNGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+++AR+EL K++++ EMRD ++LVFANKQDL  AM+ AEVTEKLGLH ++ R W++
Sbjct: 96  DRDRVEDAREELTKMLNEDEMRDAVVLVFANKQDLPNAMTAAEVTEKLGLHNLRHRQWFI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CATTG+GL+EGL+WL
Sbjct: 156 QSACATTGDGLYEGLDWL 173



>gi|396485413|ref|XP_003842165.1| similar to ADP-ribosylation factor 6 [Leptosphaeria maculans JN3]
 gi|312218741|emb|CBX98686.1| similar to ADP-ribosylation factor 6 [Leptosphaeria maculans JN3]
          Length = 201

 Score =  221 bits (564), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 122/155 (78%), Gaps = 17/155 (10%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTG----------- 49
           KLKL+Q VTTIPTVGFNVE+VTYKN KFNVWDVGGQDKIRPLWRHY++G           
Sbjct: 36  KLKLDQDVTTIPTVGFNVESVTYKNTKFNVWDVGGQDKIRPLWRHYFSGMLGRDRTVPGM 95

Query: 50  -----TQGLVFVVDSQDRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEV 104
                TQGL+FV+DS DRDRIDEAR EL +II DREM+D LLLVFANKQDLQGAM P EV
Sbjct: 96  QVSKRTQGLIFVIDSNDRDRIDEARTELTRIIQDREMKDALLLVFANKQDLQGAMRPKEV 155

Query: 105 TEKLGLHRM-KERSWYVHPSCATTGEGLFEGLNWL 138
           +++L L ++ K+  W V PSCATTGEG+FEGL WL
Sbjct: 156 SDRLQLDKIAKDHVWKVEPSCATTGEGIFEGLAWL 190



>gi|112253200|gb|ABI14189.1| ADP-ribosylation factor [Pfiesteria piscicida]
 gi|112253204|gb|ABI14190.1| ADP-ribosylation factor [Pfiesteria piscicida]
 gi|112253214|gb|ABI14195.1| ADP-ribosylation factor 1 [Pfiesteria piscicida]
 gi|112253218|gb|ABI14197.1| ADP-ribosylation factor [Pfiesteria piscicida]
 gi|112253220|gb|ABI14198.1| ADP-ribosylation factor [Pfiesteria piscicida]
 gi|112253224|gb|ABI14200.1| ADP-ribosylation factor [Pfiesteria piscicida]
          Length = 181

 Score =  221 bits (563), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 121/138 (87%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHYY GT GL++VVDS 
Sbjct: 36  KLKLGEVVTTIPTIGFNVETVEYKNLSFTVWDVGGQDKIRPLWRHYYQGTNGLIYVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRI++AR+EL+K++++ EMRD +LLVFANKQDL  AM+ AEVTEKLGLH +++R W++
Sbjct: 96  DRDRIEDAREELNKMLNEDEMRDAVLLVFANKQDLPNAMTAAEVTEKLGLHNLRQRQWFI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CATTG+GL+EGL+WL
Sbjct: 156 QSACATTGDGLYEGLDWL 173



>gi|413932673|gb|AFW67224.1| hypothetical protein ZEAMMB73_332083 [Zea mays]
          Length = 206

 Score =  221 bits (563), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 96/138 (69%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CATTGEGL+EGL+WL
Sbjct: 156 QSTCATTGEGLYEGLDWL 173



>gi|198420010|ref|XP_002129929.1| PREDICTED: ADP-ribosylation factor 3 isoform 1 [Ciona intestinalis]
          Length = 196

 Score =  221 bits (563), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL Q+VTTIPTVGFNVETV YKN +FNVWDVGGQDKIRPLWRHYYTGTQGL+FV+D  
Sbjct: 53  KLKLGQAVTTIPTVGFNVETVVYKNTRFNVWDVGGQDKIRPLWRHYYTGTQGLIFVIDCA 112

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           D DRI+EA+ ELH+II+DREMRD ++LVFANKQDL  AM P ++  KLGL ++++R+W+V
Sbjct: 113 DADRIEEAKVELHRIINDREMRDAVILVFANKQDLPDAMKPCDLQSKLGLTKLRDRNWFV 172

Query: 121 HPSCATTGEGLFEGLNWL 138
            PSCA +G+GL +GL WL
Sbjct: 173 QPSCAVSGDGLEDGLRWL 190



>gi|29124979|gb|AAO63779.1| ADP-ribosylation factor 1 [Populus tremuloides]
          Length = 181

 Score =  220 bits (561), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 120/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR+ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVGEAREELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



>gi|222636687|gb|EEE66819.1| hypothetical protein OsJ_23579 [Oryza sativa Japonica Group]
          Length = 279

 Score =  220 bits (561), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 96/138 (69%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 134 KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 193

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 194 DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 253

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CATTGEGL+EGL+WL
Sbjct: 254 QSTCATTGEGLYEGLDWL 271



>gi|242056935|ref|XP_002457613.1| hypothetical protein SORBIDRAFT_03g010350 [Sorghum bicolor]
 gi|241929588|gb|EES02733.1| hypothetical protein SORBIDRAFT_03g010350 [Sorghum bicolor]
          Length = 181

 Score =  220 bits (561), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 96/138 (69%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CATTGEGL+EGL+WL
Sbjct: 156 QSTCATTGEGLYEGLDWL 173



>gi|242037651|ref|XP_002466220.1| hypothetical protein SORBIDRAFT_01g003770 [Sorghum bicolor]
 gi|241920074|gb|EER93218.1| hypothetical protein SORBIDRAFT_01g003770 [Sorghum bicolor]
          Length = 181

 Score =  220 bits (561), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 96/138 (69%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CATTGEGL+EGL+WL
Sbjct: 156 QSTCATTGEGLYEGLDWL 173



>gi|145353078|ref|XP_001420856.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gi|308810236|ref|XP_003082427.1| unnamed protein product [Ostreococcus tauri]
 gi|116060895|emb|CAL57373.1| unnamed protein product [Ostreococcus tauri]
 gi|144581091|gb|ABO99149.1| predicted protein [Ostreococcus lucimarinus CCE9901]
          Length = 181

 Score =  220 bits (561), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AMS AE+T+KLGLH +++R W++
Sbjct: 96  DRDRVSEARDELHRMLNEDELRDAVLLVFANKQDLPNAMSAAEITDKLGLHSLRQRHWFI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



>gi|115456151|ref|NP_001051676.1| Os03g0811900 [Oryza sativa Japonica Group]
 gi|32129330|gb|AAP73857.1| ADP-ribosylation factor [Oryza sativa Japonica Group]
 gi|108711705|gb|ABF99500.1| ADP-ribosylation factor, putative, expressed [Oryza sativa Japonica
           Group]
 gi|108711706|gb|ABF99501.1| ADP-ribosylation factor, putative, expressed [Oryza sativa Japonica
           Group]
 gi|108711709|gb|ABF99504.1| ADP-ribosylation factor, putative, expressed [Oryza sativa Japonica
           Group]
 gi|113550147|dbj|BAF13590.1| Os03g0811900 [Oryza sativa Japonica Group]
 gi|440577393|emb|CCI55417.1| PH01B015M02.18 [Phyllostachys edulis]
          Length = 181

 Score =  220 bits (561), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 96/138 (69%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CATTGEGL+EGL+WL
Sbjct: 156 QSTCATTGEGLYEGLDWL 173



>gi|115435820|ref|NP_001042668.1| Os01g0265100 [Oryza sativa Japonica Group]
 gi|6815060|dbj|BAA90347.1| putative ADP-ribosylation factor [Oryza sativa Japonica Group]
 gi|7242921|dbj|BAA92519.1| putative ADP-ribosylation factor [Oryza sativa Japonica Group]
 gi|113532199|dbj|BAF04582.1| Os01g0265100 [Oryza sativa Japonica Group]
 gi|215695127|dbj|BAG90318.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 181

 Score =  220 bits (560), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 96/138 (69%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CATTGEGL+EGL+WL
Sbjct: 156 QSTCATTGEGLYEGLDWL 173



>gi|297578415|gb|ADI46685.1| ADP-ribosylation factor [Monascus purpureus]
          Length = 184

 Score =  220 bits (560), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 104/139 (74%), Positives = 118/139 (84%), Gaps = 1/139 (0%)

Query: 1   KLKL-NQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDS 59
           KLKL NQ VTTIPTVGFNVE+VTYKNVKFNVWDVGGQDKIRPLWRHYY+GTQGL+FVVDS
Sbjct: 36  KLKLTNQDVTTIPTVGFNVESVTYKNVKFNVWDVGGQDKIRPLWRHYYSGTQGLIFVVDS 95

Query: 60  QDRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWY 119
            D  R+DEAR ELHKII+DREM+D LLLVFANKQD+ G +SP E+T  L L ++K++ WY
Sbjct: 96  SDTARLDEARSELHKIINDREMKDALLLVFANKQDITGHLSPEEITNALQLTKLKDKLWY 155

Query: 120 VHPSCATTGEGLFEGLNWL 138
           V PS AT G G+FEGL  L
Sbjct: 156 VVPSIATEGTGVFEGLARL 174



>gi|357111133|ref|XP_003557369.1| PREDICTED: ADP-ribosylation factor 1-like [Brachypodium distachyon]
          Length = 181

 Score =  220 bits (560), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 96/138 (69%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CATTGEGL+EGL+WL
Sbjct: 156 QSTCATTGEGLYEGLDWL 173



>gi|194693624|gb|ACF80896.1| unknown [Zea mays]
 gi|413932674|gb|AFW67225.1| ADP-ribosylation factor [Zea mays]
          Length = 181

 Score =  220 bits (560), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 96/138 (69%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CATTGEGL+EGL+WL
Sbjct: 156 QSTCATTGEGLYEGLDWL 173



>gi|115471217|ref|NP_001059207.1| Os07g0223400 [Oryza sativa Japonica Group]
 gi|226496383|ref|NP_001147310.1| ADP-ribosylation factor 1 [Zea mays]
 gi|226497728|ref|NP_001146953.1| ADP-ribosylation factor 1 [Zea mays]
 gi|242043366|ref|XP_002459554.1| hypothetical protein SORBIDRAFT_02g006540 [Sorghum bicolor]
 gi|2293566|gb|AAB65432.1| ADP-ribosylation factor 1 [Oryza sativa]
 gi|22093618|dbj|BAC06914.1| ADP-ribosylation factor 1 [Oryza sativa Japonica Group]
 gi|27261078|dbj|BAC45192.1| ADP-ribosylation factor 1 [Oryza sativa Japonica Group]
 gi|50508690|dbj|BAD31195.1| ADP-ribosylation factor 1 [Oryza sativa Japonica Group]
 gi|113610743|dbj|BAF21121.1| Os07g0223400 [Oryza sativa Japonica Group]
 gi|194698498|gb|ACF83333.1| unknown [Zea mays]
 gi|195605784|gb|ACG24722.1| ADP-ribosylation factor 1 [Zea mays]
 gi|195609764|gb|ACG26712.1| ADP-ribosylation factor 1 [Zea mays]
 gi|215768998|dbj|BAH01227.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|215769406|dbj|BAH01635.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|218199318|gb|EEC81745.1| hypothetical protein OsI_25399 [Oryza sativa Indica Group]
 gi|218199319|gb|EEC81746.1| hypothetical protein OsI_25400 [Oryza sativa Indica Group]
 gi|223972869|gb|ACN30622.1| unknown [Zea mays]
 gi|241922931|gb|EER96075.1| hypothetical protein SORBIDRAFT_02g006540 [Sorghum bicolor]
 gi|414884023|tpg|DAA60037.1| TPA: ADP-ribosylation factor 1 [Zea mays]
          Length = 181

 Score =  220 bits (560), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 96/138 (69%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CATTGEGL+EGL+WL
Sbjct: 156 QSTCATTGEGLYEGLDWL 173



>gi|112253198|gb|ABI14188.1| ADP-ribosylation factor [Pfiesteria piscicida]
 gi|112253212|gb|ABI14194.1| ADP-ribosylation factor [Pfiesteria piscicida]
 gi|112253216|gb|ABI14196.1| ADP-ribosylation factor [Pfiesteria piscicida]
 gi|255965513|gb|ACU45061.1| ribosylation factor 1 [Pfiesteria piscicida]
          Length = 181

 Score =  220 bits (560), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 120/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHYY GT GL++VVDS 
Sbjct: 36  KLKLGEVVTTIPTIGFNVETVEYKNLSFTVWDVGGQDKIRPLWRHYYQGTNGLIYVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRI++AR+EL+K++++ EMRD +LLVFANKQDL  AM+ AEVTEKLGLH ++ R W++
Sbjct: 96  DRDRIEDAREELNKMLNEDEMRDAVLLVFANKQDLPNAMTAAEVTEKLGLHNLRHRQWFI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CATTG+GL+EGL+WL
Sbjct: 156 QSACATTGDGLYEGLDWL 173



>gi|222636686|gb|EEE66818.1| hypothetical protein OsJ_23578 [Oryza sativa Japonica Group]
          Length = 241

 Score =  220 bits (560), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 96/138 (69%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 96  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 155

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 156 DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 215

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CATTGEGL+EGL+WL
Sbjct: 216 QSTCATTGEGLYEGLDWL 233



>gi|424513379|emb|CCO66001.1| ADP-ribosylation factor [Bathycoccus prasinos]
          Length = 222

 Score =  220 bits (560), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 78  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 137

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRI EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R W++
Sbjct: 138 DRDRISEARDELHRMLNEDELRDAVLLVFANKQDLPNAMTAAEITDKLGLHSLRQRHWFI 197

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 198 QSTCATSGEGLYEGLDWL 215



>gi|195618900|gb|ACG31280.1| ADP-ribosylation factor 1 [Zea mays]
          Length = 181

 Score =  220 bits (560), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 96/138 (69%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CATTGEGL+EGL+WL
Sbjct: 156 QSTCATTGEGLYEGLDWL 173



>gi|357495837|ref|XP_003618207.1| ADP-ribosylation factor [Medicago truncatula]
 gi|355493222|gb|AES74425.1| ADP-ribosylation factor [Medicago truncatula]
          Length = 248

 Score =  220 bits (560), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 103 KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 162

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 163 DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 222

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 223 QSTCATSGEGLYEGLDWL 240



>gi|384245653|gb|EIE19146.1| ADP-ribosylation factor 1 [Coccomyxa subellipsoidea C-169]
          Length = 181

 Score =  220 bits (560), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 96/138 (69%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRI EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRIGEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



>gi|357485863|ref|XP_003613219.1| ADP-ribosylation factor [Medicago truncatula]
 gi|355514554|gb|AES96177.1| ADP-ribosylation factor [Medicago truncatula]
          Length = 454

 Score =  220 bits (560), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



 Score =  220 bits (560), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 309 KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 368

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 369 DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 428

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 429 QSTCATSGEGLYEGLDWL 446



>gi|148909114|gb|ABR17658.1| unknown [Picea sitchensis]
 gi|224285018|gb|ACN40238.1| unknown [Picea sitchensis]
          Length = 181

 Score =  219 bits (559), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVAEARDELHRMLNEDELRDAVLLVFANKQDLPNAMTAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



>gi|393241064|gb|EJD48588.1| ARF/SAR [Auricularia delicata TFB-10046 SS5]
          Length = 181

 Score =  219 bits (559), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 120/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQG++FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGIIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR+ELH+++++ E+RD LLLVFANKQDL  AM+ AE+T+KLGLH +++R+WY+
Sbjct: 96  DRDRVSEAREELHRMLNEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHGLRQRTWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+G+GL+EGL WL
Sbjct: 156 QAACATSGDGLYEGLEWL 173



>gi|353441154|gb|AEQ94161.1| ADP-ribosylation factor [Elaeis guineensis]
          Length = 181

 Score =  219 bits (559), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 96/138 (69%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRI EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



>gi|219957610|gb|ACL67836.1| ADP ribosylation factor [Jatropha curcas]
          Length = 181

 Score =  219 bits (559), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 96/138 (69%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRI EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRIVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



>gi|159465365|ref|XP_001690893.1| small ARF-related GTPase [Chlamydomonas reinhardtii]
 gi|159466569|ref|XP_001691481.1| small ARF-related GTPase [Chlamydomonas reinhardtii]
 gi|158270296|gb|EDO96164.1| small ARF-related GTPase [Chlamydomonas reinhardtii]
 gi|158279579|gb|EDP05339.1| small ARF-related GTPase [Chlamydomonas reinhardtii]
          Length = 181

 Score =  219 bits (559), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 96/138 (69%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDRI EA+ ELH+++++ E+RD +LLVFANKQDL  AM+ AE+TEKLGLH +++R WY+
Sbjct: 96  DRDRIGEAKDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITEKLGLHGLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



>gi|460365320|ref|XP_004228551.1| PREDICTED: ADP-ribosylation factor 2-like [Solanum lycopersicum]
          Length = 181

 Score =  219 bits (559), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVGEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



>gi|297736783|emb|CBI25984.3| unnamed protein product [Vitis vinifera]
          Length = 211

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 66  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 125

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 126 DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 185

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 186 QSTCATSGEGLYEGLDWL 203



>gi|224101491|ref|XP_002312302.1| predicted protein [Populus trichocarpa]
 gi|118485231|gb|ABK94475.1| unknown [Populus trichocarpa]
 gi|222852122|gb|EEE89669.1| predicted protein [Populus trichocarpa]
          Length = 181

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVGEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



>gi|357511441|ref|XP_003626009.1| ADP-ribosylation factor-like protein [Medicago truncatula]
 gi|355501024|gb|AES82227.1| ADP-ribosylation factor-like protein [Medicago truncatula]
          Length = 206

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



>gi|310006471|gb|ADP00406.1| ADP-ribosylation factor [Actinidia chinensis]
          Length = 181

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAILLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



>gi|402226057|gb|EJU06117.1| ARF/SAR [Dacryopinax sp. DJM-731 SS1]
          Length = 181

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 120/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQG++FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGIIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR+EL +++++ E+RD LLLVFANKQDL  AM+PAE+T+KLGLH +++R+WY+
Sbjct: 96  DRDRVTEAREELQRMLNEDELRDALLLVFANKQDLPNAMNPAEITDKLGLHGLRQRTWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+G+GL+EGL WL
Sbjct: 156 QAACATSGDGLYEGLEWL 173



>gi|47026845|gb|AAT08648.1| ADP-ribosylation factor [Hyacinthus orientalis]
          Length = 199

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 54  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 113

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 114 DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 173

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 174 QSTCATSGEGLYEGLDWL 191



>gi|224108844|ref|XP_002314987.1| predicted protein [Populus trichocarpa]
 gi|11131023|sp|O48649.3|ARF1_SALBA RecName: Full=ADP-ribosylation factor 1
 gi|2852443|dbj|BAA24696.1| ADP-ribosylation factor [Salix bakko]
 gi|29124981|gb|AAO63780.1| ADP-ribosylation factor 2 [Populus tremuloides]
 gi|118481812|gb|ABK92843.1| unknown [Populus trichocarpa]
 gi|222864027|gb|EEF01158.1| predicted protein [Populus trichocarpa]
          Length = 181

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVGEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



>gi|6573751|gb|AAF17671.1|AC009398_20 F20B24.7 [Arabidopsis thaliana]
          Length = 186

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



>gi|3182915|sp|P91924.3|ARF_DUGJA RecName: Full=ADP-ribosylation factor
 gi|1842150|dbj|BAA19225.1| ADP-ribosylation factor [Dugesia japonica]
          Length = 183

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 121/138 (87%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR+R++EAR+EL +++++ E+RD +LLVFANKQDL  AM+PAE+T+KLGLH ++ RSWY+
Sbjct: 96  DRERVNEAREELMRMLNEDELRDAVLLVFANKQDLPNAMNPAEITDKLGLHSLRNRSWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+G+GL+EGL+WL
Sbjct: 156 QATCATSGDGLYEGLDWL 173



>gi|470137765|ref|XP_004304633.1| PREDICTED: ADP-ribosylation factor 1-like isoform 1 [Fragaria vesca
           subsp. vesca]
          Length = 184

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



>gi|217072662|gb|ACJ84691.1| unknown [Medicago truncatula]
 gi|388494928|gb|AFK35530.1| unknown [Medicago truncatula]
          Length = 181

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



>gi|462401623|gb|EMJ07180.1| hypothetical protein PRUPE_ppa012138mg [Prunus persica]
          Length = 182

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 118/138 (85%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKNV F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEVVTTIPTIGFNVETVEYKNVSFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++S+ E+R+  LLVFANKQDL  AMS +E+T+KLGLH +++R WY+
Sbjct: 96  DRDRVSEARDELHRMLSEDELREATLLVFANKQDLPNAMSVSEITDKLGLHSLRQRRWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+G+GL+EGL+WL
Sbjct: 156 QAACATSGQGLYEGLDWL 173



>gi|30681825|ref|NP_172533.2| ADP-ribosylation factor A1F [Arabidopsis thaliana]
 gi|48310130|gb|AAT41759.1| At1g10630 [Arabidopsis thaliana]
 gi|50198855|gb|AAT70455.1| At1g10630 [Arabidopsis thaliana]
 gi|110740724|dbj|BAE98462.1| similar to ADP-ribosylation factor gb|AAD17207 [Arabidopsis
           thaliana]
 gi|332190490|gb|AEE28611.1| ADP-ribosylation factor A1F [Arabidopsis thaliana]
          Length = 181

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



>gi|76160966|gb|ABA40446.1| unknown [Solanum tuberosum]
          Length = 181

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSACATSGEGLYEGLDWL 173



>gi|413932675|gb|AFW67226.1| hypothetical protein ZEAMMB73_332083 [Zea mays]
          Length = 241

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 96/138 (69%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 88  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 147

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 148 DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 207

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CATTGEGL+EGL+WL
Sbjct: 208 QSTCATTGEGLYEGLDWL 225



>gi|224122864|ref|XP_002318935.1| predicted protein [Populus trichocarpa]
 gi|224124598|ref|XP_002330063.1| predicted protein [Populus trichocarpa]
 gi|356571535|ref|XP_003553932.1| PREDICTED: ADP-ribosylation factor isoform 1 [Glycine max]
 gi|356571537|ref|XP_003553933.1| PREDICTED: ADP-ribosylation factor isoform 2 [Glycine max]
 gi|356571539|ref|XP_003553934.1| PREDICTED: ADP-ribosylation factor isoform 3 [Glycine max]
 gi|118482509|gb|ABK93177.1| unknown [Populus trichocarpa]
 gi|118483518|gb|ABK93657.1| unknown [Populus trichocarpa]
 gi|118487697|gb|ABK95673.1| unknown [Populus trichocarpa]
 gi|222857311|gb|EEE94858.1| predicted protein [Populus trichocarpa]
 gi|222871488|gb|EEF08619.1| predicted protein [Populus trichocarpa]
          Length = 181

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



>gi|4324967|gb|AAD17207.1| ADP-ribosylation factor [Glycine max]
          Length = 178

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 33  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 92

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 93  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 152

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 153 QSTCATSGEGLYEGLDWL 170



>gi|357495841|ref|XP_003618209.1| ADP-ribosylation factor [Medicago truncatula]
 gi|449450087|ref|XP_004142795.1| PREDICTED: ADP-ribosylation factor 1-like isoform 1 [Cucumis
           sativus]
 gi|449450089|ref|XP_004142796.1| PREDICTED: ADP-ribosylation factor 1-like isoform 2 [Cucumis
           sativus]
 gi|449483765|ref|XP_004156684.1| PREDICTED: ADP-ribosylation factor 1-like isoform 1 [Cucumis
           sativus]
 gi|449483767|ref|XP_004156685.1| PREDICTED: ADP-ribosylation factor 1-like isoform 2 [Cucumis
           sativus]
 gi|470137767|ref|XP_004304634.1| PREDICTED: ADP-ribosylation factor 1-like isoform 2 [Fragaria vesca
           subsp. vesca]
 gi|502090525|ref|XP_004489257.1| PREDICTED: ADP-ribosylation factor 1-like [Cicer arietinum]
 gi|39653273|gb|AAR29293.1| ADP-ribosylation factor [Medicago sativa]
 gi|56311394|emb|CAI29265.1| ADP-ribosylation factor 1 [Medicago truncatula]
 gi|355493224|gb|AES74427.1| ADP-ribosylation factor [Medicago truncatula]
 gi|359770107|gb|AEV66152.1| ADP-ribosylation factor [Arachis hypogaea]
 gi|388508094|gb|AFK42113.1| unknown [Medicago truncatula]
 gi|388513351|gb|AFK44737.1| unknown [Lotus japonicus]
          Length = 181

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



>gi|58269752|ref|XP_572032.1| ARF small monomeric GTPase [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|134113849|ref|XP_774509.1| hypothetical protein CNBG1540 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|321260887|ref|XP_003195163.1| ARF small monomeric GTPase [Cryptococcus gattii WM276]
 gi|338817564|sp|P0CM17.1|ARF_CRYNB RecName: Full=ADP-ribosylation factor
 gi|338817565|sp|P0CM16.1|ARF_CRYNJ RecName: Full=ADP-ribosylation factor
 gi|407689|gb|AAA17546.1| ADP-ribosylation factor [Cryptococcus neoformans]
 gi|50257147|gb|EAL19862.1| hypothetical protein CNBG1540 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57228268|gb|AAW44725.1| ARF small monomeric GTPase, putative [Cryptococcus neoformans var.
           neoformans JEC21]
 gi|317461636|gb|ADV23376.1| ARF small monomeric GTPase, putative [Cryptococcus gattii WM276]
 gi|405121709|gb|AFR96477.1| ARF small monomeric GTPase [Cryptococcus neoformans var. grubii
           H99]
          Length = 182

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQG++FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGIIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DR+RI EAR+EL +++S+ E+RD LLLVFANKQDL  AM+ AE+T+KLGLH +++RSWY+
Sbjct: 96  DRERITEAREELQRMLSEDELRDALLLVFANKQDLPNAMNAAEITDKLGLHSLRQRSWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+G+GL+EGL WL
Sbjct: 156 QAACATSGDGLYEGLEWL 173



>gi|449446863|ref|XP_004141190.1| PREDICTED: ADP-ribosylation factor 1-like [Cucumis sativus]
          Length = 368

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 220 KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 279

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 280 DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 339

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 340 QSTCATSGEGLYEGLDWL 357



>gi|224068638|ref|XP_002302788.1| predicted protein [Populus trichocarpa]
 gi|224124602|ref|XP_002330064.1| predicted protein [Populus trichocarpa]
 gi|224128225|ref|XP_002320274.1| predicted protein [Populus trichocarpa]
 gi|225432130|ref|XP_002264654.1| PREDICTED: ADP-ribosylation factor 2-like [Vitis vinifera]
 gi|225437665|ref|XP_002279216.1| PREDICTED: ADP-ribosylation factor 2-like isoform 1 [Vitis
           vinifera]
 gi|225450510|ref|XP_002281047.1| PREDICTED: ADP-ribosylation factor 2-like [Vitis vinifera]
 gi|255548341|ref|XP_002515227.1| ADP-ribosylation factor, arf, putative [Ricinus communis]
 gi|255548347|ref|XP_002515230.1| ADP-ribosylation factor, arf, putative [Ricinus communis]
 gi|356499703|ref|XP_003518676.1| PREDICTED: ADP-ribosylation factor 2-like [Glycine max]
 gi|356534669|ref|XP_003535875.1| PREDICTED: ADP-ribosylation factor 2-like [Glycine max]
 gi|356575319|ref|XP_003555789.1| PREDICTED: ADP-ribosylation factor 2-like isoform 1 [Glycine max]
 gi|356575321|ref|XP_003555790.1| PREDICTED: ADP-ribosylation factor 2-like isoform 2 [Glycine max]
 gi|357442149|ref|XP_003591352.1| ADP ribosylation factor [Medicago truncatula]
 gi|359480198|ref|XP_003632415.1| PREDICTED: ADP-ribosylation factor 2-like isoform 2 [Vitis
           vinifera]
 gi|449436393|ref|XP_004135977.1| PREDICTED: ADP-ribosylation factor 2-like [Cucumis sativus]
 gi|449524537|ref|XP_004169278.1| PREDICTED: ADP-ribosylation factor 2-like [Cucumis sativus]
 gi|470132877|ref|XP_004302301.1| PREDICTED: ADP-ribosylation factor 2-like [Fragaria vesca subsp.
           vesca]
 gi|502117631|ref|XP_004495884.1| PREDICTED: ADP-ribosylation factor 2-like [Cicer arietinum]
 gi|77812440|gb|ABB03801.1| ADP ribosylation factor 002 [Daucus carota]
 gi|118482447|gb|ABK93146.1| unknown [Populus trichocarpa]
 gi|118482485|gb|ABK93165.1| unknown [Populus trichocarpa]
 gi|217072062|gb|ACJ84391.1| unknown [Medicago truncatula]
 gi|222844514|gb|EEE82061.1| predicted protein [Populus trichocarpa]
 gi|222861047|gb|EEE98589.1| predicted protein [Populus trichocarpa]
 gi|222871489|gb|EEF08620.1| predicted protein [Populus trichocarpa]
 gi|223545707|gb|EEF47211.1| ADP-ribosylation factor, arf, putative [Ricinus communis]
 gi|223545710|gb|EEF47214.1| ADP-ribosylation factor, arf, putative [Ricinus communis]
 gi|327505557|gb|AEA92306.1| Arf2 [Hevea brasiliensis]
 gi|355480400|gb|AES61603.1| ADP ribosylation factor [Medicago truncatula]
 gi|388492408|gb|AFK34270.1| unknown [Medicago truncatula]
 gi|406657702|gb|AFS50009.1| hypothetical protein [Dendrobium officinale]
 gi|462401437|gb|EMJ06994.1| hypothetical protein PRUPE_ppa010615mg [Prunus persica]
 gi|508703477|gb|EOX95373.1| ADP-ribosylation factor A1F [Theobroma cacao]
          Length = 181

 Score =  219 bits (558), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



>gi|297849408|ref|XP_002892585.1| ADP-ribosylation factor [Arabidopsis lyrata subsp. lyrata]
 gi|297338427|gb|EFH68844.1| ADP-ribosylation factor [Arabidopsis lyrata subsp. lyrata]
 gi|508719819|gb|EOY11716.1| ADP-ribosylation factor A1F [Theobroma cacao]
          Length = 181

 Score =  219 bits (557), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



>gi|219363613|ref|NP_001136508.1| uncharacterized protein LOC100216623 [Zea mays]
 gi|194695974|gb|ACF82071.1| unknown [Zea mays]
 gi|413946967|gb|AFW79616.1| hypothetical protein ZEAMMB73_444016 [Zea mays]
 gi|413946968|gb|AFW79617.1| hypothetical protein ZEAMMB73_444016 [Zea mays]
 gi|413946969|gb|AFW79618.1| hypothetical protein ZEAMMB73_444016 [Zea mays]
          Length = 181

 Score =  219 bits (557), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EA+ ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEAKDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CATTGEGL+EGL+WL
Sbjct: 156 QSTCATTGEGLYEGLDWL 173



>gi|168023699|ref|XP_001764375.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens subsp.
           patens]
 gi|162684527|gb|EDQ70929.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens subsp.
           patens]
          Length = 181

 Score =  219 bits (557), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



>gi|357111135|ref|XP_003557370.1| PREDICTED: ADP-ribosylation factor 1-like [Brachypodium distachyon]
          Length = 181

 Score =  219 bits (557), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



>gi|222820383|gb|ACM67554.1| ADP-ribosylation factor-like protein [Musa acuminata AAA Group]
          Length = 181

 Score =  219 bits (557), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



>gi|255633096|gb|ACU16903.1| unknown [Glycine max]
          Length = 204

 Score =  219 bits (557), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



>gi|297807485|ref|XP_002871626.1| ADP-ribosylation factor A1B [Arabidopsis lyrata subsp. lyrata]
 gi|297317463|gb|EFH47885.1| ADP-ribosylation factor A1B [Arabidopsis lyrata subsp. lyrata]
          Length = 183

 Score =  219 bits (557), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



>gi|168024354|ref|XP_001764701.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens subsp.
           patens]
 gi|168024490|ref|XP_001764769.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens subsp.
           patens]
 gi|162683995|gb|EDQ70400.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens subsp.
           patens]
 gi|162684063|gb|EDQ70468.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens subsp.
           patens]
          Length = 181

 Score =  219 bits (557), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



>gi|351734536|ref|NP_001236384.1| uncharacterized protein LOC100306021 [Glycine max]
 gi|356497724|ref|XP_003517709.1| PREDICTED: ADP-ribosylation factor 2-like [Glycine max]
 gi|356502055|ref|XP_003519837.1| PREDICTED: ADP-ribosylation factor 2-like isoform 1 [Glycine max]
 gi|356502057|ref|XP_003519838.1| PREDICTED: ADP-ribosylation factor 2-like isoform 2 [Glycine max]
 gi|356577891|ref|XP_003557055.1| PREDICTED: ADP-ribosylation factor 2-like [Glycine max]
 gi|449434941|ref|XP_004135254.1| PREDICTED: ADP-ribosylation factor 2-like isoform 2 [Cucumis
           sativus]
 gi|449517567|ref|XP_004165817.1| PREDICTED: ADP-ribosylation factor 2-like isoform 2 [Cucumis
           sativus]
 gi|460385928|ref|XP_004238652.1| PREDICTED: ADP-ribosylation factor 2-like isoform 2 [Solanum
           lycopersicum]
 gi|217074208|gb|ACJ85464.1| unknown [Medicago truncatula]
 gi|224284028|gb|ACN39752.1| unknown [Picea sitchensis]
 gi|224284100|gb|ACN39787.1| unknown [Picea sitchensis]
 gi|224286854|gb|ACN41130.1| unknown [Picea sitchensis]
 gi|255627305|gb|ACU13997.1| unknown [Glycine max]
 gi|255645449|gb|ACU23220.1| unknown [Glycine max]
 gi|388493526|gb|AFK34829.1| unknown [Medicago truncatula]
 gi|388511481|gb|AFK43802.1| unknown [Lotus japonicus]
 gi|388512615|gb|AFK44369.1| unknown [Lotus japonicus]
 gi|388517053|gb|AFK46588.1| unknown [Medicago truncatula]
 gi|462420485|gb|EMJ24748.1| hypothetical protein PRUPE_ppa012160mg [Prunus persica]
 gi|508708610|gb|EOY00507.1| ADP-ribosylation factor A1F [Theobroma cacao]
          Length = 181

 Score =  219 bits (557), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



>gi|15223164|ref|NP_177206.1| ARF GTPase family protein [Arabidopsis thaliana]
 gi|18395248|ref|NP_564195.1| ADP-ribosylation factor 1 [Arabidopsis thaliana]
 gi|30698721|ref|NP_850975.1| ARF GTPase family protein [Arabidopsis thaliana]
 gi|42572059|ref|NP_974120.1| ARF GTPase family protein [Arabidopsis thaliana]
 gi|297845410|ref|XP_002890586.1| hypothetical protein ARALYDRAFT_472612 [Arabidopsis lyrata subsp.
           lyrata]
 gi|378548287|sp|P0DH91.1|ARF2B_ARATH RecName: Full=ADP-ribosylation factor 2-B; Short=AtARF2; AltName:
           Full=ARF1-like protein U5
 gi|378548311|sp|Q9LQC8.2|ARF2A_ARATH RecName: Full=ADP-ribosylation factor 2-A; Short=AtARF2
 gi|11692864|gb|AAG40035.1|AF324684_1 At1g23490 [Arabidopsis thaliana]
 gi|11762198|gb|AAG40377.1|AF325025_1 At1g70490 [Arabidopsis thaliana]
 gi|11993875|gb|AAG42921.1|AF329504_1 putative ADP-ribosylation factor [Arabidopsis thaliana]
 gi|12325036|gb|AAG52463.1|AC010796_2 putative ADP-ribosylation factor 1; 15065-14075 [Arabidopsis
           thaliana]
 gi|13430504|gb|AAK25874.1|AF360164_1 putative ADP-ribosylation factor 1 [Arabidopsis thaliana]
 gi|13926232|gb|AAK49591.1|AF372875_1 F28C11.30/F28C11.30 [Arabidopsis thaliana]
 gi|13926300|gb|AAK49617.1|AF372901_1 F28C11.30/F28C11.30 [Arabidopsis thaliana]
 gi|15810605|gb|AAL07190.1| putative ADP-ribosylation factor 1 [Arabidopsis thaliana]
 gi|16323246|gb|AAL15357.1| At1g23490/F5O8_5 [Arabidopsis thaliana]
 gi|21280953|gb|AAM44988.1| putative ADP-ribosylation factor [Arabidopsis thaliana]
 gi|21592841|gb|AAM64791.1| ADP-ribosylation factor 1-like [Arabidopsis thaliana]
 gi|297336428|gb|EFH66845.1| hypothetical protein ARALYDRAFT_472612 [Arabidopsis lyrata subsp.
           lyrata]
 gi|332192273|gb|AEE30394.1| ADP-ribosylation factor 2 [Arabidopsis thaliana]
 gi|332196947|gb|AEE35068.1| ADP-ribosylation factor 2 [Arabidopsis thaliana]
 gi|332196948|gb|AEE35069.1| ADP-ribosylation factor 2 [Arabidopsis thaliana]
 gi|332196949|gb|AEE35070.1| ADP-ribosylation factor 2 [Arabidopsis thaliana]
          Length = 181

 Score =  219 bits (557), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



>gi|326510419|dbj|BAJ87426.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 181

 Score =  219 bits (557), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



>gi|168047377|ref|XP_001776147.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens subsp.
           patens]
 gi|162672522|gb|EDQ59058.1| Arf1_5/ArfA-family small GTPase [Physcomitrella patens subsp.
           patens]
          Length = 181

 Score =  219 bits (557), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



>gi|340924278|gb|EGS19181.1| hypothetical protein CTHT_0058060 [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 185

 Score =  219 bits (557), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 120/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV Y+N++F VWDVGGQDKIRPLWRHY+  TQG++FVVDS 
Sbjct: 39  KLKLGEVVTTIPTIGFNVETVEYRNIQFTVWDVGGQDKIRPLWRHYFQNTQGIIFVVDSN 98

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR+EL +++++ E+RD LLLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 99  DRDRVPEAREELQRMLNEDELRDALLLVFANKQDLPNAMTVAEITDKLGLHSLRQRKWYI 158

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CATTG+GLFEGL+WL
Sbjct: 159 QSTCATTGDGLFEGLDWL 176



>gi|462401436|gb|EMJ06993.1| hypothetical protein PRUPE_ppa010615mg [Prunus persica]
          Length = 243

 Score =  219 bits (557), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 98  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 157

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 158 DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 217

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 218 QSTCATSGEGLYEGLDWL 235



>gi|303272103|ref|XP_003055413.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226463387|gb|EEH60665.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 183

 Score =  219 bits (557), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R W++
Sbjct: 96  DRDRVSEARDELHRMLNEDELRDAVLLVFANKQDLPNAMTAAEITDKLGLHSIRQRHWFI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



>gi|7643794|gb|AAF65512.1| ADP-ribosylation factor [Capsicum annuum]
 gi|37791223|gb|AAR03592.1| ARF-like small GTPase [Brassica juncea]
 gi|482560625|gb|EOA24816.1| hypothetical protein CARUB_v10018102mg [Capsella rubella]
 gi|482564310|gb|EOA28500.1| hypothetical protein CARUB_v10024713mg [Capsella rubella]
          Length = 181

 Score =  219 bits (557), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



>gi|17154685|emb|CAD12855.1| ADP-ribosylation factor [Gossypium hirsutum]
 gi|28300416|gb|AAO37820.1| ADP-ribosylation factor [Gossypium hirsutum]
 gi|28630948|gb|AAO45616.1| ADP-ribosylation factor 1 [Gossypium hirsutum]
 gi|29028258|gb|AAO62348.1| ADP-ribosylation factor 1 [Gossypium hirsutum]
          Length = 181

 Score =  219 bits (557), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173



>gi|460385926|ref|XP_004238651.1| PREDICTED: ADP-ribosylation factor 2-like isoform 1 [Solanum
           lycopersicum]
          Length = 182

 Score =  219 bits (557), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 95/138 (68%), Positives = 119/138 (86%)

Query: 1   KLKLNQSVTTIPTVGFNVETVTYKNVKFNVWDVGGQDKIRPLWRHYYTGTQGLVFVVDSQ 60
           KLKL + VTTIPT+GFNVETV YKN+ F VWDVGGQDKIRPLWRHY+  TQGL+FVVDS 
Sbjct: 36  KLKLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSN 95

Query: 61  DRDRIDEARQELHKIISDREMRDCLLLVFANKQDLQGAMSPAEVTEKLGLHRMKERSWYV 120
           DRDR+ EAR ELH+++++ E+RD +LLVFANKQDL  AM+ AE+T+KLGLH +++R WY+
Sbjct: 96  DRDRVVEARDELHRMLNEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRHWYI 155

Query: 121 HPSCATTGEGLFEGLNWL 138
             +CAT+GEGL+EGL+WL
Sbjct: 156 QSTCATSGEGLYEGLDWL 173