BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10246_c0_seq1-m.93 5prime_partial 260-1723(-) 488 (-)
         (487 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|471911321|emb|CCO27573.1| hypothetical protein BN14_01556 [Rh...    89   3e-15   Rhizoctonia solani AG-1 IB
gi|403163254|ref|XP_003323353.2| hypothetical protein PGTG_04890...    86   3e-14   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|390597754|gb|EIN07153.1| kinesin-domain-containing protein [P...    86   3e-14   Punctularia strigosozonata HHB-11173 SS5
gi|395333772|gb|EJF66149.1| kinesin-domain-containing protein [D...    85   6e-14   Dichomitus squalens LYAD-421 SS1
gi|392567102|gb|EIW60277.1| kinesin [Trametes versicolor FP-1016...    85   6e-14   Trametes versicolor FP-101664 SS1
gi|353241232|emb|CCA73060.1| related to KIP1-kinesin-related pro...    84   1e-13   Serendipita indica DSM 11827
gi|194500040|gb|ACF75332.1| kinesin-3 [Schizophyllum commune]          84   1e-13   Schizophyllum commune
gi|302692034|ref|XP_003035696.1| kinesin [Schizophyllum commune ...    84   1e-13   Schizophyllum commune H4-8
gi|392595512|gb|EIW84835.1| kinesin-domain-containing protein [C...    84   1e-13   Coniophora puteana RWD-64-598 SS2
gi|449547223|gb|EMD38191.1| hypothetical protein CERSUDRAFT_4837...    82   3e-13   Gelatoporia subvermispora B
gi|336367279|gb|EGN95624.1| hypothetical protein SERLA73DRAFT_14...    82   4e-13   Serpula lacrymans var. lacrymans S7.3
gi|170088442|ref|XP_001875444.1| kinesin domain-containing prote...    80   2e-12   Laccaria bicolor S238N-H82
gi|328856248|gb|EGG05370.1| hypothetical protein MELLADRAFT_7811...    80   2e-12   Melampsora larici-populina 98AG31
gi|443926841|gb|ELU45399.1| kinesin family member 21A [Rhizocton...    77   1e-11   Rhizoctonia solani AG-1 IA
gi|393216733|gb|EJD02223.1| kinesin [Fomitiporia mediterranea MF...    77   1e-11   Fomitiporia mediterranea MF3/22
gi|501306151|dbj|GAC95236.1| kinesin [Pseudozyma hubeiensis SY62]      76   3e-11   Pseudozyma hubeiensis SY62
gi|71018147|ref|XP_759304.1| hypothetical protein UM03157.1 [Ust...    75   5e-11   
gi|388854462|emb|CCF51849.1| related to KIP1-kinesin-related pro...    74   8e-11   Ustilago hordei
gi|319411515|emb|CBQ73559.1| related to KIP1-kinesin-related pro...    74   8e-11   Sporisorium reilianum SRZ2
gi|402216425|gb|EJT96521.1| hypothetical protein DACRYDRAFT_1927...    74   9e-11   Dacryopinax primogenitus


>gi|471911321|emb|CCO27573.1| hypothetical protein BN14_01556 [Rhizoctonia solani AG-1 IB]
          Length = 1194

 Score = 88.6 bits (218), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 54/123 (43%), Positives = 81/123 (65%), Gaps = 3/123 (2%)

Query: 365  VEKLHKRIAKLEGDNSQNRQLVDTLEASLNDSEGNLRVAKKQLQVLQREKSDLVNQMKSL 424
            ++ L+K++   EGD   +  LV TLE SL+DSE NLR ++ Q   L +E+  L++Q++ L
Sbjct: 1075 IKTLNKQLTHCEGDLQAHMDLVATLETSLSDSERNLRKSRNQSMELVKERDSLISQVQGL 1134

Query: 425  KMQLEDAAAQYEQAKSSVQQEKKVIENVLLEERRAKEQAEKSKRILESRMEELMAKKSKF 484
            + QLE+A  +  Q + SV +EK  +E  L +ERRAK++A   ++ LESRMEEL  +KSKF
Sbjct: 1135 RAQLEEAQQEIAQVRRSVVEEKHSLEQRLDDERRAKDRA---RQQLESRMEELQRRKSKF 1191

Query: 485  MCF 487
             C 
Sbjct: 1192 ACI 1194



>gi|403163254|ref|XP_003323353.2| hypothetical protein PGTG_04890 [Puccinia graminis f. sp. tritici CRL
            75-36-700-3]
 gi|375163978|gb|EFP78934.2| hypothetical protein PGTG_04890 [Puccinia graminis f. sp. tritici CRL
            75-36-700-3]
          Length = 1890

 Score = 85.9 bits (211), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 81/127 (63%), Gaps = 7/127 (5%)

Query: 365  VEKLHKRIAKLEGDNSQNRQLVDTLEASLNDSEGNLRVAKKQLQVLQREKSDLVNQMKSL 424
            + KL K++++ E D   N  LV  LE++LN++E NLR ++ Q+  L +E+  +  Q +SL
Sbjct: 1767 IAKLSKQLSQCEMDLKGNIDLVTNLESALNETERNLRKSRLQMNELAKERDKISTQNESL 1826

Query: 425  KMQLEDAAAQYEQAKSSVQQEKKVIENVLLEERRAKEQAEKSKRILESRMEEL----MAK 480
            + +L  A A+ E  +++VQ EK   EN L EERRAKE A+K    LE+RMEE+    M +
Sbjct: 1827 RKELAAATAEVEHVRNNVQVEKAQFENQLGEERRAKENAKKQ---LEARMEEMQASRMTR 1883

Query: 481  KSKFMCF 487
            KSKF CF
Sbjct: 1884 KSKFNCF 1890



>gi|390597754|gb|EIN07153.1| kinesin-domain-containing protein [Punctularia strigosozonata
            HHB-11173 SS5]
          Length = 1956

 Score = 85.9 bits (211), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 77/123 (62%), Gaps = 3/123 (2%)

Query: 365  VEKLHKRIAKLEGDNSQNRQLVDTLEASLNDSEGNLRVAKKQLQVLQREKSDLVNQMKSL 424
            ++ L+K++   EGD   +  LV+TLEASL D+E NLR A+ Q   L RE+  L  Q+ SL
Sbjct: 1837 IKTLNKQLTHCEGDLQTHMDLVNTLEASLGDAEKNLRKARMQATELARERDILNGQVDSL 1896

Query: 425  KMQLEDAAAQYEQAKSSVQQEKKVIENVLLEERRAKEQAEKSKRILESRMEELMAKKSKF 484
            + +L DA  +    + S+ +EK+ +E+ L EERR KE+A      L+SRM EL  +KSKF
Sbjct: 1897 RRELADAKREVTNVRQSIVEEKQSLESRLDEERRQKERARAQ---LDSRMAELTKRKSKF 1953

Query: 485  MCF 487
            +C 
Sbjct: 1954 VCM 1956



>gi|395333772|gb|EJF66149.1| kinesin-domain-containing protein [Dichomitus squalens LYAD-421 SS1]
          Length = 2101

 Score = 84.7 bits (208), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 80/123 (65%), Gaps = 3/123 (2%)

Query: 365  VEKLHKRIAKLEGDNSQNRQLVDTLEASLNDSEGNLRVAKKQLQVLQREKSDLVNQMKSL 424
            ++ L+K++   E D   +  +V TLEASL DSE NLR A+ Q   L RE+ +L +Q+ +L
Sbjct: 1982 IKTLNKQLNHCETDLQAHMDMVATLEASLGDSEKNLRKARMQATELARERDNLNSQIANL 2041

Query: 425  KMQLEDAAAQYEQAKSSVQQEKKVIENVLLEERRAKEQAEKSKRILESRMEELMAKKSKF 484
            + +L++A A+    + S+ +EK+ +E+ L EERRAKE+A      L+SRMEEL  +KSKF
Sbjct: 2042 RTELQEAKAEVVNVRRSIVEEKQSLESRLDEERRAKERARAQ---LDSRMEELQRRKSKF 2098

Query: 485  MCF 487
             C 
Sbjct: 2099 ACL 2101



>gi|392567102|gb|EIW60277.1| kinesin [Trametes versicolor FP-101664 SS1]
          Length = 2030

 Score = 84.7 bits (208), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 77/123 (62%), Gaps = 3/123 (2%)

Query: 365  VEKLHKRIAKLEGDNSQNRQLVDTLEASLNDSEGNLRVAKKQLQVLQREKSDLVNQMKSL 424
            ++ L+K++   E D   +  +V TLEASL DSE NLR A+ Q   L RE+ +L  Q+ +L
Sbjct: 1911 IKTLNKQLTHCESDLQAHMDIVATLEASLGDSEKNLRKARMQATELARERDNLNGQIVNL 1970

Query: 425  KMQLEDAAAQYEQAKSSVQQEKKVIENVLLEERRAKEQAEKSKRILESRMEELMAKKSKF 484
            + +L D  A+    + S+ +EK+ +E+ L EERRAKE+A      L+SRMEEL  +KSKF
Sbjct: 1971 RQELNDTKAEVVNVRRSIVEEKQSLESRLDEERRAKERARAQ---LDSRMEELQRRKSKF 2027

Query: 485  MCF 487
             C 
Sbjct: 2028 ACL 2030



>gi|353241232|emb|CCA73060.1| related to KIP1-kinesin-related protein [Piriformospora indica DSM
            11827]
          Length = 2170

 Score = 84.0 bits (206), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 78/123 (63%), Gaps = 3/123 (2%)

Query: 365  VEKLHKRIAKLEGDNSQNRQLVDTLEASLNDSEGNLRVAKKQLQVLQREKSDLVNQMKSL 424
            ++ L+K++   EGD   +  LV TLE++LNDSE NLR A+ Q   + RE+  L +Q+++ 
Sbjct: 2051 IKTLNKQLTHCEGDLQAHMDLVRTLESTLNDSERNLRKARLQASEMARERDTLQHQLEAA 2110

Query: 425  KMQLEDAAAQYEQAKSSVQQEKKVIENVLLEERRAKEQAEKSKRILESRMEELMAKKSKF 484
            +  L+DA  +    + S+ +EK+ +E  L EERRAKE+A      L+SRMEEL  +KSKF
Sbjct: 2111 RNDLQDAKREVVNVRMSIVEEKQSLEQRLDEERRAKERARAQ---LDSRMEELAKRKSKF 2167

Query: 485  MCF 487
             C 
Sbjct: 2168 ACM 2170



>gi|194500040|gb|ACF75332.1| kinesin-3 [Schizophyllum commune]
          Length = 1978

 Score = 83.6 bits (205), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 78/123 (63%), Gaps = 3/123 (2%)

Query: 365  VEKLHKRIAKLEGDNSQNRQLVDTLEASLNDSEGNLRVAKKQLQVLQREKSDLVNQMKSL 424
            ++ L+K+++  E D   +  LV TLE SL DSE NLR A+     L RE+  L  +M++L
Sbjct: 1859 IKTLNKQLSHCESDLQTHMDLVSTLETSLGDSEKNLRKARMHATELARERDTLNTKMEAL 1918

Query: 425  KMQLEDAAAQYEQAKSSVQQEKKVIENVLLEERRAKEQAEKSKRILESRMEELMAKKSKF 484
            + +LE+A  +    + S+ +EK+ +E  L EERRAKE+A   ++ L+SRMEEL  +KSKF
Sbjct: 1919 RRELEEAKREVTNVRRSIVEEKQSLEQRLDEERRAKERA---RQQLDSRMEELQKRKSKF 1975

Query: 485  MCF 487
             C 
Sbjct: 1976 ACL 1978



>gi|302692034|ref|XP_003035696.1| kinesin [Schizophyllum commune H4-8]
 gi|300109392|gb|EFJ00794.1| kinesin [Schizophyllum commune H4-8]
          Length = 2000

 Score = 83.6 bits (205), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 78/123 (63%), Gaps = 3/123 (2%)

Query: 365  VEKLHKRIAKLEGDNSQNRQLVDTLEASLNDSEGNLRVAKKQLQVLQREKSDLVNQMKSL 424
            ++ L+K+++  E D   +  LV TLE SL DSE NLR A+     L RE+  L  +M++L
Sbjct: 1881 IKTLNKQLSHCESDLQTHMDLVSTLETSLGDSEKNLRKARMHATELARERDTLNTKMEAL 1940

Query: 425  KMQLEDAAAQYEQAKSSVQQEKKVIENVLLEERRAKEQAEKSKRILESRMEELMAKKSKF 484
            + +LE+A  +    + S+ +EK+ +E  L EERRAKE+A   ++ L+SRMEEL  +KSKF
Sbjct: 1941 RRELEEAKREVTNVRRSIVEEKQSLEQRLDEERRAKERA---RQQLDSRMEELQKRKSKF 1997

Query: 485  MCF 487
             C 
Sbjct: 1998 ACL 2000



>gi|392595512|gb|EIW84835.1| kinesin-domain-containing protein [Coniophora puteana RWD-64-598 SS2]
          Length = 2138

 Score = 83.6 bits (205), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 78/123 (63%), Gaps = 3/123 (2%)

Query: 365  VEKLHKRIAKLEGDNSQNRQLVDTLEASLNDSEGNLRVAKKQLQVLQREKSDLVNQMKSL 424
            ++ L+K+++  E D + +  LV TLE SL DSE NL+  + Q   L RE+  L +Q+++L
Sbjct: 2019 IKTLNKQLSHCESDLAAHMDLVGTLETSLGDSEKNLKKVRLQTSELARERDSLHHQVETL 2078

Query: 425  KMQLEDAAAQYEQAKSSVQQEKKVIENVLLEERRAKEQAEKSKRILESRMEELMAKKSKF 484
            + +LE++  + E A+ S+ +EK   E  L EERRAKE+A      L+SRMEE+  +KSKF
Sbjct: 2079 RGELENSRKEVENARRSIAEEKHSYEARLDEERRAKERARAQ---LDSRMEEVQKRKSKF 2135

Query: 485  MCF 487
             C 
Sbjct: 2136 ACL 2138



>gi|449547223|gb|EMD38191.1| hypothetical protein CERSUDRAFT_48377 [Ceriporiopsis subvermispora B]
          Length = 1981

 Score = 82.4 bits (202), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 76/123 (61%), Gaps = 3/123 (2%)

Query: 365  VEKLHKRIAKLEGDNSQNRQLVDTLEASLNDSEGNLRVAKKQLQVLQREKSDLVNQMKSL 424
            ++ L+K++   E D   +  +V TLE+SL DSE NLR A+ Q   L RE+  L  Q+ SL
Sbjct: 1862 IKTLNKQLTHCESDLQAHMDMVATLESSLGDSEKNLRKARMQATELARERDGLNAQIASL 1921

Query: 425  KMQLEDAAAQYEQAKSSVQQEKKVIENVLLEERRAKEQAEKSKRILESRMEELMAKKSKF 484
            + +L +  ++    + S+ +EK+ +E+ L EERRAKE+A      L+SRMEEL  +KSKF
Sbjct: 1922 RAELHETKSEVVNVRRSIVEEKQSLEHRLDEERRAKERARAQ---LDSRMEELQRRKSKF 1978

Query: 485  MCF 487
             C 
Sbjct: 1979 ACL 1981



>gi|336367279|gb|EGN95624.1| hypothetical protein SERLA73DRAFT_142439 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336379998|gb|EGO21152.1| hypothetical protein SERLADRAFT_398524 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 171

 Score = 82.0 bits (201), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 75/123 (60%), Gaps = 3/123 (2%)

Query: 365 VEKLHKRIAKLEGDNSQNRQLVDTLEASLNDSEGNLRVAKKQLQVLQREKSDLVNQMKSL 424
           ++ L+K++   E D   +  LV TLE SL DSE NLR A+ Q   L RE+  L N +  L
Sbjct: 52  IKTLNKQLTHCESDLQAHMDLVSTLETSLGDSEKNLRKARMQATELARERDSLSNTIDGL 111

Query: 425 KMQLEDAAAQYEQAKSSVQQEKKVIENVLLEERRAKEQAEKSKRILESRMEELMAKKSKF 484
           + +L++A  +    + S+ +EK+ +E+ L EERRAKE+A      L++RMEEL  +KSKF
Sbjct: 112 RGELQEAKREVVTVRRSIAEEKQSLESRLDEERRAKERARAQ---LDTRMEELQKRKSKF 168

Query: 485 MCF 487
            C 
Sbjct: 169 ACL 171



>gi|170088442|ref|XP_001875444.1| kinesin domain-containing protein [Laccaria bicolor S238N-H82]
 gi|164650644|gb|EDR14885.1| kinesin domain-containing protein [Laccaria bicolor S238N-H82]
          Length = 2021

 Score = 79.7 bits (195), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 77/123 (62%), Gaps = 3/123 (2%)

Query: 365  VEKLHKRIAKLEGDNSQNRQLVDTLEASLNDSEGNLRVAKKQLQVLQREKSDLVNQMKSL 424
            ++ L+K++   E D   +  LV TLE SL DSE NLR A+ Q   L RE+  L ++++SL
Sbjct: 1902 IKTLNKQLTHCESDLQTHMDLVTTLETSLGDSEKNLRKARMQATELARERDTLNSKLESL 1961

Query: 425  KMQLEDAAAQYEQAKSSVQQEKKVIENVLLEERRAKEQAEKSKRILESRMEELMAKKSKF 484
            + +L +A  +    + SV +EK+ +E  L EER+AKE+A +    L+SRMEEL  +KSKF
Sbjct: 1962 RNELTEAKREVVTVRRSVVEEKQSLEQRLDEERKAKERARQQ---LDSRMEELQKRKSKF 2018

Query: 485  MCF 487
             C 
Sbjct: 2019 ACL 2021



>gi|328856248|gb|EGG05370.1| hypothetical protein MELLADRAFT_78111 [Melampsora larici-populina
            98AG31]
          Length = 2103

 Score = 79.7 bits (195), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/127 (42%), Positives = 77/127 (60%), Gaps = 7/127 (5%)

Query: 365  VEKLHKRIAKLEGDNSQNRQLVDTLEASLNDSEGNLRVAKKQLQVLQREKSDLVNQMKSL 424
            + KL K+++  E D   N  LV  LE++LND+E NLR ++ Q+  L +E+  L +    L
Sbjct: 1980 IAKLSKQLSHCEVDLKSNIDLVANLESALNDTERNLRKSRLQMNELVKERDKLNSMNDQL 2039

Query: 425  KMQLEDAAAQYEQAKSSVQQEKKVIENVLLEERRAKEQAEKSKRILESRMEEL----MAK 480
            K +L  A  + E  +++V  EK   EN L EERRAKE A   K++LE+RMEE+    M +
Sbjct: 2040 KQELNRANLEVENVRNNVMAEKVEFENRLGEERRAKESA---KKLLEARMEEMQNSRMTR 2096

Query: 481  KSKFMCF 487
            KSKF CF
Sbjct: 2097 KSKFNCF 2103



>gi|443926841|gb|ELU45399.1| kinesin family member 21A [Rhizoctonia solani AG-1 IA]
          Length = 1901

 Score = 77.0 bits (188), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 75/113 (66%), Gaps = 3/113 (2%)

Query: 365  VEKLHKRIAKLEGDNSQNRQLVDTLEASLNDSEGNLRVAKKQLQVLQREKSDLVNQMKSL 424
            ++ L+K++   EGD   +  LV TLE SL+DSE NLR ++ Q   L +E+  L+NQ+++L
Sbjct: 1430 IKTLNKQLTHCEGDLQAHMDLVATLETSLSDSERNLRKSRNQSMELVKERDSLINQVQTL 1489

Query: 425  KMQLEDAAAQYEQAKSSVQQEKKVIENVLLEERRAKEQAEKSKRILESRMEEL 477
            + QLE+A  +  Q + +V +EK  +E  L +ERRAK++A +    LESRMEEL
Sbjct: 1490 RSQLEEAQQEIAQVRRTVVEEKHSLEQRLDDERRAKDRARQQ---LESRMEEL 1539



>gi|393216733|gb|EJD02223.1| kinesin [Fomitiporia mediterranea MF3/22]
          Length = 1908

 Score = 76.6 bits (187), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 78/123 (63%), Gaps = 3/123 (2%)

Query: 365  VEKLHKRIAKLEGDNSQNRQLVDTLEASLNDSEGNLRVAKKQLQVLQREKSDLVNQMKSL 424
            ++ L+K+++  E D   +  LV TLE SL DSE NLR A+ Q   L RE+  L  ++ ++
Sbjct: 1789 IKTLNKQLSHCESDLQAHMDLVSTLETSLGDSEKNLRKARMQATELARERDTLNTRLDAM 1848

Query: 425  KMQLEDAAAQYEQAKSSVQQEKKVIENVLLEERRAKEQAEKSKRILESRMEELMAKKSKF 484
            + +L++A  +    + SV +EK+ +E+ L EERRAKE+    ++ L+ R+EEL  +KSKF
Sbjct: 1849 RRELDEARRELAAVRRSVIEEKQSLESRLDEERRAKERV---RQQLDMRVEELQKRKSKF 1905

Query: 485  MCF 487
            +C 
Sbjct: 1906 VCL 1908



>gi|501306151|dbj|GAC95236.1| kinesin [Pseudozyma hubeiensis SY62]
          Length = 2263

 Score = 75.9 bits (185), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 79/127 (62%), Gaps = 4/127 (3%)

Query: 362  SEEVEKLHKRIAKLEGDNSQNRQLVDTLEASLNDSEGNLRVAKKQLQVLQREKSDLVNQM 421
            +EE++ L K++   E D   N  LV TLEA+LNDSE NLR ++ QL  + RE+     + 
Sbjct: 1810 AEEIKNLAKQLNHCEADLQANIDLVATLEAALNDSERNLRKSRVQLAEVTRERERYAEEA 1869

Query: 422  KSLKMQLEDAAAQYEQAKSSVQQEKKVIENVLLEERRAKEQAEKSKRILESRMEELMAKK 481
             +++ QL  A ++ E  ++SV  EK+  E+ + EER+AKE+A K+   LE+R+EE+  +K
Sbjct: 1870 NAMRTQLNTAQSEVENVRNSVMLEKQGYESKIEEERQAKERARKA---LEARLEEVSKRK 1926

Query: 482  -SKFMCF 487
             SK  C 
Sbjct: 1927 GSKLFCL 1933



>gi|71018147|ref|XP_759304.1| hypothetical protein UM03157.1 [Ustilago maydis 521]
 gi|46099154|gb|EAK84387.1| hypothetical protein UM03157.1 [Ustilago maydis 521]
          Length = 2248

 Score = 75.1 bits (183), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 78/127 (61%), Gaps = 4/127 (3%)

Query: 362  SEEVEKLHKRIAKLEGDNSQNRQLVDTLEASLNDSEGNLRVAKKQLQVLQREKSDLVNQM 421
            +EE++ L K++   E D   N  LV TLEA+LNDSE NLR ++ QL  + RE+     + 
Sbjct: 2125 AEEIKNLAKQLNHCEADLQANIDLVATLEAALNDSERNLRKSRVQLAEVTRERERYAEEA 2184

Query: 422  KSLKMQLEDAAAQYEQAKSSVQQEKKVIENVLLEERRAKEQAEKSKRILESRMEELMAKK 481
             +++ QL  A ++ E  ++SV  EK+  E+ + EER+AKE+A K+   LE+R+EE+  +K
Sbjct: 2185 NAMRTQLNSAQSEVENVRNSVMLEKQGYESKIEEERQAKERARKA---LEARLEEVSKRK 2241

Query: 482  S-KFMCF 487
              K  C 
Sbjct: 2242 GNKLFCL 2248



>gi|388854462|emb|CCF51849.1| related to KIP1-kinesin-related protein [Ustilago hordei]
          Length = 1950

 Score = 74.3 bits (181), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 79/127 (62%), Gaps = 4/127 (3%)

Query: 362  SEEVEKLHKRIAKLEGDNSQNRQLVDTLEASLNDSEGNLRVAKKQLQVLQREKSDLVNQM 421
            +EE++ L K++   E D   N  LV TLEA+LNDSE NLR ++ QL  + RE+     + 
Sbjct: 1827 AEEIKNLAKQLNHCEADLQANIDLVATLEAALNDSERNLRKSRVQLAEVTRERERYAAEA 1886

Query: 422  KSLKMQLEDAAAQYEQAKSSVQQEKKVIENVLLEERRAKEQAEKSKRILESRMEELMAKK 481
             +++ QL  A ++ E  ++SV  EK+  E+ + EER+AKE+A K+   LE+R+EE+  +K
Sbjct: 1887 NAMRAQLNSAQSEVENVRNSVMLEKQGYESKIEEERQAKERARKA---LEARLEEVSKRK 1943

Query: 482  -SKFMCF 487
             +K  C 
Sbjct: 1944 NNKLFCL 1950



>gi|319411515|emb|CBQ73559.1| related to KIP1-kinesin-related protein [Sporisorium reilianum SRZ2]
          Length = 1950

 Score = 74.3 bits (181), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 77/127 (60%), Gaps = 4/127 (3%)

Query: 362  SEEVEKLHKRIAKLEGDNSQNRQLVDTLEASLNDSEGNLRVAKKQLQVLQREKSDLVNQM 421
            +EE++ L +++   E D   N  LV TLEA+LNDSE NLR ++ QL  + RE+     + 
Sbjct: 1827 AEEIKNLARQLNHCEADLQANIDLVATLEAALNDSERNLRKSRVQLSEVTRERERYAAEA 1886

Query: 422  KSLKMQLEDAAAQYEQAKSSVQQEKKVIENVLLEERRAKEQAEKSKRILESRMEELMAKK 481
             +++ QL  A ++ E  ++SV  EK+  E+ L EER AKE+A K+   LE+R+EE+  +K
Sbjct: 1887 NAMRAQLNTAQSEVENVRNSVMLEKQGFESKLEEERLAKERARKA---LEARLEEVSKRK 1943

Query: 482  S-KFMCF 487
              K  C 
Sbjct: 1944 GNKLFCL 1950



>gi|402216425|gb|EJT96521.1| hypothetical protein DACRYDRAFT_19273 [Dacryopinax sp. DJM-731 SS1]
          Length = 174

 Score = 74.3 bits (181), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 78/123 (63%), Gaps = 3/123 (2%)

Query: 365 VEKLHKRIAKLEGDNSQNRQLVDTLEASLNDSEGNLRVAKKQLQVLQREKSDLVNQMKSL 424
           ++ L K++   E D   N+QLV TLE  L+D+E +LR ++ Q   L +E+  L  QM++L
Sbjct: 55  IKTLEKQLEHCEADLQANQQLVATLENELHDAERHLRKSRVQSSDLAKERDALNAQMQAL 114

Query: 425 KMQLEDAAAQYEQAKSSVQQEKKVIENVLLEERRAKEQAEKSKRILESRMEELMAKKSKF 484
           + QL DA     + + S+Q+EK+  E  L EER+A+E+A   + +L+ RME++  +KSKF
Sbjct: 115 QTQLRDAQDDSTRLRRSMQEEKQASERKLEEERKARERA---RALLDQRMEDMQKRKSKF 171

Query: 485 MCF 487
           +C 
Sbjct: 172 VCM 174