BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10251_c0_seq1-m.95 5prime_partial 36-1328(-) 431 (-)
         (430 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|510999727|gb|EPB81325.1| hypothetical protein HMPREF1544_1196...   335   2e-89   Mucor circinelloides f. circinelloides 1006PhL
gi|83648379|ref|YP_436814.1| Asp-tRNAAsn/Glu-tRNAGln amidotransf...   316   9e-84   
gi|498194552|ref|WP_010508708.1| Asp-tRNAAsn/Glu-tRNAGln amidotr...   308   2e-81   
gi|483515894|gb|EOB02983.1| Glutamyl-tRNA(Gln) amidotransferase ...   297   5e-78   Anas platyrhynchos [duck]
gi|449283894|gb|EMC90488.1| Glutamyl-tRNA(Gln) amidotransferase ...   294   4e-77   Columba livia [carrier pigeon]
gi|449485340|ref|XP_002188597.2| PREDICTED: fatty acid amide hyd...   292   1e-76   
gi|302809326|ref|XP_002986356.1| hypothetical protein SELMODRAFT...   292   1e-76   Selaginella moellendorffii
gi|470361880|ref|XP_004365217.1| amidase [Capsaspora owczarzaki ...   289   9e-76   Capsaspora owczarzaki ATCC 30864
gi|302814055|ref|XP_002988712.1| hypothetical protein SELMODRAFT...   288   2e-75   Selaginella moellendorffii
gi|224369423|ref|YP_002603587.1| protein GatA1 [Desulfobacterium...   286   1e-74   
gi|313679055|ref|YP_004056794.1| amidase [Oceanithermus profundu...   285   1e-74   
gi|508706701|gb|EOX98597.1| Amidase [Theobroma cacao]                 283   9e-74   Theobroma cacao [chocolate]
gi|326912869|ref|XP_003202768.1| PREDICTED: glutamyl-tRNA(Gln) a...   282   1e-73   
gi|513161533|ref|XP_416561.4| PREDICTED: fatty acid amide hydrol...   281   3e-73   Gallus gallus [bantam]
gi|224060987|ref|XP_002300309.1| predicted protein [Populus tric...   279   1e-72   
gi|470242438|ref|XP_004354868.1| amidase family protein [Dictyos...   279   1e-72   Dictyostelium fasciculatum
gi|330843249|ref|XP_003293572.1| hypothetical protein DICPUDRAFT...   278   3e-72   Dictyostelium purpureum
gi|470107938|ref|XP_004290293.1| PREDICTED: fatty acid amide hyd...   277   6e-72   Fragaria vesca subsp. vesca
gi|69218101|gb|AAZ04133.1| N-acylethanolamine amidohydrolase [Me...   276   1e-71   Medicago truncatula
gi|242074936|ref|XP_002447404.1| hypothetical protein SORBIDRAFT...   275   1e-71   Sorghum bicolor [broomcorn]
gi|325181146|emb|CCA15561.1| glutamyltRNA(Gln) amidotransferase ...   274   3e-71   Albugo laibachii Nc14
gi|225429238|ref|XP_002264191.1| PREDICTED: fatty acid amide hyd...   273   6e-71   Vitis vinifera
gi|115456792|ref|NP_001051996.1| Os04g0102700 [Oryza sativa Japo...   271   2e-70   
gi|38344767|emb|CAE01584.2| OSJNBa0068L06.10 [Oryza sativa Japon...   271   2e-70   Oryza sativa Japonica Group [Japonica rice]
gi|357166884|ref|XP_003580899.1| PREDICTED: glutamyl-tRNA(Gln) a...   271   2e-70   
gi|218194194|gb|EEC76621.1| hypothetical protein OsI_14505 [Oryz...   271   2e-70   Oryza sativa Indica Group [Indian rice]
gi|116317778|emb|CAH65756.1| OSIGBa0123D13.5 [Oryza sativa Indic...   271   2e-70   Oryza sativa Indica Group [Indian rice]
gi|168001836|ref|XP_001753620.1| predicted protein [Physcomitrel...   270   4e-70   Physcomitrella patens
gi|460369377|ref|XP_004230539.1| PREDICTED: fatty acid amide hyd...   270   5e-70   Solanum lycopersicum
gi|460369375|ref|XP_004230538.1| PREDICTED: fatty acid amide hyd...   270   7e-70   Solanum lycopersicum
gi|255554561|ref|XP_002518319.1| glutamyl-tRNA(gln) amidotransfe...   270   8e-70   Ricinus communis
gi|281209446|gb|EFA83614.1| amidase family protein [Polysphondyl...   269   1e-69   Polysphondylium pallidum PN500
gi|356549479|ref|XP_003543121.1| PREDICTED: glutamyl-tRNA(Gln) a...   269   1e-69   
gi|475582661|gb|EMT19195.1| Glutamyl-tRNA(Gln) amidotransferase ...   268   2e-69   Aegilops tauschii
gi|356554842|ref|XP_003545751.1| PREDICTED: glutamyl-tRNA(Gln) a...   268   2e-69   Glycine max [soybeans]
gi|449438270|ref|XP_004136912.1| PREDICTED: fatty acid amide hyd...   268   2e-69   Cucumis sativus [cucumbers]
gi|357446085|ref|XP_003593320.1| Glutamyl-tRNA(Gln) amidotransfe...   266   1e-68   
gi|502077377|ref|XP_004485635.1| PREDICTED: fatty acid amide hyd...   266   1e-68   Cicer arietinum [garbanzo]
gi|326487738|dbj|BAK05541.1| predicted protein [Hordeum vulgare ...   265   2e-68   Hordeum vulgare subsp. vulgare [barley]
gi|460369387|ref|XP_004230544.1| PREDICTED: fatty acid amide hyd...   263   6e-68   Solanum lycopersicum
gi|301097937|ref|XP_002898062.1| glutamyl-tRNA(Gln) amidotransfe...   263   8e-68   Phytophthora infestans T30-4
gi|260790541|ref|XP_002590300.1| hypothetical protein BRAFLDRAFT...   261   3e-67   Branchiostoma floridae
gi|475582662|gb|EMT19196.1| Glutamyl-tRNA(Gln) amidotransferase ...   260   6e-67   Aegilops tauschii
gi|297794035|ref|XP_002864902.1| N-acylethanolamine amidohydrola...   259   1e-66   Arabidopsis lyrata subsp. lyrata
gi|460369383|ref|XP_004230542.1| PREDICTED: fatty acid amide hyd...   258   2e-66   
gi|482548557|gb|EOA12751.1| hypothetical protein CARUB_v10028432...   258   3e-66   Capsella rubella
gi|462395702|gb|EMJ01501.1| hypothetical protein PRUPE_ppa003050...   258   3e-66   Prunus persica
gi|10178225|dbj|BAB11605.1| unnamed protein product [Arabidopsis...   258   3e-66   Arabidopsis thaliana [mouse-ear cress]
gi|425770617|gb|EKV09085.1| N-acylethanolamine amidohydrolase, p...   258   3e-66   Penicillium digitatum Pd1
gi|186532737|ref|NP_201249.2| fatty acid amide hydrolase [Arabid...   257   4e-66   Arabidopsis thaliana [mouse-ear cress]
gi|508700813|gb|EOX92709.1| Fatty acid amide hydrolase [Theobrom...   256   6e-66   Theobroma cacao [chocolate]
gi|303317760|ref|XP_003068882.1| Amidase family protein [Coccidi...   256   8e-66   Coccidioides posadasii C735 delta SOWgp
gi|8163875|gb|AAF73891.1|AF223949_1 amidase [Arabidopsis thaliana]    256   1e-65   Arabidopsis thaliana [mouse-ear cress]
gi|119186459|ref|XP_001243836.1| hypothetical protein CIMG_03277...   256   1e-65   Coccidioides immitis RS
gi|348682927|gb|EGZ22743.1| hypothetical protein PHYSODRAFT_3459...   255   1e-65   Phytophthora sojae
gi|378730068|gb|EHY56527.1| amidase [Exophiala dermatitidis NIH/...   255   2e-65   Exophiala dermatitidis NIH/UT8656
gi|315043202|ref|XP_003170977.1| amidase [Arthroderma gypseum CB...   255   2e-65   Microsporum gypseum CBS 118893
gi|502139765|ref|XP_004503893.1| PREDICTED: fatty acid amide hyd...   255   2e-65   Cicer arietinum [garbanzo]
gi|502139767|ref|XP_004503894.1| PREDICTED: fatty acid amide hyd...   254   2e-65   Cicer arietinum [garbanzo]
gi|470148351|ref|XP_004309731.1| PREDICTED: fatty acid amide hyd...   254   4e-65   Fragaria vesca subsp. vesca
gi|169767442|ref|XP_001818192.1| N-acylethanolamine amidohydrola...   253   6e-65   Aspergillus oryzae RIB40
gi|296808397|ref|XP_002844537.1| amidase [Arthroderma otae CBS 1...   253   8e-65   Arthroderma otae CBS 113480
gi|258563204|ref|XP_002582347.1| conserved hypothetical protein ...   252   2e-64   Uncinocarpus reesii 1704
gi|302663156|ref|XP_003023224.1| glutamyl-tRNA(Gln) amidotransfe...   251   2e-64   Trichophyton verrucosum HKI 0517
gi|327295084|ref|XP_003232237.1| N-acylethanolamine amidohydrola...   250   5e-64   Trichophyton rubrum CBS 118892
gi|326481981|gb|EGE05991.1| amidase [Trichophyton equinum CBS 12...   250   7e-64   Trichophyton equinum CBS 127.97
gi|326473324|gb|EGD97333.1| N-acylethanolamine amidohydrolase [T...   250   7e-64   Trichophyton tonsurans CBS 112818
gi|255941748|ref|XP_002561643.1| Pc16g13440 [Penicillium chrysog...   249   1e-63   Penicillium rubens Wisconsin 54-1255
gi|302499824|ref|XP_003011907.1| glutamyl-tRNA(Gln) amidotransfe...   249   1e-63   Arthroderma benhamiae CBS 112371
gi|356511201|ref|XP_003524317.1| PREDICTED: glutamyl-tRNA(Gln) a...   249   1e-63   Glycine max [soybeans]
gi|66819445|ref|XP_643382.1| amidase family protein [Dictyosteli...   248   3e-63   Dictyostelium discoideum AX4
gi|121701005|ref|XP_001268767.1| N-acylethanolamine amidohydrola...   247   4e-63   Aspergillus clavatus NRRL 1
gi|383452726|ref|YP_005366715.1| amidase family protein [Corallo...   247   4e-63   
gi|224081068|ref|XP_002306283.1| predicted protein [Populus tric...   247   4e-63   Populus trichocarpa [western balsam poplar]
gi|449457323|ref|XP_004146398.1| PREDICTED: fatty acid amide hyd...   246   7e-63   
gi|302766559|ref|XP_002966700.1| hypothetical protein SELMODRAFT...   246   8e-63   Selaginella moellendorffii
gi|428171149|gb|EKX40068.1| hypothetical protein GUITHDRAFT_1138...   246   1e-62   Guillardia theta CCMP2712
gi|295664358|ref|XP_002792731.1| glutamyl-tRNA(Gln) amidotransfe...   244   3e-62   
gi|226295312|gb|EEH50732.1| glutamyl-tRNA(Gln) amidotransferase ...   244   3e-62   Paracoccidioides brasiliensis Pb18
gi|225677554|gb|EEH15838.1| glutamyl-tRNA(Gln) amidotransferase ...   244   3e-62   Paracoccidioides brasiliensis Pb03
gi|224093658|ref|XP_002309950.1| predicted protein [Populus tric...   244   3e-62   
gi|67517097|ref|XP_658432.1| hypothetical protein AN0828.2 [Aspe...   244   5e-62   Aspergillus nidulans FGSC A4
gi|302772024|ref|XP_002969430.1| hypothetical protein SELMODRAFT...   243   6e-62   Selaginella moellendorffii
gi|357520143|ref|XP_003630360.1| Glutamyl-tRNA(Gln) amidotransfe...   243   7e-62   Medicago truncatula
gi|108864044|gb|ABA91618.2| Amidase family protein, expressed [O...   243   7e-62   Oryza sativa Japonica Group [Japonica rice]
gi|297611309|ref|NP_001065856.2| Os11g0170000 [Oryza sativa Japo...   243   8e-62   
gi|225561555|gb|EEH09835.1| glutamyl-tRNA amidotransferase subun...   242   1e-61   Histoplasma capsulatum G186AR
gi|302792549|ref|XP_002978040.1| hypothetical protein SELMODRAFT...   242   2e-61   Selaginella moellendorffii
gi|302774693|ref|XP_002970763.1| hypothetical protein SELMODRAFT...   242   2e-61   Selaginella moellendorffii
gi|218185324|gb|EEC67751.1| hypothetical protein OsI_35272 [Oryz...   242   2e-61   Oryza sativa Indica Group [Indian rice]
gi|310820358|ref|YP_003952716.1| amidase family protein [Stigmat...   241   3e-61   
gi|356507431|ref|XP_003522470.1| PREDICTED: glutamyl-tRNA(Gln) a...   240   5e-61   Glycine max [soybeans]
gi|356527536|ref|XP_003532365.1| PREDICTED: glutamyl-tRNA(Gln) a...   240   6e-61   Glycine max [soybeans]
gi|119494944|ref|XP_001264270.1| N-acylethanolamine amidohydrola...   239   8e-61   Aspergillus fischeri NRRL 181
gi|242070201|ref|XP_002450377.1| hypothetical protein SORBIDRAFT...   239   1e-60   Sorghum bicolor [broomcorn]
gi|238484307|ref|XP_002373392.1| N-acylethanolamine amidohydrola...   239   1e-60   Aspergillus flavus NRRL3357
gi|70996204|ref|XP_752857.1| N-acylethanolamine amidohydrolase [...   239   1e-60   Aspergillus fumigatus Af293
gi|358370116|dbj|GAA86728.1| N-acylethanolamine amidohydrolase [...   238   3e-60   Aspergillus kawachii IFO 4308
gi|356518808|ref|XP_003528069.1| PREDICTED: glutamyl-tRNA(Gln) a...   238   4e-60   Glycine max [soybeans]
gi|494833495|gb|EON69450.1| hypothetical protein W97_08710 [Coni...   237   5e-60   Coniosporium apollinis CBS 100218
gi|242778166|ref|XP_002479184.1| N-acylethanolamine amidohydrola...   236   1e-59   Talaromyces stipitatus ATCC 10500
gi|225438343|ref|XP_002272907.1| PREDICTED: fatty acid amide hyd...   236   1e-59   Vitis vinifera
gi|154282885|ref|XP_001542238.1| conserved hypothetical protein ...   236   1e-59   Histoplasma capsulatum NAm1
gi|168000260|ref|XP_001752834.1| predicted protein [Physcomitrel...   236   1e-59   Physcomitrella patens
gi|325090999|gb|EGC44309.1| N-acylethanolamine amidohydrolase [A...   235   2e-59   Histoplasma capsulatum H88
gi|488715953|ref|WP_002639829.1| amidase [Chondromyces apiculatu...   234   3e-59   Myxococcus hansupus
gi|240274662|gb|EER38178.1| N-acylethanolamine amidohydrolase [A...   233   8e-59   Histoplasma capsulatum H143
gi|326519260|dbj|BAJ96629.1| predicted protein [Hordeum vulgare ...   233   9e-59   Hordeum vulgare subsp. vulgare [barley]
gi|212533461|ref|XP_002146887.1| N-acylethanolamine amidohydrola...   233   1e-58   Talaromyces marneffei ATCC 18224
gi|414588462|tpg|DAA39033.1| TPA: hypothetical protein ZEAMMB73_...   232   1e-58   Zea mays [maize]
gi|357160660|ref|XP_003578835.1| PREDICTED: glutamyl-tRNA(Gln) a...   232   2e-58   
gi|414588463|tpg|DAA39034.1| TPA: hypothetical protein ZEAMMB73_...   232   2e-58   Zea mays [maize]
gi|224033405|gb|ACN35778.1| unknown [Zea mays]                        232   2e-58   Zea mays [maize]
gi|414588464|tpg|DAA39035.1| TPA: hypothetical protein ZEAMMB73_...   231   3e-58   Zea mays [maize]
gi|414588466|tpg|DAA39037.1| TPA: hypothetical protein ZEAMMB73_...   231   3e-58   Zea mays [maize]
gi|367029415|ref|XP_003663991.1| hypothetical protein MYCTH_2306...   231   4e-58   Myceliophthora thermophila ATCC 42464
gi|459177343|ref|XP_002123113.2| PREDICTED: fatty acid amide hyd...   230   5e-58   
gi|413916255|gb|AFW56187.1| hypothetical protein ZEAMMB73_989912...   230   6e-58   Zea mays [maize]
gi|145230876|ref|XP_001389702.1| N-acylethanolamine amidohydrola...   230   6e-58   Aspergillus niger CBS 513.88
gi|261189935|ref|XP_002621378.1| N-acylethanolamine amidohydrola...   229   8e-58   Blastomyces gilchristii SLH14081
gi|327352021|gb|EGE80878.1| N-acylethanolamine amidohydrolase [A...   229   1e-57   Blastomyces dermatitidis ATCC 18188
gi|239612856|gb|EEQ89843.1| N-acylethanolamine amidohydrolase [A...   229   1e-57   Blastomyces dermatitidis ER-3
gi|62701930|gb|AAX93003.1| Amidase, putative [Oryza sativa Japon...   229   1e-57   Oryza sativa Japonica Group [Japonica rice]
gi|147856346|emb|CAN81781.1| hypothetical protein VITISV_019910 ...   229   1e-57   Vitis vinifera
gi|242084924|ref|XP_002442887.1| hypothetical protein SORBIDRAFT...   229   1e-57   Sorghum bicolor [broomcorn]
gi|115492639|ref|XP_001210947.1| conserved hypothetical protein ...   229   2e-57   Aspergillus terreus NIH2624
gi|167998636|ref|XP_001752024.1| predicted protein [Physcomitrel...   227   4e-57   Physcomitrella patens
gi|340381644|ref|XP_003389331.1| PREDICTED: hypothetical protein...   227   6e-57   
gi|465974110|gb|EMP33658.1| Amidase [Chelonia mydas]                  226   1e-56   Chelonia mydas [green seaturtle]
gi|453085975|gb|EMF14017.1| amidase signature enzyme [Mycosphaer...   225   2e-56   Sphaerulina musiva SO2202
gi|340385589|ref|XP_003391292.1| PREDICTED: glutamyl-tRNA(Gln) a...   225   2e-56   Amphimedon queenslandica
gi|219887657|gb|ACL54203.1| unknown [Zea mays] >gi|414588461|tpg...   225   2e-56   Zea mays [maize]
gi|156040583|ref|XP_001587278.1| hypothetical protein SS1G_12308...   225   2e-56   Sclerotinia sclerotiorum 1980 UF-70
gi|442319592|ref|YP_007359613.1| amidase family protein [Myxococ...   224   3e-56   
gi|116202775|ref|XP_001227199.1| hypothetical protein CHGG_09272...   224   3e-56   Chaetomium globosum CBS 148.51
gi|482814810|gb|EOA91485.1| hypothetical protein SETTUDRAFT_1703...   224   3e-56   Setosphaeria turcica Et28A
gi|336270062|ref|XP_003349790.1| hypothetical protein SMAC_00678...   224   5e-56   Sordaria macrospora k-hell
gi|472239297|gb|EMR84116.1| putative glutamyl-trna amidotransfer...   222   2e-55   Botrytis cinerea BcDW1
gi|77553129|gb|ABA95925.1| Amidase family protein, expressed [Or...   222   2e-55   Oryza sativa Japonica Group [Japonica rice]
gi|336466230|gb|EGO54395.1| hypothetical protein NEUTE1DRAFT_689...   222   2e-55   Neurospora tetrasperma FGSC 2508
gi|449303151|gb|EMC99159.1| hypothetical protein BAUCODRAFT_3147...   222   2e-55   Baudoinia panamericana UAMH 10762
gi|290977164|ref|XP_002671308.1| predicted protein [Naegleria gr...   220   5e-55   Naegleria gruberi strain NEG-M
gi|85077960|ref|XP_956088.1| hypothetical protein NCU04092 [Neur...   220   7e-55   Neurospora crassa OR74A
gi|330914416|ref|XP_003296630.1| hypothetical protein PTT_06775 ...   219   1e-54   Pyrenophora teres f. teres 0-1
gi|169616900|ref|XP_001801865.1| hypothetical protein SNOG_11626...   219   1e-54   Parastagonospora nodorum SN15
gi|317144888|ref|XP_001820457.2| N-acylethanolamine amidohydrola...   219   1e-54   Aspergillus oryzae RIB40
gi|492934050|ref|WP_006050964.1| amidase [Burkholderia graminis]...   219   1e-54   Paraburkholderia graminis
gi|396481868|ref|XP_003841342.1| similar to glutamyl-tRNA(Gln) a...   219   1e-54   Leptosphaeria maculans JN3
gi|375008395|ref|YP_004982028.1| glutamyl-tRNA(Gln) amidotransfe...   218   4e-54   
gi|296817995|ref|XP_002849334.1| glutamyl-tRNA(Gln) amidotransfe...   218   4e-54   Arthroderma otae CBS 113480
gi|338536053|ref|YP_004669387.1| amidase family protein [Myxococ...   217   6e-54   
gi|451846487|gb|EMD59797.1| hypothetical protein COCSADRAFT_1939...   217   6e-54   Bipolaris sorokiniana ND90Pr
gi|108761318|ref|YP_632999.1| amidase [Myxococcus xanthus DK 162...   216   8e-54   
gi|477529775|gb|ENH81525.1| glutamyl-tRNA amidotransferase subun...   216   1e-53   Colletotrichum orbiculare MAFF 240422
gi|310800935|gb|EFQ35828.1| amidase [Glomerella graminicola M1.001]   216   2e-53   Colletotrichum graminicola M1.001
gi|340381035|ref|XP_003389027.1| PREDICTED: glutamyl-tRNA(Gln) a...   215   2e-53   Amphimedon queenslandica
gi|297530427|ref|YP_003671702.1| amidase [Geobacillus sp. C56-T3...   214   3e-53   
gi|514404191|dbj|GAD15025.1| glutamyl-tRNA(Gln) amidotransferase...   214   5e-53   Geobacillus kaustophilus GBlys
gi|56419927|ref|YP_147245.1| glutamyl-tRNA(Gln) amidotransferase...   214   5e-53   
gi|477586843|gb|ENI03926.1| hypothetical protein COCC4DRAFT_2445...   213   9e-53   Bipolaris maydis ATCC 48331
gi|406860204|gb|EKD13264.1| putative glutamyl-tRNA(Gln) amidotra...   213   1e-52   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|391872460|gb|EIT81576.1| alpha-glucosidase [Aspergillus oryza...   213   1e-52   Aspergillus oryzae 3.042
gi|238485422|ref|XP_002373949.1| fatty-acid amide hydrolase, put...   213   1e-52   Aspergillus flavus NRRL3357
gi|83768316|dbj|BAE58455.1| unnamed protein product [Aspergillus...   213   1e-52   Aspergillus oryzae RIB40
gi|406868314|gb|EKD21351.1| glutamyl-tRNA(Gln) amidotransferase ...   212   1e-52   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|460414675|ref|XP_004252690.1| PREDICTED: fatty acid amide hyd...   212   2e-52   
gi|261419598|ref|YP_003253280.1| amidase [Geobacillus sp. Y412MC...   212   2e-52   
gi|15982789|gb|AAL09742.1| AT5g64440/T12B11_3 [Arabidopsis thali...   212   2e-52   Arabidopsis thaliana [mouse-ear cress]
gi|239826826|ref|YP_002949450.1| amidase [Geobacillus sp. WCH70]...   212   2e-52   
gi|315041893|ref|XP_003170323.1| glutamyl-tRNA(Gln) amidotransfe...   211   3e-52   Microsporum gypseum CBS 118893
gi|429855332|gb|ELA30291.1| glutamyl-tRNA amidotransferase subun...   211   4e-52   Colletotrichum gloeosporioides Nara gc5
gi|327298715|ref|XP_003234051.1| hypothetical protein TERG_05918...   209   1e-51   Trichophyton rubrum CBS 118892
gi|326484199|gb|EGE08209.1| glutamyl-tRNA(Gln) amidotransferase ...   209   2e-51   Trichophyton equinum CBS 127.97
gi|407925341|gb|EKG18353.1| Amidase [Macrophomina phaseolina MS6]     209   2e-51   Macrophomina phaseolina MS6
gi|340517329|gb|EGR47574.1| amidase [Trichoderma reesei QM6a]         208   2e-51   Trichoderma reesei QM6a
gi|340939221|gb|EGS19843.1| hypothetical protein CTHT_0043280 [C...   208   2e-51   Chaetomium thermophilum var. thermophilum DSM 1495
gi|451994610|gb|EMD87080.1| hypothetical protein COCHEDRAFT_1197...   208   3e-51   Bipolaris maydis C5
gi|429849878|gb|ELA25208.1| n-acylethanolamine amidohydrolase [C...   207   4e-51   Colletotrichum gloeosporioides Nara gc5
gi|296423527|ref|XP_002841305.1| hypothetical protein [Tuber mel...   207   5e-51   Tuber melanosporum Mel28
gi|398412389|ref|XP_003857519.1| amidase signature enzyme [Zymos...   207   5e-51   Zymoseptoria tritici IPO323
gi|494767234|ref|WP_007502642.1| glutamyl-tRNA amidotransferase ...   206   1e-50   
gi|326472535|gb|EGD96544.1| hypothetical protein TESG_03984 [Tri...   206   2e-50   Trichophyton tonsurans CBS 112818
gi|302663928|ref|XP_003023601.1| hypothetical protein TRV_02233 ...   205   2e-50   Trichophyton verrucosum HKI 0517
gi|380485793|emb|CCF39129.1| amidase [Colletotrichum higginsianum]    205   2e-50   Colletotrichum higginsianum
gi|367051883|ref|XP_003656320.1| hypothetical protein THITE_2096...   205   2e-50   Thielavia terrestris NRRL 8126
gi|258573559|ref|XP_002540961.1| conserved hypothetical protein ...   204   3e-50   Uncinocarpus reesii 1704
gi|485916291|gb|EOD43673.1| putative ubiquitin-protein ligase se...   204   3e-50   Neofusicoccum parvum UCRNP2
gi|498238040|ref|WP_010552196.1| amidase [Brachybacterium paraco...   204   3e-50   Brachybacterium paraconglomeratum
gi|475674691|gb|EMT71772.1| Amidase [Fusarium oxysporum f. sp. c...   204   3e-50   Fusarium oxysporum f. sp. cubense race 4
gi|477517210|gb|ENH69459.1| Amidase [Fusarium oxysporum f. sp. c...   204   4e-50   Fusarium oxysporum f. sp. cubense race 1
gi|367018228|ref|XP_003658399.1| hypothetical protein MYCTH_2294...   204   4e-50   Myceliophthora thermophila ATCC 42464
gi|342887743|gb|EGU87177.1| hypothetical protein FOXB_02315 [Fus...   204   5e-50   Fusarium oxysporum Fo5176
gi|317121336|ref|YP_004101339.1| amidase [Thermaerobacter marian...   203   7e-50   
gi|171694898|ref|XP_001912373.1| hypothetical protein [Podospora...   202   1e-49   Podospora anserina S mat+
gi|497321099|ref|WP_009635312.1| amidase [Serratia sp. M24T3] >g...   202   2e-49   Serratia sp. M24T3
gi|350295966|gb|EGZ76943.1| amidase signature enzyme [Neurospora...   202   2e-49   Neurospora tetrasperma FGSC 2509
gi|493884298|ref|WP_006830486.1| glutamyl-tRNA amidotransferase ...   201   4e-49   Planococcus antarcticus
gi|336463892|gb|EGO52132.1| hypothetical protein NEUTE1DRAFT_714...   201   4e-49   Neurospora tetrasperma FGSC 2508
gi|302501017|ref|XP_003012501.1| hypothetical protein ARB_01114 ...   200   5e-49   Arthroderma benhamiae CBS 112371
gi|310790061|gb|EFQ25594.1| amidase [Glomerella graminicola M1.001]   200   6e-49   Colletotrichum graminicola M1.001
gi|495454888|ref|WP_008179582.1| glutamyl-tRNA amidotransferase ...   200   6e-49   
gi|85111196|ref|XP_963822.1| hypothetical protein NCU00905 [Neur...   200   7e-49   Neurospora crassa OR74A
gi|490347927|ref|WP_004227700.1| glutamyl-tRNA amidotransferase ...   200   8e-49   
gi|496820669|ref|WP_009373347.1| glutamyl-tRNA(Gln) amidotransfe...   199   9e-49   Lysinibacillus fusiformis
gi|499128854|ref|WP_010857652.1| glutamyl-tRNA(Gln) amidotransfe...   199   1e-48   
gi|115386944|ref|XP_001210013.1| conserved hypothetical protein ...   199   1e-48   Aspergillus terreus NIH2624
gi|408400420|gb|EKJ79501.1| hypothetical protein FPSE_00320 [Fus...   199   1e-48   Fusarium pseudograminearum CS3096
gi|477525535|gb|ENH77424.1| glutamyl-tRNA amidotransferase subun...   198   2e-48   Colletotrichum orbiculare MAFF 240422
gi|408393759|gb|EKJ73018.1| hypothetical protein FPSE_06806 [Fus...   198   2e-48   Fusarium pseudograminearum CS3096
gi|169826340|ref|YP_001696498.1| glutamyl-tRNA(Gln) amidotransfe...   198   3e-48   
gi|46107650|ref|XP_380884.1| hypothetical protein FG00708.1 [Fus...   197   4e-48   
gi|497929919|ref|WP_010244075.1| amidase [Pseudonocardia sp. P1]      197   5e-48   Pseudonocardia sp. P1
gi|497451738|ref|WP_009765936.1| glutamyl-tRNA amidotransferase ...   197   6e-48   
gi|25026579|ref|NP_736633.1| glutamyl-tRNA(Gln) amidotransferase...   197   6e-48   
gi|171682542|ref|XP_001906214.1| hypothetical protein [Podospora...   197   7e-48   Podospora anserina S mat+
gi|497779350|ref|WP_010093534.1| glutamyl-tRNA amidotransferase ...   196   1e-47   Ornithinibacillus scapharcae
gi|345571108|gb|EGX53923.1| hypothetical protein AOL_s00004g582 ...   196   1e-47   Arthrobotrys oligospora ATCC 24927
gi|331699686|ref|YP_004335925.1| amidase [Pseudonocardia dioxani...   196   1e-47   
gi|384483241|gb|EIE75421.1| hypothetical protein RO3G_00125 [Rhi...   196   2e-47   Rhizopus delemar RA 99-880
gi|320593057|gb|EFX05466.1| amidotransferase [Grosmannia clavige...   195   2e-47   Grosmannia clavigera kw1407
gi|477508232|gb|ENH61526.1| Glutamyl-tRNA(Gln) amidotransferase ...   195   2e-47   Fusarium oxysporum f. sp. cubense race 1
gi|475663559|gb|EMT61354.1| Glutamyl-tRNA(Gln) amidotransferase ...   195   2e-47   Fusarium oxysporum f. sp. cubense race 4
gi|119192100|ref|XP_001246656.1| hypothetical protein CIMG_00427...   195   2e-47   Coccidioides immitis RS
gi|402075748|gb|EJT71171.1| hypothetical protein GGTG_10431 [Gae...   195   3e-47   Gaeumannomyces graminis var. tritici R3-111a-1
gi|307102637|gb|EFN50907.1| hypothetical protein CHLNCDRAFT_1416...   194   3e-47   Chlorella variabilis
gi|440465251|gb|ELQ34589.1| glutamyl-tRNA(Gln) amidotransferase ...   194   3e-47   Magnaporthe oryzae Y34
gi|303313097|ref|XP_003066560.1| Amidase family protein [Coccidi...   194   4e-47   Coccidioides posadasii C735 delta SOWgp
gi|500253492|gb|EON97175.1| putative glutamyl-trna amidotransfer...   194   4e-47   Phaeoacremonium minimum UCRPA7
gi|389630822|ref|XP_003713064.1| glutamyl-tRNA(Gln) amidotransfe...   194   4e-47   Magnaporthe oryzae 70-15
gi|392384044|ref|YP_005033240.1| putative Glutamyl-tRNA(Gln) ami...   194   6e-47   
gi|320036558|gb|EFW18497.1| conserved hypothetical protein [Cocc...   194   6e-47   Coccidioides posadasii str. Silveira
gi|283826938|ref|YP_003377700.1| putative amidotransferase [Cory...   193   8e-47   Corynebacterium glutamicum
gi|313245080|emb|CBY42518.1| unnamed protein product [Oikopleura...   193   9e-47   Oikopleura dioica
gi|336273784|ref|XP_003351646.1| hypothetical protein SMAC_00188...   192   1e-46   Sordaria macrospora k-hell
gi|449515768|ref|XP_004164920.1| PREDICTED: fatty acid amide hyd...   192   1e-46   
gi|473951597|gb|EMS50766.1| Filament-like plant protein [Triticu...   192   1e-46   Triticum urartu
gi|46114670|ref|XP_383353.1| hypothetical protein FG03177.1 [Fus...   192   2e-46   
gi|322705561|gb|EFY97146.1| amidase [Metarhizium anisopliae ARSE...   191   3e-46   
gi|148657191|ref|YP_001277396.1| amidase [Roseiflexus sp. RS-1] ...   191   3e-46   
gi|154295346|ref|XP_001548109.1| hypothetical protein BC1G_13254...   191   3e-46   Botrytis cinerea B05.10
gi|408394679|gb|EKJ73879.1| hypothetical protein FPSE_06002 [Fus...   191   4e-46   Fusarium pseudograminearum CS3096
gi|490967398|ref|WP_004829199.1| hypothetical protein [Acinetoba...   190   6e-46   Acinetobacter bereziniae
gi|302413167|ref|XP_003004416.1| amidase [Verticillium albo-atru...   190   6e-46   Verticillium alfalfae VaMs.102
gi|342873848|gb|EGU75958.1| hypothetical protein FOXB_13528 [Fus...   190   6e-46   Fusarium oxysporum Fo5176
gi|399172514|emb|CCE26661.1| related to amidase [Claviceps purpu...   190   7e-46   Claviceps purpurea 20.1
gi|338730589|ref|YP_004659981.1| amidase [Thermotoga thermarum D...   190   8e-46   
gi|494595593|ref|WP_007353852.1| amidase [Oscillatoria sp. PCC 6...   190   9e-46   
gi|302881723|ref|XP_003039772.1| hypothetical protein NECHADRAFT...   189   9e-46   Nectria haematococca mpVI 77-13-4
gi|491174360|ref|WP_005032726.1| glutamyl-tRNA amidotransferase ...   189   1e-45   Acinetobacter bereziniae
gi|346972563|gb|EGY16015.1| glutamyl-tRNA(Gln) amidotransferase ...   189   1e-45   Verticillium dahliae VdLs.17
gi|471574614|gb|EMR72419.1| putative n-acylethanolamine amidohyd...   188   2e-45   Eutypa lata UCREL1
gi|497269915|ref|WP_009584132.1| amidase [Acinetobacter sp. WC-7...   188   3e-45   Acinetobacter
gi|490961272|ref|WP_004823085.1| hypothetical protein [Acinetoba...   188   3e-45   Acinetobacter guillouiae
gi|116182600|ref|XP_001221149.1| hypothetical protein CHGG_01928...   187   4e-45   Chaetomium globosum CBS 148.51
gi|495160383|ref|WP_007885184.1| amidase [Pantoea sp. GM01] >gi|...   187   4e-45   Pantoea sp. GM01
gi|320586346|gb|EFW99025.1| glutamyl-tRNA amidotransferase subun...   187   4e-45   Grosmannia clavigera kw1407
gi|358390890|gb|EHK40295.1| hypothetical protein TRIATDRAFT_4198...   187   5e-45   Trichoderma atroviride IMI 206040
gi|358387567|gb|EHK25161.1| hypothetical protein TRIVIDRAFT_3297...   187   5e-45   Trichoderma virens Gv29-8
gi|46134001|ref|XP_389316.1| hypothetical protein FG09140.1 [Fus...   186   9e-45   
gi|492663059|ref|WP_005915086.1| glutamyl-tRNA(Gln) amidotransfe...   186   9e-45   Fusobacterium hwasookii
gi|222528767|ref|YP_002572649.1| aspartyl/glutamyl-tRNA amidotra...   186   2e-44   
gi|495384399|ref|WP_008109103.1| amidase [Pantoea sp. YR343] >gi...   186   2e-44   Pantoea sp. YR343
gi|322692513|gb|EFY84419.1| amidase [Metarhizium acridum CQMa 102]    184   4e-44   Metarhizium acridum CQMa 102
gi|494147965|ref|WP_007087711.1| amidase [Bacillus bataviensis] ...   184   4e-44   Bacillus bataviensis
gi|347833219|emb|CCD48916.1| hypothetical protein BofuT4_P105740...   184   5e-44   Botrytis cinerea T4
gi|492628750|ref|WP_005907064.1| glutamyl-tRNA(Gln) amidotransfe...   183   7e-44   
gi|188996431|ref|YP_001930682.1| aspartyl/glutamyl-tRNA amidotra...   183   7e-44   
gi|291227346|ref|XP_002733647.1| PREDICTED: hypothetical protein...   183   7e-44   
gi|507381134|ref|YP_008019253.1| glutamyl-tRNA(Gln) amidotransfe...   183   8e-44   
gi|494810847|ref|WP_007546255.1| glutamyl-tRNA(Gln) amidotransfe...   183   9e-44   Sulfurihydrogenibium yellowstonense
gi|159900498|ref|YP_001546745.1| aspartyl/glutamyl-tRNA amidotra...   183   9e-44   
gi|413916251|gb|AFW56183.1| hypothetical protein ZEAMMB73_989912...   183   9e-44   Zea mays [maize]
gi|491688089|ref|WP_005544226.1| glutamyl-tRNA amidotransferase ...   183   1e-43   Paenibacillus alvei
gi|492592770|ref|WP_005897926.1| glutamyl-tRNA(Gln) amidotransfe...   183   1e-43   Fusobacterium nucleatum
gi|492602021|ref|WP_005900446.1| glutamyl-tRNA(Gln) amidotransfe...   182   1e-43   
gi|218186498|gb|EEC68925.1| hypothetical protein OsI_37616 [Oryz...   182   1e-43   Oryza sativa Indica Group [Indian rice]
gi|312622942|ref|YP_004024555.1| glutamyl-tRNA(Gln) amidotransfe...   182   2e-43   
gi|413916252|gb|AFW56184.1| hypothetical protein ZEAMMB73_989912...   182   2e-43   Zea mays [maize]
gi|402078275|gb|EJT73540.1| glutamyl-tRNA(Gln) amidotransferase ...   182   2e-43   Gaeumannomyces graminis var. tritici R3-111a-1
gi|226505582|ref|NP_001141439.1| uncharacterized protein LOC1002...   182   2e-43   
gi|492644063|ref|WP_005909324.1| glutamyl-tRNA(Gln) amidotransfe...   182   2e-43   
gi|52789205|gb|AAU87541.1| amidase [Comamonas testosteroni]           182   2e-43   
gi|302871353|ref|YP_003839989.1| glutamyl-tRNA(Gln) amidotransfe...   181   3e-43   
gi|294876564|ref|XP_002767709.1| conserved hypothetical protein ...   181   3e-43   
gi|312128132|ref|YP_003993006.1| glutamyl-tRNA(Gln) amidotransfe...   181   3e-43   
gi|451943460|ref|YP_007464096.1| hypothetical protein A605_03615...   181   3e-43   
gi|497453638|ref|WP_009767836.1| amidohydrolase, AtzE family [Os...   181   3e-43   
gi|146295943|ref|YP_001179714.1| aspartyl/glutamyl-tRNA amidotra...   181   3e-43   
gi|312794120|ref|YP_004027043.1| glutamyl-tRNA(Gln) amidotransfe...   181   4e-43   
gi|496071203|ref|WP_008795710.1| glutamyl-tRNA(Gln) amidotransfe...   181   5e-43   
gi|116626070|ref|YP_828226.1| aspartyl/glutamyl-tRNA amidotransf...   180   6e-43   
gi|344996607|ref|YP_004798950.1| glutamyl-tRNA(Gln) amidotransfe...   180   6e-43   
gi|434397558|ref|YP_007131562.1| amidohydrolase, AtzE family [St...   180   6e-43   
gi|313224887|emb|CBY20679.1| unnamed protein product [Oikopleura...   180   6e-43   
gi|313221273|emb|CBY43728.1| unnamed protein product [Oikopleura...   180   7e-43   
gi|465145762|gb|EMP17023.1| aspartyl/glutamyl-tRNA amidotransfer...   180   7e-43   
gi|19704089|ref|NP_603651.1| aspartyl/glutamyl-tRNA amidotransfe...   180   7e-43   
gi|218768373|ref|YP_002342885.1| aspartyl/glutamyl-tRNA amidotra...   180   9e-43   
gi|385800473|ref|YP_005836877.1| aspartyl/glutamyl-tRNA amidotra...   180   9e-43   
gi|312134644|ref|YP_004001982.1| glutamyl-tRNA(Gln) amidotransfe...   179   1e-42   
gi|380476565|emb|CCF44645.1| amidase, partial [Colletotrichum hi...   179   1e-42   
gi|495975747|ref|WP_008700326.1| glutamyl-tRNA(Gln) amidotransfe...   179   1e-42   
gi|379735929|ref|YP_005329435.1| amidase [Blastococcus saxobside...   179   1e-42   
gi|374849521|dbj|BAL52534.1| aspartyl-tRNA(Asn)/glutamyl-tRNA (G...   179   1e-42   
gi|493960806|ref|WP_006904353.1| amidase [Thermaerobacter subter...   179   1e-42   
gi|492904647|ref|WP_006035053.1| glutamyl-tRNA(Gln) amidotransfe...   179   1e-42   
gi|494767500|ref|WP_007502908.1| aspartyl/glutamyl-tRNA amidotra...   179   2e-42   
gi|225848068|ref|YP_002728231.1| aspartyl/glutamyl-tRNA amidotra...   178   2e-42   
gi|495967850|ref|WP_008692429.1| glutamyl-tRNA(Gln) amidotransfe...   178   3e-42   
gi|512193832|gb|EPE09589.1| glutamyl-trna amidotransferase subun...   178   3e-42   
gi|489448719|ref|WP_003354106.1| aspartyl/glutamyl-tRNA amidotra...   178   3e-42   
gi|310772405|dbj|BAJ23969.1| amidase [uncultured bacterium]           178   3e-42   
gi|163855724|ref|YP_001630022.1| glutamyl-tRNA(Gln) amidotransfe...   178   3e-42   
gi|413916253|gb|AFW56185.1| hypothetical protein ZEAMMB73_989912...   178   4e-42   
gi|488151134|ref|WP_002222342.1| glutamyl-tRNA amidotransferase ...   177   4e-42   
gi|488170479|ref|WP_002241687.1| glutamyl-tRNA amidotransferase ...   177   4e-42   
gi|491629620|ref|WP_005487159.1| Aspartyl-tRNA(Asn) amidotransfe...   177   5e-42   
gi|385323982|ref|YP_005878421.1| aspartyl-tRNA(Asn) amidotransfe...   177   5e-42   
gi|488165871|ref|WP_002237079.1| glutamyl-tRNA amidotransferase ...   177   5e-42   
gi|489899799|ref|WP_003803238.1| glutamyl-tRNA amidotransferase ...   177   7e-42   
gi|493993846|ref|WP_006936534.1| amidase [Labrenzia aggregata] >...   177   7e-42   
gi|500255019|gb|EON98560.1| putative amidase-like protein [Togni...   177   7e-42   
gi|488142028|ref|WP_002213236.1| glutamyl-tRNA amidotransferase ...   177   8e-42   
gi|497073726|ref|WP_009459289.1| putative amidotransferase [Alca...   177   8e-42   
gi|220933701|ref|YP_002512600.1| aspartyl/glutamyl-tRNA amidotra...   176   9e-42   
gi|488166804|ref|WP_002238012.1| glutamyl-tRNA amidotransferase ...   176   9e-42   
gi|496095938|ref|WP_008820445.1| glutamyl-tRNA(Gln) amidotransfe...   176   1e-41   
gi|488169391|ref|WP_002240599.1| glutamyl-tRNA amidotransferase ...   176   1e-41   
gi|392373879|ref|YP_003205712.1| glutamyl-tRNA(Gln) amidotransfe...   176   1e-41   
gi|288818754|ref|YP_003433102.1| glutamyl-tRNA (Gln) amidotransf...   176   1e-41   
gi|495573424|ref|WP_008298003.1| Glutamyl-tRNA(Gln) amidotransfe...   176   1e-41   
gi|254672151|emb|CBA04948.1| glutamyl-tRNA(Gln) amidotransferase...   176   1e-41   
gi|492815766|ref|WP_005974097.1| glutamyl-tRNA(Gln) amidotransfe...   176   1e-41   
gi|493905707|ref|WP_006851385.1| glutamyl-tRNA(Gln) amidotransfe...   176   2e-41   
gi|328952202|ref|YP_004369536.1| glutamyl-tRNA(Gln) amidotransfe...   176   2e-41   
gi|488180184|ref|WP_002251392.1| aspartyl/glutamyl-tRNA(Asn/Gln)...   176   2e-41   
gi|488156035|ref|WP_002227243.1| glutamyl-tRNA amidotransferase ...   175   2e-41   
gi|489803946|ref|WP_003707825.1| glutamyl-tRNA amidotransferase ...   175   2e-41   
gi|489809807|ref|WP_003713665.1| glutamyl-tRNA amidotransferase ...   175   2e-41   
gi|488171537|ref|WP_002242745.1| glutamyl-tRNA amidotransferase ...   175   2e-41   
gi|56962869|ref|YP_174596.1| aspartyl/glutamyl-tRNA amidotransfe...   175   2e-41   
gi|511055424|ref|YP_008067607.1| hypothetical protein C624_14560...   175   2e-41   
gi|15677221|ref|NP_274374.1| aspartyl/glutamyl-tRNA amidotransfe...   175   2e-41   
gi|493329142|ref|WP_006286358.1| hypothetical protein [Corynebac...   175   2e-41   
gi|452983224|gb|EME82982.1| hypothetical protein MYCFIDRAFT_2076...   175   3e-41   
gi|488145801|ref|WP_002217009.1| glutamyl-tRNA amidotransferase ...   175   3e-41   
gi|225851021|ref|YP_002731255.1| aspartyl/glutamyl-tRNA amidotra...   175   3e-41   
gi|78212688|ref|YP_381467.1| aspartyl/glutamyl-tRNA(Asn/Gln) ami...   174   3e-41   
gi|428780421|ref|YP_007172207.1| amidohydrolase, AtzE family [Da...   174   3e-41   
gi|145296956|ref|YP_001139777.1| hypothetical protein cgR_2856 [...   174   4e-41   
gi|488167943|ref|WP_002239151.1| glutamyl-tRNA amidotransferase ...   174   4e-41   
gi|310643137|ref|YP_003947895.1| glutamyl-tRNA(gln) amidotransfe...   174   4e-41   
gi|163846950|ref|YP_001634994.1| amidase [Chloroflexus aurantiac...   174   4e-41   
gi|493907239|ref|WP_006852887.1| glutamyl-tRNA(Gln) amidotransfe...   174   5e-41   
gi|488181282|ref|WP_002252490.1| aspartyl/glutamyl-tRNA(Asn/Gln)...   174   5e-41   
gi|488162782|ref|WP_002233990.1| glutamyl-tRNA amidotransferase ...   174   5e-41   
gi|374330192|ref|YP_005080376.1| amidase signature enzyme [Pseud...   174   5e-41   
gi|118473135|ref|YP_885483.1| glutamyl-tRNA(Gln)/aspartyl-tRNA(A...   174   5e-41   
gi|488173878|ref|WP_002245086.1| aspartyl/glutamyl-tRNA(Asn/Gln)...   174   5e-41   
gi|113954926|ref|YP_730836.1| aspartyl/glutamyl-tRNA amidotransf...   174   5e-41   
gi|492731084|ref|WP_005938893.1| aspartyl/glutamyl-tRNA(Asn/Gln)...   174   5e-41   
gi|496069002|ref|WP_008793509.1| glutamyl-tRNA(Gln) amidotransfe...   174   6e-41   
gi|495562484|ref|WP_008287063.1| glutamyl-tRNA(Gln) amidotransfe...   174   6e-41   
gi|488164677|ref|WP_002235885.1| glutamyl-tRNA amidotransferase ...   174   6e-41   
gi|406895696|gb|EKD40192.1| hypothetical protein ACD_75C00144G00...   174   6e-41   
gi|489989398|ref|WP_003892455.1| glutamyl-tRNA(Gln)/aspartyl-tRN...   174   6e-41   
gi|492801590|ref|WP_005967915.1| glutamyl-tRNA(Gln) amidotransfe...   174   6e-41   
gi|495053780|ref|WP_007778616.1| aspartyl/glutamyl-tRNA amidotra...   174   6e-41   
gi|385340256|ref|YP_005894128.1| glutamyl-tRNA(Gln) amidotransfe...   174   6e-41   
gi|494162517|ref|WP_007102251.1| glutamyl-tRNA(Gln) amidotransfe...   174   7e-41   
gi|302924122|ref|XP_003053818.1| hypothetical protein NECHADRAFT...   174   7e-41   
gi|158423139|ref|YP_001524431.1| amidase [Azorhizobium caulinoda...   173   7e-41   
gi|157363275|ref|YP_001470042.1| amidase [Thermotoga lettingae T...   173   7e-41   
gi|390351218|ref|XP_003727606.1| PREDICTED: fatty acid amide hyd...   173   7e-41   
gi|492910816|ref|WP_006041222.1| glutamyl-tRNA(Gln) amidotransfe...   173   8e-41   
gi|170742737|ref|YP_001771392.1| amidase [Methylobacterium sp. 4...   173   9e-41   
gi|496973616|ref|WP_009424485.1| glutamyl-tRNA(Gln) amidotransfe...   173   9e-41   
gi|494525921|ref|WP_007315373.1| glutamyl-tRNA(Gln) amidotransfe...   172   1e-40   
gi|161870226|ref|YP_001599396.1| aspartyl/glutamyl-tRNA amidotra...   172   1e-40   
gi|254805149|ref|YP_003083370.1| aspartyl/glutamyl-tRNA amidotra...   172   1e-40   
gi|488161416|ref|WP_002232624.1| glutamyl-tRNA amidotransferase ...   172   1e-40   
gi|374996382|ref|YP_004971881.1| glutamyl-tRNA(Gln) and/or aspar...   172   1e-40   
gi|406956849|gb|EKD84886.1| hypothetical protein ACD_38C00146G00...   172   2e-40   
gi|495915649|ref|WP_008640228.1| aspartyl/glutamyl-tRNA amidotra...   172   2e-40   
gi|86606740|ref|YP_475503.1| amidase [Synechococcus sp. JA-3-3Ab...   172   2e-40   
gi|385328621|ref|YP_005882924.1| Glu-tRNA(Gln) amidotransferase ...   172   2e-40   
gi|162448386|ref|YP_001610753.1| amidase [Sorangium cellulosum S...   172   2e-40   
gi|148239402|ref|YP_001224789.1| aspartyl/glutamyl-tRNA amidotra...   172   2e-40   
gi|489942044|ref|WP_003845351.1| glutamyl-tRNA amidotransferase ...   172   2e-40   
gi|406981197|gb|EKE02706.1| hypothetical protein ACD_20C00346G00...   172   2e-40   
gi|494889749|ref|WP_007615795.1| amidase [Bradyrhizobium sp. WSM...   172   2e-40   
gi|491699924|ref|WP_005551235.1| aspartyl/glutamyl-tRNA amidotra...   172   2e-40   
gi|363548416|sp|Q971U6.2|GATA_SULTO RecName: Full=Glutamyl-tRNA(...   172   2e-40   
gi|15921546|ref|NP_377215.1| aspartyl/glutamyl-tRNA amidotransfe...   172   2e-40   
gi|86610086|ref|YP_478848.1| amidase [Synechococcus sp. JA-2-3B'...   172   2e-40   
gi|400601816|gb|EJP69441.1| amidase-like protein [Beauveria bass...   172   3e-40   
gi|497976755|ref|WP_010290911.1| aspartyl/glutamyl-tRNA amidotra...   171   3e-40   
gi|495756906|ref|WP_008481485.1| glutamyl-tRNA(Gln) amidotransfe...   171   3e-40   
gi|495863668|ref|WP_008588247.1| aspartyl/glutamyl-tRNA amidotra...   171   3e-40   
gi|497307029|ref|WP_009621246.1| glutamyl-tRNA(Gln) amidotransfe...   171   3e-40   
gi|186682798|ref|YP_001865994.1| amidase [Nostoc punctiforme PCC...   171   3e-40   
gi|494991525|ref|WP_007717543.1| aspartyl/glutamyl-tRNA amidotra...   171   4e-40   
gi|489484415|ref|WP_003389392.1| aspartyl/glutamyl-tRNA(Asn/Gln)...   171   4e-40   
gi|313668490|ref|YP_004048774.1| Glu-tRNAGln amidotransferase su...   171   4e-40   
gi|392424583|ref|YP_006465577.1| glutamyl-tRNA(Gln) and/or aspar...   171   4e-40   
gi|218529971|ref|YP_002420787.1| amidase [Methylobacterium extor...   171   4e-40   
gi|428210119|ref|YP_007094472.1| aspartyl/glutamyl-tRNA amidotra...   171   4e-40   
gi|220931081|ref|YP_002507989.1| glutamyl-tRNA(Gln) amidotransfe...   171   5e-40   
gi|226310281|ref|YP_002770175.1| aspartyl/glutamyl-tRNA(Asn/Gln)...   171   5e-40   
gi|488846100|ref|WP_002758506.1| glutamyl-tRNA(Gln) amidotransfe...   170   6e-40   
gi|489791501|ref|WP_003695392.1| glutamyl-tRNA amidotransferase ...   170   6e-40   
gi|494871864|ref|WP_007597960.1| amidase [Bradyrhizobium sp. WSM...   170   6e-40   
gi|194098807|ref|YP_002001870.1| aspartyl/glutamyl-tRNA amidotra...   170   6e-40   
gi|220924666|ref|YP_002499968.1| amidase [Methylobacterium nodul...   170   6e-40   
gi|489770701|ref|WP_003674612.1| glutamyl-tRNA amidotransferase ...   170   7e-40   
gi|297528698|ref|YP_003669973.1| glutamyl-tRNA(Gln) amidotransfe...   170   7e-40   
gi|491748880|ref|WP_005582013.1| glutamyl-tRNA(Gln) amidotransfe...   170   7e-40   
gi|448236582|ref|YP_007400640.1| glutaminyl-tRNA synthase subuni...   170   7e-40   
gi|498043820|ref|WP_010357976.1| glutamyl-tRNA amidotransferase ...   170   7e-40   
gi|489430053|ref|WP_003335652.1| aspartyl/glutamyl-tRNA amidotra...   170   7e-40   
gi|435850549|ref|YP_007312135.1| glutamyl-tRNA(Gln) and/or aspar...   170   8e-40   
gi|163851120|ref|YP_001639163.1| amidase [Methylobacterium extor...   170   8e-40   
gi|325294685|ref|YP_004281199.1| Glutamyl-tRNA(Gln) amidotransfe...   170   8e-40   
gi|495816260|ref|WP_008540839.1| amidase [Bradyrhizobium sp. CCG...   170   9e-40   
gi|488826749|ref|WP_002739155.1| glutamyl-tRNA(Gln) and/or aspar...   170   9e-40   
gi|491404779|ref|WP_005262618.1| amidase [Rhodococcus opacus] >g...   170   9e-40   
gi|166363936|ref|YP_001656209.1| aspartyl/glutamyl-tRNA amidotra...   170   1e-39   
gi|490265202|ref|WP_004161859.1| glutamyl-tRNA(Gln) amidotransfe...   169   1e-39   
gi|406898289|gb|EKD41943.1| hypothetical protein ACD_73C00431G00...   169   1e-39   
gi|397691701|ref|YP_006528955.1| glutamyl-tRNA(Gln) amidotransfe...   169   1e-39   
gi|496748894|ref|WP_009360718.1| aspartyl/glutamyl-tRNA amidotra...   169   1e-39   
gi|71906992|ref|YP_284579.1| amidase [Dechloromonas aromatica RC...   169   1e-39   
gi|490567732|ref|WP_004432752.1| aspartyl/glutamyl-tRNA amidotra...   169   1e-39   
gi|434394313|ref|YP_007129260.1| aspartyl/glutamyl-tRNA(Asn/Gln)...   169   1e-39   
gi|497801821|ref|WP_010116005.1| glutamyl-tRNA(Gln) amidotransfe...   169   1e-39   
gi|150391126|ref|YP_001321175.1| aspartyl/glutamyl-tRNA amidotra...   169   1e-39   
gi|496975999|ref|WP_009425334.1| aspartyl/glutamyl-tRNA(Asn/Gln)...   169   1e-39   
gi|494840553|ref|WP_007566653.1| amidase [Methylobacterium sp. G...   169   1e-39   
gi|59801089|ref|YP_207801.1| aspartyl/glutamyl-tRNA amidotransfe...   169   1e-39   
gi|495481799|ref|WP_008206486.1| glutamyl-tRNA(Gln) amidotransfe...   169   1e-39   
gi|218439121|ref|YP_002377450.1| amidohydrolase, AtzE family [Cy...   169   1e-39   
gi|512189028|gb|EPE04797.1| glutamyl-trna amidotransferase subun...   169   2e-39   
gi|494426757|ref|WP_007223353.1| glutamyl-tRNA(Gln) amidotransfe...   169   2e-39   
gi|459293114|ref|YP_007516271.1| aspartyl/glutamyl-tRNA amidotra...   169   2e-39   
gi|489796107|ref|WP_003699998.1| glutamyl-tRNA amidotransferase ...   169   2e-39   
gi|490155178|ref|WP_004053854.1| glutamyl-tRNA(Gln) amidotransfe...   169   2e-39   
gi|121635062|ref|YP_975307.1| aspartyl/glutamyl-tRNA amidotransf...   169   2e-39   
gi|498160356|ref|WP_010474512.1| amidase [Acaryochloris sp. CCME...   169   2e-39   
gi|302392790|ref|YP_003828610.1| aspartyl/glutamyl-tRNA amidotra...   169   2e-39   
gi|218441126|ref|YP_002379455.1| aspartyl/glutamyl-tRNA amidotra...   169   2e-39   
gi|428306666|ref|YP_007143491.1| aspartyl/glutamyl-tRNA amidotra...   168   2e-39   
gi|317051994|ref|YP_004113110.1| glutamyl-tRNA(Gln) amidotransfe...   168   2e-39   
gi|488875198|ref|WP_002787423.1| glutamyl-tRNA(Gln) amidotransfe...   168   2e-39   
gi|308272774|emb|CBX29378.1| Glutamyl-tRNA(Gln) amidotransferase...   168   3e-39   
gi|113477617|ref|YP_723678.1| amidase [Trichodesmium erythraeum ...   168   3e-39   
gi|427726102|ref|YP_007073379.1| aspartyl/glutamyl-tRNA amidotra...   168   3e-39   
gi|488872008|ref|WP_002784233.1| Glutamyl-tRNA(Gln) amidotransfe...   168   3e-39   
gi|488856898|ref|WP_002769208.1| glutamyl-tRNA(Gln) amidotransfe...   168   3e-39   
gi|495569882|ref|WP_008294461.1| glutamyl-tRNA(Gln) amidotransfe...   168   3e-39   
gi|496440593|ref|WP_009149438.1| amidase [Moorea producens] >gi|...   168   3e-39   
gi|489425915|ref|WP_003331582.1| aspartyl/glutamyl-tRNA amidotra...   168   4e-39   
gi|94967532|ref|YP_589580.1| aspartyl/glutamyl-tRNA amidotransfe...   168   4e-39   
gi|495707587|ref|WP_008432166.1| aspartyl/glutamyl-tRNA amidotra...   168   4e-39   
gi|495471035|ref|WP_008195724.1| amidase [Labrenzia alexandrii] ...   167   4e-39   
gi|212638108|ref|YP_002314628.1| aspartyl/glutamyl-tRNA amidotra...   167   4e-39   
gi|188580388|ref|YP_001923833.1| amidase [Methylobacterium popul...   167   4e-39   
gi|334339885|ref|YP_004544865.1| glutamyl-tRNA(Gln) amidotransfe...   167   4e-39   
gi|489781460|ref|WP_003685351.1| glutamyl-tRNA amidotransferase ...   167   4e-39   
gi|493032554|ref|WP_006101949.1| amidase [Coleofasciculus chthon...   167   5e-39   
gi|427719801|ref|YP_007067795.1| amidohydrolase, AtzE family [Ca...   167   5e-39   
gi|333982788|ref|YP_004511998.1| glutamyl-tRNA(Gln) amidotransfe...   167   5e-39   
gi|386712939|ref|YP_006179261.1| glutamyl-tRNA amidotransferase ...   167   5e-39   
gi|386837250|ref|YP_006242308.1| amidase [Streptomyces hygroscop...   167   5e-39   
gi|169825832|ref|YP_001695990.1| aspartyl/glutamyl-tRNA amidotra...   167   5e-39   
gi|493215138|ref|WP_006198431.1| amidase [Nodularia spumigena] >...   167   5e-39   
gi|495078968|ref|WP_007803792.1| putative amidase [Pelagibaca be...   167   5e-39   
gi|410658048|ref|YP_006910419.1| Aspartyl-tRNA(Asn) amidotransfe...   167   6e-39   
gi|311069374|ref|YP_003974297.1| glutamyl-tRNA(Gln) amidotransfe...   167   6e-39   
gi|494873463|ref|WP_007599558.1| amidase [Bradyrhizobium sp. WSM...   167   6e-39   
gi|497203051|ref|WP_009517313.1| putative Glutamyl-tRNA(Gln) ami...   167   6e-39   
gi|70728276|ref|YP_258025.1| aspartyl/glutamyl-tRNA amidotransfe...   167   6e-39   
gi|493041530|ref|WP_006106600.1| glutamyl-tRNA(Gln) amidotransfe...   167   7e-39   
gi|497537900|ref|WP_009852098.1| glutamyl-tRNA amidotransferase ...   167   7e-39   
gi|428297931|ref|YP_007136237.1| amidohydrolase, AtzE family [Ca...   167   7e-39   
gi|427738793|ref|YP_007058337.1| amidohydrolase, AtzE family [Ri...   167   8e-39   
gi|490715085|ref|WP_004577746.1| aspartyl/glutamyl-tRNA amidotra...   167   8e-39   
gi|269837953|ref|YP_003320181.1| glutamyl-tRNA(Gln) amidotransfe...   167   8e-39   
gi|489714145|ref|WP_003618279.1| amidase [Gluconacetobacter hans...   167   8e-39   
gi|292490698|ref|YP_003526137.1| glutamyl-tRNA(Gln) amidotransfe...   166   9e-39   
gi|488722141|ref|WP_002645856.1| glutamyl-tRNA(Gln) amidotransfe...   166   9e-39   
gi|495448955|ref|WP_008173649.1| aspartyl/glutamyl-tRNA amidotra...   166   9e-39   
gi|514090844|gb|EPF70952.1| glutamyl-tRNA(Gln) amidotransferase ...   166   1e-38   
gi|125973547|ref|YP_001037457.1| aspartyl/glutamyl-tRNA amidotra...   166   1e-38   
gi|239825856|ref|YP_002948480.1| aspartyl/glutamyl-tRNA amidotra...   166   1e-38   
gi|497472604|ref|WP_009786802.1| amidase [Lyngbya sp. PCC 8106] ...   166   1e-38   
gi|493366504|ref|WP_006322915.1| aspartyl/glutamyl-tRNA amidotra...   166   1e-38   
gi|337280584|ref|YP_004620056.1| amidase [Ramlibacter tataouinen...   166   1e-38   
gi|440683839|ref|YP_007158634.1| amidohydrolase, AtzE family [An...   166   1e-38   
gi|27376152|ref|NP_767681.1| amidase [Bradyrhizobium japonicum U...   166   1e-38   
gi|220907942|ref|YP_002483253.1| aspartyl/glutamyl-tRNA amidotra...   166   1e-38   


>gi|510999727|gb|EPB81325.1| hypothetical protein HMPREF1544_11966 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 568

 Score =  335 bits (858), Expect = 2e-89,   Method: Compositional matrix adjust.
 Identities = 178/418 (42%), Positives = 249/418 (59%), Gaps = 2/418 (0%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           TERY   ++L  LDG+ I++K+E+D++G ET VGT FIN G PAT DAT++ +L++ GAI
Sbjct: 146 TERYKQQNALSQLDGVFISIKEEMDIQGLETKVGTNFINNGQPATEDATLVSKLKQAGAI 205

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           I+G T M+E+G+ + + NP    P+NPY+  +                L P++IG DGGG
Sbjct: 206 IVGSTVMNELGWDTFSVNPNTGMPKNPYSALHSCGGSSGGCGGCVAGGLFPVSIGADGGG 265

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVRIP++FCG+YGLKTT  R S  G   +  S+   GP+AA+ DD+AL Y ++AG D KD
Sbjct: 266 SVRIPATFCGLYGLKTTYARVSAKGGATVDPSLGSYGPLAATADDMALTYAIIAGPDTKD 325

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXXXX 240
             TL QP  +L  +     LSDL I VY  W + + +PAI   L+ F + L+  GA    
Sbjct: 326 STTLLQPPVSLKDYDQIFDLSDLTIAVYPEWARHMVDPAILEKLDFFKNHLQQLGARIVE 385

Query: 241 XXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYIVSQQV 300
                      AH +TI +E+   A RH+     F   TR            DY+ +QQV
Sbjct: 386 IEIPDLDLTATAHTVTICSEMLNFASRHELNHRNFLPHTRLMAGTASALEGRDYVRAQQV 445

Query: 301 RTRIMRTLNNLFSNQ-VDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANFA 359
           R R+M  L ++F +Q +DLIL P+TAITAP+I  +A ++G  +  +    M F  LAN  
Sbjct: 446 RGRMMNHLRHIFDDQKIDLILCPSTAITAPEIPEKAHSYGMSNAKLTIRSMIFCMLANLT 505

Query: 360 GVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPSDKFWFGN 417
           G+P +SVPAG+ +  +PIGLQF+A+W++EA L RIAKT E I G  RK P    WFG+
Sbjct: 506 GIPGLSVPAGF-NKGMPIGLQFMARWWNEALLCRIAKTCERIPGIERKHPEGANWFGD 562



>gi|83648379|ref|YP_436814.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase subunit A-like protein
           [Hahella chejuensis KCTC 2396]
 gi|499718714|ref|WP_011399448.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase subunit A-like protein
           [Hahella chejuensis]
 gi|83636422|gb|ABC32389.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit and related
           amidases [Hahella chejuensis KCTC 2396]
          Length = 566

 Score =  316 bits (809), Expect = 9e-84,   Method: Compositional matrix adjust.
 Identities = 169/407 (41%), Positives = 238/407 (58%), Gaps = 4/407 (0%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
            +RY     L LLDG+P+A+KDE+D   Y T+VGT           DAT + RLR  GAI
Sbjct: 153 AQRYREGRPLSLLDGVPVAIKDELDAAPYATSVGTLVYGQDCSVDQDATSVARLRAAGAI 212

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           I+GK +MHEIG G T  N      RNPY+ D+Y               LCPIAIG DGGG
Sbjct: 213 IIGKANMHEIGLGVTGANVHHGHCRNPYHLDHYAGGSSSGSASAVAAGLCPIAIGADGGG 272

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           S+RIP++ CG+ GLK T GR S+ G +PL  SVA  GPM   VDD+ALAY  +AG D  D
Sbjct: 273 SIRIPAALCGVVGLKPTWGRVSEHGAFPLCWSVAHVGPMGRCVDDVALAYSAIAGADLMD 332

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXXXX 240
           P ++ QP P L G+ +   LSDL+IG+YS W     N  IT +    +++LK  GA    
Sbjct: 333 PFSIDQPPPHLSGY-MKRDLSDLRIGIYSPWFGHA-NREITQSCQLAVEKLKSLGAQVQE 390

Query: 241 XXXXXXXXARIAHLLTIGTE-LTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYIVSQQ 299
                    R++H +TIG+E L  V   ++     F   TR N+ + +  +++DYI +Q+
Sbjct: 391 ISLEGLDLQRVSHAITIGSEMLAAVDAEYRRNPQNFGLDTRLNLALAQQFSSTDYIKAQR 450

Query: 300 VRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANFA 359
            RT+ MR  +N+   +VD+I+TP TA+TAP+I  +    GE ++ +++++MRF   AN  
Sbjct: 451 FRTQAMREFDNVL-QKVDIIVTPTTAMTAPRIRAQKEPSGESNLQVLTELMRFAFSANLT 509

Query: 360 GVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRR 406
           G+PA+++P  YD   LPIGLQ +   + E TLLR+ +  E ++  RR
Sbjct: 510 GLPALTLPVDYDAKGLPIGLQLMGGAWREHTLLRVGRALESLVELRR 556



>gi|498194552|ref|WP_010508708.1| Asp-tRNAAsn/Glu-tRNAGln amidotransferase subunit A-like protein
           [SAR324 cluster bacterium SCGC AAA001-C10]
          Length = 608

 Score =  308 bits (790), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 168/413 (40%), Positives = 238/413 (57%), Gaps = 7/413 (1%)

Query: 2   ERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAII 61
           ERY    SLG+LDG+P+AVKDE+D+  + T VGTKF N   P   DAT +ERLR  GA++
Sbjct: 195 ERYNRGESLGILDGVPVAVKDELDMLPFPTMVGTKFYNT-QPPVEDATTVERLRSAGALM 253

Query: 62  LGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGS 121
           +GKT+MHEIG G T  N    T RNP++ D+YP              LCPIA+G DGGGS
Sbjct: 254 VGKTNMHEIGLGVTGLNTHYGTTRNPHHLDHYPGGSSSGSAAAVAAGLCPIALGLDGGGS 313

Query: 122 VRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDP 181
           +RIP+S CG+ GLKTT GR S  G  PL+ S++  GP+ ++V D ALAY  +AG D +  
Sbjct: 314 IRIPASLCGVVGLKTTWGRISSAGSAPLSWSLSTVGPITSTVRDTALAYSFLAGPDSRQV 373

Query: 182 NTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXXXXX 241
            T  QP   L  F   + L+ +++GV+  W     +  I  + N  +D  K  GA     
Sbjct: 374 LTQDQPPVDLQDFDNLD-LTGVRLGVFLPWFNHA-SADIVQSCNQMLDSFKSLGATVQEI 431

Query: 242 XXXXXXXARIAHLLTIGTELTTVAKRH-KDKMHLFSCPTRSNINVMKLATASDYIVSQQV 300
                   R+AH ++  TEL T  K + K            N+ + +     DY+ +Q+V
Sbjct: 432 EIPDLDEIRVAHAVSFLTELLTSLKTNFKPFRQPLGLDPLVNLTLAQQFKGDDYVKAQRV 491

Query: 301 RTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANFAG 360
           R R++R ++ +F N VD ++TP+TA TAP I P AL  GE D++ ++++MR+   AN  G
Sbjct: 492 RARLIRKMSQIFQN-VDAVVTPSTARTAPPIPPDALKKGESDLSTLTELMRYAPQANLGG 550

Query: 361 VPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPSDKF 413
            PA+S P GYD   LP+G+Q + + ++E+ LLR+A TSE      R  P  +F
Sbjct: 551 FPAISFPVGYDAQGLPVGMQLMGRPWEESLLLRLANTSERFFA--RHPPMMRF 601



>gi|483515894|gb|EOB02983.1| Glutamyl-tRNA(Gln) amidotransferase subunit A, partial [Anas
           platyrhynchos]
          Length = 464

 Score =  297 bits (760), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 172/416 (41%), Positives = 234/416 (56%), Gaps = 14/416 (3%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY N  +L  LDGIP+ VK+E  V  Y   VGT ++    P T DAT+ ++LRE GAI
Sbjct: 50  TARYRNKCTLSHLDGIPVCVKEEFKVVPYHHRVGTVYLG-TEPETEDATVAKKLREAGAI 108

Query: 61  ILGKTSMHEIGFGSTNNNP--FVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDG 118
           I+G ++MHE+G G+T  NP  +   PRNPY  +++               LCP+ IG DG
Sbjct: 109 IIGVSNMHELGTGTTGCNPNRYHKIPRNPYKPNHFTGGSSSGSAAAVAAGLCPVGIGTDG 168

Query: 119 GGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDP 178
           GGSVRIP+SFCG+ GLK T GR S  G YPL++S   +GP+  SV D A+ Y ++A  DP
Sbjct: 169 GGSVRIPASFCGVVGLKGTFGRISCHGSYPLSYSTVSAGPICTSVADAAIVYSILAEPDP 228

Query: 179 KDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXX 238
             P  L QP  TL      + L  LK+GV  M+ K  D   +T      ++ LK  GA  
Sbjct: 229 LYPYGLKQPKATLSDMCAPD-LKGLKLGVDWMFFKACDAEVLTIC-EKAVEYLKSLGASV 286

Query: 239 XXXXXXXXXXARIAHLLTIGTELTTVAK----RHKDKMHLFSCPTRSNINVMKLATASDY 294
                      +IAH++ I +E+  + +    +H  +M+L    TR+ + +    TA DY
Sbjct: 287 VEVSLPEMEEVKIAHVICILSEMRDMLQPDFNKHFQEMNL---ETRATLALASQFTALDY 343

Query: 295 IVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQ 354
           I + + RTR MR L  +F+  V+ I+TPA A TAP+I+   L  G  D + I   MRF+Q
Sbjct: 344 ITANRQRTRSMRFLREIFTT-VNCIVTPAVASTAPRIHESDLLTGSNDTSFIVQSMRFMQ 402

Query: 355 LANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
           LAN  G+P + VP GY    LPI LQ + KW+DEA LLRI    E+   N+ KKPS
Sbjct: 403 LANLTGIPGLVVPVGYSTAGLPISLQVMGKWWDEAVLLRIGLKLEQ-FRNQTKKPS 457



>gi|449283894|gb|EMC90488.1| Glutamyl-tRNA(Gln) amidotransferase subunit A, partial [Columba
           livia]
          Length = 480

 Score =  294 bits (752), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 170/416 (40%), Positives = 231/416 (55%), Gaps = 14/416 (3%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY N  +L  LDGIP+ +K+E  V  Y   VGT ++    P T DAT+ ++LRE GAI
Sbjct: 66  TARYRNKCTLSYLDGIPVCLKEEFKVVPYHQRVGTVYLG-TEPETEDATVAKKLREAGAI 124

Query: 61  ILGKTSMHEIGFGSTNNNP--FVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDG 118
           I+G ++MHE+G G+T  NP  +   PRNPY  +++               LCP+AIG DG
Sbjct: 125 IIGVSNMHELGTGTTGCNPNRYHKIPRNPYKPNHFTGGSSSGSAAAVAAGLCPVAIGTDG 184

Query: 119 GGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDP 178
           GGSVRIP+SFCG+ GLK T GR S  G  PL++S    GP+  SV D A+ Y ++A  DP
Sbjct: 185 GGSVRIPASFCGVVGLKGTFGRISCHGSLPLSYSTVSVGPICTSVADAAIVYSILAEPDP 244

Query: 179 KDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXX 238
             P  L QP  TL     ++ L  LK+GV   + K  D   I +     +  L+  GA  
Sbjct: 245 LYPYGLKQPKATLSDMCASD-LKGLKLGVDWTFFKACD-AEILSICEKAVQHLQSLGASV 302

Query: 239 XXXXXXXXXXARIAHLLTIGTELTTVAK----RHKDKMHLFSCPTRSNINVMKLATASDY 294
                      R+AH++ I +E+    +    +H  +M+L    TR+N+ +    TA DY
Sbjct: 303 VELSLPEMEEVRVAHVICILSEMRDFLQPDFNKHFQEMNL---DTRANLALASQFTALDY 359

Query: 295 IVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQ 354
           I + + RTR MR L  +F+  V+ ILTPA A TAP+IY   L  G  D+++    MRF+Q
Sbjct: 360 ITANRQRTRSMRFLREIFTT-VNCILTPAVACTAPRIYQSDLVTGSSDMSLTVRSMRFMQ 418

Query: 355 LANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
           L NF G+P + VP GY    LPI  Q + KW+DEA LLRI    EE    + KKPS
Sbjct: 419 LGNFTGIPGLVVPIGYSAAGLPISFQVMGKWWDEAVLLRIGLKLEE-FRCQTKKPS 473



>gi|449485340|ref|XP_002188597.2| PREDICTED: fatty acid amide hydrolase-like [Taeniopygia guttata]
          Length = 611

 Score =  292 bits (747), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 170/413 (41%), Positives = 231/413 (55%), Gaps = 8/413 (1%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY N  +L  LDGIP+ +K+E  V  Y   VGT ++    P T DAT+ ++LRE GAI
Sbjct: 197 TTRYRNKCTLSCLDGIPVCLKEEFKVVPYHHRVGTVYLGT-QPETEDATVAKKLREAGAI 255

Query: 61  ILGKTSMHEIGFGSTNNNP--FVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDG 118
           I+G ++MHE+G G+T  NP  +   PRNPYN +++               LCP+AIG DG
Sbjct: 256 IIGVSNMHELGTGTTGCNPNRYHKIPRNPYNPNHFTGGSSSGSAAAVAAGLCPVAIGTDG 315

Query: 119 GGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDP 178
           GGSVRIP+SFCG+ GLK T GR S  G  PL++S    GP+  SV D A+ Y ++A  D 
Sbjct: 316 GGSVRIPASFCGVVGLKGTFGRISCHGCLPLSYSTVSVGPICTSVADAAIVYSILAEPDL 375

Query: 179 KDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXX 238
             P  L QP  TL      + L  LK+GV   + K  D   + +A    +  L+  GA  
Sbjct: 376 LYPYGLKQPKATLSDMCAPD-LKGLKLGVDWTFFKACDA-EVLSACEKAVKHLQSLGASV 433

Query: 239 XXXXXXXXXXARIAHLLTIGTELTTVAKRHKDK-MHLFSCPTRSNINVMKLATASDYIVS 297
                     AR+AH++ I +E+    +   +K  H  +  TR+++ +    TA DYI +
Sbjct: 434 VEVSLPEMEEARVAHVICILSEMRDFLQPDFNKHFHEMNLETRASLALASQFTALDYIKA 493

Query: 298 QQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLAN 357
            + RTR MR L  +FS  V+ ILTPA   TAP+IY   L  G  D++     MRF+QL N
Sbjct: 494 NRQRTRSMRFLQEIFST-VNCILTPAVPCTAPRIYESDLLTGSSDMSFTVRSMRFMQLGN 552

Query: 358 FAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
           F G+P + VP GY    LPI LQ +AKW+DEA LLRI    E+   ++ KKPS
Sbjct: 553 FTGIPGLVVPIGYSSAGLPISLQVMAKWWDEAVLLRIGLKLEQ-FRDQTKKPS 604



>gi|302809326|ref|XP_002986356.1| hypothetical protein SELMODRAFT_123798 [Selaginella moellendorffii]
 gi|300145892|gb|EFJ12565.1| hypothetical protein SELMODRAFT_123798 [Selaginella moellendorffii]
          Length = 599

 Score =  292 bits (747), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 164/414 (39%), Positives = 230/414 (55%), Gaps = 11/414 (2%)

Query: 2   ERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAII 61
           ER+A+ S L +LDG+ I VKD+ID   +E+  GT++++      +DA  + RLRE G I 
Sbjct: 186 ERFASGSPLSMLDGVLIVVKDDIDCLPHESRGGTQWLHKYREVKTDAACVARLRECGVIF 245

Query: 62  LGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGS 121
            GKT+MHE+G G+T NNP+  T RNPY+T  Y               LCP ++G D GGS
Sbjct: 246 AGKTNMHELGMGTTGNNPYSGTARNPYDTTRYAGGSSSGSAAVVASGLCPASLGTDAGGS 305

Query: 122 VRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDP 181
           +RIPS  CG+ GLK T GR +  G  P+  ++   GP+AA+V+D  + Y  M G  P D 
Sbjct: 306 IRIPSGLCGLVGLKCTFGRITLSGLVPVGWTLEAVGPIAANVEDALIVYSAMIGSGPSDV 365

Query: 182 NTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR-GAXXXX 240
                P P L  F+ T+    LK+G+Y+ W   V  P + T     +D    R  +    
Sbjct: 366 VYSKPPPPCLPLFNHTS-FQQLKLGIYTDWFTDVSPPEVATICRMAVDRFCERYSSRINE 424

Query: 241 XXXXXXXXARIAHLLTIGTELTT----VAKRHKDKMHLFSCPTRSNINVMKLATASDYIV 296
                    R  HL+T G+E+ T    + K  K   H     TR  I + K   +S Y+ 
Sbjct: 425 IAIPELEELRNGHLVTTGSEICTCLNSIYKYGKSTCH----ETRVIIALFKQFQSSLYVS 480

Query: 297 SQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLA 356
           +Q++R R+M     +F   VD+I+TP T +TAP I P A++ GE D+   +D+MRF+  A
Sbjct: 481 AQRLRRRLMFYHMEIFRT-VDVIVTPTTGVTAPFIPPDAISTGETDLATHADLMRFIVSA 539

Query: 357 NFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
           NF G+PAVSVP G+D   LP+GLQ I K + EATLLRIA   EE+    R+KP+
Sbjct: 540 NFLGLPAVSVPVGHDKQGLPVGLQLIGKPWQEATLLRIAFAIEELCAKARRKPA 593



>gi|470361880|ref|XP_004365217.1| amidase [Capsaspora owczarzaki ATCC 30864]
 gi|320162922|gb|EFW39821.1| amidase [Capsaspora owczarzaki ATCC 30864]
          Length = 602

 Score =  289 bits (740), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 166/409 (40%), Positives = 233/409 (56%), Gaps = 11/409 (2%)

Query: 2   ERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAII 61
           +RY + + L  LDG+P+A+KDE+DV GY T VGT+ +  G  AT+D      LR  GAII
Sbjct: 174 QRYRDGTPLSPLDGVPVAIKDELDVIGYPTTVGTRVL--GKVATTDCASAASLRAAGAII 231

Query: 62  LGKTSMHEIGFGST--NNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGG 119
           +GKT+MHEIG G+T  N N  VC  RNPYN  ++               LCPIAIG DGG
Sbjct: 232 IGKTNMHEIGIGTTGSNVNHGVC--RNPYNLGHHTGGSSSGSGSAVAAGLCPIAIGADGG 289

Query: 120 GSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPK 179
           GS+RIP+S CG+ GLK T  R S+ G +PL  SV  +GP+A++V D+ALAY + AG D +
Sbjct: 290 GSIRIPASLCGVVGLKATWSRISEFGAFPLCPSVGHTGPIASTVRDVALAYALTAGPDKR 349

Query: 180 DPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXXX 239
           D  +  QP   L  F  ++ L+ +KIGVY       D   +  +    +D    +GA   
Sbjct: 350 DEYSTIQPSIHLSNFE-SDDLTGVKIGVYDRMFDHADE-QVVKSCRAMLDVFVSKGATIR 407

Query: 240 XXXXXXXXXARIAHLLTIGTELTTVAKRH--KDKMHLFSCPTRSNINVMKLATASDYIVS 297
                     +++HL+TI +E+    + +      H  S  TR+ + + ++ TA+DY  +
Sbjct: 408 PIAIPELEEIKVSHLITILSEMIASMRGNIADSDWHRLSLTTRAPLYLGEMFTATDYQNA 467

Query: 298 QQVRTRIMRTLNNLFSN-QVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLA 356
           Q+ RTR +RTL  LF    + +I  P+TAI AP+I   ALA  E++      IMR   LA
Sbjct: 468 QRYRTRAIRTLRRLFEEGGITVIAVPSTAIAAPRINEHALATDELNAQQTGRIMRTSVLA 527

Query: 357 NFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNR 405
           N  GVP +S P+GY  + LPIG Q + KWY E TLL++A+  E  +  R
Sbjct: 528 NLTGVPGISFPSGYTADGLPIGFQLMGKWYHEHTLLQMARIGEASVTRR 576



>gi|302814055|ref|XP_002988712.1| hypothetical protein SELMODRAFT_184096 [Selaginella moellendorffii]
 gi|300143533|gb|EFJ10223.1| hypothetical protein SELMODRAFT_184096 [Selaginella moellendorffii]
          Length = 599

 Score =  288 bits (738), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 163/414 (39%), Positives = 229/414 (55%), Gaps = 11/414 (2%)

Query: 2   ERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAII 61
           ER+A+ S L +LDG+ I VKD+ID   +E+  GT++++      +DA  + RLRE G I 
Sbjct: 186 ERFASGSPLSMLDGVLIVVKDDIDCLPHESRGGTQWLHKYREVKTDAACVARLRECGVIF 245

Query: 62  LGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGS 121
            GKT+MHE+G G+T NNP+  T RNPY+T  Y               LCP ++G D GGS
Sbjct: 246 AGKTNMHELGMGTTGNNPYSGTARNPYDTTRYAGGSSSGSAAVVASGLCPASLGTDAGGS 305

Query: 122 VRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDP 181
           +RIPS  CG+ GLK T GR +  G  P+  ++   GP+AA+V+D  + Y  M G  P D 
Sbjct: 306 IRIPSGLCGLVGLKCTFGRITLSGLVPVGWTLEAVGPIAANVEDALIVYSAMIGSGPSDV 365

Query: 182 NTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR-GAXXXX 240
                P P L  F+ T+    LK+G+Y+ W   V  P + T     +D    R  +    
Sbjct: 366 VYSKPPPPCLPLFNHTS-FQQLKLGIYTDWFTDVSPPEVATICRMAVDRFCERYSSRINE 424

Query: 241 XXXXXXXXARIAHLLTIGTELTT----VAKRHKDKMHLFSCPTRSNINVMKLATASDYIV 296
                    R  HL+T G+E+ T    + K  K   H     TR  I + K   +S Y+ 
Sbjct: 425 IAIPELEELRNGHLVTTGSEICTCLNSIYKYGKSTCH----ETRVIIALFKQFQSSLYVS 480

Query: 297 SQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLA 356
           +Q++R R+M     +F   VD+I+TP T +TAP I   A++ GE D+   +D+MRF+  A
Sbjct: 481 AQRLRRRLMFYHMEIFRT-VDVIVTPTTGVTAPFIPADAISTGETDLATHADLMRFIVSA 539

Query: 357 NFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
           NF G+PAVSVP G+D   LP+GLQ I K + EATLLRIA   EE+    R+KP+
Sbjct: 540 NFLGLPAVSVPVGHDKQGLPVGLQLIGKPWQEATLLRIAFAIEELCAKARRKPA 593



>gi|224369423|ref|YP_002603587.1| protein GatA1 [Desulfobacterium autotrophicum HRM2]
 gi|506384472|ref|WP_015904191.1| protein GatA1 [Desulfobacterium autotrophicum]
 gi|223692140|gb|ACN15423.1| GatA1 [Desulfobacterium autotrophicum HRM2]
          Length = 584

 Score =  286 bits (731), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 150/404 (37%), Positives = 229/404 (56%), Gaps = 4/404 (0%)

Query: 2   ERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAII 61
           +R  + +SLGL DG+P+AVKDE D   Y T VGT F+    PA  DAT++ RLR +GA++
Sbjct: 177 QRIDHGTSLGLFDGVPVAVKDEFDQVPYPTTVGTSFLGK-KPAIEDATVVARLRSQGALL 235

Query: 62  LGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGS 121
           +GK +MHEIG      N      RNPY+ D+                L P+AIG DGGGS
Sbjct: 236 VGKANMHEIGINPNGLNVHFGAVRNPYHLDHDAGGSSSGPAAAVALGLVPVAIGADGGGS 295

Query: 122 VRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDP 181
           +R+P+ +CG+ GLK T GR S+ G  PL  SV  +GP+A +V DL LAY V+AG+DP+D 
Sbjct: 296 IRVPAGYCGVLGLKPTFGRVSEHGAAPLCWSVGHAGPIADTVADLVLAYSVVAGRDPRDK 355

Query: 182 NTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXXXXX 241
            +L QP  T+ G+   + L+ L+IGV++ WN   D P  + + ++ +++ K  GA     
Sbjct: 356 RSLVQPQVTVQGWDNAD-LTGLRIGVFNDWNHHSDGPC-SNSCDHMVEQFKGAGARVKAI 413

Query: 242 XXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYIVSQQVR 301
                   R+AH + I +E+      +K  +       R N+++ +L  A+DY+ +Q++R
Sbjct: 414 EIAELDAMRVAHSILILSEMAAAMSAYKKHLKKMGAGVRINLSLARLLRATDYVNAQRMR 473

Query: 302 TRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANFAGV 361
           TR ++  N +F   VD I++P +A   P+I       G   ++     MR+V  AN  G 
Sbjct: 474 TRAIKIFNTVFKT-VDAIVSPGSATVVPRIPQGFETAGWSAISNELGSMRYVFPANLTGF 532

Query: 362 PAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNR 405
           PA++ P GYD+N LP+G+  +A  + E  L R+A  +E ++  R
Sbjct: 533 PAITFPGGYDNNGLPLGIHAMASPWQETLLFRLASAAEAVVERR 576



>gi|313679055|ref|YP_004056794.1| amidase [Oceanithermus profundus DSM 14977]
 gi|503222130|ref|WP_013456791.1| amidase [Oceanithermus profundus]
 gi|313151770|gb|ADR35621.1| Amidase [Oceanithermus profundus DSM 14977]
          Length = 568

 Score =  285 bits (730), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 155/405 (38%), Positives = 229/405 (56%), Gaps = 6/405 (1%)

Query: 3   RYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAIIL 62
           R+     LG LDG+P+AVKDE+DV GY T VGT F+   + A+ DAT + RLR  GA+I+
Sbjct: 161 RWRRGEPLGPLDGVPVAVKDELDVVGYPTTVGTAFLR--DVASEDATAVARLRAAGAVIV 218

Query: 63  GKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGSV 122
           GK +MHE+G   T +NP     +NPY+                   L P+A+G D GGS+
Sbjct: 219 GKANMHELGANPTGHNPHHGHAKNPYDPARDTGGSSSGSAAAVASGLVPLALGADAGGSI 278

Query: 123 RIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDPN 182
           R+P++  G+YGLK T G  S+ G YP+  SVA  GP+ AS  D+ALA+ ++AG DPKDP+
Sbjct: 279 RVPAALTGVYGLKATFGGVSEHGAYPVCWSVAHVGPLGASAYDVALAHRLIAGPDPKDPH 338

Query: 183 TLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXXXXXX 242
           T   P+P    ++    LS LK+GV+  W    + P +  A    +  ++  GA      
Sbjct: 339 TASAPVPEAPDWN-REDLSGLKVGVWPAWFDHAE-PGVVEAARAALARMEEAGAEIVEFE 396

Query: 243 XXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYIVSQQVRT 302
                 AR+AH +T+  E+    +R ++     +  TR N+ + + A  +DY+ +QQVR 
Sbjct: 397 LPGLDDARVAHAVTVLVEMGRSFQRTQEHWRALAPATRINLKIGQSAAGADYVAAQQVRA 456

Query: 303 RIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANFAGVP 362
           R++  L+ +   +VDLI TP TA+ AP I   A + G  D+  ++ +MRF+ L N  G P
Sbjct: 457 RMVAALDEVL-GRVDLIATPTTAVPAPLIPKAAESDGISDLGTVTQLMRFIFLTNLTGHP 515

Query: 363 AVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRK 407
           ++S+PAGY    LP+GLQ I + + E TL+  A   E   G RR+
Sbjct: 516 SLSLPAGYTVEGLPVGLQLIGRAWGERTLMEAAGVLERA-GERRR 559



>gi|508706701|gb|EOX98597.1| Amidase [Theobroma cacao]
          Length = 608

 Score =  283 bits (723), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 159/416 (38%), Positives = 233/416 (56%), Gaps = 7/416 (1%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+R+   + L +LDGI +A+KD+ID   + +   T +++       DA  + RLR  G I
Sbjct: 185 TQRFEEGNPLSILDGIFMAIKDDIDCYPHPSKGATTWMHEVRSVKKDAVCVSRLRRCGVI 244

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GK +MHE+G G+T NNP   T RNP+  + Y               LC  A+G DGGG
Sbjct: 245 LIGKANMHELGMGTTGNNPNYGTTRNPHAPERYTGGSSSGPAALVASGLCSAALGTDGGG 304

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVRIPSS CG+ GLKTT GR    G    + +V + GP+A++V+D+ L Y  + G  P D
Sbjct: 305 SVRIPSSLCGVVGLKTTYGRTDMGGSLCDSGTVEIIGPIASTVEDVILVYAAILGSSPSD 364

Query: 181 PNTLHQP---LPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLRGA 236
             +L       P L      N L  L++G Y+ W   V +  IT    + ++ L K  G 
Sbjct: 365 RISLKPSPPCFPVLSSLDNANTLGSLRLGKYTEWFNDVHSTDITDVCEDVLNLLSKTHGC 424

Query: 237 XXXXXXXXXXXXARIAHLLTIGTE-LTTVAKRHKD-KMHLFSCPTRSNINVMKLATASDY 294
                        R AH+++IG+E L ++    +D K    +  TR+++ + +  TASDY
Sbjct: 425 ETIEIVIPELHEMRTAHVVSIGSETLCSLNPDCEDGKGVKLTYDTRTSMALFRSFTASDY 484

Query: 295 IVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQ 354
           + +Q +R RIM     +F  +VD+I+TP T +TAP+I P AL HGE D+ +   +MRFV 
Sbjct: 485 VAAQCLRRRIMHHHMEIF-KKVDVIVTPTTGMTAPQIPPSALKHGETDMQVTGYLMRFVI 543

Query: 355 LANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
            AN  G+PA++VP GYD   LPIGLQ I + + EA++LR+A   EE+ G  RKKP+
Sbjct: 544 AANLLGLPAITVPVGYDKQGLPIGLQLIGRPWGEASILRLASALEELCGKSRKKPA 599



>gi|326912869|ref|XP_003202768.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit A-like
           [Meleagris gallopavo]
          Length = 522

 Score =  282 bits (722), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 166/416 (39%), Positives = 231/416 (55%), Gaps = 14/416 (3%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY N   L  LDGIP+ +K+E  V  Y   VGT ++    P T DAT+ ++LRE GA+
Sbjct: 108 TARYRNKCPLSYLDGIPVCLKEEFKVVPYYHRVGTVYLG-TEPETEDATVAKKLREAGAV 166

Query: 61  ILGKTSMHEIGFGSTNNNP--FVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDG 118
           I+G ++MHE+G G+T  NP  +   PRNPY  +++               LCP+AIG DG
Sbjct: 167 IIGVSNMHELGTGTTGCNPNRYHKIPRNPYKPNHFTGGSSSGSAAAVAAGLCPVAIGTDG 226

Query: 119 GGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDP 178
           GGSVRIP+SFCG+ GLK T GR S  G  PL++S    GP+  SV D A+ Y ++A  DP
Sbjct: 227 GGSVRIPASFCGVVGLKGTFGRISGHGSLPLSYSTVSVGPICTSVADAAIVYSILAEPDP 286

Query: 179 KDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXX 238
             P  L QP  TL      + L  LK+GV   + K  D   I +     ++ L+  GA  
Sbjct: 287 LYPYGLKQPKATLSDMCAPD-LKGLKLGVDWTFFKACDA-EILSVCEKAMEYLQNLGASV 344

Query: 239 XXXXXXXXXXARIAHLLTIGTELTTVAK----RHKDKMHLFSCPTRSNINVMKLATASDY 294
                      +IAH + I +E+    +    +H  +M+L    TR+++ +    TA DY
Sbjct: 345 VEVSLPEMEEVKIAHAICILSEMRDFLQPDFNKHFQEMNL---ETRASLALGSQFTALDY 401

Query: 295 IVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQ 354
           I + + RTR MR L  +F+  V+ ILTPA A TAP+I+   L  G  +++     MRF+Q
Sbjct: 402 ITANRQRTRSMRFLREIFTT-VNCILTPAVASTAPRIHESDLLTGSSNISFTMRSMRFMQ 460

Query: 355 LANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
           L NF G+P + VP GY    LPIG Q +AKW+DEA LLRI    E+   ++ KKP+
Sbjct: 461 LGNFTGIPGLVVPIGYSTAGLPIGFQVMAKWWDEAVLLRIGLKLEQ-FRHQTKKPT 515



>gi|513161533|ref|XP_416561.4| PREDICTED: fatty acid amide hydrolase-like [Gallus gallus]
          Length = 655

 Score =  281 bits (719), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 163/413 (39%), Positives = 228/413 (55%), Gaps = 13/413 (3%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY N  +L  LDGIP+ +K+E  V  Y   VGT ++    P T DAT+ ++LRE GA+
Sbjct: 241 TARYRNKCTLSYLDGIPVCLKEEFKVVPYYHRVGTVYLGT-EPETEDATVAKKLREAGAV 299

Query: 61  ILGKTSMHEIGFGSTNNNP--FVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDG 118
           I+G ++MHE+G G+T  NP  +   PRNPY  +++               LCP+AIG DG
Sbjct: 300 IIGVSNMHELGTGTTGCNPNRYHKIPRNPYKPNHFTGGSSSGSAAAVAAGLCPVAIGTDG 359

Query: 119 GGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDP 178
           GGSVRIP++FCG+ GLK T GR S  G  PL++S    GP+  SV D A+ Y ++A  DP
Sbjct: 360 GGSVRIPAAFCGVVGLKGTFGRISSHGSLPLSYSTVSVGPICTSVADAAIVYSILAEPDP 419

Query: 179 KDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXX 238
             P  L QP  TL      + L  LK+GV   + K  D   I +     ++ L+  GA  
Sbjct: 420 LYPYGLKQPKATLSDMCAPD-LKGLKLGVDWTFFKACDA-EILSVCEKAVEYLQNLGASV 477

Query: 239 XXXXXXXXXXARIAHLLTIGTELTTVAK----RHKDKMHLFSCPTRSNINVMKLATASDY 294
                      +IAH + I +E+    +    +H  +M+L    TR+++ +    TA DY
Sbjct: 478 VEVSLPEMEEVKIAHAICILSEMRDFLQPDFNKHFQEMNL---ETRASLALGSQFTALDY 534

Query: 295 IVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQ 354
           I + + RTR MR L  +F+  V+ ILTPA A TAP+I+   L  G  +++     MRF+Q
Sbjct: 535 ITANRQRTRSMRFLREIFTT-VNCILTPAIASTAPRIHESDLLTGSSNISFTMRSMRFMQ 593

Query: 355 LANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRK 407
           L NF G+P + VP GY    LPIG Q +AKW+DEA LLRI    E+     +K
Sbjct: 594 LGNFTGIPGLIVPIGYSTAGLPIGFQVMAKWWDEAVLLRIGLKLEQFRCQTKK 646



>gi|224060987|ref|XP_002300309.1| predicted protein [Populus trichocarpa]
 gi|222847567|gb|EEE85114.1| predicted protein [Populus trichocarpa]
          Length = 602

 Score =  279 bits (713), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 157/416 (37%), Positives = 233/416 (56%), Gaps = 7/416 (1%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+R+   S + +LDGI IA+KD+ID+  + +  GT +++   P   DA  + RLR  G I
Sbjct: 179 TKRFEEGSPISILDGIFIAIKDDIDLYPHPSKGGTTWMHEVRPVEEDAVSVSRLRCCGVI 238

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
            +GK +MHE G G+T NNP   T RNP+  D Y               LC  A+G DGGG
Sbjct: 239 FVGKANMHEFGMGTTGNNPNYGTTRNPHALDRYTGGSSSGPAAIVASGLCSAALGTDGGG 298

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           S+RIPSS CG+ GLKTT GR +  G      +VA+ GP+A+SV+D+ L Y  + G +P D
Sbjct: 299 SIRIPSSLCGVVGLKTTYGRTNIRGSLCDHGTVAIIGPIASSVEDVMLVYAAILGSNPAD 358

Query: 181 PNTLHQP---LPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLRGA 236
             +L+     LP L      + L  L++G Y+ W   V +  ++    + ++ L K  G 
Sbjct: 359 RISLNPSPPCLPNLSSCDGADALGSLRLGKYTAWFNDVQSTDVSDTCEDMLNLLSKTHGC 418

Query: 237 XXXXXXXXXXXXARIAHLLTIGTEL--TTVAKRHKDKMHLFSCPTRSNINVMKLATASDY 294
                        R AHLL+IG+E   + +      K    +  +R+++ + +  +ASDY
Sbjct: 419 EMVEIVIPEMQEMRTAHLLSIGSEFMQSLIPDIEDGKGVRLNYDSRTSVALFRSFSASDY 478

Query: 295 IVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQ 354
           I +Q +R R+M     +F  +VD+I+TP T +TAPKI   AL++GE ++ +   +MRFV 
Sbjct: 479 IAAQCLRRRLMYHHMEIF-KKVDVIVTPTTGMTAPKIPSGALSYGETNLQVTGYLMRFVV 537

Query: 355 LANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
            AN  G PA+S+P GYD   LPIGLQ I + + EATLLR+A   EE+    +K+P+
Sbjct: 538 AANLLGFPAISIPVGYDKQGLPIGLQLIGRPWGEATLLRLASAVEELYAKPKKRPA 593



>gi|470242438|ref|XP_004354868.1| amidase family protein [Dictyostelium fasciculatum]
 gi|328868088|gb|EGG16468.1| amidase family protein [Dictyostelium fasciculatum]
          Length = 625

 Score =  279 bits (713), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 154/412 (37%), Positives = 234/412 (56%), Gaps = 10/412 (2%)

Query: 2   ERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAII 61
           ER+   + L +LDG+PI++KDE+++KGY T  GT F+        D+   ERLR  GAI+
Sbjct: 193 ERWEAGTPLSILDGVPISIKDELNMKGYRTTCGTAFLRDSPVWQVDSDCAERLRNMGAIL 252

Query: 62  LGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGS 121
           +GK +MHEIG  +   N      RNP+N DYYP              L PI+IG DGGGS
Sbjct: 253 VGKNNMHEIGISTLGYNVHYGFTRNPFNLDYYPGGSSSGSASTVSSGLNPISIGCDGGGS 312

Query: 122 VRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDP 181
           +R+P++ CG+ GLK T  R S  G + L +SV   GP+A+SV D A+ Y  +AGKDP+D 
Sbjct: 313 IRVPAALCGVVGLKPTYARTSHTGCFDLCYSVGHVGPIASSVIDCAIGYAALAGKDPRDH 372

Query: 182 NTLHQPLPTLHGFHVTNK---LSDLKIGVYSMWNKQVDN--PAITTALNNFIDELKLRGA 236
            TL QP P +  F    K   L+ L+IG+Y  +   VD+    I  +    I+ L  +GA
Sbjct: 373 QTLVQPDPLIPNFSKIPKEKPLTGLRIGIYQDY---VDDCTEEIRISFKKSIEILVEQGA 429

Query: 237 XXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKM-HLFSCPTRSNINVMKLATASDYI 295
                        R+A  + I +E+     ++  K  + F   TR+++++M+  +  +Y+
Sbjct: 430 QVVPIKINHLLYIRLAQAVIILSEMNNSMSKYMGKYKNQFHLDTRASLSMMEFVSGGEYL 489

Query: 296 VSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQL 355
            S ++RT  +  L  +F N VD+I+TP+TA T+P+I P  LA GE ++T ++++M++  L
Sbjct: 490 HSCRIRTYAINQLKAIFEN-VDIIVTPSTASTSPEIRPSVLATGESNLTAVAELMKYAFL 548

Query: 356 ANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRK 407
            N  GVP +++P   D NNLPIGLQ + +W++E  LL      E+ +G   K
Sbjct: 549 GNITGVPGLTIPVSVDKNNLPIGLQLMGRWWEEDLLLYTGYVLEKHVGFNAK 600



>gi|330843249|ref|XP_003293572.1| hypothetical protein DICPUDRAFT_158444 [Dictyostelium purpureum]
 gi|325076094|gb|EGC29911.1| hypothetical protein DICPUDRAFT_158444 [Dictyostelium purpureum]
          Length = 655

 Score =  278 bits (711), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 151/406 (37%), Positives = 226/406 (55%), Gaps = 14/406 (3%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFIN--YGNPATSDATIIERLREKG 58
           +ER+ N   L +LDG+PI++KDE+D  GY T  GT F++  Y N    D+ + ++LRE+G
Sbjct: 191 SERWKNKEPLSILDGVPISIKDELDQIGYHTTCGTTFLSKCYPNVKEEDSFVAKKLRERG 250

Query: 59  AIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDG 118
           AI++GK +MHEIG  +   N      RNPYN ++YP              L PI+IG DG
Sbjct: 251 AILVGKNNMHEIGISTLGYNTHFGFTRNPYNINHYPGGSSSGSAASVSSGLNPISIGCDG 310

Query: 119 GGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDP 178
           GGS+R+P+S CG+ G+K T  R S  G + L +SV   GP+ + V D A+ Y  +AG DP
Sbjct: 311 GGSIRVPASLCGVVGIKPTFARVSHGGVFELCYSVGHIGPIGSCVVDTAVGYACIAGADP 370

Query: 179 KDPNTL-------HQPLPTLHGFHVTNKLSDLKIGVYSMW-NKQVDNPAITTALNNFIDE 230
           KDP ++          LP      +   L  LKIG++  W N  +++  I       ID 
Sbjct: 371 KDPQSVTAEQLGGKPTLPIFTEIPMEQPLKGLKIGIFKDWINDCIED--IKEQTYKCIDI 428

Query: 231 LKLRGAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLAT 290
           L+ +GA            +RI+ L+ I +E+ T  KR K+  + F   +R ++ +  + T
Sbjct: 429 LREQGAEIVEIEIPNLLVSRISQLVLILSEMKTSMKRFKNHNNEFQLDSRISLAIAGMFT 488

Query: 291 ASDYIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIM 350
           A DYI S ++RT  +  L  +F+N VD I+TP   + AP+I       GEV++  + D+M
Sbjct: 489 AEDYIQSNRIRTYCIEELKKIFTN-VDAIVTPTNGVVAPEIEKGVPQLGEVNIRAVGDLM 547

Query: 351 RFVQLANFAGVPAVSVPAGY-DDNNLPIGLQFIAKWYDEATLLRIA 395
           +FV L N +G+P +S+P G    NNLPIG Q + KW++E  L  I+
Sbjct: 548 KFVFLGNISGIPGISIPIGVTKQNNLPIGFQIMGKWWEEDLLFYIS 593



>gi|470107938|ref|XP_004290293.1| PREDICTED: fatty acid amide hydrolase-like [Fragaria vesca subsp.
           vesca]
          Length = 608

 Score =  277 bits (708), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 155/419 (36%), Positives = 237/419 (56%), Gaps = 7/419 (1%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+R+   + + +LDGI +A+KD+ID   + +  GT +++     + DA  + +LR  G I
Sbjct: 185 TKRFEEGNPISILDGIFVAIKDDIDCYPHPSKGGTTWMHEVRTVSKDAACVSKLRSCGVI 244

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
            +GK +MHE+G G+T NNP   T RNP+  D Y               LC  A+G DGGG
Sbjct: 245 FIGKANMHEMGMGTTGNNPNYGTTRNPHALDRYTGGSSSGPAAIVASGLCSAALGTDGGG 304

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVRIPSS CG+ GLKTT GR    G    A +V + GP+A++V+D+ L Y  + G    D
Sbjct: 305 SVRIPSSLCGVVGLKTTYGRTDISGALCDAGTVEIIGPIASTVEDVVLVYSAILGASLAD 364

Query: 181 PNTLH---QPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLRGA 236
             +L      +P L  +   N L  L++G Y+ W   V +  I+    + +  L K  G 
Sbjct: 365 RISLRPSPPSVPDLSLYESLNVLGSLRLGKYTAWFNDVHSTDISDKCEDVLSLLSKNHGC 424

Query: 237 XXXXXXXXXXXXARIAHLLTIGTE-LTTVAKRHKDKMHL-FSCPTRSNINVMKLATASDY 294
                        R AHL++IG+E +++++   +D   +  +  TR+++ + +  +ASDY
Sbjct: 425 EIAEIVIPELHEMRTAHLVSIGSECVSSLSPDCEDGNGVRLTYDTRTSMALFRSFSASDY 484

Query: 295 IVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQ 354
           + +Q +R RIM     +F  +VD+I+TP T +TAPKI P AL  GE D+ +  D+MRF+ 
Sbjct: 485 VTAQCIRRRIMYHHMEIF-KKVDVIVTPTTGMTAPKIPPSALKDGETDMQVTGDLMRFII 543

Query: 355 LANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPSDKF 413
            AN  G+PA+SVP GYD + LPIGLQ I + + EA++LR+A   EE+    +K+P+  F
Sbjct: 544 AANLLGLPAISVPVGYDKHGLPIGLQLIGRPWGEASILRLASAVEELCMKSKKRPASYF 602



>gi|69218101|gb|AAZ04133.1| N-acylethanolamine amidohydrolase [Medicago truncatula]
          Length = 607

 Score =  276 bits (705), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 158/415 (38%), Positives = 233/415 (56%), Gaps = 7/415 (1%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+R+ + + L +LDGI IA+KD+ID   + +  G+ +++       DA  + RLR  G I
Sbjct: 184 TQRFESGNPLSILDGIFIAIKDDIDCHPHPSTGGSTWMHEVRDVKKDAVCVSRLRSCGVI 243

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
            +GKT+MHE G G+T NN    T RNP+  D Y               LC  A+G DGG 
Sbjct: 244 FIGKTNMHEFGMGTTGNNSNYGTARNPHAPDRYTGGSSSGPAAIVASGLCSAALGTDGGS 303

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVRIPSS CG+ GLK   GR S +G    + +V V GP+A++V+D  L Y  M G  P +
Sbjct: 304 SVRIPSSLCGVVGLKINYGRTSMEGSLCDSGTVEVIGPIASTVEDAMLVYAAMLGASPAN 363

Query: 181 PNTLHQP---LPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLRGA 236
             ++      LPTL     T+ L  L+IG+Y+ W   V +  ++    + ++ L K  G 
Sbjct: 364 RISMKPSTPCLPTLSSDDDTDALRSLRIGIYTPWFNNVHSTEVSDKCEDALNLLSKAHGC 423

Query: 237 XXXXXXXXXXXXARIAHLLTIGTE-LTTVAKRHKD-KMHLFSCPTRSNINVMKLATASDY 294
                        R AHL++IG+E L+++    +D K    S  TR+++ + +  TA+DY
Sbjct: 424 EVVEVVIPEIVEMRTAHLVSIGSECLSSLNPDIEDGKGVKLSYDTRTSLALFQSFTAADY 483

Query: 295 IVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQ 354
           + +Q +R RIM     +F  +VD+I+TP T +TAP+I P AL  GE D+     +MRFV 
Sbjct: 484 VAAQCIRRRIMHYFMEIF-KKVDVIVTPTTGMTAPRIPPSALKSGETDMPTTGYLMRFVV 542

Query: 355 LANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKP 409
            AN  G+PA+SVP GYD   LPIGLQ I + + EAT+LR+A   E++ G  +++P
Sbjct: 543 PANLLGLPAISVPVGYDKEGLPIGLQVIGRPWAEATILRVAAAVEKLCGESKRRP 597



>gi|242074936|ref|XP_002447404.1| hypothetical protein SORBIDRAFT_06g000410 [Sorghum bicolor]
 gi|241938587|gb|EES11732.1| hypothetical protein SORBIDRAFT_06g000410 [Sorghum bicolor]
          Length = 601

 Score =  275 bits (704), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 164/419 (39%), Positives = 227/419 (54%), Gaps = 13/419 (3%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+R+   + + +LDG+ +A+KD+ID   Y T   T F +  +    DA  + RLR+ G +
Sbjct: 179 TKRFQQGNPISILDGVFVAIKDDIDCFPYPTKGATTFFDQIHTVEKDAVCVARLRKCGVV 238

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
            +GK +MHE+G G T NNP   T RNP++ D Y               LC  AIG DGGG
Sbjct: 239 FIGKANMHELGLGVTGNNPNYGTARNPHSVDRYTGGSSSGPAALVSSGLCSAAIGTDGGG 298

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVRIPS+ CGI G KT  GR    G    + +V V+ P+A+SV+D  L Y  +AG  P D
Sbjct: 299 SVRIPSALCGIVGFKTNYGRTDMTGVLCDSGTVEVASPLASSVEDAILVYSAIAGSRPMD 358

Query: 181 PNTLH-QPL--PTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR--- 234
             TL   PL  P L     +N L  +KIG Y+ W   V +  I+   +   D LKL    
Sbjct: 359 KLTLRPSPLCVPNLLSPENSNILGSVKIGKYTEWFNDVCDHEISGTCD---DALKLLCST 415

Query: 235 -GAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRH--KDKMHLFSCPTRSNINVMKLATA 291
            G              R AHL++IG+E       H    +   F+  TR+++ +    TA
Sbjct: 416 FGCQIEEIILPELEEMRTAHLVSIGSESFCDLNPHYKAGRKTEFTLDTRTSLALFGSFTA 475

Query: 292 SDYIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMR 351
           +DY+ SQ +R RIM      F  +VD+I+TP T ITAPKI P AL  GE D  + + +MR
Sbjct: 476 TDYVASQSIRRRIMHYHMEAF-KKVDVIVTPTTGITAPKIPPSALKSGESDYVVSAYLMR 534

Query: 352 FVQLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
           F+   N  G+PA++VP G+D   LPIGLQ I + + EA+LLR+A   EE+   +RK+PS
Sbjct: 535 FIIAGNLLGLPAITVPVGHDKQGLPIGLQLIGRPWGEASLLRVASAVEELCLKKRKRPS 593



>gi|325181146|emb|CCA15561.1| glutamyltRNA(Gln) amidotransferase subunit A putativ [Albugo
           laibachii Nc14]
          Length = 445

 Score =  274 bits (701), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 152/422 (36%), Positives = 226/422 (53%), Gaps = 3/422 (0%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           TERYA  ++LG+LDG+P+AVKDEIDV GY T  GT      +PA  D+  + RLR   AI
Sbjct: 18  TERYAKGATLGVLDGVPVAVKDEIDVIGYRTTRGTILPKAPSPAKEDSPSVARLRSAAAI 77

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           I+GKT+MH++G G T  N    TP+NP+N  +Y               + P+A+  DGGG
Sbjct: 78  IVGKTNMHDMGVGVTGLNVHYGTPKNPHNASHYTGGSSSGSAAAVACGIVPLALAVDGGG 137

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           S+RIP+ FCG+ GLK T  R        L  SV   GP+A SV D A+AY  ++G     
Sbjct: 138 SIRIPAPFCGVVGLKPTFQRVPSLPTELL--SVGHFGPIANSVRDTAIAYATISGSHESF 195

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXXXX 240
           P    QP      F  T  L+ LKIG +        +P +  ++     EL+ +GA    
Sbjct: 196 PRGRSQPSVDFSSFDKTKSLAGLKIGYFEALANH-SSPEVAKSVRRVCQELRNKGAKIIP 254

Query: 241 XXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYIVSQQV 300
                     +AH LT+ +EL ++  +H + +H      R  + +    +A +   +Q+V
Sbjct: 255 VQLHHFHTILLAHALTVLSELASMLDQHVESLHTMGPDARIMMMLASHFSALELTSAQRV 314

Query: 301 RTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANFAG 360
           R   +R +     ++VD+ ++P T ITAPKI   AL +GE+    ISDI+RF   AN  G
Sbjct: 315 RGFALRQIQQEIFDKVDIFISPTTGITAPKISADALEYGEMSAEQISDILRFCIYANLVG 374

Query: 361 VPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPSDKFWFGNYVQ 420
           VP ++V  G+D   LP+ +QF A+ +DE  L R+A T+E++  ++ K+P   F   +  +
Sbjct: 375 VPGIAVRIGHDSGGLPLSVQFQARHWDEDVLFRVAHTTEQLYVSQMKRPQVYFSILDRAK 434

Query: 421 EV 422
           E+
Sbjct: 435 EI 436



>gi|225429238|ref|XP_002264191.1| PREDICTED: fatty acid amide hydrolase [Vitis vinifera]
 gi|296088088|emb|CBI35447.3| unnamed protein product [Vitis vinifera]
          Length = 607

 Score =  273 bits (699), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 156/420 (37%), Positives = 230/420 (54%), Gaps = 9/420 (2%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+R+   + L +LDGI +A+KD+ID   + +   T +++   P   DA  + RLR  G I
Sbjct: 184 TQRFQEGNPLSILDGIFVAIKDDIDCLPHPSKGATIWMHEVRPVEKDAVSVSRLRSCGVI 243

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
            +GK +MHE+G G++ NNP   T RNP+  + Y               LC  A+G DGGG
Sbjct: 244 FVGKANMHELGLGTSGNNPNYGTTRNPHAPERYTGGSSSGPAALVASGLCSAALGTDGGG 303

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVRIPSS CG+ GLKTT GR S  G    + +V + GP+A+ V+D+ L Y  + G  P D
Sbjct: 304 SVRIPSSLCGVVGLKTTYGRTSMIGSICDSGTVEIIGPIASMVEDVMLVYAAILGSSPAD 363

Query: 181 PNTLHQP----LPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLRG 235
                +P    LP L      N +  L++G Y+ W   V +  I+    + ++ L K  G
Sbjct: 364 -RICSKPAPPCLPNLSSSESLNVMGTLRLGKYTQWFNDVYSTDISDKCEDVLNMLSKNHG 422

Query: 236 AXXXXXXXXXXXXARIAHLLTIGTELTTVAKRH--KDKMHLFSCPTRSNINVMKLATASD 293
                         R AH+++IG+E  +    H    K+   +  TR+N+ + +   ASD
Sbjct: 423 CKVTEIIIPELNEMRNAHIVSIGSESVSSLNPHCYDGKISKMTLDTRTNLALFRTFAASD 482

Query: 294 YIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFV 353
           Y+ +Q +R R+M     +F N VD+I+TP T +TAP I P AL  GE ++ +   +MRFV
Sbjct: 483 YVAAQCLRRRLMYYHMEIFKN-VDIIVTPTTGMTAPIISPSALKFGESNLQVGGYLMRFV 541

Query: 354 QLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPSDKF 413
             AN  G+PA+SVP GYD   LPIGLQ I + + EA++LR+A   EE+ G  +KKP+  +
Sbjct: 542 VAANLLGLPAISVPVGYDKQGLPIGLQLIGRPWGEASILRLASAVEELCGEPKKKPAQFY 601



>gi|115456792|ref|NP_001051996.1| Os04g0102700 [Oryza sativa Japonica Group]
 gi|113563567|dbj|BAF13910.1| Os04g0102700 [Oryza sativa Japonica Group]
          Length = 608

 Score =  271 bits (694), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 164/416 (39%), Positives = 225/416 (54%), Gaps = 7/416 (1%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+R+   + + +LDGI IA+KD+ID   Y +   T F +       DA  + RLR+ G +
Sbjct: 186 TKRFQQGNPISILDGIFIAIKDDIDCFPYPSKGATTFFDKIRSVEKDAVCVARLRKCGVL 245

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
            +GK +MHE+G G T NNP   T RNP++ D Y               LC  AIG DGGG
Sbjct: 246 FIGKANMHELGLGVTGNNPNYGTARNPHSIDRYTGGSSSGPAALVSSGLCSAAIGTDGGG 305

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVRIPSS CGI GLKTT GR    G      +V V+ P+AASV+D  L Y  +AG  P D
Sbjct: 306 SVRIPSSLCGIIGLKTTYGRTDMTGALCDCGTVEVASPLAASVEDALLVYSAIAGSRPMD 365

Query: 181 PNTLH-QPL--PTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLRGA 236
             TL   PL  P L      N L  +KIG Y+ W   V +  I+    + ++ L    G 
Sbjct: 366 KLTLRPSPLCVPNLVSPDNNNILGSVKIGKYTEWFHDVSDRDISNTCEDALNLLCSSFGC 425

Query: 237 XXXXXXXXXXXXARIAHLLTIGTELTTVAKRH--KDKMHLFSCPTRSNINVMKLATASDY 294
                        R AH+++IGTE       H    K   F+  TR+++ +    T++DY
Sbjct: 426 QIEEIILPELEEMRTAHVVSIGTESFCDLNPHYRAGKRTEFTLDTRTSLALFGSFTSTDY 485

Query: 295 IVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQ 354
           + SQ++R RIM   N  F  +VD+I TP T ITAP+I   +L  GE +  + + +MRFV 
Sbjct: 486 VASQRIRRRIMYYHNEAF-KKVDVIATPTTGITAPEIPQSSLKLGESNYVVSAYLMRFVI 544

Query: 355 LANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
             N  G+PA++VP G+D   LPIGLQ I + + EA+LLR+A   EE+   +RK+PS
Sbjct: 545 AGNLLGLPAITVPVGHDKQGLPIGLQLIGRPWGEASLLRVASAIEELCLQKRKRPS 600



>gi|38344767|emb|CAE01584.2| OSJNBa0068L06.10 [Oryza sativa Japonica Group]
 gi|73921309|gb|AAZ94202.1| N-acylethanolamine amidohydrolase [Oryza sativa Japonica Group]
 gi|222628235|gb|EEE60367.1| hypothetical protein OsJ_13498 [Oryza sativa Japonica Group]
          Length = 601

 Score =  271 bits (694), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 164/416 (39%), Positives = 225/416 (54%), Gaps = 7/416 (1%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+R+   + + +LDGI IA+KD+ID   Y +   T F +       DA  + RLR+ G +
Sbjct: 179 TKRFQQGNPISILDGIFIAIKDDIDCFPYPSKGATTFFDKIRSVEKDAVCVARLRKCGVL 238

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
            +GK +MHE+G G T NNP   T RNP++ D Y               LC  AIG DGGG
Sbjct: 239 FIGKANMHELGLGVTGNNPNYGTARNPHSIDRYTGGSSSGPAALVSSGLCSAAIGTDGGG 298

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVRIPSS CGI GLKTT GR    G      +V V+ P+AASV+D  L Y  +AG  P D
Sbjct: 299 SVRIPSSLCGIIGLKTTYGRTDMTGALCDCGTVEVASPLAASVEDALLVYSAIAGSRPMD 358

Query: 181 PNTLH-QPL--PTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLRGA 236
             TL   PL  P L      N L  +KIG Y+ W   V +  I+    + ++ L    G 
Sbjct: 359 KLTLRPSPLCVPNLVSPDNNNILGSVKIGKYTEWFHDVSDRDISNTCEDALNLLCSSFGC 418

Query: 237 XXXXXXXXXXXXARIAHLLTIGTELTTVAKRH--KDKMHLFSCPTRSNINVMKLATASDY 294
                        R AH+++IGTE       H    K   F+  TR+++ +    T++DY
Sbjct: 419 QIEEIILPELEEMRTAHVVSIGTESFCDLNPHYRAGKRTEFTLDTRTSLALFGSFTSTDY 478

Query: 295 IVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQ 354
           + SQ++R RIM   N  F  +VD+I TP T ITAP+I   +L  GE +  + + +MRFV 
Sbjct: 479 VASQRIRRRIMYYHNEAF-KKVDVIATPTTGITAPEIPQSSLKLGESNYVVSAYLMRFVI 537

Query: 355 LANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
             N  G+PA++VP G+D   LPIGLQ I + + EA+LLR+A   EE+   +RK+PS
Sbjct: 538 AGNLLGLPAITVPVGHDKQGLPIGLQLIGRPWGEASLLRVASAIEELCLQKRKRPS 593



>gi|357166884|ref|XP_003580899.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit A-like
           [Brachypodium distachyon]
          Length = 602

 Score =  271 bits (694), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 163/416 (39%), Positives = 223/416 (53%), Gaps = 7/416 (1%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+R+   + + +LDGI +A+KD+ID   Y +   T F +       DA  + RLR  G I
Sbjct: 180 TKRFEQGNPISILDGIFVAIKDDIDCFPYPSKGATTFFDQIRSVEKDAVCVARLRRCGVI 239

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
            +GK +MHE+G G T NN    T RNP++ D Y               LC  AIG DGGG
Sbjct: 240 FIGKANMHELGLGVTGNNANYGTVRNPHSIDRYTGGSSSGPAAIVSSGLCSAAIGTDGGG 299

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVRIPSS CGI GLKTT GR    G    A +V V  P+ ASV+D  L Y  +AG  P D
Sbjct: 300 SVRIPSSLCGIVGLKTTYGRTDMTGSLCDAGTVEVGSPLTASVEDAMLVYSALAGCRPTD 359

Query: 181 PNTLH-QPL--PTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLRGA 236
             TL   PL  P L     +N L  +K+G Y+ W   V +  I+   ++ ++ L    G 
Sbjct: 360 ILTLRPSPLCVPNLVSSDNSNILQSVKVGKYTEWFNDVSDIEISNTCDSALNLLCSTFGC 419

Query: 237 XXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKD--KMHLFSCPTRSNINVMKLATASDY 294
                        R AHL++IG+E       H    +    +  TR+++ +    T++DY
Sbjct: 420 QIEEIVLPELEEMRTAHLVSIGSESFCDLNPHYQAGRRAELTLDTRTSLALFGSFTSTDY 479

Query: 295 IVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQ 354
           + SQ +R RIM      F  +VD+I TP T ITAPKI P AL  GE D  + +++MRF+ 
Sbjct: 480 VASQCLRRRIMYYHMEAF-KKVDVIATPTTGITAPKIPPSALKLGESDYVVSANLMRFIL 538

Query: 355 LANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
            AN  G+PA++VP G+D   LPIGLQ I + + EA+LLR+A   EE+   RR +PS
Sbjct: 539 AANLLGLPAITVPVGHDKQGLPIGLQLIGRPWGEASLLRVASAVEELCLKRRNRPS 594



>gi|218194194|gb|EEC76621.1| hypothetical protein OsI_14505 [Oryza sativa Indica Group]
          Length = 601

 Score =  271 bits (694), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 164/416 (39%), Positives = 225/416 (54%), Gaps = 7/416 (1%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+R+   + + +LDGI IA+KD+ID   Y +   T F +       DA  + RLR+ G +
Sbjct: 179 TKRFQQGNPISILDGIFIAIKDDIDCFPYPSKGATTFFDKIRSVEKDAVCVARLRKCGVL 238

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
            +GK +MHE+G G T NNP   T RNP++ D Y               LC  AIG DGGG
Sbjct: 239 FIGKANMHELGLGVTGNNPNYGTARNPHSIDRYTGGSSSGPAALVSSGLCSAAIGTDGGG 298

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVRIPSS CGI GLKTT GR    G      +V V+ P+AASV+D  L Y  +AG  P D
Sbjct: 299 SVRIPSSLCGIIGLKTTYGRTDMTGALCDCGTVEVASPLAASVEDALLVYSAIAGSRPMD 358

Query: 181 PNTLH-QPL--PTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLRGA 236
             TL   PL  P L      N L  +KIG Y+ W   V +  I+    + ++ L    G 
Sbjct: 359 KLTLRPSPLCVPNLVSPDNNNILGSVKIGKYTEWFHDVSDRDISNTCEDALNLLCSSFGC 418

Query: 237 XXXXXXXXXXXXARIAHLLTIGTELTTVAKRH--KDKMHLFSCPTRSNINVMKLATASDY 294
                        R AH+++IGTE       H    K   F+  TR+++ +    T++DY
Sbjct: 419 QIEEIILPELEEMRTAHVVSIGTESFCDLNPHYRAGKRTEFTLDTRTSLALFGSFTSTDY 478

Query: 295 IVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQ 354
           + SQ++R RIM   N  F  +VD+I TP T ITAP+I   +L  GE +  + + +MRFV 
Sbjct: 479 VASQRIRRRIMYYHNEAF-KKVDVIATPTTGITAPEIPQSSLKLGESNYVVSAYLMRFVI 537

Query: 355 LANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
             N  G+PA++VP G+D   LPIGLQ I + + EA+LLR+A   EE+   +RK+PS
Sbjct: 538 AGNLLGLPAITVPVGHDKQGLPIGLQLIGRPWGEASLLRVASAIEELCLKKRKRPS 593



>gi|116317778|emb|CAH65756.1| OSIGBa0123D13.5 [Oryza sativa Indica Group]
          Length = 608

 Score =  271 bits (694), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 164/416 (39%), Positives = 225/416 (54%), Gaps = 7/416 (1%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+R+   + + +LDGI IA+KD+ID   Y +   T F +       DA  + RLR+ G +
Sbjct: 186 TKRFQQGNPISILDGIFIAIKDDIDCFPYPSKGATTFFDKIRSVEKDAVCVARLRKCGVL 245

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
            +GK +MHE+G G T NNP   T RNP++ D Y               LC  AIG DGGG
Sbjct: 246 FIGKANMHELGLGVTGNNPNYGTARNPHSIDRYTGGSSSGPAALVSSGLCSAAIGTDGGG 305

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVRIPSS CGI GLKTT GR    G      +V V+ P+AASV+D  L Y  +AG  P D
Sbjct: 306 SVRIPSSLCGIIGLKTTYGRTDMTGALCDCGTVEVASPLAASVEDALLVYSAIAGSRPMD 365

Query: 181 PNTLH-QPL--PTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLRGA 236
             TL   PL  P L      N L  +KIG Y+ W   V +  I+    + ++ L    G 
Sbjct: 366 KLTLRPSPLCVPNLVSPDNNNILGSVKIGKYTEWFHDVSDRDISNTCEDALNLLCSSFGC 425

Query: 237 XXXXXXXXXXXXARIAHLLTIGTELTTVAKRH--KDKMHLFSCPTRSNINVMKLATASDY 294
                        R AH+++IGTE       H    K   F+  TR+++ +    T++DY
Sbjct: 426 QIEEIILPELEEMRTAHVVSIGTESFCDLNPHYRAGKRTEFTLDTRTSLALFGSFTSTDY 485

Query: 295 IVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQ 354
           + SQ++R RIM   N  F  +VD+I TP T ITAP+I   +L  GE +  + + +MRFV 
Sbjct: 486 VASQRIRRRIMYYHNEAF-KKVDVIATPTTGITAPEIPQSSLKLGESNYVVSAYLMRFVI 544

Query: 355 LANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
             N  G+PA++VP G+D   LPIGLQ I + + EA+LLR+A   EE+   +RK+PS
Sbjct: 545 AGNLLGLPAITVPVGHDKQGLPIGLQLIGRPWGEASLLRVASAIEELCLKKRKRPS 600



>gi|168001836|ref|XP_001753620.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162695027|gb|EDQ81372.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 575

 Score =  270 bits (691), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 157/416 (37%), Positives = 223/416 (53%), Gaps = 13/416 (3%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           TERY   ++L +LDG+P+AVKD+ID   + +  GTK++        DA  I RLR  G +
Sbjct: 156 TERYKKGTALSVLDGVPLAVKDDIDCLPHPSTAGTKWLPQVREVKEDAVSIARLRSCGMM 215

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GK  MHE+G G+T +NP   T RNP++   Y               LCP+A+G D GG
Sbjct: 216 MIGKAVMHELGMGTTGSNPHHGTARNPHDLGRYTGGSSSGPGAIVASGLCPVALGTDVGG 275

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           S+RIPSS CG  GLK T GR +++G + +  S+  SGP+A+S +D  L Y  M G  P D
Sbjct: 276 SIRIPSSLCGNIGLKPTFGRITNEGLFCVGWSMESSGPIASSTEDALLVYAAMVGSHPTD 335

Query: 181 PNTLHQ-PLPTL-----HGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KL 233
              LH  PLP        GF     +  LK+G YS W        +    N  ++ + + 
Sbjct: 336 --KLHSWPLPPCVPDLNVGFQAI--MGSLKLGKYSDWFNSTFEKEVAEVCNKSLNLIFET 391

Query: 234 RGAXXXXXXXXXXXXARIAHLLTIGTE-LTTVAKRHKDKMHLFSCPTRSNINVMKLATAS 292
            G              +IAHL T+G+E ++ +A      +   S   +  + + K  TA 
Sbjct: 392 FGTETKEIILPELDEIKIAHLCTVGSEYVSGLAGYDTKLLKELSLEVQGTLGLFKEFTAL 451

Query: 293 DYIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRF 352
           DY+ SQ++R R M      F + VD+I+TP T  TAP I   AL  GE D+T + ++MRF
Sbjct: 452 DYLSSQKIRRRAMYFYMQAFES-VDVIVTPTTGTTAPVISSAALTVGESDLTTVGNLMRF 510

Query: 353 VQLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKK 408
           +   NF G+PA+SVP G+D   LPIGLQ I + + EATL R+A   EE+    RK+
Sbjct: 511 IIAPNFLGLPAISVPVGHDSRGLPIGLQLIGRPWQEATLFRVAAAFEEVCTPLRKR 566



>gi|460369377|ref|XP_004230539.1| PREDICTED: fatty acid amide hydrolase-like [Solanum lycopersicum]
          Length = 618

 Score =  270 bits (691), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 156/417 (37%), Positives = 228/417 (54%), Gaps = 7/417 (1%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+R+     L +L+GI IAVKD+ID   + +  G+K+ +      +D   + RLR  GAI
Sbjct: 187 TQRFEKGKQLSILEGIFIAVKDDIDCYPHPSKGGSKWFHEVRQVKADGVPVSRLRNNGAI 246

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKT+MHE G G+T NNP   TPRNP+N   Y               LC  A+G D GG
Sbjct: 247 LVGKTNMHEFGMGTTGNNPNYGTPRNPHNPKRYTGGSSSGSAAIVASGLCSAALGTDAGG 306

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVRIP+S CG+ GLKTT GR    G    A +V + GP+ A+V+D  L Y  ++G  P D
Sbjct: 307 SVRIPASLCGVVGLKTTFGRTDLTGSLWEAGTVTIIGPITATVEDAILVYAAISGSSPTD 366

Query: 181 PNTLHQPLPT---LHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR-GA 236
              L+  +P    L     +N L  L +G Y+ W   V +  I+    + +++L  R G 
Sbjct: 367 RIQLNPSIPNFPDLSSSESSNILGSLTLGKYTKWFNDVSSTDISDKCEDVLNQLFRRYGC 426

Query: 237 XXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKD--KMHLFSCPTRSNINVMKLATASDY 294
                        R AH +T G+E  +      +  K    +  TR+N+ + +   ASDY
Sbjct: 427 KTTEIVIPELRELRTAHTVTFGSESLSFLNPDCEAGKGVRLTNDTRTNLALFRSFAASDY 486

Query: 295 IVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQ 354
           I +Q +R RIM     +F  +VD+I+TP T +TAP+I   ALA GE ++ +++ +M+F  
Sbjct: 487 ISAQCLRRRIMYYHMEIF-KKVDVIVTPTTGMTAPEIPESALAVGETNLQVVARLMQFAM 545

Query: 355 LANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPSD 411
            AN  G+PA+SVP G+D   LPIGLQ I + + EA++LR+A   EE+    RKKP +
Sbjct: 546 TANVLGLPAISVPIGHDKQGLPIGLQLIGRPWCEASILRLAVAVEEMSAEYRKKPVE 602



>gi|460369375|ref|XP_004230538.1| PREDICTED: fatty acid amide hydrolase-like [Solanum lycopersicum]
          Length = 608

 Score =  270 bits (690), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 155/415 (37%), Positives = 229/415 (55%), Gaps = 7/415 (1%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+R+   + L +LDGI +A+KD+ID   + +   T +++       DA  + RLR  GAI
Sbjct: 185 TQRFEQGNPLSILDGIFMAIKDDIDCYSHPSKGATTWMHEVREVKKDAVSVSRLRSCGAI 244

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GK +MHE+G G+T NN    T RNP++ D Y               LC  A+G DGGG
Sbjct: 245 LVGKANMHELGLGTTGNNANYGTTRNPHDPDRYTGGSSSGPAAIVALGLCSAALGTDGGG 304

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVRIPSS CG+ GLK+T GR    G      +VA+ GP+A +V+D  L Y  + G  P D
Sbjct: 305 SVRIPSSLCGVVGLKSTYGRTDMTGSLCGDGTVAIIGPIATTVEDTILVYAAILGSSPAD 364

Query: 181 PNTLHQPLPTLHGFHVTNKLS---DLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLRGA 236
             +L   LP +  F     L     L++G Y+ W   V +  I+    N + +L +  G 
Sbjct: 365 RISLRPSLPCVPNFSSQESLQSVESLRLGKYTEWFNDVFSIDISDKCGNVLSQLSEEHGC 424

Query: 237 XXXXXXXXXXXXARIAHLLTIGTE-LTTVAKRHKD-KMHLFSCPTRSNINVMKLATASDY 294
                        RIAH+++IG+E L  +     D K    +  TR+N+ + +  TA+DY
Sbjct: 425 RIVEIVIPELHEMRIAHVVSIGSEALCALNPDCCDGKGERLTYDTRTNLTLFRSFTAADY 484

Query: 295 IVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQ 354
           + SQ++R R+M     +F  +VD+I+TP T +TAP I P AL  GE ++ +  ++MRF+ 
Sbjct: 485 VASQRLRRRLMYFHMEIF-KRVDIIVTPTTGMTAPIIPPSALKVGETNMQVTGNLMRFII 543

Query: 355 LANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKP 409
            AN  G+PAV+VP GYD   LPIG+Q I + + EA++LR+A   EE     +KKP
Sbjct: 544 TANLLGLPAVTVPVGYDKQGLPIGIQLIGRPWCEASILRLAAAIEETCAEPKKKP 598



>gi|255554561|ref|XP_002518319.1| glutamyl-tRNA(gln) amidotransferase subunit A, putative [Ricinus
           communis]
 gi|223542539|gb|EEF44079.1| glutamyl-tRNA(gln) amidotransferase subunit A, putative [Ricinus
           communis]
          Length = 607

 Score =  270 bits (689), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 154/406 (37%), Positives = 225/406 (55%), Gaps = 7/406 (1%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T R+   + + +LDGI +A+KD+ID   + +   T +++       DA  + RLR  G I
Sbjct: 185 TRRFEEGNPMSILDGIFMAIKDDIDCYPHPSKGATTWMHEVRSVKKDAVSVSRLRSCGVI 244

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
            +GK +MHE+G G+T NNP   T RNP+ TD Y               LC  A+G DGGG
Sbjct: 245 FVGKANMHELGMGTTGNNPNYGTTRNPHATDRYTGGSSSGPAAIVASGLCSAALGTDGGG 304

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVRIPSS CG+ GLKTT GR   +G      +V + GP+A+SV+D  L Y V+ G  P D
Sbjct: 305 SVRIPSSLCGVVGLKTTYGRTDMEGSLCHYGTVEIIGPIASSVEDAMLVYSVILGSSPAD 364

Query: 181 PNTLHQP---LPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLRGA 236
              L      LP L  +     L  L++G Y+ W   V +  ++    + ++ L K  G 
Sbjct: 365 KICLRPSPPCLPNLSSYESVGGLGSLRLGKYTEWFNDVHSTDVSDKCEDALNLLSKTHGC 424

Query: 237 XXXXXXXXXXXXARIAHLLTIGTEL-TTVAKRHKD-KMHLFSCPTRSNINVMKLATASDY 294
                        R AHL+ IG+E+ ++++   +D K    +  TR+++ + +  +ASDY
Sbjct: 425 EIVEIVVPELEEMRTAHLVCIGSEMQSSLSPDIEDGKGVRLTYDTRTSLALFQSFSASDY 484

Query: 295 IVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQ 354
           + +Q +R R+M     +F  +VD+I+TP T +TAPKI P AL +GE D+ +   +MRFV 
Sbjct: 485 VAAQCLRRRLMYHHMEIF-KKVDVIVTPTTGMTAPKIPPSALKYGETDMQVTGYLMRFVI 543

Query: 355 LANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEE 400
            AN  G PA++VP GYD   LPIGLQ I + + EAT+LR+A   EE
Sbjct: 544 AANLLGFPAITVPVGYDKQGLPIGLQIIGRPWAEATILRLASAIEE 589



>gi|281209446|gb|EFA83614.1| amidase family protein [Polysphondylium pallidum PN500]
          Length = 605

 Score =  269 bits (688), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 143/395 (36%), Positives = 226/395 (57%), Gaps = 7/395 (1%)

Query: 2   ERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGN-PATSDATIIERLREKGAI 60
           +R+   + L +LDG+P+++KDE+D +GY+T  GT F+   N  A +DA  +++LRE GA+
Sbjct: 182 QRWKQGTPLSILDGVPVSIKDEVDQRGYKTTCGTSFLGKINGAAQADAYPVDKLRENGAL 241

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GK +MHEIG  +   N      RNP+N D+YP              L PI+IG DGGG
Sbjct: 242 LVGKANMHEIGISTLGYNLHHGFIRNPFNLDHYPGGSSSGSASSVSAGLNPISIGCDGGG 301

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P+S CG+ G+K T GR S  G + L  +V   GP++++V D A+AY V+AG+DP D
Sbjct: 302 SVRVPASLCGVVGMKPTFGRVSHTGTFDLCSTVGHIGPLSSTVVDNAIAYAVIAGRDPLD 361

Query: 181 PNTLHQPLPTLHGFH---VTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAX 237
             T+ QP P +  F    +   L  +++GV+  W      P I  A    +  L+ +GA 
Sbjct: 362 FQTMIQPEPIIPVFQDIPLNKPLQGIRVGVFKEWCNDC-TPDIQAAFKKSLTVLEEQGAT 420

Query: 238 XXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHL-FSCPTRSNINVMKLATASDYIV 296
                       R++ ++ I +E+     R  DK        TR ++++M   T+SDY+ 
Sbjct: 421 FVDYSISDLLHIRLSQIVLILSEMRNSMSRFWDKHRTDLHNDTRVSLSLMDGITSSDYLH 480

Query: 297 SQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLA 356
             + RT  +  L  +F + VD+I+TP  A  APKI P  L++GE +++ I+++M+F  L 
Sbjct: 481 CNRFRTHAIEQLKEIFQS-VDVIVTPTNATLAPKIMPYVLSNGESNMSDIAELMKFAFLG 539

Query: 357 NFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATL 391
           N  GVP +S+P   ++ NLPIG+Q + +W++E  L
Sbjct: 540 NITGVPGLSIPISVNEENLPIGIQLMGRWWEEDLL 574



>gi|356549479|ref|XP_003543121.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit A-like
           [Glycine max]
          Length = 607

 Score =  269 bits (687), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 155/415 (37%), Positives = 231/415 (55%), Gaps = 7/415 (1%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+R+   + L +LDGI +A+KD+ID   + +   T +++       DA  + RLR  G I
Sbjct: 184 TQRFEAGNPLSILDGIFMAIKDDIDCYPHPSKGATTWMHEVRTVKEDAVCVSRLRTCGVI 243

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
            +GK +MHE+G G+T NNP   T RNP+  D Y               LC  A+G DGGG
Sbjct: 244 FIGKANMHELGMGTTGNNPNFGTTRNPHAPDRYTGGSSSGPAAIVASGLCSAALGTDGGG 303

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVRIPSS CG+ G KTT GR S +G    + +V + GP+A++V+D+ L Y  M G  P +
Sbjct: 304 SVRIPSSLCGVVGFKTTYGRTSMEGSLCDSGTVEIIGPIASTVEDVLLVYSAMLGASPAN 363

Query: 181 PNTLHQP---LPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLRGA 236
             +L      LPTL     +N L  L+IG Y+ W   V +  I+      ++ L K  G 
Sbjct: 364 RISLKPAPPCLPTLSSNDNSNALGSLRIGKYTPWFNDVHSTEISDKCEEALNLLSKAHGC 423

Query: 237 XXXXXXXXXXXXARIAHLLTIGTE-LTTVAKRHKDKMHL-FSCPTRSNINVMKLATASDY 294
                        R AH+++IG+E L ++    +D   +  +  TR+++ + +  TA+DY
Sbjct: 424 EMIEIVIPELLEMRTAHVVSIGSECLCSLNPDCEDGRGVNLTYDTRTSLALFRSFTAADY 483

Query: 295 IVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQ 354
           + +Q +R R M     +F  +VD+I+TP T +TAP I P AL  GE D+   +++M+FV 
Sbjct: 484 VAAQCIRRRNMYYHLEIF-KKVDVIVTPTTGMTAPIIPPSALKSGETDMQTTANLMQFVV 542

Query: 355 LANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKP 409
            AN  G P++SVP GYD   LPIGLQ + + + EAT+LR+A   E++ G  +KKP
Sbjct: 543 PANLLGFPSISVPVGYDKEGLPIGLQIMGRPWAEATILRVAAEVEKLCGESKKKP 597



>gi|475582661|gb|EMT19195.1| Glutamyl-tRNA(Gln) amidotransferase subunit A [Aegilops tauschii]
          Length = 574

 Score =  268 bits (686), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 160/417 (38%), Positives = 226/417 (54%), Gaps = 10/417 (2%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+R+   S + +LDGI  A+KD+ID   Y +  GT F +   P   DA ++ RLR+ G I
Sbjct: 153 TKRFEQGSPISVLDGIFFAIKDDIDCFPYPSKSGTTFFDKIRPVEKDAVLVARLRKCGVI 212

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
            +GK +MHE+G G T NNP   T RNP++ + Y               LC  AIG D GG
Sbjct: 213 FIGKANMHELGIGVTGNNPNYGTVRNPHSINRYTGASSSGPAALVSSGLCSAAIGTDAGG 272

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVRIPSS CGI GLKTT GR +  G      +  V+ P+ ASV+D  L Y  +AG  P D
Sbjct: 273 SVRIPSSLCGIIGLKTTFGRTNMTGVLCDCGTAEVASPLTASVEDSVLVYSALAGCRPMD 332

Query: 181 PNTLHQPLPTLHGFHVTNK----LSDLKIGVYSMWNKQVDNPAITTALNNFIDELK-LRG 235
             TL +PLP      V+++    L  +K+G Y+ W   V +  I+    + +  L+   G
Sbjct: 333 KLTL-RPLPLCVPNLVSSENNDILQSVKVGKYTEWFHDVSDIEISNTCEDALSLLRNTFG 391

Query: 236 AXXXXXXXXXXXXARIAHLLTIGTE--LTTVAKRHKDKMHLFSCPTRSNINVMKLATASD 293
                         R AHL+TIG+E      A   + +    +  TR ++ +    T++D
Sbjct: 392 CQIEEIILPELLEMRTAHLVTIGSEGFCQLNAHYQEGRRTEMTLDTRGSLALFGSFTSAD 451

Query: 294 YIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFV 353
           Y+ SQ++R R+M      F  +VD+I TP T ITAP+I P AL  GE D  + + +M+F+
Sbjct: 452 YVASQRLRRRMMYYHMEAF-RKVDVIATPTTGITAPRIPPSAL-KGESDYIVSAKLMQFI 509

Query: 354 QLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
              NF G PA++VP G+D   LPIGLQ I + + EA+LLR+A   EE+   RR +PS
Sbjct: 510 VAGNFLGFPAITVPVGHDKQGLPIGLQLIGRPWGEASLLRVASAVEELCLKRRNRPS 566



>gi|356554842|ref|XP_003545751.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit A-like
           [Glycine max]
          Length = 607

 Score =  268 bits (686), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 155/419 (36%), Positives = 234/419 (55%), Gaps = 7/419 (1%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+R+   + L +LDGI +A+KD+ID   + +   T +++       DA  + RLR  G I
Sbjct: 184 TQRFEAGNPLSILDGIFMAIKDDIDCYPHPSKGATTWMHEVRTVKEDAVCVSRLRTCGVI 243

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
            +GK +MHE+G G+T NNP   T RNP+  D Y               LC  A+G DGGG
Sbjct: 244 FIGKANMHELGMGTTGNNPNYGTTRNPHAPDRYTGGSSSGPAAIVASGLCSAALGTDGGG 303

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVRIPSS CG+ G KTT GR S +G    + +V + GP+A++V+D+ L Y  M G  P +
Sbjct: 304 SVRIPSSLCGVVGFKTTYGRTSMEGSLCDSGTVEIIGPIASTVEDVLLVYSAMLGASPAN 363

Query: 181 PNTLHQP---LPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLRGA 236
             +L      LP+L     +N L  L+IG Y+ W   V +  I+   +  ++ L K  G 
Sbjct: 364 RISLKPSPPCLPSLSSNDNSNALGSLRIGKYTPWFNDVHSTEISDKCDEALNLLSKAHGC 423

Query: 237 XXXXXXXXXXXXARIAHLLTIGTE-LTTVAKRHKDKMHL-FSCPTRSNINVMKLATASDY 294
                        R AH+++IG+E L ++    +D   +  +  TR+++ + +  TA+DY
Sbjct: 424 EMIEIVIPELLEMRTAHVVSIGSECLCSLNPDCEDGKGVNLTYDTRTSLALFRSFTAADY 483

Query: 295 IVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQ 354
           + +Q +R R M     +F  +VD+I+TP T +TAP I P AL  GE D+   +++M+FV 
Sbjct: 484 VAAQCIRRRSMYYHLEIF-KKVDVIVTPTTGMTAPIIPPSALKSGETDMQTTANLMQFVV 542

Query: 355 LANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPSDKF 413
            AN  G PA+SVP GYD   LPIGLQ + + + EAT+LR+A   E++ G  +KKP+  +
Sbjct: 543 PANLLGFPAISVPVGYDKVGLPIGLQIMGRPWAEATVLRVAAEVEKLCGEWKKKPASYY 601



>gi|449438270|ref|XP_004136912.1| PREDICTED: fatty acid amide hydrolase-like [Cucumis sativus]
 gi|449478808|ref|XP_004155423.1| PREDICTED: fatty acid amide hydrolase-like [Cucumis sativus]
          Length = 606

 Score =  268 bits (685), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 157/415 (37%), Positives = 227/415 (54%), Gaps = 11/415 (2%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+R+   S L +LDGI IA+KD+ID   + T   + +++       DA  + RLR  G I
Sbjct: 185 TQRFEEGSPLSILDGIFIAIKDDIDCYPHPTKGASTWMHEVRSVQKDADSVARLRRCGVI 244

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GK +MHE+G G+T NNP   T RNP+  D Y               +C  A+G DGGG
Sbjct: 245 LVGKANMHELGMGTTGNNPNYGTTRNPHAPDRYTGGSSSGPAAIVASGICSAALGTDGGG 304

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           S+RIPSS CG+ GLKTT GR S  G      +V + GP+A+SV+D+ L Y  + G  P+D
Sbjct: 305 SIRIPSSLCGVVGLKTTYGRTSIRGSLCDCGTVEIIGPIASSVEDIMLVYAAILGSTPED 364

Query: 181 PNTLHQPLPTLHGFHVTNKLS---DLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLRGA 236
             +L    P L      + LS    L++G YS W   V +  I+    + ++ L K  G 
Sbjct: 365 KISLKPAPPCLPILSSDDNLSILGSLRLGKYSPWFNDVHSTDISEKSEDILELLTKTHGC 424

Query: 237 XXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKD----KMHLFSCPTRSNINVMKLATAS 292
                        R AHL++IG+E   +A  + D         +  +R++  + +  TAS
Sbjct: 425 EIVEVVVPELLEMRTAHLVSIGSEF--LASMNPDIEDGNGKRLTYDSRTSSALFRSFTAS 482

Query: 293 DYIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRF 352
           DY+ +Q +R RIM     +F  +VD+I+TP T +TAP I P A  +GE D+ +   +MRF
Sbjct: 483 DYVAAQCLRRRIMHHHMEIF-KKVDVIVTPTTGMTAPLIPPSAHKYGETDMPVTGYLMRF 541

Query: 353 VQLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRK 407
           +   N  G+PA+SVP GYD   LPIGLQ I + + EAT+LR+A   EE+ GN +K
Sbjct: 542 ILAPNLIGLPAISVPIGYDKQGLPIGLQLIGRPWGEATILRLASAIEELCGNPKK 596



>gi|357446085|ref|XP_003593320.1| Glutamyl-tRNA(Gln) amidotransferase subunit A [Medicago truncatula]
 gi|124359218|gb|ABN05729.1| Amidase [Medicago truncatula]
 gi|355482368|gb|AES63571.1| Glutamyl-tRNA(Gln) amidotransferase subunit A [Medicago truncatula]
          Length = 632

 Score =  266 bits (679), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 161/440 (36%), Positives = 237/440 (53%), Gaps = 32/440 (7%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGY-----------------ETNV--------GT 35
           T+R+ + + L +LDGI IA+KD+ID   +                 ET++        G+
Sbjct: 184 TQRFESGNPLSILDGIFIAIKDDIDCHPHPSTGKQILGSNFVRVIKETHLDHLLVMAGGS 243

Query: 36  KFINYGNPATSDATIIERLREKGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPX 95
            +++       DA  + RLR  G I +GKT+MHE G G+T NN    T RNP+  D Y  
Sbjct: 244 TWMHEVRDVKKDAVCVSRLRSCGVIFIGKTNMHEFGMGTTGNNSNYGTARNPHAPDRYTG 303

Query: 96  XXXXXXXXXXXXXLCPIAIGRDGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAV 155
                        LC  A+G DGGGSVRIPSS CG+ GLK   GR S +G    + +V V
Sbjct: 304 GSSSGPAAIVASGLCSAALGTDGGGSVRIPSSLCGVVGLKINYGRTSMEGSLCDSGTVEV 363

Query: 156 SGPMAASVDDLALAYYVMAGKDPKDPNTLHQP---LPTLHGFHVTNKLSDLKIGVYSMWN 212
            GP+A++V+D  L Y  M G  P +  ++      LPTL     T+ L  L+IG+Y+ W 
Sbjct: 364 IGPIASTVEDAMLVYAAMLGASPANRISMKPSTPCLPTLSSDDDTDALRSLRIGIYTPWF 423

Query: 213 KQVDNPAITTALNNFIDEL-KLRGAXXXXXXXXXXXXARIAHLLTIGTE-LTTVAKRHKD 270
             V +  ++    + ++ L K  G              R AHL++IG+E L+++    +D
Sbjct: 424 NNVHSTEVSDKCEDALNLLSKAHGCEVVEVVIPEIVEMRTAHLVSIGSECLSSLNPDIED 483

Query: 271 -KMHLFSCPTRSNINVMKLATASDYIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAP 329
            K    S  TR+++ + +  TA+DY+ +Q +R RIM     +F  +VD+I+TP T +TAP
Sbjct: 484 GKGVKLSYDTRTSLALFQSFTAADYVAAQCIRRRIMHYFMEIF-KKVDVIVTPTTGMTAP 542

Query: 330 KIYPRALAHGEVDVTMISDIMRFVQLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEA 389
           +I P AL  GE D+     +MRFV  AN  G+PA+SVP GYD   LPIGLQ I + + EA
Sbjct: 543 RIPPSALKSGETDMPTTGYLMRFVVPANLLGLPAISVPVGYDKEGLPIGLQVIGRPWAEA 602

Query: 390 TLLRIAKTSEEILGNRRKKP 409
           T+LR+A   E++ G  +++P
Sbjct: 603 TILRVAAAVEKLCGESKRRP 622



>gi|502077377|ref|XP_004485635.1| PREDICTED: fatty acid amide hydrolase-like [Cicer arietinum]
          Length = 607

 Score =  266 bits (679), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 155/415 (37%), Positives = 230/415 (55%), Gaps = 7/415 (1%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+R+   + L +LDGI +A+KD+ID     +  GT +++       DA  + RLR  G I
Sbjct: 184 TQRFEAGNPLSILDGIFMAIKDDIDCYPLLSKGGTTWMHEVRTVKKDAVCVSRLRSCGVI 243

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
            +GK +MHE+G G+T NN    T RNP+  D Y               LC  A+G DGGG
Sbjct: 244 FIGKANMHELGMGTTGNNSNYGTARNPHALDRYTGGSSSGPAAIVASGLCSAALGTDGGG 303

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           S+RIPSS CG+ GLK   GR S +G    + +V V GP+A++V+D  L Y  + G    +
Sbjct: 304 SIRIPSSLCGVVGLKINYGRSSMEGSICDSGTVEVIGPIASTVEDAMLVYAAILGATLAN 363

Query: 181 PNTLHQP---LPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLRGA 236
             ++      LPTL     T+ L  L+IG+Y+ W   V +  ++    + ++ L K  G 
Sbjct: 364 RISMKPSTPCLPTLSFDDDTDVLGSLRIGMYTPWFNNVHSTEVSDKCEDALNMLSKAHGC 423

Query: 237 XXXXXXXXXXXXARIAHLLTIGTE-LTTVAKRHKD-KMHLFSCPTRSNINVMKLATASDY 294
                        R AH ++IG+E + ++    +D K    +  TR+N+ + +  TA+DY
Sbjct: 424 EVTEVVIPELLDMRTAHAVSIGSECVCSLNPDWEDGKGVKLTYDTRTNLALFRSFTAADY 483

Query: 295 IVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQ 354
           + +Q +R RIM     +F  +VD+I+TP T +TAPKI P AL  GE D+   + +MRFV 
Sbjct: 484 VAAQCIRRRIMHYFMEIF-KKVDVIVTPTTGMTAPKIPPSALKSGETDLPTTAYLMRFVV 542

Query: 355 LANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKP 409
            AN  G+PA+SVP GYD   LPIGLQ I + + EAT+LR+A   E++ G  +K+P
Sbjct: 543 PANILGLPAISVPVGYDKEGLPIGLQIIGRPWAEATILRVASAVEKLCGESKKRP 597



>gi|326487738|dbj|BAK05541.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 613

 Score =  265 bits (676), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 159/417 (38%), Positives = 223/417 (53%), Gaps = 10/417 (2%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+R+   S + +LDGI  A+KD+ID   Y +   T F +   P   DA ++ RLR+ G I
Sbjct: 192 TKRFEQGSPISVLDGIFFAIKDDIDCFPYPSKSATTFFDKIRPVEKDAVLVARLRKCGVI 251

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
            +GK +MHE+G G T NNP   T RNP++ D Y               LC  AIG D GG
Sbjct: 252 FIGKANMHELGIGITGNNPNYGTVRNPHSIDRYTGGSSSGPAALVSSGLCSAAIGTDAGG 311

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVRIPSS CGI GLKTT GR +  G    + +  V+ P+ ASV+D  L Y  +AG  P D
Sbjct: 312 SVRIPSSLCGIVGLKTTYGRTNMTGMLCDSGTAVVASPLTASVEDSMLVYSALAGCRPMD 371

Query: 181 PNTLHQPL----PTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLRG 235
             TL +PL    P L     ++ L  +K+G Y+ W   V +  I+    + +  L    G
Sbjct: 372 KLTL-RPLPLCVPNLVSCENSDILQSVKVGKYTEWFHDVSDVEISNTCEDALSLLCSTFG 430

Query: 236 AXXXXXXXXXXXXARIAHLLTIGTELTTVAKRH--KDKMHLFSCPTRSNINVMKLATASD 293
                         R AHL+ IG+E  +    H  + +    +  TR ++ +    T++D
Sbjct: 431 CQIEEIILPELLEMRTAHLVIIGSEGFSQLNAHYQQGRRTEMTLDTRGSLALFGSFTSAD 490

Query: 294 YIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFV 353
           Y+ SQ++R RIM      F  +VD+I TP T ITAP+I P AL  GE D  + + +M+F+
Sbjct: 491 YVASQRLRRRIMYYHMEAF-RKVDVIATPTTGITAPRIPPSAL-KGESDYIVSAKLMQFI 548

Query: 354 QLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
              N  G PA++VP G+D   LPIGLQ I + + EA+LLR+A   EE+   RR +PS
Sbjct: 549 VAGNLLGFPAITVPVGHDKQGLPIGLQLIGRPWGEASLLRVALAVEELCLKRRNRPS 605



>gi|460369387|ref|XP_004230544.1| PREDICTED: fatty acid amide hydrolase-like [Solanum lycopersicum]
          Length = 610

 Score =  263 bits (673), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 153/419 (36%), Positives = 226/419 (53%), Gaps = 7/419 (1%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+R+   S L +LDGI IAVKD+ID   Y +  G  + +       DA  + RLR  GA+
Sbjct: 185 TQRFKEGSELSILDGIFIAVKDDIDCYPYPSKGGATWFHELRQVKKDAVCVSRLRNCGAV 244

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKT+MHE+  G+T NN    T RNP+  D Y               LC  A+G DGGG
Sbjct: 245 MVGKTNMHELALGTTGNNANFGTTRNPHAPDRYTGGSSSGSAAIVACGLCSAALGTDGGG 304

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVRIPSS CG+ GLKTT GR    G    + +VA+ GP+ A+V+D  L Y  + G  P +
Sbjct: 305 SVRIPSSLCGVVGLKTTYGRTDMKGLLYHSGTVAIVGPITATVEDAILVYAAILGSSPAE 364

Query: 181 PNTLHQPLPTLHGFHVTN---KLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAX 237
             +L   LP L           +  L++G Y+ W   V +  I+    + +++L  +   
Sbjct: 365 RVSLKPALPCLPNLSSCENWCSMGSLRLGKYTEWFNDVFSTEISDKCEDILNQLSEKHEC 424

Query: 238 XXXXXXXXXXXAR-IAHLLTIGTE-LTTVAKRHKD-KMHLFSCPTRSNINVMKLATASDY 294
                         IAH+++IG+E L+ +    +D K+   +  +R ++ + +  +ASDY
Sbjct: 425 KTIEIVIPELHEMFIAHVVSIGSEALSQLNPDLEDGKLARLTYDSRISLALFQTYSASDY 484

Query: 295 IVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQ 354
           I +Q +R R+M     +F  +VD+I+TP T +TAP I P AL  GE ++ +   +MRFV 
Sbjct: 485 IAAQCLRRRLMHFYMEIF-KKVDIIVTPTTPMTAPIISPTALTVGETNMWISGSLMRFVL 543

Query: 355 LANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPSDKF 413
            AN  G PA+SVP GYD   LPIG+Q I + + EA++LR+A   EE     +KKP   +
Sbjct: 544 AANLLGFPAISVPVGYDKQGLPIGMQLIGRPWCEASILRLAAAIEETCAGPKKKPKQFY 602



>gi|301097937|ref|XP_002898062.1| glutamyl-tRNA(Gln) amidotransferase subunit A, putative
           [Phytophthora infestans T30-4]
 gi|262105423|gb|EEY63475.1| glutamyl-tRNA(Gln) amidotransferase subunit A, putative
           [Phytophthora infestans T30-4]
          Length = 600

 Score =  263 bits (672), Expect = 8e-68,   Method: Compositional matrix adjust.
 Identities = 157/415 (37%), Positives = 215/415 (51%), Gaps = 25/415 (6%)

Query: 2   ERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGN-PATSDATIIERLREKGAI 60
           ERYA  + LG+LDG+P+A+KDE+ +KG+    GT F+ Y   PAT D   + RLR  GAI
Sbjct: 196 ERYARGNPLGVLDGVPVAIKDEVHIKGHRMFTGTSFLGYEEEPATMDDPPVARLRAAGAI 255

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ILG T+MHEIG G T  N      RNPYN   Y               L P+A+G DGGG
Sbjct: 256 ILGTTNMHEIGSGVTGYNMHYGAVRNPYNPKCYTGGSSSGSAAAVTSGLVPLALGLDGGG 315

Query: 121 SVRIPSSFCGIYGLKTTCGRF-SDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPK 179
           S+RIPSS CG+ G+K T  R  S     P   SVA  GP+A SV D A+ Y +M+G D  
Sbjct: 316 SIRIPSSMCGVVGIKPTFQRIPSAAADCP---SVAHVGPIAGSVRDAAIGYAIMSGGDET 372

Query: 180 D-PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXX 238
                + QP   LH F  T+ L D++IG +S +     +P I  A+   +  L+ RGA  
Sbjct: 373 SFLRGMTQPPVDLHSFEDTSSLKDVRIGYFSDYTNH-SSPEIAEAVTRTLKALETRGAEL 431

Query: 239 XXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYIVSQ 298
                       +AH +TI +E                     N++      A D++ +Q
Sbjct: 432 IETPLHHLTAIHVAHSITITSEFA------------------QNLDKFYERFAMDFLAAQ 473

Query: 299 QVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANF 358
           +VR   +R       ++VD  +TP+T ITAP+I   ALA GE++   + +I RF    N 
Sbjct: 474 RVRAFALRQFQENVLSKVDAFVTPSTGITAPEIPLEALAVGELNAAQLGNIFRFSVYGNL 533

Query: 359 AGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPSDKF 413
            GVP +SVP GYD   LP+ +QF    + E T+LR+A T+E +    +KKP   F
Sbjct: 534 IGVPGMSVPIGYDSRGLPMSIQFQTAHWQEDTMLRLAHTTENLYAKTQKKPQIYF 588



>gi|260790541|ref|XP_002590300.1| hypothetical protein BRAFLDRAFT_121360 [Branchiostoma floridae]
 gi|229275492|gb|EEN46311.1| hypothetical protein BRAFLDRAFT_121360 [Branchiostoma floridae]
          Length = 569

 Score =  261 bits (666), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 156/417 (37%), Positives = 222/417 (53%), Gaps = 30/417 (7%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           TERY NN+ L  LDG+P+ +K+E+ V  Y    GT  +    P+T D+T++ +LRE GA+
Sbjct: 175 TERYRNNAPLSPLDGVPVCIKEELAVVPYYHRSGTDCLGCDAPSTVDSTVVAKLREAGAV 234

Query: 61  ILGKTSMHEIGFGSTNNNP--FVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDG 118
           ILG  +MHE+G G T  NP     T RNPYN  ++               +CPIAIG D 
Sbjct: 235 ILGVANMHELGMGVTGCNPNKLHGTARNPYNPQHFTGGSSSGSASAVGAGICPIAIGTDA 294

Query: 119 GGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDP 178
           GGSVRIPS+ CG+ GLK                     GP+AASV D A+A+ + AG DP
Sbjct: 295 GGSVRIPSALCGVVGLK---------------------GPIAASVRDAAIAFALTAGPDP 333

Query: 179 KDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXX 238
           K P+ L+QP+  L     TN L+ +++GV   + +   N  I  A    I+ L+  GA  
Sbjct: 334 KYPHGLNQPIIDLENLDNTN-LTGIRVGVDWRYLRHSSN-CIVAACEKTIEHLENCGANI 391

Query: 239 XXXXXXXXXXARIAHLLTIGTEL-TTVAKRHKDKMHLFSCPTRSNINVMKLATASDYIVS 297
                     ARIAH   +  E+   +A+    +    + P+R  + +     A DYI +
Sbjct: 392 VDVQIPELEEARIAHTCIVVMEMAAAMAESFSKQYDNLTLPSRGLLAMRDTVPAFDYIQA 451

Query: 298 QQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLAN 357
            + RTR M  L  +F N+VD+I+TP T + AP+  P  L +G+      S +MR++ L N
Sbjct: 452 MKQRTRTMNFLKEIF-NKVDVIITPGTGVLAPRTNPGELTYGKAPDQKDSALMRYMFLGN 510

Query: 358 FAGVPAVSVPAGY-DDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPSDKF 413
            AG+PAV+VP GY  +NNLP+ LQ  A W+ E  +LR+A   E+  G +  KP   F
Sbjct: 511 LAGIPAVTVPIGYSSNNNLPMSLQVQAGWWQEGVMLRVAHAVEK--GTKHAKPQVHF 565



>gi|475582662|gb|EMT19196.1| Glutamyl-tRNA(Gln) amidotransferase subunit A [Aegilops tauschii]
          Length = 562

 Score =  260 bits (664), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 156/405 (38%), Positives = 216/405 (53%), Gaps = 8/405 (1%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+R+   S + +LDGI  AVKD+ID   Y +   T F +   P   DA  + RLR+ G I
Sbjct: 157 TKRFEKGSPISVLDGIFFAVKDDIDCLPYPSKSATTFFDEIRPVEKDAVAVSRLRKCGVI 216

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
            +GK +MHE+G G T NNP   T RNP++ D Y               LC  AIG DGGG
Sbjct: 217 FIGKANMHELGLGVTGNNPNYGTVRNPHSVDRYTGGSSSGPAALVSSGLCSGAIGTDGGG 276

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVRIPSS CGI GLKTT GR    G    A +V V+ P+ +SV+D  L Y  +AG  P D
Sbjct: 277 SVRIPSSLCGIVGLKTTFGRTDMTGVVCDAGTVEVASPLTSSVEDSVLLYSALAGSRPMD 336

Query: 181 PNTLHQPL---PTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLRGA 236
             TL   L   P L     +  L  +K+G Y+ W   V +  ++    + ++ L    G 
Sbjct: 337 KLTLRPSLLCVPNLVSSENSKILQSVKVGKYTEWFHDVPDNEVSNTCEDALNLLCSTFGC 396

Query: 237 XXXXXXXXXXXXARIAHLLTIGTELTTVAKRH--KDKMHLFSCPTRSNINVMKLATASDY 294
                        R AHL++IG+E  +    H    +    +  TR+++ + K  T++DY
Sbjct: 397 QIEEIILPELEEMRTAHLVSIGSEAFSDMNAHYQAGRRTEMTLDTRASLALFKSFTSADY 456

Query: 295 IVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQ 354
           + +Q +R RIM      F  +VD+I TP T +TAPKI P AL  GE D  + + +M+F+ 
Sbjct: 457 VAAQCLRRRIMYYHMEAF-KKVDVIATPTTGMTAPKIPPSAL-KGESDYVVSAKLMQFIF 514

Query: 355 LANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSE 399
             N  G+PA+SVP G+D   LPIGLQ I + + EA+LLR+A   E
Sbjct: 515 AGNLLGLPAISVPVGHDKQGLPIGLQLIGRPWGEASLLRVASAVE 559



>gi|297794035|ref|XP_002864902.1| N-acylethanolamine amidohydrolase [Arabidopsis lyrata subsp.
           lyrata]
 gi|297310737|gb|EFH41161.1| N-acylethanolamine amidohydrolase [Arabidopsis lyrata subsp.
           lyrata]
          Length = 607

 Score =  259 bits (662), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 152/418 (36%), Positives = 227/418 (54%), Gaps = 12/418 (2%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+R+   + + +LDGI + +KD+ID   + TN GT +++       D+ ++ +LR  GAI
Sbjct: 185 TQRFEQGNPISVLDGIFVTIKDDIDCLPHPTNGGTTWLHEDRSVEKDSAVVSKLRSCGAI 244

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           +LGK +MHE+G G+T NN    T RNP+++  Y               LC  A+G DGGG
Sbjct: 245 LLGKANMHELGMGTTGNNSNYGTTRNPHDSKRYTGGSSSGSAAIVAAGLCSAALGTDGGG 304

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVRIPS+ CGI GLKTT GR    G      +V + GP+A+S++D  L Y  + G    D
Sbjct: 305 SVRIPSALCGITGLKTTYGRTDMTGSLCEGGTVEIIGPLASSLEDAFLVYAAILGSSSAD 364

Query: 181 PNTLHQP---LPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELK-LRGA 236
              L       P L   + +N +  L++G Y+ W   V++  I+    + +  L    G 
Sbjct: 365 RFNLKPSPPCFPKLLSHNGSNAIGSLRLGKYTKWFNDVNSSDISDKCEDILKLLSNNHGC 424

Query: 237 XXXXXXXXXXXXARIAHLLTIG----TELTTVAKRHKDKMHLFSCPTRSNINVMKLATAS 292
                        R AH+++IG    + LT   +  K+    +   TR++  + +  +AS
Sbjct: 425 KVVEIVVPELEEMRAAHVISIGSATLSSLTPYCEAGKNSKLTYD--TRTSFAIFRSFSAS 482

Query: 293 DYIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRF 352
           DYI +Q +R R+M    N+F + VD+I+TP T +TAP I P AL +GE +  + +D+MRF
Sbjct: 483 DYITAQCLRRRLMEYHMNIFKD-VDVIVTPTTGMTAPVIPPDALKNGETNFQVTTDLMRF 541

Query: 353 VQLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
           V  AN  G PA+SVP GYD   LPIGLQ + + + EAT+L +A   EE L    KKP+
Sbjct: 542 VLAANLLGFPAISVPVGYDKEGLPIGLQIMGRPWAEATVLGLAAAVEE-LAPVTKKPA 598



>gi|460369383|ref|XP_004230542.1| PREDICTED: fatty acid amide hydrolase-like [Solanum lycopersicum]
          Length = 616

 Score =  258 bits (659), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 151/415 (36%), Positives = 229/415 (55%), Gaps = 7/415 (1%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+R+   + L +LDG  +A+KD+ID   + +   T +++     T DA  + RLR  G I
Sbjct: 193 TQRFEQGNPLSILDGTFMAIKDDIDCYPHPSKGATTWMHEVREVTKDAVSVSRLRSCGTI 252

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GK +MHE+G G+T NN    T RNP++ + Y               LC  A+G DGGG
Sbjct: 253 LVGKANMHELGLGTTGNNANYGTTRNPHDPERYTGGSSSGPAAIVASGLCSAALGTDGGG 312

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVRIPSS CG+ GLK+T GR    G      +V + GP+A +V+D  L Y  + G  P D
Sbjct: 313 SVRIPSSLCGVVGLKSTYGRTDMTGSLCDDGTVEIIGPIATTVEDTILVYAAILGPSPAD 372

Query: 181 PNTLHQPLPTLHGF---HVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR-GA 236
             +L   LP +  F     +  L  L++G Y+ W   V +  I+    N + +L  + G 
Sbjct: 373 RISLRPSLPCVPNFPSRESSRSLESLRLGKYTEWFNDVFSTDISDKCENVLSQLSEKHGC 432

Query: 237 XXXXXXXXXXXXARIAHLLTIGTE-LTTVAKRHKD-KMHLFSCPTRSNINVMKLATASDY 294
                        RIAH+++IG+E L ++     D +    +  TR+N+   +  TA+DY
Sbjct: 433 KTVEIVIPELHEMRIAHIVSIGSESLCSLNPDCGDGRGARLTYDTRTNLAFFRSFTAADY 492

Query: 295 IVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQ 354
           + +Q++R R+M     +F  +VD+I+TP T +TAP+I P AL  GE D+ +  ++MRF+ 
Sbjct: 493 VAAQRLRRRLMYFHMEIF-KKVDIIVTPTTGMTAPRIPPSALKVGETDLQVSGNLMRFII 551

Query: 355 LANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKP 409
            AN  G+PAV+VP GYD   LPIG+Q I + + EA++LR+A   EE     +KKP
Sbjct: 552 TANLLGLPAVTVPVGYDKQGLPIGMQLIGRPWCEASILRLAAAIEETCAEPKKKP 606



>gi|482548557|gb|EOA12751.1| hypothetical protein CARUB_v10028432mg [Capsella rubella]
          Length = 607

 Score =  258 bits (658), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 149/418 (35%), Positives = 228/418 (54%), Gaps = 12/418 (2%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+R+   + + +LDGI + +KD+ID   + TN GT +++       D+ ++ +LR  GAI
Sbjct: 185 TQRFEEGNPISVLDGIFVTIKDDIDCLPHPTNGGTTWLHEDRSVEKDSAVVSKLRSCGAI 244

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           +LGK +MHE+G G+T NN    T RNP++   Y               LC  A+G DGGG
Sbjct: 245 LLGKANMHELGMGTTGNNSNYGTTRNPHDPKRYTGGSSSGSAAIVASGLCSAALGTDGGG 304

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P++ CGI GLKTT GR    G      +V + GP+A+S++D  + Y  + G    D
Sbjct: 305 SVRVPAALCGITGLKTTYGRTDMTGSLCEGGTVEIIGPLASSLEDAFIVYAAILGSSSAD 364

Query: 181 PNTLHQP---LPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELK-LRGA 236
              L       P L  ++ +N +  L++G Y+ W   V++  I+    + +  L    G 
Sbjct: 365 RINLRPTPPCFPKLLSYNGSNAIGSLRLGKYTAWFNDVNSSDISDKCEDILKLLSNNHGC 424

Query: 237 XXXXXXXXXXXXARIAHLLTIGT----ELTTVAKRHKDKMHLFSCPTRSNINVMKLATAS 292
                        R AH+++IG+     LT   +  K+    +   TR++  + +  +AS
Sbjct: 425 KVVEIVVPELEEMRAAHVISIGSATLASLTPYCEAGKNSKLTYD--TRTSFAIFRSFSAS 482

Query: 293 DYIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRF 352
           DYI +Q +R R+M    N+F + VD+I+TPAT +TAP I P AL +GE ++ + ++IMRF
Sbjct: 483 DYIAAQCLRRRLMEFHMNIFKD-VDVIVTPATGMTAPVIRPDALKNGETNIQVTTNIMRF 541

Query: 353 VQLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
              AN  G PA+SVP GYD   LPIGLQ + + + EAT+L +A   EE L    KKP+
Sbjct: 542 ALAANLLGFPAISVPVGYDKEGLPIGLQIMGRPWAEATVLGLAAAVEE-LAPLTKKPA 598



>gi|462395702|gb|EMJ01501.1| hypothetical protein PRUPE_ppa003050mg [Prunus persica]
          Length = 608

 Score =  258 bits (658), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 149/419 (35%), Positives = 226/419 (53%), Gaps = 7/419 (1%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+R+   + L +LDGI +A+KD+ID   + +  GT +++       DA  + RLR  G I
Sbjct: 185 TKRFEEGNPLSILDGIFVAIKDDIDCFPHPSKGGTTWMHEVRTVKKDAVSVSRLRSCGVI 244

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
            +GK +MHE+G G+T NN    T RNP+  + Y               LC  A+G DGGG
Sbjct: 245 FVGKANMHELGMGTTGNNSNYGTARNPHAPERYTGGSSSGPAAIVASGLCSAALGTDGGG 304

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           S+RIPSS CG+ GLKTT GR    G    A +V + GP+A++V+D+ L Y  + G    D
Sbjct: 305 SIRIPSSLCGVVGLKTTYGRTDIGGSLCDAGTVEIIGPIASTVEDVMLVYSAILGTSLAD 364

Query: 181 PNTLHQPLPTLHGFHVT---NKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLRGA 236
             +L+   P++         N L  L++G Y+ W   V +  I+    + ++ L K  G 
Sbjct: 365 RISLNPSPPSVPNLSFNDSLNSLGSLRLGKYTAWFNDVYSTDISDKCEDALNLLSKTHGC 424

Query: 237 XXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMH--LFSCPTRSNINVMKLATASDY 294
                        R AHL++IG+E  +    + +  H    S  TR+++ + +  +ASDY
Sbjct: 425 EMVEIVIPELHEMRTAHLVSIGSECLSSLNPYCEDGHGARLSYDTRTSMALFRSFSASDY 484

Query: 295 IVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQ 354
           + +Q +R RIM     +F  +VD+I+TP T +TAP I   AL  GE D+ +   +MRFV 
Sbjct: 485 VAAQCLRRRIMYHHMEIF-KKVDVIVTPTTGMTAPIIPLSALKDGETDMQVTGYLMRFVI 543

Query: 355 LANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPSDKF 413
             N  G+PA+S+P GYD   LPIGLQ I + + EA++LR+A   EE+    + +P+  F
Sbjct: 544 AGNLLGLPAISIPVGYDKQGLPIGLQLIGRPWGEASILRLALAIEELSAKSKNRPASFF 602



>gi|10178225|dbj|BAB11605.1| unnamed protein product [Arabidopsis thaliana]
          Length = 607

 Score =  258 bits (658), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 153/418 (36%), Positives = 225/418 (53%), Gaps = 12/418 (2%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T R+   + + +LDGI + +KD+ID   + TN GT +++       D+ ++ +LR  GAI
Sbjct: 185 TRRFEQGNPISVLDGIFVTIKDDIDCLPHPTNGGTTWLHEDRSVEKDSAVVSKLRSCGAI 244

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           +LGK +MHE+G G+T NN    T RNP++   Y               LC  A+G DGGG
Sbjct: 245 LLGKANMHELGMGTTGNNSNYGTTRNPHDPKRYTGGSSSGSAAIVAAGLCSAALGTDGGG 304

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVRIPS+ CGI GLKTT GR    G      +V + GP+A+S++D  L Y  + G    D
Sbjct: 305 SVRIPSALCGITGLKTTYGRTDMTGSLCEGGTVEIIGPLASSLEDAFLVYAAILGSSSAD 364

Query: 181 PNTLHQP---LPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELK-LRGA 236
              L       P L   + +N +  L++G Y+ W   V +  I+    + +  L    G 
Sbjct: 365 RYNLKPSPPCFPKLLSHNGSNAIGSLRLGKYTKWFNDVSSSDISDKCEDILKLLSNNHGC 424

Query: 237 XXXXXXXXXXXXARIAHLLTIG----TELTTVAKRHKDKMHLFSCPTRSNINVMKLATAS 292
                        R AH+++IG    + LT   +  K+     S  TR++  + +  +AS
Sbjct: 425 KVVEIVVPELEEMRAAHVISIGSPTLSSLTPYCEAGKNSK--LSYDTRTSFAIFRSFSAS 482

Query: 293 DYIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRF 352
           DYI +Q +R R+M    N+F + VD+I+TP T +TAP I P AL +GE ++ + +D+MRF
Sbjct: 483 DYIAAQCLRRRLMEYHLNIFKD-VDVIVTPTTGMTAPVIPPDALKNGETNIQVTTDLMRF 541

Query: 353 VQLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
           V  AN  G PA+SVP GYD   LPIGLQ + + + EAT+L +A   EE L    KKP+
Sbjct: 542 VLAANLLGFPAISVPVGYDKEGLPIGLQIMGRPWAEATVLGLAAAVEE-LAPVTKKPA 598



>gi|425770617|gb|EKV09085.1| N-acylethanolamine amidohydrolase, putative [Penicillium digitatum
           Pd1]
 gi|425771923|gb|EKV10351.1| N-acylethanolamine amidohydrolase, putative [Penicillium digitatum
           PHI26]
          Length = 611

 Score =  258 bits (658), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 163/415 (39%), Positives = 229/415 (55%), Gaps = 24/415 (5%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           TERY N  SLG LDG+P+AVKDE+ + GY+  +G+K +++ N   + +  +++    GAI
Sbjct: 167 TERYKNGQSLGPLDGVPVAVKDEVHLTGYKRTLGSK-MDFKNGIDATSWCVKQWLAAGAI 225

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           I+GKTSMHEIG  + NNNP   TPRNP+N +YY               L PIA+G DGGG
Sbjct: 226 IIGKTSMHEIGLDTNNNNPNFGTPRNPHNKEYYCGGSSGGSGYAVGAGLVPIALGADGGG 285

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDP-- 178
           S+RIPSSFCGI+GLK + GR S      LA +V V GPMAAS+DDLAL+Y +MA   P  
Sbjct: 286 SIRIPSSFCGIWGLKPSHGRVSGAPSQSLAPTVGVIGPMAASIDDLALSYRIMATPAPAS 345

Query: 179 KDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXX 238
           +DP +   P PT     V    +   IG+   WN + ++P +  AL+  +D  + +G   
Sbjct: 346 EDPISSQFPYPTPPHPEVKRTKT---IGIVRDWNDRAEDP-VRAALDRALDYYREQGYKI 401

Query: 239 XXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINV-MKLATASDYIVS 297
                      + AH LTI  E+ +       K+   + P +  +++ M   TA D + S
Sbjct: 402 VDITIPYLPEGQRAHALTIMAEIASGVD--ASKIRQLTAPNKVLVSMGMYQITAQDLLAS 459

Query: 298 QQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIYPRALAHGEVDVTM-ISDI------ 349
           Q++R  +M  L +LF      LI++P T I    I       GE D++  +SD       
Sbjct: 460 QRLRNLLMTHLAHLFKTFPGLLIVSPTTPIPGWHI-----DGGEADLSRGLSDAQSSVRN 514

Query: 350 MRFVQLANFAGVPAVSVPAGY-DDNNLPIGLQFIAKWYDEATLLRIAKTSEEILG 403
           M +V LANF G PA+S PAGY  D+ +PIGL  +++W  E  L   A+  E ILG
Sbjct: 515 MEYVWLANFTGCPAISCPAGYAPDSGVPIGLMAMSEWGTEEELFAFARDGEPILG 569



>gi|186532737|ref|NP_201249.2| fatty acid amide hydrolase [Arabidopsis thaliana]
 gi|75142814|sp|Q7XJJ7.1|FAAH_ARATH RecName: Full=Fatty acid amide hydrolase; AltName:
           Full=N-acylethanolamine amidohydrolase
 gi|32454719|gb|AAP83139.1| N-acylethanolamine amidohydrolase [Arabidopsis thaliana]
 gi|332010510|gb|AED97893.1| fatty acid amide hydrolase [Arabidopsis thaliana]
          Length = 607

 Score =  257 bits (657), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 153/418 (36%), Positives = 225/418 (53%), Gaps = 12/418 (2%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T R+   + + +LDGI + +KD+ID   + TN GT +++       D+ ++ +LR  GAI
Sbjct: 185 TRRFEQGNPISVLDGIFVTIKDDIDCLPHPTNGGTTWLHEDRSVEKDSAVVSKLRSCGAI 244

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           +LGK +MHE+G G+T NN    T RNP++   Y               LC  A+G DGGG
Sbjct: 245 LLGKANMHELGMGTTGNNSNYGTTRNPHDPKRYTGGSSSGSAAIVAAGLCSAALGTDGGG 304

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVRIPS+ CGI GLKTT GR    G      +V + GP+A+S++D  L Y  + G    D
Sbjct: 305 SVRIPSALCGITGLKTTYGRTDMTGSLCEGGTVEIIGPLASSLEDAFLVYAAILGSSSAD 364

Query: 181 PNTLHQP---LPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELK-LRGA 236
              L       P L   + +N +  L++G Y+ W   V +  I+    + +  L    G 
Sbjct: 365 RYNLKPSPPCFPKLLSHNGSNAIGSLRLGKYTKWFNDVSSSDISDKCEDILKLLSNNHGC 424

Query: 237 XXXXXXXXXXXXARIAHLLTIG----TELTTVAKRHKDKMHLFSCPTRSNINVMKLATAS 292
                        R AH+++IG    + LT   +  K+     S  TR++  + +  +AS
Sbjct: 425 KVVEIVVPELEEMRAAHVISIGSPTLSSLTPYCEAGKNSK--LSYDTRTSFAIFRSFSAS 482

Query: 293 DYIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRF 352
           DYI +Q +R R+M    N+F + VD+I+TP T +TAP I P AL +GE ++ + +D+MRF
Sbjct: 483 DYIAAQCLRRRLMEYHLNIFKD-VDVIVTPTTGMTAPVIPPDALKNGETNIQVTTDLMRF 541

Query: 353 VQLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
           V  AN  G PA+SVP GYD   LPIGLQ + + + EAT+L +A   EE L    KKP+
Sbjct: 542 VLAANLLGFPAISVPVGYDKEGLPIGLQIMGRPWAEATVLGLAAAVEE-LAPVTKKPA 598



>gi|508700813|gb|EOX92709.1| Fatty acid amide hydrolase [Theobroma cacao]
          Length = 609

 Score =  256 bits (655), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 146/414 (35%), Positives = 218/414 (52%), Gaps = 9/414 (2%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY     +  LDG+PIA+KDEID   Y T  GTK+++   P   DA  + RLR  GAI
Sbjct: 192 TLRYERGEPISALDGVPIAIKDEIDCSPYPTTGGTKWLHKVRPCKGDACCVMRLRSCGAI 251

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           I+GKT+MHE+G G++  NP     RNPY+ +                 LCP+A+G DGGG
Sbjct: 252 IVGKTNMHELGAGTSGINPHYGAARNPYDPNKITGGSSSGSAAVVSAGLCPVALGVDGGG 311

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P+S CG+ G K T GR    G  PL  +V + G +A +++D  + Y  + G+ P +
Sbjct: 312 SVRMPASLCGVVGFKPTFGRIPHSGVLPLNWTVGMVGILAGTLEDAFIVYAAINGQLPSN 371

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNP---AITTALNNFIDELKLRGAX 237
             T   P       + TN +SD+K   Y  W     +      + AL+   +  K +   
Sbjct: 372 QPTTLPPKAYFPLLNSTNLISDIKFARYGEWFNDCSDEIRICCSNALHLLCERYKWK--- 428

Query: 238 XXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHL--FSCPTRSNINVMKLATASDYI 295
                       R+AH +TIG+E +T    H +K+         R  ++V     + +Y+
Sbjct: 429 TVEVTIPEIEAMRLAHYMTIGSECSTSLSSHLEKLDFAELGWDARVALSVYGAFNSKEYL 488

Query: 296 VSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQL 355
            +Q++R R M+  NN+F+ + D+I+ P T +TA  I+  AL  GE+D    + ++R+   
Sbjct: 489 KAQKIRNRQMQIHNNIFA-EADVIVAPTTGVTAYSIFDDALKTGELDYINGAALVRYQIA 547

Query: 356 ANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKP 409
            NF G+PAV+VP GYD   LPIGLQFI K + E TL+ IA   + +  +  +KP
Sbjct: 548 GNFLGLPAVTVPVGYDKAGLPIGLQFIGKPWSEPTLMHIAFAMQALSISDYRKP 601



>gi|303317760|ref|XP_003068882.1| Amidase family protein [Coccidioides posadasii C735 delta SOWgp]
 gi|240108563|gb|EER26737.1| Amidase family protein [Coccidioides posadasii C735 delta SOWgp]
          Length = 602

 Score =  256 bits (654), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 153/409 (37%), Positives = 226/409 (55%), Gaps = 15/409 (3%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY N +SLG +DG+P+AVKDE+D+ GY+  VGTK ++Y N +   +  +++  E GAI
Sbjct: 148 TARYKNGTSLGPMDGVPVAVKDEVDIDGYKRTVGTK-LDYTNKSGGTSWCVKKWEEAGAI 206

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKT+MHE+G  ++NNNP   TPRNP+N +YY               + PIA+G DGGG
Sbjct: 207 VIGKTTMHELGLDTSNNNPNFGTPRNPHNPNYYTGGSSGGSGYAVGAGIVPIALGADGGG 266

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           S+RIPSSFCGIYGLKTT GR S      LA +  V GPM +S+DDL ++Y +M+  DP  
Sbjct: 267 SIRIPSSFCGIYGLKTTHGRVSGSPTRGLATTTGVFGPMTSSLDDLDMSYRIMSSPDPDH 326

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLK-IGVYSMWNKQVDNPAITTALNNFIDELKL-RGAXX 238
             +   P P       T   +  K IGVY  W K+ D PA+ +  N  +D  +  +    
Sbjct: 327 VTSSSFPDPA----SATAATARPKIIGVYQEWVKRSD-PAVLSLFNRAMDYYRTQQNYEI 381

Query: 239 XXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVM-KLATASDYIVS 297
                      + AH LTI +E+ +     K+++   S P R  ++      +A D+  +
Sbjct: 382 IDITIPYIPQGQKAHALTILSEIAS--GISKEEISQLSAPNRVLVSSGNSQVSARDFFAA 439

Query: 298 QQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYPRA--LAHGEVDVTMISDIMRFVQ 354
           Q++R+ +M  L  LF     +++ TP   I   +I P    L HG  DV      M +V 
Sbjct: 440 QKLRSLLMSHLAFLFKKYPGMVIATPTLPIAGWQISPGGADLTHGVSDVNTSLRTMEYVY 499

Query: 355 LANFAGVPAVSVPAGY-DDNNLPIGLQFIAKWYDEATLLRIAKTSEEIL 402
           LANF+G PA+S P GY +D+ LP+G+  +++W  E  L+   +  E +L
Sbjct: 500 LANFSGCPAISCPMGYAEDSKLPVGIMGMSEWGSEWALIEWGRDGEGML 548



>gi|8163875|gb|AAF73891.1|AF223949_1 amidase [Arabidopsis thaliana]
          Length = 607

 Score =  256 bits (654), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 153/418 (36%), Positives = 224/418 (53%), Gaps = 12/418 (2%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T R+   + + +LDGI + +KD+ID   + TN GT +++       D+ ++ +LR  GAI
Sbjct: 185 TRRFEQGNPISVLDGIFVTIKDDIDCLPHPTNGGTTWLHEDRSVEKDSAVVSKLRSCGAI 244

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           +LGK +MHE+G G+T NN    T RNP++   Y               LC  A+G DGGG
Sbjct: 245 LLGKANMHELGMGTTGNNSNYGTTRNPHDPKRYTGGSSSGSAAIVAAGLCSAALGTDGGG 304

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVRIPS+ CGI GLKTT GR    G      +V + GP+A+S++D  L Y  + G    D
Sbjct: 305 SVRIPSALCGITGLKTTYGRTDMTGSLCEGGTVEIIGPLASSLEDAFLVYAAILGSSSAD 364

Query: 181 PNTLHQP---LPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELK-LRGA 236
              L       P L   + +N +  L++G Y+ W   V +  I+    + +  L    G 
Sbjct: 365 RYNLKPSPPCFPKLLSHNGSNAIGSLRLGKYTKWFNDVSSSDISDKCEDILKLLSNNHGC 424

Query: 237 XXXXXXXXXXXXARIAHLLTIG----TELTTVAKRHKDKMHLFSCPTRSNINVMKLATAS 292
                        R AH+++IG    + LT   +  K+     S  TR++  + +  +AS
Sbjct: 425 KVVEIVVPELEEMRAAHVISIGSPTLSSLTPYCEAGKNSK--LSYDTRTSFAIFRSFSAS 482

Query: 293 DYIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRF 352
           DYI +Q +R R+M    N+F + VD+I+TP T +TAP I P AL +GE ++ + +D+MRF
Sbjct: 483 DYIAAQCLRRRLMEYHLNIFKD-VDVIVTPTTGMTAPVIPPDALKNGETNIQVTTDLMRF 541

Query: 353 VQLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
           V  AN  G PA+SVP GYD   LPIGLQ   + + EAT+L +A   EE L    KKP+
Sbjct: 542 VLAANLLGFPAISVPVGYDKEGLPIGLQIRGRPWAEATVLGLAAAVEE-LAPVTKKPA 598



>gi|119186459|ref|XP_001243836.1| hypothetical protein CIMG_03277 [Coccidioides immitis RS]
 gi|392870553|gb|EAS32362.2| N-acylethanolamine amidohydrolase [Coccidioides immitis RS]
          Length = 620

 Score =  256 bits (653), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 153/409 (37%), Positives = 224/409 (54%), Gaps = 15/409 (3%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY N +SLG +DG+P+AVKDE+D+ GY+  VGTK ++Y N +   +  +++  E GAI
Sbjct: 166 TARYKNGTSLGPMDGVPVAVKDEVDIDGYKRTVGTK-LDYTNKSGGTSWCVKKWEEAGAI 224

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKT+MHE+G  ++NNNP   TPRNP+N +YY               + PIA+G DGGG
Sbjct: 225 VIGKTTMHELGLDTSNNNPNFGTPRNPHNPNYYTGGSSGGSGYAVGAGIVPIALGADGGG 284

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           S+RIPSSFCGIYGLKTT GR S      LA +  V GPM +S+DDL ++Y +M+  DP  
Sbjct: 285 SIRIPSSFCGIYGLKTTHGRVSGSPTRGLATTTGVFGPMTSSLDDLDMSYRIMSSPDPDH 344

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLK-IGVYSMWNKQVDNPAITTALNNFIDELKL-RGAXX 238
             +   P P       T   +  K IGVY  W K+ D PA+ +  N  +D  +  +    
Sbjct: 345 VTSSSFPDPA----SATAATARPKIIGVYQEWVKRSD-PAVLSLFNRAMDYYRTQQNYEI 399

Query: 239 XXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVM-KLATASDYIVS 297
                      + AH LTI +E+ +     K+ +   S P R  ++      +A D+  +
Sbjct: 400 IDITIPYIPQGQKAHALTILSEIAS--GISKEDISQLSAPNRVLVSSGNSQVSARDFFAA 457

Query: 298 QQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYPRA--LAHGEVDVTMISDIMRFVQ 354
           Q++R+ +M  L  LF     +++ TP   I   +I P    L HG  DV      M +V 
Sbjct: 458 QKLRSLLMSHLAFLFKKYPGMVIATPTLPIAGWQISPGGADLTHGVSDVNTSLRTMEYVY 517

Query: 355 LANFAGVPAVSVPAGY-DDNNLPIGLQFIAKWYDEATLLRIAKTSEEIL 402
           LANF+G PA+S P GY +D  LP+G+  +++W  E  L+   +  E +L
Sbjct: 518 LANFSGCPAISCPMGYAEDTKLPVGIMGMSEWGSEWALIEWGRDGEGLL 566



>gi|348682927|gb|EGZ22743.1| hypothetical protein PHYSODRAFT_345911 [Phytophthora sojae]
          Length = 622

 Score =  255 bits (652), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 149/417 (35%), Positives = 217/417 (52%), Gaps = 11/417 (2%)

Query: 2   ERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYG-NPATSDATIIERLREKGAI 60
           ERYA    LG+LDG+P+A+KDE+ +KG+    GT F+ Y  + A  D   + RLR  GAI
Sbjct: 200 ERYARGKPLGVLDGVPVAIKDEVRIKGHRMFTGTSFLGYEEDVAVEDDPPVARLRAAGAI 259

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ILG T+MHE+G G T  N    T RNP+N   Y               L P+A+G DGGG
Sbjct: 260 ILGTTNMHEVGSGVTGYNMHYGTARNPHNPKCYTGGSSSGSAAAVAAGLVPLALGLDGGG 319

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAH---SVAVSGPMAASVDDLALAYYVMAGKD 177
           S+RIPS+ CG+ G+K T  R       P A    SVA  GP+A SV D A+ Y +M+G D
Sbjct: 320 SIRIPSALCGVVGIKPTFQRVP-----PAAADCPSVAHVGPIAGSVRDAAIGYAIMSGGD 374

Query: 178 PKD-PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGA 236
               P  + QP   LH F  T  L  ++IG +S +     +P I  A++  +  L+ RGA
Sbjct: 375 EASFPRGVTQPPVDLHSFEETASLKGVRIGYFSDYTNH-SSPEIAEAVSKALKALEARGA 433

Query: 237 XXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYIV 296
                          AH +TI +E +    ++ ++    S   +  +   +  TA D++ 
Sbjct: 434 ELVETPLHHLTAIHTAHSVTITSEFSQNLDKYYERYGELSPEVQLILTFGRSFTAMDFLA 493

Query: 297 SQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLA 356
           +Q+VR   +R       ++VD  +TP+T ITAP+I   AL  GE++   +  I RF    
Sbjct: 494 AQRVRAFALRQFQENVLSKVDAFVTPSTGITAPEIPLEALEVGELNAQQLGAIFRFCVYG 553

Query: 357 NFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPSDKF 413
           N  GVP V+VP G+D   +P+ +QF    + E T+LR+A  +E +    ++KP   F
Sbjct: 554 NLIGVPGVAVPIGHDSRGMPMSIQFQTGHWQEDTMLRLAHATEALYAKAQRKPQVYF 610



>gi|378730068|gb|EHY56527.1| amidase [Exophiala dermatitidis NIH/UT8656]
          Length = 598

 Score =  255 bits (652), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 159/424 (37%), Positives = 222/424 (52%), Gaps = 14/424 (3%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           TERY     L +LDG+P+AVKDE+ +KGY+  +GTK ++Y +P    A  +E+ +E GAI
Sbjct: 168 TERYRAGKPLSVLDGVPLAVKDEVHLKGYKRTLGTK-LDYSDPGDRTAWCVEKWQEAGAI 226

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           I+GKT+MHE+G  +TNNNP   TP NP+N  YY               +CPIA+G DGGG
Sbjct: 227 IIGKTNMHEVGLDTTNNNPNWGTPLNPHNNGYYTGGSSGGSAFVVASGICPIALGVDGGG 286

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           S+R+PS+FCGIYGLKTT GR S    +    SV V+GPMA+S+DDLAL Y +MA  DP  
Sbjct: 287 SIRLPSAFCGIYGLKTTHGRVSSRVDFEKTDSVVVNGPMASSIDDLALGYRIMAQPDPLT 346

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKI-GVYSMWNKQVDNPAITTALNNFIDE-LKLRGAXX 238
             +   P   +    ++      K+ G+   W  + D P +    N  +D  ++  G   
Sbjct: 347 SRSSRFPTSLISEASLSEIPKGRKVLGLDRDWINRAD-PEVLDMFNAAVDHYVRNLGYEA 405

Query: 239 XXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVM-KLATASDYIVS 297
                      + AH LTI +E  + ++     +   S   +  +NV    ATA D+I +
Sbjct: 406 VDISIPYLPQGQKAHALTILSE--SRSQHSAANIKHLSWHNQLLLNVAGSHATAQDFIFA 463

Query: 298 QQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIYPRA---LAHGEVDVTMISDIMRFV 353
           Q++R  +M  L  L+      L+L+P T     KI         +G  D       M +V
Sbjct: 464 QKMRNLLMCHLAWLWEQYPGLLLLSPTTPCAGWKIEKPGDITSGYGVSDGDQSLRAMEYV 523

Query: 354 QLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEIL---GNRRKKPS 410
            LANF G PA+S P GY D NLP+GL  + +W  E  LL   K  E +L   G  R+   
Sbjct: 524 YLANFTGAPAISCPMGYTDANLPVGLMAMGEWGSEEQLLAFGKEGEALLAGEGGIRRPKG 583

Query: 411 DKFW 414
           DK W
Sbjct: 584 DKMW 587



>gi|315043202|ref|XP_003170977.1| amidase [Arthroderma gypseum CBS 118893]
 gi|311344766|gb|EFR03969.1| amidase [Arthroderma gypseum CBS 118893]
          Length = 598

 Score =  255 bits (651), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 165/434 (38%), Positives = 236/434 (54%), Gaps = 21/434 (4%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+R+AN + LG +DGIP+AVKDE+D+ GY+  + +K     NP  + +  +++  E GAI
Sbjct: 167 TQRWANGTPLGPMDGIPVAVKDEVDIDGYDKYMSSKVNFTANPNFT-SWCVKKWEEAGAI 225

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKT MHEIG  +TNNNP V TPRNP+N  YY               + PIA+G DGGG
Sbjct: 226 VIGKTVMHEIGLDTTNNNPVVGTPRNPHNPGYYTGGSSGGSGYAVGAGVVPIALGADGGG 285

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           S+RIPS++CGIYGLKTT GR S      LA SV V GPMA+++DDLA+AY +M   DP +
Sbjct: 286 SIRIPSNYCGIYGLKTTHGRVSAAPSCRLATSVGVLGPMASNLDDLAMAYRIMGAPDPNN 345

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELK-LRGAXXX 239
           P +   P P L      +    + IGVY  W ++ D P +    N  ID  +  +G    
Sbjct: 346 PVSAAFPDPLLSIPSPASSRGKV-IGVYKDWVERSD-PEVLAMFNKAIDYYRDEQGYEIV 403

Query: 240 XXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKL-ATASDYIVSQ 298
                        H L+I  E+ +     K+++   S PT+  ++V      A DY  SQ
Sbjct: 404 DITIPYIPEGGKCHALSILNEIAS--GLTKEQISQLSAPTKILVSVGGTQGLAQDYFASQ 461

Query: 299 QVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYPRALAHGEVDVTM-ISD------IM 350
           ++R  +M  L+ LF     +I+ TP T     KI     + GE D+T  ISD       M
Sbjct: 462 RMRHLLMNHLSFLFQKYPGIIIATPTTPSAGSKI-----SQGEADLTHGISDNNSTLISM 516

Query: 351 RFVQLANFAGVPAVSVPAGY-DDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKP 409
            +V LANF G PA+S P GY D+ ++P+GL  + +W  E  L+  A+  E +LG +  K 
Sbjct: 517 EYVYLANFTGCPAISCPMGYADETSIPVGLMGMGEWGSEEALIEWARDGEGMLGGKGLKT 576

Query: 410 SDKFWFGNYVQEVS 423
            +K   G ++  +S
Sbjct: 577 PNKEKGGKWIDTIS 590



>gi|502139765|ref|XP_004503893.1| PREDICTED: fatty acid amide hydrolase-like isoform X1 [Cicer
           arietinum]
          Length = 610

 Score =  255 bits (651), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 151/423 (35%), Positives = 229/423 (54%), Gaps = 20/423 (4%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY     + +LDG+P+A+KDEID   Y T  GTK+++   P T DA  ++RLR  GAI
Sbjct: 192 TLRYKKGEPISVLDGVPVAIKDEIDCLPYPTTGGTKWLHKQRPCTDDACCVKRLRLCGAI 251

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKT+MHE+G G++  NP     RNPY+ +                 LCP+A+G DGGG
Sbjct: 252 LVGKTNMHELGAGTSGINPHYGAARNPYDANRIAGGSSSGSAAVVSAGLCPVALGVDGGG 311

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P++ CG+ GLK T  R S +G  PL  +V + G +A +V+D  + Y  ++G+ P  
Sbjct: 312 SVRMPAALCGVVGLKPTFDRISHEGVIPLNWTVGMVGILAGTVEDSLITYAAISGEIPS- 370

Query: 181 PNTLHQP--------LPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELK 232
               HQP        LP L    +T  +S++K+  Y  W     +  +    ++ + +L+
Sbjct: 371 ----HQPSSIPAKINLPLL---SLTKSISNIKLAKYDKWFDDCSD-DVRICCSHALSKLQ 422

Query: 233 -LRGAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDK-MHLFSCPTRSNINVMKLAT 290
              G              R+AH LTIG+E +T      DK +  F    R  +N+    +
Sbjct: 423 GCYGWKIVDVTIPEIEVMRLAHYLTIGSECSTSLDSFLDKNLTEFGWDARVALNIYGAFS 482

Query: 291 ASDYIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIM 350
           + +YI +Q++R R ++    +FS + D+I++P T +TA  I   AL  GE+D    + ++
Sbjct: 483 SMEYIKAQKIRNRQLQFHKKIFS-EADVIVSPTTGVTAYPIQDDALKTGELDYVNGAALI 541

Query: 351 RFVQLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
           R+    NF G+PAV+VP GYD   LPIGLQFI + + EATL+ +A   + I     KKPS
Sbjct: 542 RYSISGNFLGLPAVTVPVGYDKLGLPIGLQFIGRPWAEATLIHLAFAMQAICLPEHKKPS 601

Query: 411 DKF 413
             F
Sbjct: 602 IFF 604



>gi|502139767|ref|XP_004503894.1| PREDICTED: fatty acid amide hydrolase-like isoform X2 [Cicer
           arietinum]
          Length = 609

 Score =  254 bits (650), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 151/423 (35%), Positives = 229/423 (54%), Gaps = 20/423 (4%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY     + +LDG+P+A+KDEID   Y T  GTK+++   P T DA  ++RLR  GAI
Sbjct: 191 TLRYKKGEPISVLDGVPVAIKDEIDCLPYPTTGGTKWLHKQRPCTDDACCVKRLRLCGAI 250

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKT+MHE+G G++  NP     RNPY+ +                 LCP+A+G DGGG
Sbjct: 251 LVGKTNMHELGAGTSGINPHYGAARNPYDANRIAGGSSSGSAAVVSAGLCPVALGVDGGG 310

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P++ CG+ GLK T  R S +G  PL  +V + G +A +V+D  + Y  ++G+ P  
Sbjct: 311 SVRMPAALCGVVGLKPTFDRISHEGVIPLNWTVGMVGILAGTVEDSLITYAAISGEIPS- 369

Query: 181 PNTLHQP--------LPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELK 232
               HQP        LP L    +T  +S++K+  Y  W     +  +    ++ + +L+
Sbjct: 370 ----HQPSSIPAKINLPLL---SLTKSISNIKLAKYDKWFDDCSD-DVRICCSHALSKLQ 421

Query: 233 -LRGAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDK-MHLFSCPTRSNINVMKLAT 290
              G              R+AH LTIG+E +T      DK +  F    R  +N+    +
Sbjct: 422 GCYGWKIVDVTIPEIEVMRLAHYLTIGSECSTSLDSFLDKNLTEFGWDARVALNIYGAFS 481

Query: 291 ASDYIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIM 350
           + +YI +Q++R R ++    +FS + D+I++P T +TA  I   AL  GE+D    + ++
Sbjct: 482 SMEYIKAQKIRNRQLQFHKKIFS-EADVIVSPTTGVTAYPIQDDALKTGELDYVNGAALI 540

Query: 351 RFVQLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
           R+    NF G+PAV+VP GYD   LPIGLQFI + + EATL+ +A   + I     KKPS
Sbjct: 541 RYSISGNFLGLPAVTVPVGYDKLGLPIGLQFIGRPWAEATLIHLAFAMQAICLPEHKKPS 600

Query: 411 DKF 413
             F
Sbjct: 601 IFF 603



>gi|470148351|ref|XP_004309731.1| PREDICTED: fatty acid amide hydrolase-like [Fragaria vesca subsp.
           vesca]
          Length = 613

 Score =  254 bits (648), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 152/415 (36%), Positives = 218/415 (52%), Gaps = 10/415 (2%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY     +  LDGIPIAVKDEID + Y T  GTK+++   P T DA  ++ LR+ GAI
Sbjct: 192 TLRYEKGVPISALDGIPIAVKDEIDCRPYPTTGGTKWLHKFRPCTDDACCVKCLRQCGAI 251

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKT+MHE+G G++  NP     RNP++                   LCP+A+G DGGG
Sbjct: 252 LIGKTNMHELGAGTSGINPHYGATRNPHDPRRISGGSSSGSAAVVASGLCPVALGVDGGG 311

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P++ CG+ GLK T GR    G  PL  +V + G +A +V+D  + Y  + G+ P  
Sbjct: 312 SVRMPAALCGVVGLKPTFGRVPHSGVLPLNWTVGMVGILAGTVEDALIVYAAIIGQLPSS 371

Query: 181 PNTLHQPL--PTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLRGAX 237
            +TL   +  P L        + D+K   Y  W     +  I    NN +D L K  G  
Sbjct: 372 QSTLSSKVYFPLLDS---KKPILDIKFAKYGEWFNDCSD-DIRECCNNALDRLHKQYGWK 427

Query: 238 XXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHL--FSCPTRSNINVMKLATASDYI 295
                       R+AH LTIG+E +T    H +K+         R  + V    ++ DYI
Sbjct: 428 TVEVTIPEIEVMRLAHYLTIGSECSTSLSPHLEKLDFKELGWDVRVALAVYGAFSSKDYI 487

Query: 296 VSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQL 355
            +Q++R R M+   NLFS Q D+I++P   +TA  I   AL  GE+D    + ++R+   
Sbjct: 488 QAQRIRNRQMQFHKNLFS-QADVIVSPTVGVTAYPILDDALKTGELDYINGAALVRYSIS 546

Query: 356 ANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
            NF G+PAV++P GYD + LPIGLQ I K + E TL+ IA   + +     +KP 
Sbjct: 547 GNFLGLPAVTIPVGYDKSGLPIGLQLIGKPWSEPTLIHIAFAVQNLYVGDGRKPQ 601



>gi|169767442|ref|XP_001818192.1| N-acylethanolamine amidohydrolase [Aspergillus oryzae RIB40]
 gi|83766047|dbj|BAE56190.1| unnamed protein product [Aspergillus oryzae RIB40]
 gi|391871907|gb|EIT81056.1| amidase [Aspergillus oryzae 3.042]
          Length = 609

 Score =  253 bits (647), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 157/410 (38%), Positives = 226/410 (55%), Gaps = 14/410 (3%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+RY +   LG LDGIP+ VKDE+ ++GY   +G+K +++    T  +  +++  E GAI
Sbjct: 167 TKRYKDGKPLGPLDGIPVVVKDEVHIEGYRRTLGSK-LDFTGEFTGTSWCVKKWEEAGAI 225

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           I+GKT+MHE+G  + NNNP   TPRNP+N +YY               L PIA+G DGGG
Sbjct: 226 IVGKTTMHELGLDTNNNNPNHGTPRNPHNRNYYCGGSSGGSGYAVGAGLAPIALGADGGG 285

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDP-- 178
           S+RIPSSFCGI+GLK + GR S      LA +V V GPMAAS+DDLALAY +MA   P  
Sbjct: 286 SIRIPSSFCGIWGLKPSHGRISGTPTVSLAQTVGVYGPMAASIDDLALAYRIMAAPAPAE 345

Query: 179 KDPN--TLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGA 236
           +DP+  +   PL TL  +  ++K     IG+   W  + + P +    +  +D  + +G 
Sbjct: 346 QDPSSASFPDPLTTLQVW--SSKPRTKTIGIARDWIDRAE-PPVRAVFDRALDFYRKQGY 402

Query: 237 XXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINV-MKLATASDYI 295
                        + AH+LTI TE+ +      D++   S P +  +++ M   +  D++
Sbjct: 403 EVIDITIPYLPEGQRAHILTIMTEIASGLT--PDQVGKLSAPNKVLVSMGMWQISGQDFL 460

Query: 296 VSQQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIYPRA-LAHGEVDVTMISDIMRFV 353
            SQ++R+ IM  L  LF      LILTP T I   +I   A L+ G  D       M +V
Sbjct: 461 ASQRLRSIIMSHLAYLFGKHPGLLILTPTTPIPGWRINGEADLSRGLSDGKSSVRNMEYV 520

Query: 354 QLANFAGVPAVSVPAGY-DDNNLPIGLQFIAKWYDEATLLRIAKTSEEIL 402
            LANF G PA++ PAGY  D  +P+GL  + +W  E  L+  A+  E IL
Sbjct: 521 WLANFTGCPAINCPAGYVQDTRVPVGLMAMGEWGTEEDLIAFARDGEAIL 570



>gi|296808397|ref|XP_002844537.1| amidase [Arthroderma otae CBS 113480]
 gi|238844020|gb|EEQ33682.1| amidase [Arthroderma otae CBS 113480]
          Length = 600

 Score =  253 bits (646), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 164/434 (37%), Positives = 238/434 (54%), Gaps = 24/434 (5%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           TER+A  + LG +DGIP+AVKDE+D+ GY+  + +K IN+    +  +  +++  E GAI
Sbjct: 170 TERWAKGTPLGPMDGIPVAVKDEVDIDGYDKFMSSK-INFTPNPSFTSWCVKKWEEAGAI 228

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           I+GKT MHEIG  +TNNNP V TPRNP+N  YY               + PIA+G DGGG
Sbjct: 229 IIGKTVMHEIGLDTTNNNPVVGTPRNPHNPSYYTGGSSGGSGYVVSAGVVPIALGADGGG 288

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           S+RIPS++CGIYGLKTT GR S    + LA +V V GPMA+++DDLALAY +MA  DP +
Sbjct: 289 SIRIPSNYCGIYGLKTTHGRVSAAPSHRLATTVGVLGPMASNLDDLALAYRIMAAPDPSN 348

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLK-IGVYSMWNKQVDNPAITTALNNFIDELK-LRGAXX 238
             +   P P L   ++ +  S  K IGVY  W ++ D P +    N  ID  +  +    
Sbjct: 349 QVSATFPDPLL---NIQSSSSRPKVIGVYKEWVERSD-PEVLAMFNKAIDYYRDEKYYEI 404

Query: 239 XXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKL-ATASDYIVS 297
                         H +TI  E+ +     K+++   + PTR  I+V      A D+  S
Sbjct: 405 VDITIPYIPEGGKCHAITILNEIAS--GLTKEQISQLTAPTRIMISVGGTQGLAQDFFAS 462

Query: 298 QQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYPRALAHGEVDVTM-ISD------I 349
           Q++R  +M+ L+ LF     +++ TP T     KI     + GE D+T  ISD       
Sbjct: 463 QRMRNLLMKHLSFLFQKYPGIVIATPTTPTAGLKI-----SQGEADLTHGISDSNATLLS 517

Query: 350 MRFVQLANFAGVPAVSVPAGY-DDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKK 408
           M +V LANF G PA+S P GY D+ ++P+GL  + +W  E  L+   +  E +LG +  +
Sbjct: 518 MEYVYLANFTGCPAISCPMGYADETSVPVGLMGMGEWGSEEALMEWGRDGEGVLGGKGLR 577

Query: 409 PSDKFWFGNYVQEV 422
             DK   G ++  +
Sbjct: 578 TPDKEKGGKWIDAI 591



>gi|258563204|ref|XP_002582347.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237907854|gb|EEP82255.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 614

 Score =  252 bits (643), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 147/407 (36%), Positives = 231/407 (56%), Gaps = 12/407 (2%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY N + LG +DG+P+AVKDE+D+ GY+   GTK +++   +   +  +++  E GAI
Sbjct: 165 TARYKNGTPLGPMDGVPVAVKDEVDIAGYKCTSGTK-LDFTCKSGKTSWCVKKWEEAGAI 223

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKT+MHE+G  ++NNNP V TP+NP+N +YY               + PIA+G DGGG
Sbjct: 224 VIGKTTMHELGLDTSNNNPNVGTPKNPHNPNYYTGGSSGGSGYAVGAGIVPIALGADGGG 283

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           S+RIPSSFCGIYGLK+T GR S      LA +  V GPMA+S+DDL +AY++M+  DP  
Sbjct: 284 SIRIPSSFCGIYGLKSTHGRVSGAPTCALATTTGVLGPMASSLDDLEMAYHIMSSPDPDH 343

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKL-RGAXXX 239
             +   P P      V+++     IG+Y  W K+ + PA+ +  N  I+  +  +G    
Sbjct: 344 VTSSAFPDPA-SAIAVSDRPK--VIGIYQDWIKRSE-PAVLSLFNRAIEYYRTQQGYEIV 399

Query: 240 XXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVM-KLATASDYIVSQ 298
                     + AH LTI +E+ +     K+++   + P +  I+      T+ D++V+Q
Sbjct: 400 DITIPCIPQGQKAHALTILSEIASGIS--KEQLSHLTAPNKVLISCSNSQVTSKDFLVAQ 457

Query: 299 QVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYPRA-LAHGEVDVTMISDIMRFVQLA 356
           ++R  +M  L+ LF     +I+ TP   I   +I   + L+HG  DV      M +V LA
Sbjct: 458 KLRALLMAHLSFLFKKHPGMIIATPTLPIPGWQIGGESDLSHGISDVNTSLRTMEYVYLA 517

Query: 357 NFAGVPAVSVPAGY-DDNNLPIGLQFIAKWYDEATLLRIAKTSEEIL 402
           NF+G PA+S P GY +D+ +P+G+  +++W  E  L+   +  E +L
Sbjct: 518 NFSGCPAISCPMGYVEDSKMPVGIMGMSEWGSEWALIEWGRDGEGVL 564



>gi|302663156|ref|XP_003023224.1| glutamyl-tRNA(Gln) amidotransferase subunit A, putative
           [Trichophyton verrucosum HKI 0517]
 gi|291187210|gb|EFE42606.1| glutamyl-tRNA(Gln) amidotransferase subunit A, putative
           [Trichophyton verrucosum HKI 0517]
          Length = 598

 Score =  251 bits (642), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 161/433 (37%), Positives = 239/433 (55%), Gaps = 21/433 (4%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+R+AN + LG +DGIP+A+KDE+D+ GY+  + +K     NP+ + +  +++  E GAI
Sbjct: 167 TQRWANGTPLGPMDGIPVAIKDEVDIDGYDKYLSSKVDFTANPSFT-SWCVKKWEEAGAI 225

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKT MHEIG  +TNNNP V TP+NP+N  YY               + P+A+G DGGG
Sbjct: 226 VIGKTVMHEIGLDTTNNNPVVGTPKNPHNPGYYTGGSSGGSGYAVGAGIVPLALGADGGG 285

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           S+RIPS++CGIYGLKTT GR S      LA +V V GPMA+S+DDLA+ Y +M+  DP +
Sbjct: 286 SIRIPSNYCGIYGLKTTHGRVSSAPTRRLATTVGVFGPMASSIDDLAMGYRIMSAPDPSN 345

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELK-LRGAXXX 239
           P +   P P L     ++    + IGVY  W ++ D P +    N  ID  +  +G    
Sbjct: 346 PVSAAFPDPLLSIPSPSSSRGKV-IGVYKDWVERSD-PDVLAMFNKAIDYYRDEQGYQIV 403

Query: 240 XXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKL-ATASDYIVSQ 298
                        H L+I  E+++     K+++   S PTR  ++V      A DY  SQ
Sbjct: 404 DITIPYIPEGGKCHALSILNEISS--GLSKEQISQLSAPTRIIVSVGGTQGLAQDYFASQ 461

Query: 299 QVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYPRALAHGEVDVT-MISD------IM 350
           ++R  +M  L+ LF     +++ TP T     KI     + GE D+T  ISD       M
Sbjct: 462 RMRHLLMNHLSFLFQKYPGIVIATPTTPTAGSKI-----SGGEADLTNGISDSNATLRSM 516

Query: 351 RFVQLANFAGVPAVSVPAGYDDN-NLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKP 409
            +V LANF G PA+S P GYDD  ++P+GL  + +W  E  L+  A+  E +LG++  + 
Sbjct: 517 EYVYLANFTGCPAISCPMGYDDEPSVPVGLMGMGEWGSEEALMEWARDGEGMLGDKGLRA 576

Query: 410 SDKFWFGNYVQEV 422
            +K   G +V  +
Sbjct: 577 PNKEKGGKWVDAI 589



>gi|327295084|ref|XP_003232237.1| N-acylethanolamine amidohydrolase [Trichophyton rubrum CBS 118892]
 gi|326465409|gb|EGD90862.1| N-acylethanolamine amidohydrolase [Trichophyton rubrum CBS 118892]
          Length = 598

 Score =  250 bits (639), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 161/434 (37%), Positives = 240/434 (55%), Gaps = 21/434 (4%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+R+AN + LG +DGIP+A+KDE+D+ GY+  + +K     NP+ + +  +++  E GAI
Sbjct: 167 TQRWANGTPLGPMDGIPVAIKDEVDIDGYDKYLSSKVNFTANPSFT-SWCVKKWEEAGAI 225

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKT MHEIG  +TNNNP V TPRNP+N  YY               + P+A+G DGGG
Sbjct: 226 VIGKTVMHEIGLDTTNNNPVVGTPRNPHNPGYYTGGSSGGSGYAVGAGVVPLALGADGGG 285

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           S+RIPS++CGIYGLKTT GR S      LA +V V GPMA+S+DDLA+ Y +M+  DP +
Sbjct: 286 SIRIPSNYCGIYGLKTTHGRVSAAPTCRLATTVGVFGPMASSIDDLAMGYRIMSAPDPNN 345

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELK-LRGAXXX 239
           P +   P P L     ++    + IGVY  W ++  NP +    N  ID  +  +G    
Sbjct: 346 PVSAAFPDPLLSIPSPSSSRGKV-IGVYKDWVER-SNPDVLAMFNKAIDYYRDEQGYQIV 403

Query: 240 XXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKL-ATASDYIVSQ 298
                        H L+I  E+++     K+++   S PTR  ++V      A DY  SQ
Sbjct: 404 DITIPYIPEGGKCHALSILNEISS--GLTKEQISQLSAPTRIVVSVGGTQGLAQDYFASQ 461

Query: 299 QVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYPRALAHGEVDVT-MISD------IM 350
           ++R  +M  L+ LF     +++ TP T     KI     + GE D+T  ISD       M
Sbjct: 462 RMRHLLMNHLSFLFQKYPGIVIATPTTPTAGSKI-----SGGEADLTNGISDSNATLQSM 516

Query: 351 RFVQLANFAGVPAVSVPAGYDDN-NLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKP 409
            +V LANF G PA+S P GYDD  ++P+GL  + +W  E  L+  A+  E +LG++  + 
Sbjct: 517 EYVYLANFTGCPAISCPMGYDDEPSVPVGLMGMGEWGSEEALMEWARDGEGMLGDKGLRA 576

Query: 410 SDKFWFGNYVQEVS 423
            +K   G ++  ++
Sbjct: 577 PNKEKGGKWLDAIN 590



>gi|326481981|gb|EGE05991.1| amidase [Trichophyton equinum CBS 127.97]
          Length = 598

 Score =  250 bits (638), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 161/434 (37%), Positives = 239/434 (55%), Gaps = 21/434 (4%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+R+AN + LG +DGIP+A+KDE+D+ GY+  + +K     NP+ + +  +++  E GAI
Sbjct: 167 TQRWANGTPLGPMDGIPVAIKDEVDIDGYDKYLSSKVNFTANPSFT-SWCVKKWEEAGAI 225

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKT MHEIG  +TNNNP V TPRNP+N  YY               + P+A+G DGGG
Sbjct: 226 VIGKTVMHEIGLDTTNNNPVVGTPRNPHNPGYYTGGSSGGSGYAVGAGIVPLALGADGGG 285

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           S+RIPS++CGIYGLKTT GR S      LA +V V GPMA+++DDLA+ Y +M+  DP +
Sbjct: 286 SIRIPSNYCGIYGLKTTHGRVSAAPTRRLATTVGVFGPMASNIDDLAMGYRIMSAPDPNN 345

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELK-LRGAXXX 239
           P +   P P L     ++    + IGVY  W ++  NP +    N  ID  +  +G    
Sbjct: 346 PVSAAFPDPLLSVPSPSSSRGKV-IGVYKDWVER-SNPDVLAMFNKAIDYYRDEQGYEII 403

Query: 240 XXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKL-ATASDYIVSQ 298
                        H L+I  E+++     K ++   S PTR  ++V      A DY  SQ
Sbjct: 404 DITIPYIPEGGKCHALSILNEISS--GLTKKQISQLSAPTRIVVSVGGTQGLAQDYFASQ 461

Query: 299 QVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYPRALAHGEVDVT-MISD------IM 350
           ++R  +M  L+ LF     L++ TP T     KI     + GE D+T  ISD       M
Sbjct: 462 RMRHLLMNHLSFLFQKYPGLVIATPTTPTAGSKI-----SGGEADLTNGISDSNATLQSM 516

Query: 351 RFVQLANFAGVPAVSVPAGYDDN-NLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKP 409
            +V LANF G PA+S P GYDD  ++P+GL  + +W  E  L+  A+  E +LG++  + 
Sbjct: 517 EYVYLANFTGCPAISCPMGYDDEPSVPVGLMGMGEWGSEEALMEWARDGEGMLGDKGLRA 576

Query: 410 SDKFWFGNYVQEVS 423
            +K   G ++  ++
Sbjct: 577 PNKEKGGKWIDAIN 590



>gi|326473324|gb|EGD97333.1| N-acylethanolamine amidohydrolase [Trichophyton tonsurans CBS
           112818]
          Length = 574

 Score =  250 bits (638), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 161/434 (37%), Positives = 239/434 (55%), Gaps = 21/434 (4%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+R+AN + LG +DGIP+A+KDE+D+ GY+  + +K     NP+ + +  +++  E GAI
Sbjct: 143 TQRWANGTPLGPMDGIPVAIKDEVDIDGYDKYLSSKVNFTANPSFT-SWCVKKWEEAGAI 201

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKT MHEIG  +TNNNP V TPRNP+N  YY               + P+A+G DGGG
Sbjct: 202 VIGKTVMHEIGLDTTNNNPVVGTPRNPHNPGYYTGGSSGGSGYAVGAGIVPLALGADGGG 261

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           S+RIPS++CGIYGLKTT GR S      LA +V V GPMA+++DDLA+ Y +M+  DP +
Sbjct: 262 SIRIPSNYCGIYGLKTTHGRVSAAPTRRLATTVGVFGPMASNIDDLAMGYRIMSAPDPNN 321

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELK-LRGAXXX 239
           P +   P P L     ++    + IGVY  W ++  NP +    N  ID  +  +G    
Sbjct: 322 PVSAAFPDPLLSVPSPSSSRGKV-IGVYKDWVER-SNPDVLAMFNKAIDYYRDEQGYEII 379

Query: 240 XXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKL-ATASDYIVSQ 298
                        H L+I  E+++     K ++   S PTR  ++V      A DY  SQ
Sbjct: 380 DITIPYIPEGGKCHALSILNEISS--GLTKKQISQLSAPTRIVVSVGGTQGLAQDYFASQ 437

Query: 299 QVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYPRALAHGEVDVT-MISD------IM 350
           ++R  +M  L+ LF     L++ TP T     KI     + GE D+T  ISD       M
Sbjct: 438 RMRHLLMNHLSFLFQKYPGLVIATPTTPTAGSKI-----SGGEADLTNGISDSNATLQSM 492

Query: 351 RFVQLANFAGVPAVSVPAGYDDN-NLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKP 409
            +V LANF G PA+S P GYDD  ++P+GL  + +W  E  L+  A+  E +LG++  + 
Sbjct: 493 EYVYLANFTGCPAISCPMGYDDEPSVPVGLMGMGEWGSEEALMEWARDGEGMLGDKGLRA 552

Query: 410 SDKFWFGNYVQEVS 423
            +K   G ++  ++
Sbjct: 553 PNKQKGGKWIDAIN 566



>gi|255941748|ref|XP_002561643.1| Pc16g13440 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211586266|emb|CAP94014.1| Pc16g13440 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 611

 Score =  249 bits (636), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 161/421 (38%), Positives = 224/421 (53%), Gaps = 22/421 (5%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKF-INYGNPATSDATIIERLREKGA 59
           TERY    SLG LDG+P+AVKDE+ + GY+  +G+K    +G  ATS    +++  + GA
Sbjct: 167 TERYKKGKSLGPLDGVPVAVKDEVHLTGYKRTLGSKLDFKHGTDATS--WCVKQWLDAGA 224

Query: 60  IILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGG 119
           II+GKTSMHEIG  + NNNP   TPRNP+N +YY               L PIA+G DGG
Sbjct: 225 IIIGKTSMHEIGLDTNNNNPNYGTPRNPHNKEYYCGGSSGGSGYAVGAGLVPIALGADGG 284

Query: 120 GSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPK 179
           GS+RIPSSFCGI+GLK + GR S      LA +V V GPMAAS+DDLALAY +MA   P 
Sbjct: 285 GSIRIPSSFCGIWGLKPSHGRVSGAPSQSLAPTVGVIGPMAASIDDLALAYRIMATPAPP 344

Query: 180 DPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXXX 239
             + +    P     H   K +   IG+   W  + + P +   L+  +D  + +G    
Sbjct: 345 SEDPISSQFPYPAPPHPDTKRTK-TIGIVRDWIDRAEGP-VRAVLDRALDYYREQGYNVI 402

Query: 240 XXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINV-MKLATASDYIVSQ 298
                     + AH LTI  E+ +       K+   + P +  +++ M   TA D + SQ
Sbjct: 403 DIKIPYLPEGQRAHALTIMAEIASGVD--ASKIRQLTAPNKVLVSMGMYQITAQDLLASQ 460

Query: 299 QVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIYPRALAHGEVDVTM-ISDI------M 350
           ++R  +M  L +LF      LI++P T I    I       GE D++  +SD       M
Sbjct: 461 RLRNLLMTHLAHLFKAHPGMLIVSPTTPIPGWHI-----DGGEADLSRGLSDAKSSVRNM 515

Query: 351 RFVQLANFAGVPAVSVPAGYD-DNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKP 409
            +V LANF G PA+S PAGY+ D+ +PIG+  + +W  E  L+  A+  E IL      P
Sbjct: 516 EYVWLANFTGCPAISCPAGYNPDSGVPIGVMAMGEWGTEEDLIAFARDGEPILDLPSSGP 575

Query: 410 S 410
           S
Sbjct: 576 S 576



>gi|302499824|ref|XP_003011907.1| glutamyl-tRNA(Gln) amidotransferase subunit A, putative
           [Arthroderma benhamiae CBS 112371]
 gi|291175461|gb|EFE31267.1| glutamyl-tRNA(Gln) amidotransferase subunit A, putative
           [Arthroderma benhamiae CBS 112371]
          Length = 604

 Score =  249 bits (636), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 161/434 (37%), Positives = 240/434 (55%), Gaps = 21/434 (4%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+R+AN + LG +DGIP+A+KDE+D+ GY+  + +K     NP+ + +  +++  E GAI
Sbjct: 173 TQRWANGTPLGPMDGIPVAIKDEVDIDGYDKYLSSKVDFTANPSFT-SWCVKKWEEAGAI 231

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKT MHEIG  +TNNNP V TP+NP+N  YY               + P+A+G DGGG
Sbjct: 232 VIGKTVMHEIGLDTTNNNPVVGTPKNPHNPGYYTGGSSGGSGYAVGAGVVPLALGADGGG 291

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           S+RIPS++CGIYGLKTT GR S      LA +V V GPMA+++DDLA+ Y +M+  DP +
Sbjct: 292 SIRIPSNYCGIYGLKTTHGRVSAAPTRRLATTVGVFGPMASNIDDLAMGYRIMSAPDPSN 351

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELK-LRGAXXX 239
           P +   P P L     ++    + IGVY  W ++ D P +    N  ID  +  +G    
Sbjct: 352 PVSAAFPDPLLSIPPSSSSRGKV-IGVYKDWVERSD-PDVLAMFNKAIDYYRDEQGYQIV 409

Query: 240 XXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKL-ATASDYIVSQ 298
                        H L+I  E+++     K+++   S PTR  ++V      A DY  SQ
Sbjct: 410 DITIPYIPEGGKCHALSILNEISS--GLTKEQISQLSAPTRIIVSVGGTQGLAQDYFASQ 467

Query: 299 QVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYPRALAHGEVDVT-MISD------IM 350
           ++R  +M  L+ LF     +I+ TP T     KI     + GE D+T  ISD       M
Sbjct: 468 RMRHLLMNHLSFLFQKYPGIIIATPTTPTAGSKI-----SGGEADLTNGISDSNATLRSM 522

Query: 351 RFVQLANFAGVPAVSVPAGYDDN-NLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKP 409
            +V LANF G PA+S P GYDD  ++P+GL  + +W  E  L+  A+  E +LG++  + 
Sbjct: 523 EYVYLANFTGCPAISCPMGYDDEPSVPVGLMGMGEWGSEEALMEWARDGEGMLGDKGLRA 582

Query: 410 SDKFWFGNYVQEVS 423
            +K   G +V  ++
Sbjct: 583 PNKEKGGKWVDAIN 596



>gi|356511201|ref|XP_003524317.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit A-like
           [Glycine max]
          Length = 608

 Score =  249 bits (635), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 149/419 (35%), Positives = 221/419 (52%), Gaps = 24/419 (5%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY     + +LDG+P+A+KDE+D   Y T  GTK+++   P T DA  ++RLR  GAI
Sbjct: 191 TLRYKKGEPISVLDGVPVAIKDEMDCLPYPTTGGTKWLHRERPCTDDACCVKRLRLCGAI 250

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKT+MHE+G G +  NP     RNPY+T+                 LCP+A+G DGGG
Sbjct: 251 LVGKTNMHELGVGISGINPHYGAARNPYDTNKISGGSSSGSATVVSAGLCPVALGVDGGG 310

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P+S CG+ GLK T GR    G  PL  +V + G +A +V+D  + Y  ++G+    
Sbjct: 311 SVRVPASLCGVVGLKPTFGRVPHSGVLPLNWTVGMVGILAGTVEDALITYAAISGE---- 366

Query: 181 PNTLHQP--------LPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAI---TTALNNFID 229
             + HQP        LP L    +T  + D+K+  Y  W     +  I   + AL    D
Sbjct: 367 -ISSHQPSNMLTKINLPLL---PLTKSICDIKLAKYGKWFDDCSDDVILCCSRALRKLQD 422

Query: 230 ELKLRGAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHL-FSCPTRSNINVMKL 288
                G              R+AH LTIG+E +T      +K    F    R  +N+   
Sbjct: 423 HY---GWKTIDVTIPDIEAMRLAHYLTIGSECSTWFDSFGEKYFAEFGWDARVALNIYGA 479

Query: 289 ATASDYIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISD 348
            +  +YI +Q++R R ++    +F+ + D+I++P T +TA  I   AL  GE+D    + 
Sbjct: 480 FSGKEYIKAQKLRNRQLQFHMKIFA-EADVIVSPTTGVTAYSIQDDALKTGELDYVNGAA 538

Query: 349 IMRFVQLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRK 407
           ++R+    NF G+PAV+VP GYD   LPIGLQFI + + EATL+ +A  ++ I    RK
Sbjct: 539 LVRYSISGNFLGLPAVTVPVGYDKLGLPIGLQFIGRPWAEATLIHLAFATQAICLEYRK 597



>gi|66819445|ref|XP_643382.1| amidase family protein [Dictyostelium discoideum AX4]
 gi|60471483|gb|EAL69440.1| amidase family protein [Dictyostelium discoideum AX4]
          Length = 637

 Score =  248 bits (632), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 142/409 (34%), Positives = 215/409 (52%), Gaps = 12/409 (2%)

Query: 2   ERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFIN--YGNPATSDATIIERLREKGA 59
           ER+ + S L L+DG+PI++KDEID  GY T  GT F+   + N  T D+ + + LR++GA
Sbjct: 208 ERWKSGSPLSLIDGVPISLKDEIDQIGYHTTCGTTFLEKVFPNVKTEDSGVAKMLRQQGA 267

Query: 60  IILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGG 119
           I++GK +MHEIG  +   N      RNPYN ++YP              L P++IG DGG
Sbjct: 268 ILVGKNNMHEIGISTLGYNTHFGFTRNPYNLNHYPGGSSSGSASSVSAGLNPLSIGCDGG 327

Query: 120 GSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPK 179
           GS+R+P+S CG+ GLK T  R S  G + L  SV   GP+ +SV D A+ Y  +AG D  
Sbjct: 328 GSIRVPASLCGVVGLKPTFARVSHGGIFDLCWSVGHVGPIGSSVIDTAIGYACIAGSDSA 387

Query: 180 DPNTL-------HQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELK 232
           D  ++          +P      +   L  LKIGV+  W     N     +    I+ LK
Sbjct: 388 DHQSVLAEQYGGKPTVPMFTEIPLIQPLKGLKIGVFYDWINDC-NIEFKDSTYKCIEILK 446

Query: 233 LRGAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATAS 292
            +GA             R++    I +E+ +  KR K+  +     +R ++++  +   S
Sbjct: 447 EQGAEIIEIEISNLLVTRLSQGAIILSEMNSSMKRFKNYSNELQYDSRISLSIGNILPTS 506

Query: 293 DYIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRF 352
           DY+ + +VRT  +     +F   VDLI+TP  AI AP+I    L+ GE +   + ++M++
Sbjct: 507 DYLQANKVRTFCIEQFTEIFKG-VDLIVTPTNAIAAPEIEKSVLSMGESNFGSVGELMKY 565

Query: 353 VQLANFAGVPAVSVPAGY-DDNNLPIGLQFIAKWYDEATLLRIAKTSEE 400
           V + N  G+P ++VP G   D NLPIG Q +AKW+ E  LL  +   E+
Sbjct: 566 VFIGNITGIPGITVPVGLTKDKNLPIGFQIMAKWWQEDLLLYTSYVLEK 614



>gi|121701005|ref|XP_001268767.1| N-acylethanolamine amidohydrolase, putative [Aspergillus clavatus
           NRRL 1]
 gi|119396910|gb|EAW07341.1| N-acylethanolamine amidohydrolase, putative [Aspergillus clavatus
           NRRL 1]
          Length = 617

 Score =  247 bits (631), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 156/417 (37%), Positives = 222/417 (53%), Gaps = 13/417 (3%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+RY     LG LDG+P+AVKDE+ V+GY+ N+G+K +++       +  +E+L E GA+
Sbjct: 167 TKRYKAGQPLGPLDGVPVAVKDEVHVEGYQRNLGSK-LDFKGDFDGTSWCVEKLEEAGAV 225

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKT+MHE+G  +TNNNP   TP+NP+N DYY               L PIA+G DGGG
Sbjct: 226 VIGKTTMHELGLDTTNNNPNYGTPKNPHNQDYYCGGSSGGSGYAVGAGLVPIALGADGGG 285

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDP-- 178
           S+RIPSSFCGI+GLK + GR S      LA +V V GPMAASVDDLALAY ++A   P  
Sbjct: 286 SIRIPSSFCGIWGLKPSHGRISSFPTASLAPTVGVYGPMAASVDDLALAYRLLATPAPAT 345

Query: 179 KDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXX 238
           +DP + + P P         +  +  IG+   W  + + P +    +  +D  +      
Sbjct: 346 EDPVSANFPDPISSLSASYPRPKNKTIGIVRDWIDRAE-PPVRAVFDAALDFYRKHSYTV 404

Query: 239 XXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINV-MKLATASDYIVS 297
                      + AH+LTI  E+ +       ++   + PT+  +++ M   TA D I +
Sbjct: 405 VDIAIPYLPEGQRAHILTIMAEIAS--GLTPAQISTLTAPTKVLVSMGMWQITAQDLIAA 462

Query: 298 QQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIYPRA-LAHGEVDVTMISDIMRFVQL 355
           Q++R  +M  L +LF      LILTP T I   KI     L  G  D       M +V L
Sbjct: 463 QRLRNLLMSHLAHLFQQHPGLLILTPTTPIPGWKISSATDLVRGVSDGKGSVRNMEYVWL 522

Query: 356 ANFAGVPAVSVPAGY----DDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKK 408
           ANF G PA+S PAGY    +   +P+GL  + +W  E  LL  A+  E IL   R +
Sbjct: 523 ANFTGCPAISCPAGYAGGDEGARVPVGLMAMGEWGTEEDLLAFARDGEAILDLPRNQ 579



>gi|383452726|ref|YP_005366715.1| amidase family protein [Corallococcus coralloides DSM 2259]
 gi|504206458|ref|WP_014393560.1| amidase [Corallococcus coralloides]
 gi|380732877|gb|AFE08879.1| amidase family protein [Corallococcus coralloides DSM 2259]
          Length = 558

 Score =  247 bits (631), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 143/409 (34%), Positives = 217/409 (53%), Gaps = 8/409 (1%)

Query: 2   ERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAII 61
           ER    + L + DG+P+ +KDE+D+ G+ T +GT F     PA +D+T+  RL+  GA+I
Sbjct: 149 ERLRAGAPLSVFDGVPVVIKDELDLAGFPTTLGTTFRT--EPARTDSTVAARLKAAGAVI 206

Query: 62  LGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGS 121
           LGK +M EIG      NP     RNP+N  +                LCP++IG DGGGS
Sbjct: 207 LGKANMQEIGINPIGLNPHHGAARNPWNRGHITGGSSSGSGAVVAAGLCPVSIGADGGGS 266

Query: 122 VRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDP 181
           +RIP++ CGI GLK T GR  + G  PL  +VA  GP+  +VDD+A AY ++AG D  D 
Sbjct: 267 IRIPAALCGIVGLKATWGRIPETGVPPLCWNVAHVGPLGLTVDDVAAAYAIVAGPDGHDV 326

Query: 182 NTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXXXXX 241
               QP   L GF     L  +++G+ + + +  D P +       +  L   GA     
Sbjct: 327 VARQQPPHHLSGFE-DGALKGIRLGICTPYFEDAD-PDVVARCREAVRALTDAGATVVEL 384

Query: 242 XXXXXXXARIAHLLTIGTELT-TVAKRHKDKMHLFSCPTRSNINVMKLATASDYIVSQQV 300
                      H   I +E+   +  + K +  +F   +R+N+ + +   A+D I + + 
Sbjct: 385 PAPDLNTILWTHSCIILSEMAEAMLPQLKARASVFGLDSRTNLALGRHFRATDLIHALRH 444

Query: 301 RTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANFAG 360
           R R+ R L  L ++ VD+I+TP TA TAP I    L  GE ++ ++  +MRF++LAN  G
Sbjct: 445 RHRLTRELLALMAD-VDVIVTPTTASTAPAIPEATLPAGESNLPVVDALMRFIRLANLTG 503

Query: 361 VPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKP 409
            PA+SVPAG+D   LP+G+  + + Y+E  LLR+ +  E      R+ P
Sbjct: 504 CPALSVPAGFDRAGLPVGVHLMGRPYEEHLLLRLGRVVER--ATERRTP 550



>gi|224081068|ref|XP_002306283.1| predicted protein [Populus trichocarpa]
 gi|222855732|gb|EEE93279.1| predicted protein [Populus trichocarpa]
          Length = 611

 Score =  247 bits (631), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 145/415 (34%), Positives = 218/415 (52%), Gaps = 8/415 (1%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY     +  LDG+PIA+KDEID   Y T  GTK+++       DA  + RLR  GA+
Sbjct: 191 TRRYERGEPISALDGVPIAIKDEIDCSPYPTTGGTKWLHKFRSCKGDACCVMRLRSCGAV 250

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           I+GKT+MHE+G G++  NP     RNPYN                   LCP+A+G DGGG
Sbjct: 251 IIGKTNMHELGAGTSGINPHYGATRNPYNPGMISGGSSSGSAAVVAAGLCPVALGVDGGG 310

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P++ CG+ G K T GR    G  PL  +V + G +A +++D  + Y  + G  P  
Sbjct: 311 SVRMPAALCGVVGFKPTFGRVPHSGVLPLNWTVGMVGVLAGTIEDAFIVYAAINGPLPSH 370

Query: 181 PNTLHQPLPTLHG--FHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR-GAX 237
             T   PLP ++      TN +S++ +  Y  W     +  I T  +  + +L  + G  
Sbjct: 371 -ETSAIPLPKVYFPLLQSTNSVSNVILARYGEWFSDCGD-DIRTCCSQALHQLSEKFGWK 428

Query: 238 XXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMH--LFSCPTRSNINVMKLATASDYI 295
                       R+AH LTIG+E T     + +K+         R  + V    +  +YI
Sbjct: 429 TVDVTIPDIESMRLAHYLTIGSECTAALSSYLEKLDNAESGWDLRVALCVYGSFSGEEYI 488

Query: 296 VSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQL 355
            +Q++R+R M+   N+F+ + D+I+TP   +TA  I+  AL  GE+D    + ++R+   
Sbjct: 489 KAQKLRSRQMQFHRNIFT-KADVIVTPTVGVTAYPIFDDALKTGELDYINGAALVRYQIA 547

Query: 356 ANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
            NF G+PAV+VP GYD N LPIGLQFI + + E TL+ IA   + +  ++ +KP 
Sbjct: 548 GNFLGLPAVTVPVGYDKNGLPIGLQFIGRPWSEPTLIHIAYAMQTLCVSKYRKPQ 602



>gi|449457323|ref|XP_004146398.1| PREDICTED: fatty acid amide hydrolase-like [Cucumis sativus]
          Length = 608

 Score =  246 bits (629), Expect = 7e-63,   Method: Compositional matrix adjust.
 Identities = 156/416 (37%), Positives = 222/416 (53%), Gaps = 15/416 (3%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+RY     L +LDG+PIAVKDEID   Y T  GT +++   P T DA+ ++ LR  GA+
Sbjct: 191 TKRYELGKPLSVLDGVPIAVKDEIDCLPYPTTGGTSWLHKLRPCTGDASCVKYLRLSGAL 250

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           I+GKT+MHE+G G++  NP   T RNPYN+                  LCP A+G DGGG
Sbjct: 251 IVGKTNMHELGIGTSGINPHHGTTRNPYNSSRICGGSSSGSAAVVAAGLCPAALGVDGGG 310

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVRIP+S CG+ GLK T GR    G  PL  +V + G +A +++D  + Y  ++ K P  
Sbjct: 311 SVRIPASLCGVVGLKPTFGRVPHSGVLPLNWTVGMVGILAGTIEDAFIVYAAISSKLPSH 370

Query: 181 PNTLHQPLPTLHGFHVTNK---LSDLKIGVYSMW-NKQVDNPAITTALNNFIDEL-KLRG 235
            NT    LP L  F V N    +S + +  YS W N   D+  I    +N +D+L K  G
Sbjct: 371 QNT---ALPKL-CFPVLNSSRPISSVTLAKYSEWFNDCSDD--IRVCCSNAMDKLQKHNG 424

Query: 236 AXXXXXXXXXXXXARIAHLLTIGTELTTVAKRH--KDKMHLFSCPTRSNINVMKLATASD 293
                         R+AH  TI +E +T    +  KD   L     R  + V    ++ +
Sbjct: 425 WKSVEVTIPEIEVMRLAHYSTIASECSTSLSSYLEKDSSQL-GWDARVALAVYGSFSSKE 483

Query: 294 YIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFV 353
           YI +Q++R R M     + ++  D+I++P T +TA  I   AL  GE+D    + ++R+ 
Sbjct: 484 YIKAQKIRNRQMYFHRKILAH-ADVIVSPTTGVTAYPILNGALKTGELDYINGAALVRYS 542

Query: 354 QLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKP 409
              NF G+PAV+VP GYD   LPIGLQFI + + EATL+ IA   + +     K+P
Sbjct: 543 IAGNFLGLPAVTVPVGYDKTGLPIGLQFIGRPWSEATLIHIACAMQALCIGDYKRP 598



>gi|302766559|ref|XP_002966700.1| hypothetical protein SELMODRAFT_439658 [Selaginella moellendorffii]
 gi|300166120|gb|EFJ32727.1| hypothetical protein SELMODRAFT_439658 [Selaginella moellendorffii]
          Length = 625

 Score =  246 bits (629), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 161/435 (37%), Positives = 214/435 (49%), Gaps = 27/435 (6%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           TER+AN + + +LDGI IA+KD+ID   YETN  + ++        D+  + RLR+ GAI
Sbjct: 178 TERFANGNPISILDGIFIAIKDDIDCLPYETNGASVWVKKIRKTKDDSVCVSRLRKCGAI 237

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
             GK +MHE G G+T NNPF  T RNPY+   Y               LCP A+G D GG
Sbjct: 238 FPGKANMHEAGMGTTGNNPFFGTVRNPYDVKRYTGGSSSGSSALVASGLCPAALGTDVGG 297

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           S+RIPSS CGI GLKTT GR +  G      S+   GP+AA+++DL + Y  + G    D
Sbjct: 298 SIRIPSSLCGIVGLKTTTGRTTCRGGLKGGWSMLCVGPIAANIEDLMIVYAAVLGSHESD 357

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELK-------- 232
                 P P        + L +LK G YS W   V +  IT A +  +D LK        
Sbjct: 358 VLYSKPPPPCFPLLEKNSILGNLKFGKYSKWYYDVLDQEITKACDRTLDALKSEFGTEAR 417

Query: 233 -----LRGAXXXXXXXXXXXXA------------RIAHLLTIGTELTTVAKRHKDKMHL- 274
                LR +                         R AHL+T G+E+ T      + +   
Sbjct: 418 TKEFPLRLSQLVLVYAQTSTLQTVEIVIPELEELRAAHLVTCGSEIMTSLNHDYNYVRKD 477

Query: 275 FSCPTRSNINVMKLATASDYIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPR 334
            S   R  + + K   AS YI SQ +R R M      F  +VD+I+ P T  TAP I   
Sbjct: 478 ISYEVRGTLAIFKHFNASYYIGSQCLRRRNMYYYMEAF-KKVDIIVVPTTPCTAPVIPQD 536

Query: 335 ALAHGEVDVTMISDIMRFVQLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRI 394
           +L+ GE D      +MRF+   N  G+P +SVP GYDD  LPIGLQ I + + EATLLR+
Sbjct: 537 SLSIGESDFVKAGTLMRFIATGNLLGLPCLSVPVGYDDQGLPIGLQLIGRPWQEATLLRV 596

Query: 395 AKTSEEILGNRRKKP 409
               +E+    RK P
Sbjct: 597 GFAIQELHAAARKAP 611



>gi|428171149|gb|EKX40068.1| hypothetical protein GUITHDRAFT_113807 [Guillardia theta CCMP2712]
          Length = 576

 Score =  246 bits (627), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 151/442 (34%), Positives = 224/442 (50%), Gaps = 49/442 (11%)

Query: 3   RYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFI-NYGNPATSDATIIERLREKGAII 61
           R+    SLG LDG+P AVKD  +   Y T+ GT F+ +       D T I R++  GAI+
Sbjct: 148 RWEEGKSLGPLDGVPFAVKDNFNAVNYTTSYGTCFLADALGVQLQDCTPIARMKAAGAIL 207

Query: 62  LGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXX-----XXXXXXXXLCPIAIGR 116
           +GKT MHE+G G+   +      RNP+N + Y                    L PIA+G 
Sbjct: 208 VGKTGMHELGLGTLGTSSVAGPFRNPHNINAYCGGSSTEIGAAGSAAVVAAGLVPIALGG 267

Query: 117 DGGGSVRIPSSFCGIYGLKTTCGRFSD----------------DGQYPLAHSVAVSGPMA 160
           DGGGSVRIP+S CG+YGLK T  R  +                 G   + +SV   GP+ 
Sbjct: 268 DGGGSVRIPASICGVYGLKPTHRRIPNISVGRKEESRASLTDSQGSGIVDNSVVCIGPIG 327

Query: 161 ASVDDLALAYYVMAGKDPKDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAI 220
           A++ D+ALAY  ++G DP   N+L  P P + GF     L  ++IG++  + +  D P I
Sbjct: 328 ATIYDIALAYLAVSGDDPTAGNSLITPKPHVSGFEKITNLRGVRIGIFKSFFEHAD-PPI 386

Query: 221 TTALNNFIDELKLRGAXXXXXXXXXXXXARIAHLLTIGTELTTVAK--------RHKDKM 272
               +  I  +                  R+AHLLTI TE     +             M
Sbjct: 387 VEVKDVVISNMD---------------TIRLAHLLTIATETGQCIEMFEKNNRIEKSKTM 431

Query: 273 HLFSCPTRSNINVMKLATASDYIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIY 332
             F+      +NV K  TA DYI +Q+V+   +  +  +F  +VD++  P  A+TAP + 
Sbjct: 432 GKFTLENEILLNVCKQCTAYDYIAAQKVKAFAVEQMRKMF-EEVDVLALPTCAVTAPDMR 490

Query: 333 PRALAHGEVDVTMISDIMRFVQLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLL 392
             A++HGE+D+ ++  + RF  LANFAG+PA+SVPAG+D    PIG Q +A  Y+E  LL
Sbjct: 491 AEAISHGELDMQVLGRLGRFSSLANFAGLPAISVPAGFDQQMKPIGFQLMANAYNEPLLL 550

Query: 393 RIAKTSEEILGNRRKKPSDKFW 414
           R+A + ++ +  + +KP+  F+
Sbjct: 551 RLANSLKDSV--KMRKPAGYFY 570



>gi|295664358|ref|XP_002792731.1| glutamyl-tRNA(Gln) amidotransferase subunit A [Paracoccidioides sp.
           'lutzii' Pb01]
 gi|226278845|gb|EEH34411.1| glutamyl-tRNA(Gln) amidotransferase subunit A [Paracoccidioides sp.
           'lutzii' Pb01]
          Length = 613

 Score =  244 bits (624), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 157/413 (38%), Positives = 221/413 (53%), Gaps = 19/413 (4%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           TERY N + LG LDG+P+AVKDE+D++GY+  +G+K +++       A  +++  E GA+
Sbjct: 167 TERYKNGNPLGPLDGVPVAVKDEVDIEGYKRTLGSK-LDFTGAENRTAWCVKKWEEAGAV 225

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKTSMHE+G  +TNNNP V TPRNP++ DYY               L PIA+G DGGG
Sbjct: 226 VIGKTSMHELGLDTTNNNPNVGTPRNPHHEDYYTGGSSGGSGYAVGAGLVPIALGADGGG 285

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           S+RIP+SFCGIYGLK + GR S      +A +  V GPMA+++DDLAL+Y +MA  DP  
Sbjct: 286 SIRIPASFCGIYGLKPSHGRVSGHPTVGIASTTGVIGPMASNLDDLALSYRIMAAPDPSS 345

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLK--IGVYSMWNKQVDNPAITTALNNFIDELK-LRGAX 237
             +   P P L     +  LS     IGV+  W  + D PA+    N  ID  +  +G  
Sbjct: 346 MTSSSFPDP-LTTIPSSQSLSSRPKVIGVFPDWVNRAD-PAVLALFNKAIDYYRNNQGYT 403

Query: 238 XXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLA----TASD 293
                       + AH LTI  E+ +        M   S  T +N  +M +      A D
Sbjct: 404 VVDISIPLLPEGQKAHALTILAEIESSL-----SMDQISKLTPANRIIMAVGGNPTGARD 458

Query: 294 YIVSQQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYPRA--LAHGEVDVTMISDIM 350
           ++ +Q++R  +M  L  LF     LI+ TP T +   KI      LA G  D    S  M
Sbjct: 459 FLAAQKLRNLLMSHLAFLFQQHPGLIIATPTTPLPGWKILKGKADLARGVSDADSSSRSM 518

Query: 351 RFVQLANFAGVPAVSVPAGY-DDNNLPIGLQFIAKWYDEATLLRIAKTSEEIL 402
            +V LANF G P++S P G  D  N+P GL  +++W  E  L+  A+  E +L
Sbjct: 519 EYVFLANFTGCPSISRPMGLIDGPNVPAGLMGMSEWGSEEMLIEWARDGEGML 571



>gi|226295312|gb|EEH50732.1| glutamyl-tRNA(Gln) amidotransferase subunit A [Paracoccidioides
           brasiliensis Pb18]
          Length = 613

 Score =  244 bits (624), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 157/411 (38%), Positives = 222/411 (54%), Gaps = 13/411 (3%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           TERY N + LG LDG+P+AVKDE+D++GY+  +G+K +++       A  +++  E GA+
Sbjct: 167 TERYKNGNPLGPLDGVPVAVKDEVDIEGYKRTLGSK-LDFTGAENRTAWCVKKWEEAGAV 225

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKTSMHE+G  +TNNNP V TPRNP++ DYY               L PIA+G DGGG
Sbjct: 226 VIGKTSMHELGLDTTNNNPNVGTPRNPHHEDYYTGGSSGGSGYAVGVGLVPIALGADGGG 285

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           S+RIP+SFCGIYGLK + GR S      +A +  V GPMA+++DDLAL+Y +MA  DP  
Sbjct: 286 SIRIPASFCGIYGLKPSHGRVSGHPTVGIASTTGVIGPMASNLDDLALSYRIMAAPDPSS 345

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLK--IGVYSMWNKQVDNPAITTALNNFIDELK-LRGAX 237
             +   P P L     +  LS     IGV+  W  + D PA+    N  ID  +  +G  
Sbjct: 346 MTSSSFPDP-LTTIPSSQSLSSRPKVIGVFPDWVNRAD-PAVLALFNKAIDYYRNNQGYT 403

Query: 238 XXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLAT-ASDYIV 296
                       + AH LTI  E+ +      D++   +   R  + V    T A D++ 
Sbjct: 404 VVDISIPLLPEGQKAHALTILAEIES--HLSLDQISKLTPANRIIMAVGGNPTRARDFLA 461

Query: 297 SQQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYP--RALAHGEVDVTMISDIMRFV 353
           +Q++R  +M  L  LF     LI+ TP T +   KI      LA G  DV   +  M +V
Sbjct: 462 AQKLRNLLMSHLAFLFQQHPGLIIATPTTPLPGWKILKGNADLARGVSDVDSSTRSMEYV 521

Query: 354 QLANFAGVPAVSVPAGY-DDNNLPIGLQFIAKWYDEATLLRIAKTSEEILG 403
            LANF G P++S P G  D  N+P GL  ++ W  E  L+  A+  E +LG
Sbjct: 522 FLANFTGCPSISRPMGLVDGPNVPAGLMGMSDWGSEEMLIEWARDGEGMLG 572



>gi|225677554|gb|EEH15838.1| glutamyl-tRNA(Gln) amidotransferase subunit A [Paracoccidioides
           brasiliensis Pb03]
          Length = 613

 Score =  244 bits (624), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 157/411 (38%), Positives = 222/411 (54%), Gaps = 13/411 (3%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           TERY N + LG LDG+P+AVKDE+D++GY+  +G+K +++       A  +++  E GA+
Sbjct: 167 TERYKNGNPLGPLDGVPVAVKDEVDIEGYKRTLGSK-LDFTGAENRTAWCVKKWEEAGAV 225

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKTSMHE+G  +TNNNP V TPRNP++ DYY               L PIA+G DGGG
Sbjct: 226 VIGKTSMHELGLDTTNNNPNVGTPRNPHHEDYYTGGSSGGSGYAVGVGLVPIALGADGGG 285

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           S+RIP+SFCGIYGLK + GR S      +A +  V GPMA+++DDLAL+Y +MA  DP  
Sbjct: 286 SIRIPASFCGIYGLKPSHGRVSGHPTVGIASTTGVIGPMASNLDDLALSYRIMAAPDPSS 345

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLK--IGVYSMWNKQVDNPAITTALNNFIDELK-LRGAX 237
             +   P P L     +  LS     IGV+  W  + D PA+    N  ID  +  +G  
Sbjct: 346 MTSSSFPDP-LTTIPSSQSLSSRPKVIGVFPDWVNRAD-PAVLALFNKAIDYYRNNQGYT 403

Query: 238 XXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLAT-ASDYIV 296
                       + AH LTI  E+ +      D++   +   R  + V    T A D++ 
Sbjct: 404 VVDISIPLLPEGQKAHALTILAEIES--HLSLDQISKLTPANRIIMAVGGNPTRARDFLA 461

Query: 297 SQQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYP--RALAHGEVDVTMISDIMRFV 353
           +Q++R  +M  L  LF     LI+ TP T +   KI      LA G  DV   +  M +V
Sbjct: 462 AQKLRNLLMSHLAFLFQQHPGLIIVTPTTPLPGWKILKGNADLARGVSDVDSSTRSMEYV 521

Query: 354 QLANFAGVPAVSVPAGY-DDNNLPIGLQFIAKWYDEATLLRIAKTSEEILG 403
            LANF G P++S P G  D  N+P GL  ++ W  E  L+  A+  E +LG
Sbjct: 522 FLANFTGCPSISRPMGLVDGPNVPAGLMGMSDWGSEEMLIEWARDGEGMLG 572



>gi|224093658|ref|XP_002309950.1| predicted protein [Populus trichocarpa]
 gi|222852853|gb|EEE90400.1| predicted protein [Populus trichocarpa]
          Length = 578

 Score =  244 bits (623), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 146/418 (34%), Positives = 218/418 (52%), Gaps = 14/418 (3%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY       +LDG+P+A+KDEID   Y T  GTK+++   P  SDA  I RLR  G +
Sbjct: 158 TLRYQRGEPRSVLDGVPVAIKDEIDCSPYPTTGGTKWLHKFRPCKSDAFCILRLRSCGVV 217

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           I+GKT+MHE+G G++  NP     RNPY+                   LCP+A+G DGGG
Sbjct: 218 IIGKTNMHELGAGTSGINPHYGATRNPYDPSRISGGSSSGSAAVVAAGLCPVALGVDGGG 277

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P++ CG+ G K T GR    G  PL  +V + G +A +++D  + Y  + G  P  
Sbjct: 278 SVRMPAALCGVVGFKPTFGRVPHSGVLPLNWTVGMVGVLAGTIEDALIVYAAINGPVPSH 337

Query: 181 PNTLHQP----LPTLHGFHVTNKLSDLKIGVYSMW-NKQVDNPAITTALNNFIDELKLR- 234
             ++  P     P L     TN +SD+ +  Y  W N   D+  I T  +  + +L  + 
Sbjct: 338 ETSVIPPPKMYFPMLQS---TNSVSDITLARYGEWFNDCSDD--IRTCCSLALHKLSEKH 392

Query: 235 GAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSC--PTRSNINVMKLATAS 292
           G              R+AH LTIG+E T     + +K+ +       R  ++V    +  
Sbjct: 393 GWKTVDVTIPDIEAMRLAHYLTIGSECTAALSSYLEKLDIAESGWDVRVALSVYGAFSGE 452

Query: 293 DYIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRF 352
           DYI +Q++R R ++   N+F+ + D+I+TP   +TA  I   AL  GE+D    + ++R+
Sbjct: 453 DYIKAQKLRNRQIQFHRNIFT-KADVIVTPTVGVTAYPILNDALHTGELDYINGAALVRY 511

Query: 353 VQLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
               NF G+PAV+VP GYD   LPIGLQFI + + E TL+ IA   + +  +  +KP 
Sbjct: 512 QIAGNFLGLPAVTVPVGYDKKGLPIGLQFIGRPWSEPTLIHIAHAMQTLCISEYRKPQ 569



>gi|67517097|ref|XP_658432.1| hypothetical protein AN0828.2 [Aspergillus nidulans FGSC A4]
 gi|40746502|gb|EAA65658.1| hypothetical protein AN0828.2 [Aspergillus nidulans FGSC A4]
 gi|259488889|tpe|CBF88705.1| TPA: N-acylethanolamine amidohydrolase, putative (AFU_orthologue;
           AFUA_1G14880) [Aspergillus nidulans FGSC A4]
          Length = 619

 Score =  244 bits (622), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 153/424 (36%), Positives = 220/424 (51%), Gaps = 14/424 (3%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+RY +   LG LDGIP+ VKDE+ + GY   +GTK    G  A S +  +++  E GAI
Sbjct: 169 TQRYKDGKPLGPLDGIPVTVKDEVHMDGYRRTLGTKLDFTGEFAGSTSWCVKKWEEAGAI 228

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GK++MHE+G  +TNNNP   TP+NP+N +YY               L PIA+G DGGG
Sbjct: 229 VIGKSTMHELGLDTTNNNPNFGTPKNPHNPNYYCGGSSGGSGYAVGAGLVPIALGADGGG 288

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           S+RIPSSFCG++GLK +  R S      LA +V V GP+AAS+DDLALAY +MA   P  
Sbjct: 289 SIRIPSSFCGVWGLKPSHSRVSGFPTVGLASTVGVLGPIAASIDDLALAYRIMAAPAPPS 348

Query: 181 PN----TLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGA 236
            +        PL  L+     ++  +  IG+   W  + + PA+    +  +D  + +  
Sbjct: 349 EDAKSGAFPNPLSELNSHPAHSRPKNKTIGIMREWTDRAE-PAVRAVFDRALDFYRKQNY 407

Query: 237 XXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINV-MKLATASDYI 295
                          AH+LTI  E+ +         HL + P +  +++ M   +  D++
Sbjct: 408 TIIDISIPYIPEGARAHVLTIMAEIASGLSSPSQIKHL-TAPNKVLVSMGMYQISGQDFL 466

Query: 296 VSQQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIY--PRALAHGEVDVTMISDIMRF 352
            +Q++R  +M  L  LF      LI TP + I   KI      LA G  D       M +
Sbjct: 467 AAQRLRGLLMSHLGFLFQKHPGLLIFTPTSPIPGWKIAGGDADLARGVSDGKSSVRNMEY 526

Query: 353 VQLANFAGVPAVSVPAGYDDNN---LPIGLQFIAKWYDEATLLRIAKTSEEILG-NRRKK 408
           V LANF G PAVS PAGY ++N   +PIG+  + +W  E  L+  A+  E IL     K+
Sbjct: 527 VWLANFTGCPAVSCPAGYAEDNGHRVPIGVMAMGEWGSEEDLIAFARQGEGILDLPENKE 586

Query: 409 PSDK 412
           PS K
Sbjct: 587 PSPK 590



>gi|302772024|ref|XP_002969430.1| hypothetical protein SELMODRAFT_270796 [Selaginella moellendorffii]
 gi|300162906|gb|EFJ29518.1| hypothetical protein SELMODRAFT_270796 [Selaginella moellendorffii]
          Length = 606

 Score =  243 bits (621), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 149/419 (35%), Positives = 215/419 (51%), Gaps = 9/419 (2%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY     L +LDG+PIAVKDE+D   Y+T  GTK+++       DA  + +LR  GA+
Sbjct: 187 TSRYKQGKPLSVLDGVPIAVKDELDCLPYDTTGGTKWMSKVRDVKEDAACVSKLRACGAM 246

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKT+MHE+G G+T  NP     RNPYN                   LCP A+G DGGG
Sbjct: 247 LVGKTNMHELGQGTTGINPHYGATRNPYNKAKASGGSSGGSAAAVACGLCPAALGVDGGG 306

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P++ CGI GLK T GR S  G  PL  +V   G +AA+V+D  + Y  + G    D
Sbjct: 307 SVRMPAALCGIVGLKGTFGRISSHGVLPLNWTVGSVGVLAATVEDTLIMYAAVHGHLSSD 366

Query: 181 PNTLHQP---LPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR-GA 236
                 P   LP L+       +  LK+  Y+ W    D P +       + +L+ R G 
Sbjct: 367 RIVSIPPQVTLPQLNRIE-NEAIGSLKLAKYTEWFDDSD-PDVKDRCYAALSKLQKRYGC 424

Query: 237 XXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFS--CPTRSNINVMKLATASDY 294
                        R+AH +TIG E  +      + + + +     R   ++ K  T ++Y
Sbjct: 425 KTVEVTIPELEEMRLAHFVTIGCECYSSIGIQYENVGVTATGADIRVGFSLYKSFTNTEY 484

Query: 295 IVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQ 354
           + +Q++R R M     +F N  D+I+TP TA TAP I   AL  GE++    + +MR+  
Sbjct: 485 LSAQRMRYRQMYYHMQIFKN-ADVIVTPTTAATAPSISLDALECGELNYVYGAKLMRYQI 543

Query: 355 LANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPSDKF 413
             NF G+PA+SVP G+D   +PIG+Q I K + EATLLR+A   E +     ++P   F
Sbjct: 544 AGNFIGLPAISVPVGFDQAGMPIGIQLIGKPWSEATLLRLAYVIEGLCAAESRRPEVLF 602



>gi|357520143|ref|XP_003630360.1| Glutamyl-tRNA(Gln) amidotransferase subunit A [Medicago truncatula]
 gi|355524382|gb|AET04836.1| Glutamyl-tRNA(Gln) amidotransferase subunit A [Medicago truncatula]
          Length = 609

 Score =  243 bits (621), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 144/415 (34%), Positives = 221/415 (53%), Gaps = 10/415 (2%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY     + +LDG+P+A+KDEID   Y T  GTK+++   P T DA  I+RLR  GA+
Sbjct: 191 TLRYQKGEPISVLDGVPVAIKDEIDCLPYPTTGGTKWLHKQRPCTDDACCIKRLRLCGAV 250

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKT+MHE+G G++  NP     RNP+N                   LCP+A+G DGGG
Sbjct: 251 LVGKTNMHELGAGTSGINPHYGATRNPHNASRIAGGSSSGSAAVVSAGLCPVALGVDGGG 310

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDP-K 179
           SVR+P++ CGI GLK T  R    G  PL  +V + G +A +V+D  + Y  ++G+ P +
Sbjct: 311 SVRMPAALCGIVGLKPTFSRIPHSGVIPLNWTVGMVGILAGTVEDSLITYAAISGEIPSR 370

Query: 180 DPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNP---AITTALNNFIDELKLRGA 236
            P+++   +  L    +T  +S +K+  Y  W     +      + ALN         G 
Sbjct: 371 QPSSIPAKI-NLPLLPLTKSISKIKLAKYGKWFDDCSDDVRICCSGALNKLQGHY---GW 426

Query: 237 XXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDK-MHLFSCPTRSNINVMKLATASDYI 295
                        R+AH  TIG+E  T     +DK +  F    R  + +    ++ +YI
Sbjct: 427 KIVDVTIPEIEVMRLAHYSTIGSECNTSLDYFQDKNLADFGWDARVALKIYGSFSSMEYI 486

Query: 296 VSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQL 355
            +Q++R R ++    +FS + D+I++P T +TA  I   AL  GE+D    + ++R+   
Sbjct: 487 KAQKIRNRQLQFHKKIFS-EADIIVSPTTGVTAYPIQDDALKTGELDYVNGAALIRYSIA 545

Query: 356 ANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
            NF G+PAV+VP GYD   LPIGLQFI + + EATL+ +A   + I  +  +KP+
Sbjct: 546 GNFLGLPAVTVPVGYDKLGLPIGLQFIGRPWAEATLIHLAFAMQTICLSEYRKPA 600



>gi|108864044|gb|ABA91618.2| Amidase family protein, expressed [Oryza sativa Japonica Group]
 gi|222615590|gb|EEE51722.1| hypothetical protein OsJ_33114 [Oryza sativa Japonica Group]
          Length = 610

 Score =  243 bits (620), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 142/412 (34%), Positives = 217/412 (52%), Gaps = 8/412 (1%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY   + L  +DG+ +AVKDEID   Y T  GT+++    P   DA ++ +LR  GA+
Sbjct: 192 TLRYQQGAPLSAMDGVLVAVKDEIDCLPYPTTGGTRWLQRMRPCVQDAAVVAQLRACGAV 251

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           + GKT+MHE+G G++  NP   + RNPYNT                  LCP+A+G DGGG
Sbjct: 252 LAGKTNMHELGAGTSGINPHHGSTRNPYNTGKVAGGSSGGSAAVVCAGLCPVALGADGGG 311

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P++ CG+ GLK T GRFS DG  PL  +V + G +AA+V+D  +AY  +A  D   
Sbjct: 312 SVRMPAALCGVVGLKPTAGRFSKDGLLPLNWTVGMPGILAATVEDALIAYAAIA--DQSQ 369

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR-GAXXX 239
           P+ L QP   L      + +  +++  Y+ W        I +     +  L+ R G    
Sbjct: 370 PSHL-QPELNLPLLKAASSMPTIRLARYAKWFNDCSE-DIRSCCYKAVHTLRTRYGWETA 427

Query: 240 XXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHL--FSCPTRSNINVMKLATASDYIVS 297
                     R+AH +T+G+E T    ++  K+         R  ++     ++  Y+ S
Sbjct: 428 DVTIPEIEEMRLAHYVTMGSECTASFDKYLKKLSKSEIGWDVRIALSAYGSFSSRAYLNS 487

Query: 298 QQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLAN 357
           Q++R R M   + +F    D+I+TP T +TA ++   A   GE+D    + ++R+    N
Sbjct: 488 QRIRNRQMYFHDKIFET-FDVIVTPMTGVTAHELQDNAGHTGELDYINGAALVRYSIAGN 546

Query: 358 FAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKP 409
           F G+PA++V  GYD   LP+GLQFI + + EATLL +A   +E  G   +KP
Sbjct: 547 FLGLPAITVKVGYDREGLPVGLQFIGRPWSEATLLHLAYAMQEACGKNYRKP 598



>gi|297611309|ref|NP_001065856.2| Os11g0170000 [Oryza sativa Japonica Group]
 gi|255679826|dbj|BAF27701.2| Os11g0170000, partial [Oryza sativa Japonica Group]
          Length = 637

 Score =  243 bits (620), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 142/412 (34%), Positives = 217/412 (52%), Gaps = 8/412 (1%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY   + L  +DG+ +AVKDEID   Y T  GT+++    P   DA ++ +LR  GA+
Sbjct: 219 TLRYQQGAPLSAMDGVLVAVKDEIDCLPYPTTGGTRWLQRMRPCVQDAAVVAQLRACGAV 278

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           + GKT+MHE+G G++  NP   + RNPYNT                  LCP+A+G DGGG
Sbjct: 279 LAGKTNMHELGAGTSGINPHHGSTRNPYNTGKVAGGSSGGSAAVVCAGLCPVALGADGGG 338

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P++ CG+ GLK T GRFS DG  PL  +V + G +AA+V+D  +AY  +A  D   
Sbjct: 339 SVRMPAALCGVVGLKPTAGRFSKDGLLPLNWTVGMPGILAATVEDALIAYAAIA--DQSQ 396

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR-GAXXX 239
           P+ L QP   L      + +  +++  Y+ W        I +     +  L+ R G    
Sbjct: 397 PSHL-QPELNLPLLKAASSMPTIRLARYAKWFNDCSE-DIRSCCYKAVHTLRTRYGWETA 454

Query: 240 XXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHL--FSCPTRSNINVMKLATASDYIVS 297
                     R+AH +T+G+E T    ++  K+         R  ++     ++  Y+ S
Sbjct: 455 DVTIPEIEEMRLAHYVTMGSECTASFDKYLKKLSKSEIGWDVRIALSAYGSFSSRAYLNS 514

Query: 298 QQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLAN 357
           Q++R R M   + +F    D+I+TP T +TA ++   A   GE+D    + ++R+    N
Sbjct: 515 QRIRNRQMYFHDKIFET-FDVIVTPMTGVTAHELQDNAGHTGELDYINGAALVRYSIAGN 573

Query: 358 FAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKP 409
           F G+PA++V  GYD   LP+GLQFI + + EATLL +A   +E  G   +KP
Sbjct: 574 FLGLPAITVKVGYDREGLPVGLQFIGRPWSEATLLHLAYAMQEACGKNYRKP 625



>gi|225561555|gb|EEH09835.1| glutamyl-tRNA amidotransferase subunit A [Ajellomyces capsulatus
           G186AR]
          Length = 624

 Score =  242 bits (618), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 148/411 (36%), Positives = 222/411 (54%), Gaps = 22/411 (5%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           TERY     LG +DG+P+A+KDE  ++GY+  +G++F ++     S +  +++  E GAI
Sbjct: 167 TERYKIRKPLGPMDGVPVAIKDEAHLEGYKRTLGSRF-DFTGKINSTSWCVKKWEEAGAI 225

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKTSMHE+G G+TNNNP   TPRNP+N DYY               L PIA+G DGGG
Sbjct: 226 VVGKTSMHELGLGTTNNNPCTGTPRNPHNQDYYTGGSSGGSAYVVGAGLVPIALGADGGG 285

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPK- 179
           S+R+PS FCGIYG+KTT GR S      +A +  V G M +S+DDLAL+Y +MA  DP  
Sbjct: 286 SIRLPSGFCGIYGIKTTHGRVSAHPTLRIASTTGVLGTMTSSLDDLALSYRLMASPDPDS 345

Query: 180 -DPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXX 238
            + ++   PL T+           + IG++  W  + D PA+    N  ID  + +    
Sbjct: 346 MESSSFPDPLSTIPSSSALAARPKV-IGIFPDWVNRAD-PAVLALFNKAIDHYRTKNYTV 403

Query: 239 XXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINV-MKLATASDYIVS 297
                      + AH LTI  E+++  K   D++   +   +  +++    A+A D++ +
Sbjct: 404 VDISIPLLAEGQKAHSLTILAEISSTVK--PDQIRQLTPQNKILVSLGANQASAPDFLAA 461

Query: 298 QQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYPRALAHGEVD-VTMISD------I 349
           Q++R+ +M  L  LF     LI+ TP T +   KI     A G+ D V+ +SD       
Sbjct: 462 QRLRSLLMSHLAFLFQKHPGLIIVTPTTPMPGWKI-----AKGDADLVSGVSDENSSLRA 516

Query: 350 MRFVQLANFAGVPAVSVPAGY-DDNNLPIGLQFIAKWYDEATLLRIAKTSE 399
           M +V LANF G PA+S P G  D   +P+GL  + +W  E  L+  A+  E
Sbjct: 517 MEYVYLANFTGCPALSRPMGLIDGPQVPVGLMGMGEWCSEEMLIEWARDGE 567



>gi|302792549|ref|XP_002978040.1| hypothetical protein SELMODRAFT_108353 [Selaginella moellendorffii]
 gi|300154061|gb|EFJ20697.1| hypothetical protein SELMODRAFT_108353 [Selaginella moellendorffii]
          Length = 611

 Score =  242 bits (618), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 156/421 (37%), Positives = 210/421 (49%), Gaps = 27/421 (6%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           TER+AN + + +LDGI IA+KD+ID   YETN  + ++        D+  + RLR+ GAI
Sbjct: 171 TERFANGNPISILDGIFIAIKDDIDCLPYETNGASVWVKKIRKTKDDSVCVSRLRKCGAI 230

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
             GK +MHE+G G+T NNPF  T RNPY+   Y               LCP A+G D GG
Sbjct: 231 FPGKANMHEVGMGTTGNNPFFGTVRNPYDVKRYTGGSSSGSSALVASGLCPAALGTDVGG 290

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           S+RIPSS CGI GLKTT GR +  G      S+   GP+AA+++DL + Y  + G    D
Sbjct: 291 SIRIPSSLCGIVGLKTTTGRTTCRGGLKGGWSMLCVGPIAANIEDLMIVYAAVLGSHESD 350

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELK-------- 232
                 P P        + L +LK G YS W   V +  IT A +  +D LK        
Sbjct: 351 VLYSKPPPPCFPLLEKNSILGNLKFGKYSKWYYDVLDQEITKACDRTLDALKSEFGTEAR 410

Query: 233 -----LRGAXXXXXXXXXXXXA------------RIAHLLTIGTELTTVAKRHKDKMHL- 274
                LR +                         R AHL+T G+E+ T      + +   
Sbjct: 411 TTEFPLRLSQLVLVYAQTSTLQTVEIVIPELEELRAAHLVTCGSEIMTSLNHDYNYVRKD 470

Query: 275 FSCPTRSNINVMKLATASDYIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPR 334
            S   R  + + K   AS YI SQ +R R M      F  +VD+I+ P T  TAP I   
Sbjct: 471 ISYEVRGTLAIFKHFNASYYIGSQCLRRRNMYYYMEAF-KKVDIIVVPTTPCTAPVIPQD 529

Query: 335 ALAHGEVDVTMISDIMRFVQLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRI 394
           +L+ GE D   +  +MRF+   N  G+P +SVP GYD+  LPIGLQ I + + EATLLR+
Sbjct: 530 SLSIGESDFVKVGTLMRFIATGNLLGLPCLSVPVGYDEQGLPIGLQLIGRPWQEATLLRV 589

Query: 395 A 395
            
Sbjct: 590 G 590



>gi|302774693|ref|XP_002970763.1| hypothetical protein SELMODRAFT_270878 [Selaginella moellendorffii]
 gi|300161474|gb|EFJ28089.1| hypothetical protein SELMODRAFT_270878 [Selaginella moellendorffii]
          Length = 606

 Score =  242 bits (617), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 149/419 (35%), Positives = 214/419 (51%), Gaps = 9/419 (2%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY     L +LDG+PIAVKDE+D   Y+T  GTK+++       DA  + +LR  GA+
Sbjct: 187 TSRYKQGKPLSVLDGVPIAVKDELDCLPYDTTGGTKWMSKVRDVKEDAACVSKLRACGAM 246

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKT+MHE+G G+T  NP     RNPYN                   LCP A+G DGGG
Sbjct: 247 LVGKTNMHELGQGTTGINPHYGATRNPYNKAKASGGSSGGSAAAVACGLCPAALGVDGGG 306

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P++ CGI GLK T GR S  G  PL  +V   G +AA+V+D  + Y  + G    D
Sbjct: 307 SVRMPAALCGIVGLKGTFGRISSHGVLPLNWTVGSVGVLAATVEDTLIMYAAVQGHLSSD 366

Query: 181 PNTLHQP---LPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR-GA 236
                 P   LP L+       +  LK+  Y+ W    D P +       + +L+ R G 
Sbjct: 367 RIVSIPPQVTLPQLNRIE-NEAIGGLKLAKYTEWFDDSD-PDVKDRCYAALSKLQKRYGC 424

Query: 237 XXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFS--CPTRSNINVMKLATASDY 294
                        R+AH +TIG E  +      + + + +     R    + K  T ++Y
Sbjct: 425 KTVEVTIPELEEMRLAHFVTIGCECYSSIGIQYENVGVTATGADIRVGFALYKSFTNTEY 484

Query: 295 IVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQ 354
           + +Q++R R M     +F N  D+I+TP TA TAP I   AL  GE++    + +MR+  
Sbjct: 485 LSAQRMRYRQMYYHMEIFKN-ADVIVTPTTAATAPSISLDALECGELNYVYGAKLMRYQI 543

Query: 355 LANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPSDKF 413
             NF G+PA+SVP G+D   +PIG+Q I K + EATLLR+A   E +     ++P   F
Sbjct: 544 AGNFIGLPAISVPVGFDQAGMPIGIQLIGKPWSEATLLRLAYVIEGLCAAESRRPEVLF 602



>gi|218185324|gb|EEC67751.1| hypothetical protein OsI_35272 [Oryza sativa Indica Group]
          Length = 610

 Score =  242 bits (617), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 142/412 (34%), Positives = 216/412 (52%), Gaps = 8/412 (1%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY   + L  +DG+ +AVKDEID   Y T  GT+++    P   DA ++ +LR  GA+
Sbjct: 192 TLRYQQGAPLSAMDGVLVAVKDEIDCLPYPTTGGTRWLQRMRPCVQDAAVVAQLRACGAV 251

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           + GKT+MHE+G G++  NP   + RNPYNT                  LCP+A+G DGGG
Sbjct: 252 LAGKTNMHELGAGTSGINPHHGSTRNPYNTGKVAGGSSGGSAAVVCAGLCPVALGADGGG 311

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P++ CG+ GLK T GRFS DG  PL  +V + G +AA+V+D  +AY  +A  D   
Sbjct: 312 SVRMPAALCGVVGLKPTAGRFSKDGLLPLNWTVGMPGILAATVEDALIAYAAIA--DQSQ 369

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR-GAXXX 239
           P+ L QP   L      + +  +++  Y+ W        I +     +  L+ R G    
Sbjct: 370 PSHL-QPELNLPLLKAASSMPTIRLARYAKWFNDCSE-DIRSCCYKAVHTLRTRYGWETA 427

Query: 240 XXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHL--FSCPTRSNINVMKLATASDYIVS 297
                     R+AH +T+G+E T    ++  K+         R  ++      +  Y+ S
Sbjct: 428 DVTIPEIEEMRLAHYVTMGSECTASFDKYLKKLSKSEIGWDVRIALSAYGSFGSRAYLNS 487

Query: 298 QQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLAN 357
           Q++R R M   + +F    D+I+TP T +TA ++   A   GE+D    + ++R+    N
Sbjct: 488 QRIRNRQMYFHDKIFET-FDVIVTPMTGVTAHELQDNAGHTGELDYINGAALVRYSIAGN 546

Query: 358 FAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKP 409
           F G+PA++V  GYD   LP+GLQFI + + EATLL +A   +E  G   +KP
Sbjct: 547 FLGLPAITVKVGYDREGLPVGLQFIGRPWSEATLLHLAYAMQEACGKNYRKP 598



>gi|310820358|ref|YP_003952716.1| amidase family protein [Stigmatella aurantiaca DW4/3-1]
 gi|503140914|ref|WP_013375575.1| amidase [Stigmatella aurantiaca]
 gi|309393430|gb|ADO70889.1| Amidase family protein [Stigmatella aurantiaca DW4/3-1]
          Length = 558

 Score =  241 bits (615), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 140/401 (34%), Positives = 216/401 (53%), Gaps = 6/401 (1%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           +ER      L +LDG+P+ +KDE+D+ G+ T +GT +      A +D+T+  RL+  GA+
Sbjct: 148 SERLRAGMPLSVLDGVPVVLKDEVDLAGFPTTLGTTYRT--EVARADSTVAARLKAAGAL 205

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ILGK +M+EIG      NP     RNP+N  +                LCP++IG DGGG
Sbjct: 206 ILGKANMNEIGINPIGLNPHYGAARNPWNRGHITGGSSSASSAAVAAGLCPLSIGADGGG 265

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           S+RIP++ CGI GLK T GR  + G  PL  +VA  GPM  +VDD+A  Y ++AG D  D
Sbjct: 266 SIRIPAALCGIVGLKATWGRIPETGVPPLCWNVAHVGPMGLTVDDVAAMYAILAGPDGHD 325

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXXXX 240
                QP+  L  +     L  +++GV + + +  D P + T   + +  L   GA    
Sbjct: 326 VVARDQPVHHLSRYE-DGSLQGIRLGVCTPYFEDAD-PDVVTRCKDALRALTDAGATVVE 383

Query: 241 XXXXXXXXARIAHLLTIGTELT-TVAKRHKDKMHLFSCPTRSNINVMKLATASDYIVSQQ 299
                       H   I +E+   V  + K +  +F   +R+N+ + +   A+D++ + +
Sbjct: 384 LPPPDLNAILWTHSCIILSEMAEAVLPQLKARASVFGLDSRANLALGRQFRATDFVHALR 443

Query: 300 VRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANFA 359
            R R+ R L  L ++ VD+++TP TA TAP I    L  GE ++ ++  +MRFV+LAN  
Sbjct: 444 HRHRLTRELLALMAD-VDVLVTPTTACTAPAIPESTLPAGESNLPVVDALMRFVRLANLT 502

Query: 360 GVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEE 400
           G PA+SVPAG+D   LP+G+    + Y+E  LLR+ +  E 
Sbjct: 503 GNPALSVPAGFDRAGLPVGVHLTGRPYEEHLLLRLGRVVER 543



>gi|356507431|ref|XP_003522470.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit A-like
           [Glycine max]
          Length = 620

 Score =  240 bits (613), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 138/414 (33%), Positives = 218/414 (52%), Gaps = 8/414 (1%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY     + LLDG+P+A+KDEID   Y T  GT +++   P + DA  ++RLR  GAI
Sbjct: 191 TLRYQRGEPISLLDGVPVAIKDEIDCLPYPTTGGTTWLHKERPCSDDACCVKRLRLCGAI 250

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKT+MHE+G G++  NP     RNPY+T+                 LCP+A+G DGGG
Sbjct: 251 LVGKTNMHELGSGTSGINPHYGPARNPYDTNKIAGGSSSGSASLVSAGLCPVALGVDGGG 310

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P++ CG+ GLK T  R  ++G  PL  +V + G +A +V+D  + Y  ++G+ P  
Sbjct: 311 SVRMPAALCGVVGLKPTFERIPNEGVLPLNWTVGMVGILAGTVEDALIVYAAISGEIPYH 370

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNP---AITTALNNFIDELKLRGAX 237
                     L    +T  +SD+K+  Y  W     +      T  L+   D    +   
Sbjct: 371 KTFSVSTKINLPRLSLTKSISDIKLAKYGKWFDDCSDDVRICCTKTLHMLQDHYSWK--- 427

Query: 238 XXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDK-MHLFSCPTRSNINVMKLATASDYIV 296
                       R+AH +TIG+E +T     K+K         R   ++    +  +Y+ 
Sbjct: 428 IIDVTIPEIEAMRLAHYITIGSECSTALDSFKEKNFAELGWDVRVAQSIYGAFSGLEYLK 487

Query: 297 SQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLA 356
           +Q++R R ++    +F+ + D+I++P T +TA +I   AL  GE+D    + ++R+    
Sbjct: 488 AQKMRNRQLQFHKKIFA-EADVIVSPTTGVTAYQIQDDALQTGELDYVNGAALVRYSIAG 546

Query: 357 NFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
           NF G+PAV+VP G+D   LPIGLQFI + + EATL+ +A   + I  +  +KP 
Sbjct: 547 NFLGLPAVTVPVGFDRLGLPIGLQFIGRPWSEATLIHLAFAMQAICMSEYRKPE 600



>gi|356527536|ref|XP_003532365.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit A-like
           [Glycine max]
          Length = 609

 Score =  240 bits (613), Expect = 6e-61,   Method: Compositional matrix adjust.
 Identities = 145/417 (34%), Positives = 221/417 (52%), Gaps = 16/417 (3%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY   + + +LDG+P+A+KDE+D   Y T  GTK+++     T DA  ++RLR  GAI
Sbjct: 191 TLRYQKGTPISVLDGVPVAIKDEMDCLPYPTTGGTKWLHKERLCTDDACCVKRLRLCGAI 250

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKT+MHE+G G++  NP     RNPY+ +                 LCP+A+G DGGG
Sbjct: 251 LVGKTNMHELGVGTSGINPHYGAARNPYDINKISGGSSSGSAAVVSAGLCPVALGVDGGG 310

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGK--DP 178
           SVR+P+S CG+ GLK T GR    G  PL  +V + G +A +V+D  + Y  + G+    
Sbjct: 311 SVRMPASLCGVVGLKPTFGRVPHSGVLPLNWTVGMVGILAGTVEDALITYAAIGGEISSH 370

Query: 179 KDPNTLHQ-PLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNP---AITTALNNFIDELKLR 234
           +  N L +  LP L    +T  + D+K+  Y  W     +      + A+    D     
Sbjct: 371 QSSNMLTKINLPLL---PLTKSICDIKLAKYGKWFDDCSDDVRLCCSHAMRKLQDHY--- 424

Query: 235 GAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHL--FSCPTRSNINVMKLATAS 292
           G              R+AH LTIG+E +T      +K H   F    R  +N+    +  
Sbjct: 425 GWKTIDVTIPDIEAMRLAHYLTIGSECSTWFDSFGEK-HFAEFGWDARVALNIYGAFSGK 483

Query: 293 DYIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRF 352
           +YI +Q++R R ++    +F+ + D+I++P T +TA  I   AL  GE+D    + ++R+
Sbjct: 484 EYIKAQKLRNRQLQFHMKIFA-EADVIVSPTTGVTAYSIQDDALKTGELDYVNGAALVRY 542

Query: 353 VQLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKP 409
               NF G+PAV+VP GYD   LPIGLQFI + + EATL+ +A   + I  +  +KP
Sbjct: 543 SISGNFLGLPAVTVPVGYDKLGLPIGLQFIGRPWAEATLIHLAFAMQAICLSEYRKP 599



>gi|119494944|ref|XP_001264270.1| N-acylethanolamine amidohydrolase, putative [Neosartorya fischeri
           NRRL 181]
 gi|119412432|gb|EAW22373.1| N-acylethanolamine amidohydrolase, putative [Neosartorya fischeri
           NRRL 181]
          Length = 616

 Score =  239 bits (611), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 155/424 (36%), Positives = 221/424 (52%), Gaps = 17/424 (4%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+RY     LG  DG+P+AVKDE+ V+GY  N+G+  +++       +  +++  E GAI
Sbjct: 167 TQRYKQGQPLGPFDGVPVAVKDEVHVEGYRRNLGSN-LDFKGGFEGTSWCVQKWEEAGAI 225

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           I+GKT+MHE+G  +TNNNP   TPRNP+N  YY               L PIA+G DGGG
Sbjct: 226 IIGKTTMHELGLDTTNNNPNYGTPRNPHNQRYYCGGSSGGSGYAVGAGLVPIALGADGGG 285

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDP-- 178
           S+RIPSSFCGI+GLK T  R S      LA +V V GPMAAS+DDLALAY +MA   P  
Sbjct: 286 SIRIPSSFCGIWGLKPTHNRVSGFPTASLAPTVGVYGPMAASIDDLALAYRLMAAPAPAT 345

Query: 179 KDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXX 238
           +DP +   P P         +     IG+   W  + + P +    +  +D  + +    
Sbjct: 346 EDPVSATFPDPMSSISSTAQRPRSKTIGIVPSWIDRAE-PPVRAVFDAALDFYRKQDYTV 404

Query: 239 XXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINV-MKLATASDYIVS 297
                      + AH+LTI  E+ +  K    ++   + P +  +++ M   TA D I +
Sbjct: 405 VDIAIPYLPEGQRAHVLTIMAEIASGLK--PAQIGALTAPNKVLVSMGMWQITAQDLIAA 462

Query: 298 QQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIYPRA-LAHGEVDVTMISDIMRFVQL 355
           Q++R  +M  L  LF      LILTP + I   +I     LA G  D       M +V L
Sbjct: 463 QRLRNLLMAHLAYLFRQHPGLLILTPTSPIPGWRIESETDLARGVSDGKASVRNMEYVWL 522

Query: 356 ANFAGVPAVSVPAGYDDNN----LPIGLQFIAKWYDEATLLRIAKTSEEIL---GNRRKK 408
           ANF+G PA+S PAGY   +    +P+G+  + +W  E  L+  A+  E IL   GN+  K
Sbjct: 523 ANFSGCPAISCPAGYSGGDKGGRVPVGVMAMGEWGTEEDLIAFARDGEAILDLPGNQPSK 582

Query: 409 PSDK 412
            SD+
Sbjct: 583 -SDR 585



>gi|242070201|ref|XP_002450377.1| hypothetical protein SORBIDRAFT_05g004540 [Sorghum bicolor]
 gi|241936220|gb|EES09365.1| hypothetical protein SORBIDRAFT_05g004540 [Sorghum bicolor]
          Length = 618

 Score =  239 bits (610), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 140/413 (33%), Positives = 214/413 (51%), Gaps = 8/413 (1%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY   + L  +DG+ +AVKDEID   Y T  GT+++       +DA  + +LR  GA+
Sbjct: 200 TRRYQQGAPLSAMDGVLVAVKDEIDCLPYPTTGGTRWLGSARRCVADAACVAQLRACGAV 259

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           + GK +MHE+G G++  NP   + RNPYN                   LCP+A+G DGGG
Sbjct: 260 MAGKANMHELGAGTSGINPHHGSTRNPYNVGRVSGGSSGGSAAAVCAGLCPVALGADGGG 319

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P++ CG+ G K T GR S+ G  PL  +V + G +AA+V+D  +AY  +A  D   
Sbjct: 320 SVRMPAALCGVVGFKPTAGRLSNSGLLPLNWTVGMPGILAATVEDTLIAYAAIA--DQSK 377

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR-GAXXX 239
           P+ L QP   L     T  + ++++  Y+ W     +  I +     +  L+   G    
Sbjct: 378 PSPLQQPELNLPLLTSTRSIPNIRLAKYAKWFDD-SSEDIRSLCGKALQMLRTHYGWESV 436

Query: 240 XXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHL--FSCPTRSNINVMKLATASDYIVS 297
                     R+AH +T+G+E T    ++ + M         R  ++     ++ DY+ S
Sbjct: 437 EVTVPEIEEMRLAHYVTMGSECTASLAKYLNNMDRSEIGWDVRIALSAYGSFSSRDYLNS 496

Query: 298 QQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLAN 357
           Q++R R M     +F    D I+TP T +TA  +   AL+ GE+D    + ++R+    N
Sbjct: 497 QRLRCRQMYFHEKIFET-ADAIVTPMTGVTAYALQDDALSTGELDYINGAALVRYSIAGN 555

Query: 358 FAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRR-KKP 409
           F G+PA++VP GYD   LP+GLQFI + + EATLL +A   +E  G    KKP
Sbjct: 556 FLGLPAITVPVGYDREGLPVGLQFIGRPWSEATLLHLAYAMQESCGKEHCKKP 608



>gi|238484307|ref|XP_002373392.1| N-acylethanolamine amidohydrolase, putative [Aspergillus flavus
           NRRL3357]
 gi|220701442|gb|EED57780.1| N-acylethanolamine amidohydrolase, putative [Aspergillus flavus
           NRRL3357]
          Length = 612

 Score =  239 bits (609), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 155/413 (37%), Positives = 225/413 (54%), Gaps = 17/413 (4%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+RY +   LG LDGIP+ VKDE+ ++GY   +G+K +++    T  +  +++  E GAI
Sbjct: 167 TKRYKDGKPLGPLDGIPVVVKDEVHIEGYRRTLGSK-LDFTGEFTGTSWCVKKWEEAGAI 225

Query: 61  ILGKTSMHEIGFGSTNNNPFVC---TPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRD 117
           I+GKT+MHE+G  +T+ N       TPRNP+N +YY               L PIA+G D
Sbjct: 226 IVGKTTMHELGLDNTDTNNNNPNHGTPRNPHNRNYYCGGSSGGSGYAVGAGLAPIALGAD 285

Query: 118 GGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKD 177
           GGGS+RIPSSFCGI+GLK + GR S      LA +V V GPMAAS+DDLALAY +MA   
Sbjct: 286 GGGSIRIPSSFCGIWGLKPSHGRISGTPTVSLAQTVGVYGPMAASIDDLALAYRIMAAPA 345

Query: 178 P--KDPN--TLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKL 233
           P  +DP+  +   PL TL  +  ++K     IG+   W  + + P +    +  +D  + 
Sbjct: 346 PAEQDPSSASFPDPLTTLQVW--SSKPRTKTIGIARDWIDRAE-PPVRAVFDRALDFYRK 402

Query: 234 RGAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINV-MKLATAS 292
           +G              + AH+LTI TE+ +      D++   S P +  +++ M   +  
Sbjct: 403 QGYEVIDITIPYLPEGQRAHILTIMTEIASGLT--PDQVGKLSAPNKVLVSMGMWQISGQ 460

Query: 293 DYIVSQQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIYPRA-LAHGEVDVTMISDIM 350
           D++ SQ++R+ IM  L  LF      LILTP T I   +I   A L+ G  D       M
Sbjct: 461 DFLASQRLRSIIMSHLAYLFGKHPGLLILTPTTPIPGWRINGEADLSRGLSDGKSSVRNM 520

Query: 351 RFVQLANFAGVPAVSVPAGY-DDNNLPIGLQFIAKWYDEATLLRIAKTSEEIL 402
            +V LANF G PA++ PAGY  D  +P+GL  + +W  E  L+  A+  E IL
Sbjct: 521 EYVWLANFTGCPAINCPAGYVQDTRVPVGLMAMGEWGTEEDLIAFARDGEAIL 573



>gi|70996204|ref|XP_752857.1| N-acylethanolamine amidohydrolase [Aspergillus fumigatus Af293]
 gi|66850492|gb|EAL90819.1| N-acylethanolamine amidohydrolase, putative [Aspergillus fumigatus
           Af293]
 gi|159131610|gb|EDP56723.1| N-acylethanolamine amidohydrolase, putative [Aspergillus fumigatus
           A1163]
          Length = 625

 Score =  239 bits (609), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 157/433 (36%), Positives = 225/433 (51%), Gaps = 26/433 (6%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+RY     LG LDG+P+AVKDE+ V+GY  N+G+  +++       +  +++  E GAI
Sbjct: 167 TQRYKQGQPLGPLDGVPVAVKDEVHVEGYRRNLGSN-LDFKGGFEGTSWCVQKWEEAGAI 225

Query: 61  ILGKTSMHEIGF---------GSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCP 111
           I+GKT+MHE+G           +TNNNP   TPRNP+N DYY               L P
Sbjct: 226 IIGKTTMHELGLEISQAHPEADTTNNNPNYGTPRNPHNQDYYCGGSSGGSGYAVGAGLVP 285

Query: 112 IAIGRDGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYY 171
           IA+G DGGGS+RIPSSFCGI+GLK T  R S      LA +V V GPMAAS+DDLALAY 
Sbjct: 286 IALGADGGGSIRIPSSFCGIWGLKPTHNRVSGFPTASLAPTVGVYGPMAASIDDLALAYR 345

Query: 172 VMAGKDP--KDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFID 229
           +MA   P  +DP +   P P         +     IG+   W  + + P +    +  +D
Sbjct: 346 LMAAPAPATEDPVSATFPDPMSSISSTAQRPRSKTIGIVPSWIDRAE-PPVRAVFDAALD 404

Query: 230 ELKLRGAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINV-MKL 288
             + +G              + AH+LTI +E+++       ++   + P +  +++ M  
Sbjct: 405 FYRKQGYTVVDIAIPYLPEGQRAHVLTIMSEISS--GLTPAQIGALTAPNKVLVSMGMWQ 462

Query: 289 ATASDYIVSQQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIYPRA-LAHGEVDVTMI 346
            TA D I +Q++R  +M  L  LF      LILTP + I   +I     LA G  D    
Sbjct: 463 ITAQDLIAAQRLRNLLMSHLAYLFRQHPGLLILTPTSPIPGWRIESETDLARGVSDGKAS 522

Query: 347 SDIMRFVQLANFAGVPAVSVPAGYDDNN----LPIGLQFIAKWYDEATLLRIAKTSEEIL 402
              M +V LANF+G PA+S PAGY   +    +P+G+  + +W  E  L+  A+  E IL
Sbjct: 523 VRNMEYVWLANFSGCPAISCPAGYSGGDKGGRVPVGVMAMGEWGSEEDLIAFARDGEAIL 582

Query: 403 ---GNRRKKPSDK 412
              GN+  K SD+
Sbjct: 583 DLPGNQPSK-SDR 594



>gi|358370116|dbj|GAA86728.1| N-acylethanolamine amidohydrolase [Aspergillus kawachii IFO 4308]
          Length = 614

 Score =  238 bits (607), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 151/420 (35%), Positives = 227/420 (54%), Gaps = 26/420 (6%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+RY +   LG +DGIP+A+KDE+ ++GY   +G+K +++    T  +  +++  + GAI
Sbjct: 162 TQRYKDGKPLGPMDGIPVAIKDEVHMEGYRRTLGSK-LDFTGEFTGTSWCVKQWEDAGAI 220

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKT+MHE+G  +TNNNP   TPRNP+N DYY               L PIA+G D GG
Sbjct: 221 VIGKTTMHELGLDTTNNNPNFGTPRNPHNPDYYCGGSSGGSGYAVSAGLVPIALGADSGG 280

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPK- 179
           S+RIP+SFCGI+GLKTT GR S      LA +  V GP+A+++DDLALAY +MA   P+ 
Sbjct: 281 SIRIPASFCGIWGLKTTHGRVSGSPTISLASTTGVYGPLASNIDDLALAYRLMATPAPES 340

Query: 180 -DPNTLHQPLPTLHGFHVT--NKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLRG 235
            DP +   P P LH    T  N  +   IG+   W  +  +P +    N  +D   KL+ 
Sbjct: 341 SDPVSASFPSP-LHTLPSTPNNNNTSKTIGIVRPWIDRA-SPEVLAIFNATLDHYRKLKN 398

Query: 236 AXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYI 295
                         + AH LTI +E+T+     +      +    +++ + ++    D++
Sbjct: 399 YTIIDITIPYLPEGQKAHALTILSEVTSSLTPSQISHLTPANKVMASMGMWQI-KGQDFL 457

Query: 296 VSQQVRTRIMRTLNNLFSNQVDL-ILTPATAITAPKIYPRALAHGEVDVTM-ISDI---- 349
            +Q++R  +M  L +LF     L I+TP T I   KI     A GE D+   +SD     
Sbjct: 458 AAQRLRNCLMTHLAHLFQKHPCLMIVTPTTPIPGWKI-----AGGEADLKRGVSDGNSTV 512

Query: 350 --MRFVQLANFAGVPAVSVPAGYD----DNNLPIGLQFIAKWYDEATLLRIAKTSEEILG 403
             M +V LANF+G PA+S PAGYD       +P+G+  + +W  E  L+  A+  E +LG
Sbjct: 513 RNMEYVWLANFSGCPAISCPAGYDVVDGGRRVPVGVMAMGEWGSEEELIEFARDGEGVLG 572



>gi|356518808|ref|XP_003528069.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit A-like
           [Glycine max]
          Length = 621

 Score =  238 bits (606), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 137/414 (33%), Positives = 217/414 (52%), Gaps = 8/414 (1%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY     + +LDG+P+A+KDEID   Y T  GT +++   P + DA  ++RLR  GAI
Sbjct: 191 TLRYQRGEPISVLDGVPVAIKDEIDCLPYPTTGGTTWLHKERPCSDDACCVKRLRLCGAI 250

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKT+MHE+G G++  NP     RNPY+T+                 LCP+A+G DGGG
Sbjct: 251 LVGKTNMHELGSGTSGINPHYGPARNPYDTNKIAGGSSSGSASLVSAGLCPVALGVDGGG 310

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P++ CG+ GLK T  R   +G  PL  +V + G +A +V+D  + Y  ++G+ P  
Sbjct: 311 SVRMPAALCGVVGLKPTFERIPHEGVLPLNWTVGMVGILAGTVEDALIVYAAISGEIPYH 370

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNP---AITTALNNFIDELKLRGAX 237
                     L    +T  +SD+K+  Y  W     +      T  L+   D    +   
Sbjct: 371 KTFSVSTKINLPRLSLTKSISDIKLAKYGKWFDDCSDDVRICCTKTLHKLQDHYNWK--- 427

Query: 238 XXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDK-MHLFSCPTRSNINVMKLATASDYIV 296
                       R+AH +TIG+E +T     K+K         R   ++    ++ +Y+ 
Sbjct: 428 IIDVTIPEIEAMRLAHYITIGSECSTALDSFKEKNFAELGWDVRVAQSIYGAFSSLEYLK 487

Query: 297 SQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLA 356
           +Q++R R ++    +F+ + D+I++P T +TA  I   AL  GE+D    + ++R+    
Sbjct: 488 AQKMRNRQLQFHKKIFA-EADVIVSPTTGVTAYPIQDDALQTGELDYVNGAALVRYSIAG 546

Query: 357 NFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
           NF G+PAV+VP G+D   LPIGLQFI + + EATL+ +A   + I  +  +KP 
Sbjct: 547 NFLGLPAVTVPVGFDRLGLPIGLQFIGRPWSEATLIHLAFAMQVICMSEYRKPE 600



>gi|494833495|gb|EON69450.1| hypothetical protein W97_08710 [Coniosporium apollinis CBS 100218]
          Length = 592

 Score =  237 bits (604), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 157/425 (36%), Positives = 217/425 (51%), Gaps = 28/425 (6%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY   +SLG LDG+P+AVKDE+D+ GY+  +G++  ++ N     +  + +  E+GAI
Sbjct: 168 TRRYKEGASLGCLDGVPVAVKDEVDLNGYKKCLGSR-KDFTNKLDETSWCVTKWEEQGAI 226

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           +LGK +MHE+G  +TNNNP   TPRNP+N  YY               L P A+G DGGG
Sbjct: 227 VLGKLNMHELGLDTTNNNPNYGTPRNPFNEHYYTGGSSGGSGYAVGAGLIPFALGADGGG 286

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           S+RIPS++CGI+GLKT+ GR S      LA +  V GPMAA++ DL +AY VMA  DP D
Sbjct: 287 SIRIPSNYCGIFGLKTSHGRISGRPTPSLAGTTGVLGPMAANMVDLEMAYRVMATPDPDD 346

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNP---AITTALNNFIDELKLRGAX 237
           P +     P  H    T  L     GVY  W  + D P   A   AL+  I +L   G  
Sbjct: 347 PTSALFAPPRPHNGDRTKLL-----GVYKPWFDRADPPVRDACEKALDYLITKL---GYS 398

Query: 238 XXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYIVS 297
                       +IAH LTI   L+ +A    D   L + P +  I+V     + D++ +
Sbjct: 399 IIDITIPLVHEGQIAHALTI---LSEIASSFPDVTGL-TAPNKVLISVGSKCPSIDFLQA 454

Query: 298 QQVRTRIMRTLNNLFSNQVDL-ILTPATAITAPKIYPRA--LAHGEVDVTMISDIMRFVQ 354
           Q++R  +M  L  LF     L I+TP T      I      L +G  D  M    M +V 
Sbjct: 455 QKLRNLLMEHLAYLFKMHPGLVIVTPTTPGAGWHIQGGQGDLKYGVSDANMSVRSMEYVW 514

Query: 355 LANFAGVPAVSVPAGYDD-----NNLPIGLQFIAKWYDEATLLRIAKTSE----EILGNR 405
           +ANF GVPA++ P GY D       +P+GL  + +W  E  L+      E    E L   
Sbjct: 515 MANFCGVPALTCPVGYVDPVEGEGKIPVGLMGMGEWGSEDALIEWGYDGEAWLNEGLPGG 574

Query: 406 RKKPS 410
           RK+P+
Sbjct: 575 RKRPA 579



>gi|242778166|ref|XP_002479184.1| N-acylethanolamine amidohydrolase, putative [Talaromyces stipitatus
           ATCC 10500]
 gi|218722803|gb|EED22221.1| N-acylethanolamine amidohydrolase, putative [Talaromyces stipitatus
           ATCC 10500]
          Length = 609

 Score =  236 bits (602), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 162/410 (39%), Positives = 229/410 (55%), Gaps = 27/410 (6%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKF-INYGNPATSDATIIERLREKGA 59
           T+RY     LG LDG+P+AVKDE+ +KGY+  +G+K   ++G   TS    +E+  E GA
Sbjct: 166 TKRYREGKPLGPLDGVPVAVKDEVHMKGYKRTLGSKSDFSHGFDVTS--WCVEKWEEAGA 223

Query: 60  IILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGG 119
           I++GKT+MHEIG  +TNNNP   TPRNPYN +YY               L PIA+G DGG
Sbjct: 224 IVIGKTTMHEIGIDTTNNNPNTGTPRNPYNRNYYCGGSSGGSGYALATGLVPIALGADGG 283

Query: 120 GSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPK 179
           GS+RIPSS+CG+YGLK T GR S      LA SV V GPM++++DDLALAY +MA   P 
Sbjct: 284 GSIRIPSSYCGVYGLKPTHGRISAVPTPSLAPSVGVYGPMSSNIDDLALAYRLMAAPPPI 343

Query: 180 DPNTLHQPLPTLHGFHVTNKLSDLK-------IGVYSMWNKQVDNPAITTALNNFIDELK 232
           + +++        GF  +N L++++       IGV+  W  + + PA+    +  I  LK
Sbjct: 344 EADSIAS------GF--SNPLAEIQFNTNTRTIGVFQAWIDRSE-PAVRNIFDQIIKHLK 394

Query: 233 L-RGAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVM-KLAT 290
             +G              + AH LTI  EL        D   L    T+  I V    +T
Sbjct: 395 TQKGYNIIDIEIPYLPEGQQAHALTILAEL-AAGIPASDVTSLLPH-TKVLITVSGSKST 452

Query: 291 ASDYIVSQQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIY--PRALAHGEVDVTMIS 347
            +DYI +Q++R+ +M  L+ LF+     LILTP   I   +I    + L+HG +D    +
Sbjct: 453 GTDYIAAQKLRSLLMSHLSYLFTTHPGLLILTPTAPIAGCEIKGGEKDLSHGVMDTFTST 512

Query: 348 DIMRFVQLANFAGVPAVSVPAGYDDN-NLPIGLQFIAKWYDEATLLRIAK 396
             M +V LANF G PA+SVP GYDD+  +P+G+  + +W  E +LL  A+
Sbjct: 513 RSMEYVWLANFTGCPAISVPGGYDDSTGIPVGVMAMGEWGSEESLLEFAR 562



>gi|225438343|ref|XP_002272907.1| PREDICTED: fatty acid amide hydrolase [Vitis vinifera]
 gi|296082617|emb|CBI21622.3| unnamed protein product [Vitis vinifera]
          Length = 610

 Score =  236 bits (601), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 145/413 (35%), Positives = 212/413 (51%), Gaps = 5/413 (1%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY     + +LDG+PIA+KDEID   Y T  GT +++      +DA  ++RLR  GAI
Sbjct: 191 TLRYERGEPISVLDGVPIAIKDEIDCTPYPTTGGTTWLHKVRDCKNDACCVQRLRSCGAI 250

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKT+MHE+G G++  NP     RNPYNT                  LCP A+G DGGG
Sbjct: 251 LVGKTNMHELGAGTSGINPHYGATRNPYNTSKVTGGSSSGSAAVVSAGLCPAALGVDGGG 310

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P++ CG+ G K T GR S  G  PL  +V + G +A++V+D  + Y  ++G+    
Sbjct: 311 SVRMPAALCGVVGFKPTFGRVSHSGVLPLNWTVGMVGILASTVEDAFIVYAAISGETSSH 370

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLRGAXXX 239
             T+  P         TN +S++K+  Y  W     +  I    +  +D+L +  G    
Sbjct: 371 QPTMLLPKVCFPLLKSTNSISNIKLAKYGEWFNDCSDD-IKVCCSQALDKLHEHYGWETV 429

Query: 240 XXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHL--FSCPTRSNINVMKLATASDYIVS 297
                     R+AH LTIG E TT        + +      TR    V     + +Y+ +
Sbjct: 430 EVTVPEIETMRLAHYLTIGAECTTSLSSLLQNVSIEELGWDTRVAFRVYGSFDSMEYLNA 489

Query: 298 QQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLAN 357
           Q++R R M+    +F  + D+I+TP T  TA  I   AL  GE+D    +  +R+    N
Sbjct: 490 QRIRNRQMQFHKKIF-EKADVIVTPTTGATAYSIMNDALKTGELDYINGAAFVRYQIAGN 548

Query: 358 FAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
           F G+PAV+VP GYD   LPIGLQFI + + E TL+ IA   + +  +  KKP 
Sbjct: 549 FLGLPAVTVPIGYDKLGLPIGLQFIGRQWSEPTLIHIAHAMQALCISDYKKPE 601



>gi|154282885|ref|XP_001542238.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
 gi|150410418|gb|EDN05806.1| conserved hypothetical protein [Ajellomyces capsulatus NAm1]
          Length = 624

 Score =  236 bits (601), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 148/411 (36%), Positives = 222/411 (54%), Gaps = 22/411 (5%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           TERY     LG +DG+P+A+KDE  ++GY+  +G++F ++     S +  +++  E GAI
Sbjct: 167 TERYKIRKPLGPMDGVPVAIKDEAHLEGYKRTLGSRF-DFTGKINSTSWCVKKWEEAGAI 225

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKTSMHE+G G+TNNNP+  TPRNP+N DYY               L PIA+G DGGG
Sbjct: 226 VVGKTSMHELGLGTTNNNPYTGTPRNPHNKDYYAGGSSGGSGYVVGAGLVPIALGADGGG 285

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPK- 179
           S+R+PS FCGIYG+KTT GR S      +A +  V G M +S+DDLAL+Y +MA  DP  
Sbjct: 286 SIRLPSGFCGIYGIKTTHGRVSAHPTVRIASTTGVLGTMTSSLDDLALSYRLMASPDPDS 345

Query: 180 -DPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXX 238
            + ++   PL T+           + IG++  W  + D PA+    N  ID  + +    
Sbjct: 346 MESSSFPDPLSTIPSSSALASRPKV-IGIFLDWVNRAD-PAVLALFNKAIDHYRTKNYTV 403

Query: 239 XXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINV-MKLATASDYIVS 297
                      + AH LTI  E+++  K   D++   +   +  +++    A+A D++ +
Sbjct: 404 VDISIPLLAEGQKAHSLTILAEISSTVK--PDQIRQLTPQNKILVSLGANQASARDFLAA 461

Query: 298 QQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYPRALAHGEVD-VTMISD------I 349
           Q++R+ +M  L  LF     LI+ TP T +   KI     A G+ D V+ +SD       
Sbjct: 462 QRLRSLLMSHLAFLFQKHPGLIIVTPTTPMPGWKI-----AKGDADLVSGVSDENSSLRA 516

Query: 350 MRFVQLANFAGVPAVSVPAGY-DDNNLPIGLQFIAKWYDEATLLRIAKTSE 399
           M +V LANF G PA+S P G  D   +P GL  + +W  E  L+  A+  E
Sbjct: 517 MEYVYLANFTGCPALSRPMGLIDGPQVPAGLMGMGEWCSEEMLIEWARDGE 567



>gi|168000260|ref|XP_001752834.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162695997|gb|EDQ82338.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 590

 Score =  236 bits (601), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 143/430 (33%), Positives = 212/430 (49%), Gaps = 31/430 (7%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           TERY   + L +LDG+PIAVKDEID   Y T  GT ++        DA  ++RLR  GA+
Sbjct: 161 TERYKQGTPLSVLDGVPIAVKDEIDCLPYRTTGGTTWLGKVREVKEDAEAVKRLRSCGAV 220

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKT+MHE+G G+T  NP     RNP+N                   +CP A+G DGGG
Sbjct: 221 MVGKTNMHELGMGTTGINPHYGATRNPHNILRVSGGSSGGSSAAVAAGICPAALGVDGGG 280

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P+  CG+ G K T GR S+ G  PL  +V + G +  SV+D  + Y  M G  P D
Sbjct: 281 SVRMPAGLCGVVGFKPTFGRTSNAGFLPLNWTVGMLGTLTGSVEDALIMYAAMHGPRPDD 340

Query: 181 -----PNTLHQPL---PTLHGFHVTNKLSDLKIGVYSMWNKQVDNPA----------ITT 222
                P   + PL   P     +    + DLK   +S W    D P           + T
Sbjct: 341 DIVSFPPPANLPLLKDPDEASTNTAKVMGDLKFAKFSKWFDDCDEPVRNACHRALQLVQT 400

Query: 223 ALNNFIDELKLRGAXXXXXXXXXXXXARIAHLLTIGTELTTV--AKRHKDKMHLFSCPTR 280
             N  + E+ +                R+AH +TIG+E  T       +  +       R
Sbjct: 401 TFNTKVVEVTI----------PEIEEMRLAHFVTIGSECCTSLGVDYRESGLKASGADVR 450

Query: 281 SNINVMKLATASDYIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGE 340
              ++       ++I +Q++R R M   N +F  + ++I++P T  TAP I   A   GE
Sbjct: 451 VTSSIYGSFNNREFIGAQRMRFRQMHYHNEIF-KKANIIISPTTGATAPLIRRAAEKCGE 509

Query: 341 VDVTMISDIMRFVQLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEE 400
           +D  + + +MR+    NF G+PA+SVP G+D + LPIG+Q I + + EATLL++A   E 
Sbjct: 510 LDYVVGAKLMRYQIAGNFLGLPALSVPVGHDADGLPIGMQLIGRPWSEATLLQVAAVIER 569

Query: 401 ILGNRRKKPS 410
           +    +++P 
Sbjct: 570 LCSPFQRRPE 579



>gi|325090999|gb|EGC44309.1| N-acylethanolamine amidohydrolase [Ajellomyces capsulatus H88]
          Length = 627

 Score =  235 bits (600), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 149/411 (36%), Positives = 221/411 (53%), Gaps = 22/411 (5%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           TERY     LG +DG+P+A+KDE  ++GY+  +G++F ++     S +  +++  E GAI
Sbjct: 167 TERYKIRKPLGPMDGVPVAIKDEAHLEGYKRTLGSRF-DFTGKINSTSWCVKKWEEAGAI 225

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKTSMHE+G G TNNNP   TPRNP+N DYY               L PIA+G DGGG
Sbjct: 226 VVGKTSMHELGLGMTNNNPCTGTPRNPHNKDYYTGGSSGGSGYVVGAGLVPIALGADGGG 285

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPK- 179
           S+RIPS FCGIYG+KTT GR S      +A +  V G M +S+DDLAL+Y +MA  DP  
Sbjct: 286 SIRIPSGFCGIYGIKTTHGRVSAHPTLRIASTTGVLGTMTSSLDDLALSYRLMASPDPDS 345

Query: 180 -DPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXX 238
            + ++   PL T+           + IG++  W  + D PA+    N  ID  + +    
Sbjct: 346 MESSSFPDPLSTIPSSSALASRPKV-IGIFPDWVNRAD-PAVLALFNKAIDHYRTKNYNV 403

Query: 239 XXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINV-MKLATASDYIVS 297
                      + AH LTI  E+++  K   D++   +   +  +++    A+A D++ +
Sbjct: 404 VDISIPLLAEGQKAHSLTILAEISSTIK--PDQIRQLTPQNKILVSLGANQASAQDFLAA 461

Query: 298 QQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYPRALAHGEVD-VTMISD------I 349
           Q++R+ +M  L  LF     LI+ TP T +   KI     A G+ D V+ +SD       
Sbjct: 462 QRLRSLLMSHLAFLFQKHPGLIIVTPTTPMPGWKI-----AKGDADLVSGVSDENSSLRA 516

Query: 350 MRFVQLANFAGVPAVSVPAGY-DDNNLPIGLQFIAKWYDEATLLRIAKTSE 399
           M +V LANF G PA+S P G  D   +P+GL  + +W  E  L+  A+  E
Sbjct: 517 MEYVYLANFTGCPALSRPMGLIDGPQVPVGLMGMGEWCSEEMLIEWARDGE 567



>gi|488715953|ref|WP_002639829.1| amidase [Chondromyces apiculatus]
 gi|397086735|gb|EJJ17824.1| amidase family protein [Myxococcus sp. (contaminant ex DSM 436)]
          Length = 557

 Score =  234 bits (598), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 143/407 (35%), Positives = 217/407 (53%), Gaps = 8/407 (1%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           TER      L +LDG+P+ +KDE+D+ G+ T +GT+F      AT+D+T+  RL+  GAI
Sbjct: 147 TERLRAGRPLSVLDGVPVVLKDEVDLAGFPTTLGTRFRT--QVATADSTVAARLKAAGAI 204

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ILGK +M+EIG      NP     RNP++T                  LCP++IG DGGG
Sbjct: 205 ILGKANMNEIGINPIGLNPHHGAARNPWDTGRITGGSSSASAAAVAAGLCPVSIGADGGG 264

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           S+RIP++ CGI GLK T GR  + G  PL  +V   GPM  +VDD+A AY ++AG D  D
Sbjct: 265 SIRIPAALCGIVGLKATWGRIPETGVPPLCWNVGHVGPMGLTVDDVAAAYALLAGPDGHD 324

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXXXX 240
             +  Q    L G+     LS +++G+   W+   D  A   A                 
Sbjct: 325 LVSQGQSPHHLSGYE-DGALSGVRLGI--CWDYFEDADADVVARCKEAVAALTAAGARVV 381

Query: 241 XXXXXXXXARI-AHLLTIGTELT-TVAKRHKDKMHLFSCPTRSNINVMKLATASDYIVSQ 298
                   A +  H   I +E++ ++    K+ +  F   TR+N+ + +   A+D + + 
Sbjct: 382 EVPPPDLNAVLWTHSCIILSEMSESMGPSMKEHLSDFGLDTRTNLAIGRHFRATDLVHAL 441

Query: 299 QVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANF 358
           + R R+ R +    ++ VD+ +TP TA TAP I   AL  GE ++ ++  +MRFV+LAN 
Sbjct: 442 RHRHRLTREVLAQMAD-VDVFVTPTTASTAPVIPEAALPDGESNLPVVDALMRFVRLANL 500

Query: 359 AGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNR 405
            G P++SVPAG+D+  LP+G+Q   + Y+E  LLR+ +  E    +R
Sbjct: 501 TGFPSLSVPAGFDEEGLPVGVQLTGRPYEEHLLLRLGRVVERASEHR 547



>gi|240274662|gb|EER38178.1| N-acylethanolamine amidohydrolase [Ajellomyces capsulatus H143]
          Length = 627

 Score =  233 bits (594), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 148/411 (36%), Positives = 221/411 (53%), Gaps = 22/411 (5%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           TERY     LG +DG+P+A+KDE  ++GY+  +G++F ++     S +  +++  E GAI
Sbjct: 167 TERYKIRKPLGPMDGVPVAIKDEAHLEGYKRTLGSRF-DFTGKINSTSWCVKKWEEAGAI 225

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKTSMHE+G G TNNNP   TPRNP+N DYY               L PIA+G DGGG
Sbjct: 226 VVGKTSMHELGLGMTNNNPCTGTPRNPHNKDYYTGGSSGGSGYVVGAGLVPIALGADGGG 285

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAG--KDP 178
           S+RIPS FCGIYG+KTT GR S      +A +  V G M +S+DDLAL+Y +MA   +D 
Sbjct: 286 SIRIPSGFCGIYGIKTTHGRVSAHPTLRIASTTGVLGTMTSSLDDLALSYRLMASPDRDS 345

Query: 179 KDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXX 238
            + ++   PL T+           + IG++  W  + D PA+    N  ID  + +    
Sbjct: 346 MESSSFPDPLSTIPSSSALASRPKV-IGIFPDWVNRAD-PAVLALFNKAIDHYRTKNYNV 403

Query: 239 XXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINV-MKLATASDYIVS 297
                      + AH LTI  E+++  K   D++   +   +  +++    A+A D++ +
Sbjct: 404 VDISIPLLAEGQKAHSLTILAEISSTIK--PDQIRQLTPQNKILVSLGANQASAQDFLAA 461

Query: 298 QQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYPRALAHGEVD-VTMISD------I 349
           Q++R+ +M  L  LF     LI+ TP T +   KI     A G+ D V+ +SD       
Sbjct: 462 QRLRSLLMSHLAFLFQKHPGLIIVTPTTPMPGWKI-----AKGDADLVSGVSDENSSLRA 516

Query: 350 MRFVQLANFAGVPAVSVPAGY-DDNNLPIGLQFIAKWYDEATLLRIAKTSE 399
           M +V LANF G PA+S P G  D   +P+GL  + +W  E  L+  A+  E
Sbjct: 517 MEYVYLANFTGCPALSRPMGLIDGPQVPVGLMGMGEWCSEEMLIEWARDGE 567



>gi|326519260|dbj|BAJ96629.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 609

 Score =  233 bits (594), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 140/414 (33%), Positives = 218/414 (52%), Gaps = 10/414 (2%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY   + L ++DG+ +AVKDEID   Y T  GT+++       +DA  + +LR  GAI
Sbjct: 193 TLRYQTGTPLSVMDGVLVAVKDEIDCLPYPTTGGTRWLGKARACEADAACVAQLRACGAI 252

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           + GKT+MHE+G G++  NP   + RNPYN                   LCP+A+G DGGG
Sbjct: 253 LAGKTNMHELGAGTSGINPHHGSARNPYNVGKVAGGSSSGSAAVVCAGLCPVALGVDGGG 312

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P++ CG+ G K T GR S+ G  PL  +V ++G +A +V+D  +AY  +   D   
Sbjct: 313 SVRMPAALCGVVGFKPTAGRLSNAGVLPLNWTVGMAGILAGTVEDAVVAYSAIV--DQSQ 370

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMW-NKQVDNPAITTALNNFIDELKLR-GAXX 238
           P+ L +P   L     T  +S++++  Y  W N   ++  I +  +  +  L+ + G   
Sbjct: 371 PSYL-RPELNLPMLTSTPSISNVRLAKYGKWFNDSSED--IRSCCDKALQTLRTQYGWET 427

Query: 239 XXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHL--FSCPTRSNINVMKLATASDYIV 296
                      R+AH +TIG+E T    ++ DK+         R  + V    ++  Y+ 
Sbjct: 428 LDVTVPEIEEMRLAHYVTIGSECTASLAKYLDKLKRSEIGWDVRVALAVYGSFSSRAYLN 487

Query: 297 SQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLA 356
           SQ++R R M     +F    D+I++P T +TA  +   AL+ GE+D    + ++R+    
Sbjct: 488 SQRLRNRQMFFHKEIFKT-ADVIVSPMTGVTAYTLQDDALSSGELDYINGAALIRYSIAG 546

Query: 357 NFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
           NF G+PA++V  G D   LPIGLQFI + + EATLL IA   +E      +KP+
Sbjct: 547 NFLGLPAITVMVGQDKGGLPIGLQFIGRPWSEATLLHIAFAMQEACSKNHRKPA 600



>gi|212533461|ref|XP_002146887.1| N-acylethanolamine amidohydrolase, putative [Talaromyces marneffei
           ATCC 18224]
 gi|210072251|gb|EEA26340.1| N-acylethanolamine amidohydrolase, putative [Talaromyces marneffei
           ATCC 18224]
          Length = 611

 Score =  233 bits (593), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 160/428 (37%), Positives = 235/428 (54%), Gaps = 32/428 (7%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKF-INYGNPATSDATIIERLREKGA 59
           T+RY +   LG LDG+P+AVKDE+ +KGY+  +G+K   ++G   TS    +E+  E GA
Sbjct: 166 TKRYRDGKPLGPLDGVPVAVKDEVHLKGYKRTLGSKLDFSHGFDVTS--WCVEKWEEAGA 223

Query: 60  IILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGG 119
           I++GKT+MHEIG  +TNNNP   TPRNPYN +YY               L PIA+G DGG
Sbjct: 224 IVIGKTTMHEIGIDTTNNNPNTGTPRNPYNRNYYCGGSSGGSGYALATGLVPIALGADGG 283

Query: 120 GSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPK 179
           GS+RIP+S+CG+YGLKTT GR S      LA SV V GPMA+S+DDLALAY +MA     
Sbjct: 284 GSIRIPASYCGVYGLKTTHGRISAAPTPSLAPSVGVYGPMASSIDDLALAYRLMAAPPSV 343

Query: 180 DPNTLHQPLPTLHGFHVTNKLSDLK-------IGVYSMWNKQVDNPAITTALNNFIDELK 232
           + +++    P        N L++++       IG+   W  + + P++    +  I  L+
Sbjct: 344 EADSIASGFP--------NPLTEIRSAPSTKTIGICPAWVDRSE-PSVRKIFDQTIHHLE 394

Query: 233 -LRGAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVM-KLAT 290
             +G              + AH LTI  EL   A      ++     T+  I V    +T
Sbjct: 395 NQKGYNIVDIEIPYLPEGQQAHALTILAEL--AAGIPASDVNSLLPHTKVLITVSGSKST 452

Query: 291 ASDYIVSQQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIYPRA--LAHGEVDVTMIS 347
            +DY+ +Q++R+ +M  L +LF+     LILTP  AI   +I   A  L+HG +D    +
Sbjct: 453 GTDYVAAQKLRSLLMSHLAHLFTTHPGLLILTPTVAIPGYEIKGGAKDLSHGVMDALTST 512

Query: 348 DIMRFVQLANFAGVPAVSVPAGY-DDNNLPIGLQFIAKWYDEATLLRIAKTSEEI----- 401
             M +V LANF G PA+S PAGY D + +P+G+  + +W  E +LL   + + ++     
Sbjct: 513 RSMEYVWLANFTGCPAISFPAGYVDGSGIPVGVMAMGEWGSEESLLSFVRDTTDVPGALE 572

Query: 402 LGNRRKKP 409
           +G R + P
Sbjct: 573 VGGRLRTP 580



>gi|414588462|tpg|DAA39033.1| TPA: hypothetical protein ZEAMMB73_232282 [Zea mays]
          Length = 523

 Score =  232 bits (592), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 139/414 (33%), Positives = 217/414 (52%), Gaps = 9/414 (2%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY   + L  +DG+ +AVKDE+D   Y T+ GT+++       +DA  + +LR  GA+
Sbjct: 104 TRRYQQGAPLSAMDGVLVAVKDELDCLPYPTSGGTRWLGSARRCAADAACVAQLRACGAV 163

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           + GK +MHE+G G++  NP     RNPYN                   LCP+A+G DGGG
Sbjct: 164 MAGKANMHELGAGTSGINPHHGATRNPYNVGRVSGGSSGGSAAAVCAGLCPVALGADGGG 223

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P++ CG+ G K T GR S+ G  PL  +V + G +AA+V+D  +AY  +A  D   
Sbjct: 224 SVRMPAALCGVVGFKPTAGRLSNSGLLPLNWTVGMPGILAATVEDTLIAYAAIA--DQSK 281

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR-GAXXX 239
           P+ L QP   L     T  +  +++  Y+ W     +  I +     +  L+   G    
Sbjct: 282 PSPLQQPELNLPMLTRTRSMPSIRLAKYAKWFDD-SSEDIRSLCGKALQMLRTHYGWESV 340

Query: 240 XXXXXXXXXARIAHLLTIGTELT-TVAKRHKDKMHL--FSCPTRSNINVMKLATASDYIV 296
                     R+AH +T+G+E T ++A ++ D M         R  ++     ++ DY+ 
Sbjct: 341 DVTVPEIEEMRLAHYVTMGSECTASLAAKYLDSMDRSEVGWDVRIALSAYGSFSSRDYLS 400

Query: 297 SQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLA 356
           +Q++R R M     +F    D I+TP T +TA  +   AL+ GE+D    + ++R+    
Sbjct: 401 AQRLRCRQMYFHEKIFET-ADAIVTPMTGVTAYALQDDALSTGELDYINGAALVRYSIAG 459

Query: 357 NFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNR-RKKP 409
           NF G+PA++VP GYD   LP+GLQFI + + EATLL +A   +E  G +  +KP
Sbjct: 460 NFLGLPAITVPVGYDRGGLPVGLQFIGRPWSEATLLHLAYAMQEACGKKVLRKP 513



>gi|357160660|ref|XP_003578835.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit A-like
           [Brachypodium distachyon]
          Length = 606

 Score =  232 bits (592), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 140/414 (33%), Positives = 215/414 (51%), Gaps = 10/414 (2%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY   ++L  LDG+ +AVKDEID   Y T  GT+++    P  +DA  +  LR  GA+
Sbjct: 190 TLRYQKGAALSALDGVLVAVKDEIDCMPYPTTGGTRWLGNARPCAADAACVAPLRACGAV 249

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           + GK +MHE+G G++  NP   + RNPY+                   LCP+A+G DGGG
Sbjct: 250 LAGKANMHELGAGTSGINPHHGSARNPYDAGKVAGGSSSGSAAVVCAGLCPVALGVDGGG 309

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P++ CG+ G K T GR S  G  PL  +V ++G +A +V+D  +AY  +   D   
Sbjct: 310 SVRMPAALCGVVGFKPTAGRLSSAGVLPLNWTVGMAGILAGTVEDALVAYSAIV--DHSQ 367

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMW-NKQVDNPAITTALNNFIDELKLR-GAXX 238
           P+ + +P   L     T  +S++K+  Y+ W N   D+  I +  +  +  L+   G   
Sbjct: 368 PSYM-RPELNLPMLTSTPSISNVKLAKYAKWFNDSSDD--IRSCCDKALQTLRTHYGWET 424

Query: 239 XXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHL--FSCPTRSNINVMKLATASDYIV 296
                      R+AH +TIG+E T    ++ DK+         R  + V    ++  Y+ 
Sbjct: 425 LDVTVPEIEEMRLAHYVTIGSECTASLAKYLDKLKRSEIGWDVRVALAVYGSFSSRAYLN 484

Query: 297 SQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLA 356
           SQ++R R M     +F    D+I++P T +TA  +   AL  GE+D    + ++R+    
Sbjct: 485 SQRIRNRQMFFHKEIFKT-ADVIVSPMTGVTAYTLQDDALQSGELDYINGAALIRYSIAG 543

Query: 357 NFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
           NF G+PA++V  G D   LPIGLQFI + + EATLL IA   +E      +KP+
Sbjct: 544 NFLGLPAITVMVGQDKGGLPIGLQFIGRPWSEATLLHIAFAMQEACSKNHRKPA 597



>gi|414588463|tpg|DAA39034.1| TPA: hypothetical protein ZEAMMB73_232282 [Zea mays]
          Length = 566

 Score =  232 bits (591), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 139/414 (33%), Positives = 217/414 (52%), Gaps = 9/414 (2%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY   + L  +DG+ +AVKDE+D   Y T+ GT+++       +DA  + +LR  GA+
Sbjct: 147 TRRYQQGAPLSAMDGVLVAVKDELDCLPYPTSGGTRWLGSARRCAADAACVAQLRACGAV 206

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           + GK +MHE+G G++  NP     RNPYN                   LCP+A+G DGGG
Sbjct: 207 MAGKANMHELGAGTSGINPHHGATRNPYNVGRVSGGSSGGSAAAVCAGLCPVALGADGGG 266

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P++ CG+ G K T GR S+ G  PL  +V + G +AA+V+D  +AY  +A  D   
Sbjct: 267 SVRMPAALCGVVGFKPTAGRLSNSGLLPLNWTVGMPGILAATVEDTLIAYAAIA--DQSK 324

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR-GAXXX 239
           P+ L QP   L     T  +  +++  Y+ W     +  I +     +  L+   G    
Sbjct: 325 PSPLQQPELNLPMLTRTRSMPSIRLAKYAKWFDD-SSEDIRSLCGKALQMLRTHYGWESV 383

Query: 240 XXXXXXXXXARIAHLLTIGTELT-TVAKRHKDKMHL--FSCPTRSNINVMKLATASDYIV 296
                     R+AH +T+G+E T ++A ++ D M         R  ++     ++ DY+ 
Sbjct: 384 DVTVPEIEEMRLAHYVTMGSECTASLAAKYLDSMDRSEVGWDVRIALSAYGSFSSRDYLS 443

Query: 297 SQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLA 356
           +Q++R R M     +F    D I+TP T +TA  +   AL+ GE+D    + ++R+    
Sbjct: 444 AQRLRCRQMYFHEKIFET-ADAIVTPMTGVTAYALQDDALSTGELDYINGAALVRYSIAG 502

Query: 357 NFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNR-RKKP 409
           NF G+PA++VP GYD   LP+GLQFI + + EATLL +A   +E  G +  +KP
Sbjct: 503 NFLGLPAITVPVGYDRGGLPVGLQFIGRPWSEATLLHLAYAMQEACGKKVLRKP 556



>gi|224033405|gb|ACN35778.1| unknown [Zea mays]
          Length = 458

 Score =  232 bits (591), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 139/414 (33%), Positives = 217/414 (52%), Gaps = 9/414 (2%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY   + L  +DG+ +AVKDE+D   Y T+ GT+++       +DA  + +LR  GA+
Sbjct: 39  TRRYQQGAPLSAMDGVLVAVKDELDCLPYPTSGGTRWLGSARRCAADAACVAQLRACGAV 98

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           + GK +MHE+G G++  NP     RNPYN                   LCP+A+G DGGG
Sbjct: 99  MAGKANMHELGAGTSGINPHHGATRNPYNVGRVSGGSSGGSAAAVCAGLCPVALGADGGG 158

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P++ CG+ G K T GR S+ G  PL  +V + G +AA+V+D  +AY  +A  D   
Sbjct: 159 SVRMPAALCGVVGFKPTAGRLSNSGLLPLNWTVGMPGILAATVEDTLIAYAAIA--DQSK 216

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR-GAXXX 239
           P+ L QP   L     T  +  +++  Y+ W     +  I +     +  L+   G    
Sbjct: 217 PSPLQQPELNLPMLTRTRSMPSIRLAKYAKWFDD-SSEDIRSLCGKALQMLRTHYGWESV 275

Query: 240 XXXXXXXXXARIAHLLTIGTELT-TVAKRHKDKMHL--FSCPTRSNINVMKLATASDYIV 296
                     R+AH +T+G+E T ++A ++ D M         R  ++     ++ DY+ 
Sbjct: 276 DVTVPEIEEMRLAHYVTMGSECTASLAAKYLDSMDRSEVGWDVRIALSAYGSFSSRDYLS 335

Query: 297 SQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLA 356
           +Q++R R M     +F    D I+TP T +TA  +   AL+ GE+D    + ++R+    
Sbjct: 336 AQRLRCRQMYFHEKIFET-ADAIVTPMTGVTAYALQDDALSTGELDYINGAALVRYSIAG 394

Query: 357 NFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNR-RKKP 409
           NF G+PA++VP GYD   LP+GLQFI + + EATLL +A   +E  G +  +KP
Sbjct: 395 NFLGLPAITVPVGYDRGGLPVGLQFIGRPWSEATLLHLAYAMQEACGKKVLRKP 448



>gi|414588464|tpg|DAA39035.1| TPA: hypothetical protein ZEAMMB73_232282 [Zea mays]
          Length = 609

 Score =  231 bits (590), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 139/414 (33%), Positives = 217/414 (52%), Gaps = 9/414 (2%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY   + L  +DG+ +AVKDE+D   Y T+ GT+++       +DA  + +LR  GA+
Sbjct: 190 TRRYQQGAPLSAMDGVLVAVKDELDCLPYPTSGGTRWLGSARRCAADAACVAQLRACGAV 249

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           + GK +MHE+G G++  NP     RNPYN                   LCP+A+G DGGG
Sbjct: 250 MAGKANMHELGAGTSGINPHHGATRNPYNVGRVSGGSSGGSAAAVCAGLCPVALGADGGG 309

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P++ CG+ G K T GR S+ G  PL  +V + G +AA+V+D  +AY  +A  D   
Sbjct: 310 SVRMPAALCGVVGFKPTAGRLSNSGLLPLNWTVGMPGILAATVEDTLIAYAAIA--DQSK 367

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR-GAXXX 239
           P+ L QP   L     T  +  +++  Y+ W     +  I +     +  L+   G    
Sbjct: 368 PSPLQQPELNLPMLTRTRSMPSIRLAKYAKWFDD-SSEDIRSLCGKALQMLRTHYGWESV 426

Query: 240 XXXXXXXXXARIAHLLTIGTELT-TVAKRHKDKMHL--FSCPTRSNINVMKLATASDYIV 296
                     R+AH +T+G+E T ++A ++ D M         R  ++     ++ DY+ 
Sbjct: 427 DVTVPEIEEMRLAHYVTMGSECTASLAAKYLDSMDRSEVGWDVRIALSAYGSFSSRDYLS 486

Query: 297 SQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLA 356
           +Q++R R M     +F    D I+TP T +TA  +   AL+ GE+D    + ++R+    
Sbjct: 487 AQRLRCRQMYFHEKIFET-ADAIVTPMTGVTAYALQDDALSTGELDYINGAALVRYSIAG 545

Query: 357 NFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNR-RKKP 409
           NF G+PA++VP GYD   LP+GLQFI + + EATLL +A   +E  G +  +KP
Sbjct: 546 NFLGLPAITVPVGYDRGGLPVGLQFIGRPWSEATLLHLAYAMQEACGKKVLRKP 599



>gi|414588466|tpg|DAA39037.1| TPA: hypothetical protein ZEAMMB73_232282 [Zea mays]
          Length = 610

 Score =  231 bits (589), Expect = 3e-58,   Method: Compositional matrix adjust.
 Identities = 139/414 (33%), Positives = 217/414 (52%), Gaps = 9/414 (2%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY   + L  +DG+ +AVKDE+D   Y T+ GT+++       +DA  + +LR  GA+
Sbjct: 191 TRRYQQGAPLSAMDGVLVAVKDELDCLPYPTSGGTRWLGSARRCAADAACVAQLRACGAV 250

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           + GK +MHE+G G++  NP     RNPYN                   LCP+A+G DGGG
Sbjct: 251 MAGKANMHELGAGTSGINPHHGATRNPYNVGRVSGGSSGGSAAAVCAGLCPVALGADGGG 310

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P++ CG+ G K T GR S+ G  PL  +V + G +AA+V+D  +AY  +A  D   
Sbjct: 311 SVRMPAALCGVVGFKPTAGRLSNSGLLPLNWTVGMPGILAATVEDTLIAYAAIA--DQSK 368

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR-GAXXX 239
           P+ L QP   L     T  +  +++  Y+ W     +  I +     +  L+   G    
Sbjct: 369 PSPLQQPELNLPMLTRTRSMPSIRLAKYAKWFDD-SSEDIRSLCGKALQMLRTHYGWESV 427

Query: 240 XXXXXXXXXARIAHLLTIGTELT-TVAKRHKDKMHL--FSCPTRSNINVMKLATASDYIV 296
                     R+AH +T+G+E T ++A ++ D M         R  ++     ++ DY+ 
Sbjct: 428 DVTVPEIEEMRLAHYVTMGSECTASLAAKYLDSMDRSEVGWDVRIALSAYGSFSSRDYLS 487

Query: 297 SQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLA 356
           +Q++R R M     +F    D I+TP T +TA  +   AL+ GE+D    + ++R+    
Sbjct: 488 AQRLRCRQMYFHEKIFET-ADAIVTPMTGVTAYALQDDALSTGELDYINGAALVRYSIAG 546

Query: 357 NFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNR-RKKP 409
           NF G+PA++VP GYD   LP+GLQFI + + EATLL +A   +E  G +  +KP
Sbjct: 547 NFLGLPAITVPVGYDRGGLPVGLQFIGRPWSEATLLHLAYAMQEACGKKVLRKP 600



>gi|367029415|ref|XP_003663991.1| hypothetical protein MYCTH_2306275 [Myceliophthora thermophila ATCC
           42464]
 gi|347011261|gb|AEO58746.1| hypothetical protein MYCTH_2306275 [Myceliophthora thermophila ATCC
           42464]
          Length = 560

 Score =  231 bits (588), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 149/425 (35%), Positives = 212/425 (49%), Gaps = 21/425 (4%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY    SLG LDG+P AVKDE DV+GY T +G++   +       +  +++L   GA+
Sbjct: 134 TRRYKEGRSLGPLDGVPTAVKDEYDVEGYRTCLGSRNTYFSPEDHGTSWCVQKLEAAGAL 193

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
            LGK SMHE G  +T NNP   TPRNP+N  YY               L PI +G DGGG
Sbjct: 194 NLGKLSMHEFGLDTTGNNPIYGTPRNPHNPTYYTGGSSSGTAYAVSAGLIPIGLGSDGGG 253

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           S+RIPSS CG++GLK T GR S         S A  GP+A+ +  LA  + V++  DP  
Sbjct: 254 SIRIPSSLCGVFGLKPTHGRLSFRPGANHCISCACLGPIASDMSSLAAVFSVISVPDPSS 313

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLRGAXXX 239
           P     PLPT     +        +G+ S W  +   PAI    N+ + EL    G    
Sbjct: 314 P---FPPLPTPLSLRLPRPDDPKILGIPSAWTARA-TPAIQALCNSLVHELVTSHGYTTV 369

Query: 240 XXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYIVSQQ 299
                     ++AH +T+ T+  T+     DK    +   R  + + ++  A+DY ++Q+
Sbjct: 370 PIEIPFLREGQLAHAMTVLTDAATLLP--PDKTRNLTPANRILLALGRVTPATDYTLAQK 427

Query: 300 VRTRIMRTLNNLFSNQVD-LILTPATAITAPKIYPRA----LAHGEVDVTMISDIMRFVQ 354
           +R  +M+ L  L+      LI+TP TA     I   A        E D TM S  M +V 
Sbjct: 428 LRRLLMQHLAWLWQEHPGMLIITPTTACEGLPILDAAAEMRWGVNEGDRTMES--MEYVW 485

Query: 355 LANFAGVPAVSVPAGY-----DDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKP 409
           LANF G+P++SVPAG+        ++P+GL    +W  E  LLR  +  EE+  +RR++P
Sbjct: 486 LANFCGLPSLSVPAGFVPGRKGTADVPVGLMATGEWCAEEQLLRFGRLLEEVGADRRRRP 545

Query: 410 SDKFW 414
             K W
Sbjct: 546 --KVW 548



>gi|459177343|ref|XP_002123113.2| PREDICTED: fatty acid amide hydrolase [Ciona intestinalis]
          Length = 580

 Score =  230 bits (587), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 133/393 (33%), Positives = 211/393 (53%), Gaps = 11/393 (2%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+RY  N++L  +DG+ I VKDE  VKG+    G+ + +   PA +D+ ++ ++R+ G I
Sbjct: 187 TDRYRTNTTLSPIDGVIIVVKDEFAVKGFPHTSGSSYRHPNEPAKADSGVVTKMRDLGCI 246

Query: 61  ILGKTSMHEIGFGSTNNNP----FVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGR 116
           +L   +MHE G G++ NNP      C  R PY+ D++               +  + IG 
Sbjct: 247 VLAVVNMHEFGIGTSGNNPNKGFGAC--RTPYHLDHFSGGSSSGCASAVGAGIATMGIGT 304

Query: 117 DGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGK 176
           DGGGS+RIPS++CG+ GLK T  R +  G   L++SV  +GP+   V D+AL Y +++G 
Sbjct: 305 DGGGSIRIPSAYCGVVGLKPTFARVTLAGVDGLSYSVGHAGPICNCVRDVALFYALLSGP 364

Query: 177 DPKDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGA 236
           DP+ P  L QP   L  F     L  +KIG+   + K   +P +    ++ +  L+  GA
Sbjct: 365 DPEYPLGLKQPKVKLPKFG--GNLDGIKIGIDRRYFKDC-SPDMFKICSDALPLLESSGA 421

Query: 237 XXXXXXXXXXXXARIAHLLTIGTELTT-VAKRHKDKMHLFSCPTRSNINVMKLATASDYI 295
                         IAH +TI +E++T ++    ++ +  S P+R+   + +  TA D+I
Sbjct: 422 TLETAEFAEITDICIAHRITILSEMSTNISSDFDNEFNAISVPSRTLFALGRSITAQDFI 481

Query: 296 VSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQL 355
            + + RTR +      F  + D ++TP T  TAP I+   LA G  + +     MRFV L
Sbjct: 482 QANKQRTRAIEITEEFF-KKYDALVTPTTGQTAPLIHSDELAVGATNPSQDGVNMRFVAL 540

Query: 356 ANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDE 388
            NF G+PA++VP GY+D  LP+G Q +  W+ E
Sbjct: 541 GNFTGIPAITVPVGYNDKGLPVGFQIMCAWWRE 573



>gi|413916255|gb|AFW56187.1| hypothetical protein ZEAMMB73_989912 [Zea mays]
          Length = 610

 Score =  230 bits (587), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 138/413 (33%), Positives = 216/413 (52%), Gaps = 10/413 (2%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY   + L  LDG+ + VKDEID   Y T  GT+++       +DA  + +LR  GA+
Sbjct: 192 TLRYQRGAPLSALDGVLVGVKDEIDCLPYPTTGGTRWLGAARRCEADAACVAQLRACGAV 251

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           + GK +MHE+G G++  NP   + RNPYN                   LCP+A+G DGGG
Sbjct: 252 LAGKANMHELGAGTSGINPHHGSTRNPYNASTIAGGSSSGSAAIVCAGLCPVALGVDGGG 311

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P++ CG+ G K T GR S+ G  PL  +V + G +A +V+D  +AY  +   D   
Sbjct: 312 SVRMPAALCGVVGFKPTAGRLSNAGVLPLNWTVGMPGILAGTVEDALIAYSAIV--DQSQ 369

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMW-NKQVDNPAITTALNNFIDELKLR-GAXX 238
           P+ L +P   L     T  + ++K+  Y  W N   ++  I +  +  +  L+   G   
Sbjct: 370 PSYL-RPELNLPQLGSTLSIGNIKLARYGKWFNDSAED--IRSCCDKALQALRANYGWQT 426

Query: 239 XXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHL--FSCPTRSNINVMKLATASDYIV 296
                      R+AH +TIG+E TT   ++ DK+         R  ++V    ++  Y+ 
Sbjct: 427 VDVTIPEVEEMRLAHYVTIGSECTTSLAKYLDKLKRSEIGWDARVALSVYGSFSSRAYLN 486

Query: 297 SQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLA 356
           +Q++R R M     +F    D+I++P T +TA  +   AL+ GE+D    + ++R+   +
Sbjct: 487 AQRLRNRQMYFHKQIF-KAADVIVSPMTGVTAYPLQDDALSTGELDYINGAALVRYSIAS 545

Query: 357 NFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKP 409
           NF G+PA++V  GYD   LPIGLQFI + + EATLL +A  +++      KKP
Sbjct: 546 NFLGLPAITVTVGYDRGGLPIGLQFIGRPWAEATLLHVAFATQQACAKEYKKP 598



>gi|145230876|ref|XP_001389702.1| N-acylethanolamine amidohydrolase [Aspergillus niger CBS 513.88]
 gi|134055825|emb|CAK37347.1| unnamed protein product [Aspergillus niger]
 gi|350638683|gb|EHA27039.1| hypothetical protein ASPNIDRAFT_205482 [Aspergillus niger ATCC
           1015]
          Length = 605

 Score =  230 bits (586), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 140/411 (34%), Positives = 215/411 (52%), Gaps = 12/411 (2%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+RY +   LG +DGIP+A+KDE+ ++GY   +G+K +++       +  +++  E GAI
Sbjct: 162 TQRYKDGKPLGPMDGIPVAIKDEVHMEGYRRTLGSK-LDFTGEFRGTSWCVKQWEEAGAI 220

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKT MHE+G  +TNNNP   TPRNP+N DYY               L PIA+G DGGG
Sbjct: 221 VIGKTIMHELGLDTTNNNPNFGTPRNPHNPDYYCGGSSGGSGYAVGAGLVPIALGADGGG 280

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           S+RIP+SFCG++GLK + GR S      LA +  V GP+A+S+DDLALAY +MA   P+ 
Sbjct: 281 SIRIPASFCGVWGLKPSHGRVSGSPTVSLASTTGVYGPLASSIDDLALAYRIMATPAPES 340

Query: 181 PNTLHQPLPT-LHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELK-LRGAXX 238
            + L    P+ L         +   IG+   W  +  +P +    N  +D  + L+    
Sbjct: 341 SDPLSAAFPSPLRTLPSPTNNTPRTIGIVRDWIDRA-SPPVRAVFNATLDHYRTLKNYTI 399

Query: 239 XXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYIVSQ 298
                      + AH LTI +E+T+     +      +    +++ + ++    D++ +Q
Sbjct: 400 IDITIPYLPEGQKAHALTILSEVTSSLTPSQISQLTPANKIMASMGMWQI-KGQDFLAAQ 458

Query: 299 QVRTRIMRTLNNLFSNQVDL-ILTPATAITAPKIY--PRALAHGEVDVTMISDIMRFVQL 355
           ++R  +M  L +LF     L I+TP T I   KI      L  G  D       M +V L
Sbjct: 459 RLRNCLMMHLAHLFQKHPGLMIVTPTTPIPGWKIEGGEADLKRGVSDGNTTVRNMEYVWL 518

Query: 356 ANFAGVPAVSVPAGYD----DNNLPIGLQFIAKWYDEATLLRIAKTSEEIL 402
           ANF G PA+S PAGYD     + +P+G+  + +W  E  L+  A+  E +L
Sbjct: 519 ANFTGCPAISCPAGYDVLDGGSRVPVGVMAMGEWGSEEELIAFARDGEGVL 569



>gi|261189935|ref|XP_002621378.1| N-acylethanolamine amidohydrolase [Ajellomyces dermatitidis
           SLH14081]
 gi|239591614|gb|EEQ74195.1| N-acylethanolamine amidohydrolase [Ajellomyces dermatitidis
           SLH14081]
          Length = 635

 Score =  229 bits (585), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 146/412 (35%), Positives = 224/412 (54%), Gaps = 23/412 (5%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           TERY     LG LDG+P+AVKDE+D++GY+  +G++ +++       A  +++  E GAI
Sbjct: 167 TERYKTGKPLGPLDGVPVAVKDEVDLEGYKRTLGSR-LDFTGKTNRTAWCVKKWEEAGAI 225

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKTSMHE+G G+TNNNPF  TPRNP+N DYY               L PIA+G DGGG
Sbjct: 226 VVGKTSMHELGLGTTNNNPFTGTPRNPHNKDYYTGGSSGGSGYVVGAGLVPIALGADGGG 285

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P+ FCGIYG+KT+ GR S      +A +  V G M +S+DDLAL+Y +MA  DP+ 
Sbjct: 286 SVRVPAGFCGIYGIKTSHGRVSGHPTCGIATTTGVFGTMTSSLDDLALSYRIMASPDPES 345

Query: 181 --PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELK-LRGAX 237
              ++   PL T+           + IG++  W  + D PA+ +  NN ID  +  +   
Sbjct: 346 MPSSSFPDPLSTIPSSDTLASRPKV-IGIFRDWVNRAD-PAVLSLFNNAIDYYRDHQNYT 403

Query: 238 XXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINV-MKLATASDYIV 296
                       + AH LTI  E+++      +++   +   +  +++    A A D++ 
Sbjct: 404 VLDISIPFLPEGQKAHALTILAEISSTIT--PEQIRQLTPQNKVLVSIGSNQAAARDFLA 461

Query: 297 SQQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYPRALAHGEVD-VTMISD------ 348
           +Q++R  +M  L +L+     LI+ TP T +   KI     + G+ D V+ +SD      
Sbjct: 462 AQRMRNLLMSHLAHLYQKHPGLIIATPTTPMPGWKI-----SKGDADLVSGVSDENSSLR 516

Query: 349 IMRFVQLANFAGVPAVSVPAGY-DDNNLPIGLQFIAKWYDEATLLRIAKTSE 399
            M +V LANF G PA+S P G  +   +P+GL  + +W  E  L+  A+  E
Sbjct: 517 AMEYVFLANFTGCPALSRPMGLVEGPGVPVGLMGMGEWGSEEMLIEWARDGE 568



>gi|327352021|gb|EGE80878.1| N-acylethanolamine amidohydrolase [Ajellomyces dermatitidis ATCC
           18188]
          Length = 631

 Score =  229 bits (585), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 146/412 (35%), Positives = 224/412 (54%), Gaps = 23/412 (5%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           TERY     LG LDG+P+AVKDE+D++GY+  +G++ +++       A  +++  E GAI
Sbjct: 167 TERYKTGKPLGPLDGVPVAVKDEVDLEGYKRTLGSR-LDFTGKTNRTAWCVKKWEEAGAI 225

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKTSMHE+G G+TNNNPF  TPRNP+N DYY               L PIA+G DGGG
Sbjct: 226 VVGKTSMHELGLGTTNNNPFTGTPRNPHNKDYYTGGSSGGSGYVVGAGLVPIALGADGGG 285

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P+ FCGIYG+KT+ GR S      +A +  V G M +S+DDLAL+Y +MA  DP+ 
Sbjct: 286 SVRVPAGFCGIYGIKTSHGRVSGHPTCGIATTTGVFGTMTSSLDDLALSYRIMASPDPES 345

Query: 181 --PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELK-LRGAX 237
              ++   PL T+           + IG++  W  + D PA+ +  NN ID  +  +   
Sbjct: 346 MPSSSFPDPLSTIPSSDTLASRPKV-IGIFRDWVNRAD-PAVLSLFNNAIDYYRDHQNYT 403

Query: 238 XXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINV-MKLATASDYIV 296
                       + AH LTI  E+++      +++   +   +  +++    A A D++ 
Sbjct: 404 VLDISIPFLPEGQKAHALTILAEISSTIT--PEQIRQLTPQNKVLVSIGSNQAAARDFLA 461

Query: 297 SQQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYPRALAHGEVD-VTMISD------ 348
           +Q++R  +M  L +L+     LI+ TP T +   KI     + G+ D V+ +SD      
Sbjct: 462 AQRMRNLLMSHLAHLYQKHPGLIIATPTTPMPGWKI-----SKGDADLVSGVSDENSSLR 516

Query: 349 IMRFVQLANFAGVPAVSVPAGY-DDNNLPIGLQFIAKWYDEATLLRIAKTSE 399
            M +V LANF G PA+S P G  +   +P+GL  + +W  E  L+  A+  E
Sbjct: 517 AMEYVFLANFTGCPALSRPMGLVEGPGVPVGLMGMGEWGSEEMLIEWARDGE 568



>gi|239612856|gb|EEQ89843.1| N-acylethanolamine amidohydrolase [Ajellomyces dermatitidis ER-3]
          Length = 632

 Score =  229 bits (585), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 146/412 (35%), Positives = 224/412 (54%), Gaps = 23/412 (5%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           TERY     LG LDG+P+AVKDE+D++GY+  +G++ +++       A  +++  E GAI
Sbjct: 167 TERYKTGKPLGPLDGVPVAVKDEVDLEGYKRTLGSR-LDFTGKTNRTAWCVKKWEEAGAI 225

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKTSMHE+G G+TNNNPF  TPRNP+N DYY               L PIA+G DGGG
Sbjct: 226 VVGKTSMHELGLGTTNNNPFTGTPRNPHNKDYYTGGSSGGSGYVVGAGLVPIALGADGGG 285

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P+ FCGIYG+KT+ GR S      +A +  V G M +S+DDLAL+Y +MA  DP+ 
Sbjct: 286 SVRVPAGFCGIYGIKTSHGRVSGHPTCGIATTTGVFGTMTSSLDDLALSYRIMASPDPES 345

Query: 181 --PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELK-LRGAX 237
              ++   PL T+           + IG++  W  + D PA+ +  NN ID  +  +   
Sbjct: 346 MPSSSFPDPLSTIPSSDTLASRPKV-IGIFRDWVNRAD-PAVLSLFNNAIDYYRDHQNYT 403

Query: 238 XXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINV-MKLATASDYIV 296
                       + AH LTI  E+++      +++   +   +  +++    A A D++ 
Sbjct: 404 VLDISIPFLPEGQKAHALTILAEISSTIT--PEQIRQLTPQNKVLVSIGSNQAAARDFLA 461

Query: 297 SQQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYPRALAHGEVD-VTMISD------ 348
           +Q++R  +M  L +L+     LI+ TP T +   KI     + G+ D V+ +SD      
Sbjct: 462 AQRMRNLLMSHLAHLYQKHPGLIIATPTTPMPGWKI-----SKGDADLVSGVSDENSSLR 516

Query: 349 IMRFVQLANFAGVPAVSVPAGY-DDNNLPIGLQFIAKWYDEATLLRIAKTSE 399
            M +V LANF G PA+S P G  +   +P+GL  + +W  E  L+  A+  E
Sbjct: 517 AMEYVFLANFTGCPALSRPMGLVEGPGVPVGLMGMGEWGSEEMLIEWARDGE 568



>gi|62701930|gb|AAX93003.1| Amidase, putative [Oryza sativa Japonica Group]
          Length = 683

 Score =  229 bits (584), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 141/443 (31%), Positives = 216/443 (48%), Gaps = 38/443 (8%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY   + L  +DG+ +AVKDEID   Y T  GT+++    P   DA ++ +LR  GA+
Sbjct: 233 TLRYQQGAPLSAMDGVLVAVKDEIDCLPYPTTGGTRWLQRMRPCVQDAAVVAQLRACGAV 292

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           + GKT+MHE+G G++  NP   + RNPYNT                  LCP+A+G DGGG
Sbjct: 293 LAGKTNMHELGAGTSGINPHHGSTRNPYNTGKVAGGSSGGSAAVVCAGLCPVALGADGGG 352

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P++ CG+ GLK T GRFS DG  PL  +V + G +AA+V+D  +AY  +A  D   
Sbjct: 353 SVRMPAALCGVVGLKPTAGRFSKDGLLPLNWTVGMPGILAATVEDALIAYAAIA--DQSQ 410

Query: 181 PNTLH------------------------------QPLPTLHGFHVTNKLSDLKIGVYSM 210
           P+ L                               QP   L      + +  +++  Y+ 
Sbjct: 411 PSHLQANARTLYFLLHVWMFSETEFAEDLIFFVCLQPELNLPLLKAASSMPTIRLARYAK 470

Query: 211 WNKQVDNPAITTALNNFIDELKLR--GAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRH 268
           W        I +     +  L+ R                 R+AH +T+G+E T    ++
Sbjct: 471 WFNDCSED-IRSCCYKAVHTLRTRYGWEVTADVTIPEIEEMRLAHYVTMGSECTASFDKY 529

Query: 269 KDKMHL--FSCPTRSNINVMKLATASDYIVSQQVRTRIMRTLNNLFSNQVDLILTPATAI 326
             K+         R  ++     ++  Y+ SQ++R R M   + +F    D+I+TP T +
Sbjct: 530 LKKLSKSEIGWDVRIALSAYGSFSSRAYLNSQRIRNRQMYFHDKIFET-FDVIVTPMTGV 588

Query: 327 TAPKIYPRALAHGEVDVTMISDIMRFVQLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWY 386
           TA ++   A   GE+D    + ++R+    NF G+PA++V  GYD   LP+GLQFI + +
Sbjct: 589 TAHELQDNAGHTGELDYINGAALVRYSIAGNFLGLPAITVKVGYDREGLPVGLQFIGRPW 648

Query: 387 DEATLLRIAKTSEEILGNRRKKP 409
            EATLL +A   +E  G   +KP
Sbjct: 649 SEATLLHLAYAMQEACGKNYRKP 671



>gi|147856346|emb|CAN81781.1| hypothetical protein VITISV_019910 [Vitis vinifera]
          Length = 358

 Score =  229 bits (584), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 132/353 (37%), Positives = 191/353 (54%), Gaps = 7/353 (1%)

Query: 67  MHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGSVRIPS 126
           MHE+G G++ NNP   T RNP+  + Y               LC  A+G DGGGSVRIPS
Sbjct: 1   MHELGLGTSGNNPNYGTTRNPHAPERYTGGSSSGPAALVASGLCSAALGTDGGGSVRIPS 60

Query: 127 SFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDPNTLHQ 186
           S CG+ GLKTT GR S  G    + +V + GP+A++V+D+ L Y  + G  P D   L  
Sbjct: 61  SLCGVVGLKTTYGRTSMIGSICDSGTVEIIGPIASTVEDVMLVYAAILGSSPADRICLKP 120

Query: 187 P---LPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLRGAXXXXXX 242
               LP L      N +  L++G Y+ W   V +  I+    + ++ L K  G       
Sbjct: 121 APPCLPNLSSSESLNVMGTLRLGKYTQWFNDVYSTDISDKCEDVLNMLSKNHGCKVTEII 180

Query: 243 XXXXXXARIAHLLTIGTELTTVAKRH--KDKMHLFSCPTRSNINVMKLATASDYIVSQQV 300
                  R AH+++IG+E  +    H    K+   +  TR+N+ + +   ASDY+ +Q +
Sbjct: 181 IPELNEMRNAHIVSIGSESVSSLNPHCYDGKISKMTLDTRTNLALFRTFAASDYVAAQCL 240

Query: 301 RTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANFAG 360
           R R+M     +F N VD+I+TP T +TAP I P AL  GE ++ +   +MRFV  AN  G
Sbjct: 241 RRRLMYYHMEIFKN-VDIIVTPTTGMTAPIISPSALKFGESNLQVGGYLMRFVVAANLLG 299

Query: 361 VPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPSDKF 413
           +PA+SVP GYD   LPIGLQ I + + EA++LR+A   EE+    +KKP+  +
Sbjct: 300 LPAISVPVGYDKQGLPIGLQLIGRPWGEASILRLASAVEELCREPKKKPAQFY 352



>gi|242084924|ref|XP_002442887.1| hypothetical protein SORBIDRAFT_08g004400 [Sorghum bicolor]
 gi|241943580|gb|EES16725.1| hypothetical protein SORBIDRAFT_08g004400 [Sorghum bicolor]
          Length = 615

 Score =  229 bits (583), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 139/414 (33%), Positives = 214/414 (51%), Gaps = 10/414 (2%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY   + L  LDG+ + VKDEID   Y T  GT+++       +DA  + +LR  GA+
Sbjct: 197 TLRYQRGAPLSALDGVLVGVKDEIDCVPYPTTGGTRWLGAARRCEADAACVAQLRACGAV 256

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           + GK +MHE+G G++  NP   + RNPYN                   LCP+A+G DGGG
Sbjct: 257 LAGKANMHELGAGTSGINPHHGSTRNPYNASKVAGGSSSGSAAVVCAGLCPVALGVDGGG 316

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P++ CG+ G K T GR S+ G  PL  +V + G +A +V+D  +AY  +   D   
Sbjct: 317 SVRMPAALCGVVGFKPTAGRLSNAGVLPLNWTVGMPGILAGTVEDALIAYSAIV--DQSQ 374

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMW-NKQVDNPAITTALNNFIDELKLR-GAXX 238
           P+ L +P   L     T  + ++K+  Y  W N   ++  I +  +  +  L    G   
Sbjct: 375 PSYL-RPELNLPQLSSTPSIGNIKLAKYGKWFNDSAED--IRSCCDKALQALHAHYGWQT 431

Query: 239 XXXXXXXXXXARIAHLLTIGTELTTVAKRHKD--KMHLFSCPTRSNINVMKLATASDYIV 296
                      R+AH +TIG+E TT   ++ D  K        R  ++V    ++  Y+ 
Sbjct: 432 VDVTIPEIEEMRLAHYVTIGSECTTSLAKYLDNLKRSEIGWDARVALSVYGSFSSRAYLN 491

Query: 297 SQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLA 356
           SQ++R R M     +F    D+I++P T +TA  +   AL  GE+D    + ++R+    
Sbjct: 492 SQRLRNRQMYFHKQIFKT-ADVIVSPMTGVTAYTLQDDALNTGELDYINGAALVRYSIAG 550

Query: 357 NFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
           NF G+PA++V  GYD   LPIGLQFI + + EATLL +A  +++   +  KKP+
Sbjct: 551 NFLGLPAITVKVGYDRGGLPIGLQFIGRPWSEATLLHVAFATQQACADGYKKPA 604



>gi|115492639|ref|XP_001210947.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gi|114197807|gb|EAU39507.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 659

 Score =  229 bits (583), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 150/447 (33%), Positives = 225/447 (50%), Gaps = 45/447 (10%)

Query: 2   ERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAII 61
           +RY + + LG LDG+P+AVKDE++++GY+  +G+K +++ N     +  +++  E GAI+
Sbjct: 193 QRYRDGTPLGPLDGVPVAVKDELNMEGYKRTLGSK-LDFTNGVEGTSWCVKKWEEAGAIV 251

Query: 62  LGKTSMHEIGFGST---------------------------NNNPFVCTPRNPYNTDYYP 94
           +GKT+MHE+G G +                           NNNP   TPRNP+N  YY 
Sbjct: 252 VGKTTMHELGLGESRSKEDRRSTSPQNHLYLGNETDPADTNNNNPNYGTPRNPHNEKYYC 311

Query: 95  XXXXXXXXXXXXXXLCPIAIGRDGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVA 154
                         L PIA+G DGGGS+RIPSSFCGI+GLK + GR S      LA +V 
Sbjct: 312 GGSSGGSGYAVAAGLVPIALGADGGGSIRIPSSFCGIWGLKPSHGRVSGTPTVSLATTVG 371

Query: 155 VSGPMAASVDDLALAYYVMAGKDPKDPNTLHQPLPT-LHGFHVTNKLSDLKIGVYSMWNK 213
           V+GPMAAS+DDLALAY VMA   P   + +    P+ L    V      + IG+   W  
Sbjct: 372 VNGPMAASIDDLALAYRVMAAPAPAADDPMSAAFPSPLRTLAVPADRPKM-IGIIPEWID 430

Query: 214 QVDNPAITTALNNFIDELKLRGAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMH 273
           + + P +    +  +D  + +G              + AH+LTI TE+ +       ++ 
Sbjct: 431 RAE-PEVRRVFDATLDFYRKQGYTVVEIAIPYLPEGQRAHVLTIMTEIASALS--PRQIR 487

Query: 274 LFSCPTRSNINV-MKLATASDYIVSQQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKI 331
             + P +  +++ M   T  D + +Q++R  +M  L +LF      LI +P T I   KI
Sbjct: 488 SLTAPNKVLVSMGMWQITGQDVLAAQRLRNLLMAHLAHLFQKYPGLLIFSPTTPIAGWKI 547

Query: 332 ------YPRALAHGEVDVTMISDIMRFVQLANFAGVPAVSVPAGYDDNNLPIGLQFIAKW 385
                   R L+ G+  V      M +V LANF G PA++ PAGY +  +PIG+  + +W
Sbjct: 548 DGGEADLSRGLSDGKASVRN----MEYVWLANFTGCPAINCPAGYSNAGVPIGVMAMGEW 603

Query: 386 YDEATLLRIAKTSEEILGNRRKKPSDK 412
             E  L+  A+  E IL     +P  K
Sbjct: 604 GTEEELIAFARDGEAILDLPENQPHTK 630



>gi|167998636|ref|XP_001752024.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162697122|gb|EDQ83459.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 601

 Score =  227 bits (579), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 139/435 (31%), Positives = 218/435 (50%), Gaps = 35/435 (8%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           TERY   + L +LDG+ +AVKDEID   Y T  G+ ++      T DA +++RLRE GA+
Sbjct: 165 TERYRQGTPLSVLDGVLVAVKDEIDCLPYPTTGGSTWLGKARQVTKDAAVVKRLRECGAV 224

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKT+MHE+G G+T  NP     RNP++                   LCP+A+G DGGG
Sbjct: 225 MVGKTNMHELGVGTTGINPHYGATRNPHDMTRVSGGSSGGSATVVAAGLCPVALGVDGGG 284

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDD--------------- 165
           SVR+P+S  G+ GLK T GR +  G  PL  ++ + G +  +V+D               
Sbjct: 285 SVRMPASLSGVVGLKPTFGRIAKSGLLPLNWTIGMVGTLTGTVEDAYIFVSLLIEVLERN 344

Query: 166 -LALAYYV--MAGKDPKDPNTLHQPLPTLHGFH-----VTNKLSDLKIGVYSMWNKQVDN 217
            + L Y++  M    PK   +    LP L+        +   + ++K+  +S W    D+
Sbjct: 345 RMKLKYFLLFMVVYCPKSSCS---TLPLLNDVQMEPNIMAKLIEEIKLAKFSKWYNDSDD 401

Query: 218 P---AITTALNNFIDELKLRGAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHL 274
                  +AL    D     G              R+AH +T+G ELT       + +  
Sbjct: 402 SVWRVCDSALRLIQDTY---GCKVVDASIPDLDKMRLAHYITMGGELTASLGVEYENLGR 458

Query: 275 FSC--PTRSNINVMKLATASDYIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIY 332
            +     RS I++ +  +  +++ +Q++R+R M+    +F  + D I+TP TA TAP I 
Sbjct: 459 KTTGGDVRSTISIFQGFSNREFVTAQRLRSRCMQHHMEVF-KEADFIVTPTTACTAPPIR 517

Query: 333 PRALAHGEVDVTMISDIMRFVQLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLL 392
             A  +GE+D      +MRF+   N  G+PA+++P GYD   LP+GLQ + K + EA LL
Sbjct: 518 DDAEQYGELDYQHGGKLMRFIIAGNLLGLPAITLPVGYDAKGLPVGLQLVGKPWSEAALL 577

Query: 393 RIAKTSEEILGNRRK 407
           R+A   E+I   + +
Sbjct: 578 RVAVAFEKICAPQHR 592



>gi|340381644|ref|XP_003389331.1| PREDICTED: hypothetical protein LOC100637805 [Amphimedon
           queenslandica]
          Length = 942

 Score =  227 bits (578), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 146/410 (35%), Positives = 200/410 (48%), Gaps = 21/410 (5%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+R+     L LLDG+P AVK +I  + Y    G  F    +    +A ++ RL E GAI
Sbjct: 529 TKRWREGKPLSLLDGVPFAVKAQIKFESYSLTGGGTFKPTCSLGLKEAKVVRRLVEAGAI 588

Query: 61  ILGKTSMHEIGFGSTNNNPF--VCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDG 118
           + G T+M E G G+  +NP     T RNPY+ + Y               LCPI IG D 
Sbjct: 589 MAGLTNMQEFGTGALGSNPHKEYLTARNPYSDECYCGGSSSGSAAAVASGLCPITIGGDA 648

Query: 119 GGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDP 178
           GGS+R PSSFCGI GLKTT G     G  P   SV V GPM ++  D A+A  VM     
Sbjct: 649 GGSIRTPSSFCGITGLKTTFGSLDLTGFLPQTASVGVIGPMCSTSVDAAIAMNVM----- 703

Query: 179 KDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXX 238
            +P         L G      LS L+IGVY+ +    D P + +     +D L   GA  
Sbjct: 704 -EPGRFD-----LSGLADIKDLSGLRIGVYNEYFDHAD-PQVVSLCRKALDALASLGAEV 756

Query: 239 XXXXXXXXXXARIAHLLTIGTELTTVAKRHKDK-MHLFSCPTRSNINVMKLATASDYIVS 297
                      R+AH++T  TE  T      DK +   +  T +  +V K  +A +YI +
Sbjct: 757 KDIVIPELEELRVAHMITTATEFFTSYTVDIDKRVEEMNSETITLFSVGKSVSAKEYINA 816

Query: 298 QQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLAN 357
           Q+ RTR +  + +LF  +VDLI TPAT   AP I P A  +G  +  +   IMR+  LAN
Sbjct: 817 QKQRTRSISIVKSLF-EEVDLIATPATGSVAPAIPPGAEKYGYGNTELTGKIMRYASLAN 875

Query: 358 FAGVPAVSVPAGYDDNN-----LPIGLQFIAKWYDEATLLRIAKTSEEIL 402
           F G+P +S+P G          LP+G    ++W  E  LLR+    EE++
Sbjct: 876 FTGIPGISIPVGLTSGEGRGGGLPVGFLLQSEWNHEGLLLRVGSALEELI 925



>gi|465974110|gb|EMP33658.1| Amidase [Chelonia mydas]
          Length = 553

 Score =  226 bits (576), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 148/413 (35%), Positives = 201/413 (48%), Gaps = 41/413 (9%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY N   L LLDGIP+ +K+EI V  Y    GT ++    P T DAT+  +LRE GAI
Sbjct: 167 TTRYRNKCPLSLLDGIPVCLKEEIKVVPYHHRAGTAYLG-TEPETEDATVTRKLREAGAI 225

Query: 61  ILGKTSMHEIGFGSTNNNP--FVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDG 118
           I+G ++MHE+G G+T  NP  F  T RNPYN  ++                         
Sbjct: 226 IIGVSNMHELGTGTTGCNPNRFHGTTRNPYNPQHFTGGSSSGSAAAVA------------ 273

Query: 119 GGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDP 178
                             T GR S  G  PL++S    GP+  SV D A+A+ ++A  DP
Sbjct: 274 ----------------AGTFGRISCHGCLPLSYSTVSLGPICTSVTDAAIAFSILAEPDP 317

Query: 179 KDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXX 238
             P  L QP P+L    +T  L  LK+GV   + K  D   I       ++ L+  GA  
Sbjct: 318 LYPYGLQQPKPSLSEI-LTPDLKGLKLGVNWTFFKACDA-EILKVCQKAVEHLQALGASV 375

Query: 239 XXXXXXXXXXARIAHLLTIGTELTTVAK----RHKDKMHLFSCPTRSNINVMKLATASDY 294
                      R+AH++ I +E+    +     H  +M+L    TR N+ +    TA DY
Sbjct: 376 VDVPLSEMEEVRVAHVICILSEMRDYLQPDFNAHFQQMNL---ETRLNLALASQFTALDY 432

Query: 295 IVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQ 354
           I + + RTR M  L  +F+N V+ ILTPATA TAP+I+   L  G  DV      MR++Q
Sbjct: 433 IKANRQRTRSMSFLREIFAN-VNCILTPATACTAPRIHDSDLLTGNNDVLTTLRTMRYMQ 491

Query: 355 LANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRK 407
           L NF G+P + VP GY    LPI  Q +AKW+DEA L R+    E+     RK
Sbjct: 492 LGNFTGIPGLVVPVGYTATGLPISFQVMAKWWDEAVLFRVGLKLEQFREMTRK 544



>gi|453085975|gb|EMF14017.1| amidase signature enzyme [Mycosphaerella populorum SO2202]
          Length = 625

 Score =  225 bits (574), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 148/426 (34%), Positives = 221/426 (51%), Gaps = 19/426 (4%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+RYA    L +LDG+P+AVKDE+D+ GY    G+K I+Y     + +  +++  + GA+
Sbjct: 195 TKRYAEGRFLSVLDGVPVAVKDEMDLSGYSKCFGSK-IDYTRADDATSYCVQKWLDAGAM 253

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKT+MHE+G  +TNNNP   TP NPYN +YY               L P+  G DGGG
Sbjct: 254 VVGKTTMHEMGADTTNNNPNFGTPLNPYNENYYTGGSSGGSAYSVAAGLTPLCEGNDGGG 313

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           S+R+P+++CG++GLK + GR S      LA S  VSGP+AA++ DL + Y +MA  D  D
Sbjct: 314 SIRLPANYCGVFGLKPSQGRISGRPSTNLAKSNGVSGPIAANMIDLEIGYRIMAQPDALD 373

Query: 181 PNT-LHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKL-RGAXX 238
           P + L  P  ++      +    L +G+Y  W  + D P + +     ID L   +    
Sbjct: 374 PTSCLFTPPGSVSKKKPLSSTPKL-LGIYKPWFDRAD-PIVKSTCQASIDHLTTHQQYQT 431

Query: 239 XXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYIVSQ 298
                      ++AH +TI  EL T         HL +   +  I+V +  TA D++ +Q
Sbjct: 432 IDISIPLLPEGQLAHAMTILAELATGVS--ASDQHLLTPANKVLISVARKTTAVDFLQAQ 489

Query: 299 QVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLAN 357
           ++R  +M+ L +LF     LI+ TP T     +I    L++G  D       M +V LAN
Sbjct: 490 RLRNLLMQHLAHLFHLHPGLIIVTPTTPNAGWRIGAGDLSYGISDANQQVRNMEYVWLAN 549

Query: 358 FAGVPAVSVPAGY---------DDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKK 408
           F G PA++ P GY         D+  +PIGL  +A+W +E  LL      EE L N R +
Sbjct: 550 FTGCPALTAPVGYHHHPHPHDKDEGIVPIGLMGMAEWCEEDALLEFGYHLEEYLRNDRVR 609

Query: 409 PSDKFW 414
           P  K W
Sbjct: 610 P--KVW 613



>gi|340385589|ref|XP_003391292.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit A-like
           [Amphimedon queenslandica]
          Length = 635

 Score =  225 bits (574), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 147/416 (35%), Positives = 201/416 (48%), Gaps = 35/416 (8%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T R+     L LLDGIP AVK +I  + Y    G  F    +    +A ++ RL E GAI
Sbjct: 222 TRRWREGKPLSLLDGIPFAVKAQIKFESYSLTGGATFEPTCSLGLKEAKVVRRLVEAGAI 281

Query: 61  ILGKTSMHEIGFGSTNNNPF--VCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDG 118
           ++G  +M E G G   +NP     T RNPYN + Y               LCPI IG D 
Sbjct: 282 MVGLANMQEFGTGVFGSNPHKEYMTARNPYNDECYCGGSSSGSAAAVASGLCPITIGGDA 341

Query: 119 GGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDP 178
           GGS+R PSSFCGI GLKTT G     G  P   SV V GPM ++  D A+A  VM     
Sbjct: 342 GGSIRTPSSFCGITGLKTTFGSLDLTGFLPQTPSVGVIGPMCSTSVDAAIAMNVM----- 396

Query: 179 KDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXX 238
            +P         L G      LS L+IGVY+ +    D P + +     +D L   GA  
Sbjct: 397 -EPGRFD-----LSGLADIKDLSGLRIGVYNEYFDDAD-PQVVSLCREALDALASLGAEV 449

Query: 239 XXXXXXXXXXARIAHLLTIGTELTT---------VAKRHKDKMHLFSCPTRSNINVMKLA 289
                      R+AHL T+ TE  T         V + + + + LFS        V K  
Sbjct: 450 KDIVIPELEELRVAHLTTVATEFFTNYAVDIDKRVEEMNSETIMLFS--------VGKSV 501

Query: 290 TASDYIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDI 349
           +A +YI +Q+ RTR +  + +LF  +VDLI TPAT   AP I P A  +G  ++ +   I
Sbjct: 502 SAKEYINAQKQRTRSISIIKSLF-EEVDLIATPATGSVAPAIPPGAEKYGYGNMELTGKI 560

Query: 350 MRFVQLANFAGVPAVSVPAGY---DDNNLPIGLQFIAKWYDEATLLRIAKTSEEIL 402
           +++  LANF G+P +S+P G    +   LP+G    + W +E  LLR+    EE++
Sbjct: 561 IKYASLANFTGIPGISIPVGLTSGEGGGLPVGFLLQSHWNNEGLLLRVGSALEELI 616



>gi|219887657|gb|ACL54203.1| unknown [Zea mays]
 gi|414588461|tpg|DAA39032.1| TPA: hypothetical protein ZEAMMB73_232282 [Zea mays]
          Length = 424

 Score =  225 bits (573), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 136/405 (33%), Positives = 213/405 (52%), Gaps = 9/405 (2%)

Query: 10  LGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAIILGKTSMHE 69
           L  +DG+ +AVKDE+D   Y T+ GT+++       +DA  + +LR  GA++ GK +MHE
Sbjct: 14  LSAMDGVLVAVKDELDCLPYPTSGGTRWLGSARRCAADAACVAQLRACGAVMAGKANMHE 73

Query: 70  IGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGSVRIPSSFC 129
           +G G++  NP     RNPYN                   LCP+A+G DGGGSVR+P++ C
Sbjct: 74  LGAGTSGINPHHGATRNPYNVGRVSGGSSGGSAAAVCAGLCPVALGADGGGSVRMPAALC 133

Query: 130 GIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDPNTLHQPLP 189
           G+ G K T GR S+ G  PL  +V + G +AA+V+D  +AY  +A  D   P+ L QP  
Sbjct: 134 GVVGFKPTAGRLSNSGLLPLNWTVGMPGILAATVEDTLIAYAAIA--DQSKPSPLQQPEL 191

Query: 190 TLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR-GAXXXXXXXXXXXX 248
            L     T  +  +++  Y+ W     +  I +     +  L+   G             
Sbjct: 192 NLPMLTRTRSMPSIRLAKYAKWFDD-SSEDIRSLCGKALQMLRTHYGWESVDVTVPEIEE 250

Query: 249 ARIAHLLTIGTELT-TVAKRHKDKMHL--FSCPTRSNINVMKLATASDYIVSQQVRTRIM 305
            R+AH +T+G+E T ++A ++ D M         R  ++     ++ DY+ +Q++R R M
Sbjct: 251 MRLAHYVTMGSECTASLAAKYLDSMDRSEVGWDVRIALSAYGSFSSRDYLSAQRLRCRQM 310

Query: 306 RTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANFAGVPAVS 365
                +F    D I+TP T +TA  +   AL+ GE+D    + ++R+    NF G+PA++
Sbjct: 311 YFHEKIFET-ADAIVTPMTGVTAYALQDDALSTGELDYINGAALVRYSIAGNFLGLPAIT 369

Query: 366 VPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNR-RKKP 409
           VP GYD   LP+GLQFI + + EATLL +A   +E  G +  +KP
Sbjct: 370 VPVGYDRGGLPVGLQFIGRPWSEATLLHLAYAMQEACGKKVLRKP 414



>gi|156040583|ref|XP_001587278.1| hypothetical protein SS1G_12308 [Sclerotinia sclerotiorum 1980]
 gi|154696364|gb|EDN96102.1| hypothetical protein SS1G_12308 [Sclerotinia sclerotiorum 1980 UF-70]
          Length = 1244

 Score =  225 bits (573), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 150/431 (34%), Positives = 219/431 (50%), Gaps = 33/431 (7%)

Query: 1    TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDAT-IIERLREKGA 59
            T RY   + L +LDG+P  +KD+ DV GY ++ G K  +    A   +T I+++    GA
Sbjct: 807  TLRYQQGNPLSILDGVPTGIKDDSDVAGYRSHHGRKRNDSMFTAAEKSTWIVQQWENSGA 866

Query: 60   IILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGG 119
            +I+GK +MHE+G  +TNNNP   TP+NP+N  YYP              L P A+G DGG
Sbjct: 867  LIMGKLNMHELGSDTTNNNPHWGTPKNPHNDHYYPGGSSGGPAYAVSSGLIPFALGSDGG 926

Query: 120  GSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPK 179
            GS+RIPSSFCG+YGLK +  R  D G      +V V+GP+AA++ DL +AY VMA  +P 
Sbjct: 927  GSIRIPSSFCGLYGLKPSHSRVEDTGS-----TVTVNGPLAATMADLEVAYRVMAKPNPS 981

Query: 180  DP-NTLHQPLPTLHGFHVTNKLSDLK-IGVYSMWNKQVDNPAITTALNNFIDEL-KLRGA 236
            DP   L  P  +        K +  K IG+Y  W  + + P++ T    F+D   K  G 
Sbjct: 982  DPVAALFSPPGSF-------KTAQPKVIGIYKDWFDRAE-PSVHTLCTKFVDYCEKTLGY 1033

Query: 237  XXXXXXXXXXXXARIAHLLTIGTELTTVAKRHK-DKMHLFSCPTRSNINVMKLAT---AS 292
                         ++AH +TI   + + AK H    M+     + SN  ++ +     A 
Sbjct: 1034 TIVPITIPYCPEGQLAHAMTILANMASRAKTHPFSPMNWLQDASPSNKILLTMGAYTPAR 1093

Query: 293  DYIVSQQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKI-YPRALAHGEVDVTMISDIM 350
            DY+++QQ+R  +M+ L+ LF     LI+ TP T I   +I +   L HG  D       M
Sbjct: 1094 DYLLAQQLRNLLMQHLSFLFKKYPGLIIVTPTTPIPGWQIEHEGDLLHGAFDPNKSLRNM 1153

Query: 351  RFVQLANFAGVPAVSVPAGYDD-----NNLPIGLQFIAKWYDEATLLRIAKTSEEIL--- 402
             +V LANF G+P ++ P GY D       +P+G+    +W  E  L+   K +E  L   
Sbjct: 1154 EYVWLANFTGIPGINCPVGYVDPKKGEGKIPVGIMGSTEWGGEEVLIEFGKEAEAWLAAG 1213

Query: 403  --GNRRKKPSD 411
              G  RK P +
Sbjct: 1214 NEGGGRKLPRN 1224



>gi|442319592|ref|YP_007359613.1| amidase family protein [Myxococcus stipitatus DSM 14675]
 gi|505161088|ref|WP_015348190.1| amidase family protein [Myxococcus stipitatus]
 gi|441487234|gb|AGC43929.1| amidase family protein [Myxococcus stipitatus DSM 14675]
          Length = 557

 Score =  224 bits (572), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 145/400 (36%), Positives = 212/400 (53%), Gaps = 8/400 (2%)

Query: 2   ERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAII 61
           ER      L +LDG+P+ VKDE+DV GY T +GT+F N    A  DAT+  RLR  GA+I
Sbjct: 148 ERLRAGRPLSVLDGVPVVVKDEVDVAGYPTTLGTRFRN--QVAAVDATVAARLRAAGALI 205

Query: 62  LGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGS 121
           LGK +M EIG      NP     RNP+N  +                LCP+ +G DGGGS
Sbjct: 206 LGKANMQEIGINPIGLNPHHGAVRNPWNRGHITGGSSSGSAAVVAAGLCPLGVGADGGGS 265

Query: 122 VRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDP 181
           +RIP++ CGI GLK T GR  + G  PL  +V   GPM  +VDD+A  Y V+AG D KD 
Sbjct: 266 IRIPAALCGIVGLKATWGRIPETGVPPLCWNVGHVGPMGLTVDDVAALYAVLAGPDGKDV 325

Query: 182 NTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVD-NPAITTALNNFIDELKLRGAXXXX 240
              +QP   L G+   + L+ +++G+   W    D  P +     + +  L   GA    
Sbjct: 326 VAQNQPAHHLSGYERAD-LTGIRLGI--CWPYFEDAAPDVVARCKDAVKALTDAGAVVVE 382

Query: 241 XXXXXXXXARIAHLLTIGTELTTVAKRH-KDKMHLFSCPTRSNINVMKLATASDYIVSQQ 299
                       H   I +E+      H ++++  F   +R+N+ + +   A+D + + +
Sbjct: 383 IPAPDLNTVLWTHSCIILSEMAESMLPHTRERVSDFGLDSRTNLAIGRHFRATDLVHALR 442

Query: 300 VRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANFA 359
            R R+ R L  + S  VD+I+TP TAI+AP I    L  GE ++ +   +MRFV+  N  
Sbjct: 443 HRHRLTRELLAVMSG-VDVIITPTTAISAPAIPESTLPEGESNLQVADALMRFVREGNLT 501

Query: 360 GVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSE 399
           G PA+SVPAG+D   LP+G+Q + + ++E  LLR+ +  E
Sbjct: 502 GFPALSVPAGHDRAGLPVGVQLMGRPFEEHLLLRLGRVVE 541



>gi|116202775|ref|XP_001227199.1| hypothetical protein CHGG_09272 [Chaetomium globosum CBS 148.51]
 gi|88177790|gb|EAQ85258.1| hypothetical protein CHGG_09272 [Chaetomium globosum CBS 148.51]
          Length = 665

 Score =  224 bits (572), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 154/441 (34%), Positives = 222/441 (50%), Gaps = 32/441 (7%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDAT--IIERLREKG 58
           T+RY    SLG LDG+P AVKDE D++GY T++G++   Y +P     T   +E+L   G
Sbjct: 131 TQRYKEGRSLGPLDGVPTAVKDEYDIEGYRTSLGSRNTYY-SPDEDHGTSWCVEKLEAAG 189

Query: 59  AIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDG 118
           AI LGK SMHE G  +T NNP   TPRNP+N  YY               L PI +G DG
Sbjct: 190 AINLGKLSMHEFGLDTTGNNPIHGTPRNPHNRHYYTGGSSSGTAYAVSAGLIPIGLGSDG 249

Query: 119 GGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDP 178
           GGS+RIPSS CG++GLK T GR S      +  + A  GP+AA +  LA  + V++    
Sbjct: 250 GGSIRIPSSLCGVFGLKPTHGRLSFRPGPNVCITCACLGPIAADISSLAAVFSVISAPHS 309

Query: 179 KDPNTLHQPLPTLHGFHVTNKLSDLKI-GVYSMWNKQVDNPAITTALNNFIDEL-KLRGA 236
             P     PLPT      T + +D KI G+   W  +   P I    N  I +L    G 
Sbjct: 310 SSP---FPPLPTPLSLG-TPRPNDPKILGIPQAWIAR-STPTIQALCNRLIRQLVTTHGY 364

Query: 237 XXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYIV 296
                        ++AH LT+ T+  T+    +      +   R  + + ++  A+DY++
Sbjct: 365 TTVDITIPFLREGQLAHALTVLTDAATLLPNPRG----LTAANRVLLALGRVTPATDYLL 420

Query: 297 SQQVRTRIMRTLNNLFSNQVD-LILTPATAITA-PKIYPRALAHGEV---DVTMISDIMR 351
           +Q++R  +M+ L  L+      LI+TP TA    P +  RA     V   D TM S  M 
Sbjct: 421 AQKLRRLLMQHLAWLWQQHPGMLIVTPTTACEGLPIVDERAEMRWGVNDGDRTMQS--ME 478

Query: 352 FVQLANFAGVPAVSVPAGY-----DDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRR 406
           +V +ANF G+P++S PAG+        ++P+G+  + +W  E  LLR  +  EE+   RR
Sbjct: 479 YVWMANFCGLPSLSAPAGFVPGRGGTPDVPVGVMAMGEWCAEEQLLRFGRVLEEVGAERR 538

Query: 407 KKPSDKFWFGNYVQEVSENFF 427
           ++P      G +V  V E FF
Sbjct: 539 RRP------GVWVDVVEEAFF 553



>gi|482814810|gb|EOA91485.1| hypothetical protein SETTUDRAFT_170384 [Setosphaeria turcica Et28A]
          Length = 593

 Score =  224 bits (572), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 145/412 (35%), Positives = 210/412 (50%), Gaps = 22/412 (5%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+RY     LG+LDG+P  VKD++ VKGY+  +GT        +T  +   E + ++GAI
Sbjct: 173 TQRYKEGKPLGILDGVPFGVKDDLRVKGYKHYIGTTHDFSHGGSTVTSWCAEVVEKEGAI 232

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++G  +MHE+G  +TNNNP   TP NPYN  YYP              L P AIG DGGG
Sbjct: 233 MVGTLTMHELGMDTTNNNPNWGTPLNPYNNSYYPGGSSGGAASAVGHGLIPFAIGSDGGG 292

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVRIPS++CG+YGLKT+  R S         SV V GP+A+++ DL +AY V+A  DP +
Sbjct: 293 SVRIPSNYCGLYGLKTSHARVSIAPMPNAGKSVTVRGPLASNMCDLEIAYRVLAQPDPSN 352

Query: 181 -PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNP---AITTALNNFIDELKLRGA 236
            P +L  P P  H    T   S + +GV+  W  + D P   A  +AL  F  EL   G 
Sbjct: 353 YPASLFAP-PKKH----TGPRSKV-LGVHKAWVDRADAPVQEAFQSALRYFETEL---GY 403

Query: 237 XXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYIV 296
                        ++AH +TI  E        K  ++  + P R  + V +   A+D+++
Sbjct: 404 QVVDISIPLLTEGQLAHAMTIMAEGVA---GFKQSIYSLTPPNRVLMTVGRQTPATDFLL 460

Query: 297 SQQVRTRIMRTLNNLFSNQVDL-ILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQL 355
           +Q++R  +M+ L +LF+    L I+TP T      I    L+HG  +  M    M +V L
Sbjct: 461 AQRLRHLLMQHLADLFTKYPGLVIVTPTTPNAGWPIDEAELSHGVTNANMQIRNMEYVWL 520

Query: 356 ANFAGVPAVSVPAGYDD-----NNLPIGLQFIAKWYDEATLLRIAKTSEEIL 402
           ANF G+P +  P GY D       +P+G+    +W  E  L+      E+ L
Sbjct: 521 ANFTGIPCIQFPMGYVDGVKGKGKVPVGMSGQGEWGSEDALIEFGHDGEKWL 572



>gi|336270062|ref|XP_003349790.1| hypothetical protein SMAC_00678 [Sordaria macrospora k-hell]
 gi|380095180|emb|CCC06653.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 620

 Score =  224 bits (570), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 150/429 (34%), Positives = 209/429 (48%), Gaps = 28/429 (6%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDAT---IIERLREK 57
           T+RY    SLG LDG+P  VKDE D+ GYETN+G+K I  G     D+     + +L+E 
Sbjct: 182 TQRYKEGRSLGPLDGVPTGVKDEYDIDGYETNLGSKNIYTGTIHEEDSITTWCVRKLQES 241

Query: 58  GAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRD 117
           GAIILGK SMHE G  +T NNP   TPRNP+N +YY               L PI +G D
Sbjct: 242 GAIILGKLSMHEFGLDTTGNNPIHGTPRNPHNPNYYTGGSSSGTGYAVSAGLIPIGLGSD 301

Query: 118 GGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKD 177
           GGGS+RIPSS CG++GLK T GR S         + A  GP+AA +  LA  + V+    
Sbjct: 302 GGGSIRIPSSLCGVFGLKPTHGRLSFKPGQNHCLTCACLGPIAADIKSLATVFQVICKPH 361

Query: 178 PKDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLRGA 236
           P  P     PL  L      N  +   +GV S W  +   PAI T  N  I  L    G 
Sbjct: 362 PSSP---FPPLKRLSLTTPPNGGNPKVLGVPSAWFARA-TPAIQTLCNTMIRRLCSDHGY 417

Query: 237 XXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYIV 296
                        +IAH +T+ T+  T+     +     +   R  I +  +  ASDY++
Sbjct: 418 TAVEIDIPFLPEGQIAHAITVLTDAATLLPETSN----LTYGNRILIALGTVTPASDYML 473

Query: 297 SQQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIYPRA-LAHGEVDVTMISDIMRFVQ 354
           + ++R  +M+ L+ L+      LI+TP T+     I  ++ L  G  D       M +V 
Sbjct: 474 AMKLRRVLMQHLSWLWQQYPGMLIVTPTTSCEGLPIKTKSELKWGVNDGDRTLQSMEYVW 533

Query: 355 LANFAGVPAVSVPAGY--------------DDNNLPIGLQFIAKWYDEATLLRIAKTSEE 400
           LANF G+P++SVPAG+                  +P+GL  + +W  E  LL+     EE
Sbjct: 534 LANFCGLPSISVPAGFVSPESGLVNDMDVQGRGEVPVGLMAMGEWCAEEQLLQFGAVCEE 593

Query: 401 ILGNRRKKP 409
              +RR++P
Sbjct: 594 AGADRRRRP 602



>gi|472239297|gb|EMR84116.1| putative glutamyl-trna amidotransferase subunit a protein
           [Botryotinia fuckeliana BcDW1]
          Length = 610

 Score =  222 bits (566), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 146/424 (34%), Positives = 219/424 (51%), Gaps = 32/424 (7%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDAT-IIERLREKGA 59
           T RY   + L +LDG+P  +KD+ DV GY ++ G K  +    A  ++T I+++ ++ GA
Sbjct: 173 TLRYQQGNPLSILDGVPTGIKDDSDVAGYRSHGGRKKNDLLFIAAKESTWIVQQWQKSGA 232

Query: 60  IILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGG 119
           +I+GK +MHE+G  +TNNNP   TP+NP+N +YYP              L P A+G DGG
Sbjct: 233 LIMGKLNMHELGSDTTNNNPNWGTPKNPHNYNYYPGGSSGGPAYAVSSGLIPFALGSDGG 292

Query: 120 GSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPK 179
           GS+RIPSSFCG+YGLK +  R  + G      +V V+GP+A+++ DL +AY +MA  +P 
Sbjct: 293 GSIRIPSSFCGLYGLKPSHSRVQNTGS-----TVTVNGPLASTMADLEVAYRIMAKPNPS 347

Query: 180 DP-NTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLRGAX 237
           DP   L  P  +L             IG+Y  W  + + P++      F+D   K  G  
Sbjct: 348 DPVAALFSPPESLRAARPK------VIGIYKDWFDRAE-PSVHDLCTKFVDHCEKSLGYT 400

Query: 238 XXXXXXXXXXXARIAHLLTIGTELTTVAKRHKD----KMHLFSCPTRSNINVMKLAT--- 290
                       ++AH +TI   LT +A R K+      +     T SN  ++ +     
Sbjct: 401 VVPITIPYCPEGQLAHAMTI---LTNMASRAKNLPFSASNWLKDATPSNKILLTMGAYTP 457

Query: 291 ASDYIVSQQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKI-YPRALAHGEVDVTMISD 348
           A DY+++QQ+R  +M+ L+ LF     LI+ TP T I   +I +   L HG  D      
Sbjct: 458 ARDYLLAQQLRNLLMQHLSFLFKKYPGLIIVTPTTPIPGWEIEHEGDLQHGAFDPNKSLR 517

Query: 349 IMRFVQLANFAGVPAVSVPAGYDD-----NNLPIGLQFIAKWYDEATLLRIAKTSEEILG 403
            M +V LANF GVP ++ P GY D       +P+G+   A+W  E  L+   K +E  LG
Sbjct: 518 NMEYVWLANFTGVPGINCPVGYVDPKKGEGKIPVGIMGSAEWGGEEVLIEFGKEAEVWLG 577

Query: 404 NRRK 407
              +
Sbjct: 578 RENE 581



>gi|77553129|gb|ABA95925.1| Amidase family protein, expressed [Oryza sativa Japonica Group]
          Length = 603

 Score =  222 bits (565), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 142/413 (34%), Positives = 216/413 (52%), Gaps = 10/413 (2%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY   + L  +DGI +AVKDEID   Y T  GT+++       +DA ++ +LR  GA+
Sbjct: 187 TLRYQRGTPLSAMDGILVAVKDEIDCLPYPTTGGTRWLGRARACAADAAVVAQLRACGAV 246

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           + GKT+MHE+G G++  NP   + RNP+N                   LCP+A+G DGGG
Sbjct: 247 LAGKTNMHELGAGTSGINPHHGSTRNPHNPGRVSGGSSSGSAAAVCAGLCPVALGVDGGG 306

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P++ CG+ G K T GR S+ G  PL  +V + G +A +V+D A+AY  +   D   
Sbjct: 307 SVRMPAALCGVVGFKPTAGRLSNAGVLPLNWTVGMPGILAGTVEDAAVAYSAIV--DQSQ 364

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMW-NKQVDNPAITTALNNFIDELKLR-GAXX 238
           P+ L +P   L     +  + ++K+  Y+ W N   ++  I +  +  +  L    G   
Sbjct: 365 PSYL-RPELNLPLLKSSLSIKNIKLAKYAKWFNDSSED--IRSCCDKSLQMLHAHYGWET 421

Query: 239 XXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHL--FSCPTRSNINVMKLATASDYIV 296
                      R+AH +TIG+E T    ++ DK+         R  + V    ++  Y+ 
Sbjct: 422 LDVTIPEIEEMRLAHYVTIGSECTASLAKYLDKLKRSEIGWDVRVALGVYGSFSSRAYLN 481

Query: 297 SQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLA 356
           SQ++R R M     +F    D+I++P T +TA K+   AL  GE+D    + ++R+    
Sbjct: 482 SQRLRNRQMYFHKEIFKT-ADVIVSPMTGVTAYKLQDDALKSGELDYINGAALVRYSIAG 540

Query: 357 NFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKP 409
           NF G+PA++V  GYD   LPIGLQFI + + EATLL IA   +E      KKP
Sbjct: 541 NFLGLPAITVMVGYDKAGLPIGLQFIGRPWSEATLLHIAFAMQEACKKHYKKP 593



>gi|336466230|gb|EGO54395.1| hypothetical protein NEUTE1DRAFT_68998 [Neurospora tetrasperma FGSC
           2508]
 gi|350286914|gb|EGZ68161.1| amidase signature enzyme [Neurospora tetrasperma FGSC 2509]
          Length = 625

 Score =  222 bits (565), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 150/430 (34%), Positives = 210/430 (48%), Gaps = 29/430 (6%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDAT---IIERLREK 57
           T+RY    SLG LDG+P  VKDE D+ GYETN+G+K I  G     D+     + +L+E 
Sbjct: 186 TQRYKEGRSLGPLDGVPTGVKDEYDIDGYETNLGSKNIYTGTIHEEDSITTWCVRKLQES 245

Query: 58  GAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRD 117
           GAIILGK SMHE G  +T NNP   TPRNP+N +YY               L PI +G D
Sbjct: 246 GAIILGKLSMHEFGLDTTGNNPVHGTPRNPHNPNYYTGGSSSGTGYAVSAGLIPIGLGSD 305

Query: 118 GGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKD 177
           GGGS+RIPSS CG++G+K T GR S         + A  GP+AA +  LA  + V+    
Sbjct: 306 GGGSIRIPSSLCGVFGIKPTHGRLSFKPGQNHCLTCACLGPIAADIKSLATVFQVICKPH 365

Query: 178 PKDPNTLHQPLPTLHGFHVTNKLSDLKI-GVYSMWNKQVDNPAITTALNNFIDEL-KLRG 235
           P  P     PL  L      N  S  K+ G+ S W  +   PAI T  N  I  L    G
Sbjct: 366 PSSP---FPPLKRLSLTGPPNGGSHPKVLGIPSAWFARA-TPAIQTLCNTMIRRLCSDHG 421

Query: 236 AXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYI 295
                         +IAH +T+ T+  T+     +     +   R  I +  +  ASDY+
Sbjct: 422 YTAVEIDIPFLPEGQIAHAITVLTDAATLLPETSN----LTYGNRILIALGTVTPASDYM 477

Query: 296 VSQQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIYPRA-LAHGEVDVTMISDIMRFV 353
           ++ ++R  +M+ L+ L+      LI+TP T+     I  ++ L  G  D       M +V
Sbjct: 478 LAMKLRRVLMQHLSWLWQQYPGMLIVTPTTSCEGLPIKSKSELKWGVNDGDRTLQSMEYV 537

Query: 354 QLANFAGVPAVSVPAGY--------------DDNNLPIGLQFIAKWYDEATLLRIAKTSE 399
            LANF G+P++SVPAG+                  +P+GL  + +W  E  LL+     E
Sbjct: 538 WLANFCGLPSISVPAGFVSPESGLVNDMDVQGRGEVPVGLMAMGEWCAEEQLLQFGAVCE 597

Query: 400 EILGNRRKKP 409
           E   +RR++P
Sbjct: 598 EAGADRRRRP 607



>gi|449303151|gb|EMC99159.1| hypothetical protein BAUCODRAFT_31474 [Baudoinia compniacensis UAMH
           10762]
          Length = 608

 Score =  222 bits (565), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 146/417 (35%), Positives = 213/417 (51%), Gaps = 29/417 (6%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+RY     LG LDGIP+AVKDE DV GY   +G+K ++Y     + +  ++   + GA+
Sbjct: 174 TKRYGEGRPLGPLDGIPVAVKDEEDVTGYRKCLGSK-LDYTRKDNATSHCVQLWLDAGAV 232

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           +LGKT+MHE+G  +TNNNP   TP NP+N  YY               L P+ +G DGGG
Sbjct: 233 LLGKTNMHELGMDTTNNNPNYGTPVNPHNETYYCGGSSGGSAYTVSAGLMPVTMGNDGGG 292

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVRIPS++CG+YGLK + GR S      LA S    GP+AA++ DL +AY VMA  D  D
Sbjct: 293 SVRIPSAYCGLYGLKPSQGRISIRPTMNLARSNGTPGPLAANMVDLEIAYRVMAQPDALD 352

Query: 181 PNT-LHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR-GAXX 238
            ++ L  P  +        K+    +GV++ W  + D P +  A    ID L  + G   
Sbjct: 353 RDSKLFSPPQSAARLSKRTKV----LGVFNEWFARADAP-VKDACQATIDYLTSKHGYTV 407

Query: 239 XXXXXXXXXXARIAHLLTIGTEL------TTVAKRHKDKMHLFSCPTRSNINVMKLATAS 292
                     A++AH +TI TE+      +++++       L SC T++         + 
Sbjct: 408 VPITLPLLHDAQVAHGMTILTEIGAGVPTSSISQLTAPNKVLLSCGTKT--------PSV 459

Query: 293 DYIVSQQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYPRALAHGEVDVTMISDIMR 351
           D++ +Q++R  +M+ L +LF     +I+ TP T        P+ L +G  D  M    M 
Sbjct: 460 DFLQAQKLRNLLMQHLAHLFDQHPGMIIVTPTTPNAGWHFSPQDLRYGCSDGNMQLRNME 519

Query: 352 FVQLANFAGVPAVSVPAGY------DDNNLPIGLQFIAKWYDEATLLRIAKTSEEIL 402
           +  LANF G PA+SVP GY          +PIGLQ +A+W  E  L+      E  L
Sbjct: 520 YAYLANFVGCPAISVPVGYVAPVKGTKGRIPIGLQGMAEWCSEDELIAFGYDCERYL 576



>gi|290977164|ref|XP_002671308.1| predicted protein [Naegleria gruberi]
 gi|284084876|gb|EFC38564.1| predicted protein [Naegleria gruberi]
          Length = 538

 Score =  220 bits (561), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 141/429 (32%), Positives = 222/429 (51%), Gaps = 23/429 (5%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSD---ATIIERLREK 57
           T+RY     + + DG+P+ +KDE+D+ G+ +  G K   Y     ++   + + + LR  
Sbjct: 106 TKRYEEGKEISVFDGVPVTIKDELDLAGFTSTKGMKVTEYTEHVITEDEESNVSKSLRAL 165

Query: 58  GAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRD 117
           G + +GK + +EIG  +   N    + RNPYN                   L P++IG D
Sbjct: 166 GVMFVGKANQNEIGICARGINVNFGSARNPYNLQCDTGGSSSGSGAGVGSGLIPLSIGTD 225

Query: 118 GGGSVRIPSSFCGIYGLKTTCGRFSDDGQY-PLAHSVAVSGPMAASVDDLALAYYVMAGK 176
           GGGSVRIPSS CG+YGLK T  R S   +  P+A S  V+GPM  S  DL L++  +AG+
Sbjct: 226 GGGSVRIPSSLCGVYGLKPTHYRISTKQKSAPVAFSTCVAGPMTGSAIDLTLSFAAVAGR 285

Query: 177 DPKDPNTLHQPLP-TLHGFHVTN----KLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL 231
              D  +L QP    L+   + +     L++ KIG+++ +   V +  I     +FI+++
Sbjct: 286 RSNDLKSLTQPRDLRLNEIRLMDPDYYNLNERKIGIHNDYFNDVKDNRIPKLCRDFIEKV 345

Query: 232 --KLRGAXXXXXXXX-XXXXARIAHLLTIGTELTTVAKRHK----DKMHLFSCPTRSNIN 284
             K+  A             +R++HL+TI  E+    K +     DK       TR ++ 
Sbjct: 346 FCKIYNAQIDDSIVIPLLEPSRVSHLVTIAGEMRNGMKDYGYYEYDKRSKLCPETRMSLL 405

Query: 285 VMKLATASDYIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVT 344
             K A++SDYI +Q+VR+  M     LF  +VD+I  P     AP+     +  G + V+
Sbjct: 406 SQKYASSSDYITAQRVRSHQMDEFAKLFE-KVDVIALPTVGCVAPEFDESQVKKGGLGVS 464

Query: 345 ---MISDIMRFVQLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEI 401
              ++S IM+F+  +NF G P+VS+P G+ DN  P+GLQ +AKW+DE TLL+    +E+ 
Sbjct: 465 DYDVLSSIMKFIFTSNFCGFPSVSIPIGFIDNK-PVGLQLMAKWWDEVTLLKFCLLAEKY 523

Query: 402 LGNRRKKPS 410
               +KKP 
Sbjct: 524 --TEKKKPQ 530



>gi|85077960|ref|XP_956088.1| hypothetical protein NCU04092 [Neurospora crassa OR74A]
 gi|28917133|gb|EAA26852.1| conserved hypothetical protein [Neurospora crassa OR74A]
          Length = 625

 Score =  220 bits (560), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 149/430 (34%), Positives = 209/430 (48%), Gaps = 29/430 (6%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDAT---IIERLREK 57
           T+RY    SLG LDG+P  VKDE D+ GYETN+G+K I  G     D+     + +L+E 
Sbjct: 186 TQRYKEGRSLGPLDGVPTGVKDEYDIDGYETNLGSKNIYTGTIHEEDSITTWCVRKLQES 245

Query: 58  GAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRD 117
           GAIILGK SMHE G  +T NNP   TPRNP+N +YY               L PI +G D
Sbjct: 246 GAIILGKLSMHEFGLDTTGNNPVHGTPRNPHNPNYYTGGSSSGTGYAVSAGLIPIGLGSD 305

Query: 118 GGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKD 177
           GGGS+RIPSS CG++G+K T GR S         + A  GP+AA +  LA  + V+    
Sbjct: 306 GGGSIRIPSSLCGVFGIKPTHGRLSFKPGQNHCLTCACLGPIAADIKSLATVFQVICKPH 365

Query: 178 PKDPNTLHQPLPTLHGFHVTNKLSDLKI-GVYSMWNKQVDNPAITTALNNFIDEL-KLRG 235
           P  P     PL  L      N     K+ G+ S W  +   PAI T  N  I  L    G
Sbjct: 366 PSSP---FPPLKRLSLTGPPNGGDHPKVLGIPSAWFARA-TPAIQTLCNTMIRRLCSDHG 421

Query: 236 AXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYI 295
                         +IAH +T+ T+  T+     +     +   R  I +  +  ASDY+
Sbjct: 422 YTAVEIDIPFLPEGQIAHAITVLTDAATLLPETGN----LTYGNRILIALGTVTPASDYM 477

Query: 296 VSQQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIYPRA-LAHGEVDVTMISDIMRFV 353
           ++ ++R  +M+ L+ L+      LI+TP T+     I  ++ L  G  D       M +V
Sbjct: 478 LAMKLRRVLMQHLSWLWQQYPGMLIVTPTTSCEGLPIKSKSELKWGVNDGDRTLQSMEYV 537

Query: 354 QLANFAGVPAVSVPAGY--------------DDNNLPIGLQFIAKWYDEATLLRIAKTSE 399
            LANF G+P++SVPAG+                  +P+GL  + +W  E  LL+     E
Sbjct: 538 WLANFCGLPSISVPAGFVSPESGLVNDMDVQGRGEVPVGLMAMGEWCAEEQLLQFGAVCE 597

Query: 400 EILGNRRKKP 409
           E   +RR++P
Sbjct: 598 EAGADRRRRP 607



>gi|330914416|ref|XP_003296630.1| hypothetical protein PTT_06775 [Pyrenophora teres f. teres 0-1]
 gi|311331130|gb|EFQ95265.1| hypothetical protein PTT_06775 [Pyrenophora teres f. teres 0-1]
          Length = 598

 Score =  219 bits (559), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 140/389 (35%), Positives = 196/389 (50%), Gaps = 22/389 (5%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREK-GA 59
           T+RY     LG+LDG+P  VKD++ V GY   +G +  +  N    + +   R  EK GA
Sbjct: 173 TQRYKLGQPLGVLDGVPFGVKDDVQVNGYRRYIGARH-DVSNGGEGETSFCARALEKEGA 231

Query: 60  IILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGG 119
           I++G  +MHE+G  +TNNNP   TP NPYNT YY               L P AIG DGG
Sbjct: 232 ILVGTLTMHELGMDTTNNNPIWGTPVNPYNTCYYTGGSSGGPASAVSHGLIPFAIGSDGG 291

Query: 120 GSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPK 179
           GS+R+PS++CGIYGLK +  R S         SV   GP+AA++ DLA++Y V+A  DP 
Sbjct: 292 GSIRLPSNYCGIYGLKPSHSRVSMAPMADSTSSVTTHGPIAANMSDLAISYRVLAQPDPS 351

Query: 180 DPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNP---AITTALNNFIDELKLRGA 236
              + H   P  H  H         +G+Y  W  + D P   AI  AL  F  +L   G 
Sbjct: 352 TFPSSHFRAPNPHTSHRPK-----VVGIYKPWLDRADGPVQEAIYAALGYFEKQL---GY 403

Query: 237 XXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYIV 296
                        ++AH +TI  E  T    +K  ++  S P R  ++V +   ASD+I+
Sbjct: 404 EVIDVTIPLTTDGQLAHAMTIMAEGATA---YKHSVYDLSAPNRILLSVGRQTPASDFIL 460

Query: 297 SQQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYPRALAHGEVDVTMISDIMRFVQL 355
           +Q+VR   M+ L +LF     LI+ +P +      I P+ L+HG  D  M    M +V  
Sbjct: 461 AQRVRNLQMQHLAHLFQKHPGLIIVSPTSPNAGWPIDPKDLSHGVSDANMQLRNMEYVWF 520

Query: 356 ANFAGVPAVSVPAGY-----DDNNLPIGL 379
           ANF GVP +  P GY      +  +P+GL
Sbjct: 521 ANFTGVPCIQFPVGYVQGVRGEGRVPMGL 549



>gi|169616900|ref|XP_001801865.1| hypothetical protein SNOG_11626 [Phaeosphaeria nodorum SN15]
 gi|111060214|gb|EAT81334.1| hypothetical protein SNOG_11626 [Phaeosphaeria nodorum SN15]
          Length = 602

 Score =  219 bits (559), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 145/439 (33%), Positives = 214/439 (48%), Gaps = 24/439 (5%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+R+     LG+LDG+P AVKD++DV+GY+ +VGT            +  ++++ E GA+
Sbjct: 173 TQRWKAGKPLGILDGVPFAVKDDLDVRGYKRHVGTGHDYTEGKEVETSWCVKKIEEAGAV 232

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GK +MHE+G  +TNNNP   TP NPYN  YY               + P  IG DGGG
Sbjct: 233 LIGKLNMHELGSDTTNNNPIWGTPLNPYNASYYTGGSSGGVASAVGHGIVPFGIGSDGGG 292

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVRIPS++CG++GLKT+ GR S         SV V GP+  S+ DL ++Y V+A  DP  
Sbjct: 293 SVRIPSNYCGLFGLKTSHGRVSTAPTPGGMKSVVVRGPLTTSMADLDISYRVLAQPDPSC 352

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR-GAXXX 239
             + H   P  H     NK+    IG+   W  + D PA+  A  + +  ++   G    
Sbjct: 353 YPSSHFSPPKPH-TGPRNKI----IGICKPWFDRAD-PAVQEACQSAMQYMQSELGYTII 406

Query: 240 XXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYIVSQQ 299
                     ++AH +TI  E   +++     +   +   R  ++V K     D++++Q+
Sbjct: 407 DITIPLLQEGQLAHAMTILAEGVDLSR----PIWGLTPANRILMSVAKQTPTIDFLLAQR 462

Query: 300 VRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANF 358
           VR  IM  L +LF     LI+ TP T      I    LA G  +  M    M +V LANF
Sbjct: 463 VRNVIMEHLAHLFEKHPGLIIVTPTTPNVGWPIEDADLACGVSNANMTLRSMEYVWLANF 522

Query: 359 AGVPAVSVPAGYDD-----NNLPIGLQFIAKWYDEATLLRIAKTSEEIL--GNRRKKPSD 411
            G+P + +P GY D       +PIGL     W  E  L+      E  L  G++  KP  
Sbjct: 523 TGIPCIQLPVGYADAVEGKGKVPIGLSGHGDWGSEDALIEFGYDGERWLHEGHKGGKPMP 582

Query: 412 KFW-----FGNYVQEVSEN 425
           + W      G+ V+ V  N
Sbjct: 583 EGWVDILNLGDRVESVGRN 601



>gi|317144888|ref|XP_001820457.2| N-acylethanolamine amidohydrolase [Aspergillus oryzae RIB40]
          Length = 598

 Score =  219 bits (558), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 146/419 (34%), Positives = 207/419 (49%), Gaps = 23/419 (5%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATI----IERLRE 56
           T RY     LGL DG+P AVKDE D+ GY TN+G+       P + D +I    I +L +
Sbjct: 170 TRRYREGRPLGLFDGVPAAVKDEFDLDGYRTNMGSLNDYTLEPKSDDPSITNWCIRQLEK 229

Query: 57  KGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGR 116
            GAI++GK SMHE G  +T NN    TP NPY+ DYY               L PIA+G 
Sbjct: 230 AGAIVVGKVSMHEFGLDTTGNNIHYGTPPNPYHPDYYTGGSSSGCAYAVSTGLVPIALGT 289

Query: 117 DGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGK 176
           DGGGSVRIPSSFC + GLK T  R S       A + +V GP+AA +  LA AY V A  
Sbjct: 290 DGGGSVRIPSSFCSVVGLKPTHNRLSHYPSVNYASTTSVIGPLAADIRSLAEAYRVFATP 349

Query: 177 DPKDPNTLHQPL---PTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-K 232
            P  P     PL   P+  G  +        +G+  +W  +   P +     + +D+L  
Sbjct: 350 GPDTPFPAPGPLSLTPSTRGKKI--------LGIPEVWFSR-STPDVQRLCRSLLDKLVT 400

Query: 233 LRGAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATAS 292
            +               + AH +TI   L   A    D  ++ + P R  + + +   A+
Sbjct: 401 EKDYTIVPIDIPFLVEGQTAHAMTI---LADGAALLPDTTNI-TAPNRILLTLGRTTPAT 456

Query: 293 DYIVSQQVRTRIMRTLNNLFSNQVDLIL-TPATAITA-PKIYPRALAHGEVDVTMISDIM 350
           DY+++Q++R  +M+ L  L+     +I+ TP TA    P +    L  G  D       M
Sbjct: 457 DYLLAQKLRRLLMQHLAALWQEFPGMIIVTPTTACAGWPVVSKSELKWGLSDGDRTLKAM 516

Query: 351 RFVQLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKP 409
            +V LANF G+PA+SVPAGY D  +P+GL    +W  E  LL+    +EE+  + R++P
Sbjct: 517 EYVWLANFTGIPAISVPAGYADPEVPVGLMGNGEWGSEEQLLQWGLEAEELGADLRERP 575



>gi|492934050|ref|WP_006050964.1| amidase [Burkholderia graminis]
 gi|170140569|gb|EDT08744.1| Amidase [Burkholderia graminis C4D1M]
          Length = 476

 Score =  219 bits (558), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 135/407 (33%), Positives = 210/407 (51%), Gaps = 13/407 (3%)

Query: 10  LGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAIILGKTSMHE 69
           LG L GIP+A+KD I V    T  G++ +   +PA  DA I+ +LR+ GAI++GKT+MHE
Sbjct: 70  LGPLHGIPVALKDNIAVAHTRTTAGSRVLADWHPA-EDAAIVTKLRQAGAILIGKTNMHE 128

Query: 70  IGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGSVRIPSSFC 129
             +G T+ NP     RNP++T  +P               C  AIG D GGS+R+PS+  
Sbjct: 129 FAWGGTSANPHYGFVRNPWDTSRFPAGSSGGSAVAVAARFCFGAIGTDTGGSIRLPSAVN 188

Query: 130 GIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDPNTLHQP-- 187
           G  G++ T GR S+ G  PLA S+  +GPM  +V+D A  + V+AG D  D  +  QP  
Sbjct: 189 GTVGIRPTYGRVSNRGIVPLAWSMDTAGPMTRTVEDCATLFGVIAGFDRADAGSAAQPCG 248

Query: 188 --LPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXXXXXXXXX 245
             L TL      + +  L+IGV   +      PA+  A+   +D L+  GA         
Sbjct: 249 DYLQTL-----ADGIRHLRIGVIPSYFFHHLQPAVHGAVQQALDTLRELGAAVVDVPIDG 303

Query: 246 XXXARIAHLLTIGTELTTVAKRH-KDKMHLFSCPTRSNINVMKLATASDYIVSQQVRTRI 304
                 A L     E +   +RH +++   +    R+ + V +L  A+ YI +Q+ R  +
Sbjct: 304 IEDNISAQLTIEAAEPSAWHQRHLRERPQDYGDDVRTLLEVGELLLATHYIQAQRYRAVL 363

Query: 305 MRTLNNLFSNQVDLILTPATAITAPKI-YPRALAHGEVDVTMISDIMRFVQLANFAGVPA 363
                  F ++VD+ + P    TA ++   R +    V+  M+S IM+F  +A+  G+PA
Sbjct: 364 RAAFIEAF-HKVDVFICPTLPFTATRVGETRVVIEDGVEEDMLSAIMQFTGIASLTGLPA 422

Query: 364 VSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
           ++VP G+DD  LP+G+Q I + +DEATL R+    ++     R+ P 
Sbjct: 423 LNVPCGFDDEGLPVGMQIIGRPFDEATLFRVGHAFQQATAFHRRAPE 469



>gi|396481868|ref|XP_003841342.1| similar to glutamyl-tRNA(Gln) amidotransferase subunit A
           [Leptosphaeria maculans JN3]
 gi|312217916|emb|CBX97863.1| similar to glutamyl-tRNA(Gln) amidotransferase subunit A
           [Leptosphaeria maculans JN3]
          Length = 587

 Score =  219 bits (557), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 143/416 (34%), Positives = 207/416 (49%), Gaps = 30/416 (7%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGT--KFINYGNPATSDATIIERLREKG 58
           T+R+     LG+LDG+P  VKD++ +KGY+  +GT   + + G+  TS     +++ E G
Sbjct: 167 TQRWKQGQPLGILDGVPFGVKDDLAIKGYKRYIGTTHDYTDGGDKETS--WCAKKVEEAG 224

Query: 59  AIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDG 118
           AI++GK +MHE+G  +TNNNP   TP NPYN  YY               + P AIG DG
Sbjct: 225 AILVGKLTMHELGMDTTNNNPNWGTPLNPYNNSYYTGGSSGGAASAVGYGIIPFAIGSDG 284

Query: 119 GGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDP 178
           GGSVRIPS +CG+YGLKT+  R S         SV V GP+A+++ DL ++Y VMA  DP
Sbjct: 285 GGSVRIPSCYCGLYGLKTSHARVSVAPMPDAGKSVTVRGPLASNMSDLEISYRVMAQPDP 344

Query: 179 KDPNTLHQPLPTLHGFHVTNKLSDLK---IGVYSMWNKQVD---NPAITTALNNFIDELK 232
                 H P      F    K+S  +   IG+Y  W  + D     A  +AL  F  EL 
Sbjct: 345 T-----HYP---SSDFSPPKKISGPRPKVIGIYKAWLDRADPAVQEACQSALQYFKSEL- 395

Query: 233 LRGAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATAS 292
             G              +IAH +TI   L   A  H+  ++  + P R  ++V K   A+
Sbjct: 396 --GYETVDITIPLLPQGQIAHAMTI---LAEGASGHRSSIYDLTSPNRVLMSVAKQTPAT 450

Query: 293 DYIVSQQVRTRIMRTLNNLFSNQVDL-ILTPATAITAPKIYPRALAHGEVDVTMISDIMR 351
           D++++Q+VR  +M  L +L+     L I+TP T      I    L++G  +       M 
Sbjct: 451 DFLLAQRVRNILMEHLAHLYRTHPGLVIVTPTTPNAGWPIEDGELSYGVSNGNQQLRNME 510

Query: 352 FVQLANFAGVPAVSVPAGYDD-----NNLPIGLQFIAKWYDEATLLRIAKTSEEIL 402
           +  LANF G+P +  P GY D       +PIG+    +W  E  L+      E+ L
Sbjct: 511 YAWLANFTGIPCIQFPVGYVDGVKGAGKVPIGMSGHGEWGSEDALIEFGFDGEKFL 566



>gi|375008395|ref|YP_004982028.1| glutamyl-tRNA(Gln) amidotransferase subunit A [Geobacillus
           thermoleovorans CCB_US3_UF5]
 gi|503961576|ref|WP_014195570.1| glutamyl-tRNA amidotransferase subunit A [Geobacillus
           thermoleovorans]
 gi|359287244|gb|AEV18928.1| Glutamyl-tRNA(Gln) amidotransferase subunit A [Geobacillus
           thermoleovorans CCB_US3_UF5]
          Length = 470

 Score =  218 bits (554), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 137/401 (34%), Positives = 204/401 (50%), Gaps = 6/401 (1%)

Query: 11  GLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAIILGKTSMHEI 70
           G L GIPIA+KD + V    T +G+K      PA S AT+IERL E GA+  GKT++HE 
Sbjct: 71  GPLHGIPIAIKDLLYVADEMTTMGSKIHRNFRPAYS-ATVIERLTEAGAVFPGKTNLHEY 129

Query: 71  GFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGSVRIPSSFCG 130
            +G+TNNNP     RNP++ +  P              +   ++G D GGS+RIPSSFCG
Sbjct: 130 AWGATNNNPHFGPARNPWDPERIPGGSSGGSGVATAAHMTIASLGTDTGGSIRIPSSFCG 189

Query: 131 IYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDPNTLHQPLPT 190
           I GLK T G  S  G +PLA S+   GPM  +V D A     +AG DPKDP +   P  T
Sbjct: 190 IVGLKPTHGLVSKYGCFPLAWSLDHIGPMTKTVRDAAYVLEAIAGYDPKDPTSFAAPT-T 248

Query: 191 LHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXXXXXXXXXXXXAR 250
            +       +  +KIG+   +   VD   +  A+   I  L+  GA            A+
Sbjct: 249 SYALTFKESVKGVKIGIEPYFFDHVDK-EVEKAVKQAIASLEREGAVVETVRIPTLQYAQ 307

Query: 251 IAHLLTIGTELTTVAKRH-KDKMHLFSCPTRSNINVMKLATASDYIVSQQVRTRIMRTLN 309
            A ++TI +E +T+   H  ++   F    R  + + +L +A DY+ +QQ+R ++     
Sbjct: 308 YAEMITILSEASTIHHNHLVEREEDFGDDVRFLLKLGELPSAVDYLEAQQIRLKLDHEFM 367

Query: 310 NLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANFAGVPAVSVPAG 369
            +F N+VD+++TP      PKI    +     +V  +  I+RF    N  G+P V+VP G
Sbjct: 368 EIF-NKVDVLITPTIPFLPPKIGQDTVWINGEEVNFLDHIIRFTGPFNLTGLPVVTVPCG 426

Query: 370 YDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
           +    LP+G+Q I   + E T+L +A   E +    +  P+
Sbjct: 427 F-VQGLPVGMQIIGPAFGEGTILNVADVFETLHPELKYPPA 466



>gi|296817995|ref|XP_002849334.1| glutamyl-tRNA(Gln) amidotransferase subunit A [Arthroderma otae CBS
           113480]
 gi|238839787|gb|EEQ29449.1| glutamyl-tRNA(Gln) amidotransferase subunit A [Arthroderma otae CBS
           113480]
          Length = 611

 Score =  218 bits (554), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 149/432 (34%), Positives = 214/432 (49%), Gaps = 33/432 (7%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATI----IERLRE 56
           T RY   S LGLLDG+P AVKDE D+ GY+T +G+      +PA    +I    + +L E
Sbjct: 172 TTRYKKGSPLGLLDGVPTAVKDEYDIDGYKTCLGSLNDYTSDPAPPGDSIASWCVRKLEE 231

Query: 57  KGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGR 116
            GAI+LGK SMHE G  ++ +NP   TP NPYN  YYP              L P A+G 
Sbjct: 232 AGAIVLGKLSMHEFGLDTSGSNPNYGTPLNPYNPKYYPGGSSSGSAYAVSAGLVPFALGS 291

Query: 117 DGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGK 176
           DGGGS+RIPSSFC +YGLK T  R S       +++ AV+GP+AA +  L+  Y ++   
Sbjct: 292 DGGGSIRIPSSFCSVYGLKPTHNRISHHPGPNHSNTCAVNGPLAADLQSLSALYRIIGC- 350

Query: 177 DPKDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGA 236
            P   +  +   P L   H + K     +GV   W  Q   PAI     + I  L  +  
Sbjct: 351 -PPSSSPFNPVSPRLAPCHPSGK---KYLGVPEAWFSQA-TPAIQHLCRSAITTLADKND 405

Query: 237 XXXXXXXXX-XXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYI 295
                         +IAH LTI   LT  A    D  +L + P +  + + ++  A+DY+
Sbjct: 406 YTIVPIQIPFLVEGQIAHALTI---LTDAATLLPDTSNL-TAPNKILLGLGRVTPATDYL 461

Query: 296 VSQQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIY-PRALAHGEVDVTMISDIMRFV 353
           ++Q++R  +M+ L+ L+     +I+ TP T+     I   + L +G  D       M F+
Sbjct: 462 LAQKLRRLLMQHLSWLWKEYPGMIIVTPTTSCAGWPIRDQKELKYGISDGDQTLKTMDFI 521

Query: 354 QLANFAGVPAVSVPAGY----------------DDNNLPIGLQFIAKWYDEATLLRIAKT 397
            LANF G+PA+SVPAG+                 +  +PIGL    +W  E  L+R    
Sbjct: 522 WLANFTGLPAISVPAGFVVPEGAKGEGEIAEENTEGKIPIGLMGTGEWGSEDFLMRWGLD 581

Query: 398 SEEILGNRRKKP 409
            E ++G+RR KP
Sbjct: 582 VENVVGDRRSKP 593



>gi|338536053|ref|YP_004669387.1| amidase family protein [Myxococcus fulvus HW-1]
 gi|503707323|ref|WP_013941399.1| amidase [Myxococcus fulvus]
 gi|337262149|gb|AEI68309.1| amidase family protein [Myxococcus fulvus HW-1]
          Length = 557

 Score =  217 bits (552), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 146/403 (36%), Positives = 215/403 (53%), Gaps = 10/403 (2%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
            ER      L +LDGIP+ +KDE+D+ G+ T +GT+F      AT+D+T+  RL+  GAI
Sbjct: 147 AERLRAGRPLSVLDGIPVVLKDEVDLAGFPTTLGTRFRT--QVATADSTVAARLKAAGAI 204

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ILGK +M+EIG      NP     RNP++T                  LCP++IG DGGG
Sbjct: 205 ILGKANMNEIGINPIGLNPHHGAARNPWDTGRITGGSSSASAAAVAAGLCPLSIGADGGG 264

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           S+RIP++ CGI GLK T GR  + G  PL  +V   GPM  +VDD+A AY ++AG D +D
Sbjct: 265 SIRIPAALCGIVGLKATWGRIPETGVPPLCWNVGHVGPMGLTVDDVAAAYALLAGPDGQD 324

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXXXX 240
             +  Q    L G+   N LS +++G+   W+   D  A   A                 
Sbjct: 325 LVSQGQSPHHLSGYGDDN-LSGVRLGI--CWDYFEDAEADVVARCKEAVAALTAAGARVV 381

Query: 241 XXXXXXXXARI-AHLLTIGTELTTVAKRHKDKMHL--FSCPTRSNINVMKLATASDYIVS 297
                   A +  H   I +E++   + +  K HL  F   TR+N+ + +   A+D + +
Sbjct: 382 EVPPPDLNAVLWTHSCIILSEMSESMQPYV-KAHLSDFGLDTRTNLAIGRHFRATDLVHA 440

Query: 298 QQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLAN 357
            + R R+ R L    +  VD  +TP TA TAP I   AL  GE ++ ++  +MRFV+LAN
Sbjct: 441 LRHRHRLTRELLAQMAG-VDAFVTPTTATTAPLIPEAALPDGESNLPVVDALMRFVRLAN 499

Query: 358 FAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEE 400
             G P++SVPAG+D+  LP+G+Q   + Y+E  LLR+ +  E+
Sbjct: 500 LTGFPSLSVPAGFDEEGLPVGVQLTGRPYEEHLLLRLGRVVEQ 542



>gi|451846487|gb|EMD59797.1| hypothetical protein COCSADRAFT_193903 [Bipolaris sorokiniana
           ND90Pr]
          Length = 581

 Score =  217 bits (552), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 144/418 (34%), Positives = 211/418 (50%), Gaps = 24/418 (5%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREK-GA 59
           T+RY     LG+LDG+P  VKD++ VK Y+  VGT   +Y N  + +++   ++ EK GA
Sbjct: 160 TQRYKEGEPLGILDGVPFGVKDDLLVKDYKHYVGTTH-DYSNGGSKESSWCAKMLEKEGA 218

Query: 60  IILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGG 119
           I++G  +MHE+G  +TNNNP   TPRNPYN+ YYP              L P AIG DGG
Sbjct: 219 ILVGTLTMHELGMDTTNNNPHWGTPRNPYNSSYYPGGSSGGAASAVGHGLIPFAIGSDGG 278

Query: 120 GSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPK 179
           GSVRIPS++CG+YGLK +  R S         SV V GP+A+++ DL ++Y V+A  DP 
Sbjct: 279 GSVRIPSNYCGVYGLKPSHSRVSIAPMPNSGKSVTVRGPLASNMADLEISYRVLAQPDPS 338

Query: 180 D-PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVD---NPAITTALNNFIDELKLRG 235
             P++L  P     G    NK     +GV+  W  + D     +  +AL  F  EL   G
Sbjct: 339 TYPSSLFAPPRKFSG--PRNK----ALGVHKQWIDRSDPVVQESFYSALKYFEHEL---G 389

Query: 236 AXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYI 295
                         ++AH +TI  E    A  H+  ++  +   R  + +     A+D++
Sbjct: 390 YKVIDISIPLLTQGQLAHAMTIMAE---GAAAHRSSIYDLTPANRILMTIAHQTPATDFL 446

Query: 296 VSQQVRTRIMRTLNNLFSNQVDL-ILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQ 354
           ++Q++R  +M+ L +LF     L I+TP T      I    L+HG  +  M    M +V 
Sbjct: 447 LAQRLRNLLMQHLADLFRAYPGLVIVTPTTPNAGWPIDEAELSHGVTNGNMQIRNMEYVW 506

Query: 355 LANFAGVPAVSVPAGY-----DDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRK 407
           LANF GVP +  P  Y      +  +PIGL    +W  E  L+      E+ L   R+
Sbjct: 507 LANFTGVPCIQFPVDYVQGVKGEGMVPIGLSGHGEWGSEDALIEFGFDGEKWLHEGRE 564



>gi|108761318|ref|YP_632999.1| amidase [Myxococcus xanthus DK 1622]
 gi|499874090|ref|WP_011554824.1| amidase [Myxococcus xanthus]
 gi|108465198|gb|ABF90383.1| amidase family protein [Myxococcus xanthus DK 1622]
          Length = 557

 Score =  216 bits (551), Expect = 8e-54,   Method: Compositional matrix adjust.
 Identities = 146/402 (36%), Positives = 215/402 (53%), Gaps = 8/402 (1%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           +ER      L +LDGIP+ +KDE+D+ G+ T +GT+F      A +D+T+  RL+  GAI
Sbjct: 147 SERLREGRPLSVLDGIPVVLKDEVDLAGFPTTLGTRFRT--QVAAADSTVAARLKAAGAI 204

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ILGK +M+EIG      NP     RNP++T                  LCP++IG DGGG
Sbjct: 205 ILGKANMNEIGINPIGLNPHHGAARNPWDTGRITGGSSSASAAAVAAGLCPLSIGADGGG 264

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           S+RIP++ CGI GLK T GR  + G  PL  +V   GPM  +VDD+A AY V+AG D  D
Sbjct: 265 SIRIPAALCGIVGLKATWGRIPETGVPPLCWNVGHVGPMGLTVDDVAAAYAVLAGPDGHD 324

Query: 181 PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPA-ITTALNNFIDELKLRGAXXX 239
             +  Q    L G+     LS +++G+   W+   D  A +       +  L   GA   
Sbjct: 325 LVSQGQSPHHLSGYE-DEGLSGVRLGI--CWDYFEDADADVVARCKEAVAALSAAGARVV 381

Query: 240 XXXXXXXXXARIAHLLTIGTELTTVAKRH-KDKMHLFSCPTRSNINVMKLATASDYIVSQ 298
                        H   I +E++ V   H K     F   TR+N+ + +   A+D + + 
Sbjct: 382 EIPPPDLNTVLWTHSCIILSEMSEVMLPHVKAHPSEFGLDTRTNLAIGRHFRATDLVHAL 441

Query: 299 QVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANF 358
           + R R+ R L    +  VD+++TP TA TAP I   AL  GE ++ ++  +MRFV+LAN 
Sbjct: 442 RHRHRLTRELLAQMAG-VDVLVTPTTATTAPLIPEAALPDGESNLPVVDALMRFVRLANL 500

Query: 359 AGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEE 400
            G P++SVPAG+D+  LP+G+Q   + Y+E  LLR+ +  E+
Sbjct: 501 TGFPSLSVPAGFDEEGLPVGVQLTGRPYEEHLLLRLGRVVEQ 542



>gi|477529775|gb|ENH81525.1| glutamyl-tRNA amidotransferase subunit a [Colletotrichum orbiculare
           MAFF 240422]
          Length = 607

 Score =  216 bits (549), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 147/446 (32%), Positives = 216/446 (48%), Gaps = 47/446 (10%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTK--FINYGNPATS-DATIIERLREK 57
           T+RY    SLG LDG+P AVKDE ++ GY T +G++  +     P  S ++  +++L++ 
Sbjct: 147 TKRYKEGRSLGPLDGVPTAVKDEYEIDGYRTCLGSRNDYTTEAEPGKSINSWCVKKLQDA 206

Query: 58  GAIILGKTSMHEIGFG---------------STNNNPFVCTPRNPYNTDYYPXXXXXXXX 102
           GA+ILGK SMHE G G               +T NNP   TPRNPYN  YY         
Sbjct: 207 GAVILGKLSMHEFGLGRELLTHGTFKADRPDTTGNNPIYGTPRNPYNRGYYTGGSSSGAG 266

Query: 103 XXXXXXLCPIAIGRDGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAAS 162
                 + P+A+G DGGGS+RIPSS CG+YGLK + GR S D     ++S AV+GP+AA 
Sbjct: 267 YAVATGIVPVALGSDGGGSIRIPSSLCGVYGLKPSHGRVSFDPCPNHSNSCAVNGPIAAD 326

Query: 163 VDDLALAYYVMAGKDPKDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITT 222
           V+ LA  +  +    P   +   Q  P +     + K   + +G+   W  Q D PAI  
Sbjct: 327 VESLAACFETIGAPHPG--SNFIQASPFI--LSPSEKRGKI-LGIPEAWFAQAD-PAIQR 380

Query: 223 ALNNFIDEL-KLRGAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRS 281
                I  L    G              + AH LT+ T+  T+    K+  H      R 
Sbjct: 381 MCRTMIARLVTHHGYITVPIDIPFLVEGQSAHALTVLTDGATLLPETKNLTH----GNRI 436

Query: 282 NINVMKLATASDYIVSQQVRTRIMRTLNNLFSNQVDLIL-TPATAITA-PKIYPRALAHG 339
            + + ++ TA DY+++Q++R  +M+ L +L+     +I+ TP TA    P +    L++G
Sbjct: 437 LLAIGRVTTAVDYLLAQKLRGLLMQHLAHLWQAYPGMIIVTPTTACAGWPILRESELSYG 496

Query: 340 EVDVTMISDIMRFVQLANFAGVPAVSVPAGY----------------DDNNLPIGLQFIA 383
             D       M +V L NF G+P V+VPAGY                    +PIGL  + 
Sbjct: 497 VSDGDRTIRSMEYVWLGNFCGLPGVTVPAGYVVPHDQPGAGGEAGPDTVGKVPIGLMGMG 556

Query: 384 KWYDEATLLRIAKTSEEILGNRRKKP 409
           +W DE +LL     +EE+    R +P
Sbjct: 557 EWTDEHSLLEFGLDAEELFAKERCRP 582



>gi|310800935|gb|EFQ35828.1| amidase [Glomerella graminicola M1.001]
          Length = 614

 Score =  216 bits (549), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 139/433 (32%), Positives = 208/433 (48%), Gaps = 32/433 (7%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTK--FINYGNPATS-DATIIERLREK 57
           T+RY    SLG LDG+P AVKDE ++ GY T +G++  +     P  S  +  + +L + 
Sbjct: 169 TKRYKEGCSLGPLDGVPTAVKDEYEIDGYRTCLGSRNDYTTKAEPGQSITSWCVRKLEDA 228

Query: 58  GAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRD 117
           GA+++GK SMHE G  +T NNP   TPRNPYN  YY               L P+A+G D
Sbjct: 229 GAVVMGKLSMHEFGLDTTGNNPIYGTPRNPYNRGYYTGGSSSGAGYAVATGLVPVALGSD 288

Query: 118 GGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKD 177
           GGGS+RIPSS CG+YGLK T GR S       ++S AV+GP+AA ++ LA  +  +    
Sbjct: 289 GGGSIRIPSSMCGVYGLKPTHGRVSFHPCPNHSNSCAVNGPIAADIESLATYFETIGAPH 348

Query: 178 PKDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLRGA 236
           P        P          ++     +GV   W  Q D PAI       I +L    G 
Sbjct: 349 PDSCFIQASPF-----ISSPSEKRGKILGVPEAWFGQAD-PAIQRMCRAMITKLVTTYGY 402

Query: 237 XXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYIV 296
                        + AH +T+ T+  T+    K+  H      R  + + ++ +A DY++
Sbjct: 403 STVSIDIPFLIEGQFAHAMTVLTDGATLLPETKNLTHA----NRILLAIGRVTSAMDYLL 458

Query: 297 SQQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYPRA-LAHGEVDVTMISDIMRFVQ 354
           +Q++R  +M  L +L+     +I+ TP TA     I  +  LA+G  D       M +V 
Sbjct: 459 AQKLRGLLMSHLAHLWRTYPGMIIVTPTTACAGWPIMSKGELAYGVSDGDRTIRSMEYVW 518

Query: 355 LANFAGVPAVSVPAGY----------------DDNNLPIGLQFIAKWYDEATLLRIAKTS 398
           + NF G+P ++VPAGY                    +PIGL  + +W DE +LL     +
Sbjct: 519 MGNFCGLPGITVPAGYVVPHDQPGAGSEAGPETMGKIPIGLMGMGEWTDEHSLLEFGLDA 578

Query: 399 EEILGNRRKKPSD 411
           E++    R +P +
Sbjct: 579 EDLFAKERCRPPN 591



>gi|340381035|ref|XP_003389027.1| PREDICTED: glutamyl-tRNA(Gln) amidotransferase subunit A 2-like
           [Amphimedon queenslandica]
          Length = 606

 Score =  215 bits (547), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 138/391 (35%), Positives = 200/391 (51%), Gaps = 18/391 (4%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           ++R+A    L LLDG+P+A+K E+ +  Y    G K         S+   I  LR  GA+
Sbjct: 202 SQRWAKGEPLSLLDGVPVAIKGEMYLDPYPFLCGGKIKIAAMEGVSEGPNISTLRGSGAV 261

Query: 61  ILGKTSMHEIGFGSTNNNPF--VCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDG 118
           I+G  +M E+G G+  +NP     T RNP+N D++               LCP+A+G DG
Sbjct: 262 IIGICNMQELGKGTLGSNPHSGYQTARNPHNIDHFCGGSSSGAAASVSAGLCPLAMGGDG 321

Query: 119 GGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDP 178
           GGS+RIP+S CG+ GLK T G  S  G  P+  +V V GP+ A+V D A+A  ++  +  
Sbjct: 322 GGSIRIPASLCGVVGLKPTYGLLSSVGGTPMGFTVGVPGPIGATVLDTAIALSLLDKEK- 380

Query: 179 KDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXX 238
                 H  L +L+       LSDLKIGVY  +     N  +  +    +D  +  GA  
Sbjct: 381 ------HVSLSSLNLI----DLSDLKIGVYWDYFNHC-NKEVRDSCRKGLDAFETLGAQI 429

Query: 239 XXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHL-FSCPTRSNINVMKLATASDYIVS 297
                     A++AH+  I TE ++      DK    F+  T + I V    + +DY+ +
Sbjct: 430 KDIVIPELEEAKVAHMFIILTEGSSSLSNEIDKHFWDFNPETLTPILVGLHTSGTDYVNA 489

Query: 298 QQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLAN 357
            + RTR +  L  LF  +VD+I+ PATA TAP I  ++L+HG  DV    D+MRF  LAN
Sbjct: 490 MKQRTRSIAFLKKLF-EEVDIIVMPATACTAPMIPSKSLSHGISDVKTSGDLMRFSFLAN 548

Query: 358 FAGVPAVSVPAGYDDNNLPIGLQFIAKWYDE 388
             G+P + +P       LPIGLQ +  WY E
Sbjct: 549 LTGIPGLVLP--IQREGLPIGLQLLGPWYSE 577



>gi|297530427|ref|YP_003671702.1| amidase [Geobacillus sp. C56-T3]
 gi|502910651|ref|WP_013145627.1| glutamyl-tRNA amidotransferase subunit A [Geobacillus sp. C56-T3]
 gi|297253679|gb|ADI27125.1| Amidase [Geobacillus sp. C56-T3]
          Length = 470

 Score =  214 bits (546), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 135/401 (33%), Positives = 203/401 (50%), Gaps = 6/401 (1%)

Query: 11  GLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAIILGKTSMHEI 70
           G L GIPIA+KD + V    T +G+K      P T  AT+IE+L E GA+  GKT++HE 
Sbjct: 71  GPLHGIPIAIKDILYVANETTTMGSKIHRNFRP-TYSATVIEKLTEAGAVFPGKTNLHEY 129

Query: 71  GFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGSVRIPSSFCG 130
            +G+TNNNP     RNP++ +  P              +   ++G D GGS+RIPSSFCG
Sbjct: 130 AWGATNNNPHFGPARNPWDPERIPGGSSGGSGVATAAHMTIASLGTDTGGSIRIPSSFCG 189

Query: 131 IYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDPNTLHQPLPT 190
           I GLK T G  S  G +PLA S+   GPMA +  D A     MAG DPKDP + + P  T
Sbjct: 190 IVGLKPTYGLVSKYGCFPLAWSLDHIGPMAKTARDAAYILEAMAGYDPKDPTSTNAPA-T 248

Query: 191 LHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXXXXXXXXXXXXAR 250
            +       +  +KIG+   +   VD   +  A+   I  L+  GA            A+
Sbjct: 249 SYSTQFMESVKGVKIGIEPYFFDHVDE-GVERAVKQAIASLEREGAVVETVRIPTLQYAQ 307

Query: 251 IAHLLTIGTELTTVAKRH-KDKMHLFSCPTRSNINVMKLATASDYIVSQQVRTRIMRTLN 309
            A ++TI +E + +   H  ++   F    R  + + +L +A DY+ +QQ+R ++     
Sbjct: 308 YAEMITILSEASAIHHNHLVEREEDFGDDVRFLLKLGELPSAVDYLEAQQIRLKLDHEFM 367

Query: 310 NLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANFAGVPAVSVPAG 369
            +F N+VD+++TP      PKI    +     +V  +  I+RF    N  G+P V+VP G
Sbjct: 368 EIF-NKVDVLITPTIPFLPPKIGQDTVWINGEEVNFLDHIIRFTGPFNLTGLPVVTVPCG 426

Query: 370 YDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
           +    LP+G+Q I   + E T+L +A   E +    +  P+
Sbjct: 427 F-VQGLPVGMQIIGPAFGEGTILNVADVFETLHPELKYPPA 466



>gi|514404191|dbj|GAD15025.1| glutamyl-tRNA(Gln) amidotransferase subunit A [Geobacillus
           kaustophilus GBlys]
          Length = 485

 Score =  214 bits (544), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 135/401 (33%), Positives = 202/401 (50%), Gaps = 6/401 (1%)

Query: 11  GLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAIILGKTSMHEI 70
           G L GIPIA+KD + V    T +G+K      P T  AT+IE+L E GA+  GKT++HE 
Sbjct: 86  GPLHGIPIAIKDILYVANETTTMGSKIHRNFRP-TYSATVIEKLTEAGAVFPGKTNLHEY 144

Query: 71  GFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGSVRIPSSFCG 130
            +G+TNNNP     RNP++ +  P              +   ++G D GGS+RIPSSFCG
Sbjct: 145 AWGATNNNPHFGPARNPWDPERIPGGSSGGSGVATAAHMTIASLGTDTGGSIRIPSSFCG 204

Query: 131 IYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDPNTLHQPLPT 190
           I GLK T G  S  G +PLA S+   GPMA +  D A     MAG DPKDP +   P  T
Sbjct: 205 IVGLKPTYGLVSKYGCFPLAWSLDHIGPMAKTARDAAYILEAMAGYDPKDPTSTDAPA-T 263

Query: 191 LHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXXXXXXXXXXXXAR 250
            +       +  +KIG+   +   VD   +  A+   I  L+  GA            A+
Sbjct: 264 SYSTQFMESVKGVKIGIEPYFFDHVDE-GVERAVKQAIASLEREGAVVETVRIPTLQYAQ 322

Query: 251 IAHLLTIGTELTTVAKRH-KDKMHLFSCPTRSNINVMKLATASDYIVSQQVRTRIMRTLN 309
            A ++TI +E + +   H  ++   F    R  + + +L +A DY+ +QQ+R ++     
Sbjct: 323 YAEMITILSEASAIHHNHLVEREEDFGDDVRFLLKLGELPSAVDYLEAQQIRLKLDHEFM 382

Query: 310 NLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANFAGVPAVSVPAG 369
            +F N+VD+++TP      PKI    +     +V  +  I+RF    N  G+P V+VP G
Sbjct: 383 EIF-NKVDVLITPTIPFLPPKIGQDTVWINGEEVNFLDHIIRFTGPFNLTGLPVVTVPCG 441

Query: 370 YDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
           +    LP+G+Q I   + E T+L +A   E +    +  P+
Sbjct: 442 F-VQGLPVGMQIIGPAFGEGTILNVADVFETLHPELKYPPA 481



>gi|56419927|ref|YP_147245.1| glutamyl-tRNA(Gln) amidotransferase subunit A [Geobacillus
           kaustophilus HTA426]
 gi|499550105|ref|WP_011230888.1| glutamyl-tRNA amidotransferase subunit A [Geobacillus kaustophilus]
 gi|56379769|dbj|BAD75677.1| glutamyl-tRNA(Gln) amidotransferase subunit A [Geobacillus
           kaustophilus HTA426]
          Length = 470

 Score =  214 bits (544), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 135/401 (33%), Positives = 202/401 (50%), Gaps = 6/401 (1%)

Query: 11  GLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAIILGKTSMHEI 70
           G L GIPIA+KD + V    T +G+K      P T  AT+IE+L E GA+  GKT++HE 
Sbjct: 71  GPLHGIPIAIKDILYVANETTTMGSKIHRNFRP-TYSATVIEKLTEAGAVFPGKTNLHEY 129

Query: 71  GFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGSVRIPSSFCG 130
            +G+TNNNP     RNP++ +  P              +   ++G D GGS+RIPSSFCG
Sbjct: 130 AWGATNNNPHFGPARNPWDPERIPGGSSGGSGVATAAHMTIASLGTDTGGSIRIPSSFCG 189

Query: 131 IYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDPNTLHQPLPT 190
           I GLK T G  S  G +PLA S+   GPMA +  D A     MAG DPKDP +   P  T
Sbjct: 190 IVGLKPTYGLVSKYGCFPLAWSLDHIGPMAKTARDAAYILEAMAGYDPKDPTSTDAPA-T 248

Query: 191 LHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXXXXXXXXXXXXAR 250
            +       +  +KIG+   +   VD   +  A+   I  L+  GA            A+
Sbjct: 249 SYSTQFMESVKGVKIGIEPYFFDHVDE-GVERAVKQAIASLEREGAVVETVRIPTLQYAQ 307

Query: 251 IAHLLTIGTELTTVAKRH-KDKMHLFSCPTRSNINVMKLATASDYIVSQQVRTRIMRTLN 309
            A ++TI +E + +   H  ++   F    R  + + +L +A DY+ +QQ+R ++     
Sbjct: 308 YAEMITILSEASAIHHNHLVEREEDFGDDVRFLLKLGELPSAVDYLEAQQIRLKLDHEFM 367

Query: 310 NLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANFAGVPAVSVPAG 369
            +F N+VD+++TP      PKI    +     +V  +  I+RF    N  G+P V+VP G
Sbjct: 368 EIF-NKVDVLITPTIPFLPPKIGQDTVWINGEEVNFLDHIIRFTGPFNLTGLPVVTVPCG 426

Query: 370 YDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
           +    LP+G+Q I   + E T+L +A   E +    +  P+
Sbjct: 427 F-VQGLPVGMQIIGPAFGEGTILNVADVFETLHPELKYPPA 466



>gi|477586843|gb|ENI03926.1| hypothetical protein COCC4DRAFT_24454 [Bipolaris maydis ATCC 48331]
          Length = 592

 Score =  213 bits (542), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 139/419 (33%), Positives = 214/419 (51%), Gaps = 26/419 (6%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREK-GA 59
           T+RY     LG+LDG+P  VKD++ VK Y+  VGT   +Y N    +++   ++ EK GA
Sbjct: 173 TQRYKEGKPLGILDGVPFGVKDDLRVKDYKHYVGTTH-DYSNGGNKESSWCAKMLEKEGA 231

Query: 60  IILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGG 119
           I++G  +MHE+G  +TNNNP   TPRNPYN+ YYP              L P AIG DGG
Sbjct: 232 ILVGTLTMHELGMDTTNNNPHWGTPRNPYNSSYYPGGSSGGAASAVGHGLIPFAIGSDGG 291

Query: 120 GSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPK 179
           GSVRIPS++CG+YGLK +  R S         SV V GP+A+++ DL ++Y V+A  DP 
Sbjct: 292 GSVRIPSNYCGVYGLKPSHSRVSIAPMPNSGKSVTVRGPLASNMADLEISYRVLAQPDPS 351

Query: 180 D-PNTLHQPLPTLHGFHVTNKLSDLK---IGVYSMWNKQVDNPAITTALNNFIDELKLR- 234
             P++L         F    K S  +   +GV   W  + D PA+  +  + ++ L+ + 
Sbjct: 352 TYPSSL---------FAAPRKFSGPRNKVVGVPRQWVDRSD-PAVQESFYSALEYLEHQL 401

Query: 235 GAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDY 294
           G              ++AH +TI  E    A  H+  ++  +   R  + V +   A+D+
Sbjct: 402 GYKVVNVSIPLLAQGQLAHAMTIMAE---GAAAHRSSIYDLTPANRILMTVARQTPATDF 458

Query: 295 IVSQQVRTRIMRTLNNLF-SNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFV 353
           +++Q++R  +M+ L +LF +N   +I+TP        I    L+HG  +  M    M +V
Sbjct: 459 LLAQRLRNLLMQHLADLFRANPGMVIVTPTAPNAGWPIDEAELSHGVSNGNMQIRNMEYV 518

Query: 354 QLANFAGVPAVSVPAGY-----DDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRK 407
            LANF G+P +  P  Y      +  +PIG+    +W  E  L+      E+ L   R+
Sbjct: 519 WLANFTGLPCIQFPVNYAQGVKGEGLVPIGMSGHGEWGSEDALIEFGFDGEKWLHEGRE 577



>gi|406860204|gb|EKD13264.1| putative glutamyl-tRNA(Gln) amidotransferase subunit A [Marssonina
           brunnea f. sp. 'multigermtubi' MB_m1]
          Length = 615

 Score =  213 bits (541), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 139/429 (32%), Positives = 212/429 (49%), Gaps = 30/429 (6%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNP-ATSDATIIERLREKGA 59
           T RY   + LG+LDG+P  +KD+ DV GY +  G    +   P A   +  ++ L++ GA
Sbjct: 185 TLRYKQGAPLGILDGVPTGIKDDTDVAGYVSTYGRARNDEVFPTAEKSSWPVQMLQDAGA 244

Query: 60  IILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGG 119
           I+LGK +MHE+G  +TNNNP   TPRNP+N  YY               L P+ +G DGG
Sbjct: 245 IVLGKLNMHEMGADTTNNNPNWGTPRNPHNDQYYTGGSSGGPAYAVSAGLVPLVVGTDGG 304

Query: 120 GSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPK 179
           GS+RIP+SFCG+YGLK +  R  D     L  +  V+GP+AA++ DL +AY  MA  +P 
Sbjct: 305 GSIRIPASFCGVYGLKPSHNRLQD-----LGSTTTVNGPLAATISDLEIAYRTMAQPNPS 359

Query: 180 DPN-TLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR-GAX 237
           D   +L   +PTL             IG+Y  W  + + P++    N+ +   K + G  
Sbjct: 360 DATCSLFPEVPTL------PPSRPRVIGIYKEWFNRAE-PSVLKLCNDVLAYYKEKLGYQ 412

Query: 238 XXXXXXXXXXXARIAHLLTIGTELTTVAK----RHKDKMHLFSCPTRSNINVMKLATASD 293
                       +IAH  TI  E+  VA+       + +H  +   +  + +     A+D
Sbjct: 413 IIDIAIPYAPEGQIAHAFTILCEMANVARAAPPNPSNWLHGLNAANQVLLAIAARTPAAD 472

Query: 294 YIVSQQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYPRA-LAHGEVDVTMISDIMR 351
           Y+++QQ+R  +M+ L  L+     LI+ TP T +    I     L +G  D       M 
Sbjct: 473 YLLAQQLRNMLMQHLAFLYQQHPGLIIVTPTTPMPGWPIAAEGDLKYGITDGNTSIRNME 532

Query: 352 FVQLANFAGVPAVSVPAGY-----DDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNR- 405
           +V LANF G PA+S P GY      +  +P+G+  + +W +E  LL   +  E  L    
Sbjct: 533 YVWLANFCGNPAISCPVGYVEPVQGEGRVPVGIMAMGEWGEELQLLGWGRECEAWLNEAY 592

Query: 406 ---RKKPSD 411
              R++P +
Sbjct: 593 PGGRQRPGN 601



>gi|391872460|gb|EIT81576.1| alpha-glucosidase [Aspergillus oryzae 3.042]
          Length = 606

 Score =  213 bits (541), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 146/427 (34%), Positives = 207/427 (48%), Gaps = 31/427 (7%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATI----IERLRE 56
           T RY     LGL DG+P AVKDE D+ GY TN+G+       P + D +I    I +L +
Sbjct: 170 TRRYKEGRPLGLFDGVPAAVKDEFDLDGYRTNMGSLNDYTLEPKSDDPSITNWCIRQLEK 229

Query: 57  KGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGR 116
            GAI++GK SMHE G  +T NN    TP NPY+ DYY               L PIA+G 
Sbjct: 230 AGAIVVGKVSMHEFGLDTTGNNIHYGTPPNPYHPDYYTGGSSSGCAYAVSTGLVPIALGT 289

Query: 117 DGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGK 176
           DGGGSVRIPSSFC + GLK T  R S       A + +V GP+AA +  LA AY V A  
Sbjct: 290 DGGGSVRIPSSFCSVVGLKPTHNRLSHYPSVNYASTTSVIGPLAADIRSLAEAYRVFATP 349

Query: 177 DPKDPNTLHQPL---PTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-K 232
            P  P     PL   P+  G  +        +G+  +W  +   P +     + +D+L  
Sbjct: 350 GPDTPFPAPGPLSLTPSTRGKKI--------LGIPEVWFSR-STPDVQRLCRSLLDKLVT 400

Query: 233 LRGAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATAS 292
            +               + AH +TI   L   A    D  ++ + P R  + + +   A+
Sbjct: 401 EKDYTIVPIDIPFLVEGQTAHAMTI---LADGAALLPDTTNI-TAPNRILLTLGRTTPAT 456

Query: 293 DYIVSQQVRTRIMRTLNNLFSNQVDLIL-TPATAITA-PKIYPRALAHGEVDVTMISDIM 350
           DY+++Q++R  +M+ L  L+     +I+ TP TA    P +    L  G  D       M
Sbjct: 457 DYLLAQKLRRLLMQHLAALWQEFPGMIIVTPTTACAGWPVVSKSELKWGLSDGDRTLKAM 516

Query: 351 RFVQLANFAGVPAVSVPAGYDD--------NNLPIGLQFIAKWYDEATLLRIAKTSEEIL 402
            +V LANF G+PA+SVPAGY D          +P+GL    +W  E  LL+    +EE+ 
Sbjct: 517 EYVWLANFTGIPAISVPAGYADPEGKHSTEGTVPVGLMGNGEWGSEEQLLQWGLEAEELG 576

Query: 403 GNRRKKP 409
            + R++P
Sbjct: 577 ADLRERP 583



>gi|238485422|ref|XP_002373949.1| fatty-acid amide hydrolase, putative [Aspergillus flavus NRRL3357]
 gi|220698828|gb|EED55167.1| fatty-acid amide hydrolase, putative [Aspergillus flavus NRRL3357]
          Length = 628

 Score =  213 bits (541), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 146/427 (34%), Positives = 207/427 (48%), Gaps = 31/427 (7%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATI----IERLRE 56
           T RY     LGL DG+P AVKDE D+ GY TN+G+       P + D +I    I +L +
Sbjct: 192 TRRYKEGRPLGLFDGVPAAVKDEFDLDGYRTNMGSLNDYTLEPKSDDPSITNWCIRQLEK 251

Query: 57  KGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGR 116
            GAI++GK SMHE G  +T NN    TP NPY+ DYY               L PIA+G 
Sbjct: 252 AGAIVVGKVSMHEFGLDTTGNNIHYGTPPNPYHPDYYTGGSSSGCAYAVSTGLVPIALGT 311

Query: 117 DGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGK 176
           DGGGSVRIPSSFC + GLK T  R S       A + +V GP+AA +  LA AY V A  
Sbjct: 312 DGGGSVRIPSSFCSVVGLKPTHNRLSHYPSVNYASTTSVIGPLAADIRSLAEAYRVFATP 371

Query: 177 DPKDPNTLHQPL---PTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-K 232
            P  P     PL   P+  G  +        +G+  +W  +   P +     + +D+L  
Sbjct: 372 GPDTPFPAPGPLSLTPSTRGKKI--------LGIPEVWFSR-STPDVQRLCRSLLDKLVT 422

Query: 233 LRGAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATAS 292
            +               + AH +TI   L   A    D  ++ + P R  + + +   A+
Sbjct: 423 EKDYTIVPIDIPFLVEGQTAHAMTI---LADGAALLPDTTNI-TAPNRILLTLGRTTPAT 478

Query: 293 DYIVSQQVRTRIMRTLNNLFSNQVDLIL-TPATAITA-PKIYPRALAHGEVDVTMISDIM 350
           DY+++Q++R  +M+ L  L+     +I+ TP TA    P +    L  G  D       M
Sbjct: 479 DYLLAQKLRRLLMQHLAALWQEFPGMIIVTPTTACAGWPVVSKSELKWGLSDGDRTLKAM 538

Query: 351 RFVQLANFAGVPAVSVPAGYDD--------NNLPIGLQFIAKWYDEATLLRIAKTSEEIL 402
            +V LANF G+PA+SVPAGY D          +P+GL    +W  E  LL+    +EE+ 
Sbjct: 539 EYVWLANFTGIPAISVPAGYADPEGKHSTEGTVPVGLMGNGEWGSEEQLLQWGLEAEELG 598

Query: 403 GNRRKKP 409
            + R++P
Sbjct: 599 ADLRERP 605



>gi|83768316|dbj|BAE58455.1| unnamed protein product [Aspergillus oryzae RIB40]
          Length = 606

 Score =  213 bits (541), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 146/427 (34%), Positives = 207/427 (48%), Gaps = 31/427 (7%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATI----IERLRE 56
           T RY     LGL DG+P AVKDE D+ GY TN+G+       P + D +I    I +L +
Sbjct: 170 TRRYREGRPLGLFDGVPAAVKDEFDLDGYRTNMGSLNDYTLEPKSDDPSITNWCIRQLEK 229

Query: 57  KGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGR 116
            GAI++GK SMHE G  +T NN    TP NPY+ DYY               L PIA+G 
Sbjct: 230 AGAIVVGKVSMHEFGLDTTGNNIHYGTPPNPYHPDYYTGGSSSGCAYAVSTGLVPIALGT 289

Query: 117 DGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGK 176
           DGGGSVRIPSSFC + GLK T  R S       A + +V GP+AA +  LA AY V A  
Sbjct: 290 DGGGSVRIPSSFCSVVGLKPTHNRLSHYPSVNYASTTSVIGPLAADIRSLAEAYRVFATP 349

Query: 177 DPKDPNTLHQPL---PTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-K 232
            P  P     PL   P+  G  +        +G+  +W  +   P +     + +D+L  
Sbjct: 350 GPDTPFPAPGPLSLTPSTRGKKI--------LGIPEVWFSR-STPDVQRLCRSLLDKLVT 400

Query: 233 LRGAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATAS 292
            +               + AH +TI   L   A    D  ++ + P R  + + +   A+
Sbjct: 401 EKDYTIVPIDIPFLVEGQTAHAMTI---LADGAALLPDTTNI-TAPNRILLTLGRTTPAT 456

Query: 293 DYIVSQQVRTRIMRTLNNLFSNQVDLIL-TPATAITA-PKIYPRALAHGEVDVTMISDIM 350
           DY+++Q++R  +M+ L  L+     +I+ TP TA    P +    L  G  D       M
Sbjct: 457 DYLLAQKLRRLLMQHLAALWQEFPGMIIVTPTTACAGWPVVSKSELKWGLSDGDRTLKAM 516

Query: 351 RFVQLANFAGVPAVSVPAGYDD--------NNLPIGLQFIAKWYDEATLLRIAKTSEEIL 402
            +V LANF G+PA+SVPAGY D          +P+GL    +W  E  LL+    +EE+ 
Sbjct: 517 EYVWLANFTGIPAISVPAGYADPEGKHSTEGTVPVGLMGNGEWGSEEQLLQWGLEAEELG 576

Query: 403 GNRRKKP 409
            + R++P
Sbjct: 577 ADLRERP 583



>gi|406868314|gb|EKD21351.1| glutamyl-tRNA(Gln) amidotransferase subunit A [Marssonina brunnea
           f. sp. 'multigermtubi' MB_m1]
          Length = 849

 Score =  212 bits (540), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 136/429 (31%), Positives = 215/429 (50%), Gaps = 32/429 (7%)

Query: 3   RYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSD---ATIIERLREKGA 59
           RY N + LG LDGIP+A+KDE D++GY T +G+     G     +   A  ++++ E GA
Sbjct: 181 RYKNKAPLGPLDGIPVAIKDEYDIEGYTTCLGSVNDYTGKVPDGESITAWCVKKIEEAGA 240

Query: 60  IILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGG 119
           + LGK SMHE G  ++ NNP   TP NPYN+DYY               L PIA+G DGG
Sbjct: 241 VNLGKLSMHEFGLDTSGNNPIYGTPPNPYNSDYYTGGSSSGCGYAVASGLIPIALGGDGG 300

Query: 120 GSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPK 179
           GS+RIP+SFC ++GLK + GR S       + + AV+GP+AA +  L   Y V+   DP 
Sbjct: 301 GSIRIPASFCSVFGLKPSHGRLSFKPCMNHSSTCAVNGPIAADIASLTAFYQVLGAPDPS 360

Query: 180 DPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLRGAXX 238
                  P P+L     + + + + +G+   W  +   PAI     + ID++  +     
Sbjct: 361 S----IFPAPSLTILSPSLRKNRV-LGIPEAWFARA-TPAIQRLCRSLIDKMTTVHDYTI 414

Query: 239 XXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYIVSQ 298
                      +I H +T+ T+  T+    ++     +   R  I +  +  A+DY+++Q
Sbjct: 415 VPITIPFLSEGQIGHAMTVLTDAATLLPVTRN----LTAANRIMIALGTVTPATDYVLAQ 470

Query: 299 QVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYPR-ALAHGEVDVTMISDIMRFVQLA 356
           ++R  +M+ L  L+     +++ TP T+    KI  +  L +G  D  M    M +V +A
Sbjct: 471 KLRQLLMQHLAYLWQQYPGMVITTPTTSCAGWKIGNKNELTYGISDGNMTLKTMEYVWMA 530

Query: 357 NFAGVPAVSVPAGY----------------DDNNLPIGLQFIAKWYDEATLLRIAKTSEE 400
           NF G+P++SVP GY                 +  +P+GL  + +W  E  LLR    +EE
Sbjct: 531 NFLGLPSLSVPVGYVRPEGGQGAGEEAEESTEGKVPVGLMAMGEWGAEEELLRWGAEAEE 590

Query: 401 ILGNRRKKP 409
           +   RR++P
Sbjct: 591 VGSERRRRP 599



>gi|460414675|ref|XP_004252690.1| PREDICTED: fatty acid amide hydrolase-like [Solanum lycopersicum]
          Length = 573

 Score =  212 bits (540), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 136/422 (32%), Positives = 213/422 (50%), Gaps = 44/422 (10%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+RY    +L +LDG+PI +KDEID   Y T  GTK+++       DA  ++RLR  GAI
Sbjct: 183 TQRYQQGEALSVLDGVPIGIKDEIDCMPYPTTGGTKWMHKVRQCKDDAECVKRLRLCGAI 242

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKT+MHE+G G++  NP   T RNPYN                   LCP AIG DGGG
Sbjct: 243 LVGKTNMHELGAGTSGINPHHGTTRNPYNIGRIAGGSSSGSAAVVAAGLCPAAIGVDGGG 302

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVR+P++ CG+ GLK + GR S  G  PL  +V + G +A +V+D  L Y  ++G     
Sbjct: 303 SVRMPAALCGVVGLKPSFGRVSHSGVLPLNWTVGMVGILAGTVEDALLVYAAISG----- 357

Query: 181 PNTLHQ---PLPTLHG--FHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR- 234
           PN+ H     LP L+         + ++++  Y  W     N  I    +  +++L+   
Sbjct: 358 PNSSHHSQTALPKLYFPLLKSPRPMPNIRLAKYGEWFNDC-NEEIRVCCSRALEKLRDNY 416

Query: 235 GAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHL--FSCPTRSNINVMKLATAS 292
           G              R+AH +TIG+E +T      +KM+        R  ++V    ++ 
Sbjct: 417 GWETIQVTIPELEVMRLAHYVTIGSECSTSIGPELEKMNKDEVGWDARVAVSVYGSFSSQ 476

Query: 293 DYIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRF 352
           +Y+ +Q++      ++ N   +                        GE+D    + ++R+
Sbjct: 477 EYLNAQRI------SIGNDTRHT-----------------------GELDYINGAALVRY 507

Query: 353 VQLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPSDK 412
               NF G+PA++VP GYD ++LPIGLQFI K +DE+ L+ IA + + +  ++ KKP + 
Sbjct: 508 QIAGNFLGLPAITVPVGYDKSHLPIGLQFIGKPWDESLLIHIAFSMQALCISQHKKP-EV 566

Query: 413 FW 414
           FW
Sbjct: 567 FW 568



>gi|261419598|ref|YP_003253280.1| amidase [Geobacillus sp. Y412MC61]
 gi|319766416|ref|YP_004131917.1| amidase [Geobacillus sp. Y412MC52]
 gi|503288836|ref|WP_013523497.1| glutamyl-tRNA amidotransferase subunit A [Geobacillus sp. Y412MC52]
 gi|261376055|gb|ACX78798.1| Amidase [Geobacillus sp. Y412MC61]
 gi|317111282|gb|ADU93774.1| Amidase [Geobacillus sp. Y412MC52]
          Length = 470

 Score =  212 bits (540), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 134/401 (33%), Positives = 202/401 (50%), Gaps = 6/401 (1%)

Query: 11  GLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAIILGKTSMHEI 70
           G L GIPIA+KD + V    T +G+K      P T  AT+IE+L E GA+  GKT++HE 
Sbjct: 71  GPLHGIPIAIKDILYVANETTTMGSKIHRDFRP-TYSATVIEKLTEAGAVFPGKTNLHEY 129

Query: 71  GFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGSVRIPSSFCG 130
            +G+TNNNP     RNP++ +  P              +   ++G D GGS+RIPSSFCG
Sbjct: 130 AWGATNNNPHFGPARNPWDPERIPGGSSGGSGVATAAHMTIASLGTDTGGSIRIPSSFCG 189

Query: 131 IYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDPNTLHQPLPT 190
           I GLK T G  S  G +PLA S+   GPMA +  D A     +AG DPKDP +   P  T
Sbjct: 190 IVGLKPTYGLVSKYGCFPLAWSLDHIGPMAKTARDAAYILEAVAGYDPKDPTSTDAPA-T 248

Query: 191 LHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXXXXXXXXXXXXAR 250
            +       +  +KIG+   +   VD   +   +   I  L+  GA            A+
Sbjct: 249 SYSTQFMESVKGVKIGIEPYFFDHVDK-GVERVVKQAIASLEREGAVVETVRIPTLQYAQ 307

Query: 251 IAHLLTIGTELTTVAKRHK-DKMHLFSCPTRSNINVMKLATASDYIVSQQVRTRIMRTLN 309
            A ++TI +E + +   H  ++   F    R  + + +L +A DY+ +QQ+R ++ R   
Sbjct: 308 YAEMITILSEASAIHHNHLIEREEDFGDDVRFLLKLGELPSAVDYLEAQQIRLKLDREFM 367

Query: 310 NLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANFAGVPAVSVPAG 369
            +F N+VD+++TP      PKI    +     +V  +  I+RF    N  G+P V+VP G
Sbjct: 368 EVF-NKVDVLITPTIPFLPPKIGQDTVWINGEEVNFLDHIIRFTGPFNLTGLPVVTVPCG 426

Query: 370 YDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
           +    LP+G+Q I   + E T+L +A   E +    +  P+
Sbjct: 427 F-VQGLPVGMQIIGPAFGEGTILNVADVFETLHPELKYPPA 466



>gi|15982789|gb|AAL09742.1| AT5g64440/T12B11_3 [Arabidopsis thaliana]
 gi|23505899|gb|AAN28809.1| At5g64440/T12B11_3 [Arabidopsis thaliana]
          Length = 357

 Score =  212 bits (539), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 130/352 (36%), Positives = 185/352 (52%), Gaps = 12/352 (3%)

Query: 67  MHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGSVRIPS 126
           MHE+G G+T NN    T RNP++   Y               LC  A+G DGGGSVRIPS
Sbjct: 1   MHELGMGTTGNNSNYGTTRNPHDPKRYTGGSSSGSAAIVAAGLCSAALGTDGGGSVRIPS 60

Query: 127 SFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDPNTLHQ 186
           + CGI GLKTT GR    G      +V + GP+A+S++D  L Y  + G    D   L  
Sbjct: 61  ALCGITGLKTTYGRTDMTGSLCEGGTVEIIGPLASSLEDAFLVYAAILGSSSADRYNLKP 120

Query: 187 P---LPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELK-LRGAXXXXXX 242
                P L   + +N +  L++G Y+ W   V +  I+    + +  L    G       
Sbjct: 121 SPPCFPKLLSHNGSNAIGSLRLGKYTKWFNDVSSSDISDKCEDILKLLSNNHGCKVVEIV 180

Query: 243 XXXXXXARIAHLLTIG----TELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYIVSQ 298
                  R AH+++IG    + LT   +  K+     S  TR++  + +  +ASDYI +Q
Sbjct: 181 VPELEEMRAAHVISIGSPTLSSLTPYCEAGKNSK--LSYDTRTSFAIFRSFSASDYIAAQ 238

Query: 299 QVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANF 358
            +R R+M    N+F + VD+I+TP T +TAP I P AL +GE ++ + +D+MRFV  AN 
Sbjct: 239 CLRRRLMEYHLNIFKD-VDVIVTPTTGMTAPVIPPDALKNGETNIQVTTDLMRFVLAANL 297

Query: 359 AGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
            G PA+SVP GYD   LPIGLQ + + + EAT+L +A   EE L    KKP+
Sbjct: 298 LGFPAISVPVGYDKEGLPIGLQIMGRPWAEATVLGLAAAVEE-LAPVTKKPA 348



>gi|239826826|ref|YP_002949450.1| amidase [Geobacillus sp. WCH70]
 gi|506343933|ref|WP_015863652.1| glutamyl-tRNA amidotransferase subunit A [Geobacillus sp. WCH70]
 gi|239807119|gb|ACS24184.1| Amidase [Geobacillus sp. WCH70]
          Length = 470

 Score =  212 bits (539), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 131/404 (32%), Positives = 207/404 (51%), Gaps = 14/404 (3%)

Query: 11  GLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAIILGKTSMHEI 70
           G L GIP+A+KD I +      +G+K      P +  AT++E+L E GA+  GK ++HE 
Sbjct: 71  GPLHGIPVAIKDNIYIANETATMGSKIHRNFQP-SYHATVVEKLSEAGAVFPGKLNLHEY 129

Query: 71  GFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGSVRIPSSFCG 130
            +G+TNNNP     RNP++T+                 +   ++G D GGS+RIPSSFCG
Sbjct: 130 AWGATNNNPHFGPVRNPWDTERISGGSSGGSGVATAAHMTIASLGTDTGGSIRIPSSFCG 189

Query: 131 IYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDPNTLHQPLPT 190
           I GLK T G  S  G +PLA S+   GPM  +V+D A     +AG DPKDP ++  P   
Sbjct: 190 IVGLKPTHGLVSKYGCFPLAWSLDHIGPMTKTVEDAAYVLEAIAGYDPKDPTSIDAPT-A 248

Query: 191 LHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXXXXXXXXXXXXAR 250
            +   +T  +  +KIG+   +   VD   +  A+ N I  L+  GA            A+
Sbjct: 249 RYSTQLTESVKGVKIGIEPYFFDNVDA-EVEKAVKNAISSLEREGAIVETVRIPTLQYAQ 307

Query: 251 IAHLLTIGTELTTV-----AKRHKDKMHLFSCPTRSNINVMKLATASDYIVSQQVRTRIM 305
            A ++TI +E   +      +R +D    F    R  + + ++ +A DY+ +QQ+R ++ 
Sbjct: 308 YAEMITIISEANAIHHHNLVEREED----FGDDVRFLLKLGEIPSAVDYLQAQQIRLQLD 363

Query: 306 RTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANFAGVPAVS 365
           R    +F N+VD+I+TP   +  PKI    +     +V  +  I+RF    N  G+PAV+
Sbjct: 364 REFMEIF-NKVDVIITPTLPLLPPKIGQDTVLLNGKEVNFLDHIIRFTGPFNLTGLPAVT 422

Query: 366 VPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKP 409
           VP G+    LP+G+Q +   + E  +L +A   E++    ++ P
Sbjct: 423 VPCGF-AKELPVGMQIVGPAFGEGKILNVADVFEKLHPELKQNP 465



>gi|315041893|ref|XP_003170323.1| glutamyl-tRNA(Gln) amidotransferase subunit A [Arthroderma gypseum
           CBS 118893]
 gi|311345357|gb|EFR04560.1| glutamyl-tRNA(Gln) amidotransferase subunit A [Arthroderma gypseum
           CBS 118893]
          Length = 617

 Score =  211 bits (538), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 147/432 (34%), Positives = 212/432 (49%), Gaps = 33/432 (7%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATI----IERLRE 56
           T RY     LGL+DGIP AVKDE D+ GY+T +G+      +PA+S  +I    + +L E
Sbjct: 178 TLRYKQGRPLGLMDGIPTAVKDEYDIDGYKTCLGSLNDYTSDPASSGGSIASWCVRKLEE 237

Query: 57  KGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGR 116
            GA++LGK SMHE G  ++ +NP   TP NPYN  YY               L P A+G 
Sbjct: 238 AGAVVLGKLSMHEFGLDTSGSNPNYGTPLNPYNPKYYTGGSSSGTAYAVSAGLLPFALGS 297

Query: 117 DGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGK 176
           DGGGS+RIPSSFC +YGLK T  R S       +++ AV+GP+AA +  L+  Y ++   
Sbjct: 298 DGGGSIRIPSSFCSVYGLKPTHSRISHHPGPNHSNTCAVNGPLAADLQSLSALYRIIGCP 357

Query: 177 DPKDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR-G 235
            P  P     P  T      T  L     GV   W  Q   PAI +   + I  L  +  
Sbjct: 358 PPSSPFRPVSPRLTPCDPAGTKYL-----GVPEAWFSQA-TPAIQSLCRSAISALADKHN 411

Query: 236 AXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYI 295
                         +IAH +TI   LT  A    D   L + P +  + + +   A+DY+
Sbjct: 412 YTVVPIQIPYLVEGQIAHAVTI---LTDAATLLPDTSKL-TAPNKILLGLGRETPATDYL 467

Query: 296 VSQQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYPR-ALAHGEVDVTMISDIMRFV 353
           ++Q++R  +M+ L+ L+     +I+ TP T+     I  +  L +G  D       M F+
Sbjct: 468 LAQKLRRLLMQHLSWLWKEYPGMIIVTPTTSCAGWPIRDKNELKYGISDGDQTLKTMNFI 527

Query: 354 QLANFAGVPAVSVPAGY-------------DDN---NLPIGLQFIAKWYDEATLLRIAKT 397
            LANF G+PA++VPAG+             ++N    +PIGL    +W  E  L+R    
Sbjct: 528 WLANFTGLPAINVPAGFVVPEGAKNEGEIAEENTRGKIPIGLMGTGEWGSEDCLMRWGLD 587

Query: 398 SEEILGNRRKKP 409
            E ++G+RR KP
Sbjct: 588 VENVVGDRRSKP 599



>gi|429855332|gb|ELA30291.1| glutamyl-tRNA amidotransferase subunit a [Colletotrichum
           gloeosporioides Nara gc5]
          Length = 608

 Score =  211 bits (536), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 138/416 (33%), Positives = 203/416 (48%), Gaps = 43/416 (10%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTK--FINYGNPATS-DATIIERLREK 57
           T RY     LG LDG+P AVKDE ++ GY T +G++  +     P  S ++  +++L   
Sbjct: 208 TRRYKEGKPLGPLDGVPTAVKDEYEMDGYRTCLGSRNDYTTQVEPGQSINSWCVKKLESA 267

Query: 58  GAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRD 117
           GA+ILGK SMHE G  +T NNP   TPRNPYN  YY               L P A+G D
Sbjct: 268 GAVILGKLSMHEFGLDTTGNNPIYGTPRNPYNAGYYTGGSSSGAGYAVATGLVPFALGSD 327

Query: 118 GGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKD 177
           GGGS+RIPSS CG+YGLK T GR S       ++S AV+GP+AA ++ LA  +  +    
Sbjct: 328 GGGSIRIPSSLCGVYGLKPTHGRISFHPCPNHSNSCAVNGPIAADIESLATCFETIGAPH 387

Query: 178 PKDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAX 237
           P D N +      L       K+    +GV   W  Q D PAI     + I  L      
Sbjct: 388 P-DSNFIQASPFVLSPSEKRGKI----LGVPESWFAQAD-PAIQRMCRSMIARLS----- 436

Query: 238 XXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYIVS 297
                         AH +T+ T+  T+    K+  H      R  + + ++ +A DY+++
Sbjct: 437 --------------AHAMTVLTDGATLLPETKNLTHG----NRILLAIGRVTSAMDYLLA 478

Query: 298 QQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYPRA-LAHGEVDVTMISDIMRFVQL 355
           Q++R  +M+ L +L+     +I+ TP TA     I  ++ L HG  D       M +V +
Sbjct: 479 QKLRGLLMQHLAHLWQTYPGMIIVTPTTACAGWPIMSKSELTHGLSDGDRTIRSMEYVWM 538

Query: 356 ANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPSD 411
            NF G+P V++         P+GL  + +W DE +LL     +EE+    R +P +
Sbjct: 539 GNFCGLPGVTI---------PVGLMGMGEWTDEHSLLEFGLDAEELFAKERCRPPN 585



>gi|327298715|ref|XP_003234051.1| hypothetical protein TERG_05918 [Trichophyton rubrum CBS 118892]
 gi|326464229|gb|EGD89682.1| hypothetical protein TERG_05918 [Trichophyton rubrum CBS 118892]
          Length = 626

 Score =  209 bits (532), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 145/432 (33%), Positives = 211/432 (48%), Gaps = 33/432 (7%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATI----IERLRE 56
           T RY      GL+DGIP AVKDE D+ GY+T +G+      +PA+S  +I    + +L E
Sbjct: 187 TLRYKQGCPRGLMDGIPTAVKDEYDIDGYKTCLGSLNDYTSDPASSGGSIASWCVRKLEE 246

Query: 57  KGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGR 116
            GA++LGK SMHE G  ++ +NP   TP NPYN  YY               L P A+G 
Sbjct: 247 AGAVVLGKLSMHEFGLDTSGSNPNYGTPLNPYNPKYYTGGSSSGTAYAVSVGLLPFALGS 306

Query: 117 DGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGK 176
           DGGGS+RIPSSFC +YGLK T  R S       +++ AV+GP+AA +  L+  Y ++   
Sbjct: 307 DGGGSIRIPSSFCSVYGLKPTHSRISHHPGPNHSNTCAVNGPIAADLQSLSALYRIIGCP 366

Query: 177 DPKDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR-G 235
            P  P      LP        +      +GV   W  Q   PAI     + I  L  +  
Sbjct: 367 PPTSPF-----LPVSPRLAPCSPNGTKYLGVPEAWFSQA-TPAIQRLCRSAISTLADKHN 420

Query: 236 AXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYI 295
                         +IAH +TI   LT  A    D  +L + P +  + + +   A+DY+
Sbjct: 421 YTVVPIQIPYLVEGQIAHAVTI---LTDAATLLPDTSNL-TAPNKILLGLGRETPATDYL 476

Query: 296 VSQQVRTRIMRTLNNLFSNQVDLI-LTPATAITAPKIY-PRALAHGEVDVTMISDIMRFV 353
           ++Q++R  +M+ L+ L+     +I +TP T+     I   + L +G  D       M F+
Sbjct: 477 LAQKLRRLLMQHLSWLWKEYPGMIVVTPTTSCAGWPIRDQKELKYGISDGDQTLKTMNFI 536

Query: 354 QLANFAGVPAVSVPAGY-------------DDN---NLPIGLQFIAKWYDEATLLRIAKT 397
            LANF G+PA++VPAG+             D+N    +PIGL    +W  E  L+R    
Sbjct: 537 WLANFTGLPAINVPAGFVVPEGAKNEGEIADENTEGKIPIGLMGTGEWGSEDFLMRWGLD 596

Query: 398 SEEILGNRRKKP 409
            E ++G+RR KP
Sbjct: 597 VENVVGDRRSKP 608



>gi|326484199|gb|EGE08209.1| glutamyl-tRNA(Gln) amidotransferase subunit A [Trichophyton equinum
           CBS 127.97]
          Length = 621

 Score =  209 bits (531), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 145/433 (33%), Positives = 212/433 (48%), Gaps = 35/433 (8%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATI----IERLRE 56
           T RY      GL+DGIP AVKDE D+ GY+T +G+      +P +S  +I    + +L E
Sbjct: 182 TLRYKQGCPRGLMDGIPTAVKDEYDIDGYKTCLGSLNDYTSDPESSGGSIASWCVRKLEE 241

Query: 57  KGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGR 116
            GA++LGK SMHE G  ++ +NP   TP NPYN  YY               L P A+G 
Sbjct: 242 AGAVVLGKLSMHEFGLDTSGSNPNYGTPLNPYNPKYYTGGSSSGTAYAVSVGLLPFALGS 301

Query: 117 DGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGK 176
           DGGGS+RIPSSFC +YGLK T  R S       +++ AV+GP+AA +  L+  Y ++   
Sbjct: 302 DGGGSIRIPSSFCSVYGLKPTHSRISHHPGSNHSNTCAVNGPLAADLQSLSALYRIIGCP 361

Query: 177 DPKDPNTLHQPL-PTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR- 234
            P  P    QP+ P L      N      +GV   W  Q   PAI     + I  L  + 
Sbjct: 362 PPTSP---FQPVSPRL---APCNPNGTKYLGVPEAWFSQA-TPAIQRLCRSAISTLADKH 414

Query: 235 GAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDY 294
                          +IAH +TI   LT  A    D  +L + P +  + + +   A+DY
Sbjct: 415 NYTVVPIQIPYLIEGQIAHAVTI---LTDAATLLPDTSNL-TAPNKILLGLGRETPATDY 470

Query: 295 IVSQQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIY-PRALAHGEVDVTMISDIMRF 352
           +++Q++R  +M+ L+ L+     +I+ TP T+     I   + L +G  D       M F
Sbjct: 471 LLAQKLRRLLMQHLSWLWKEYPGMIIVTPTTSCAGWPIRDQKELKYGISDGDQTLKTMNF 530

Query: 353 VQLANFAGVPAVSVPAGY----------------DDNNLPIGLQFIAKWYDEATLLRIAK 396
           + LANF G+PA++VPAG+                 +  +PIGL  + +W  E  L+R   
Sbjct: 531 IWLANFTGLPAINVPAGFVVPEGAKNEGEIAEENTEGKIPIGLMGMGEWGSEDFLMRWGL 590

Query: 397 TSEEILGNRRKKP 409
             E ++G+RR KP
Sbjct: 591 DVENVVGDRRSKP 603



>gi|407925341|gb|EKG18353.1| Amidase [Macrophomina phaseolina MS6]
          Length = 606

 Score =  209 bits (531), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 153/416 (36%), Positives = 208/416 (50%), Gaps = 25/416 (6%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           TERY     LG+LDG+P++VKDE+DV GY+ ++GT   +        +  +++    GAI
Sbjct: 175 TERYKAGKPLGILDGVPVSVKDEVDVAGYKKHIGTTQDHSNGGRCETSFCVQQWEAAGAI 234

Query: 61  ILGKTSMHEIGFGSTNNNPFVC--TPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDG 118
           I+GKT+MHE+G  +TNNNP     TP NPYN+ YY               L P A+G DG
Sbjct: 235 IVGKTTMHELGLDTTNNNPNPNHGTPLNPYNSHYYTGGSSGGSGYAVGAGLLPFALGADG 294

Query: 119 GGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDP 178
           GGS+RIPS++CG+YGLKT+ GR S      LA S  V GP+AA+V DL +AY VMA    
Sbjct: 295 GGSIRIPSNYCGVYGLKTSHGRVSGRPTPSLAASTGVLGPIAANVADLEVAYRVMA---- 350

Query: 179 KDPNTLHQPLPTLHGFHVTNKLSDLK---IGVYSMWNKQVDNPAITTALNNFIDEL-KLR 234
             P+TLH     L    +T   S  +   +G+   W  + D P +  A+   ID L    
Sbjct: 351 -TPDTLHAS-SALFPSALTTTSSPARPKLLGLCQPWLSRAD-PPVRAAIQRAIDHLVSHH 407

Query: 235 GAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDY 294
           G              + AH LTI   L  +A  H     L     +  I+V   A A D 
Sbjct: 408 GYRTVDIHIPLLASGQSAHALTI---LAEIASGHPSVAGLTPA-NKVLISVGSRAGAVDL 463

Query: 295 IVSQQVRTRIMRTLNNLFSNQVDL-ILTPATAITAPKIYPRA--LAHGEVDVTMISDIMR 351
           + +Q+VRT +M+ L +L+     + I+TP T      I   A  L HG  D  M    M 
Sbjct: 464 LQAQKVRTLLMQHLAHLYREHPGMVIVTPTTPNAGWHISGGAGDLKHGVSDANMSIRSME 523

Query: 352 FVQLANFAGVPAVSVPAGYDD-----NNLPIGLQFIAKWYDEATLLRIAKTSEEIL 402
           +V +ANF G PA+S P GY D       +P+GL  + +W  E  LL      E  L
Sbjct: 524 YVWMANFTGCPALSAPVGYVDPVEGEGRIPVGLMGMGEWGSEDALLEFGYDVEAYL 579



>gi|340517329|gb|EGR47574.1| amidase [Trichoderma reesei QM6a]
          Length = 592

 Score =  208 bits (530), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 154/439 (35%), Positives = 209/439 (47%), Gaps = 51/439 (11%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPA----TSDATIIERLRE 56
           TER+A  + LG+LDG+P+ VKD+ DVKGY  + G K+ N   PA       A  + +L+E
Sbjct: 162 TERWAAGTPLGVLDGVPVGVKDDTDVKGYVNHYGMKY-NGALPAFAAREETAWPVRKLQE 220

Query: 57  KGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGR 116
            GAI+LGK  MHE+G  ++  N    TP N  N  YYP              + PI +G 
Sbjct: 221 AGAIVLGKNKMHELGSDTSGLNVVQGTPTNHLNNAYYPGGSSNGAGSSISAGIVPICVGT 280

Query: 117 DGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGK 176
           D GGS+RIP++F GIYGLK +  R        +  +V V+GP+AA+  DL +AY VMA  
Sbjct: 281 DAGGSIRIPANFNGIYGLKPSHHR-----TMAMEGTVCVTGPLAATAADLTIAYRVMAQP 335

Query: 177 DPKDPN----TLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPA---ITTALNNFID 229
           D   P      L  P P+  G  V        +GV+  W  + D P       AL+ F  
Sbjct: 336 DASCPTQARFALSLPPPSAGGSRV--------MGVFRDWYNRADPPVRDLCDKALDYFAS 387

Query: 230 ELKLRGAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRH-----KDKMHLFSCPTRSNIN 284
           E   RG             A++AH      E+   A+R       D + L     +  ++
Sbjct: 388 E---RGYQIVDISIPFLPEAQVAHAGLCIAEMAEKARRRTPDNAADHLSLVGSANKILLS 444

Query: 285 VMKLATASDYIVSQQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIYPRAL---AHGE 340
           V    +A DY+    +RT +MR L +LF      LI+TPAT I     +PRA    AHG 
Sbjct: 445 VGAQVSAGDYLKINALRTVLMRHLAHLFQQHPGLLIMTPATPIVG---WPRAAGDDAHGM 501

Query: 341 VDVTMISDIMRFVQLANFAGVPAVSVPAGYDD-----NNLPIGLQFIAKWYDEATLLRIA 395
            D  +    M +V LAN AG P+VS P GY D       LP+ L    +W  E  LL  A
Sbjct: 502 SDANVTLRNMSYVFLANMAGNPSVSAPVGYVDPEQGEGKLPVSLLATGEWGSEEQLLAWA 561

Query: 396 KTSEEIL------GNRRKK 408
           + +EE L      G RR +
Sbjct: 562 REAEEYLHETYPEGRRRPE 580



>gi|340939221|gb|EGS19843.1| hypothetical protein CTHT_0043280 [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 647

 Score =  208 bits (530), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 147/437 (33%), Positives = 219/437 (50%), Gaps = 41/437 (9%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFI----NYGNPATSDATIIERLRE 56
           TERY     LG LDG+P  VKDE DV GY+T +G++ I      G+P+T     +++L +
Sbjct: 198 TERYKQGRPLGPLDGVPTVVKDEYDVAGYQTTLGSRNIYASTEDGHPST---WCVQQLEQ 254

Query: 57  KGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGR 116
            GAI++ K++M E G  +T NNP   TPRNPYN  YY               L P+ +G 
Sbjct: 255 AGAIVIAKSAMTEFGLDATGNNPIYGTPRNPYNRRYYTGGSSSGTGYSVAVGLVPVGLGS 314

Query: 117 DGGGSVRIPSSFCGIYGLKTTCGRFS-DDGQYPLAHSV--AVSGPMAASVDDLALAYYVM 173
           DGGGS+RIP+ FCG++GLK T GR S   GQ    HS+  A  GPMAA ++ LA  + V+
Sbjct: 315 DGGGSIRIPAGFCGVFGLKPTHGRVSFRPGQ---NHSITCACLGPMAADIESLATVFEVI 371

Query: 174 AGKDP-------KDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNN 226
           A  DP       K P  L  P P+       N+L    +G+   W  Q  +PA+ T +N+
Sbjct: 372 AKPDPSSHFPELKSPLDLRMPPPS-SDEEDPNRL----LGIPIAWVSQA-SPAVQTLINS 425

Query: 227 FIDEL-KLRGAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINV 285
            I +L    G              ++AH +TI T+  T+        +L     R  + +
Sbjct: 426 LIRKLTTTHGFRTVPISIPFLPEGQLAHAMTILTDAATLLPPPPATRNLTPA-NRLLLAL 484

Query: 286 MKLATASDYIVSQQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIYPRALA----HGE 340
            +   A+DY+++Q++R  +M+ L  L+      LI+TP       KI   + A     G 
Sbjct: 485 GRTTPATDYLLAQKLRRLLMQHLAWLWEQHPGMLIITPTAGCAGLKIGRESDAVQGGFGV 544

Query: 341 VDVTMISDIMRFVQLANFAGVPAVSVPAGY---DDNNLPIGLQFIAKWYDEATLLRIAKT 397
            D     + MR+  LANF G+P++S+P G+      ++P+G+    +W  E  LLR  + 
Sbjct: 545 SDGDSTMECMRYAWLANFCGLPSLSIPVGFVQARGGDVPVGMMVTGEWCAEERLLRFGRV 604

Query: 398 SEEIL-----GNRRKKP 409
            E +L       RR++P
Sbjct: 605 VERVLYEEGMQGRRRRP 621



>gi|451994610|gb|EMD87080.1| hypothetical protein COCHEDRAFT_1197929 [Bipolaris maydis C5]
          Length = 594

 Score =  208 bits (529), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 139/421 (33%), Positives = 214/421 (50%), Gaps = 28/421 (6%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREK-GA 59
           T+RY     LG+LDG+P  VKD++ VK Y+  VGT   +Y N    +++   ++ EK GA
Sbjct: 173 TQRYKEGKPLGILDGVPFGVKDDLRVKDYKHYVGTTH-DYSNGGNKESSWCAKMLEKEGA 231

Query: 60  IILGKTSMHEIGFGS--TNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRD 117
           I++G  +MHE+G  +  TNNNP   TPRNPYN+ YYP              L P AIG D
Sbjct: 232 ILVGTLTMHELGMDTDTTNNNPHWGTPRNPYNSSYYPGGSSGGAASAVGHGLIPFAIGSD 291

Query: 118 GGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKD 177
           GGGSVRIPS++CG+YGLK +  R S         SV V GP+A+++ DL ++Y V+A  D
Sbjct: 292 GGGSVRIPSNYCGVYGLKPSHSRVSIAPMPNSGKSVTVRGPLASNMADLEISYRVLAQPD 351

Query: 178 PKD-PNTLHQPLPTLHGFHVTNKLSDLK---IGVYSMWNKQVDNPAITTALNNFIDELKL 233
           P   P++L         F    K S  +   +GV   W  + D PA+  +  + ++ L+ 
Sbjct: 352 PSTYPSSL---------FAAPRKFSGPRNKVVGVPRQWVDRSD-PAVQESFYSALEYLEH 401

Query: 234 R-GAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATAS 292
           + G              ++AH +TI  E    A  H+  ++  +   R  + V +   A+
Sbjct: 402 QLGYKVVNVSIPLLAQGQLAHAMTIMAE---GAAAHRSSIYDLTPANRILMTVARQTPAT 458

Query: 293 DYIVSQQVRTRIMRTLNNLF-SNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMR 351
           D++++Q++R  +M+ L +LF +N   +I+TP        I    L+HG  +  M    M 
Sbjct: 459 DFLLAQRLRNLLMQHLADLFRANPGMVIVTPTAPNAGWPIDEAELSHGVSNGNMQIRNME 518

Query: 352 FVQLANFAGVPAVSVPAGY-----DDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRR 406
           +V LANF G+P +  P  Y      +  +PIG+    +W  E  L+      E+ L   R
Sbjct: 519 YVWLANFTGLPCIQFPVNYAQGVKGEGLVPIGMSGHGEWGSEDALIEFGFDGEKWLHEGR 578

Query: 407 K 407
           +
Sbjct: 579 E 579



>gi|429849878|gb|ELA25208.1| n-acylethanolamine amidohydrolase [Colletotrichum gloeosporioides
           Nara gc5]
          Length = 608

 Score =  207 bits (528), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 141/428 (32%), Positives = 207/428 (48%), Gaps = 33/428 (7%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKF---INYGNPATSDATIIERLREK 57
           TER+     LG LDG+PI VKD+IDVKGY ++ G ++   + +  PA      +E+L   
Sbjct: 176 TERWRRGEPLGPLDGVPIGVKDDIDVKGYVSHNGMQYRPDLPWFKPAEKTWWPVEQLEAA 235

Query: 58  GAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRD 117
           GAI+LGK +MHE+G  +   NP   TP N +N  YYP              + PI+IG D
Sbjct: 236 GAIVLGKNAMHELGGDTNGCNPRWGTPTNWHNKSYYPGGSSSGGGSALGAGIVPISIGTD 295

Query: 118 GGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKD 177
            GGS+RIPSSF GIYGLK +  R        +  S+ V GP+AA+V DL +AY +M+  +
Sbjct: 296 AGGSIRIPSSFNGIYGLKPSHHRTCA-----MNSSMCVVGPLAATVSDLTIAYRLMSRPN 350

Query: 178 PKDPNTLHQPLPTLHGFHVTNKLSDLK----IGVYSMWNKQVDNPAITTALNNFIDELKL 233
           P DP         + G +  +          I +   W  +   P + +     +D  K 
Sbjct: 351 PDDP---------IQGLYTPSIPPSPSAPKTIAIDEAWWSKASGP-VASICRAAVDNFKS 400

Query: 234 RGAXXXXXXXXXXXXARIAHLLTIGTELTTVAK-RHKDKMHLFSCPTRSNINVMKLAT-- 290
           +G              ++ H  T  TE+  +A+ RH D     S    +N   M + T  
Sbjct: 401 QGYSVVNIRIPYLREIQLMHSATCVTEMQDLARHRHPDPAAWQSIINHANKVTMSVGTQT 460

Query: 291 -ASDYIVSQQVRTRIMRTLNNLF-SNQVDLILTPATAITAPKIYPRALAHGEVDVTMISD 348
            A DY+   Q+R  +M+ L +LF  N   L++TP T +     +P   A+G  D      
Sbjct: 461 PAGDYMKYNQLRDLLMKHLAHLFEENPGMLVVTPTTPLPGWPKHPGDEAYGVSDTNTTIA 520

Query: 349 IMRFVQLANFAGVPAVSVPAGYDD-----NNLPIGLQFIAKWYDEATLLRIAKTSEEILG 403
            M +V +AN +G PAV+ P GY D       +P+GL  +A+W  E  LL  A+ +E  L 
Sbjct: 521 NMSYVYVANVSGCPAVTAPVGYVDPVQGEGKIPVGLMAMAEWGCEEQLLGWAREAETYLH 580

Query: 404 NR-RKKPS 410
              R++P 
Sbjct: 581 KEGRQRPE 588



>gi|296423527|ref|XP_002841305.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295637542|emb|CAZ85496.1| unnamed protein product [Tuber melanosporum]
          Length = 615

 Score =  207 bits (527), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 145/418 (34%), Positives = 214/418 (51%), Gaps = 28/418 (6%)

Query: 1   TERYANNSS-LGLLDGIPIAVKDEIDVKGYETNVG------TKFINYGNPATSDATIIER 53
           T RYA +++    +DG+PI VKDE  + G    +G      T+     +     +  +++
Sbjct: 161 TSRYAASTAHTSGIDGVPILVKDEFSLAGTPRTMGLTKAEMTRRAYSASEEGQTSWCVQK 220

Query: 54  LREKGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIA 113
           L + GA+++GK +MHEIGF +TNNNP   TPRNPYN  YYP              L PIA
Sbjct: 221 LIDAGALVVGKANMHEIGFDTTNNNPNWGTPRNPYNKGYYPGGSSGGCAYAVGAGLVPIA 280

Query: 114 IGRDGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVM 173
           +G DGGGS+RIP+++CG+YGLK T GR S      +A S  V GP+AA++ DL LAY +M
Sbjct: 281 VGADGGGSIRIPAAYCGVYGLKPTHGRVSHRPTLSIAASNGVVGPIAATISDLELAYRIM 340

Query: 174 AGKDPKDPNTLH--QPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL 231
           A  DP+DP +++  QP       H   ++    IG+Y  W +  D   +    N  +  L
Sbjct: 341 ATPDPQDPVSINFSQPKKPPVEAHTGKRI----IGIYKPWFEDCDQ-EVKDVTNTAVKWL 395

Query: 232 KLR-GAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLAT 290
           +   G              R AH +TI TE+       K +    +   +  + V     
Sbjct: 396 ETEAGYEVVDIEIPYLKEGRTAHAITIMTEIGQ--GFCKGEASGLTPANKLLVGVSNKTP 453

Query: 291 ASDYIVSQQVRTRIMRTLNNLFSNQVD--LILTPATAITAPKIYPRALAHGEVDVTMISD 348
           A D+ ++Q+VR  +M  L++LF+   D  +IL+P T     KI   + +H     + ISD
Sbjct: 454 ARDFNIAQRVRAMLMSHLSSLFATHTDSLVILSPVTPHIGVKI--GSESHVAKGGSGISD 511

Query: 349 I------MRFVQLANFAGVPAVSVPAGYD-DNNLPIGLQFIAKWYDEATLLRIAKTSE 399
                  M++V LANF G P++SVP GY     +PIGL  +A W  E  LL + + +E
Sbjct: 512 ANTSLKSMQYVFLANFTGCPSISVPVGYSLTEGVPIGLMGMAAWGGEEVLLGLGECTE 569



>gi|398412389|ref|XP_003857519.1| amidase signature enzyme [Zymoseptoria tritici IPO323]
 gi|339477404|gb|EGP92495.1| amidase signature enzyme [Zymoseptoria tritici IPO323]
          Length = 581

 Score =  207 bits (527), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 141/418 (33%), Positives = 209/418 (50%), Gaps = 31/418 (7%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+RY N   L  LDG+P+AVKDE+DV GY    G+  +++     + +  ++R  + GAI
Sbjct: 150 TQRYQNGKYLSPLDGVPVAVKDEVDVAGYTKCFGSA-MDFTREDGATSYCVQRWLDAGAI 208

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           ++GKT+MHE+G  +TN N    TP NPYN  YY               L P+A G D GG
Sbjct: 209 LVGKTNMHEMGVDTTNCNVVHGTPLNPYNEKYYCGGSSGGSAYAVGAGLVPLAEGNDEGG 268

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           S+RIP+++CG+YGLK + GR S      LA +  V+GP+AA++ DL L Y +MA  D  +
Sbjct: 269 SIRIPAAYCGVYGLKPSHGRVSSRPSKELASTTGVAGPIAANMCDLELGYRIMAQPDSLN 328

Query: 181 PNT-LHQP--LPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR-GA 236
             + L  P   PT       N      +G+Y  W  + D P +  +  N I+ L  + G 
Sbjct: 329 HKSRLFAPPSSPT-----AKNPKRRKVLGIYKPWFDRAD-PGVEASCQNAIEFLTSKLGY 382

Query: 237 XXXXXXXXXXXXARIAHLLTIGTEL------TTVAKRHKDKMHLFSCPTRSNINVMKLAT 290
                        +IAH LTI +EL      +++ K       LFS   R+        T
Sbjct: 383 ETVDITIPLVPEGQIAHALTILSELASGVTASSIWKLQPATKILFSVGRRT--------T 434

Query: 291 ASDYIVSQQVRTRIMRTLNNLFSNQVDL-ILTPATAITAPKIYPRALAHGEVDVTMISDI 349
           A D++ +Q+VR  IM+ L+ LF+    L I+TP T      I    LA+G  +  M    
Sbjct: 435 AIDFLQAQRVRQIIMQHLSYLFTTHPSLIIITPTTPNAGWPIGVNDLAYGASNANMSVRS 494

Query: 350 MRFVQLANFAGVPAVSVPAGYDD-----NNLPIGLQFIAKWYDEATLLRIAKTSEEIL 402
           M +V +ANF+G PA++ P G+ +       +PIGL  + +W  E  L+      E  +
Sbjct: 495 MEYVWMANFSGCPALTAPVGFVEAKQGKGKVPIGLMGMGEWRSEDELIAFGYDCESFV 552



>gi|494767234|ref|WP_007502642.1| glutamyl-tRNA amidotransferase subunit A [Caldalkalibacillus
           thermarum]
 gi|334181460|gb|EGL84003.1| Amidase [Caldalkalibacillus thermarum TA2.A1]
          Length = 488

 Score =  206 bits (523), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 129/404 (31%), Positives = 207/404 (51%), Gaps = 13/404 (3%)

Query: 11  GLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAIILGKTSMHEI 70
           G L GIP+A+KD I      T +G+K I+    ++ DAT++++L + G I  GK ++HE 
Sbjct: 86  GPLHGIPMAIKDIIYFANEVTTMGSK-IHQNFKSSYDATVVKKLTQAGVIFTGKLNLHEY 144

Query: 71  GFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGSVRIPSSFCG 130
            +G+TNNNP     RNP++ +                 +   A+  D GGS+RIPSSFCG
Sbjct: 145 AWGATNNNPHFGPCRNPWDVERISGGSSGGSGVAPASHMTIAALRTDTGGSIRIPSSFCG 204

Query: 131 IYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDPNTLHQPLPT 190
           I GLK T G  S  G +PLA S+   GPM  +  D A     +AG DPKDP +++ P P 
Sbjct: 205 IVGLKPTHGLVSKYGCFPLAWSLDHIGPMTKTAKDAAYVLEAIAGYDPKDPTSINVPTPK 264

Query: 191 LHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXXXXXXXXXXXXAR 250
            +   +T  +  L+IG+   +     +  +   + N I  L+  GA            A 
Sbjct: 265 -YSEELTGSVKGLRIGINEEYFFNNVDSEVEKTVRNAILSLEKEGAVIETVNVPALQYAE 323

Query: 251 IAHLLTIGTELTTV-----AKRHKDKMHLFSCPTRSNINVMKLATASDYIVSQQVRTRIM 305
            A ++TI +E +T+       R +D    F    R  + + ++ +A DY+ +QQ+R ++ 
Sbjct: 324 YAEMITIISEASTIHHNNLIAREED----FGDDVRFLLKLGEIPSAVDYLQAQQIRLQLD 379

Query: 306 RTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANFAGVPAVS 365
           R    +F N+VD+++TP      PKI    +     +V  +  I+RF    N  G+PAV+
Sbjct: 380 REFKEMF-NKVDVLITPTLPFLPPKIGQDTVLLNGNEVNFLDHIIRFTGPFNLTGLPAVT 438

Query: 366 VPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKP 409
           VP G+  N+LP+G+Q +   + E  +L +A T E++    ++ P
Sbjct: 439 VPCGF-VNDLPVGMQIVGPAFQEGRILNVADTFEKLHPELKRSP 481



>gi|326472535|gb|EGD96544.1| hypothetical protein TESG_03984 [Trichophyton tonsurans CBS 112818]
          Length = 628

 Score =  206 bits (523), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 144/433 (33%), Positives = 211/433 (48%), Gaps = 35/433 (8%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATI----IERLRE 56
           T RY      GL+DGIP AVKDE D+ GY+T +G+      +P +S  +I    + +L E
Sbjct: 189 TLRYKQGCPRGLMDGIPTAVKDEYDIDGYKTCLGSLNDYTSDPESSGGSIASWCVRKLEE 248

Query: 57  KGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGR 116
            GA++LGK SMHE G  ++ +NP   TP NPYN  YY               L P A+G 
Sbjct: 249 AGAVVLGKLSMHEFGLDTSGSNPNYGTPLNPYNPKYYTGGSSSGTAYAISVGLLPFALGS 308

Query: 117 DGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGK 176
           DGGGS+RIPSSFC +YGLK T  R S       +++ AV+GP+AA +  L+  Y ++   
Sbjct: 309 DGGGSIRIPSSFCSVYGLKPTHSRISHHPGPNHSNTCAVNGPLAADLQSLSALYRIIGCP 368

Query: 177 DPKDPNTLHQPL-PTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR- 234
            P  P    QP+ P L      N      +GV   W  Q   PAI     + I  L  + 
Sbjct: 369 PPTSP---FQPVSPRL---APCNPNGTKYLGVPEAWFSQA-TPAIQRLCRSAISTLADKH 421

Query: 235 GAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDY 294
                          +IAH +TI   LT  A    D  +L + P +  + + +   A+DY
Sbjct: 422 NYTVVPIQIPYLIEGQIAHAVTI---LTDAATLLPDTSNL-TAPNKILLGLGRETPATDY 477

Query: 295 IVSQQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIY-PRALAHGEVDVTMISDIMRF 352
           +++Q++R  +M+ L+ L+     +I+ TP T+     I   + L +G  D       M F
Sbjct: 478 LLAQKLRRLLMQHLSWLWKEYPGMIIVTPTTSCAGWPIRDQKELKYGISDGDQTLKTMNF 537

Query: 353 VQLANFAGVPAVSVPAGY----------------DDNNLPIGLQFIAKWYDEATLLRIAK 396
           + LANF G+PA++VPAG+                 +  +PIGL  + +W  E  L+R   
Sbjct: 538 IWLANFTGLPAINVPAGFVVPEGAKNEGEIAEENTEGKIPIGLMGMGEWGSEDFLMRWGL 597

Query: 397 TSEEILGNRRKKP 409
               ++G+RR KP
Sbjct: 598 DVGNVVGDRRSKP 610



>gi|302663928|ref|XP_003023601.1| hypothetical protein TRV_02233 [Trichophyton verrucosum HKI 0517]
 gi|291187605|gb|EFE42983.1| hypothetical protein TRV_02233 [Trichophyton verrucosum HKI 0517]
          Length = 577

 Score =  205 bits (522), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 144/435 (33%), Positives = 209/435 (48%), Gaps = 36/435 (8%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATI----IERLRE 56
           T RY      GL+DGIP AVKDE D+ GY+T +G+      +PA+S  +I    + +L E
Sbjct: 135 TLRYKQGCPRGLMDGIPTAVKDEYDIDGYKTCLGSLNDYTSDPASSGGSIASWCVRKLEE 194

Query: 57  KGAIILGKTSMHEIGF---GSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIA 113
            GA++LGK SMHE G     ++ +NP   TP NPYN  YY               L P A
Sbjct: 195 AGAVVLGKLSMHEFGLVDVDTSGSNPNYGTPLNPYNPKYYTGGSSSGTAYAVSVGLLPFA 254

Query: 114 IGRDGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVM 173
           +G DGGGS+RIPSSFC +YGLK T  R S       +++ AV+GP+AA +  L+  Y ++
Sbjct: 255 LGSDGGGSIRIPSSFCSVYGLKPTHSRISHHPGPNHSNTCAVNGPIAADLQSLSALYRII 314

Query: 174 AGKDPKDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKL 233
               P  P      LP        N      +GV   W  Q   PAI     + I  L  
Sbjct: 315 GCPPPTSPF-----LPVSPRLAPCNPNGTKYLGVPEAWFSQA-TPAIQHLCRSAISTLAD 368

Query: 234 R-GAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATAS 292
           +                +IAH +TI   LT  A    D  +L + P +  + + +   A+
Sbjct: 369 KHNYTVVPIQIPYLVEGQIAHAVTI---LTDAATLLPDTSNL-TAPNKILLGLGRETPAT 424

Query: 293 DYIVSQQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIY-PRALAHGEVDVTMISDIM 350
           DY+++Q++R  +M+ L+ L+     +I+ TP T+     I   + L +G  D       M
Sbjct: 425 DYLLAQKLRRLLMQHLSWLWKEYPGMIIVTPTTSCAGWPIRDQKELKYGISDGDQTLKTM 484

Query: 351 RFVQLANFAGVPAVSVPAGY----------------DDNNLPIGLQFIAKWYDEATLLRI 394
            F+ LANF G+PA++VPAG+                 +  +PIGL    +W  E  L+R 
Sbjct: 485 NFIWLANFTGLPAINVPAGFVVPEGTKNEGEIAEENTEGKIPIGLMGTGEWGSEDFLMRW 544

Query: 395 AKTSEEILGNRRKKP 409
               E ++G+RR KP
Sbjct: 545 GLDVENVVGDRRSKP 559



>gi|380485793|emb|CCF39129.1| amidase [Colletotrichum higginsianum]
          Length = 590

 Score =  205 bits (522), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 140/416 (33%), Positives = 205/416 (49%), Gaps = 26/416 (6%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTK--FINYGNPATS-DATIIERLREK 57
           T+RY    SLG LDG+P AVKDE ++ GY T +G++  +     P  S  +  +++L + 
Sbjct: 169 TKRYKEGRSLGPLDGVPTAVKDEYEIDGYRTCLGSRNDYTTEAEPGQSITSWCVKKLEDA 228

Query: 58  GAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRD 117
           GA++LGK SMHE G  +T NNP   TPRNPYN  YY               L P+A+G D
Sbjct: 229 GAVVLGKLSMHEFGLDTTGNNPIYGTPRNPYNRGYYTGGSSSGAGYAVATGLVPVALGSD 288

Query: 118 GGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKD 177
           GGGS+RIPSS CG+YGLK T GR S       ++S AV+GP+AA ++ LA  Y+   G  
Sbjct: 289 GGGSIRIPSSMCGVYGLKPTHGRVSFHPCPNHSNSCAVNGPIAADIESLA-TYFETIGAP 347

Query: 178 PKDPNTLHQPLPTLHGFHVTNKLSDLKI-GVYSMWNKQVDNPAITTALNNFIDEL-KLRG 235
             D N + Q  P    F  +      KI G+   W  Q D PAI       I +L    G
Sbjct: 348 HPDSNFI-QASP----FMCSPSEKRGKILGIPEAWFAQAD-PAIQRLCRTMIAKLVTHHG 401

Query: 236 AXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYI 295
                         + AH +T+ T+   +    K+     +   R  + + ++ +A DY+
Sbjct: 402 YTTVPIDIPFLVEGQFAHAMTVLTDGAALLPETKN----LTPANRILLAIGRVTSAMDYL 457

Query: 296 VSQQVRTRIMRTLNNLFSNQVDLIL-TPATAITA-PKIYPRALAHGEVDVTMISDIMRFV 353
           ++Q++R  +M  L +L+     +I+ TP TA    P +    LAHG  D       M +V
Sbjct: 458 LAQKLRGLLMSHLAHLWREYPGMIIVTPTTACAGWPIVSKGELAHGVSDGDRTIRSMEYV 517

Query: 354 QLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKP 409
            + NF+G   +          +PIGL  + +W DE +LL     +EE+    R +P
Sbjct: 518 WMGNFSGPETL--------GKIPIGLMGMGEWTDEHSLLEFGLDAEELFAKERCRP 565



>gi|367051883|ref|XP_003656320.1| hypothetical protein THITE_2096993 [Thielavia terrestris NRRL 8126]
 gi|347003585|gb|AEO69984.1| hypothetical protein THITE_2096993 [Thielavia terrestris NRRL 8126]
          Length = 616

 Score =  205 bits (522), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 149/431 (34%), Positives = 204/431 (47%), Gaps = 39/431 (9%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFIN----YGNPATSDATIIERLRE 56
           TER+A  + LG+LDG+P  VKD++DVKG+ + +G K       +  PA   A    RL E
Sbjct: 172 TERWAAGTPLGILDGVPFGVKDDVDVKGFVSTMGMKVDKTQEYFNKPAKETAWPARRLEE 231

Query: 57  KGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGR 116
            GAI++GK + HE+G  +T  NP   T  N YN  YY               L PI +G 
Sbjct: 232 AGAIMMGKMNQHEVGMDTTGCNPATGTATNWYNKSYYTGGSSAGAGSALSGGLVPITVGT 291

Query: 117 DGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGK 176
           D GGSVRIP++FCG+YGLK T  R        ++ SV V GPM A+  DL +AY  MA  
Sbjct: 292 DAGGSVRIPTAFCGVYGLKPTHNRTCG-----MSSSVCVVGPMTATAADLTIAYRFMAQP 346

Query: 177 DPKDPNTLHQPLPTLHGFHVTNKLSDLK-IGVYSMWNKQVDNPAITTALNNFIDELKLR- 234
            P DP         L         S  K +G+   W     +P +    +  +  L  R 
Sbjct: 347 IPDDPAQ------NLFAVSTPPDPSAPKYLGICREWVATA-SPDVQRIYDAAVAHLTSRC 399

Query: 235 GAXXXXXXXXXXXXARIAHLLTIGTELTTVAK-RHKDKMH---LFSCPTRSNINVMKLAT 290
           G              +IAH  T  TE    A+ R ++  H   L + P R N+ +     
Sbjct: 400 GYTAVDIRLPFLREGQIAHAATCLTEAAADARGRTRNPAHYLRLLNRPNRINVGIGAQTP 459

Query: 291 ASDYIVSQQVRTRIMRTLNNLFSNQVDL-ILTPATAITAPKIYPRAL---AHGEVDVTMI 346
           A+DY+   Q+R  +M+ L  LF+    L +LTP T +     +PR     A+G  D    
Sbjct: 460 AADYLRYGQLRQVLMQHLAFLFAAHPGLLVLTPTTPMAG---WPRHAGDDAYGSSDGNQT 516

Query: 347 SDIMRFVQLANFAGVPAVSVPAGY-----DDNNLPIGLQFIAKWYDEATLLRIAKTSEEI 401
              MRFV +AN +G PAV+ PAGY      +  LP+GL  +A+W  E  LL  A+  E  
Sbjct: 517 IRSMRFVWVANMSGCPAVTCPAGYVEPAQGEGMLPVGLMAMAEWGMEEQLLGFAREVEGY 576

Query: 402 L-----GNRRK 407
           L     G RR+
Sbjct: 577 LNEAYPGGRRR 587



>gi|258573559|ref|XP_002540961.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237901227|gb|EEP75628.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 621

 Score =  204 bits (520), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 136/432 (31%), Positives = 212/432 (49%), Gaps = 34/432 (7%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATI----IERLRE 56
           T+RY N   +GLLDG+P AVKDE D+ GY T +G+   +Y + A  + +I    + +L +
Sbjct: 172 TQRYKNKCPIGLLDGVPTAVKDEYDIDGYRTCLGSAN-DYTSAALPEKSITSWCVRQLED 230

Query: 57  KGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGR 116
            GA+ILGK +MHE G  ++ NNP   TPRNP+N+ YY               L PI++G 
Sbjct: 231 AGAVILGKLAMHEFGLDTSGNNPIHGTPRNPFNSQYYTGGSSSGSAYAVSAGLIPISLGS 290

Query: 117 DGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGK 176
           DGGGS+RIPSSFC +YGLK T  R S       +++ AV+GP+AA +  LAL Y+V+   
Sbjct: 291 DGGGSIRIPSSFCSVYGLKPTHSRLSHRPGCNHSNTCAVNGPIAADIRSLALLYHVIGTP 350

Query: 177 DPKDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLRG 235
            P        P P        NK+    +G+   W  Q   PAI    ++ +D+L     
Sbjct: 351 HPSSHFPTLSP-PLAPPIRPRNKV----LGIPEAWFSQ-STPAIQQLCHSLLDKLVSACD 404

Query: 236 AXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYI 295
                         + AH +T+ T+  T+    +      +   +  I +  +  A+D++
Sbjct: 405 YTLIPIEIPYLKEGQAAHAMTVLTDAATLLPDTEG----LTAANKIMIGLGTITPATDFL 460

Query: 296 VSQQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYPRA-LAHGEVDVTMISDIMRFV 353
           ++Q++R  +M+ L  L+     +I+ TP T+     I   + L HG  D       M +V
Sbjct: 461 LAQKLRQLLMQHLAYLWKEYPGMIIVTPTTSCAGWPIRSESELKHGINDGNQTLKTMEYV 520

Query: 354 QLANFAGVPAVSVPAGY----------------DDNNLPIGLQFIAKWYDEATLLRIAKT 397
            +ANF G+PA++VPAG+                    +P+GL  + +W  E  LL+    
Sbjct: 521 WMANFTGIPALNVPAGFVIPEGTPGAGEVAETDTVGKVPVGLMGMGEWASEDNLLQWGLD 580

Query: 398 SEEILGNRRKKP 409
            E++   R  +P
Sbjct: 581 IEKVGEERLSRP 592



>gi|485916291|gb|EOD43673.1| putative ubiquitin-protein ligase sel1 protein [Neofusicoccum parvum
            UCRNP2]
          Length = 1543

 Score =  204 bits (520), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 151/424 (35%), Positives = 207/424 (48%), Gaps = 38/424 (8%)

Query: 10   LGLLDGIPIAVKDEIDVKGYETNVGT--KFINYGNPATSDATIIERLREKGAIILGKTSM 67
            LG+LDG+P++VKDE+D+ GY   +GT   F + G   TS    + +    GA+++GK +M
Sbjct: 1116 LGVLDGVPVSVKDEVDLAGYHKRIGTLRDFSHGGRAETS--FCVAQWEAAGAVVVGKLTM 1173

Query: 68   HEIGFGSTNNNPFV--CTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGSVRIP 125
            HE+G  +TNNNP     TP NP+N  YY               L P A+G DGGGS+RIP
Sbjct: 1174 HELGLDTTNNNPNANHGTPLNPHNPHYYTGGSSGGSGYAVGAGLLPFALGADGGGSIRIP 1233

Query: 126  SSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDPNTLH 185
            +++CG+YGLK + GR S      LA S  V GP+AA+V DL +AY VMA      P+ LH
Sbjct: 1234 ANYCGVYGLKPSHGRVSGRPTPSLAASTGVLGPLAANVADLEVAYRVMA-----TPDALH 1288

Query: 186  -------QPLPTLHGFHVTNKLSDLK-IGVYSMWNKQVDNPAITTALNNFIDEL-KLRGA 236
                    P  +  G   ++  S  K IG+   W  + D PA+  A+   +D L   RG 
Sbjct: 1289 ASSALFAAPSSSTAGAATSSSPSRPKTIGICKPWFSRAD-PAVRDAVQRCVDHLASTRGY 1347

Query: 237  XXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYIV 296
                         + AH LTI   L  +A    D   L +   +  I+V   A A D + 
Sbjct: 1348 AVVDVALPLLSEGQSAHALTI---LAEIASGFPDVAGL-TPANKVLISVGSRAGAVDLLQ 1403

Query: 297  SQQVRTRIMRTLNNLFSNQVDL-ILTPATAITAPKIY--PRALAHGEVDVTMISDIMRFV 353
            +Q+VR  +M+ L  L      L ++TP T      I   P  L +G  D  M    M +V
Sbjct: 1404 AQKVRALLMQHLAALHRRHPGLVVVTPTTPNAGWHIAGGPGDLKYGVSDGNMSIRSMEYV 1463

Query: 354  QLANFAGVPAVSVPAGYDD-----NNLPIGLQFIAKWYDEATLLRIAKTSEEIL-----G 403
             +ANF G PA+S P GY D       +PIGL  + +W  E  LL      EE L     G
Sbjct: 1464 WMANFTGCPALSAPVGYADPVEGEGKIPIGLMGMGEWGSEDALLAFGYDVEEYLNTGLEG 1523

Query: 404  NRRK 407
             RR+
Sbjct: 1524 GRRR 1527



>gi|498238040|ref|WP_010552196.1| amidase [Brachybacterium paraconglomeratum]
          Length = 475

 Score =  204 bits (520), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 137/405 (33%), Positives = 200/405 (49%), Gaps = 8/405 (1%)

Query: 3   RYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAIIL 62
           R A  +   LLDG+P+AVKD +DV G  T +G++      P T  A +++RL E GA+ L
Sbjct: 62  RRAEGAPPRLLDGLPVAVKDNLDVAGRVTTMGSEIFRDHVP-TGSAAVVDRLEEHGAVRL 120

Query: 63  GKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGSV 122
           G T++HE   G T  NP     RNP++T   P              +   A+G D  GS+
Sbjct: 121 GATNLHEFALGVTTENPHHGICRNPWDTSRTPGGSSGGSAVAVASGMALAALGTDTSGSI 180

Query: 123 RIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDPN 182
           RIP++ CGI GLK T GR S  G YP A S+   G + +SV D AL    ++G DP+ P+
Sbjct: 181 RIPAAACGIVGLKPTYGRISSVGCYPEAWSLDHVGVLTSSVADAALLLDTLSGHDPRGPS 240

Query: 183 TLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXXXXXX 242
           +L  PLP        +    L+IGV   +     +PA+   +   ++ L   GA      
Sbjct: 241 SL--PLPPTTSRQELDDPRPLRIGVEEEFFFAGIDPAVEGIVREALEGLTRAGATLVPIS 298

Query: 243 XXXXXXARIAHLLTIGTELTTVAKRHKDKMH--LFSCPTRSNINVMKLATASDYIVSQQV 300
                 A  A L  I T  TT     + + H  L+    R  +    LATA DY+ +QQ+
Sbjct: 299 LPSLSDAVFA-LTVIDTAETTAFHETQLRRHGELYGEDVRRLVECGALATAVDYVRAQQI 357

Query: 301 RTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANFAG 360
           R+ +       F++ VD+I +P   I  P+I   ++  G V     +++MR V  +N AG
Sbjct: 358 RSLVRAEFARAFAD-VDVIASPTLPIRTPRIGETSVEVGGVTRDRDAELMRLVGPSNLAG 416

Query: 361 VPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNR 405
           +P+VSVP G  D  +P+GLQ I     E  +LR A   E ++  R
Sbjct: 417 IPSVSVPCGMLD-GMPVGLQLIGPALGEGAVLRAAAAVESLVPPR 460



>gi|475674691|gb|EMT71772.1| Amidase [Fusarium oxysporum f. sp. cubense race 4]
          Length = 611

 Score =  204 bits (520), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 136/432 (31%), Positives = 212/432 (49%), Gaps = 36/432 (8%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDAT---IIERLREK 57
           TERY N   LG LDG+P A+KD+ D+ GY T +G+       P   ++T   I+ +L E 
Sbjct: 166 TERYKNKQPLGPLDGVPSAIKDDYDLDGYSTTLGSPRDYTETPKDGESTTSWIVRKLEEA 225

Query: 58  GAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRD 117
           G +I+GK +MHE G  +T NNP   TPRNP+N+ YY               L P+A+G D
Sbjct: 226 GVVIIGKLAMHEFGLDTTGNNPNQGTPRNPFNSGYYTGGSSSGPAYAVSSGLIPLALGSD 285

Query: 118 GGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKD 177
           GGGS+RIP SFC ++GLK T  R +       + + AV GP+A  +  LA AY  +A  +
Sbjct: 286 GGGSIRIPGSFCSVFGLKPTHNRLASWPGANHSPTCAVQGPLAVDMQSLAAAYEAIA--E 343

Query: 178 PKDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR-GA 236
           P  P+T   PL       VT  L     G++  W  +   P++ + +   ++ L  + G 
Sbjct: 344 PH-PSTQFPPLALQPSPPVTKVL-----GIFDAWISRA-TPSVQSLVRGLVESLAAKHGY 396

Query: 237 XXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYIV 296
                        ++AH LT+ T+ +T+    K      +   +  + + +   ++DY++
Sbjct: 397 TLVPIEIPFPAEGQMAHALTVLTDASTLLYDTKG----LTPANKILLALGRTTPSTDYLL 452

Query: 297 SQQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIY--PRALAHGEVDVTMISDIMRFV 353
           +Q++R  +M+ L+ L+      LI+TP TA     I      L++G  D     + M +V
Sbjct: 453 AQKLRGMLMQHLSYLWKTYPGMLIITPTTACAGAPIRGGKSELSYGVNDGNYTLESMEYV 512

Query: 354 QLANFAGVPAVSVPAGY----------------DDNNLPIGLQFIAKWYDEATLLRIAKT 397
            LANF G+PA++VPAGY                 +  +P+GL    +W  E  LL+    
Sbjct: 513 WLANFCGLPAITVPAGYVVPEGRKDAGEVADRDTEGKIPVGLMATGEWCSEDALLQFGFD 572

Query: 398 SEEILGNRRKKP 409
           +E    + R KP
Sbjct: 573 AEAAGQDLRCKP 584



>gi|477517210|gb|ENH69459.1| Amidase [Fusarium oxysporum f. sp. cubense race 1]
          Length = 959

 Score =  204 bits (519), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 138/435 (31%), Positives = 215/435 (49%), Gaps = 42/435 (9%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDAT---IIERLREK 57
           TERY N   LG LDG+P A+KD+ D+ GY T +G+       P   ++T   I+ +L E 
Sbjct: 166 TERYKNKQPLGPLDGVPSAIKDDYDLDGYSTTLGSLRDYTETPKDGESTTSWIVRKLEEA 225

Query: 58  GAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRD 117
           G +I+GK +MHE G  +T NNP   TPRNP+N+ YY               L P+A+G D
Sbjct: 226 GVVIMGKLAMHEFGLDTTGNNPNQGTPRNPFNSGYYTGGSSSGPAYAVSSGLIPLALGSD 285

Query: 118 GGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAH---SVAVSGPMAASVDDLALAYYVMA 174
           GGGS+RIP SFC ++GLK T  R +    +P A+   + AV GP+A  +  LA AY  +A
Sbjct: 286 GGGSIRIPGSFCSVFGLKPTHNRLAS---WPGANHSPTCAVQGPLAVDMQSLAAAYEAIA 342

Query: 175 GKDPKDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR 234
             +P  P+T   PL       VT  L     G++  W  +   P++ + +   ++ L  +
Sbjct: 343 --EPH-PSTQFPPLALQPSPPVTKVL-----GIFDAWISRA-TPSVQSLVRGLVESLAAK 393

Query: 235 -GAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASD 293
            G              ++AH LT+ T+ +T+    K      +   +  + + +   ++D
Sbjct: 394 HGYTLVPIEIPFPAEGQMAHALTVLTDASTLLYDTKG----LTPANKILLALGRTTPSTD 449

Query: 294 YIVSQQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIY--PRALAHGEVDVTMISDIM 350
           Y+++Q++R  +M+ L+ L+      LI+TP TA     I      L++G  D     + M
Sbjct: 450 YLLAQKLRGMLMQHLSYLWKTYPGMLIITPTTACAGAPIRGGKSELSYGVNDGNYTLESM 509

Query: 351 RFVQLANFAGVPAVSVPAGY----------------DDNNLPIGLQFIAKWYDEATLLRI 394
            +V LANF G+PA++VPAGY                 +  +P+GL    +W  E  LL+ 
Sbjct: 510 EYVWLANFCGLPAITVPAGYVVPEGRKDAGEVADRDTEGKIPVGLMATGEWCSEDALLQF 569

Query: 395 AKTSEEILGNRRKKP 409
              +E    + R KP
Sbjct: 570 GFDAEAAGQDLRCKP 584



>gi|367018228|ref|XP_003658399.1| hypothetical protein MYCTH_2294109 [Myceliophthora thermophila ATCC
           42464]
 gi|347005666|gb|AEO53154.1| hypothetical protein MYCTH_2294109 [Myceliophthora thermophila ATCC
           42464]
          Length = 490

 Score =  204 bits (519), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 139/427 (32%), Positives = 200/427 (46%), Gaps = 31/427 (7%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFIN----YGNPATSDATIIERLRE 56
           TER+A    L  LDG+P  VKD++DV+GY + +G K  +    +       A  + +L+E
Sbjct: 14  TERWAQGKPLSYLDGVPFGVKDDVDVEGYVSLMGMKVNDAHKYFNTLPERSAWPVRKLKE 73

Query: 57  KGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGR 116
            GAI++GK + HEIG  +T  NP   TPRN YN  YYP              L PIA+G 
Sbjct: 74  AGAIMMGKLNQHEIGMDTTGCNPTTGTPRNWYNKSYYPGGSSSGCASAVSAGLVPIAVGS 133

Query: 117 DGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGK 176
           D GGS+RIPS+FCG+YGLK T  R        ++ SV   GP+A++  DL +AY  MA  
Sbjct: 134 DAGGSIRIPSAFCGVYGLKPTHNRVCH-----MSSSVCALGPIASTAADLTIAYRFMAQP 188

Query: 177 DPKDPNTLHQPLPTLHGFHVTNKLSDLK-IGVYSMWNKQVDNPAITTALNNFIDELKLRG 235
           +P+D      P+ +L       + S  K +G+   W     +  +   L+  +D L   G
Sbjct: 189 NPED------PVQSLFAVSTPPEPSAKKYLGICREWIGGTVDQDVLRILDQSLDHLVALG 242

Query: 236 AXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDK----MHLFSCPTRSNINVMKLATA 291
                         ++AH     TE    A+   +     + + + P R  I       A
Sbjct: 243 YEVIDIRLPFLREGQLAHSAICVTEAAADARNRAETPSSFLDMLNYPNRVVIGTGSQTPA 302

Query: 292 SDYIVSQQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIYPRALAHGEVDVTMISDIM 350
            D++   Q+R  IM+ L  L+      +IL+PAT +    I      +G  D  M    M
Sbjct: 303 IDFLKYGQIRQVIMQHLAFLWEKYPGMMILSPATPMAGWPITEGDDKYGCFDGNMSIRNM 362

Query: 351 RFVQLANFAGVPAVSVPAGY-----DDNNLPIGLQFIAKWYDEATLLRIAKTSEEIL--- 402
            +  LAN +G PAVS PAGY      +  LP+GL  + +W  E  LL  A+  E  L   
Sbjct: 363 TYAWLANLSGCPAVSFPAGYVEPKQGEGMLPVGLMAMGEWGAEEQLLAFARERESYLNDV 422

Query: 403 --GNRRK 407
             G RR+
Sbjct: 423 YPGGRRR 429



>gi|342887743|gb|EGU87177.1| hypothetical protein FOXB_02315 [Fusarium oxysporum Fo5176]
          Length = 1433

 Score =  204 bits (518), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 138/435 (31%), Positives = 215/435 (49%), Gaps = 42/435 (9%)

Query: 1    TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDAT---IIERLREK 57
            TERY N   LG LDG+P A+KD+ D+ GY T +G+       P   ++T   I+ +L E 
Sbjct: 624  TERYKNKQPLGPLDGVPSAIKDDYDLDGYSTTLGSLRDYTETPKDGESTTSWIVRKLEEA 683

Query: 58   GAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRD 117
            G +I+GK +MHE G  +T NNP   TPRNP+N+ YY               L P+A+G D
Sbjct: 684  GVVIMGKLAMHEFGLDTTGNNPNQGTPRNPFNSGYYTGGSSSGPAYAVSSGLIPLALGSD 743

Query: 118  GGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAH---SVAVSGPMAASVDDLALAYYVMA 174
            GGGS+RIP SFC ++GLK T  R +    +P A+   + AV GP+A  +  LA AY  +A
Sbjct: 744  GGGSIRIPGSFCSVFGLKPTHNRLAS---WPGANHSPTCAVQGPLAVDMQSLAAAYEAIA 800

Query: 175  GKDPKDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR 234
              +P  P+T   PL       VT  L     G++  W  +   P++ + +   ++ L  +
Sbjct: 801  --EPH-PSTQFPPLALQPSPPVTKVL-----GIFDAWISRA-TPSVQSLVRGLVESLAAK 851

Query: 235  -GAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASD 293
             G              ++AH LT+ T+ +T+    K      +   +  + + +   ++D
Sbjct: 852  HGYTLVPIEIPFPAEGQMAHALTVLTDASTLLYDTKG----LTPANKILLALGRTTPSTD 907

Query: 294  YIVSQQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIY--PRALAHGEVDVTMISDIM 350
            Y+++Q++R  +M+ L+ L+      LI+TP TA     I      L++G  D     + M
Sbjct: 908  YLLAQKLRGMLMQHLSYLWKTYPGMLIITPTTACAGAPIRGGKSELSYGVNDGNYTLESM 967

Query: 351  RFVQLANFAGVPAVSVPAGY----------------DDNNLPIGLQFIAKWYDEATLLRI 394
             +V LANF G+PA++VPAGY                 +  +P+GL    +W  E  LL+ 
Sbjct: 968  EYVWLANFCGLPAITVPAGYVIPEGRKDAGEVADRDTEGKIPVGLMATGEWCSEDALLQF 1027

Query: 395  AKTSEEILGNRRKKP 409
               +E    + R KP
Sbjct: 1028 GFDAEAAGQDLRCKP 1042



>gi|317121336|ref|YP_004101339.1| amidase [Thermaerobacter marianensis DSM 12885]
 gi|503260256|ref|WP_013494917.1| amidase [Thermaerobacter marianensis]
 gi|315591316|gb|ADU50612.1| Amidase [Thermaerobacter marianensis DSM 12885]
          Length = 608

 Score =  203 bits (517), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 129/412 (31%), Positives = 199/412 (48%), Gaps = 23/412 (5%)

Query: 13  LDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAIILGKTSMHEIGF 72
           L G+P+A+KD IDV G  T  G++ +  G+ A   AT++ RL E GA+I+GKT+ HE  F
Sbjct: 203 LFGVPVALKDLIDVAGVPTTAGSR-VRAGHVADRTATVVRRLEEAGAVIVGKTATHEFAF 261

Query: 73  GSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGSVRIPSSFCGIY 132
           G+T + PF     NP+N D+                L P+A+G D GGS+RIP++ CG  
Sbjct: 262 GATTDTPFHGPVHNPWNLDHSAGGSSGGSGAVVGAGLLPVALGTDTGGSIRIPAAACGTV 321

Query: 133 GLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDPNTLHQPLPTL- 191
           GLK T GR S  G  PL+ S+  +GP+AASV D A    V+AG DP DP  +  P   L 
Sbjct: 322 GLKPTYGRVSRHGTVPLSWSLDHTGPLAASVADAARVLEVLAGPDPLDPAAVPVPAQGLL 381

Query: 192 --HGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXXXX--------- 240
                     L  L++GV + W +   +P +  A  + + +L+  GA             
Sbjct: 382 EAAAAGAAGDLRGLRVGVLADWARDRVHPEVEQAFRDALRQLEALGAELVEIGGPGGDGP 441

Query: 241 ---XXXXXXXXARIAHLLTIGT-ELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYIV 296
                       R+  L   G     T+A++  D    +S   R    + +   A DY++
Sbjct: 442 AFPAAGVLTLVNRVLALAEGGAYHAATLARQAGD----YSHEVRIRFELGQFLLARDYLL 497

Query: 297 SQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIM-RFVQL 355
           +Q++R  + R    +  +   +++ P   I AP++          D   + + M R    
Sbjct: 498 AQRLRAELARQATAVMEH-CHVLVAPTLPIPAPRLGQPVWEPAGADPEPVPEAMIRLTAP 556

Query: 356 ANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRK 407
            N  G PA+SVP     + LPIG+Q + + +DEAT+LR+    E++ G  R+
Sbjct: 557 FNVTGQPALSVPVAVGASGLPIGVQIVGRVFDEATVLRVGAALEQVRGPLRR 608



>gi|171694898|ref|XP_001912373.1| hypothetical protein [Podospora anserina S mat+]
 gi|170947691|emb|CAP59853.1| unnamed protein product [Podospora anserina S mat+]
          Length = 594

 Score =  202 bits (515), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 142/428 (33%), Positives = 206/428 (48%), Gaps = 35/428 (8%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTK------FINYGNPATSDATIIERL 54
           TER+     LG+LDG+P  VK + +VKGY + +G K      + N   P T    +  ++
Sbjct: 168 TERWKEGKQLGILDGVPFGVKADTEVKGYVSTMGMKVDKTVAYFNKPEPETCWPAL--KM 225

Query: 55  REKGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAI 114
           +E+GAI++GK + HEIG  +T  NP   T  N YNT Y+P              L P+AI
Sbjct: 226 QEQGAIMVGKMNQHEIGMDTTGCNPVTGTATNWYNTRYFPGGSSSGAGSGLCAGLVPVAI 285

Query: 115 GRDGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMA 174
           G D GGS+RIP +FCG+YGLK T  R         A S+ V GPM ++V DL +AY VM+
Sbjct: 286 GTDAGGSMRIPPAFCGVYGLKPTFNRTCSR-----ATSMCVVGPMTSTVADLTIAYRVMS 340

Query: 175 GKDPKDP--NTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL- 231
             +P DP  N L   +P   G       S   +G+   W  + D P +    ++ ++ L 
Sbjct: 341 QPNPSDPGQNLLCLSVPPSPG-------SKKTLGICRAWIARAD-PDVLKVFSSCVEYLT 392

Query: 232 KLRGAXXXXXXXXXXXXARIAHLLTIGTELTT--VAKRHKDKMHLFSCPTRSNINVMKLA 289
            ++G              ++AH  T  TE  T   A+   + +   +   R  ++     
Sbjct: 393 TVKGYTAVDISLPYLREGQLAHAATCLTEAATEAFARNPSNYLAPLNHANRMLVSAATHT 452

Query: 290 TASDYIVSQQVRTRIMRTLNNLFSNQVDLI-LTPATAITAPKIYPRALAHGEVDVTMISD 348
            A+DY+   Q+R  IM  L  L+    D+I LTP T I   KI     A+G  D  +   
Sbjct: 453 PATDYLSYGQIRHVIMAHLAWLWEQHPDMIVLTPTTPIAGWKICDGDEAYGCSDGNLSIK 512

Query: 349 IMRFVQLANFAGVPAVSVPAGY-----DDNNLPIGLQFIAKWYDEATLLRIAKTSE---E 400
            M F  +AN +G PAV+ P GY      +  LP+G+  + +W  E  LL  A+  E   E
Sbjct: 513 NMTFAWVANTSGCPAVTCPGGYVEAEQGEGVLPVGVMGMGEWGAEEQLLGFARDVEGFLE 572

Query: 401 ILGNRRKK 408
           + G RR K
Sbjct: 573 VEGRRRPK 580



>gi|497321099|ref|WP_009635312.1| amidase [Serratia sp. M24T3]
 gi|383297543|gb|EIC85852.1| amidase [Serratia sp. M24T3]
          Length = 464

 Score =  202 bits (514), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 135/395 (34%), Positives = 194/395 (49%), Gaps = 18/395 (4%)

Query: 6   NNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAIILGKT 65
           N   LG L GIP+ +K  ID+ G E N G+K +  GN A+ DAT+   L++ GAIILG T
Sbjct: 64  NGYDLGPLQGIPLGLKANIDICGQEMNAGSKILQ-GNIASQDATVTRLLKQAGAIILGTT 122

Query: 66  SMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGSVRIP 125
           +MHE  +G T NNP     RNP++T   P                   +G D GGSVR+P
Sbjct: 123 NMHEFAWGGTTNNPHFGACRNPWDTQRVPAGSSGGSGVVAAVRSAFATLGTDTGGSVRLP 182

Query: 126 SSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDPNTLH 185
           ++  G+ GL+ T G  S DG +PLA S+   GP+AA   D A+ Y  ++G D K    + 
Sbjct: 183 AALNGVTGLRPTVGNISTDGVFPLAWSMDTVGPLAARSADCAILYATLSGADAKQRANID 242

Query: 186 QPLPTLHGFHVTNKLSDLKIGV---YSMWNKQVDNPAITTALNNFIDEL-KLRGAXXXXX 241
           Q L           L  L+IGV   YS ++ Q   P +   L   + +  K  G      
Sbjct: 243 QQL--------ARPLKGLRIGVLDPYSFYSLQ---PGVEKTLRGALSDFEKQHGVEIVSL 291

Query: 242 XXXXXXXARIAHLLTIGTELTTVA-KRHKDKMHLFSCPTRSNINVMKLATASDYIVSQQV 300
                  A  A ++    E + +     KD+   +    R  +      TA +Y+ +Q+ 
Sbjct: 292 KVEGLENAVDAQIIVDACEPSAIHWPWLKDRASDYGDDVRILLQAGLTFTAVEYLQAQRY 351

Query: 301 RTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANFAG 360
           RT +    N LF+ QVD+I+TP    TAP I    L  G+ +V+ +   + F  + + A 
Sbjct: 352 RTWLRDKFNELFT-QVDMIITPTLPFTAPLIGQETLPIGDGEVSTLLGNLIFTCIPSLAV 410

Query: 361 VPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIA 395
           +PA+S PAG+D   LP+GLQ +A    EA LLR A
Sbjct: 411 LPAISFPAGFDSLGLPVGLQLMAAPGQEALLLRAA 445



>gi|350295966|gb|EGZ76943.1| amidase signature enzyme [Neurospora tetrasperma FGSC 2509]
          Length = 595

 Score =  202 bits (513), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 141/434 (32%), Positives = 204/434 (47%), Gaps = 35/434 (8%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTK----FINYGNPATSDATIIERLRE 56
           TER+     LG+LDG+P  VKD+ +V+GY + +G K    F  +  PAT      ++LRE
Sbjct: 160 TERWQAGRPLGILDGVPFGVKDDTEVEGYVSTMGMKVDERFEYFKKPATETVWPAKKLRE 219

Query: 57  KGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGR 116
            GAI++GK + HEIG  +T  NP   T  N YNT Y+P              L PIAIG 
Sbjct: 220 AGAIMVGKMNQHEIGMDTTGCNPATGTATNWYNTQYFPGGSSSGAGSALSAGLVPIAIGT 279

Query: 117 DGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGK 176
           D GGS+RIP +FCG+YGLK T  R           S+ V GPM ++  DL +AY +MA  
Sbjct: 280 DAGGSMRIPPAFCGVYGLKPTHNRVVSRNS-----SMCVVGPMCSNPSDLTIAYRIMAQP 334

Query: 177 DPKDP--NTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITT---ALNNFIDEL 231
           +P DP  ++L   +P        +  +   +G+   W    D    TT   A+       
Sbjct: 335 NPSDPAQSSLAPSIP-------PSPTAKKYLGLCPEWIALADADVRTTFNRAIETLCSSS 387

Query: 232 KLRGAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRH----KDKMHLFSCPTRSNINVMK 287
            L G              ++AH  T  TE    A+       D +   + P R  +++  
Sbjct: 388 SLGGYELVTIKLPYLREGQLAHAATCLTEAAADARNRVANPDDYLKPLNYPNRIMVSMGA 447

Query: 288 LATASDYIVSQQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIYPRALAHGEVDVTMI 346
              A+DY+   Q+R  IM+ L +L+      LI+TP T +    I P   A+G  D    
Sbjct: 448 QTPAADYLRYNQLRHVIMQHLAHLYEQYPGLLIVTPTTPMAGWPIMPGDHAYGCSDGNRS 507

Query: 347 SDIMRFVQLANFAGVPAVSVPAGY-----DDNNLPIGLQFIAKWYDEATLLRIAKTSEEI 401
              M +V  AN +G PAV+ P GY      +  LP+G+  +A+W +E  LL  A+  E  
Sbjct: 508 IRNMTYVWYANTSGCPAVTCPGGYVEAQQGEGKLPVGVMAMAEWGEEERLLGFAREMERY 567

Query: 402 LGNR----RKKPSD 411
           L       R++P +
Sbjct: 568 LAEAYEGGRQRPKE 581



>gi|493884298|ref|WP_006830486.1| glutamyl-tRNA amidotransferase subunit A [Planococcus antarcticus]
 gi|388463760|gb|EIM06104.1| amidase [Planococcus antarcticus DSM 14505]
          Length = 472

 Score =  201 bits (511), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 133/407 (32%), Positives = 205/407 (50%), Gaps = 13/407 (3%)

Query: 11  GLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAIILGKTSMHEI 70
           G L GIP+A+KD +  K     +G+K I+ G  A  DAT++ +L+  G    GK +MHE 
Sbjct: 71  GFLHGIPMALKDILYFKDEPATMGSK-IHEGFTADFDATVVSKLKLSGVTFHGKLNMHEY 129

Query: 71  GFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGSVRIPSSFCG 130
            +G+T NNP     RNP++ +  P              +   ++G D GGS+RIP+S CG
Sbjct: 130 AWGATTNNPHYGACRNPWDLNQIPGGSSGGSGAAVAANMSIASLGTDTGGSIRIPASSCG 189

Query: 131 IYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDPNTLHQPLPT 190
           I GLK T GR S  G +PLA S+   GPM  +V D AL   V+ G DPKDP ++ +P   
Sbjct: 190 IIGLKPTHGRISKYGCFPLAWSLDHIGPMTKTVFDAALLLEVLGGYDPKDPTSVDRPTQH 249

Query: 191 LHGFHVTNKLSDLKIGVYS-MWNKQVDNPAITTALNNFIDELKLRGAXXXXXXXXXXXXA 249
             G  +   +  L IG+    + K VD+  +  A+ N + +L+  GA            A
Sbjct: 250 YSGL-LKEDVKGLVIGIEEGYFFKNVDS-RVDEAVRNALQQLEKLGARIEVVKIPSLAQA 307

Query: 250 RIAHLLTIGTELTTVAKRHKDKM----HLFSCPTRSNINVMKLATASDYIVSQQVRTRIM 305
             A L+TI TE + V   H D +      F    R  + V +L +  DY+ SQQ+R ++ 
Sbjct: 308 EFAELVTIATEASAV---HHDNLVKQPEKFGEDVRFLLEVGELMSGVDYVQSQQIRRKLN 364

Query: 306 RTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANFAGVPAVS 365
                 F  +VD++++P      P I    +      ++ + +++RF    N  G+PA+S
Sbjct: 365 LDFAAAF-EKVDVLISPTLPFLPPSIGDSTVDINGKSLSFLDEVIRFTGPGNLTGLPALS 423

Query: 366 VPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPSDK 412
           +P G  D  LPIGLQ +   + E  +L +A   E++   + +KP+ K
Sbjct: 424 IPCGVRD-GLPIGLQIMGPAFQEEKVLNVAYALEKLELMKGQKPNLK 469



>gi|336463892|gb|EGO52132.1| hypothetical protein NEUTE1DRAFT_71418 [Neurospora tetrasperma FGSC
           2508]
          Length = 613

 Score =  201 bits (510), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 141/434 (32%), Positives = 203/434 (46%), Gaps = 35/434 (8%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTK----FINYGNPATSDATIIERLRE 56
           TER+     LG+LDG+P  VKD+ +V+GY + +G K    F  +  PAT      ++LRE
Sbjct: 177 TERWQAGRPLGILDGVPFGVKDDTEVEGYVSTMGMKVDERFEYFKKPATETVWPAKKLRE 236

Query: 57  KGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGR 116
            GAI++GK + HEIG  +T  NP   T  N YNT Y+P              L PIAIG 
Sbjct: 237 AGAIMVGKMNQHEIGMDTTGCNPATGTATNWYNTQYFPGGSSSGAGSALSAGLVPIAIGT 296

Query: 117 DGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGK 176
           D GGS+RIP +FCG+YGLK T  R           S+ V GPM  +  DL +AY +MA  
Sbjct: 297 DAGGSMRIPPAFCGVYGLKPTHNRVVSRNS-----SMCVVGPMCPNPSDLTIAYRIMAQP 351

Query: 177 DPKDP--NTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITT---ALNNFIDEL 231
           +P DP  ++L   +P        +  +   +G+   W    D    TT   A+       
Sbjct: 352 NPSDPAQSSLAPSIP-------PSPTAKKYLGLCPEWIALADADVRTTFNRAIETLCSSS 404

Query: 232 KLRGAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRH----KDKMHLFSCPTRSNINVMK 287
            L G              ++AH  T  TE    A+       D +   + P R  +++  
Sbjct: 405 SLGGYELVTIKLPYLREGQLAHAATCLTEAAADARNRVANPDDYLKPLNYPNRIMVSMGA 464

Query: 288 LATASDYIVSQQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIYPRALAHGEVDVTMI 346
              A+DY+   Q+R  IM+ L +L+      LI+TP T +    I P   A+G  D    
Sbjct: 465 QTPAADYLRYNQMRHVIMQHLAHLYEQYPGLLIVTPTTPMAGWPIMPGDNAYGCSDGNRS 524

Query: 347 SDIMRFVQLANFAGVPAVSVPAGY-----DDNNLPIGLQFIAKWYDEATLLRIAKTSEEI 401
              M +V  AN +G PAV+ P GY      +  LP+G+  +A+W +E  LL  A+  E  
Sbjct: 525 IRNMTYVWYANTSGCPAVTCPGGYVEAQQGEGKLPVGVMAMAEWGEEERLLGFAREMERY 584

Query: 402 LGNR----RKKPSD 411
           L       R++P +
Sbjct: 585 LAEAYEGGRQRPKE 598



>gi|302501017|ref|XP_003012501.1| hypothetical protein ARB_01114 [Arthroderma benhamiae CBS 112371]
 gi|291176060|gb|EFE31861.1| hypothetical protein ARB_01114 [Arthroderma benhamiae CBS 112371]
          Length = 596

 Score =  200 bits (509), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 145/454 (31%), Positives = 210/454 (46%), Gaps = 55/454 (12%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATI----IERLRE 56
           T RY      GL+DGIP AVKDE D+ GY+T +G+      +PA+S  +I    + +L E
Sbjct: 135 TLRYKQGCPRGLMDGIPTAVKDEYDIDGYKTCLGSLNDYTSDPASSGGSIASWCVRKLEE 194

Query: 57  KGAIILGKTSMHEIGFG----------------------STNNNPFVCTPRNPYNTDYYP 94
            GA++LGK SMHE G G                      ++ +NP   TP NPYN  YY 
Sbjct: 195 AGAVVLGKLSMHEFGLGMYTLAEIYIYILHKQVLTVDVDTSGSNPNYGTPLNPYNPKYYT 254

Query: 95  XXXXXXXXXXXXXXLCPIAIGRDGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVA 154
                         L P A+G DGGGS+RIPSSFC +YGLK T  R S       +++ A
Sbjct: 255 GGSSSGTAYAVSVGLLPFALGSDGGGSIRIPSSFCSVYGLKPTHSRISHHPGPNHSNTCA 314

Query: 155 VSGPMAASVDDLALAYYVMAGKDPKDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQ 214
           V+GP+AA +  L+  Y ++    P  P      LP        N      +GV   W  Q
Sbjct: 315 VNGPIAADLQSLSALYRIIGCPPPTSPF-----LPVSPRLAPCNPNGAKYLGVPEAWFSQ 369

Query: 215 VDNPAITTALNNFIDELKLR-GAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMH 273
              PAI     + I  L  +                +IAH +TI   LT  A    D  +
Sbjct: 370 A-TPAIQRLCRSAISTLADKHNYTVVPIQIPYLVEGQIAHAVTI---LTDAATLLPDTSN 425

Query: 274 LFSCPTRSNINVMKLATASDYIVSQQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIY 332
           L + P +  + + +   A+DY+++Q++R  +M+ L+ L+     +I+ TP T+     I 
Sbjct: 426 L-TAPNKILLGLGRETPATDYLLAQKLRRLLMQHLSWLWKEYPGMIIVTPTTSCAGWPIR 484

Query: 333 -PRALAHGEVDVTMISDIMRFVQLANFAGVPAVSVPAGY----------------DDNNL 375
             + L +G  D       M F+ LANF G+PA++VPAG+                 +  +
Sbjct: 485 DQKELKYGISDGDQTLKTMNFIWLANFTGLPAINVPAGFVVPEGAKNEGEIAEESTEGKI 544

Query: 376 PIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKP 409
           PIGL    +W  E  L+R     E ++G+RR KP
Sbjct: 545 PIGLMGTGEWGSEDFLMRWGLDVENVVGDRRSKP 578



>gi|310790061|gb|EFQ25594.1| amidase [Glomerella graminicola M1.001]
          Length = 611

 Score =  200 bits (509), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 141/425 (33%), Positives = 204/425 (48%), Gaps = 26/425 (6%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKF---INYGNPATSDATIIERLREK 57
           TER+     LG LDG+PI VKD+IDVKGY ++ G ++   + +  PA      + +L   
Sbjct: 176 TERWRRGEPLGPLDGVPIGVKDDIDVKGYVSHNGMQYRPDLPWFKPAEETMWPVRQLEAA 235

Query: 58  GAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRD 117
           GAI+LGK +MHE+G  +   NP   TP N +N  YYP              + PI+IG D
Sbjct: 236 GAIVLGKNAMHELGGDTNGCNPRWGTPTNWHNKSYYPGGSSSGGGSALGAGIVPISIGTD 295

Query: 118 GGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKD 177
            GGS+RIP+SF   YGLK +  R        +  SV V GP+AA+V DL +AY VM+  +
Sbjct: 296 AGGSIRIPASFNSAYGLKPSHHRACT-----MNTSVCVVGPLAATVADLTIAYRVMSRPN 350

Query: 178 PKDP-NTLHQP-LPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRG 235
           P DP   L+ P +P         K+    I +   W    + P++       +D    RG
Sbjct: 351 PDDPIQGLYTPSIPPSLSHSPPQKI----IAIDEAWWSHAE-PSVNAVCRRAVDHFTSRG 405

Query: 236 AXXXXXXXXXXXXARIAHLLTIGTELTTVAK-RHKDKMHLFSCPTRSNINVMKLAT---A 291
                         ++ H  T  TE+  +A+ RH D     S    +N   M + T   A
Sbjct: 406 YATIPIRIPYLREIQLMHSATCITEMQDLARHRHPDPEQWQSLINHANAITMSVGTQTPA 465

Query: 292 SDYIVSQQVRTRIMRTLNNLF-SNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIM 350
            DY+   Q+R  +M+ L  LF  N   L++TP T +      P   A+G  D       M
Sbjct: 466 GDYMKYAQLRDLLMKHLAFLFEQNPGMLVVTPTTPLPGWPRQPGDDAYGVSDANTTIANM 525

Query: 351 RFVQLANFAGVPAVSVPAGYDD-----NNLPIGLQFIAKWYDEATLLRIAKTSEE-ILGN 404
            +V +AN +G PAV+ P GY D       +P+GL  + +W  E  LL  AK +E  ++  
Sbjct: 526 SYVFVANVSGCPAVTAPIGYVDPVQGEGRVPVGLMAMGEWGCEEQLLEWAKEAETYLIKE 585

Query: 405 RRKKP 409
            R++P
Sbjct: 586 GRQRP 590



>gi|495454888|ref|WP_008179582.1| glutamyl-tRNA amidotransferase subunit A [Bacillus sp. B14905]
 gi|126590317|gb|EAZ84438.1| putative glutamyl-tRNA(Gln) amidotransferase subunit A [Bacillus
           sp. B14905]
          Length = 472

 Score =  200 bits (509), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 139/405 (34%), Positives = 201/405 (49%), Gaps = 13/405 (3%)

Query: 11  GLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAIILGKTSMHEI 70
           G+  GIP+A+KD +  K   T + +K I+    +  DAT++E+LR+ G I  GK SMHE 
Sbjct: 71  GMYHGIPMALKDNLYFKNKITTMSSK-IHKDFVSNYDATVVEKLRDAGVIFTGKLSMHEY 129

Query: 71  GFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGSVRIPSSFCG 130
            +G TNNNP     RNP++ D  P                  ++G D  GS+RIPSS CG
Sbjct: 130 AWGITNNNPHYGPVRNPWDLDKIPGGSSGGSGAAVAAGASVASLGTDTAGSIRIPSSACG 189

Query: 131 IYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDPNTLHQPLPT 190
           I GLK T GR S  G YPLA S+   GPM  +V D A    V++G D +DP  +  P   
Sbjct: 190 IVGLKPTHGRVSKYGCYPLAWSLDHIGPMTKTVKDAAGLLEVISGFDHRDPTCIDVPTDN 249

Query: 191 LHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXXXXXXXXXXXXAR 250
            +   ++    DL IG+   +  +  +  I  A+   I  L  +GA            A 
Sbjct: 250 -YVQQISGNSKDLVIGINEEYFFKDVDADIEKAVRASIQSLVDQGAKVEIVRIPSLQYAE 308

Query: 251 IAHLLTIGTELTTV-----AKRHKDKMHLFSCPTRSNINVMKLATASDYIVSQQVRTRIM 305
            A L+T  +E   +      KR +D    F    R    + +L +A DY+ +QQVR +I 
Sbjct: 309 WAELVTSLSEAAAIHHSDLQKRPQD----FGDDIRLLFELGELPSAVDYLQAQQVRRQIK 364

Query: 306 RTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANFAGVPAVS 365
           +  N +F NQVD+++TP   + A  I           V +I +I+RF   +N  G+PA+S
Sbjct: 365 QEFNEIF-NQVDVLITPTLPVVANTIGDDFAELNGKKVDLIDNIIRFTGPSNLTGLPALS 423

Query: 366 VPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
           VP G+   NLPIGLQ I   + E  +L +    E+    R +KP+
Sbjct: 424 VPCGF-KGNLPIGLQIIGPAFKEGRILNVGYAIEQTNPLRNRKPN 467



>gi|85111196|ref|XP_963822.1| hypothetical protein NCU00905 [Neurospora crassa OR74A]
 gi|28925560|gb|EAA34586.1| predicted protein [Neurospora crassa OR74A]
 gi|38636458|emb|CAE81993.1| related to amidase [Neurospora crassa]
          Length = 610

 Score =  200 bits (509), Expect = 7e-49,   Method: Compositional matrix adjust.
 Identities = 140/434 (32%), Positives = 204/434 (47%), Gaps = 35/434 (8%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTK----FINYGNPATSDATIIERLRE 56
           TER+     LG+LDG+P  VKD+ +V+GY + +G K    F  +  PAT      ++LRE
Sbjct: 175 TERWQAGRPLGILDGVPFGVKDDTEVEGYVSTMGMKVDERFEYFKKPATETVWPAKKLRE 234

Query: 57  KGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGR 116
            GAI++GK + HEIG  +T  NP   T  N YNT Y+P              L PIAIG 
Sbjct: 235 AGAIMVGKMNQHEIGMDTTGCNPATGTATNWYNTQYFPGGSSSGAGSALSAGLVPIAIGT 294

Query: 117 DGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGK 176
           D GGS+RIP +FCG+YGLK T  R           S+ V GPM ++  DL +AY +MA  
Sbjct: 295 DAGGSMRIPPAFCGVYGLKPTHNRVVSRNS-----SMCVVGPMCSNPSDLTIAYRIMAQP 349

Query: 177 DPKDP--NTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITT---ALNNFIDEL 231
           +P DP  ++L   +P        +  +   +G+   W    D    TT   A+       
Sbjct: 350 NPSDPAQSSLAPSIP-------PSPTAKKYLGLCPEWIALADADVRTTFNRAIETLCSSS 402

Query: 232 KLRGAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRH----KDKMHLFSCPTRSNINVMK 287
            L G              ++AH  T  TE    A+       D +   + P R  +++  
Sbjct: 403 SLGGYELVTIKLPYLREGQLAHAATCLTEAAADARNRVANPDDYLKPLNYPNRIMVSMGA 462

Query: 288 LATASDYIVSQQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIYPRALAHGEVDVTMI 346
              A+DY+   Q+R  IM+ L +L+      LI+TP T +    I P    +G  D    
Sbjct: 463 QTPAADYLRYNQLRHVIMQHLAHLYEQYPGLLIVTPTTPMAGWPIMPGDNVYGCSDGNRS 522

Query: 347 SDIMRFVQLANFAGVPAVSVPAGY-----DDNNLPIGLQFIAKWYDEATLLRIAKTSEEI 401
              M +V +AN +G PAV+ P GY      +  LP+G+  +A+W +E  LL  A+  E  
Sbjct: 523 IRNMTYVWVANTSGCPAVTCPGGYVEAQQGEGKLPVGVMAMAEWGEEERLLGFAREMERY 582

Query: 402 LGNR----RKKPSD 411
           L       R++P +
Sbjct: 583 LAEAYEGGRQRPKE 596



>gi|490347927|ref|WP_004227700.1| glutamyl-tRNA amidotransferase subunit A [Lysinibacillus
           fusiformis]
 gi|298728487|gb|EFI69045.1| glutamyl-tRNA(Gln) amidotransferase subunit A [Lysinibacillus
           fusiformis ZC1]
          Length = 472

 Score =  200 bits (508), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 139/409 (33%), Positives = 203/409 (49%), Gaps = 21/409 (5%)

Query: 11  GLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAIILGKTSMHEI 70
           G+  GIP+A+KD +  K   T + +K I+    +  DAT++E+LR+ G I  GK SMHE 
Sbjct: 71  GMYHGIPMALKDNLYFKDKITTMSSK-IHKDFVSDYDATVVEKLRDAGVIFTGKLSMHEY 129

Query: 71  GFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGSVRIPSSFCG 130
            +G TNNNP     RNP++ D  P                  ++G D  GS+RIPSS CG
Sbjct: 130 AWGITNNNPHYGPVRNPWDLDKIPGGSSGGSGAAVAAGASVASLGTDTAGSIRIPSSACG 189

Query: 131 IYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDPNTLHQPLPT 190
           I GLK T GR S  G YPLA S+   GPM  +V D A    V+AG D +DP  +  P+  
Sbjct: 190 IVGLKPTHGRVSKFGCYPLAWSLDHIGPMTKTVKDAAGLLEVIAGFDHRDPTCIDIPIDN 249

Query: 191 LHGFHVTNKLSDLKIGV---YSMWNKQVD-NPAITTALNNFIDELKLRGAXXXXXXXXXX 246
                +T  + DL IG+   Y   N   D   A+  ++ + +D+    GA          
Sbjct: 250 YEK-QLTGNIKDLVIGINEEYFFNNVDTDVEKAVRASIQSLVDQ----GAKVDVVRIPSL 304

Query: 247 XXARIAHLLTIGTELTTV-----AKRHKDKMHLFSCPTRSNINVMKLATASDYIVSQQVR 301
             A  A L+T  +E   +      KR +D    F    R    + +L +A DY+ +QQVR
Sbjct: 305 QYAEWAELVTSLSEAAAIHHSDLQKRPQD----FGDDIRLLFELGELPSAVDYLQAQQVR 360

Query: 302 TRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANFAGV 361
            +I +    +F N+VD++++P   + A  I           V +I +I+RF   +N  G+
Sbjct: 361 RQIKQEFTEIF-NKVDVLISPTLPVVASTIGDDFAVLNGKKVDLIDNIIRFTGPSNLTGL 419

Query: 362 PAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
           PA+SVP G+   NLPIGLQ I   + E  +L +    E+    R +KP+
Sbjct: 420 PALSVPCGF-KGNLPIGLQIIGPAFKEGRILNVGYAVEQANPQRTRKPN 467



>gi|496820669|ref|WP_009373347.1| glutamyl-tRNA(Gln) amidotransferase subunit A [Lysinibacillus
           fusiformis]
 gi|422947462|gb|EKU41857.1| glutamyl-tRNA(Gln) amidotransferase subunit A [Lysinibacillus
           fusiformis ZB2]
          Length = 487

 Score =  199 bits (507), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 139/409 (33%), Positives = 203/409 (49%), Gaps = 21/409 (5%)

Query: 11  GLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAIILGKTSMHEI 70
           G+  GIP+A+KD +  K   T + +K I+    +  DAT++E+LR+ G I  GK SMHE 
Sbjct: 86  GMYHGIPMALKDNLYFKDKITTMSSK-IHKDFVSDYDATVVEKLRDAGVIFTGKLSMHEY 144

Query: 71  GFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGSVRIPSSFCG 130
            +G TNNNP     RNP++ D  P                  ++G D  GS+RIPSS CG
Sbjct: 145 AWGITNNNPHYGPVRNPWDLDKIPGGSSGGSGAAVAAGASVASLGTDTAGSIRIPSSACG 204

Query: 131 IYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDPNTLHQPLPT 190
           I GLK T GR S  G YPLA S+   GPM  +V D A    V+AG D +DP  +  P+  
Sbjct: 205 IVGLKPTHGRVSKFGCYPLAWSLDHIGPMTKTVKDAAGLLEVIAGFDHRDPTCIDIPIDN 264

Query: 191 LHGFHVTNKLSDLKIGV---YSMWNKQVD-NPAITTALNNFIDELKLRGAXXXXXXXXXX 246
                +T  + DL IG+   Y   N   D   A+  ++ + +D+    GA          
Sbjct: 265 YEK-QLTGNIKDLVIGINEEYFFNNVDTDVEKAVRASIQSLVDQ----GAKVDVVRIPSL 319

Query: 247 XXARIAHLLTIGTELTTV-----AKRHKDKMHLFSCPTRSNINVMKLATASDYIVSQQVR 301
             A  A L+T  +E   +      KR +D    F    R    + +L +A DY+ +QQVR
Sbjct: 320 QYAEWAELVTSLSEAAAIHHSDLQKRPQD----FGDDIRLLFELGELPSAVDYLQAQQVR 375

Query: 302 TRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANFAGV 361
            +I +    +F N+VD++++P   + A  I           V +I +I+RF   +N  G+
Sbjct: 376 RQIKQEFTEIF-NKVDVLISPTLPVVASTIGDDFAVLNGKKVDLIDNIIRFTGPSNLTGL 434

Query: 362 PAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
           PA+SVP G+   NLPIGLQ I   + E  +L +    E+    R +KP+
Sbjct: 435 PALSVPCGF-KGNLPIGLQIIGPAFKEGRILNVGYAVEQANPQRTRKPN 482



>gi|499128854|ref|WP_010857652.1| glutamyl-tRNA(Gln) amidotransferase subunit A [Lysinibacillus
           sphaericus]
 gi|496194442|gb|EON73683.1| glutamyl-tRNA(Gln) amidotransferase subunit A [Lysinibacillus
           sphaericus OT4b.31]
          Length = 472

 Score =  199 bits (507), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 141/414 (34%), Positives = 210/414 (50%), Gaps = 21/414 (5%)

Query: 6   NNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAIILGKT 65
           N    G+  GIP+A+KD +  K   T + +K I+    +  DAT++E+LR+ G I  GK 
Sbjct: 66  NGQYRGMYHGIPMALKDNLYFKDKITTMSSK-IHKDFVSHYDATVVEKLRDAGVIFTGKL 124

Query: 66  SMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGSVRIP 125
           SMHE  +G TNNNP     RNP++ D  P                  ++G D  GS+RIP
Sbjct: 125 SMHEYAWGITNNNPHYGPVRNPWDLDKIPGGSSGGSGAAVAAGASVASLGTDTAGSIRIP 184

Query: 126 SSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDPNTLH 185
           SS CGI GLK T GR S  G YPLA S+   GPM  +V D A    +++G D +DP  + 
Sbjct: 185 SSACGIVGLKPTHGRVSKYGCYPLAWSLDHIGPMTKTVKDAAGMLEIISGFDHRDPTCVD 244

Query: 186 QPLPTLHGFHVTNKLSDLKIGV-----YSMWNKQVDNPAITTALNNFIDELKLRGAXXXX 240
            P    +   +T  + DL IGV     ++  +  VD  A+ T++ + +D+    GA    
Sbjct: 245 VPTDN-YVQQLTGNVKDLVIGVNEDYFFNRVDSDVDR-AVRTSIQSLVDQ----GARVEV 298

Query: 241 XXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHL---FSCPTRSNINVMKLATASDYIVS 297
                   A  A L+T  +E   +   H D +     F    R    + +L +A DY+ +
Sbjct: 299 VKIPSLQYAEWAELITSLSEAAAI--HHSDLLKRPQDFGDDIRLLFELGELPSAVDYLQA 356

Query: 298 QQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPR-ALAHGEVDVTMISDIMRFVQLA 356
           QQVR +I +    +F NQVD+++TP   + A  I    A  +GE  V +I +I+RF   +
Sbjct: 357 QQVRRQIKQEFTQIF-NQVDVMITPTLPVVASSIGDDFAELNGE-KVDLIDNIIRFTGPS 414

Query: 357 NFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
           N  G+PA+SVP G+   NLP+GLQ I   + E  +L +    E+    + +KP+
Sbjct: 415 NLTGLPALSVPCGF-KGNLPVGLQIIGPAFKEGRILNVGYAIEQTNPKKNRKPN 467



>gi|115386944|ref|XP_001210013.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gi|114191011|gb|EAU32711.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 597

 Score =  199 bits (507), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 138/424 (32%), Positives = 212/424 (50%), Gaps = 27/424 (6%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATI----IERLRE 56
           T+RY     LG+ DG+P AVK E DV GY+T++G+       P   D +I    + +L++
Sbjct: 165 TQRYQEKRPLGIFDGVPTAVKGEFDVDGYKTHLGSLNDYTPEPTEEDPSITNWCVRQLQD 224

Query: 57  KGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGR 116
            GAI+LGK SMHE G  +T NN    TP NPY+ DYY               L PIA+G 
Sbjct: 225 AGAIMLGKLSMHEFGLDTTGNNIHYGTPPNPYHPDYYTGGSSSGCAYAVSTGLVPIALGT 284

Query: 117 DGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGK 176
           DGGGSVRIP+S C + GLK T  R S       A + +V GP+AA +  LA AY ++A  
Sbjct: 285 DGGGSVRIPASLCSVAGLKPTHNRLSHYPGVNFASTTSVIGPLAADIRSLAEAYKLVAT- 343

Query: 177 DPKDPNTLHQPL-PTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLR 234
               P+TL  P  P +       K+    +GV  +W  + D P++     + +D+L  + 
Sbjct: 344 --PGPDTLFPPPGPIVLSPSAKGKI----LGVPEVWFSRAD-PSVQRLCRSLLDKLVTVY 396

Query: 235 GAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDY 294
                          + AH +TI   LT  +    D  ++ +   R  + + +   A DY
Sbjct: 397 DYTLVPIDIPFLVEGQTAHAMTI---LTDASAALTDTTNITAA-NRILLTLGRTTPAIDY 452

Query: 295 IVSQQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYPRA-LAHGEVDVTMISDIMRF 352
           +++Q++R  +M+ L+ L+ +   +I+ TP TA    ++  ++   +G  D       M +
Sbjct: 453 VLAQKLRQLLMQHLSALWKDFPGMIIVTPTTACAGWRVESKSEYKYGFSDGDKTIKCMEY 512

Query: 353 VQLANFAGVPAVSVPAGYDD-------NNLPIGLQFIAKWYDEATLLRIAKTSEEILGNR 405
           V LANF G+PA+SVPAGY +         +P+GL    +W  E  LL+     EE+  + 
Sbjct: 513 VWLANFTGIPAISVPAGYAEPQDEPGNGKVPVGLMGNGEWGSEEALLQWGLHVEEVGSDL 572

Query: 406 RKKP 409
           + +P
Sbjct: 573 QDRP 576



>gi|408400420|gb|EKJ79501.1| hypothetical protein FPSE_00320 [Fusarium pseudograminearum CS3096]
          Length = 591

 Score =  199 bits (506), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 142/435 (32%), Positives = 207/435 (47%), Gaps = 41/435 (9%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKF---INYGNPATSDATIIERLREK 57
           TERYA    LG+LDG+PI VKD+ DVKG+  ++G K+   I+        +  +++L+E 
Sbjct: 163 TERYAAGRPLGVLDGVPIGVKDDTDVKGFHNHIGMKYNPEIDTFKEQKESSWPVKKLQEA 222

Query: 58  GAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRD 117
           GA+++GK +MHE+G  ++  N    TP N +N  YYP              + PI++G D
Sbjct: 223 GAVVIGKNAMHELGSDTSGCNAAQGTPTNWHNKSYYPGGSSSGGSSAVSVGIVPISVGTD 282

Query: 118 GGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKD 177
            GGS+RIP +F G+YGLKTT  R        + +++ ++GP+AA+V DL +AY VM+   
Sbjct: 283 AGGSIRIPPTFNGVYGLKTTHNR-----SLYMNNTMCITGPLAANVADLTIAYRVMS--- 334

Query: 178 PKDPNTLHQPLPTLH-----GFHVTNKLSDLK-IGVYSMWNKQVDNPAITTALNNFIDEL 231
                   QP P  H        V       K IG+Y  W  + D P +       +D L
Sbjct: 335 --------QPNPDCHVQGRFALSVPPPKDQKKVIGIYRDWWNKAD-PRVQEVCERAVDYL 385

Query: 232 KLR-GAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRH----KDKMHLFSCPTRSNINVM 286
             + G             A++AH +   TE+   A+R      D + L     +  + V 
Sbjct: 386 TNKCGYELVDITIPYIPEAQLAHSVICITEMAESARRRTPNPADWLSLVGPANKVLMTVG 445

Query: 287 KLATASDYIVSQQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIYPRALAHGEVDVTM 345
               A+D +    +R  IM+ L  LF      LILTP + +    I P   A+G  D   
Sbjct: 446 TRTPAADLLKYSALRELIMQHLAFLFQKHPGLLILTPTSPMIGWPIVPGDEAYGMSDTNT 505

Query: 346 ISDIMRFVQLANFAGVPAVSVPAGYDD-----NNLPIGLQFIAKWYDEATLLRIAKTSEE 400
               M +V LAN  G P++S P GY D       LPIGL    +W  E  LL  A  +EE
Sbjct: 506 TIRNMLYVFLANLTGTPSLSAPVGYVDPDQGEGKLPIGLMATGEWGSEEQLLAWAGEAEE 565

Query: 401 ILGNR----RKKPSD 411
            L N     R++PS+
Sbjct: 566 YLHNATESGRRRPSE 580



>gi|477525535|gb|ENH77424.1| glutamyl-tRNA amidotransferase subunit a [Colletotrichum orbiculare
           MAFF 240422]
          Length = 608

 Score =  198 bits (504), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 145/425 (34%), Positives = 204/425 (48%), Gaps = 29/425 (6%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKF---INYGNPATSDATIIERLREK 57
           TER+     LG LDG+PI VKD+IDVKGY ++ G ++   + +  PA      I++L   
Sbjct: 176 TERWRRGEPLGPLDGVPIGVKDDIDVKGYVSHNGMQYRPDLPWFKPAEETWWPIKQLEAA 235

Query: 58  GAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRD 117
           GAI++GK +MHE+G  +   NP   TP N YN  YYP              + PI+IG D
Sbjct: 236 GAIVVGKNAMHELGGDTNGCNPRWGTPTNWYNKSYYPGGSSSGGGSALGAGIVPISIGTD 295

Query: 118 GGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKD 177
            GGSVRIPSSF G+YGLK +  R        +  SV V GP+AA+V DL LAY +M+  +
Sbjct: 296 AGGSVRIPSSFNGVYGLKPSHHRTCT-----MNSSVCVVGPLAATVTDLTLAYRLMSRPN 350

Query: 178 PKDPNTLHQPLPTLHGFHVTNKLSDLK-IGVYSMWNKQVDNPAITTALNNFIDELKLRGA 236
           P D      P+  ++   V    S  K I +   W  + +NP +       +D  K  G 
Sbjct: 351 PDD------PIQGVYTPSVPPPSSARKIIAIDESWWSRAENP-VANVCRRAVDHFKTLGY 403

Query: 237 XXXXXXXXXXXXARIAHLLTIGTELTTVA-KRHKDKMHLFSCPTRSNINVMKLAT---AS 292
                        ++ H  +  TE+   A +R  D  +  S     N   M + T   A+
Sbjct: 404 EVINVKLPFLREIQLMHSASCITEMQDNAHQRTPDPNNWQSIINHVNAITMSVGTQTPAA 463

Query: 293 DYIVSQQVRTRIMRTLNNLFSNQVDLI-LTPATAITAPKIYPRALAHGEVDVTMISDIMR 351
           D +   Q+R  +M+ L +LF     L+ +TP T +      P   A+G  D       M 
Sbjct: 464 DLLKYAQLRDVLMKHLAHLFEQYPGLLFVTPTTPLPGWVRNPADEAYGVSDANRTIANMG 523

Query: 352 FVQLANFAGVPAVSVPAGYDD-----NNLPIGLQFIAKWYDEATLLRIAKTSEEIL---G 403
           +V +AN +G PAVS P GY D       +PIGL  + +W  E  LL  AK +E  L   G
Sbjct: 524 YVYIANVSGCPAVSAPVGYADPVEGRGKIPIGLMAMGEWGCEEQLLGWAKEAETYLHKEG 583

Query: 404 NRRKK 408
            RR +
Sbjct: 584 RRRPE 588



>gi|408393759|gb|EKJ73018.1| hypothetical protein FPSE_06806 [Fusarium pseudograminearum CS3096]
          Length = 614

 Score =  198 bits (504), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 138/437 (31%), Positives = 214/437 (48%), Gaps = 44/437 (10%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGN-PA---TSDATIIERLRE 56
           TERY N   LG LDG+P A+KD+ D+ GY T +G+   +Y   PA   +S + I+ +L E
Sbjct: 176 TERYKNKQPLGPLDGVPSAIKDDYDLDGYSTTLGS-LKDYAEIPAEGQSSTSWIVRKLEE 234

Query: 57  KGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGR 116
            G +ILGK +MHE G  +T NNP   TP NP+N  YY               L P+A+G 
Sbjct: 235 AGVVILGKLAMHEFGLDTTGNNPNQGTPLNPFNPKYYTGGSSSGPAYAVSAGLVPLALGS 294

Query: 117 DGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAH---SVAVSGPMAASVDDLALAYYVM 173
           DGGGS+RIP SFC ++GLK T  R +    +P A+   + AV GP+A  +  L  AY  +
Sbjct: 295 DGGGSIRIPGSFCSVFGLKPTHNRLAS---WPGANHSPTCAVQGPLAGDMQSLVAAYEAI 351

Query: 174 AGKDPKDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKL 233
           A  +P  P+T   PL       VT  L     G++  W  +   P + + +   ++ L  
Sbjct: 352 A--EPH-PSTQFPPLALQPSPPVTKVL-----GIFDAWISRA-QPGVQSLVRGLVESLAA 402

Query: 234 R-GAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATAS 292
           + G              ++AH LT+ T+ +T+           +   +  I++ +   ++
Sbjct: 403 KHGYTLVPIDIPFPAEGQMAHALTVLTDASTLLPDTTG----ITAANKILISLGRTTPST 458

Query: 293 DYIVSQQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIY--PRALAHGEVDVTMISDI 349
           DY+++Q++R  +M+ L +L+      +I+TP TA     I      +++G  D       
Sbjct: 459 DYLLAQKLRGMLMKHLAHLWKTYPGMMIITPTTACAGAPIRGGKFEMSYGVNDGNYTLQS 518

Query: 350 MRFVQLANFAGVPAVSVPAGYD----------------DNNLPIGLQFIAKWYDEATLLR 393
           M +V LANF G+PA++VPAGY                 +  +P+GL    +W  E  LL+
Sbjct: 519 MEYVWLANFCGLPAITVPAGYVIPEGSKDAGEVAEKDIEGKIPVGLMATGEWCSEDALLQ 578

Query: 394 IAKTSEEILGNRRKKPS 410
               +E    N R KP+
Sbjct: 579 FGFDAEAAGQNIRCKPA 595



>gi|169826340|ref|YP_001696498.1| glutamyl-tRNA(Gln) amidotransferase subunit A [Lysinibacillus
           sphaericus C3-41]
 gi|501249500|ref|WP_012292518.1| glutamyl-tRNA amidotransferase subunit A [Lysinibacillus
           sphaericus]
 gi|168990828|gb|ACA38368.1| Glutamyl-tRNA(Gln) amidotransferase subunit A [Lysinibacillus
           sphaericus C3-41]
          Length = 475

 Score =  198 bits (503), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 138/405 (34%), Positives = 201/405 (49%), Gaps = 13/405 (3%)

Query: 11  GLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAIILGKTSMHEI 70
           G+  GIP+A+KD +  K   T + +K I+    +  DAT++E+LR+ G I  GK SMHE 
Sbjct: 74  GMYHGIPMALKDNLYFKDKITTMSSK-IHKDFVSNYDATVVEKLRDAGVIFTGKLSMHEY 132

Query: 71  GFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGSVRIPSSFCG 130
            +G TNNNP     RNP++ D  P                  ++G D  GS+RIPSS CG
Sbjct: 133 AWGITNNNPHYGPVRNPWDLDKIPGGSSGGSGAAVAAGASVASLGTDTAGSIRIPSSACG 192

Query: 131 IYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDPNTLHQPLPT 190
           I GLK T GR S  G YPLA S+   GPM  +V D A    V++G D +DP  +  P   
Sbjct: 193 IVGLKPTHGRVSKYGCYPLAWSLDHIGPMTKTVKDAAGLLEVISGFDHRDPTCIDVPTDN 252

Query: 191 LHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXXXXXXXXXXXXAR 250
            +   ++    DL IG+   +  +  +  I  A+   I  L  +GA            A 
Sbjct: 253 -YVQQLSGNSKDLVIGINEEYFFKDVDADIEKAVRASIQSLVDQGAKVEGVRIPSLQYAE 311

Query: 251 IAHLLTIGTELTTV-----AKRHKDKMHLFSCPTRSNINVMKLATASDYIVSQQVRTRIM 305
            A L+T  +E   +      KR +D    F    R    + +L +A DY+ +QQVR +I 
Sbjct: 312 WAELVTSLSEAAAIHHSDLQKRPQD----FGDDIRLLFELGELPSAVDYLQAQQVRRQIK 367

Query: 306 RTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANFAGVPAVS 365
           +  N +F NQVD+++TP   + A  I           V +I +I+RF   +N  G+PA+S
Sbjct: 368 QEFNEIF-NQVDVLITPTLPVVANTIGDDFAELNGKKVDLIDNIIRFTGPSNLTGLPALS 426

Query: 366 VPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
           VP G+   NLPIGLQ I   + E  +L +    E+    + +KP+
Sbjct: 427 VPCGF-KGNLPIGLQIIGPAFKEGRILNVGYAIEQTNPLKNRKPN 470



>gi|46107650|ref|XP_380884.1| hypothetical protein FG00708.1 [Fusarium graminearum PH-1]
          Length = 588

 Score =  197 bits (502), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 143/435 (32%), Positives = 206/435 (47%), Gaps = 41/435 (9%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKF---INYGNPATSDATIIERLREK 57
           TERY     LG+LDG+PI VKD+ DVKG+  ++G K+   I         +  +++L+E 
Sbjct: 160 TERYTAGKPLGVLDGVPIGVKDDTDVKGFHNHIGMKYNPEIETFKEQKESSWPVKKLQEA 219

Query: 58  GAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRD 117
           GA+++GK +MHE+G  ++  N    TP N +N  YYP              + PI++G D
Sbjct: 220 GAVVIGKNAMHELGSDTSGCNAAQGTPTNWHNKSYYPGGSSSGGSSAVSAGIVPISVGTD 279

Query: 118 GGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKD 177
            GGS+RIP +F G+YGLKTT  R      Y + +++ ++GP+AA+V DL +AY VM+   
Sbjct: 280 AGGSIRIPPTFNGVYGLKTTHNR----ALY-MNNTMCITGPLAANVADLTIAYRVMS--- 331

Query: 178 PKDPNTLHQPLPTLH-----GFHVTNKLSDLK-IGVYSMWNKQVDNPAITTALNNFIDEL 231
                   QP P  H        V       K IG+Y  W  + D P +       +D L
Sbjct: 332 --------QPNPDCHVQGRFALSVPPPKDQKKVIGIYRDWWNKAD-PRVQKVCERAVDYL 382

Query: 232 -KLRGAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRH----KDKMHLFSCPTRSNINVM 286
            K  G             A++AH +   TE+   A+R      D + L     +  + V 
Sbjct: 383 TKKCGYELIDITIPYIPEAQLAHSVICITEMAESARRRTPNPADWLSLVGPANKVLMTVG 442

Query: 287 KLATASDYIVSQQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIYPRALAHGEVDVTM 345
               A+D +    +R  IM+ L  LF      LILTP + +    I P   A+G  D   
Sbjct: 443 TRTPAADLLKYSALRELIMQHLAFLFQKHPGLLILTPTSPMIGWPIVPGDEAYGMSDTNT 502

Query: 346 ISDIMRFVQLANFAGVPAVSVPAGYDD-----NNLPIGLQFIAKWYDEATLLRIAKTSEE 400
               M +V LAN  G P++S P GY D       LPIGL    +W  E  LL  A  +EE
Sbjct: 503 TIRNMLYVFLANLTGTPSLSAPVGYVDPDQGEGKLPIGLMATGEWGSEEHLLAWAGEAEE 562

Query: 401 ILGNR----RKKPSD 411
            L N     R++PS+
Sbjct: 563 YLHNATESGRRRPSE 577



>gi|497929919|ref|WP_010244075.1| amidase [Pseudonocardia sp. P1]
          Length = 485

 Score =  197 bits (501), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 129/395 (32%), Positives = 198/395 (50%), Gaps = 19/395 (4%)

Query: 10  LGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAIILGKTSMHE 69
           +G L G+P+A+KD + V+   T  G+  +    PA  DAT+  RLR  GAII+GKT+MHE
Sbjct: 79  IGPLHGVPVALKDNVSVRDKPTTAGSAILADHRPA-EDATVTRRLRSAGAIIVGKTNMHE 137

Query: 70  IGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGSVRIPSSFC 129
             +G T+ NP      NP++T   P               C  A+G D GGS+R+P++  
Sbjct: 138 FAWGGTSANPHYGFVTNPWDTGRMPGGSSGGSGVAVATRACFGALGTDTGGSIRLPAALN 197

Query: 130 GIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDPNTLHQPLP 189
           GI GL+ T GR S+ G  PLA S+   GPMA +  D A+ +  +AG DP D  +  +   
Sbjct: 198 GITGLRPTIGRVSNAGVIPLAWSMDTVGPMARTAADCAVMFTALAGHDPADAGSADRAGE 257

Query: 190 TLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXXXXXXXXXXXXA 249
             +   +   L  L++G+   ++     PA+  AL   +D L   GA             
Sbjct: 258 D-YSRDLGAGLDGLRVGIIEGYSLHHVQPAVDKALRAALDVLVAGGARTSEVSIADIEGN 316

Query: 250 RIAHLLTIGTELTTVAKRH-KDKMHLFSCPTRSNINVMKLATASDYIVSQQVRTRIMRTL 308
             A L     E +T  +R  +++   +    R  +   ++  A+ Y+ +Q+ RT ++R+ 
Sbjct: 317 ISAQLTVEACEPSTYHQRWLRERPDDYGDDVRLLLEAGEMLPATQYLQAQRYRT-LLRSQ 375

Query: 309 NNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVT--------MISDIMRFVQLANFAG 360
                ++VDL++ P    TA  +       GEV V         M+S IM+F  L +  G
Sbjct: 376 TLAALSRVDLLVCPTLPFTATPL-------GEVTVEIDPGRAEDMLSAIMQFTGLPSLTG 428

Query: 361 VPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIA 395
           +PA+SVP G+DD  LPIG+Q I + + E+TLLR A
Sbjct: 429 LPAISVPCGFDDAGLPIGMQLIGRPFAESTLLRAA 463



>gi|497451738|ref|WP_009765936.1| glutamyl-tRNA amidotransferase subunit A [Sporosarcina
           newyorkensis]
 gi|339622406|gb|EGQ26927.1| glutamyl-tRNA(Gln) amidotransferase subunit A [Sporosarcina
           newyorkensis 2681]
          Length = 475

 Score =  197 bits (500), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 134/404 (33%), Positives = 200/404 (49%), Gaps = 11/404 (2%)

Query: 11  GLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAIILGKTSMHEI 70
           G+  GIP+A+KD +  K   T + +K      P   DAT++ +LR+ G I  GK SMHE 
Sbjct: 74  GMYHGIPMALKDNLYFKNKVTTMSSKIHKDFVP-DDDATVVSKLRDAGVIFTGKLSMHEY 132

Query: 71  GFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGSVRIPSSFCG 130
            +G TNNNP     RNP++TD  P                  ++G D  GS+RIPSS CG
Sbjct: 133 AWGITNNNPHYGAVRNPWDTDKIPGGSSGGSGAAVAVGSSVASLGTDTAGSIRIPSSICG 192

Query: 131 IYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDPNTLHQPLPT 190
           I GLK T GR S  G YPLA ++   GPM  ++ D A    +++G D KDP +++ P+  
Sbjct: 193 IVGLKPTHGRVSKYGCYPLAWTLDHIGPMTKTIKDAAGMMDIISGYDQKDPTSVNTPVDQ 252

Query: 191 LHGFHVTNKLSDLKIGV-YSMWNKQVDNPAITTALNNFIDELKLRGAXXXXXXXXXXXXA 249
            H   +   + DL IGV    + KQVDN        N I  L  +GA            A
Sbjct: 253 -HLQKIQGNVKDLVIGVNEEYFFKQVDNEVDQIVRKN-IQALVDQGAKVEIVNIPSLQYA 310

Query: 250 RIAHLLTIGTELTTVAKRHKDKMHL---FSCPTRSNINVMKLATASDYIVSQQVRTRIMR 306
             A L+T  +E + +   H+D +     F    R    + +L +A DY+ +QQVR ++ +
Sbjct: 311 EWAELVTSLSEASAI--HHEDMLKRPQDFGDDIRMLFELGELPSAVDYLQAQQVRRQLKQ 368

Query: 307 TLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANFAGVPAVSV 366
                F  +VD+++ P   + A  I    +      V +I +I+RF   +N  G+PA+S+
Sbjct: 369 EFQQAF-QKVDVMIAPTLPVVAGTIGDDTVDLNGQQVDLIDNIIRFTGPSNLTGLPALSI 427

Query: 367 PAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPS 410
           P G    NLP+G+Q I   + EA +L +    E+    + +KP 
Sbjct: 428 PGGL-KGNLPVGVQIIGPAFAEARILDVGYAIEQTNPMKDRKPE 470



>gi|25026579|ref|NP_736633.1| glutamyl-tRNA(Gln) amidotransferase subunit A [Corynebacterium
           efficiens YS-314]
 gi|493821158|ref|WP_006768668.1| glutamyl-tRNA amidotransferase subunit A [Corynebacterium
           efficiens]
 gi|23491858|dbj|BAC16833.1| putative glutamyl-tRNA(Gln) amidotransferase subunit A
           [Corynebacterium efficiens YS-314]
 gi|259164104|gb|EEW48658.1| Amidase [Corynebacterium efficiens YS-314]
          Length = 474

 Score =  197 bits (500), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 132/392 (33%), Positives = 203/392 (51%), Gaps = 9/392 (2%)

Query: 11  GLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAIILGKTSMHEI 70
           G L GIP+A+KD I V G  T + +K I+    +  DA+++++LRE G ++ GK +MHE 
Sbjct: 71  GPLHGIPMAIKDNIYVGGEVTTMASK-IHGEFVSQDDASVVKKLREAGVVLTGKLNMHEY 129

Query: 71  GFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGSVRIPSSFCG 130
            +G  NN+P   + +NP+NTD  P                   +G D  GS+RIPS+ CG
Sbjct: 130 AWGIDNNSPHFGSVQNPWNTDKVPGGSSGGSGAAVASDASFTTLGTDTAGSIRIPSAACG 189

Query: 131 IYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDPNTLHQPLPT 190
           + GLK T GR +  G +PLA S+   GPM+ SV D A     +AG D +DP  +  P+P 
Sbjct: 190 LVGLKPTHGRVAKYGCFPLAWSLDHIGPMSKSVADAAATLRAIAGFDHRDPTAVDVPVPD 249

Query: 191 LHGFHVTNKLSDLKIGVYS-MWNKQVDNPAITTALNNFIDELKLRGAXXXXXXXXXXXXA 249
            +   +     DL IGV    + + VD+P I  A+   I++L  +GA            +
Sbjct: 250 -YSADLGGDARDLVIGVEEDYFFRDVDSP-IEQAVRKQIEDLVSQGATLKTVSIPSLAIS 307

Query: 250 RIAHLLTIGTELTTVAKRH-KDKMHLFSCPTRSNINVMKLATASDYIVSQQVRTRIMRTL 308
               L T  +E + +  R  + +   F    R    + +L +  DY+ +QQ R +I +  
Sbjct: 308 EWTELATSLSEASAIHHRDLQTRPDDFGADIRFLFELGELFSGVDYLQAQQARRQIKQEF 367

Query: 309 NNLFSNQVDLILTPATAITAPKI-YPRALAHGEVDVTMISDIMRFVQLANFAGVPAVSVP 367
                + VD+I+ P   + AP I  P A  +G+ DV +I + +RF   +N  G+PA++VP
Sbjct: 368 TAALRD-VDVIIAPTLPVMAPDIGSPTAKLNGQ-DVDLIDNFIRFTGPSNLTGLPAMTVP 425

Query: 368 AGYDDNNLPIGLQFIAKWYDEATLLRIAKTSE 399
            G  D  LPIGLQ I + +DEA +L++    E
Sbjct: 426 VGLTD-GLPIGLQIIGRAFDEARVLKVGSIIE 456



>gi|171682542|ref|XP_001906214.1| hypothetical protein [Podospora anserina S mat+]
 gi|170941230|emb|CAP66880.1| unnamed protein product [Podospora anserina S mat+]
          Length = 601

 Score =  197 bits (500), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 138/406 (33%), Positives = 202/406 (49%), Gaps = 28/406 (6%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDAT--IIERLREKG 58
           T RY    SLG LDG+P AVKDE D++GY T +G+  + Y + +T+  T   ++++   G
Sbjct: 172 TLRYKEGRSLGPLDGVPTAVKDEYDMEGYSTTLGSPNV-YADSSTNKTTSWCVQQIEAAG 230

Query: 59  AIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDG 118
           A+ILGK SMHE G  +T NNP   TPRNP+N++YY               L PI +G DG
Sbjct: 231 ALILGKLSMHEFGLDTTGNNPHYGTPRNPHNSNYYTGGSSSGTAYAVAAGLIPIGLGSDG 290

Query: 119 GGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVM----- 173
           GGS+RIPSS CGIYGLK T GR S         + A  GP+AA +  LA  + V+     
Sbjct: 291 GGSIRIPSSLCGIYGLKPTHGRLSFRPGPNHCVTCACLGPIAADMSSLAALFSVISTPHS 350

Query: 174 AGKDPKDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKL 233
           +   P  P+ L   LPT     V        +G+   W  Q   PAI T +N  I  L  
Sbjct: 351 SSPFPPLPSPLKIQLPTPDDAKV--------LGIPQAWISQA-TPAIQTLVNTLIRTLVS 401

Query: 234 R-GAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATAS 292
           + G              +IAH +T+ T+  T+   +K+     +   R  + + +   A+
Sbjct: 402 KHGYTTVPVTIPFLQEGQIAHAMTVLTDAATLLPEYKN----LTYANRILLALGRTTPAT 457

Query: 293 DYIVSQQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIY--PRALAHGEVDVTMISDI 349
           DY+++Q++R  +M+ L  L+     +I+ TP TA    +I      L +G  D       
Sbjct: 458 DYMLAQKLRRLLMQHLAWLWEQHPGMIIVTPTTACEGWEIRGGTGELRYGLNDGDRTMQS 517

Query: 350 MRFVQLANFAGVPAVSVPAGY---DDNNLPIGLQFIAKWYDEATLL 392
           M FV L NF G+P++S P G+       +P+G+    +W  E  L+
Sbjct: 518 MEFVWLGNFCGLPSLSCPVGFVQGKGGEVPVGVMATGEWCSERELM 563



>gi|497779350|ref|WP_010093534.1| glutamyl-tRNA amidotransferase subunit A [Ornithinibacillus
           scapharcae]
          Length = 463

 Score =  196 bits (498), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 131/391 (33%), Positives = 190/391 (48%), Gaps = 10/391 (2%)

Query: 11  GLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAIILGKTSMHEI 70
           G L GIPI +KD    KG  T  G+K      P   +AT +++L   G+I+LGK +MHE+
Sbjct: 70  GPLHGIPIGIKDNYATKGIRTTDGSKLFANFIPE-QNATTVKKLLGAGSIMLGKQNMHEL 128

Query: 71  GFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGSVRIPSSFCG 130
             GST  NP+  T RNP+N  Y P              L  +  G D  GS+R+P++ CG
Sbjct: 129 AAGSTGTNPYYGTTRNPWNIRYMPGGSSSGGAASLAAGLAVLTTGSDTFGSIRLPAAMCG 188

Query: 131 IYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDPNTLHQPLPT 190
           +YGLK T G  S  G  P A S+  +GPMA SV DLAL    MAG D KDP +L   +P 
Sbjct: 189 VYGLKPTYGLISTFGVIPTAWSLDTAGPMARSVSDLALMLQYMAGFDGKDPASLDVRIPN 248

Query: 191 -LHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXXXXXXXXXXXXA 249
            +   H    ++ +KIG+ + + + +D P +       I  L+  GA            A
Sbjct: 249 YMKNLH--KGMNGVKIGIPTYYLRGLD-PDVDKLFQQAIHTLRRLGAEIKEMEIPELEMA 305

Query: 250 RIAHLLTIGTELTTVAKRH-KDKMHLFSCPTRSNINVMKLATASDYIVSQQVRTRIMRTL 308
             A    +  E +T      K+    +S   RS      L  A  Y+ +QQ R ++++ L
Sbjct: 306 TYAGYAIVTGEASTFHYEWLKEYSEDYSVDIRSFFLSGALTAAPQYVRAQQARRKMVKAL 365

Query: 309 NNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANFAGVPAVSVPA 368
              FS+ VD++L P   +T P      +   E ++ ++   M F    N  G+P++SVP 
Sbjct: 366 KQAFSD-VDILLGPTVPMTTPAYREDWI---EQNLEVVRKSMPFTAPINLTGIPSLSVPM 421

Query: 369 GYDDNNLPIGLQFIAKWYDEATLLRIAKTSE 399
           G D   LP+G+QF+     EA L +I K  E
Sbjct: 422 GLDQRGLPVGMQFMGNHLSEALLFQIGKAWE 452



>gi|345571108|gb|EGX53923.1| hypothetical protein AOL_s00004g582 [Arthrobotrys oligospora ATCC
           24927]
          Length = 579

 Score =  196 bits (498), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 133/416 (31%), Positives = 209/416 (50%), Gaps = 12/416 (2%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGT-KFINYGNPATSDATIIERLREKGA 59
           ++RYA  ++LG LDG+P  VKDE+ + GY T  G+ +  + G  +TS    +++L + GA
Sbjct: 164 SKRYATGATLGPLDGVPFVVKDEVYMHGYLTQCGSARVFDKGEGSTS--WCVKKLEDAGA 221

Query: 60  IILGKTSMHEIGFGSTNNNPFVC-TPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDG 118
           I++ K SMHE+G  +TN NP    TPRNPYN  +Y               + PIA+G DG
Sbjct: 222 IMIAKVSMHEVGSDTTNCNPVRGKTPRNPYNRKFYTGGSSGGSAYCVSAGIVPIAVGCDG 281

Query: 119 GGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDP 178
           GGS+RIPS++CGIYGLK + GR S      L     V+GPM  +++DL + Y +MA  DP
Sbjct: 282 GGSIRIPSNYCGIYGLKPSAGRVSISPTPNLTPGNGVTGPMCGTIEDLKIVYRIMAVPDP 341

Query: 179 KDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRG-AX 237
            +  +   P+       +T +   L IGVY  W     +P +   +   ++ L+ +G   
Sbjct: 342 GEATSSSFPVHRNPLAPLTAQKKKL-IGVYKKWFDDC-SPQVHKIVWPAVEALEKQGYEI 399

Query: 238 XXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYIVS 297
                      AR AH L+I   +T +A      +   + P R   +V     A D + +
Sbjct: 400 FYIPSIPYLSIARRAHGLSI---ITDMAASLNGDVTGLTAPNRVLFSVAAQTPAIDLLAA 456

Query: 298 QQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLA 356
            +VR  ++    +++     +I+ TP       +I    L +G  D       M++V + 
Sbjct: 457 NRVRAMMVSHFASVWQKHPGMIIVTPVVPDVGAEINEGHLKYGVSDGDSSIRSMKYVSVG 516

Query: 357 NFAGVPAVSVPAGYDDN-NLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKPSD 411
           NF G PA +   GYDD+ +LP+ L  +A+W  E  LL  +    +  G  RK+P++
Sbjct: 517 NFIGAPATNSIVGYDDDTSLPVSLMGLAEWGKEEDLLGWSAEVAQATGLVRKRPAN 572



>gi|331699686|ref|YP_004335925.1| amidase [Pseudonocardia dioxanivorans CB1190]
 gi|503443309|ref|WP_013677970.1| amidase [Pseudonocardia dioxanivorans]
 gi|326954375|gb|AEA28072.1| Amidase [Pseudonocardia dioxanivorans CB1190]
          Length = 474

 Score =  196 bits (497), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 136/404 (33%), Positives = 196/404 (48%), Gaps = 27/404 (6%)

Query: 5   ANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAIILGK 64
           A    LG L G+PIA+KD I V+G  T  G+K +   +P  +DAT+ ERLR  GAII+GK
Sbjct: 65  AAGHRLGPLHGVPIALKDNISVRGRRTTAGSKVLADHHP-EADATVTERLRSAGAIIIGK 123

Query: 65  TSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGSVRI 124
           T++HE  +G T+ NP      NP++T   P               C  A+G D GGS+R+
Sbjct: 124 TNLHEFAWGGTSANPHYGFVTNPWDTSRMPGGSSGGSGVAVATRSCFGALGTDTGGSIRL 183

Query: 125 PSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDPNTL 184
           PS+  G+ GL+ T GR S+ G  PLA S+   GPMA +  D A+ + V+AG DP D  + 
Sbjct: 184 PSALNGVTGLRPTIGRVSNAGVVPLAWSMDTVGPMARTAADCAVMFGVLAGHDPADAGSA 243

Query: 185 HQPLPTLHGFHVTNKL----SDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXXXX 240
            +      G   T  L      L+IG+   ++       +  A+   +  L   GA    
Sbjct: 244 DR-----SGEDYTRDLDLGVDGLRIGLIEGYSLHHVQAPVEKAVRGALSRLDDAGARVVD 298

Query: 241 XXXXXXXXARIAHLLTIGTELTTVAKRH-KDKMHLFSCPTRSNINVMKLATASDYIVSQQ 299
                      A L     E +T  +R  +++   +    R  +   +L  A+ Y+ +Q+
Sbjct: 299 VVVDDIEGNISAQLTVEAAEPSTYHQRWLRERPDDYGDDVRLLLEAGELLLATQYLQAQR 358

Query: 300 VRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVT--------MISDIMR 351
            R         L   Q    L  A  +  P +   A A GEV+V         M+S IM+
Sbjct: 359 YRA--------LLRRQTLAALARADVLACPTLPFTATALGEVEVEIDEGVREDMLSAIMQ 410

Query: 352 FVQLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIA 395
           F  L +  G+PA+SVP G+DD  LPIG+Q I K + EATLLR+A
Sbjct: 411 FTGLPSLTGLPAISVPCGFDDAGLPIGVQLIGKPFAEATLLRVA 454



>gi|384483241|gb|EIE75421.1| hypothetical protein RO3G_00125 [Rhizopus delemar RA 99-880]
          Length = 459

 Score =  196 bits (497), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 103/237 (43%), Positives = 139/237 (58%), Gaps = 1/237 (0%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T RY + + L  LDG+ +AVK+E+D++G ET  GT FIN G PA  D+TI+ +L++ GAI
Sbjct: 142 TLRYKSKNPLSQLDGVFVAVKEEVDIQGLETKSGTSFINDGKPALQDSTIVAKLKKAGAI 201

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXX-LCPIAIGRDGG 119
           ++G T M+E+G+ +   NP    P+NPY    +                L P  IG DGG
Sbjct: 202 VVGSTVMNELGWDTFTVNPNTGVPKNPYKKVLHSCGGSSGGCSGSVAAGLFPFTIGADGG 261

Query: 120 GSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPK 179
           GS+RIPS+FCG+YGLKTT GR S  G   L  S+   GP+AA+ DD+ +AY  +AG DPK
Sbjct: 262 GSIRIPSAFCGLYGLKTTWGRVSAYGGATLDPSLGSYGPIAATADDMTIAYSAIAGPDPK 321

Query: 180 DPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGA 236
           DP TL QP  +L  +   + LSDL I +   WNK  +  AI    +     LK  GA
Sbjct: 322 DPYTLQQPSVSLADYEKCSDLSDLTIAIVPEWNKLSNEVAILEKFDQVQTYLKQLGA 378



>gi|320593057|gb|EFX05466.1| amidotransferase [Grosmannia clavigera kw1407]
          Length = 626

 Score =  195 bits (496), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 143/446 (32%), Positives = 208/446 (46%), Gaps = 40/446 (8%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDAT----IIERLRE 56
           T RY    SLG LDG+P AVKDE D++GY + +G+   +Y      D T     + +L E
Sbjct: 176 TLRYRKKQSLGPLDGVPTAVKDEYDMEGYMSCLGS-VNDYTGSFLEDGTYTTWCVRKLEE 234

Query: 57  KGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGR 116
            G IILGK  M E G  +  NN    TP NPYN  YY               L P A+G 
Sbjct: 235 AGCIILGKLHMVEFGLDTPGNNINHGTPPNPYNERYYTGGSSSGAGYAVASGLIPFALGS 294

Query: 117 DGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGK 176
           DGGGSVRIP+SFC +YGLK T GR S         + A  GP+AA V  LA AY V+   
Sbjct: 295 DGGGSVRIPASFCSVYGLKPTHGRISFKPGQNHCITCACLGPLAADVRTLATAYSVIGQP 354

Query: 177 DPKDPNT--------LHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFI 228
            P             L +  PTL           + +G+ ++W  Q   PA+    N FI
Sbjct: 355 HPTSAFPPVPPPSVLLDRQRPTLPSSLSAPSSPRV-LGIPNVWIAQA-VPAVQELCNTFI 412

Query: 229 DEL-KLRGAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMK 287
           + L +  G              + AH LT+ T+  T+   + +     +  TR  +++ +
Sbjct: 413 ESLVRDHGYTTVPIEIPLLVEGQNAHALTVLTDAATLLPEYGN----LTPTTRILLSLGR 468

Query: 288 LATASDYIVSQQVRTRIMRTLNNLFSNQVDL-ILTPATAITA-PKIYPRALAHGEVDVTM 345
              A+DY+++Q++R  +++ L+ L+     + I+TP T+    P   P   ++G  D   
Sbjct: 469 TTPATDYLLAQKLRRALVQHLSYLWHKHPGMIIMTPTTSCAGWPVRSPSEYSYGVSDGDT 528

Query: 346 ISDIMRFVQLANFAGVPAVSVPAGY----------------DDNNLPIGLQFIAKWYDEA 389
               M +V LANF G+P++S+PAGY                    +P+G+    +W  EA
Sbjct: 529 TIRSMEYVWLANFCGLPSISIPAGYVVPEGQPGAGNIAGANVSGKVPVGIMATGEWATEA 588

Query: 390 TLLRIAKTSEEILGNRRKKPSDKFWF 415
            LLR    +E +   RR +PS   W+
Sbjct: 589 DLLRFGMDAESVSAERRARPS--IWY 612



>gi|477508232|gb|ENH61526.1| Glutamyl-tRNA(Gln) amidotransferase subunit A [Fusarium oxysporum
           f. sp. cubense race 1]
          Length = 592

 Score =  195 bits (496), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 142/445 (31%), Positives = 211/445 (47%), Gaps = 41/445 (9%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKF---INYGNPATSDATIIERLREK 57
           TERYA    LG+LDG+PI VKD+ DVKG+  ++G K+   I         +  +++L+E 
Sbjct: 163 TERYAAGKPLGVLDGVPIGVKDDTDVKGFHNHIGMKYDPSIETFKEQKESSWPVKKLQEA 222

Query: 58  GAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRD 117
           GA+++GK +MHE+G  ++  N    TP N  N  YYP              + PIA+G D
Sbjct: 223 GAVVIGKNAMHELGSDTSGCNAAQGTPTNWLNKSYYPGGSSSGGSSTVSAGVVPIAVGTD 282

Query: 118 GGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKD 177
            GGS+RIP +F G+YGLKTT  R        + +++ ++GP+AA+V DL +AY VM+   
Sbjct: 283 AGGSIRIPPTFNGVYGLKTTHNR-----TMFMNNTMCITGPIAATVADLTIAYRVMS--- 334

Query: 178 PKDPNTLHQPLPTLH---GFHVTN---KLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL 231
                   QP P  H    F  ++   K     +G+Y  W  + D P +    +  +D L
Sbjct: 335 --------QPNPDCHIQSRFARSDPPPKGQKKVMGIYRDWWNKAD-PRVKEVCDRAVDYL 385

Query: 232 KLR-GAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRH----KDKMHLFSCPTRSNINVM 286
             + G             A++AH +   TE+   A+R      D + L     +  ++V 
Sbjct: 386 ANKCGYEIIDITIPYIPEAQLAHSVVCITEMAESARRRTPNPADWLSLVGPANKVVMSVG 445

Query: 287 KLATASDYIVSQQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIYPRALAHGEVDVTM 345
               A+D +    +R  IM+ L  LF      LI+TP + +    I P   A+G  D   
Sbjct: 446 TRTPAADMLKYGALRELIMQHLAYLFQKHPGLLIMTPTSPLIGWPIVPGDQAYGMSDTNT 505

Query: 346 ISDIMRFVQLANFAGVPAVSVPAGYDD-----NNLPIGLQFIAKWYDEATLLRIAKTSEE 400
               M +V LAN  G PAVS P GY D       L IGL    +W  E  LL  A  +EE
Sbjct: 506 TIRNMLYVFLANLTGTPAVSAPVGYVDPDHGEGKLSIGLMATGEWGSEEQLLAWATEAEE 565

Query: 401 ILGNR----RKKPSDKFWFGNYVQE 421
            L N     R++P +     + V++
Sbjct: 566 YLHNATESGRRRPDEWLDVADLVKQ 590



>gi|475663559|gb|EMT61354.1| Glutamyl-tRNA(Gln) amidotransferase subunit A [Fusarium oxysporum
           f. sp. cubense race 4]
          Length = 592

 Score =  195 bits (495), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 142/445 (31%), Positives = 211/445 (47%), Gaps = 41/445 (9%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKF---INYGNPATSDATIIERLREK 57
           TERYA    LG+LDG+PI VKD+ DVKG+  ++G K+   I         +  +++L+E 
Sbjct: 163 TERYAAGKPLGVLDGVPIGVKDDTDVKGFHNHIGMKYDPSIETFKEQKESSWPVKKLQEA 222

Query: 58  GAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRD 117
           GA+++GK +MHE+G  ++  N    TP N  N  YYP              + PIA+G D
Sbjct: 223 GAVVIGKNAMHELGSDTSGCNAAQGTPTNWLNKSYYPGGSSSGGSSTVSAGVVPIAVGTD 282

Query: 118 GGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKD 177
            GGS+RIP +F G+YGLKTT  R        + +++ ++GP+AA+V DL +AY VM+   
Sbjct: 283 AGGSIRIPPTFNGVYGLKTTHNR-----TMFMNNTMCITGPIAATVADLTIAYRVMS--- 334

Query: 178 PKDPNTLHQPLPTLH---GFHVTN---KLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL 231
                   QP P  H    F  ++   K     +G+Y  W  + D P +    +  +D L
Sbjct: 335 --------QPNPDCHIQSRFARSDPPPKGQKKVMGIYRDWWNKAD-PRVKEVCDRAVDYL 385

Query: 232 KLR-GAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRH----KDKMHLFSCPTRSNINVM 286
             + G             A++AH +   TE+   A+R      D + L     +  ++V 
Sbjct: 386 VNKCGYEIIDVTIPYIPEAQLAHSVVCITEMAESARRRTPNPADWLSLVGPANKVVMSVG 445

Query: 287 KLATASDYIVSQQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIYPRALAHGEVDVTM 345
               A+D +    +R  IM+ L  LF      LI+TP + +    I P   A+G  D   
Sbjct: 446 TRTPAADMLKYGALRELIMQHLAYLFQKHPGLLIMTPTSPLIGWPIVPGDQAYGMSDTNT 505

Query: 346 ISDIMRFVQLANFAGVPAVSVPAGYDD-----NNLPIGLQFIAKWYDEATLLRIAKTSEE 400
               M +V LAN  G PAVS P GY D       L IGL    +W  E  LL  A  +EE
Sbjct: 506 TIRNMLYVFLANLTGTPAVSAPVGYVDPDQGEGKLSIGLMATGEWGSEEQLLAWATEAEE 565

Query: 401 ILGNR----RKKPSDKFWFGNYVQE 421
            L N     R++P +     + V++
Sbjct: 566 YLHNATESGRRRPDEWLDVADLVKQ 590



>gi|119192100|ref|XP_001246656.1| hypothetical protein CIMG_00427 [Coccidioides immitis RS]
 gi|392864107|gb|EAS35091.2| N-acylethanolamine amidohydrolase [Coccidioides immitis RS]
          Length = 621

 Score =  195 bits (495), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 135/432 (31%), Positives = 211/432 (48%), Gaps = 34/432 (7%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATI----IERLRE 56
           T RY     LGLLDG+P AVKDE D+ GY T +G+   +Y   A  + +I    + +L E
Sbjct: 172 TLRYKRKRPLGLLDGVPTAVKDEYDIDGYRTCLGS-VNDYTGEAEPEKSITSWCVRQLEE 230

Query: 57  KGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGR 116
            GA++LGK SM E G  ++ NNP   TP NPY + YY               L P+A+G 
Sbjct: 231 AGAVVLGKLSMPEFGLDTSGNNPIYGTPCNPYCSRYYTGGSSSGSAYAVSTGLIPMALGS 290

Query: 117 DGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGK 176
           DGGGS+RIPS+FC +YGLK T  R S       +++ AV+GP+AA +  LAL Y+V+   
Sbjct: 291 DGGGSIRIPSAFCSVYGLKPTHSRLSHRPGCNHSNTCAVNGPIAADIRSLALLYHVIGTP 350

Query: 177 DPKDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLRG 235
            P   +      P        NK+    +G+   W  +   PAI     + +D+L     
Sbjct: 351 HPSS-HFPSLSPPLSPPLRPRNKI----LGIPETWFSR-STPAIQRLCRSLLDKLVSAHN 404

Query: 236 AXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYI 295
                         + AH +T+ T+  T+     +    F+   +  I +  +  A+D++
Sbjct: 405 YTLMPIEIPFLVEGQTAHAMTVLTDAATLLPNTDN----FTAANQIMIGLGTITPATDFL 460

Query: 296 VSQQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYPRA-LAHGEVDVTMISDIMRFV 353
           ++Q++R  +M+ L +L+     +I+ TP T+     I  ++ L +G  D   I   M +V
Sbjct: 461 LAQKLRQLLMQHLAHLWKEYPGMIIVTPTTSCAGWPIRSKSELQYGLNDGNHILKTMEYV 520

Query: 354 QLANFAGVPAVSVPAGY-------------DDN---NLPIGLQFIAKWYDEATLLRIAKT 397
            +ANF G PA+SVP GY             D +    +P+GL  + +W  E  LL+    
Sbjct: 521 WMANFTGAPALSVPVGYIVPEGSEGAGEEADRDVAGKVPVGLMGMGEWASEDNLLQWGLE 580

Query: 398 SEEILGNRRKKP 409
           +E++  +R  +P
Sbjct: 581 AEDVGKDRLSRP 592



>gi|402075748|gb|EJT71171.1| hypothetical protein GGTG_10431 [Gaeumannomyces graminis var.
           tritici R3-111a-1]
          Length = 636

 Score =  195 bits (495), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 136/438 (31%), Positives = 205/438 (46%), Gaps = 32/438 (7%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGT--KFINYGNP-------ATSDATII 51
           T+RY    SLG LDG+P AVKDE D+ GY+T +G+   +     P           +  +
Sbjct: 181 TQRYKEKKSLGPLDGVPTAVKDEYDMAGYKTTLGSPNDYTALHVPREEGDDDGDKTSWCV 240

Query: 52  ERLREKGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCP 111
            ++   GA++LGK S+HE G  ++  N    TPRNPYN  YYP              L P
Sbjct: 241 RQVMGAGAVVLGKLSLHEFGMDTSGYNITYGTPRNPYNPSYYPGGSSSGSAYAVAAGLLP 300

Query: 112 IAIGRDGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYY 171
           I++G DGGGS+RIP+SF  ++GLK T GR +       ++S AV+GPMAA +  L   Y 
Sbjct: 301 ISLGSDGGGSIRIPASFNSVFGLKPTHGRLAFLPGQNHSNSAAVNGPMAADMRSLIALYD 360

Query: 172 VMAGKDPKDPNTLH--QPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFID 229
            M+   P  P +       P        +      IGV   W  +  +P +    ++ +D
Sbjct: 361 AMSRPHPASPFSFPGLATAPRRSSLETDDAARPRIIGVPEAWFARA-SPVVQQLCSSLVD 419

Query: 230 EL-KLRGAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKL 288
            L + +G              + AH LT+ T+   + +    K    S   R  + + + 
Sbjct: 420 RLVERKGYRVVPVEIPFTQEGQAAHALTLLTDAAALVRDGDTKG--LSPANRILLALGRT 477

Query: 289 ATASDYIVSQQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIY--PRALAHGEVDVTM 345
             ASDY ++Q++R  +MR L  L+     ++L TPA+A     I    R LA+G  D   
Sbjct: 478 TPASDYQLAQRLRHVLMRHLAWLWRRHPGMVLVTPASACAGWPIRGGGRELAYGVSDGDR 537

Query: 346 ISDIMRFVQLANFAGVPAVSVPAGY--------------DDNNLPIGLQFIAKWYDEATL 391
               M +V LAN  GVP++SVPAG+                  +P+GL    +W  E +L
Sbjct: 538 TMRSMEYVWLANLCGVPSISVPAGFAAPGDGEAEVAGEDTPGKVPVGLMGTGEWCSEESL 597

Query: 392 LRIAKTSEEILGNRRKKP 409
           LR    +EE+  + ++ P
Sbjct: 598 LRFGLDAEEVGADLQRPP 615



>gi|307102637|gb|EFN50907.1| hypothetical protein CHLNCDRAFT_141670 [Chlorella variabilis]
          Length = 646

 Score =  194 bits (494), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 136/421 (32%), Positives = 197/421 (46%), Gaps = 39/421 (9%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFI-NYGNPATSDATIIERLREKGA 59
           T R+     L  LDG+P AVKD  D   Y T  GT F+  +  P  S A + + L + GA
Sbjct: 193 TARWQQGRPLSPLDGVPYAVKDGCDALPYPTTTGTGFMAEWRTPVRSLAGV-QALLDAGA 251

Query: 60  IILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGG 119
           +++GK ++HEIG G+T  N    TPRNP++  ++               LCP A+G DGG
Sbjct: 252 LLIGKANLHEIGLGTTGLNILTGTPRNPHSPAHHTGGSSSGSAALVAAGLCPFAVGSDGG 311

Query: 120 GSVRIPSSFCGIYGLKTTCGRFSDD-GQYPLAHSVAVSGPMAASVDDLALAYYVMA--GK 176
           GS+RIP++ CG+ GLK T  R     G  P+  +V+V GP+AASV D AL Y V A  G+
Sbjct: 312 GSIRIPAAACGVVGLKPTHERVGTAVGTPPIDQTVSVVGPLAASVQDCALMYAVAANTGQ 371

Query: 177 DPKDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGA 236
            P +      P P L    +         G  + W +   + A+  A  + +  L+  G 
Sbjct: 372 RPGE-----APPPVLLPAALGGGGRRPLAGKTAGWFEDAAS-AVAEACRSAVAMLEGAGL 425

Query: 237 XXXXXXXXXXXXARIAHLLTIGTEL---TTVAKRHKDKMHLFSCPTRSNINVMKLATASD 293
                        R AH  TI +E+      A          +  TR ++ V     A+ 
Sbjct: 426 AVVPLRLPELGLLRAAHSCTIASEMRNNMAAALSDGGARRRMNAETRISLAVAAGFQAAH 485

Query: 294 YIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFV 353
           YI +Q++RTR+     + F+ + DLILTP    TAP I P AL  GE D+T  + +M ++
Sbjct: 486 YIQAQKIRTRVEAHFRSAFA-RCDLILTPTLPCTAPPIKPAALQCGETDLTTTTALMHYM 544

Query: 354 QLANFAGVPAVSVPAGYDDNN------------------------LPIGLQFIAKWYDEA 389
              NF G+PA+SVP G   +                         LP+ LQ +A  + EA
Sbjct: 545 LAPNFIGLPAISVPVGVVPSTHPPAPSTPAPGAGAVDGGGASPPLLPVALQLMAPCWHEA 604

Query: 390 T 390
           +
Sbjct: 605 S 605



>gi|440465251|gb|ELQ34589.1| glutamyl-tRNA(Gln) amidotransferase subunit A [Magnaporthe oryzae
           Y34]
 gi|440487824|gb|ELQ67594.1| glutamyl-tRNA(Gln) amidotransferase subunit A [Magnaporthe oryzae
           P131]
          Length = 615

 Score =  194 bits (494), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 148/440 (33%), Positives = 212/440 (48%), Gaps = 38/440 (8%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYG---NPATSDAT--IIERLR 55
           T RY N  SLG LDG+P A+KDE ++ GY T  G++    G   +P T   T   + +L 
Sbjct: 160 TRRYQNKQSLGPLDGVPTAIKDEYEMDGYMTTHGSRNDYTGKDVDPETGLNTNWCVRKLE 219

Query: 56  EKGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIG 115
           E G ++LGK SMHE G  +T NNP   TP NP+N  YY               L P A+G
Sbjct: 220 EAGCVVLGKLSMHEFGLDTTGNNPVFGTPLNPHNQGYYTGGSSSGCGYAVAAGLVPFAMG 279

Query: 116 RDGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAG 175
            DGGGS+RIPSS CGI GLK T GR S        ++ AV GP+AA V  LA AY V+  
Sbjct: 280 SDGGGSIRIPSSLCGIVGLKPTHGRLSCLPTQNHCNTCAVLGPLAADVRTLATAYSVVGQ 339

Query: 176 KDPKDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLR 234
             P        P PTL         S   + V + W  +  +P++ T   + +  L   R
Sbjct: 340 PHPTSLFPPLPPAPTLLRSPSPASPSAKTLAVPTTWFSRA-SPSVQTLCRSLMQRLVDQR 398

Query: 235 GAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDY 294
           G              +IAH + + T+ +T+    K      +   R  + + +  TA D 
Sbjct: 399 GYRVVPVDLPMLTEGQIAHAIVVLTDASTLLPDTKG----LTPANRILLALGRTTTAVDV 454

Query: 295 IVSQQVRTRIMRTLNNLFSNQVD---LILTPATAITA-PKIYPRA-LAHG--EVDVTMIS 347
           +++ ++R  ++  L  L+ + +    LILTP TA    P   P A L +G  + D T+ S
Sbjct: 455 LLAHKLRRMLVAHLARLWRDTLGPDALILTPTTACAGWPVRDPAAELRYGLNDGDTTLAS 514

Query: 348 DIMRFVQLANFAGVPAVSVPAGY------------------DDNNLPIGLQFIAKWYDEA 389
             M +V +ANF G+PAVSVPAG+                   +  +P+GL  + +W +E 
Sbjct: 515 --MEYVWMANFCGLPAVSVPAGFVVPEGAVGAGRPVADGEDVEGKVPVGLMAMGEWANED 572

Query: 390 TLLRIAKTSEEILGNRRKKP 409
            LLR A  +EE+    + +P
Sbjct: 573 GLLRFAVDAEEVGEGLKARP 592



>gi|303313097|ref|XP_003066560.1| Amidase family protein [Coccidioides posadasii C735 delta SOWgp]
 gi|240106222|gb|EER24415.1| Amidase family protein [Coccidioides posadasii C735 delta SOWgp]
          Length = 621

 Score =  194 bits (494), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 135/432 (31%), Positives = 211/432 (48%), Gaps = 34/432 (7%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATI----IERLRE 56
           T RY     LGLLDG+P AVKDE D+ GY T +G+   +Y   A  + +I    + +L E
Sbjct: 172 TLRYKRKRPLGLLDGVPTAVKDEYDIDGYRTCLGS-VNDYTGEAEPEKSITSWCVRQLEE 230

Query: 57  KGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGR 116
            GA++LGK SM E G  ++ NNP   TP NPY + YY               L P+A+G 
Sbjct: 231 AGAVVLGKLSMPEFGLDTSGNNPIYGTPCNPYCSRYYTGGSSSGSAYAVSTGLIPMALGS 290

Query: 117 DGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGK 176
           DGGGS+RIPS+FC +YGLK T  R S       +++ AV+GP+AA +  LAL Y+V+   
Sbjct: 291 DGGGSIRIPSAFCSVYGLKPTHSRLSHRPGCNHSNTCAVNGPIAADIRSLALLYHVIGTP 350

Query: 177 DPKDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLRG 235
            P   +      P        NK+    +G+   W  +   PAI     + +D+L     
Sbjct: 351 HPSS-HFPSLSPPLSPPLRPRNKI----LGIPETWFSR-STPAIQRLCRSLLDKLVSAHN 404

Query: 236 AXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYI 295
                         + AH +T+ T+  T+     +    F+   +  I +  +  A+D++
Sbjct: 405 YTLMPIEIPFLVEGQTAHAMTVLTDAATLLPNTDN----FTAANQIMIGLGTITPATDFL 460

Query: 296 VSQQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYPRA-LAHGEVDVTMISDIMRFV 353
           ++Q++R  +M+ L  L+     +I+ TP T+     I  ++ L +G  D   I   M +V
Sbjct: 461 LAQKLRQLLMQHLAYLWKEYPGMIIVTPTTSCAGWPIRSKSELQYGLNDGNHILKTMEYV 520

Query: 354 QLANFAGVPAVSVPAGY-------------DDN---NLPIGLQFIAKWYDEATLLRIAKT 397
            +ANF G PA+SVP GY             D +    +P+GL  + +W  E +LL+    
Sbjct: 521 WMANFTGAPALSVPVGYIVPEGPEGAGEEADRDVAGKVPVGLMGMGEWASEDSLLQWGLE 580

Query: 398 SEEILGNRRKKP 409
           +E++  +R  +P
Sbjct: 581 AEDVGKDRLSRP 592



>gi|500253492|gb|EON97175.1| putative glutamyl-trna amidotransferase subunit a protein [Togninia
           minima UCRPA7]
          Length = 624

 Score =  194 bits (493), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 133/434 (30%), Positives = 207/434 (47%), Gaps = 34/434 (7%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSD----ATIIERLRE 56
           T+RY    SLG LDG+P AVKDE D++GY + +G+   +Y    T D    A  + ++++
Sbjct: 179 TQRYQEKRSLGPLDGVPTAVKDEYDMEGYMSCLGS-VNDYTGTITEDNSTTAWCVRKVQD 237

Query: 57  KGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGR 116
            G +ILGK SM E G  +  NNP   TP NP+N +YY               L PI +G 
Sbjct: 238 AGCVILGKLSMVEFGLDTPGNNPNYGTPPNPHNPNYYTGGSSSGTAYAVSAGLIPIGLGS 297

Query: 117 DGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGK 176
           DGGGS+RIP+SFCG+YG+K T GR S         + A  GP+A+ +  LA    V+   
Sbjct: 298 DGGGSIRIPASFCGVYGIKPTHGRISFKPGQNHCITCACLGPIASDIQSLATLLEVIGA- 356

Query: 177 DPKDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR-G 235
               P++   P+P +             +G+   W      PA+     +FI  L  + G
Sbjct: 357 --PHPSSHFPPIPPVSRMLAPAADDSKVLGIPEEWFA-ASEPAVQELCRSFIKTLVAQHG 413

Query: 236 AXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYI 295
                         ++AH LT+ T+ +T+    +      +   R  + + + + A+D++
Sbjct: 414 YRTVPIRIPFLVEGQMAHALTVLTDASTLLPDTRG----LTAANRILLAIGRSSPATDFL 469

Query: 296 VSQQVRTRIMRTLNNLFSNQVD-LILTPATAITA-PKIYPRALAHGEVDVTMISDIMRFV 353
           ++Q++R  +M+ L  L+      LI+TP T+    P   P  L+ G  D       M +V
Sbjct: 470 LAQKLRRLLMQHLAWLWREHPGMLIVTPTTSCAGWPVRSPGELSRGVSDGDQTLKTMEYV 529

Query: 354 QLANFAGVPAVSVPAGY----------------DDNNLPIGLQFIAKWYDEATLLRIAKT 397
            LANF G+P+++VPAG+                    +P+GL    +W  EA LLR    
Sbjct: 530 WLANFCGLPSIAVPAGFVTPEGQPGAGSVAERTTRGRVPVGLMATGEWASEAQLLRFGLD 589

Query: 398 SEEI--LGNRRKKP 409
           +EE+  +G R  +P
Sbjct: 590 AEEVVAVGARMDRP 603



>gi|389630822|ref|XP_003713064.1| glutamyl-tRNA(Gln) amidotransferase subunit A [Magnaporthe oryzae
           70-15]
 gi|351645396|gb|EHA53257.1| glutamyl-tRNA(Gln) amidotransferase subunit A [Magnaporthe oryzae
           70-15]
          Length = 640

 Score =  194 bits (493), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 148/440 (33%), Positives = 212/440 (48%), Gaps = 38/440 (8%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYG---NPATSDAT--IIERLR 55
           T RY N  SLG LDG+P A+KDE ++ GY T  G++    G   +P T   T   + +L 
Sbjct: 185 TRRYQNKQSLGPLDGVPTAIKDEYEMDGYMTTHGSRNDYTGKDVDPETGLNTNWCVRKLE 244

Query: 56  EKGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIG 115
           E G ++LGK SMHE G  +T NNP   TP NP+N  YY               L P A+G
Sbjct: 245 EAGCVVLGKLSMHEFGLDTTGNNPVFGTPLNPHNQGYYTGGSSSGCGYAVAAGLVPFAMG 304

Query: 116 RDGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAG 175
            DGGGS+RIPSS CGI GLK T GR S        ++ AV GP+AA V  LA AY V+  
Sbjct: 305 SDGGGSIRIPSSLCGIVGLKPTHGRLSCLPTQNHCNTCAVLGPLAADVRTLATAYSVVGQ 364

Query: 176 KDPKDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLR 234
             P        P PTL         S   + V + W  +  +P++ T   + +  L   R
Sbjct: 365 PHPTSLFPPLPPAPTLLRSPSPASPSAKTLAVPTTWFSRA-SPSVQTLCRSLMQRLVDQR 423

Query: 235 GAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDY 294
           G              +IAH + + T+ +T+    K      +   R  + + +  TA D 
Sbjct: 424 GYRVVPVDLPMLTEGQIAHAIVVLTDASTLLPDTKG----LTPANRILLALGRTTTAVDV 479

Query: 295 IVSQQVRTRIMRTLNNLFSNQVD---LILTPATAITA-PKIYPRA-LAHG--EVDVTMIS 347
           +++ ++R  ++  L  L+ + +    LILTP TA    P   P A L +G  + D T+ S
Sbjct: 480 LLAHKLRRMLVAHLARLWRDTLGPDALILTPTTACAGWPVRDPAAELRYGLNDGDTTLAS 539

Query: 348 DIMRFVQLANFAGVPAVSVPAGY------------------DDNNLPIGLQFIAKWYDEA 389
             M +V +ANF G+PAVSVPAG+                   +  +P+GL  + +W +E 
Sbjct: 540 --MEYVWMANFCGLPAVSVPAGFVVPEGAVGAGRPVADGEDVEGKVPVGLMAMGEWANED 597

Query: 390 TLLRIAKTSEEILGNRRKKP 409
            LLR A  +EE+    + +P
Sbjct: 598 GLLRFAVDAEEVGEGLKARP 617



>gi|392384044|ref|YP_005033240.1| putative Glutamyl-tRNA(Gln) amidotransferase subunit A (Glu-ADT
           subunit A) [Azospirillum brasilense Sp245]
 gi|504008072|ref|WP_014242066.1| putative Glutamyl-tRNA(Gln) amidotransferase subunit A (Glu-ADT
           subunit A) [Azospirillum brasilense]
 gi|356880759|emb|CCD01723.1| putative Glutamyl-tRNA(Gln) amidotransferase subunit A (Glu-ADT
           subunit A) [Azospirillum brasilense Sp245]
          Length = 448

 Score =  194 bits (492), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 137/423 (32%), Positives = 206/423 (48%), Gaps = 52/423 (12%)

Query: 11  GLLDGIPIAVKDEIDVKGYETNVGT--KFINYGNPATSDATIIERLREKGAIILGKTSMH 68
           GLLDG+ + VKD  ++ G  T+ G+  +F   G+    DA +I RLR+ GAI++G+ ++ 
Sbjct: 52  GLLDGVTVTVKDCFELAGETTSYGSSDRFARMGH---RDAPLIRRLRDAGAILVGRNNLS 108

Query: 69  EIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGSVRIPSSF 128
           E   GSTN N      RNP++T   P              LC ++IG D GGS+RIP++ 
Sbjct: 109 EFCLGSTNQNEHHGPCRNPWDTGRVPGGSSGGSAASVAAGLCRVSIGTDTGGSIRIPAAL 168

Query: 129 CGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDPNTLHQPL 188
           CG+ GL+ + GR S+ G  P +      GP+A SV D+A A+  +AG DP+DPN++  PL
Sbjct: 169 CGVVGLRPSVGRVSNSGVIPCSVDFDTVGPLAYSVADVARAFAAIAGYDPEDPNSVDVPL 228

Query: 189 PTLHGFHVTNKLSDLKIGVYSM-----WNKQVDN--PAITTALNNFIDELKLRGAXX--X 239
                    N L DLK G+         N   DN  PA+   +      L+  GA     
Sbjct: 229 --------GNFLPDLKAGIAGTRIGLPRNFYFDNLQPAVAERVRAAAAVLEKAGAVLVDV 280

Query: 240 XXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMK------------ 287
                    AR A  L +      +A+ H DKM   + P      V++            
Sbjct: 281 TIEDAEVAQARTAFSLLV----ADMAQYHLDKME--TAPESIGPEVLRRLQLGLPVSGVQ 334

Query: 288 LATASDYIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMIS 347
            A +  ++ S ++R R       LF  +VDLILTP T+ITAP+IY  A       +    
Sbjct: 335 YADSRRWLASWKLRFRA------LF-ERVDLILTPTTSITAPRIYDSADM-----IEATR 382

Query: 348 DIMRFVQLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRK 407
            + RF       G+PA+SVP G+D + +P+GLQ + +W+DE  + R     +    + R+
Sbjct: 383 AVSRFTYGFGALGLPAMSVPCGFDGDGMPVGLQIVGRWFDEPLVFRAGAAFQAATDHHRQ 442

Query: 408 KPS 410
           +P+
Sbjct: 443 RPA 445



>gi|320036558|gb|EFW18497.1| conserved hypothetical protein [Coccidioides posadasii str.
           Silveira]
          Length = 598

 Score =  194 bits (492), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 135/432 (31%), Positives = 211/432 (48%), Gaps = 34/432 (7%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATI----IERLRE 56
           T RY     LGLLDG+P AVKDE D+ GY T +G+   +Y   A  + +I    + +L E
Sbjct: 149 TLRYKRKRPLGLLDGVPTAVKDEYDIDGYRTCLGS-VNDYTGEAEPEKSITSWCVRQLEE 207

Query: 57  KGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGR 116
            GA++LGK SM E G  ++ NNP   TP NPY + YY               L P+A+G 
Sbjct: 208 AGAVVLGKLSMPEFGLDTSGNNPIYGTPCNPYCSRYYTGGSSSGSAYAVSTGLIPMALGS 267

Query: 117 DGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGK 176
           DGGGS+RIPS+FC +YGLK T  R S       +++ AV+GP+AA +  LAL Y+V+   
Sbjct: 268 DGGGSIRIPSAFCSVYGLKPTHSRLSHRPGCNHSNTCAVNGPIAADIRSLALLYHVIGTP 327

Query: 177 DPKDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLRG 235
            P   +      P        NK+    +G+   W  +   PAI     + +D+L     
Sbjct: 328 HPSS-HFPSLSPPLSPPLRPRNKI----LGIPETWFSR-STPAIQRLCRSLLDKLVSAHN 381

Query: 236 AXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYI 295
                         + AH +T+ T+  T+     +    F+   +  I +  +  A+D++
Sbjct: 382 YTLMPIEIPFLVEGQTAHAMTVLTDAATLLPNTDN----FTAANQIMIGLGTITPATDFL 437

Query: 296 VSQQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKIYPRA-LAHGEVDVTMISDIMRFV 353
           ++Q++R  +M+ L  L+     +I+ TP T+     I  ++ L +G  D   I   M +V
Sbjct: 438 LAQKLRQLLMQHLAYLWKEYPGMIIVTPTTSCAGWPIRSKSELQYGLNDGNHILKTMEYV 497

Query: 354 QLANFAGVPAVSVPAGY-------------DDN---NLPIGLQFIAKWYDEATLLRIAKT 397
            +ANF G PA+SVP GY             D +    +P+GL  + +W  E +LL+    
Sbjct: 498 WMANFTGGPALSVPVGYIVPEGPEGAGEEADRDVAGKVPVGLMGMGEWASEDSLLQWGLE 557

Query: 398 SEEILGNRRKKP 409
           +E++  +R  +P
Sbjct: 558 AEDVGKDRLSRP 569



>gi|283826938|ref|YP_003377700.1| putative amidotransferase [Corynebacterium glutamicum]
 gi|502682033|ref|WP_012917659.1| putative amidotransferase [Corynebacterium glutamicum]
 gi|283362278|dbj|BAI66035.1| putative amidotransferase [Corynebacterium glutamicum]
          Length = 479

 Score =  193 bits (490), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 130/401 (32%), Positives = 208/401 (51%), Gaps = 9/401 (2%)

Query: 2   ERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAII 61
           E  AN +  G L GIP+A+KD I V G  T + +K I+    +  D++++++LRE G ++
Sbjct: 66  EEIANGNYRGPLHGIPMAIKDNIYVGGEVTTMASK-IHGDFVSKDDSSVVKKLREAGVVL 124

Query: 62  LGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGS 121
            GK +MHE  +G  NNNP      NP+N D  P              +    +G D  GS
Sbjct: 125 TGKLNMHEYAWGIDNNNPHFGAVHNPWNLDKVPGGSSGGSGAAVAADMTFTTLGTDTAGS 184

Query: 122 VRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDP 181
           +RIPS+ CG+ GLK T GR +  G +PLA S+   GPM+ +V D A     +AG D +DP
Sbjct: 185 IRIPSAACGLVGLKPTHGRVAKYGCFPLAWSLDHIGPMSKTVADAAATLQAIAGYDHRDP 244

Query: 182 NTLHQPLPTLHGFHVTNKLSDLKIGV-YSMWNKQVDNPAITTALNNFIDELKLRGAXXXX 240
            ++  P+   +   +     DL IG+  + + K VD+P I   +   ID+L  RGA    
Sbjct: 245 TSVDVPVGD-YSAALGGDPKDLVIGIEENYFFKNVDSP-IEQLVRKQIDDLVSRGAILKT 302

Query: 241 XXXXXXXXARIAHLLTIGTELTTVAKRH-KDKMHLFSCPTRSNINVMKLATASDYIVSQQ 299
                   +  A L T  +E + +     +++        R    + +L ++ D++ +QQ
Sbjct: 303 VSIPSLAYSEWAELATSLSEASAIHHHDLQNRPEDLGADIRFLFELGELFSSVDFLQAQQ 362

Query: 300 VRTRIMRTLNNLFSNQVDLILTPATAITAPKI-YPRALAHGEVDVTMISDIMRFVQLANF 358
           VR +I +       + VD+I+ P   + AP I  P A  +G  +V +I + +RF   +N 
Sbjct: 363 VRRQIKQEFVAALQD-VDVIIAPTLPVMAPDIGSPVANLNG-TEVDLIDNFIRFTGPSNL 420

Query: 359 AGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSE 399
            G+PA++VP G  D +LP+GLQ I + +DE+T+L++    E
Sbjct: 421 TGLPALTVPVGLSD-DLPVGLQIIGRAFDESTVLKVGSQIE 460



>gi|313245080|emb|CBY42518.1| unnamed protein product [Oikopleura dioica]
          Length = 464

 Score =  193 bits (490), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 130/404 (32%), Positives = 198/404 (49%), Gaps = 26/404 (6%)

Query: 9   SLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAIILGKTSMH 68
           +LG LDG+PIA+KD++D++G+    G +F   G  A  D TI  R R +G II+G T+MH
Sbjct: 55  ALGPLDGVPIAMKDQLDIEGHRRRNGLEFCESG-AAVEDCTITARCRAQGMIIVGVTNMH 113

Query: 69  EIGFGSTNNNPFV----CTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGSVRI 124
             G     +N  V    C  RNP+N  +Y               + P+A+G DGGGSVRI
Sbjct: 114 PKGMSCFGSNISVDHGMC--RNPFNDKFYCGASSSGAGAIVASGIMPLAVGTDGGGSVRI 171

Query: 125 PSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPK--DPN 182
           P+ +C + GL  + GR    G    + + + +GPMA +  D A  Y VMAG D +     
Sbjct: 172 PAGYCNLVGLFPSIGRAPQRGTS--SGTCSAAGPMAHTPQDCARLYAVMAGPDYQVGSEQ 229

Query: 183 TLHQPLPTLHGFHVTNKLSDLKIGVYSMWNK-----QVDNPAITTALNNFIDELKLRGAX 237
           +  QP  T+    +   L  +K+G+   WN+      + NP     LN  ID+    GA 
Sbjct: 230 SRIQPKVTIPK-TLLKSLVGVKVGIDQCWNQTGVPDSLFNP-FQKRLNWMIDQ----GAE 283

Query: 238 XXXXXXXXXXXARIAHLLTIGTELTTVAKRHKD--KMHLFSCPTRSNINVMKLATASDYI 295
                         AHL+    E+ +   R++   K   +     SNI   +   A+DY 
Sbjct: 284 IVHFIMPEKDVVYAAHLMCFSNEIASDVIRYQQQGKQVDYDVEMISNIQA-QTVRATDYF 342

Query: 296 VSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQL 355
           ++ ++RT+ MR +++LFS ++D+I TP +  T  +I      +G  D   +  I  F ++
Sbjct: 343 IANKIRTKFMRIMDDLFS-KMDIIATPMSKSTMVEIGAGDHLYGRSDAKTVGKISYFTRI 401

Query: 356 ANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSE 399
            NF G P + V  G+D N++P G    AKW++E  L  IA   E
Sbjct: 402 FNFVGCPGIMVQLGHDKNDVPFGFHMAAKWWNEEKLFEIAAFME 445



>gi|336273784|ref|XP_003351646.1| hypothetical protein SMAC_00188 [Sordaria macrospora k-hell]
 gi|380095925|emb|CCC05972.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 606

 Score =  192 bits (489), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 137/434 (31%), Positives = 203/434 (46%), Gaps = 34/434 (7%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTK----FINYGNPATSDATIIERLRE 56
           TER+     LG+LDG+P  VKD+ +V+GY + +G K    F  +  PAT      ++LRE
Sbjct: 170 TERWQAGRPLGILDGVPFGVKDDTEVEGYVSTMGMKVNERFEYFTKPATETVWPAKKLRE 229

Query: 57  KGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGR 116
           +GAI++GK + HEIG  +T  NP   T  N YNT Y+P              L PIAIG 
Sbjct: 230 QGAIMVGKMNQHEIGMDTTGCNPTTGTATNWYNTKYFPGGSSSGAGSALSAGLVPIAIGT 289

Query: 117 DGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGK 176
           D GGS+RIP +FCG+YGLK T  R           S+ V GPM ++  DL + Y +MA  
Sbjct: 290 DAGGSMRIPPAFCGVYGLKPTHNRVVSRNS-----SMCVVGPMCSNPSDLTITYRIMAQP 344

Query: 177 DPKDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGA 236
           +P DP      +P++    +  K     +G+   W    D   + T  N  I+ L    +
Sbjct: 345 NPSDP-AQSSLVPSIPPSPIAKKY----LGLCPEWIALADA-DVRTTFNRAIETLCSSPS 398

Query: 237 XXXXXXXXXXX-----XARIAHLLTIGTELTTVAKRH----KDKMHLFSCPTRSNINVMK 287
                             ++AH  T  TE    A+       D +   + P R  +++  
Sbjct: 399 FGSQYELVTIKLPYLREGQLAHAATCLTEAAADARNRVTNPDDYLKPLNYPNRILVSMGA 458

Query: 288 LATASDYIVSQQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIYPRALAHGEVDVTMI 346
              A+DY+   Q+R  IM+ L +L+      LI++P T +    I P    +G  D    
Sbjct: 459 QTPAADYLRYNQLRQVIMQHLAHLYEQYPGLLIVSPTTPMAGWPIMPGDETYGCSDGNRS 518

Query: 347 SDIMRFVQLANFAGVPAVSVPAGY-----DDNNLPIGLQFIAKWYDEATLLRIAKTSEEI 401
              M +V  AN +G PAV+ P GY      +  LP+G+  +A+W +E  LL  A+  E  
Sbjct: 519 IRNMTYVWYANTSGCPAVTCPGGYVEAQQGEGKLPVGVMAMAEWGEEERLLAFARDMERY 578

Query: 402 LGNR----RKKPSD 411
           L       R++P +
Sbjct: 579 LAEAYEGGRQRPRE 592



>gi|449515768|ref|XP_004164920.1| PREDICTED: fatty acid amide hydrolase-like [Cucumis sativus]
          Length = 746

 Score =  192 bits (489), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 140/409 (34%), Positives = 206/409 (50%), Gaps = 17/409 (4%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
           T+RY     L +LDG+PIAVKDEID   Y T  GT +++   P T DA+ ++ LR  GA+
Sbjct: 191 TKRYELGKPLSVLDGVPIAVKDEIDCLPYPTTGGTSWLHKLRPCTGDASCVKYLRLCGAL 250

Query: 61  ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
           I+GKT+MHE+G G++  NP   T RNPYN+                  LCP A+G DGGG
Sbjct: 251 IVGKTNMHELGIGTSGINPHHGTTRNPYNSSRICGGSSSGSAAVVAAGLCPAALGVDGGG 310

Query: 121 SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKD 180
           SVRIP+S CG+ GLK T GR    G  PL  +V + G +A +++D  + Y  ++ K P  
Sbjct: 311 SVRIPASLCGVVGLKPTFGRVPHSGVLPLNWTVGMVGILAGTIEDAFIVYAAISSKLPSH 370

Query: 181 PNTLHQPLPTLHGFHVTNK---LSDLKIGVYSMW-NKQVDNPAITTALNNFIDEL-KLRG 235
            NT    LP L  F V N    +S + +  YS W N   D+  I    +N +D+L K  G
Sbjct: 371 QNT---ALPKL-CFPVLNSSRPISSVTLAKYSEWFNDCSDD--IRVCCSNAMDKLQKHNG 424

Query: 236 AXXXXXXXXXXXXARIAHLLTIGTELTTVAKRH--KDKMHLFSCPTRSNINVMKLATASD 293
                         R+AH  TI +E +T    +  KD   L     R  + V    ++ +
Sbjct: 425 WKSVEVTIPEIEVMRLAHYSTIASECSTSLSSYLEKDSSQL-GWDARVALAVYGSFSSKE 483

Query: 294 YIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVD-VTMISDIMRF 352
           YI +Q++R R M     + ++  D+I++P T +TA  I   AL  GE+D +    D  + 
Sbjct: 484 YIKAQKIRNRQMYFHRKILAH-ADVIVSPTTGVTAYPILNGALKTGELDYINGGIDFGKK 542

Query: 353 VQLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEI 401
           ++LA    V  +    GY   +   G + I  +     +L + +T +EI
Sbjct: 543 LRLA-LGEVSNLLEGVGYLKFSFTHGTKKIRDFRLNCKILSVEETEDEI 590



>gi|473951597|gb|EMS50766.1| Filament-like plant protein [Triticum urartu]
          Length = 1583

 Score =  192 bits (489), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 135/428 (31%), Positives = 207/428 (48%), Gaps = 44/428 (10%)

Query: 1    TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAI 60
            T RY   + L  +DG+ +AVKDEID   Y+T  GT ++    P  +DA  + +LR  GA+
Sbjct: 1178 TLRYQQGAPLSAMDGVLVAVKDEIDCLPYQTTGGTSWLGKMRPCVADAACVAQLRACGAV 1237

Query: 61   ILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGG 120
            + GKT+MHE+G G++  NP   + RN                      LCP+A+G DGGG
Sbjct: 1238 LAGKTNMHELGAGTSGINPHHGSTRN--------------------AGLCPVALGADGGG 1277

Query: 121  SVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSV----AVSG-----PMAASVDDLALAYY 171
            SVR+P++ CG+ G K T GR S+ G      SV    A+ G     P A  + +   A  
Sbjct: 1278 SVRMPAALCGVVGFKPTAGRLSNSGCRSGGGSVRMPAALCGVVGFKPTAGRLSNSGYAAM 1337

Query: 172  VMAGKDPKDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPA--ITTALNNFID 229
            V    D   P    QP   L     T+ + ++++  Y  W    D+ +  I    +  + 
Sbjct: 1338 V----DQSGP-AHSQPQLNLPLLTSTHSMPNIRLARYGKW---FDDSSEDIRGCCDKALQ 1389

Query: 230  ELKLR-GAXXXXXXXXXXXXARIAHLLTIGTELT-TVAKRHKDKM--HLFSCPTRSNINV 285
             L+   G              R+AH +T+G+E + ++A ++ DK+         R  ++ 
Sbjct: 1390 ILRAHYGWETVDVTVPEVEEMRLAHYVTMGSECSASLATKYLDKLDKSEIGWDVRIALSA 1449

Query: 286  MKLATASDYIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTM 345
                ++  Y+ +Q++R R M   N +F    D I+TP T +TA  +   AL  GE+D   
Sbjct: 1450 YGSFSSRAYLNAQRIRNRQMYFHNKIFET-ADAIVTPMTGVTAYALQDDALRTGELDYIN 1508

Query: 346  ISDIMRFVQLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNR 405
             + I R+    NF G+PA++V  GYD   LP+GLQFI + + EATLL +A   +E     
Sbjct: 1509 AAAISRYSIAGNFLGLPAITVTVGYDRGGLPVGLQFIGRPWAEATLLHLAYAMQEACSKS 1568

Query: 406  RKKPSDKF 413
             +KP   F
Sbjct: 1569 CRKPMVSF 1576



>gi|46114670|ref|XP_383353.1| hypothetical protein FG03177.1 [Fusarium graminearum PH-1]
          Length = 626

 Score =  192 bits (488), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 138/435 (31%), Positives = 210/435 (48%), Gaps = 42/435 (9%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATI----IERLRE 56
           T RY     LG LDG+P A+KD+ D+ GYE  +G+K  NY   A S  +I    + +L++
Sbjct: 182 TIRYREGRPLGPLDGVPAAIKDDFDMDGYEMTMGSKN-NYAGKAVSTGSITNWCVGKLQD 240

Query: 57  KGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGR 116
            G I+LGK +MHE G  +T NNP   TP NP+N+ YY               L PIA+G 
Sbjct: 241 AGVIVLGKLNMHEFGMDTTGNNPNHGTPLNPFNSKYYSGGSSSGAGYAVGAGLIPIALGG 300

Query: 117 DGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGK 176
           D GGS+RIPSS+C ++GLK T GR S       A +  V GP+AA +  LA  Y ++A  
Sbjct: 301 DAGGSIRIPSSYCSVFGLKPTHGRLSSFPTPNPAPTCCVQGPIAADMYSLATVYDIIADP 360

Query: 177 DPKD--PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR 234
            P    P    +P         +  L+ L +G+Y  W   +  P + T     ID+L   
Sbjct: 361 HPTSRFPRLYREP---------SRPLAKL-LGIYEPWF-DLATPGVQTITRRMIDKLCTE 409

Query: 235 -GAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASD 293
                           +IAH +T+  +  ++     +     +   +  + + +   A D
Sbjct: 410 YNYEIVPITIPFTEEGQIAHAMTVLADAASLLPESANT----TAANKLLLAMGRTTPAGD 465

Query: 294 YIVSQQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIYPRA--LAHGEVDVTMISDIM 350
           Y+++Q++R  +M+ L +L+      +I+TP TA     I   A  L HG  D  +  + M
Sbjct: 466 YVLAQKLRNLLMQHLAHLWQMHPGMMIITPTTACGGAPIRRGASELKHGLSDGDLTIESM 525

Query: 351 RFVQLANFAGVPAVSVPAGY-------------DDN---NLPIGLQFIAKWYDEATLLRI 394
            +V LANF G+P++S+PAG+             D+N    +PIGL    +W  E  LL  
Sbjct: 526 TYVWLANFCGMPSLSIPAGFVVPVGQERAGEEADENTVGKVPIGLMATGEWCSEKALLEF 585

Query: 395 AKTSEEILGNRRKKP 409
              +E +  ++R KP
Sbjct: 586 GVEAEAVGSDKRCKP 600



>gi|322705561|gb|EFY97146.1| amidase [Metarhizium anisopliae ARSEF 23]
          Length = 531

 Score =  191 bits (486), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 136/430 (31%), Positives = 206/430 (47%), Gaps = 33/430 (7%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNP----ATSDATIIERLRE 56
           TER+A    LG+LDG+PI VKD+++VKGY  + G ++ N  +P        A  ++ L++
Sbjct: 88  TERWAAGKPLGILDGVPIGVKDDVNVKGYVNHNGMRY-NADSPFFKRQEKSAWCVQALQD 146

Query: 57  KGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGR 116
            GA++LGK  MHE+G  +   N    +P N  NT+YYP              + P ++  
Sbjct: 147 AGAVVLGKNRMHELGSDTCGLNVAQGSPTNHLNTEYYPGGSSSGPASAVCAGVVPFSVAT 206

Query: 117 DGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGK 176
           D GGS+RIP+SF G+YGLKT+  R    G      ++ ++GP+AA+V DL +AY +M+  
Sbjct: 207 DAGGSIRIPASFNGLYGLKTSHHRTGYMGS-----TMCITGPIAANVADLTIAYRLMSQP 261

Query: 177 DPKDPNTLHQPLPTLHGFHVTNKLSDLKI-GVYSMWNKQVDNPAITTALNNFIDEL-KLR 234
           +P D       +  + G       S  ++ GVY  W    D P +    N  +D   K R
Sbjct: 262 NPDD------GIQGVFGRSTPPPPSTKRVMGVYREWLNAAD-PEVIEHCNEALDYFAKER 314

Query: 235 GAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRH----KDKMHLFSCPTRSNINVMKLAT 290
           G             A++AH +   TE+   A+R      D + L     R  + V +   
Sbjct: 315 GYEIVDISLPHLADAQLAHGMICITEMAEAARRRTVNPADWLSLVGSVNRLLMTVGQQTP 374

Query: 291 ASDYIVSQQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIYPRALAHGEVDVTMISDI 349
           A+D++    +RT +MR    LF      LI++P T +     +P   A G  D       
Sbjct: 375 AADFLKFNTMRTVLMRHFAFLFRKYPGMLIMSPTTPLNGWPKHPSDEALGMNDANTTFRN 434

Query: 350 MRFVQLANFAGVPAVSVPAGY-----DDNNLPIGLQFIAKWYDEATLLRIAKTSEE---- 400
           M ++ LAN  G P+VSVP GY      +  +P+GL    +W  E  LL  A  +EE    
Sbjct: 435 MMYIFLANMTGTPSVSVPVGYAAPKQGEGKIPVGLMATGEWGSEEQLLAFAGEAEEYLHG 494

Query: 401 ILGNRRKKPS 410
           I    R++PS
Sbjct: 495 IYEEGRRRPS 504



>gi|148657191|ref|YP_001277396.1| amidase [Roseiflexus sp. RS-1]
 gi|500595789|ref|WP_011957790.1| amidase [Roseiflexus sp. RS-1]
 gi|148569301|gb|ABQ91446.1| aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit A
           [Roseiflexus sp. RS-1]
          Length = 463

 Score =  191 bits (486), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 136/408 (33%), Positives = 193/408 (47%), Gaps = 26/408 (6%)

Query: 11  GLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAIILGKTSMHEI 70
           G L GIP+A+KD  D  G  T  G+ F     P T DA  +  L + GA++LGK +MHE 
Sbjct: 70  GPLHGIPLALKDLYDTAGIRTTAGSTFFADRVPDT-DARAVTLLYQAGAVLLGKLNMHEW 128

Query: 71  GFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGSVRIPSSFCG 130
             G TN NP     RNP++                   LC  A+G D GGS+RIP+S CG
Sbjct: 129 ALGVTNINPHYGPSRNPWDPSRITGGSSGGAAAALAAGLCMGALGSDTGGSIRIPASLCG 188

Query: 131 IYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDPNTLHQPLPT 190
           I GLK T GR S  G  PL+ ++  +GPMA +V D AL    +AG DP DP ++  P   
Sbjct: 189 IVGLKPTFGRVSLQGVIPLSWNLDHAGPMARTVTDAALLLQAIAGYDPDDPVSVALP--- 245

Query: 191 LHGFHVTNKLSDLKIGVYSMWNKQV--------DNPAITTALNNFIDELKLRGAXXXXXX 242
                V N L+ L  GV + W   +         +P + +A+       +  GA      
Sbjct: 246 -----VDNLLATLDAGV-TGWRIALATDAHFGEADPEVISAVRRAATVFEELGARVEAVD 299

Query: 243 XXX-XXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYIVSQQVR 301
                  A++  L+T          R +D  H F     + +      T+++YI++++ +
Sbjct: 300 LSQGREAAQMNALMTTSDAAAFHRDRLRDHPHRFGADVLARMERGAQFTSTEYILARRFQ 359

Query: 302 TRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANFAGV 361
           +   R L  LF +Q DL+LTPAT ITAP I       G   +     + R     N AG+
Sbjct: 360 SEWRRRLERLF-DQFDLLLTPATPITAPVI------EGLDSIEAARQLTRCTAPFNLAGL 412

Query: 362 PAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKP 409
           PA+S+P G     LPIGLQ +A  ++EA +LR  +  E      R+ P
Sbjct: 413 PALSLPCGLSAAGLPIGLQIVAAPWNEARVLRAGRAFENATQWHRQTP 460



>gi|154295346|ref|XP_001548109.1| hypothetical protein BC1G_13254 [Botryotinia fuckeliana B05.10]
          Length = 591

 Score =  191 bits (485), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 136/419 (32%), Positives = 207/419 (49%), Gaps = 41/419 (9%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDAT-IIERLREKGA 59
           T RY   + L +LDG+P  +KD+ DV GY ++ G K  +    A  ++T I+++ ++ GA
Sbjct: 173 TLRYQQGNPLSILDGVPTGIKDDSDVAGYRSHGGRKKNDLLFIAAKESTWIVQQWQKSGA 232

Query: 60  IILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGG 119
           +I+GK +MHE+G  +TNNNP   TP+NP+N +YYP              L P A+G DGG
Sbjct: 233 LIMGKLNMHELGSDTTNNNPNWGTPKNPHNYNYYPGGSSGGPAYAVSSGLIPFALGSDGG 292

Query: 120 GSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPK 179
           GS+RIPSSFCG+YGLK +  R  + G      +V V+GP+A+++ DL +AY +MA  +P 
Sbjct: 293 GSIRIPSSFCGLYGLKPSHSRVQNTGS-----TVTVNGPLASTMADLEVAYRIMAKPNPS 347

Query: 180 DP-NTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL-KLRGAX 237
           DP   L  P  +L             IG+Y  W  + + P++      F+D   K  G  
Sbjct: 348 DPVAALFSPPESLRAARPK------VIGIYKDWFDRAE-PSVHDLCTKFVDHCEKSLGYT 400

Query: 238 XXXXXXXXXXXARIAHLLTIGTELTTVAKRHKD----KMHLFSCPTRSNINVMKLAT--- 290
                       ++AH +TI   LT +A R K+      +     T SN  ++ +     
Sbjct: 401 VVPITIPYCPEGQLAHAMTI---LTNMASRAKNLPFSASNWLKDATPSNKILLTMGAYTP 457

Query: 291 ASDYIVSQQVRTRIMRTLNNLFSNQVDLIL-TPATAITAPKI-YPRALAHGEVDVTMISD 348
           A DY+++QQ+R  +M+ L+ LF     LI+ TP T I   +I +   L HG  D      
Sbjct: 458 ARDYLLAQQLRNLLMQHLSFLFKKYPGLIIVTPTTPIPGWEIEHEGDLQHGAFDPNKSLR 517

Query: 349 IMRFVQLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRK 407
            M +V +A F     V              L    +W +E  L++  K +E  LG   +
Sbjct: 518 NMEYVWVAQFHRGSGV--------------LIVCLEWGEEEVLIQSGKEAEVWLGRENE 562



>gi|408394679|gb|EKJ73879.1| hypothetical protein FPSE_06002 [Fusarium pseudograminearum CS3096]
          Length = 626

 Score =  191 bits (484), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 138/435 (31%), Positives = 209/435 (48%), Gaps = 42/435 (9%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATI----IERLRE 56
           T RY     LG LDGIP A+KD+ D+ GYE  +G+K  NY   A S  +I    + +L++
Sbjct: 182 TIRYREGRPLGPLDGIPAAIKDDFDMDGYEMTMGSKN-NYAGKAVSTGSITNWCVGKLQD 240

Query: 57  KGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGR 116
            G I+LGK +MHE G  +T NNP   TP NP+N  YY               L PIA+G 
Sbjct: 241 AGVIVLGKLNMHEFGMDTTGNNPNHGTPLNPFNPKYYSGGSSSGAGYAVGAGLIPIALGG 300

Query: 117 DGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGK 176
           D GGS+RIP+S+C ++GLK T GR S       A +  V GP+AA +  LA  Y ++A  
Sbjct: 301 DAGGSIRIPASYCSVFGLKPTHGRLSSFPTPNPAPTCCVQGPIAADMYSLATVYDIIADP 360

Query: 177 DPKD--PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR 234
            P    P    +P         +  L+ L +G+Y  W   +  P + T     ID+L   
Sbjct: 361 HPTSRFPRLYREP---------SRPLAKL-LGIYEPWF-DLAAPGVQTITRRMIDKLCTE 409

Query: 235 -GAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASD 293
                           +IAH +T+  +  ++     +     +   +  + + +   A D
Sbjct: 410 YNYEIVPITIPFTEEGQIAHAMTVLADAASLLPESANT----TAANKLLLAMGRTTPAGD 465

Query: 294 YIVSQQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIYPRA--LAHGEVDVTMISDIM 350
           Y+++Q++R  +M+ L +L+      +I+TP TA     I   A  L HG  D  +  + M
Sbjct: 466 YVLAQKLRNLLMQHLAHLWQMHPGMMIITPTTACGGAPIRRGASELKHGLSDGDLTIESM 525

Query: 351 RFVQLANFAGVPAVSVPAGY-------------DDN---NLPIGLQFIAKWYDEATLLRI 394
            +V LANF G+P++S+PAG+             D+N    +PIGL    +W  E TLL  
Sbjct: 526 TYVWLANFCGMPSLSIPAGFVVPVGQERAGEEADENTVGKVPIGLMATGEWCSEKTLLEF 585

Query: 395 AKTSEEILGNRRKKP 409
              +E +   +R +P
Sbjct: 586 GVEAEAVGSEKRCRP 600



>gi|490967398|ref|WP_004829199.1| hypothetical protein [Acinetobacter bereziniae]
 gi|479978969|gb|ENV22824.1| hypothetical protein F963_01075 [Acinetobacter bereziniae NIPH 3]
          Length = 472

 Score =  190 bits (483), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 133/413 (32%), Positives = 203/413 (49%), Gaps = 19/413 (4%)

Query: 5   ANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAIILGK 64
           A  S  G+  GIP+ +KD I + G  T + +K I+    ++ DAT+I +L+  GAII+GK
Sbjct: 66  AQGSYKGIFHGIPMGIKDNIYIGGEVTTMASK-IHANFISSDDATVISKLKAAGAIIIGK 124

Query: 65  TSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGSVRI 124
            +MHE  +G TNN+P     RNP+N D  P              +  I +G D  GS+RI
Sbjct: 125 LNMHEYAWGITNNSPHFGPCRNPWNLDKIPGGSSGGSGAAVASGMSTITLGTDTAGSIRI 184

Query: 125 PSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDPNTL 184
           PSS CG+ GLK T G  +  G +PLA ++   GPMA +V D A    V+AG D +DP + 
Sbjct: 185 PSSACGLVGLKPTHGLVAKYGCFPLAWTLDHIGPMAKTVADAAAMLKVIAGFDERDPTSK 244

Query: 185 HQPLPTLHGFHVTNKLSDLK---IGV-YSMWNKQVDNPAITTALNNFIDELKLRGAXXXX 240
           H  +P     ++    SD+K   IG+    +  QVD P I   +   I +L+ RGA    
Sbjct: 245 HVEIPD----YIALLNSDVKGKVIGINEDYFFHQVDAP-IEKLVREQIAQLEQRGAIIKK 299

Query: 241 XXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHL----FSCPTRSNINVMKLATASDYIV 296
                   A    L+T  +E  T+   H D +      F    R    + +L TA +Y+ 
Sbjct: 300 VTIPALKNAEYVELVTSLSEAATI---HHDDLQQRPNDFGDDIRLLFELGELPTAVEYLQ 356

Query: 297 SQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLA 356
           +QQ+R  + +     F  ++D+++ P   I  P I           V +++ I+RF   +
Sbjct: 357 AQQLRRELKQQFAQAF-KEIDVLIAPTLPILPPDIGSSVAKLNGERVDLLNHIIRFTGPS 415

Query: 357 NFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKP 409
           N  G+PA+++P G  D   P+GLQ I   + E  +  IA   EE +    ++P
Sbjct: 416 NLTGLPALTIPCGLIDGQ-PVGLQIIGPAFQEPKVFNIALAIEEQVKFNYQQP 467



>gi|302413167|ref|XP_003004416.1| amidase [Verticillium albo-atrum VaMs.102]
 gi|261356992|gb|EEY19420.1| amidase [Verticillium albo-atrum VaMs.102]
          Length = 609

 Score =  190 bits (483), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 133/448 (29%), Positives = 210/448 (46%), Gaps = 34/448 (7%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVG-----TKFINYGNPATSD----ATII 51
           T RY    SLG LDG+P AVKDE DV GY T  G      +F+  G  A  +    +  +
Sbjct: 151 TIRYNEKRSLGPLDGVPTAVKDEYDVLGYRTTQGGIHDYAEFLEVGPGARGNVGQPSWCV 210

Query: 52  ERLREKGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCP 111
            +L E GA+I GK S+HE G  +   N F  TPRNPY+  YY               + P
Sbjct: 211 SKLEEAGAVIYGKLSLHEFGMDTAGYNIFHGTPRNPYDPSYYTGGSSSGCGYAVATGIVP 270

Query: 112 IAIGRDGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYY 171
           +++G DGGGS+R+P+SFC ++GLK T GR S       + + AV GP+A+ +  L   Y 
Sbjct: 271 LSMGADGGGSIRLPASFCSVFGLKPTHGRVSFYPGQNHSGTAAVRGPIASDMRSLVALYE 330

Query: 172 VMAGKDPKDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSM-WNKQVDNPAITTALNNFIDE 230
           V +  DP+         P    F  +++    KI  + + W  + D P +     N ID 
Sbjct: 331 VTSVPDPQ------SFFPPAKPFDFSSEGEQTKILGFPIDWISRAD-PEVQKICQNLIDR 383

Query: 231 L-KLRGAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLA 289
           L   +G              +IAH +T+ T+ +++ +  K      S   R  + + +  
Sbjct: 384 LVDQKGYTVVPIDIPLVAEGQIAHAITLLTDASSLVQSTKG----ISPANRILLALGRTT 439

Query: 290 TASDYIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITA--PKIYPRALAHGEVDVTMIS 347
            A D++++Q++R  +M  L+ L+     +I+   T+ +A  P    + L +G  D     
Sbjct: 440 PAWDFLLAQKLRRVLMEHLSWLWQQHPGMIIVTPTSASAGWPIRNEKELKYGISDGDQTM 499

Query: 348 DIMRFVQLANFAGVPAVSVPAGYD----------DNNLPIGLQFIAKWYDEATLLRIAKT 397
             M +V LAN+ GVP+++VPAGY              +P+GL    +W  E  LLR    
Sbjct: 500 KTMEYVWLANYCGVPSITVPAGYAMAEGKTGSAVSPTVPVGLMGTGEWCSEEALLRFGLD 559

Query: 398 SEEILGNRRKKPSDKFWFGNYVQEVSEN 425
           +E++  +  + P +    G   ++  E 
Sbjct: 560 AEDVGHDILRHPPNWVDVGRLAKQEKER 587



>gi|342873848|gb|EGU75958.1| hypothetical protein FOXB_13528 [Fusarium oxysporum Fo5176]
          Length = 582

 Score =  190 bits (483), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 139/440 (31%), Positives = 209/440 (47%), Gaps = 41/440 (9%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKF---INYGNPATSDATIIERLREK 57
           TERYA    LG+LDG+PI VKD+ DVKG+  ++G K+   I         +  +++L+E 
Sbjct: 163 TERYAAGKPLGVLDGVPIGVKDDTDVKGFHNHIGMKYDPSIETFKEQKESSWPVKKLQEA 222

Query: 58  GAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRD 117
           GA+++GK +MHE+G  ++  N    TP N  N  YYP              + PIA+G D
Sbjct: 223 GAVVIGKNAMHELGSDTSGCNAAQGTPTNWLNKSYYPGGSSSGGSSTVSAGVVPIAVGTD 282

Query: 118 GGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKD 177
            GGS+RIP +F G+YGLKTT  R        + +++ ++GP+AA+V DL +AY VM+   
Sbjct: 283 AGGSIRIPPTFNGVYGLKTTHNRTMF-----MNNTMCITGPIAATVADLTIAYRVMS--- 334

Query: 178 PKDPNTLHQPLPTLH---GFHVTN---KLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL 231
                   QP P  H    F  ++   K     +G+Y  W  + D P +    +  +D L
Sbjct: 335 --------QPNPDCHIQSRFARSDPPPKGQKKVMGIYRDWWNKAD-PRVKEVCDRAVDYL 385

Query: 232 KLR-GAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRH----KDKMHLFSCPTRSNINVM 286
             + G             A++AH +   TE+   A+R      D + L     +  ++V 
Sbjct: 386 ANKCGYEIIDITIPYIPEAQLAHSVVCITEMAESARRRTPNPADWLSLVGPANKVVMSVG 445

Query: 287 KLATASDYIVSQQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIYPRALAHGEVDVTM 345
               A+D +    +R  IM+ L  LF      LI+TP + +    I P   A+G  D   
Sbjct: 446 TRTPAADMLKYGALRELIMQHLAYLFQKHPGLLIMTPTSPLIGWPIVPGDQAYGMSDTNT 505

Query: 346 ISDIMRFVQLANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNR 405
               M +V LAN  G PAVS P GY D +     Q   +W  E  LL  A  +EE L N 
Sbjct: 506 TIRNMLYVFLANLTGTPAVSAPVGYVDPD-----QGEGEWGSEEQLLAWATEAEEYLHNA 560

Query: 406 ----RKKPSDKFWFGNYVQE 421
               R++P +     + V++
Sbjct: 561 TESGRRRPDEWLDVADLVKQ 580



>gi|399172514|emb|CCE26661.1| related to amidase [Claviceps purpurea 20.1]
          Length = 597

 Score =  190 bits (483), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 141/432 (32%), Positives = 203/432 (46%), Gaps = 42/432 (9%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKF----INYGNPATSDATIIERLRE 56
           T R+A    L +LDG+PI VKD++DV+GY  ++G K+      +   A S A  ++ L++
Sbjct: 171 TARWAAGKPLSILDGVPIGVKDDLDVEGYRNHIGMKYNAKSRTFDRQAKS-AWCVQVLQD 229

Query: 57  KGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGR 116
            GA++LGK  MHE+G           TP N  N +YYP              + P+ +G 
Sbjct: 230 AGAVVLGKNRMHELGSAGQIAQ---GTPTNHMNNEYYPGGSSSGPASALCSGMVPLTLGT 286

Query: 117 DGGGSVRIPSSFCGIYGLKTTCGR--FSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMA 174
           D GGS+RIP+SF G+YGLK +  R  F D        S+ V+GPMAA+V DL + Y  M 
Sbjct: 287 DAGGSIRIPASFNGLYGLKPSHHRAGFMDS-------SMCVTGPMAANVADLTIGYRFMT 339

Query: 175 GKDPKD--PNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDEL- 231
             DP D       + LP           +   +GVY  W    D P +    N  +D   
Sbjct: 340 QADPSDGVQAAFARSLPPAPS-------AKKVMGVYRDWWNAAD-PDVAQHCNKAMDYFA 391

Query: 232 KLRGAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRH----KDKMHLFSCPTRSNINVMK 287
           + RG             A++AH +    E+   A+R      D + L S   +  ++V  
Sbjct: 392 QQRGYEVVDISIPHLGDAQLAHGIICLVEMAEGARRRTTNPADWLSLVSPSNKLLLSVAT 451

Query: 288 LATASDYIVSQQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIYPRALAHGEVDVTMI 346
              A+DY+    +RT +MR   +LF      LI++P T +     +P    HG  D    
Sbjct: 452 ATPAADYLKFNAMRTLLMRHFAHLFRKYPGLLIMSPTTPLAGWPKHPGDEMHGLNDGNTA 511

Query: 347 SDIMRFVQLANFAGVPAVSVPAGY-----DDNNLPIGLQFIAKWYDEATLLRIAKTSEEI 401
              M ++ LAN  G P+VSVP GY      D +LPIGL   A+W  E  LL+ A  +EE 
Sbjct: 512 LRNMMYIFLANLTGTPSVSVPVGYAPAKQGDGDLPIGLLATAEWGAEEQLLQFAGEAEEY 571

Query: 402 LGNR----RKKP 409
           L  R    R++P
Sbjct: 572 LHVRYPDGRRRP 583



>gi|338730589|ref|YP_004659981.1| amidase [Thermotoga thermarum DSM 5069]
 gi|503698031|ref|WP_013932107.1| amidase [Thermotoga thermarum]
 gi|335364940|gb|AEH50885.1| Amidase [Thermotoga thermarum DSM 5069]
          Length = 452

 Score =  190 bits (482), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 130/407 (31%), Positives = 193/407 (47%), Gaps = 24/407 (5%)

Query: 2   ERYANNSSLGL--LDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGA 59
           E+ A N+      L GIPIAVKD IDVKG  T  G+ F    N A  DA +++ LR+ GA
Sbjct: 63  EKVAKNADFEKQPLLGIPIAVKDLIDVKGVPTTAGSLFFKE-NIAKEDAFVVKLLRKAGA 121

Query: 60  IILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGG 119
           II+GKT++HEI  G TNNNP     RNPY+                   +   A+G D G
Sbjct: 122 IIVGKTNLHEIALGVTNNNPHFGPCRNPYDKSKISGGSSGGSAVAVATGMALAALGTDTG 181

Query: 120 GSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPK 179
           GS+RIP++ CG+ GLK T G  S  G  PLA  +   GP+ +SV+D  L + +    D  
Sbjct: 182 GSIRIPAALCGVVGLKPTYGVVSTSGVIPLAWHLDHVGPITSSVEDAHLIFRITRKYDRN 241

Query: 180 DPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXXX 239
           +P ++ +       + V   LS L++ V      +  +  I   + +    L+  G    
Sbjct: 242 NPYSVTRV------YKVKRNLSRLRVAVAVGEYIEEADQRILELVRDIAKSLEKMGFSVE 295

Query: 240 XXXXXXXXXARIAHLLTIGTELTTVAKRHKDKM----HLFSCPTRSNINVMKLATASDYI 295
                       A++L    E  T    HK+++     +F    R  +      + +DY 
Sbjct: 296 QKKLDWLKDLAAANVLMTQVEAATF---HKERLLKNPEMFGSDVRERLMQGLNTSGTDYA 352

Query: 296 VSQQVRTRIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQL 355
           ++++ +T         F  + DLIL P T ITAP I       GE  V M   + RF   
Sbjct: 353 LARKTQTEAKHIFREFF-KEYDLILLPTTPITAPPI------EGENAVAMARKLTRFTAP 405

Query: 356 ANFAGVPAVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEIL 402
            N +G+PA++VP G+ D  LP G+Q +A W++E  L  + +  E I+
Sbjct: 406 FNISGLPALTVPVGFVD-GLPAGVQLVASWFEEELLFFVGQKIESIV 451



>gi|494595593|ref|WP_007353852.1| amidase [Oscillatoria sp. PCC 6506]
 gi|300337370|emb|CBN54627.1| amidase [Oscillatoria sp. PCC 6506]
          Length = 463

 Score =  190 bits (482), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 131/394 (33%), Positives = 184/394 (46%), Gaps = 16/394 (4%)

Query: 11  GLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAIILGKTSMHEI 70
           G L G+P AVK+  D+ G  T  G K      PATSDAT++ RL++ GAI++G  +M E 
Sbjct: 72  GPLAGVPFAVKNLFDIAGVTTLAGAKINQETPPATSDATLVTRLKQAGAILVGAQNMDEY 131

Query: 71  GFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGSVRIPSSFCG 130
            +G    N      RNP++T                  L P+++G D  GS+R+PS+ CG
Sbjct: 132 AYGFVTENSHYGPTRNPHDTTRVAGGSSGGSAAAVAGGLVPLSLGSDTNGSIRVPSALCG 191

Query: 131 IYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDPNTLHQPLPT 190
           I+GLK T GR S  G YP   S+   GP A SV D+A  Y ++ G DP DP   ++P P 
Sbjct: 192 IFGLKPTYGRLSRAGAYPFVGSLDHVGPFARSVRDIAAVYDILQGSDPADPVCTNRP-PE 250

Query: 191 LHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLRGAXXXXXXXXXXXXAR 250
           L    ++  +  L+I V   +  Q   P    A+      L                 AR
Sbjct: 251 LCLPQLSRGIEGLRIAVADGYFAQGAEPEALAAVETVARALNC----TATVTIPEAHRAR 306

Query: 251 IAHLLTIGTE-----LTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYIVSQQVRTRIM 305
            A  +    E     L  +  R +D    F   TR       L  A+ YI +Q+ R    
Sbjct: 307 AAAFVITACEGANLHLANLRSRPQD----FDPATRDRFLAGALIPATWYIQAQRFRQWYR 362

Query: 306 RTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANFAGVPAVS 365
             +  +F N VD+IL PAT I AP I    +     +V +  ++  F Q  +F G+P  S
Sbjct: 363 DRVREIFQN-VDIILAPATPICAPPIGLEKMTIAGEEVVIRPNLGIFTQPLSFIGLPIAS 421

Query: 366 VPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSE 399
           VP     N LP+G+Q IA  Y+EA +LR+A   E
Sbjct: 422 VPI-QRPNALPLGVQIIAAPYNEALILRVAAMLE 454



>gi|302881723|ref|XP_003039772.1| hypothetical protein NECHADRAFT_72189 [Nectria haematococca mpVI
           77-13-4]
 gi|256720639|gb|EEU34059.1| hypothetical protein NECHADRAFT_72189 [Nectria haematococca mpVI
           77-13-4]
          Length = 621

 Score =  189 bits (481), Expect = 9e-46,   Method: Compositional matrix adjust.
 Identities = 134/433 (30%), Positives = 212/433 (48%), Gaps = 38/433 (8%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPA----TSDATIIERLRE 56
           T RY N   +G LDGIP ++KD+ D  GY T++G+   +Y   A    +S +  + +L E
Sbjct: 175 TLRYKNGQPIGPLDGIPSSIKDDYDYDGYATSLGS-VNDYAEEAADGTSSTSWAVRKLEE 233

Query: 57  KGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGR 116
            GAII+GK  MHE G  +T NNP   TP NPYN  YY               + P+A+G 
Sbjct: 234 SGAIIIGKLHMHEYGLDTTGNNPHHGTPPNPYNPKYYTGGSSSGPAYAVSSGIIPLALGS 293

Query: 117 DGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGK 176
           DGGGS+RIP+S+C ++GLK T  R +       + + AV GP+A  ++ L  AY  +A  
Sbjct: 294 DGGGSIRIPASYCSLFGLKPTHNRITCWPGPNHSPTCAVQGPLAIDMESLVAAYETIA-- 351

Query: 177 DPKDPNTLHQPLPTLHGFHVTNKLSDLKIGVYSMWNKQVDNPAITTALNNFIDELKLR-G 235
           +P  P+T + PL       VT  L     G+Y  W  +  N ++   +   +D L  + G
Sbjct: 352 EPH-PSTQYPPLRLQPSPPVTKVL-----GIYEAWFSRA-NLSVQKLVRGLVDSLVAQYG 404

Query: 236 AXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLATASDYI 295
                         ++AH LT+ T+ +T+    +      +   +  +++ +   ++DY+
Sbjct: 405 YTVIPIEIPFAAEGQMAHALTVLTDASTLLVDTRT----ITPANKILLSLGRTTPSTDYL 460

Query: 296 VSQQVRTRIMRTLNNLFSNQVD-LILTPATAITAPKIYP--RALAHGEVDVTMISDIMRF 352
           ++Q++R  IM  L  L+      +I+TP T+     +      L++G  D +   + M +
Sbjct: 461 LAQKLRNLIMEHLAYLWKQYPGMMIITPTTSCAGWPVKSGQTELSYGLNDGSRTLESMEY 520

Query: 353 VQLANFAGVPAVSVPAGY----------------DDNNLPIGLQFIAKWYDEATLLRIAK 396
           V LANF G+PA++VPAGY                 +  +P+GL    +W  E  LLR   
Sbjct: 521 VWLANFCGLPAINVPAGYVVPEGSKGAGEIATKDTEGMVPVGLMATGEWCSEDALLRFGF 580

Query: 397 TSEEILGNRRKKP 409
            +E    +RR KP
Sbjct: 581 DAEAAGQDRRCKP 593



>gi|491174360|ref|WP_005032726.1| glutamyl-tRNA amidotransferase subunit A [Acinetobacter bereziniae]
 gi|480055631|gb|ENV94669.1| hypothetical protein F938_02855 [Acinetobacter bereziniae CIP
           70.12]
          Length = 472

 Score =  189 bits (480), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 131/407 (32%), Positives = 201/407 (49%), Gaps = 19/407 (4%)

Query: 11  GLLDGIPIAVKDEIDVKGYETNVGTKFINYGNPATSDATIIERLREKGAIILGKTSMHEI 70
           G+  GIP+ +KD I + G  T + +K I+    ++ DAT+I +L+  GAII+GK +MHE 
Sbjct: 72  GIFHGIPMGIKDNIYIGGEVTTMASK-IHANFISSDDATVISKLKAAGAIIIGKLNMHEY 130

Query: 71  GFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCPIAIGRDGGGSVRIPSSFCG 130
            +G TNN+P     RNP+N D  P              +  I +G D  GS+RIPSS CG
Sbjct: 131 AWGITNNSPHFGPCRNPWNLDKIPGGSSGGSGAAVASGMSTITLGTDTAGSIRIPSSACG 190

Query: 131 IYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYYVMAGKDPKDPNTLHQPLPT 190
           + GLK T G  +  G +PLA ++   GPMA +V D A    V+AG D +DP + H  +P 
Sbjct: 191 LVGLKPTHGLVAKYGCFPLAWTLDHIGPMAKTVADAAAMLKVIAGFDERDPTSKHVEIPD 250

Query: 191 LHGFHVTNKLSDLK---IGV-YSMWNKQVDNPAITTALNNFIDELKLRGAXXXXXXXXXX 246
               ++    SD+K   IG+    +  QVD P I   +   I +L+ RGA          
Sbjct: 251 ----YIALLNSDVKGKVIGINEDYFFHQVDAP-IEKLVREQIAQLEQRGAIIKKVTIPAL 305

Query: 247 XXARIAHLLTIGTELTTVAKRHKDKMHL----FSCPTRSNINVMKLATASDYIVSQQVRT 302
             A    L+T  +E  T+   H D +      F    R    + +L TA +Y+ +QQ+R 
Sbjct: 306 KNAEYVELVTSLSEAATI---HHDDLQQRPNDFGDDIRLLFELGELPTAVEYLQAQQLRR 362

Query: 303 RIMRTLNNLFSNQVDLILTPATAITAPKIYPRALAHGEVDVTMISDIMRFVQLANFAGVP 362
            + +     F  ++D+++ P   I  P I           V +++ I+RF   +N  G+P
Sbjct: 363 ELKQQFAQAFE-EIDVLIAPTLPILPPDIGSSVAKLNGERVDLLNHIIRFTGPSNLTGLP 421

Query: 363 AVSVPAGYDDNNLPIGLQFIAKWYDEATLLRIAKTSEEILGNRRKKP 409
           A+++P G  D   P+GLQ I   + E  +  IA   EE +    ++P
Sbjct: 422 ALTIPCGLIDGQ-PVGLQIIGPAFQEPKVFNIALAIEEQVKFNYQQP 467



>gi|346972563|gb|EGY16015.1| glutamyl-tRNA(Gln) amidotransferase subunit A [Verticillium dahliae
           VdLs.17]
          Length = 635

 Score =  189 bits (480), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 132/448 (29%), Positives = 211/448 (47%), Gaps = 34/448 (7%)

Query: 1   TERYANNSSLGLLDGIPIAVKDEIDVKGYETNVG-----TKFINYGNPATSD----ATII 51
           T RY    SLG LDG+P AVKDE DV GY T+ G      +F+  G  A  +    +  +
Sbjct: 177 TIRYNEKRSLGPLDGVPTAVKDEYDVLGYRTSQGGIHDYAEFLEVGPGARGNVGQPSWCV 236

Query: 52  ERLREKGAIILGKTSMHEIGFGSTNNNPFVCTPRNPYNTDYYPXXXXXXXXXXXXXXLCP 111
            +L E GA+I GK S+HE G  +   N F  TPRNPY+  YY               + P
Sbjct: 237 SKLEEAGAVIYGKLSLHEFGMDTAGYNIFHGTPRNPYDPSYYTGGSSSGCGYAVATGIVP 296

Query: 112 IAIGRDGGGSVRIPSSFCGIYGLKTTCGRFSDDGQYPLAHSVAVSGPMAASVDDLALAYY 171
           +++G DGGGS+R+P+SFC ++GLK T GR S       + + AV GP+A+ +  L   Y 
Sbjct: 297 LSMGADGGGSIRLPASFCSVFGLKPTHGRVSFYPGQNHSGTAAVRGPIASDMRSLIALYE 356

Query: 172 VMAGKDPKDPNTLHQPLPTLHGFHVTNKLSDLKI-GVYSMWNKQVDNPAITTALNNFIDE 230
           V +   P+         P    F  +++    K+ G+ + W  + D P +     N +D 
Sbjct: 357 VTSVPGPQ------SFFPPAKPFDFSSEGERTKVLGLPAKWISRAD-PEVQKICQNLMDR 409

Query: 231 L-KLRGAXXXXXXXXXXXXARIAHLLTIGTELTTVAKRHKDKMHLFSCPTRSNINVMKLA 289
           L   +G              +IAH LT+ T+ +++ +  K      S   R  + + +  
Sbjct: 410 LVDQKGYTVVPIDIPLVAEGQIAHALTLLTDASSLVQSTKG----ISPANRILLALGRTT 465

Query: 290 TASDYIVSQQVRTRIMRTLNNLFSNQVDLILTPATAITA--PKIYPRALAHGEVDVTMIS 347
            A D++++Q++R  +M  L+ L+     +I+   T+ +A  P    + L +G  D     
Sbjct: 466 PAWDFLLAQKLRRVLMEHLSWLWQQHPGMIIVTPTSASAGWPIRNEKELKYGISDGDQTM 525

Query: 348 DIMRFVQLANFAGVPAVSVPAGY----------DDNNLPIGLQFIAKWYDEATLLRIAKT 397
             M +V LAN+ GVP+++VPAGY              +P+GL    +W  E  LLR    
Sbjct: 526 KTMEYVWLANYCGVPSITVPAGYAMAEGKTGSATSPTVPVGLMGTGEWCSEEALLRFGLD 585

Query: 398 SEEILGNRRKKPSDKFWFGNYVQEVSEN 425
           +E++  +  + P +    G   ++  E 
Sbjct: 586 AEDVGRDILRHPPNWVDVGRLAKQEKER 613