BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10252_c0_seq1-m.96 5prime_partial 2-892(+) 297 (+)
         (296 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|495189579|ref|WP_007914369.1| type 11 methyltransferase [Kted...   146   6e-33   Ktedonobacter racemifer
gi|495194496|ref|WP_007919286.1| type 11 methyltransferase [Kted...   142   1e-31   
gi|495192558|ref|WP_007917348.1| Methyltransferase type 11 [Kted...   137   3e-30   Ktedonobacter racemifer
gi|384499478|gb|EIE89969.1| hypothetical protein RO3G_14680 [Rhi...   134   4e-29   Rhizopus delemar RA 99-880
gi|495197908|ref|WP_007922697.1| type 11 methyltransferase [Kted...   130   4e-28   Ktedonobacter racemifer
gi|511005353|gb|EPB86696.1| hypothetical protein HMPREF1544_0648...   129   1e-27   Mucor circinelloides f. circinelloides 1006PhL
gi|511010408|gb|EPB91632.1| hypothetical protein HMPREF1544_0155...   126   8e-27   Mucor circinelloides f. circinelloides 1006PhL
gi|495198348|ref|WP_007923137.1| type 11 methyltransferase [Kted...   121   2e-25   Ktedonobacter racemifer
gi|495195997|ref|WP_007920787.1| Methyltransferase type 11 [Kted...   117   4e-24   Ktedonobacter racemifer
gi|495198165|ref|WP_007922954.1| Methyltransferase type 11 [Kted...   113   5e-23   Ktedonobacter racemifer
gi|511003178|gb|EPB84590.1| hypothetical protein HMPREF1544_0868...   111   3e-22   Mucor circinelloides f. circinelloides 1006PhL
gi|384491034|gb|EIE82230.1| hypothetical protein RO3G_06935 [Rhi...   109   7e-22   Rhizopus delemar RA 99-880
gi|384498726|gb|EIE89217.1| hypothetical protein RO3G_13928 [Rhi...   108   2e-21   Rhizopus delemar RA 99-880
gi|511009362|gb|EPB90606.1| hypothetical protein HMPREF1544_0251...   108   2e-21   Mucor circinelloides f. circinelloides 1006PhL
gi|511006550|gb|EPB87860.1| hypothetical protein HMPREF1544_0538...   107   4e-21   Mucor circinelloides f. circinelloides 1006PhL
gi|401883649|gb|EJT47847.1| Methyltransferase type 11 [Trichospo...   106   6e-21   Trichosporon asahii var. asahii CBS 2479
gi|406702527|gb|EKD05542.1| Methyltransferase type 11 [Trichospo...   106   8e-21   Trichosporon asahii var. asahii CBS 8904
gi|511007540|gb|EPB88826.1| hypothetical protein HMPREF1544_0433...   105   1e-20   Mucor circinelloides f. circinelloides 1006PhL
gi|495193431|ref|WP_007918221.1| Methyltransferase type 11 [Kted...   104   3e-20   Ktedonobacter racemifer
gi|511004453|gb|EPB85823.1| hypothetical protein HMPREF1544_0740...   103   4e-20   Mucor circinelloides f. circinelloides 1006PhL
gi|511006549|gb|EPB87859.1| hypothetical protein HMPREF1544_0538...   103   5e-20   Mucor circinelloides f. circinelloides 1006PhL
gi|510999582|gb|EPB81197.1| hypothetical protein HMPREF1544_1210...   102   8e-20   Mucor circinelloides f. circinelloides 1006PhL
gi|495196550|ref|WP_007921340.1| Methyltransferase type 11 [Kted...   101   3e-19   Ktedonobacter racemifer
gi|384488579|gb|EIE80759.1| hypothetical protein RO3G_05464 [Rhi...   100   4e-19   Rhizopus delemar RA 99-880
gi|511004214|gb|EPB85591.1| hypothetical protein HMPREF1544_0768...   100   4e-19   Mucor circinelloides f. circinelloides 1006PhL
gi|384489746|gb|EIE80968.1| hypothetical protein RO3G_05673 [Rhi...   100   5e-19   Rhizopus delemar RA 99-880
gi|495196549|ref|WP_007921339.1| Methyltransferase type 11 [Kted...   100   8e-19   Ktedonobacter racemifer
gi|384484246|gb|EIE76426.1| hypothetical protein RO3G_01130 [Rhi...    99   2e-18   Rhizopus delemar RA 99-880
gi|384500386|gb|EIE90877.1| hypothetical protein RO3G_15588 [Rhi...    99   2e-18   Rhizopus delemar RA 99-880
gi|384502053|gb|EIE92544.1| hypothetical protein RO3G_17142 [Rhi...    99   2e-18   Rhizopus delemar RA 99-880
gi|511004042|gb|EPB85423.1| hypothetical protein HMPREF1544_0779...    99   2e-18   Mucor circinelloides f. circinelloides 1006PhL
gi|384484898|gb|EIE77078.1| hypothetical protein RO3G_01782 [Rhi...    97   4e-18   Rhizopus delemar RA 99-880
gi|511004033|gb|EPB85414.1| hypothetical protein HMPREF1544_0778...    97   4e-18   Mucor circinelloides f. circinelloides 1006PhL
gi|384500229|gb|EIE90720.1| hypothetical protein RO3G_15431 [Rhi...    96   8e-18   Rhizopus delemar RA 99-880
gi|384484014|gb|EIE76194.1| hypothetical protein RO3G_00898 [Rhi...    96   9e-18   Rhizopus delemar RA 99-880
gi|384499227|gb|EIE89718.1| hypothetical protein RO3G_14429 [Rhi...    96   1e-17   Rhizopus delemar RA 99-880
gi|511007051|gb|EPB88350.1| hypothetical protein HMPREF1544_0481...    96   1e-17   Mucor circinelloides f. circinelloides 1006PhL
gi|390595704|gb|EIN05108.1| S-adenosyl-L-methionine-dependent me...    96   1e-17   Punctularia strigosozonata HHB-11173 SS5
gi|511009368|gb|EPB90612.1| hypothetical protein HMPREF1544_0252...    96   2e-17   Mucor circinelloides f. circinelloides 1006PhL
gi|511001640|gb|EPB83106.1| hypothetical protein HMPREF1544_1014...    95   2e-17   Mucor circinelloides f. circinelloides 1006PhL
gi|511011209|gb|EPB92421.1| hypothetical protein HMPREF1544_0071...    95   2e-17   Mucor circinelloides f. circinelloides 1006PhL
gi|511006015|gb|EPB87336.1| hypothetical protein HMPREF1544_0586...    95   3e-17   Mucor circinelloides f. circinelloides 1006PhL
gi|511010507|gb|EPB91728.1| hypothetical protein HMPREF1544_0143...    94   3e-17   Mucor circinelloides f. circinelloides 1006PhL
gi|384490271|gb|EIE81493.1| hypothetical protein RO3G_06198 [Rhi...    94   3e-17   Rhizopus delemar RA 99-880
gi|384493124|gb|EIE83615.1| hypothetical protein RO3G_08320 [Rhi...    94   3e-17   Rhizopus delemar RA 99-880
gi|511004034|gb|EPB85415.1| hypothetical protein HMPREF1544_0778...    93   8e-17   Mucor circinelloides f. circinelloides 1006PhL
gi|511006590|gb|EPB87899.1| hypothetical protein HMPREF1544_0530...    93   9e-17   Mucor circinelloides f. circinelloides 1006PhL
gi|384496141|gb|EIE86632.1| hypothetical protein RO3G_11343 [Rhi...    92   1e-16   Rhizopus delemar RA 99-880
gi|380479314|emb|CCF43091.1| TAM domain methyltransferase [Colle...    92   1e-16   Colletotrichum higginsianum
gi|384496105|gb|EIE86596.1| hypothetical protein RO3G_11307 [Rhi...    91   4e-16   Rhizopus delemar RA 99-880
gi|511006275|gb|EPB87591.1| hypothetical protein HMPREF1544_0557...    91   5e-16   Mucor circinelloides f. circinelloides 1006PhL
gi|384483931|gb|EIE76111.1| hypothetical protein RO3G_00815 [Rhi...    90   6e-16   Rhizopus delemar RA 99-880
gi|392574788|gb|EIW67923.1| hypothetical protein TREMEDRAFT_6381...    89   9e-16   Tremella mesenterica DSM 1558
gi|393214636|gb|EJD00129.1| hypothetical protein FOMMEDRAFT_9172...    89   1e-15   Fomitiporia mediterranea MF3/22
gi|384491468|gb|EIE82664.1| hypothetical protein RO3G_07369 [Rhi...    89   1e-15   Rhizopus delemar RA 99-880
gi|511001982|gb|EPB83433.1| hypothetical protein HMPREF1544_0981...    89   1e-15   Mucor circinelloides f. circinelloides 1006PhL
gi|169854493|ref|XP_001833921.1| hypothetical protein CC1G_01598...    89   2e-15   Coprinopsis cinerea okayama7#130
gi|511002580|gb|EPB84010.1| hypothetical protein HMPREF1544_0920...    88   3e-15   Mucor circinelloides f. circinelloides 1006PhL
gi|477527332|gb|ENH79155.1| methyltransferase domain-containing ...    87   4e-15   Colletotrichum orbiculare MAFF 240422
gi|384491877|gb|EIE83073.1| hypothetical protein RO3G_07778 [Rhi...    87   4e-15   Rhizopus delemar RA 99-880
gi|384494573|gb|EIE85064.1| hypothetical protein RO3G_09774 [Rhi...    87   5e-15   Rhizopus delemar RA 99-880
gi|384486559|gb|EIE78739.1| hypothetical protein RO3G_03444 [Rhi...    87   5e-15   Rhizopus delemar RA 99-880
gi|291510280|gb|ADE10096.1| AdoMet-MTases [Tremella fuciformis]        87   6e-15   Tremella fuciformis
gi|384486101|gb|EIE78281.1| hypothetical protein RO3G_02985 [Rhi...    87   7e-15   Rhizopus delemar RA 99-880
gi|392574792|gb|EIW67927.1| hypothetical protein TREMEDRAFT_6381...    87   8e-15   Tremella mesenterica DSM 1558
gi|384497298|gb|EIE87789.1| hypothetical protein RO3G_12500 [Rhi...    86   8e-15   Rhizopus delemar RA 99-880
gi|392574793|gb|EIW67928.1| hypothetical protein TREMEDRAFT_5739...    86   9e-15   Tremella mesenterica DSM 1558
gi|384498349|gb|EIE88840.1| hypothetical protein RO3G_13551 [Rhi...    86   1e-14   Rhizopus delemar RA 99-880
gi|429850977|gb|ELA26202.1| methyltransferase domain-containing ...    86   1e-14   Colletotrichum gloeosporioides Nara gc5
gi|384488140|gb|EIE80320.1| hypothetical protein RO3G_05025 [Rhi...    85   2e-14   Rhizopus delemar RA 99-880
gi|510999200|gb|EPB80932.1| hypothetical protein HMPREF1544_1238...    84   3e-14   Mucor circinelloides f. circinelloides 1006PhL
gi|389744785|gb|EIM85967.1| hypothetical protein STEHIDRAFT_1475...    84   3e-14   Stereum hirsutum FP-91666 SS1
gi|429859026|gb|ELA33824.1| methyltransferase domain-containing ...    84   4e-14   Colletotrichum gloeosporioides Nara gc5
gi|511002906|gb|EPB84327.1| hypothetical protein HMPREF1544_0892...    84   5e-14   Mucor circinelloides f. circinelloides 1006PhL
gi|393246637|gb|EJD54146.1| S-adenosyl-L-methionine-dependent me...    84   6e-14   Auricularia subglabra TFB-10046 SS5
gi|393214528|gb|EJD00021.1| S-adenosyl-L-methionine-dependent me...    83   7e-14   Fomitiporia mediterranea MF3/22
gi|475669176|gb|EMT66938.1| Phosphoethanolamine N-methyltransfer...    83   9e-14   Fusarium oxysporum f. sp. cubense race 4
gi|392574789|gb|EIW67924.1| hypothetical protein TREMEDRAFT_6381...    83   1e-13   Tremella mesenterica DSM 1558
gi|342881065|gb|EGU82047.1| hypothetical protein FOXB_07450 [Fus...    82   1e-13   Fusarium oxysporum Fo5176
gi|242795021|ref|XP_002482494.1| phosphoethanolamine N-methyltra...    82   2e-13   Talaromyces stipitatus ATCC 10500
gi|384487154|gb|EIE79334.1| hypothetical protein RO3G_04039 [Rhi...    82   2e-13   Rhizopus delemar RA 99-880
gi|392586338|gb|EIW75675.1| hypothetical protein CONPUDRAFT_7730...    81   3e-13   Coniophora puteana RWD-64-598 SS2
gi|384485664|gb|EIE77844.1| hypothetical protein RO3G_02548 [Rhi...    81   3e-13   Rhizopus delemar RA 99-880
gi|511011743|gb|EPB92948.1| hypothetical protein HMPREF1544_0002...    81   3e-13   Mucor circinelloides f. circinelloides 1006PhL
gi|393221741|gb|EJD07225.1| S-adenosyl-L-methionine-dependent me...    81   3e-13   Fomitiporia mediterranea MF3/22
gi|302885854|ref|XP_003041818.1| hypothetical protein NECHADRAFT...    81   3e-13   Nectria haematococca mpVI 77-13-4
gi|392574791|gb|EIW67926.1| hypothetical protein TREMEDRAFT_6381...    81   4e-13   Tremella mesenterica DSM 1558
gi|384493293|gb|EIE83784.1| hypothetical protein RO3G_08489 [Rhi...    81   4e-13   Rhizopus delemar RA 99-880
gi|403412790|emb|CCL99490.1| predicted protein [Fibroporia radic...    80   5e-13   Fibroporia radiculosa
gi|384493763|gb|EIE84254.1| hypothetical protein RO3G_08964 [Rhi...    80   5e-13   Rhizopus delemar RA 99-880
gi|392594192|gb|EIW83517.1| S-adenosyl-L-methionine-dependent me...    80   5e-13   Coniophora puteana RWD-64-598 SS2
gi|511003877|gb|EPB85263.1| hypothetical protein HMPREF1544_0794...    80   6e-13   Mucor circinelloides f. circinelloides 1006PhL
gi|384483693|gb|EIE75873.1| hypothetical protein RO3G_00577 [Rhi...    80   6e-13   Rhizopus delemar RA 99-880
gi|242216589|ref|XP_002474101.1| predicted protein [Postia place...    80   6e-13   Postia placenta Mad-698-R
gi|510999402|gb|EPB81043.1| hypothetical protein HMPREF1544_1225...    80   8e-13   Mucor circinelloides f. circinelloides 1006PhL
gi|477534569|gb|ENH86104.1| methyltransferase domain-containing ...    80   8e-13   Colletotrichum orbiculare MAFF 240422
gi|384500734|gb|EIE91225.1| hypothetical protein RO3G_15936 [Rhi...    79   1e-12   Rhizopus delemar RA 99-880
gi|511000432|gb|EPB81971.1| hypothetical protein HMPREF1544_1128...    79   1e-12   Mucor circinelloides f. circinelloides 1006PhL
gi|429858695|gb|ELA33506.1| methyltransferase domain-containing ...    79   1e-12   Colletotrichum gloeosporioides Nara gc5
gi|299743279|ref|XP_001835655.2| hypothetical protein CC1G_03437...    79   1e-12   Coprinopsis cinerea okayama7#130
gi|384485109|gb|EIE77289.1| hypothetical protein RO3G_01993 [Rhi...    79   2e-12   Rhizopus delemar RA 99-880
gi|472585357|gb|EMS22911.1| methyltransferase type 11 [Rhodospor...    79   2e-12   Rhodotorula toruloides NP11
gi|392571088|gb|EIW64260.1| hypothetical protein TRAVEDRAFT_1583...    79   2e-12   Trametes versicolor FP-101664 SS1
gi|384500413|gb|EIE90904.1| hypothetical protein RO3G_15615 [Rhi...    79   2e-12   Rhizopus delemar RA 99-880
gi|170089965|ref|XP_001876205.1| predicted protein [Laccaria bic...    78   2e-12   Laccaria bicolor S238N-H82
gi|399170960|emb|CCE28054.1| uncharacterized protein CPUR_01528 ...    78   3e-12   Claviceps purpurea 20.1
gi|242222589|ref|XP_002477008.1| predicted protein [Postia place...    78   3e-12   Postia placenta Mad-698-R
gi|390603017|gb|EIN12409.1| hypothetical protein PUNSTDRAFT_1242...    78   3e-12   Punctularia strigosozonata HHB-11173 SS5
gi|302888902|ref|XP_003043337.1| hypothetical protein NECHADRAFT...    78   3e-12   Nectria haematococca mpVI 77-13-4
gi|342320225|gb|EGU12167.1| Proteophosphoglycan ppg4 [Rhodotorul...    78   3e-12   Rhodotorula toruloides ATCC 204091
gi|477510784|gb|ENH63694.1| Demethylmenaquinone methyltransferas...    77   4e-12   Fusarium oxysporum f. sp. cubense race 1
gi|475670269|gb|EMT67638.1| Demethylmenaquinone methyltransferas...    77   4e-12   Fusarium oxysporum f. sp. cubense race 4
gi|302886185|ref|XP_003041983.1| hypothetical protein NECHADRAFT...    77   5e-12   Nectria haematococca mpVI 77-13-4
gi|170106044|ref|XP_001884234.1| predicted protein [Laccaria bic...    77   5e-12   Laccaria bicolor S238N-H82
gi|399171424|emb|CCE27614.1| uncharacterized protein CPUR_01088 ...    77   6e-12   Claviceps purpurea 20.1
gi|384496097|gb|EIE86588.1| hypothetical protein RO3G_11299 [Rhi...    77   6e-12   Rhizopus delemar RA 99-880
gi|399170964|emb|CCE28058.1| uncharacterized protein CPUR_01532 ...    77   6e-12   Claviceps purpurea 20.1
gi|393214573|gb|EJD00066.1| S-adenosyl-L-methionine-dependent me...    77   6e-12   Fomitiporia mediterranea MF3/22
gi|85095489|ref|XP_960101.1| hypothetical protein NCU05841 [Neur...    77   6e-12   Neurospora crassa OR74A
gi|212539277|ref|XP_002149794.1| conserved hypothetical protein ...    77   7e-12   Talaromyces marneffei ATCC 18224
gi|449549146|gb|EMD40112.1| hypothetical protein CERSUDRAFT_8139...    76   9e-12   Gelatoporia subvermispora B
gi|399166203|emb|CCE32995.1| uncharacterized protein CPUR_06918 ...    76   9e-12   Claviceps purpurea 20.1
gi|426198624|gb|EKV48550.1| hypothetical protein AGABI2DRAFT_192...    76   1e-11   Agaricus bisporus var. bisporus H97
gi|302887855|ref|XP_003042815.1| hypothetical protein NECHADRAFT...    76   1e-11   Nectria haematococca mpVI 77-13-4
gi|392587262|gb|EIW76596.1| S-adenosyl-L-methionine-dependent me...    76   1e-11   Coniophora puteana RWD-64-598 SS2
gi|409082773|gb|EKM83131.1| hypothetical protein AGABI1DRAFT_125...    76   1e-11   Agaricus bisporus var. burnettii JB137-S8
gi|399170491|emb|CCE28868.1| uncharacterized protein CPUR_02558 ...    76   1e-11   Claviceps purpurea 20.1
gi|399164450|emb|CCE34654.1| uncharacterized protein CPUR_08588 ...    76   1e-11   Claviceps purpurea 20.1
gi|342881933|gb|EGU82712.1| hypothetical protein FOXB_06767 [Fus...    76   1e-11   Fusarium oxysporum Fo5176
gi|384493937|gb|EIE84428.1| hypothetical protein RO3G_09138 [Rhi...    76   1e-11   Rhizopus delemar RA 99-880
gi|399170480|emb|CCE28857.1| uncharacterized protein CPUR_02546 ...    75   1e-11   Claviceps purpurea 20.1
gi|399166185|emb|CCE32977.1| uncharacterized protein CPUR_06899 ...    75   1e-11   Claviceps purpurea 20.1
gi|389750229|gb|EIM91400.1| hypothetical protein STEHIDRAFT_4960...    75   2e-11   Stereum hirsutum FP-91666 SS1
gi|302881379|ref|XP_003039604.1| hypothetical protein NECHADRAFT...    75   2e-11   Nectria haematococca mpVI 77-13-4
gi|399166191|emb|CCE32983.1| uncharacterized protein CPUR_06906 ...    75   2e-11   Claviceps purpurea 20.1
gi|495194818|ref|WP_007919608.1| type 11 methyltransferase [Kted...    75   2e-11   
gi|399166192|emb|CCE32984.1| uncharacterized protein CPUR_06907 ...    75   2e-11   Claviceps purpurea 20.1
gi|302902186|ref|XP_003048600.1| hypothetical protein NECHADRAFT...    75   2e-11   Nectria haematococca mpVI 77-13-4
gi|426196999|gb|EKV46927.1| hypothetical protein AGABI2DRAFT_119...    75   2e-11   Agaricus bisporus var. bisporus H97
gi|393214529|gb|EJD00022.1| hypothetical protein FOMMEDRAFT_5320...    75   2e-11   Fomitiporia mediterranea MF3/22
gi|302917172|ref|XP_003052390.1| hypothetical protein NECHADRAFT...    75   2e-11   Nectria haematococca mpVI 77-13-4
gi|399167619|emb|CCE31634.1| uncharacterized protein CPUR_05487 ...    75   2e-11   Claviceps purpurea 20.1
gi|477522885|gb|ENH74927.1| hypothetical protein FOC1_g10002472 ...    75   2e-11   Fusarium oxysporum f. sp. cubense race 1
gi|393214533|gb|EJD00026.1| S-adenosyl-L-methionine-dependent me...    75   2e-11   Fomitiporia mediterranea MF3/22
gi|399166187|emb|CCE32979.1| uncharacterized protein CPUR_06901 ...    75   2e-11   Claviceps purpurea 20.1
gi|302884878|ref|XP_003041333.1| hypothetical protein NECHADRAFT...    75   2e-11   Nectria haematococca mpVI 77-13-4
gi|495190294|ref|WP_007915084.1| type 11 methyltransferase [Kted...    75   3e-11   Ktedonobacter racemifer
gi|259479962|tpe|CBF70661.1| TPA: hypothetical protein ANIA_0587...    74   3e-11   Aspergillus nidulans FGSC A4
gi|408396178|gb|EKJ75342.1| hypothetical protein FPSE_04470 [Fus...    74   4e-11   Fusarium pseudograminearum CS3096
gi|399170468|emb|CCE28845.1| uncharacterized protein CPUR_02534 ...    74   4e-11   Claviceps purpurea 20.1
gi|409082776|gb|EKM83134.1| hypothetical protein AGABI1DRAFT_118...    74   5e-11   Agaricus bisporus var. burnettii JB137-S8
gi|317147688|ref|XP_003189941.1| hypothetical protein AOR_1_1634...    74   6e-11   Aspergillus oryzae RIB40
gi|302886149|ref|XP_003041965.1| hypothetical protein NECHADRAFT...    74   6e-11   Nectria haematococca mpVI 77-13-4
gi|336256943|ref|XP_003343500.1| hypothetical protein SMAC_09744...    74   6e-11   Sordaria macrospora k-hell
gi|500253840|gb|EON97487.1| hypothetical protein UCRPA7_7099 [To...    74   6e-11   Phaeoacremonium minimum UCRPA7
gi|393238105|gb|EJD45643.1| hypothetical protein AURDEDRAFT_1139...    73   7e-11   Auricularia subglabra TFB-10046 SS5
gi|302885268|ref|XP_003041526.1| predicted protein [Nectria haem...    73   7e-11   Nectria haematococca mpVI 77-13-4
gi|399170476|emb|CCE28853.1| uncharacterized protein CPUR_02542 ...    73   7e-11   Claviceps purpurea 20.1


>gi|495189579|ref|WP_007914369.1| type 11 methyltransferase [Ktedonobacter racemifer]
 gi|297549711|gb|EFH83577.1| Methyltransferase type 11 [Ktedonobacter racemifer DSM 44963]
          Length = 279

 Score =  146 bits (369), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 77/259 (29%), Positives = 140/259 (54%), Gaps = 15/259 (5%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILE 87
            P+ND E+ +        H +++    GN ++P++          +LDVGCGT   W  E
Sbjct: 21  LPRNDEEINR----LDFQHYILRATLKGNALAPLQ------NPTSILDVGCGTG-RWCQE 69

Query: 88  LSKTYPLAKFIGLDLLTPL-LPKDFS-QNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAA 145
           ++ TYP A  +G DL++PL LP+     +  +FVQ ++L+GLPF   S D+VH R L  A
Sbjct: 70  IAVTYPQATIVGFDLVSPLSLPRSPEFPDTCRFVQGNVLEGLPFAPQSFDYVHQRLLVFA 129

Query: 146 FTERQWEEVVIKELVRVCKPGGWIELLEIDVDGKSLGPTSKRIISACMAKFENRGVNGLI 205
              ++W   V +ELV+V +PGGW+EL+E+D+  + +GP S ++ +        +G++  +
Sbjct: 130 LPTQRWPGEV-QELVKVTRPGGWVELVEVDIAFEQMGPASTQLATWITEASRRKGIDPSM 188

Query: 206 SEEIPEFFESTNQVEIYAEEKYSPIGNWGDELGKLALDFFVSIFSS-SDELIEWIKVSKE 264
           +       E+     I   +  +P+G+WG  +G +A     ++  +   +++  + VS  
Sbjct: 189 TRRTQTLLEAAGLTNIMHRQVPNPVGSWGGRIGTMAATGVQAVNKAMRQQVLSQLGVSPA 248

Query: 265 EYEHMIAQYIKEVEIYRSY 283
           +Y+  +A  ++E + Y+SY
Sbjct: 249 QYDQALATSLEEYDRYKSY 267



>gi|495194496|ref|WP_007919286.1| type 11 methyltransferase [Ktedonobacter racemifer]
 gi|297547873|gb|EFH81740.1| Methyltransferase type 11 [Ktedonobacter racemifer DSM 44963]
          Length = 321

 Score =  142 bits (357), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 75/259 (28%), Positives = 138/259 (53%), Gaps = 15/259 (5%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILE 87
            P+ND E+ +        H +++    GN ++P++          +LDVGCGT   W  E
Sbjct: 63  LPRNDEEINR----LDFQHYILRATLKGNALAPLQHPTS------ILDVGCGT-GRWCQE 111

Query: 88  LSKTYPLAKFIGLDLLTPLLPKDFSQ--NNLQFVQSDILKGLPFEDGSIDFVHMRCLTAA 145
           ++ TYP A  +G DL++PL      Q  +  +FVQ ++L+GLPF   S D+VH R L  A
Sbjct: 112 MAVTYPQATVVGFDLVSPLALLRSPQFPDTCRFVQGNVLEGLPFAPQSFDYVHQRLLVFA 171

Query: 146 FTERQWEEVVIKELVRVCKPGGWIELLEIDVDGKSLGPTSKRIISACMAKFENRGVNGLI 205
              ++W    I+ELV+V +PGGW+E++E+D+  + +GP S ++ +        +G++  +
Sbjct: 172 LPTQRWPGE-IQELVKVTRPGGWVEIVEVDITFEQMGPASTQLATWITEASRQKGIDPSM 230

Query: 206 SEEIPEFFESTNQVEIYAEEKYSPIGNWGDELGKLALDFFVSIFSS-SDELIEWIKVSKE 264
           +       +      I  ++  +P+G+WG  +G +A     +I  +   +++  + VS  
Sbjct: 231 ARRAQTLLKVAGLTNIVYQQVPNPVGSWGGRIGTMAATGVQAINKAMRQQVLSQLGVSPV 290

Query: 265 EYEHMIAQYIKEVEIYRSY 283
           +Y+  +A  ++E + Y+SY
Sbjct: 291 QYDQALATSLEEYDSYKSY 309



>gi|495192558|ref|WP_007917348.1| Methyltransferase type 11 [Ktedonobacter racemifer]
 gi|297551358|gb|EFH85224.1| Methyltransferase type 11 [Ktedonobacter racemifer DSM 44963]
          Length = 298

 Score =  137 bits (346), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 77/226 (34%), Positives = 119/226 (52%), Gaps = 9/226 (3%)

Query: 46  HELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTP 105
           H L+++ +  N++SPI Q     KD  +LDVG GT   W  E+++ +P A   G DL+  
Sbjct: 56  HFLLRQAFQSNYLSPITQ----PKD--ILDVGAGT-GRWADEMAQVFPQAFVTGCDLVEQ 108

Query: 106 LLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKP 165
              K F Q N +FV++D+LKGLPF D S DFVH R L  A     W   ++ ELVRV +P
Sbjct: 109 TTDKSFKQPNYRFVEADVLKGLPFRDRSFDFVHQRLLFLAIPAHSWPSELL-ELVRVARP 167

Query: 166 GGWIELLEIDVDGKSLGPTSKRIISACMAKFENRGVNGLISEEIPEFFESTNQVEIYAEE 225
           GGWIEL+E ++  ++ GP ++R+    +   + RG++      +  +  +     +    
Sbjct: 168 GGWIELVESEIQARNAGPATQRMGQWIIEVSKRRGIDSSQVPNLGTYLNNAGLQNVVTRS 227

Query: 226 KYSPIGNWGDELGKLALDFFVSIFSSSDELI-EWIKVSKEEYEHMI 270
              P+G WG  +G +      S + +   LI   + +S EEYE  I
Sbjct: 228 VTVPMGQWGGRVGSMMAANINSAYQAMKPLITSQLGISPEEYEKNI 273



>gi|384499478|gb|EIE89969.1| hypothetical protein RO3G_14680 [Rhizopus delemar RA 99-880]
          Length = 396

 Score =  134 bits (336), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 83/253 (32%), Positives = 137/253 (54%), Gaps = 9/253 (3%)

Query: 44  LLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLL 103
           L H +++    GN+++P+   L+  K  K+LDVGCG   +W +E++  YP +  IG+D+ 
Sbjct: 148 LQHFMIRFAIQGNYLAPVHDMLR--KGSKILDVGCGPG-TWSMEIAGEYPKSTVIGIDM- 203

Query: 104 TPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVC 163
           TPL P++   +N  F Q ++L  LPFED S D+V MR +    +  QW   ++KEL R+ 
Sbjct: 204 TPLFPREIKPSNCAFYQCNLLNKLPFEDSSFDYVFMRFMNQGISADQWLN-LLKELSRIL 262

Query: 164 KPGGWIELLEIDVDGKSLGPTSKRIISACMAKFENRGVNGLISEEIPEFFESTNQVEIYA 223
           KP GWIE +E D +    GP +K      +   E+   +  + + + E  + TNQ    +
Sbjct: 263 KPNGWIEWVEADNEIHRPGPITKEFNQQLIQLMEHHQQDPSLGKHLQEKLKETNQFNHIS 322

Query: 224 EEKYS-PIGNWGDELGKLALDFFVSIFSSSDELI-EWIKVSKEEYEHMIAQYIKEVEIYR 281
               S P G W  +LGKL +  + + + +   L+ E   V+++EY   + Q  +E + ++
Sbjct: 323 SMFVSCPGGQWAGKLGKLTMQAWKAYYQALRPLLCELWGVTEKEYTEKLKQCWREADEHK 382

Query: 282 SYFINIKF-YCQK 293
           + F NI F Y QK
Sbjct: 383 T-FENIHFCYAQK 394



>gi|495197908|ref|WP_007922697.1| type 11 methyltransferase [Ktedonobacter racemifer]
 gi|297546375|gb|EFH80243.1| Methyltransferase type 11 [Ktedonobacter racemifer DSM 44963]
          Length = 301

 Score =  130 bits (328), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 80/269 (29%), Positives = 134/269 (49%), Gaps = 15/269 (5%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILE 87
           FPK+  E ++        H  +K + GGN+V+PI+   +      +LDVGCGT   W  E
Sbjct: 45  FPKDMPEYDR----LTFQHYFLKTLLGGNYVAPIDSPRR------ILDVGCGTGI-WGRE 93

Query: 88  LSKTYPLAKFIGLDLLTPLLPKDFSQ--NNLQFVQSDILKGLPFEDGSIDFVHMRCLTAA 145
           +++ +P  + +G D+    L     +  +N  FVQ ++L+GLPF D   DF H R + AA
Sbjct: 94  MAQPFPGTQVVGFDIEPHTLVSHVIEMPSNCLFVQGNVLQGLPFSDHDFDFTHQRLMVAA 153

Query: 146 FTERQWEEVVIKELVRVCKPGGWIELLEIDVDGKSLGPTSKRIISACMAKFENRGVNGLI 205
              R W  VV  ELVRV +PGGWIEL+E     + +GP +++ +          G +  +
Sbjct: 154 LPARAWPYVV-SELVRVTRPGGWIELVEAADTFEHMGPMTRKFMEWWHNLESKTGFDASL 212

Query: 206 SEEIPEFFESTNQVEIYAEEKYSPIGNWGDELGKLALDFFVSIFSSSDELI-EWIKVSKE 264
              +P         ++       P+G WG   G+L      +IF++   +    +K+S++
Sbjct: 213 MTRLPTLLTKAGLSQVKESILQVPLGAWGGRGGELLAKDLHAIFTNLKPVYCTQLKLSEK 272

Query: 265 EYEHMIAQYIKEVEIYRSYFINIKFYCQK 293
           E++H + +  +E + + +YF     Y QK
Sbjct: 273 EFDHTLQKLPQEWDTHHTYFHFYITYGQK 301



>gi|511005353|gb|EPB86696.1| hypothetical protein HMPREF1544_06482 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 529

 Score =  129 bits (324), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 79/256 (30%), Positives = 137/256 (53%), Gaps = 15/256 (5%)

Query: 44  LLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLL 103
           L H +++    GN+++P+   L+  K  +VLD+GCG   SW +E++  YP +  IG+D+ 
Sbjct: 260 LQHFMIRFAIQGNYLAPVSDVLR--KGGRVLDIGCGPG-SWSMEIAGEYPKSTVIGVDI- 315

Query: 104 TPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVC 163
           TP  P++    N  F Q +IL  LPFEDG+ D++ MR +       +W   ++KEL+RV 
Sbjct: 316 TPNYPREIKPANCAFYQCNILTTLPFEDGTFDYIFMRFMGQGVGSDEWSP-LLKELLRVL 374

Query: 164 KPGGWIELLEIDVDGKSLGPTS----KRIISACMAKFENRGVNGLISEEIPEFFESTNQV 219
           KP GWIE +E D++    GP +    +++IS  M   ++  +   +   + E  E TN  
Sbjct: 375 KPNGWIEWIEADIEIHRPGPVTYEFNQKLISLMMENNQDAHIGSNLKSRLQEMDELTNIS 434

Query: 220 EIYAEEKYSPIGNWGDELGKLALDFFVSIFSSSDELI-EWIKVSKEEYEHMIAQYIKEVE 278
             +      P G W  +LG+L +  + + + +   L+ ++  +S  EY   + +  +E +
Sbjct: 435 TTFVS---CPGGQWAGKLGQLTMQSWKAYYQALRPLMCQYWDISPSEYNEKLKECWREAD 491

Query: 279 IYRSYFINIKF-YCQK 293
            Y++ F N+ F Y QK
Sbjct: 492 EYKT-FENVHFSYAQK 506



>gi|511010408|gb|EPB91632.1| hypothetical protein HMPREF1544_01554 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 450

 Score =  126 bits (316), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 87/279 (31%), Positives = 143/279 (51%), Gaps = 33/279 (11%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKN---KKDFKVLDVGCGTTCSW 84
            P N+ EL++  +    +H + K ++G NF +P++  L +   ++D  +LD+ CG   +W
Sbjct: 79  LPNNEQELDRLVQ----VHFIYKYLFGANFSAPVKDLLSSNPSRRDSGLLDIACGN-GTW 133

Query: 85  ILELSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDIL--KGLPFEDGSIDFVHMRCL 142
           ILE++  +P ++F G+D+L    P      N  F Q DIL  KGLP+ D   D++HMR +
Sbjct: 134 ILEMATEFPGSQFYGIDILA-NYPTTVKPANTFFCQYDILNPKGLPYPDDYFDYIHMRQV 192

Query: 143 TAAFTERQWEEVVIKELVRVCKPGGWIELLEIDVDGKSLGPTSKRIIS---ACMAKFENR 199
            + F+E+ W   V+KE+ R+ KPGG++EL +ID   +++GP S    +     M K+   
Sbjct: 193 YSCFSEQDW-VTVMKEIKRLLKPGGYVELRDIDPMLRNMGPISYNFFARFPPLMKKWH-- 249

Query: 200 GVNGL-------ISEEIPEFFESTNQVEIYAEEKYSPIGNWGDELGKLALDFFVSIFSSS 252
           GVN L       I  ++ +  +   QV         PIGN      +LAL  F S F   
Sbjct: 250 GVNILWARHMLDIMNDVGDMVDVHQQVNALQFGTSGPIGNMIQNSLRLALQSFRSFFEMH 309

Query: 253 DELIEWIKVSKEEYEHMIAQYIKEVEIYRSYFINIKFYC 291
           + L         +Y+ ++   ++E + Y SYF    +YC
Sbjct: 310 NNL------PGRDYDRVVNDIVEETKKYHSYF---NYYC 339



>gi|495198348|ref|WP_007923137.1| type 11 methyltransferase [Ktedonobacter racemifer]
 gi|297546640|gb|EFH80508.1| Methyltransferase type 11 [Ktedonobacter racemifer DSM 44963]
          Length = 305

 Score =  121 bits (304), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 80/272 (29%), Positives = 132/272 (48%), Gaps = 14/272 (5%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILE 87
           FPK+  E ++       L  ++      N+ +P+E   +      +LDVG GT   W  E
Sbjct: 45  FPKDMPEYDRLTFQHYFLKTMLNN---SNYAAPLEYPKR------ILDVGSGTGI-WGRE 94

Query: 88  LSKTYPLAKFIGLDL--LTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAA 145
           +++T+P A+ +G D+   TPL       +N  F+Q D+LKGLPF D   DF H R + AA
Sbjct: 95  MAQTFPGAQVVGFDIEAQTPLSHVLEIPSNCLFIQGDVLKGLPFSDNDFDFTHQRLMVAA 154

Query: 146 FTERQWEEVVIKELVRVCKPGGWIELLEIDVDGKSLGPTSKRIISACMAKFENRGVNGLI 205
              R W   V+ EL RV  PGG++EL++     +++GP +K+ +          G +  +
Sbjct: 155 LPARIW-PFVVSELTRVTHPGGYVELIDAADTFENMGPATKKYMEWWHKAERRTGFDASL 213

Query: 206 SEEIPEFFESTNQVEIYAEEKYSPIGNWGDELGKLALDFFVSIFSSSDELI-EWIKVSKE 264
             ++PE        +I       P+G W    G+L      +IF++        +K+S++
Sbjct: 214 MTKLPELLGQAGLQDIKDYTIKVPLGAWAGRGGELLAKDLHAIFANLKSFYCSTLKLSEQ 273

Query: 265 EYEHMIAQYIKEVEIYRSYFINIKFYCQKITS 296
           E+E M+    +E E + +YF     Y QK+ S
Sbjct: 274 EFETMLKALPREWENHHTYFHFYLAYGQKMMS 305



>gi|495195997|ref|WP_007920787.1| Methyltransferase type 11 [Ktedonobacter racemifer]
 gi|297548703|gb|EFH82570.1| Methyltransferase type 11 [Ktedonobacter racemifer DSM 44963]
          Length = 302

 Score =  117 bits (292), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 75/270 (27%), Positives = 130/270 (48%), Gaps = 12/270 (4%)

Query: 28  FPKNDLELEQDAKCSKLL---HELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSW 84
            P     L +DA+    L   H  +    G +++ P+  ++       +LDVG GT   W
Sbjct: 38  LPDAPYFLPKDAQEQNRLNFQHRCLYSAIGNHYLVPLRPDVTT-----ILDVGTGTGI-W 91

Query: 85  ILELSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTA 144
            +E+++ +P A  +G+D+    L +  S ++  F  +D+LKGLPF D   D+VH R L A
Sbjct: 92  PVEMARLFPQAHIVGVDISAASL-EFTSSSSYTFCLADVLKGLPFPDQQFDYVHQRLLVA 150

Query: 145 AFTERQWEEVVIKELVRVCKPGGWIELLEIDVDGKSLGPTSKRIISACMAKFENRGVNGL 204
           A    QW  V I+ELVRV +PGGWIELLEI V  +  GP +  +++    +   RG +  
Sbjct: 151 ALPATQWPSV-IQELVRVTRPGGWIELLEIGVTIQQAGPETTHLLTWMGERSRERGFDMG 209

Query: 205 ISEEIPEFFESTNQVEIYAEEKYSPIGNWGDELGKLALDFFVSIFSSSDELI-EWIKVSK 263
           +   + E         I  ++   P+G W   +G +     +S F +   +      +  
Sbjct: 210 LMSRLGEMLAQQGLEAIERQDIPVPLGEWAGHVGAMLKANVLSAFDALKGVYCTQANMPL 269

Query: 264 EEYEHMIAQYIKEVEIYRSYFINIKFYCQK 293
            ++E M+ +  +E E + + ++    Y ++
Sbjct: 270 GQFEAMVNRVAQEWEEHHASYVFHAAYGRR 299



>gi|495198165|ref|WP_007922954.1| Methyltransferase type 11 [Ktedonobacter racemifer]
 gi|297546517|gb|EFH80385.1| Methyltransferase type 11 [Ktedonobacter racemifer DSM 44963]
          Length = 314

 Score =  113 bits (283), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 72/245 (29%), Positives = 128/245 (52%), Gaps = 10/245 (4%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILE 87
            PK+D E+++        H ++++V  GN  +P +  L++++ + VLDVGCGT   W  E
Sbjct: 57  LPKDDQEIQR----LDYQHYILRQVLQGNISAPFQ--LESQQGY-VLDVGCGT-GRWASE 108

Query: 88  LSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFT 147
           ++ +YP  + IGLDL            N QF Q ++L+ LPF   S+ +VH R L AA  
Sbjct: 109 IATSYPHVQVIGLDLEEASSKASSRPLNYQFTQGNVLEKLPFPGESMAYVHQRLLVAAIP 168

Query: 148 ERQWEEVVIKELVRVCKPGGWIELLEIDVDGKSLGPTSKRIISACMAKFENRGVNGLISE 207
             +W  VV +EL RV + GGW+EL+E+       G  +++ ++      + RG++  +  
Sbjct: 169 AAKWPWVV-QELARVTRRGGWVELVEMGGGFVREGAATRQFMAWFRQLSQMRGIDLEVMG 227

Query: 208 EIPEFFESTNQVEIYAEEKYSPIGNWGDELGKLALDFFVSIFSSSDELI-EWIKVSKEEY 266
            +    +      +  +    P+G+WG  +G+L     +S + S   L  +++ +SKE +
Sbjct: 228 RLDVLLQQAGLHHVQKKTLKLPVGSWGGRMGELLARDMLSGWPSLQPLCQQYLNISKETF 287

Query: 267 EHMIA 271
           + +IA
Sbjct: 288 DAVIA 292



>gi|511003178|gb|EPB84590.1| hypothetical protein HMPREF1544_08685 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 475

 Score =  111 bits (277), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 53/161 (32%), Positives = 93/161 (57%), Gaps = 4/161 (2%)

Query: 45  LHELMKKVWGGNFVSPIEQELKNKKD-FKVLDVGCGTTCSWILELSKTYPLAKFIGLDLL 103
           +H ++K  + GNF +P+   L+N K   KVLD+GCG+  +WILE++  +P  +F G+D  
Sbjct: 186 MHYILKATFHGNFTAPVYNMLENSKHKTKVLDIGCGS-GTWILEMATEFPNTEFYGIDDC 244

Query: 104 TPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVC 163
            PL P     +N  F+  +ILKGLP+ D   D+VHMR +   F+  +   +++ E+ R+ 
Sbjct: 245 -PLFPTHIKPSNSHFLLHNILKGLPYPDNEFDYVHMRMMIFYFSPEEL-SLLLAEISRIM 302

Query: 164 KPGGWIELLEIDVDGKSLGPTSKRIISACMAKFENRGVNGL 204
           KPG + E+++     +  GP S ++++  + +  + G   L
Sbjct: 303 KPGAYFEIVDTGYTIRHAGPISNKVVNNDLKQMLHSGSTSL 343



>gi|384491034|gb|EIE82230.1| hypothetical protein RO3G_06935 [Rhizopus delemar RA 99-880]
          Length = 263

 Score =  109 bits (273), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 82/250 (32%), Positives = 124/250 (49%), Gaps = 25/250 (10%)

Query: 47  ELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTPL 106
           EL   +W   + SPI  +L   K  +VLD+GCG    W LE+++ YP +KF+G+D+    
Sbjct: 36  ELNHSLWNL-YKSPIHDKLM--KGIRVLDIGCGPGW-WTLEMARLYPKSKFVGIDMANVF 91

Query: 107 LPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPG 166
           + K+   +N+ F  ++    L FED S DFV  R L    T  Q+    I E+ RV K G
Sbjct: 92  ITKNMP-SNVTFKIANAGTRLEFEDQSFDFVFQRFLVMGLTTEQYLG-SIHEMKRVLKEG 149

Query: 167 GWIELLEIDVDGKSLGPTSKRIISACMAKFENRGVNGLISEEIPEFFEST--NQVEIYAE 224
           G IE+LE+  D ++ GP   +I S               + +IP +  +T  N ++I+  
Sbjct: 150 GSIEILELISDYQNRGPFLDKICSW--------------TNKIPNYLLNTGYNHIQIFNY 195

Query: 225 EKYSPIGNWGDELGKLALDFF-VSIFSSSDELIEWIKVSKEEYEHMIAQYIKEVEIYRSY 283
               PIG+WG ELGKL  D   +++ +    +     +  EEY H + +  KE E YR Y
Sbjct: 196 N--VPIGSWGGELGKLHFDIQKLALLAVGVMVTHLTLIKYEEYVHNLEEAFKEFEEYRVY 253

Query: 284 FINIKFYCQK 293
            +    Y  K
Sbjct: 254 TLYKLIYATK 263



>gi|384498726|gb|EIE89217.1| hypothetical protein RO3G_13928 [Rhizopus delemar RA 99-880]
          Length = 227

 Score =  108 bits (270), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 59/179 (32%), Positives = 101/179 (56%), Gaps = 5/179 (2%)

Query: 56  NFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTPLLPKDFSQNN 115
           NF +P+ Q L+  +   VLD  CG   +W LE++KT+P + F G+D+ + + P++    N
Sbjct: 6   NFHAPLHQPLE--QGITVLDSACGP-ATWTLEMAKTFPNSSFYGIDI-SSVFPENIKPAN 61

Query: 116 LQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIELLEID 175
           ++F+  +I K +PFED + D++H R +    TE  W+   + EL RV KPGG+IEL+E  
Sbjct: 62  IEFLTGNIAKSIPFEDNTFDYIHQRLVIVGLTEIDWQN-NLAELYRVLKPGGYIELVEPV 120

Query: 176 VDGKSLGPTSKRIISACMAKFENRGVNGLISEEIPEFFESTNQVEIYAEEKYSPIGNWG 234
           V+ +  GP +++ + A  +   +R +   I +E+ +   ST    I    K  P+ + G
Sbjct: 121 VELEHCGPLTRQNVEALHSVLTSRNMCPNIGQELHDRLLSTGFENITVIHKQIPMNHSG 179



>gi|511009362|gb|EPB90606.1| hypothetical protein HMPREF1544_02516 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 355

 Score =  108 bits (270), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 75/275 (27%), Positives = 139/275 (50%), Gaps = 23/275 (8%)

Query: 36  EQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKD------FKVLDVGCGTTCSWILELS 89
           +++A    +LH  +K  + GN V+P+ Q L+ K +       +VLDVGCG   +WILE++
Sbjct: 14  DEEADRMVILHFCIKYGFNGNIVAPVIQSLRVKPNQNDEYSARVLDVGCGPG-TWILEMA 72

Query: 90  KTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKG-LPFEDGSIDFVHMRCLTAAFTE 148
             +P  +F G+D+ T + P     +N +F Q D L+  LP+ED S +FV MR +    TE
Sbjct: 73  SEFPFTEFHGIDIRT-MFPTTIKPSNAKFTQHDFLQSTLPYEDNSFEFVRMRLMLVFITE 131

Query: 149 RQWEEVVIKELVRVCKPGGWIELLEIDVDGKSLGPTSKRIISACMAKFENRGVNGLISEE 208
            Q+   ++ E+ RV KP G+ E+L+ +      G   ++I++  + +  +  +  +  E 
Sbjct: 132 SQFFH-LLSEIRRVLKPDGYFEILDCEYQIHRPGILCEKILNRQLPQSLHNKLGTI--EH 188

Query: 209 IPEFFESTNQ------VEIYAEEKYSPIGNWGDELGKLA----LDFFVSIFSSSDELIEW 258
           +P    ST        V ++    + P+G WG +LG++     + + +SI     + +  
Sbjct: 189 MPSHHVSTALTLHGGFVNVHQRRIHIPVG-WGGQLGEVHAQNLMSYLLSIRPDIKQYLSM 247

Query: 259 IKVSKEEYEHMIAQYIKEVEIYRSYFINIKFYCQK 293
           +  S    + ++ + +KE  + +S+      Y QK
Sbjct: 248 LNGSDINIDELLMEAVKECTVRQSHVYWFACYGQK 282



>gi|511006550|gb|EPB87860.1| hypothetical protein HMPREF1544_05389 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 282

 Score =  107 bits (267), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 54/166 (32%), Positives = 101/166 (60%), Gaps = 7/166 (4%)

Query: 46  HELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTP 105
           H +++     NF +P++++L+  +   VLD GCG   +W+ +++K +P ++F G+D+ T 
Sbjct: 38  HVVLRYTLQSNFQAPLQEKLE--QGITVLDSGCGP-AAWVFDMAKDFPNSQFHGIDI-TS 93

Query: 106 LLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKP 165
             P D   +N +F  +++ +G+P+ D   D+VH R L    T+  W + V+KEL+RV KP
Sbjct: 94  TFPHDTKPSNCEFTVANLAEGIPYPDNYFDYVHQRLLILGLTDANW-DFVLKELLRVLKP 152

Query: 166 GGWIELLEIDVDGKSLGPTSKRIISACMAKFENRGVNGLISEEIPE 211
           GG+IEL E +++  ++GP  K++     +  +++G+   IS E+ E
Sbjct: 153 GGYIELHEANLN--NMGPLLKQLQYTMSSMLQSKGMPPKISNELQE 196



>gi|401883649|gb|EJT47847.1| Methyltransferase type 11 [Trichosporon asahii var. asahii CBS
           2479]
          Length = 320

 Score =  106 bits (265), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 97/194 (50%), Gaps = 23/194 (11%)

Query: 46  HELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTP 105
           H L+  ++GG   +PIE     K   KVLDVGCG   SWI ++   +P  +    D    
Sbjct: 75  HRLIGLLFGGTVSAPIEL----KTGSKVLDVGCGP-GSWIKQVKTEHPEIEAYATDFADT 129

Query: 106 LLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKP 165
             P D     ++FV  DILKGLPFED + D VHMR  T A    +W  V  KEL R+ +P
Sbjct: 130 FKPSDA---QVKFVHGDILKGLPFEDDTFDLVHMRFFTGALKVSEW-PVAAKELARITRP 185

Query: 166 GGWIELLEIDVDGKSLGPTSKRIISACMAKFENRGVNGLI---------SEEIPEFFEST 216
           GGW++++E D   +     S+R I+  +A +  RG+ G +           ++ EF  + 
Sbjct: 186 GGWVQMVEPDGTLR-----SERGITDAIADWNKRGMRGSLEKRGGEPNAGPKLHEFMAAA 240

Query: 217 NQVEIYAEEKYSPI 230
               I  + K +P+
Sbjct: 241 GLTNIDNKAKSAPM 254



>gi|406702527|gb|EKD05542.1| Methyltransferase type 11 [Trichosporon asahii var. asahii CBS
           8904]
          Length = 294

 Score =  106 bits (264), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 97/194 (50%), Gaps = 23/194 (11%)

Query: 46  HELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTP 105
           H L+  ++GG   +PIE     K   KVLDVGCG   SWI ++   +P  +    D    
Sbjct: 49  HRLIGLLFGGTVSAPIEL----KTGSKVLDVGCGP-GSWIKQVKTEHPEIEAYATDFADT 103

Query: 106 LLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKP 165
             P D     ++FV  DILKGLPFED + D VHMR  T A    +W  V  KEL R+ +P
Sbjct: 104 FKPSD---AQVKFVHGDILKGLPFEDDTFDLVHMRFFTGALKVSEW-PVAAKELARITRP 159

Query: 166 GGWIELLEIDVDGKSLGPTSKRIISACMAKFENRGVNGLI---------SEEIPEFFEST 216
           GGW++++E D   +     S+R I+  +A +  RG+ G +           ++ EF  + 
Sbjct: 160 GGWVQMVEPDGTLR-----SERGITDAIADWNKRGMRGSLEKRGGEPNAGPKLHEFMAAA 214

Query: 217 NQVEIYAEEKYSPI 230
               I  + K +P+
Sbjct: 215 GLTNIDNKAKSAPM 228



>gi|511007540|gb|EPB88826.1| hypothetical protein HMPREF1544_04335 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 286

 Score =  105 bits (262), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 55/150 (36%), Positives = 90/150 (60%), Gaps = 10/150 (6%)

Query: 49  MKKVWGGNFVSPIEQELK-NKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTPLL 107
           +K ++GGN++  + + +     + KVLD+GCG    W+++++  +P  +FIGLD +  L 
Sbjct: 98  LKALFGGNYLEEVGKRIDFESANTKVLDIGCGAG-GWVMDMATEHPATQFIGLDKVC-LF 155

Query: 108 PKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGG 167
           PK     N+ FVQ D   GLP++D + D VH+R    AF + Q+ E  +KE+ RV KP G
Sbjct: 156 PKCIRPANVSFVQHDATLGLPYKDNTFDLVHLRMFLIAFNKHQYAE-CMKEVFRVTKPNG 214

Query: 168 WIELLEIDV--DG----KSLGPTSKRIISA 191
            ++LLE+++  DG    K  G   +RI++A
Sbjct: 215 IVQLLEVEMVDDGDELVKQFGAAVERIMAA 244



>gi|495193431|ref|WP_007918221.1| Methyltransferase type 11 [Ktedonobacter racemifer]
 gi|297547201|gb|EFH81068.1| Methyltransferase type 11 [Ktedonobacter racemifer DSM 44963]
          Length = 306

 Score =  104 bits (260), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 73/257 (28%), Positives = 122/257 (47%), Gaps = 30/257 (11%)

Query: 46  HELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTP 105
           H  ++    GNFV+P+ +++++     +LDVG GT   W  E+++ +P A  +GLDL  P
Sbjct: 51  HYALRLALKGNFVAPLGEQVQH-----ILDVGSGTGI-WGQEMARQFPHAHIVGLDLEPP 104

Query: 106 L-----LPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELV 160
                        +N +F+Q D+LKGLPF   + D  H R L  A    QW   V+ ELV
Sbjct: 105 QTVSLSAAATLPPSNYRFLQGDVLKGLPFSAPTFDLTHQRLLVFAIPAAQW-PFVLGELV 163

Query: 161 RVCKPGGWIELLEIDVDG-KSLGPTSKRIISACMAKFENRGVNGLISEEIPEFFESTNQV 219
           RV    GW+ELL  D DG  S+GP  ++  +      + RG+   I   +    +     
Sbjct: 164 RVTHSQGWVELL--DFDGFYSMGPAMEQADAWLRRSLQARGIQMDIISTLDGILQHEANA 221

Query: 220 EIYAEEKYS------PIGNW--GDELGKLA----LDFFVSIFSSSDELIEWIKVSKEEYE 267
           +     +++      PIG W   D +G L     L+ F+++ S+   +   +++    Y+
Sbjct: 222 QGVQLHQFTKQWLDLPIGGWRSHDRIGPLVEKNILNLFLALKST---ICTHLQIEPATYD 278

Query: 268 HMIAQYIKEVEIYRSYF 284
            ++A   +E   Y +Y 
Sbjct: 279 RVLATLPQEWHQYYTYL 295



>gi|511004453|gb|EPB85823.1| hypothetical protein HMPREF1544_07405 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 330

 Score =  103 bits (258), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 79/269 (29%), Positives = 135/269 (50%), Gaps = 15/269 (5%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILE 87
            P +D E+E+     ++ H L K ++   + SP+E  LK+    KVLDV  G    W+++
Sbjct: 66  LPCDDEEIER----LQVNHLLFKSLFITQYFSPMEASLKS--GIKVLDVSTGPGW-WLID 118

Query: 88  LSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFT 147
           ++K +P + F G D +  + P      N  F   DI KGLPF D + DFV        ++
Sbjct: 119 MAKEFPKSHFTGCDEM--IYPISAPPTNCHFRVIDISKGLPFADDTFDFVTQHDALFRYS 176

Query: 148 ERQWEEVVIKELVRVCKPGGWIELLEIDVDGKSLGPTSKRIISACMAKFENRGVNGLISE 207
           ++ WE  V+ EL+RV KPGG++EL+E     + +GP     +       + R +N  I+ 
Sbjct: 177 QKDWE-TVLPELIRVLKPGGYVELVEPGGVIQDIGPNMSIWMMRLTVSLQTRDINLKIAT 235

Query: 208 EIPEFFESTNQVE-IYAEEKYSPIGNWGDELGKLALDFFVSIFSS-SDELIEWIKVSKEE 265
           ++    ES   ++ I A  + +PIG W    G + L+    +F +   +L E   +S  +
Sbjct: 236 QLEGMLESIGGLDKIEASHRSAPIG-WYGRNGDIMLEAIERLFDAIKPKLCEDWSMSSSK 294

Query: 266 YEHMIAQYIKEVEIYRSYFINIKF-YCQK 293
           Y+ ++     E   +RS+ +NI + + QK
Sbjct: 295 YDKVVQTASSECRDFRSW-LNIHYIFAQK 322



>gi|511006549|gb|EPB87859.1| hypothetical protein HMPREF1544_05388 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 333

 Score =  103 bits (258), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 98/177 (55%), Gaps = 10/177 (5%)

Query: 13  RDQKITKXXXXXXXXFPKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFK 72
           RD +           FP +D E ++  +     H +++     N+ +P+ Q L+  +   
Sbjct: 57  RDGRRYHADEKVSYLFPSDDDEADRVHQ----QHWILRYALQRNYHAPVTQLLQ--QGIT 110

Query: 73  VLDVGCGTTCSWILELSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDG 132
           VLD GCG   +W LE+ +TYP +KF G+D  + + P+    +N++F  ++I + +PF D 
Sbjct: 111 VLDSGCGP-ATWTLEMGETYPSSKFHGIDA-SSVFPESIKPSNVEFCVTNIAEKIPFSDN 168

Query: 133 SIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIELLEIDV-DGKSLGPTSKRI 188
           + D++H R L    T   WE   +KEL RV KPGG+IE++E D+ D +++GP   +I
Sbjct: 169 TFDYIHQRLLILGLTNDDWEN-ALKELYRVLKPGGYIEVVEPDMQDLRNMGPLLHKI 224



>gi|510999582|gb|EPB81197.1| hypothetical protein HMPREF1544_12102 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 319

 Score =  102 bits (255), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 78/267 (29%), Positives = 134/267 (50%), Gaps = 22/267 (8%)

Query: 36  EQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLA 95
           E++A   +L ++L+K  + G F  P +   ++    ++LDVGCG   SW ++LS  YP  
Sbjct: 29  EEEADRIQLKNDLVKLAFEGEFSLPFD--YRDLPSGRILDVGCGPG-SWCIDLSTKYPRI 85

Query: 96  KFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLP-FEDGSIDFVHMRCLTAAFTERQWEEV 154
           + IG+D       K    +N Q +  ++L GL  F + S D +H+R +  +FT  Q+ +V
Sbjct: 86  QVIGVDSDDMFPSKRNLPSNCQLLVCNVLDGLKEFPEASFDVIHIRFMVLSFTTTQYPQV 145

Query: 155 VIKELVRVCKPGGWIELLEIDVDGKSLGPTSKRIISACMAKFENRGVNGL-----ISEEI 209
           V K+  R+ KPGG+IE+LE D+   S GP + ++         +RG+N       +SE I
Sbjct: 146 V-KDCWRLLKPGGYIEILETDLTVHSPGPITMKLNEEMHEVSISRGLNPRRQTDKLSELI 204

Query: 210 PEFFESTNQVEIYAEEKYSPIGNWGDELGKLALDFFVSIFSSSDELI------EWIKVSK 263
           P     ++ +    + +  PIG WG  +G L  D  +++ +     +      E    +K
Sbjct: 205 P-----SDAINRQVKYRSIPIGVWGGRIGVLCRDDMINMLTKFQPAVQDYYKRENNSEAK 259

Query: 264 EEYEHMIAQYIKEVEIYRSYFINIKFY 290
             +   I   ++E++ Y+S F N  FY
Sbjct: 260 VAFNQNINTVLREMDQYKS-FSNYYFY 285



>gi|495196550|ref|WP_007921340.1| Methyltransferase type 11 [Ktedonobacter racemifer]
 gi|297549028|gb|EFH82895.1| Methyltransferase type 11 [Ktedonobacter racemifer DSM 44963]
          Length = 313

 Score =  101 bits (251), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 115/246 (46%), Gaps = 17/246 (6%)

Query: 45  LHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLT 104
           LH   ++V+ GN + P    L   K+ ++LDVG GT C W +E+++  P  +  GLDL  
Sbjct: 60  LHYFFRQVFKGNSLVP----LAFGKESRMLDVGTGTGC-WAIEMAEALPNVQVYGLDLQA 114

Query: 105 PLLPKDFSQN------NLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKE 158
           P      S        N  F   ++LK LPF +    FVH R L A+    QW   V++E
Sbjct: 115 PQDASARSHRHNHHPANYHFQPGNVLKHLPFREECFAFVHQRFLLASIPPAQW-YAVLRE 173

Query: 159 LVRVCKPGGWIELLEIDVDGKSLGPTSKRIISACMAKFENRGVNGLISEEIPEFFESTNQ 218
           L+RV +PGGWIEL+E        GP +++  S   A     G++   S  + E  +   Q
Sbjct: 174 LMRVTRPGGWIELVEGGTVLLDQGPATRQWFSWWEALAARSGLDLSRSSHLGELVQ---Q 230

Query: 219 VEIYAEEKY--SPIGNWGDELGKLALDFFVSIFSSSDELIEWIKVSKEEYEHMIAQYIKE 276
           V +         P+G WG ++G L     ++++       ++  ++  + + +  Q   E
Sbjct: 231 VGLTCRSSVIDLPVGAWGRQVGLLLQRHMLTVYDDFAAHAQYSGIAPTQLQAVRTQLQDE 290

Query: 277 VEIYRS 282
            +  RS
Sbjct: 291 WQTRRS 296



>gi|384488579|gb|EIE80759.1| hypothetical protein RO3G_05464 [Rhizopus delemar RA 99-880]
          Length = 259

 Score =  100 bits (250), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 59/182 (32%), Positives = 97/182 (53%), Gaps = 4/182 (2%)

Query: 46  HELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTP 105
           H   K+++ GN      + L  K+   VLDVGCG+   WI+++   YP   + G D++  
Sbjct: 36  HFAFKELFEGNISRKAHEVLNFKEGISVLDVGCGSGV-WIMDMINDYPNCTYHGCDIVDT 94

Query: 106 LLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKP 165
              K    +   +   ++L GLP+ED + DFV MR    A  + +W  + IKE++RV KP
Sbjct: 95  T-NKILKVDQFTYSYGNVLVGLPYEDNTFDFVQMRFFILALRKEEW-PLAIKEIIRVVKP 152

Query: 166 GGWIELLEIDVD-GKSLGPTSKRIISACMAKFENRGVNGLISEEIPEFFESTNQVEIYAE 224
           GG I+++E D++  K       R+I +  +   +RG + LI+ ++  FF  TN V+I   
Sbjct: 153 GGMIQVMEPDLELPKDSSSAYHRLIKSFHSVAHSRGQDFLIASQLEGFFLETNMVKIVEH 212

Query: 225 EK 226
           +K
Sbjct: 213 DK 214



>gi|511004214|gb|EPB85591.1| hypothetical protein HMPREF1544_07680, partial [Mucor
           circinelloides f. circinelloides 1006PhL]
          Length = 296

 Score =  100 bits (249), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 73/223 (32%), Positives = 113/223 (50%), Gaps = 15/223 (6%)

Query: 46  HELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTP 105
           H+ +     G F +PI  +L++     VLD GCG  C W ++++  Y  ++F G+D+L  
Sbjct: 42  HKAITTTLNGLFSAPISDQLED--GITVLDAGCGPGC-WSIDMAALYKNSQFHGVDILDS 98

Query: 106 LLPKDFSQ-NNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCK 164
            LPK  ++  N QFV  D++  +P+ D +  F++ R L+ AFT+ QW    +KEL RV K
Sbjct: 99  QLPKKSNKPANTQFVIGDLVDNIPYPDNTFGFIYQRLLSLAFTKEQWRR-NLKELQRVLK 157

Query: 165 PGGWIELLEIDVDGKSL--GPTSKRIISACMAKFENRGVNGLISEEIPEFFESTNQVEIY 222
           PGG++EL+E D   K L  GP  K+   A      +RG+   ++E + +  E     EI 
Sbjct: 158 PGGYVELIEYD-HRKMLEYGPLFKKEQEAIEKYQVSRGMYPYVAENLCDILEDAGFTEIK 216

Query: 223 AEEKYSPIGN--WGDELGKLALDFFVSIFSS-----SDELIEW 258
              K     N    D+  +L  D  +  F S     S+ L EW
Sbjct: 217 KSVKQQAFCNSDSADKGMELTGDAILCAFESLGPRLSEILPEW 259



>gi|384489746|gb|EIE80968.1| hypothetical protein RO3G_05673 [Rhizopus delemar RA 99-880]
          Length = 293

 Score =  100 bits (249), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 53/157 (33%), Positives = 88/157 (56%), Gaps = 4/157 (2%)

Query: 36  EQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLA 95
           +++A     LH ++K ++  NF+SP+   L ++K  +VLD+GCG   +W LE++  YP A
Sbjct: 137 DEEADRLTALHYILKVMFQWNFISPVHDLLASEKKHRVLDIGCGPG-TWTLEMATEYPNA 195

Query: 96  KFIGLDLLTPLLPKDFSQNNLQFVQSDILKG-LPFEDGSIDFVHMRCLTAAFTERQWEEV 154
            F G+D   P+ P      N  F   +ILKG LPFE+   DF++MR +    +  +    
Sbjct: 196 DFYGIDEC-PIFPTTIKPPNAHFQTHNILKGPLPFENEQFDFIYMRSMMLYLSPVELSN- 253

Query: 155 VIKELVRVCKPGGWIELLEIDVDGKSLGPTSKRIISA 191
           ++ E+ R+ KPG + E+++ D   +  GP S  II+ 
Sbjct: 254 LLSEIHRIMKPGSYFEVIDTDYTIRRAGPLSNSIINT 290



>gi|495196549|ref|WP_007921339.1| Methyltransferase type 11 [Ktedonobacter racemifer]
 gi|297549027|gb|EFH82894.1| Methyltransferase type 11 [Ktedonobacter racemifer DSM 44963]
          Length = 312

 Score = 99.8 bits (247), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 74/262 (28%), Positives = 123/262 (46%), Gaps = 31/262 (11%)

Query: 46  HELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDL--- 102
           H ++++   GN+V+PI    +++    +LDVG GT   W +E+++ +P A+  G+DL   
Sbjct: 64  HFILRQALMGNYVAPIHPGERSQ----ILDVGTGT-GRWAIEMAQNFPQAQVFGVDLEES 118

Query: 103 --------LTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEV 154
                    TPL        N  F   ++L+GLPF DG+ DFVH R L       +W + 
Sbjct: 119 RDITGHQSSTPL--------NYHFQAGNVLQGLPFLDGTFDFVHQRLLVTGIPFARWGD- 169

Query: 155 VIKELVRVCKPGGWIELLEIDVDGKSLGPTSKRIISACMAKFENRGVNGLISEEIPEFFE 214
           VI+EL+RV K GGWIE++E      + G  + +  +      +  G++     +I +   
Sbjct: 170 VIRELLRVTKAGGWIEMVEAGSTFVNSGAATAQWSAWSNTLMKPAGID---VYQITQLGA 226

Query: 215 STNQVEIYAEEKYS--PIGNWGDELGKLALDFFVSIFSS-SDELIEWIKVSKEEYEHMIA 271
              Q  +  E +    PIG WG  +G +     +SI+ S      + + VS      +  
Sbjct: 227 IVQQNGLACESRVYNIPIGAWGGRIGTMLQQDLLSIYESLVPRYQKALGVSPASTNLVRQ 286

Query: 272 QYIKEVEIYRSYFINIKFYCQK 293
           Q I+E E  ++ F     + QK
Sbjct: 287 QLIQEWERQQTLFSVFVVWGQK 308



>gi|384484246|gb|EIE76426.1| hypothetical protein RO3G_01130 [Rhizopus delemar RA 99-880]
          Length = 301

 Score = 98.6 bits (244), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 58/184 (31%), Positives = 95/184 (51%), Gaps = 18/184 (9%)

Query: 46  HELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTP 105
           H  +K+++GGN +S +   L  +K   VLD+GCG+   WI+++   YP + + G D++  
Sbjct: 52  HFALKELFGGNMLSSVSDALDFEKGVSVLDIGCGSGV-WIMDMINDYPNSTYHGCDIVD- 109

Query: 106 LLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKP 165
           ++ K    +   F   ++ KGLP+ D + DFVHMR L  A  + +W  V IKE +RV KP
Sbjct: 110 VVNKSMKLDQFTFNHGNVAKGLPYADNTFDFVHMRLLVYALRKDEW-PVAIKEAIRVVKP 168

Query: 166 GGWIELLEIDVDGKSLGPTSKRIISACMAKFEN--------RGVNGLISEEIPEFFESTN 217
           GG ++L+E +       P   +  S    KF          RG N  +  EI E   + +
Sbjct: 169 GGILQLVEGE-------PRLPKDTSCAYYKFTEAINNVGYMRGQNPRVILEIEELVAAND 221

Query: 218 QVEI 221
            +++
Sbjct: 222 NIKV 225



>gi|384500386|gb|EIE90877.1| hypothetical protein RO3G_15588 [Rhizopus delemar RA 99-880]
          Length = 512

 Score = 98.6 bits (244), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 82/265 (30%), Positives = 129/265 (48%), Gaps = 51/265 (19%)

Query: 46  HELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTP 105
           H  +K+++ GN +S + + +  K+   VLDVGCG+  +W+ +++  YP   + G D++  
Sbjct: 46  HFAIKELYQGNVLSEVTKIIDFKRGVSVLDVGCGSG-AWLTDMALNYPNCTYNGCDIVEV 104

Query: 106 ----LLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVR 161
               + P+ F+   LQ+   ++L GLPF D + DFV MR L  A  E +W  V +KEL+R
Sbjct: 105 ANKFVTPRQFT---LQY--GNVLAGLPFHDNTFDFVQMRLLIFALREEEW-PVAVKELLR 158

Query: 162 VCKPGGWIELLE-----IDVDGKSLGPTSKR---------------IISACMAKFENRGV 201
           V KPGG +++LE      D   KSL   S                 + S C A    RG 
Sbjct: 159 VTKPGGIVQILEPVLEIPDKAKKSLYRFSMTCNDLHYLILYINHSIVFSVCQA----RGQ 214

Query: 202 NGLISEEIPEFFESTNQVEIYAEEKYSPIGNWGDELGK-------LALDFFVSIFSSSDE 254
           N  I+ E+ + F   N V+I   E  S   N    + K        A +  + +FS S E
Sbjct: 215 NPRIAMEMEKIFMENNNVKIIQSECRSCNTNTRSSMAKNFAWDAIQAANSMMPLFSKSPE 274

Query: 255 LIEWIKVSKEEYEHMIAQYIKEVEI 279
           L      SK+E +    +++KE+E+
Sbjct: 275 L-----KSKQEQQ----KFLKELEV 290



>gi|384502053|gb|EIE92544.1| hypothetical protein RO3G_17142 [Rhizopus delemar RA 99-880]
          Length = 529

 Score = 98.6 bits (244), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 69/213 (32%), Positives = 109/213 (51%), Gaps = 28/213 (13%)

Query: 36  EQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLA 95
           EQD   ++  H L++  +G +F SPI  +L+  K   VLDVGCG   +W +E+   +P +
Sbjct: 239 EQDRMVAQ--HYLLRTAFGSDFCSPIRSQLQ--KGIIVLDVGCGPG-TWTMEMGTAFPKS 293

Query: 96  KFIGLDLLTPLLPKDFSQNNLQF------VQSDILKGLPFEDGSIDFVHMRCLTAAFTER 149
            FIG+D  +   PKD    N  F      VQ  +   LPF D SID+++ R +    T +
Sbjct: 294 TFIGIDQ-SAFFPKDIKPKNCHFRTCGHLVQHQL--PLPFPDNSIDYIYQRDMNWGLTGQ 350

Query: 150 QWEEVVIKELVRVCKPGGWIELLEIDVDGKSLGP------TSKRIISACMAKFENRGVNG 203
            W+  ++KE +R+ KPGGWIE++E D + ++  P        K I S C+   +   V+ 
Sbjct: 351 TWQ-ALLKEYLRILKPGGWIEVVEQDFETQN-SPENECYMNDKLIASLCLRMQDPYAVHR 408

Query: 204 LISEEIPEFFESTNQVEIYAEEKYSPIGNWGDE 236
           L +  +   F+S   +      K  P+G WG +
Sbjct: 409 LPTMLLFNGFDSIETI-----SKSCPLG-WGAD 435



>gi|511004042|gb|EPB85423.1| hypothetical protein HMPREF1544_07794 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 347

 Score = 98.6 bits (244), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 73/257 (28%), Positives = 126/257 (49%), Gaps = 16/257 (6%)

Query: 46  HELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTP 105
           H +++     N+ +P+  +L+  K   VLD GCG   +W  E+ + +P + F G+D  + 
Sbjct: 99  HWILRYALQSNYQAPVTDQLE--KGITVLDSGCGP-ATWTFEMGEAWPNSTFHGIDA-SC 154

Query: 106 LLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKP 165
           + P++    N++FV  +I K +P+ D + D+VH R L    T   WE   +KEL RV KP
Sbjct: 155 VFPENIKPANVEFVIGNIAKEIPYPDNTFDYVHQRLLLLGLTNDDWEN-ALKELYRVLKP 213

Query: 166 GGWIELLEIDV-DGKSLGPTSKRIISACMAKFENRGVNGLISEEIPEFFESTNQVEIYAE 224
           GG+IEL E D+ D +++GP  +++        ++R +   ++ E+ +       V    +
Sbjct: 214 GGYIELAEPDLQDLENMGPILRKLQYTMSDMLKSRNMPNKVACELEDRLIRAGFVNT--K 271

Query: 225 EKYSPIG-NWGDELGKLALDFFVSIFSSSDELI-----EWIKVSKEEYEHMIAQYIKEVE 278
            K +P+  N  D+ GKL  D +   +S+   ++     EW     E Y   +A    E E
Sbjct: 272 LKMTPLKLNHTDKAGKLLWDDYKHGYSNVRPVMAQIVPEWQDA--EVYARFLADCGVEAE 329

Query: 279 IYRSYFINIKFYCQKIT 295
             ++       Y QK T
Sbjct: 330 KNKTNVNWYACYAQKPT 346



>gi|384484898|gb|EIE77078.1| hypothetical protein RO3G_01782 [Rhizopus delemar RA 99-880]
          Length = 178

 Score = 97.4 bits (241), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 47/131 (35%), Positives = 79/131 (60%), Gaps = 3/131 (2%)

Query: 46  HELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTP 105
           H  +K ++ GN    I++ L ++ +  +LDVGCG+ C+WI +++  YP   F G D++  
Sbjct: 44  HFAIKDLFEGNMHPNIKEALDSEPNMTILDVGCGS-CTWIFDMASDYPQCDFHGCDIVD- 101

Query: 106 LLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKP 165
           +  K+   N   F   ++ + LP++D   DFV+ R L  A +E +W    I+E++RV KP
Sbjct: 102 VANKEMIPNQFTFQLGNVAQRLPYKDSMFDFVYARLLALALSEDEWPR-AIQEILRVTKP 160

Query: 166 GGWIELLEIDV 176
           GGWI+L++ DV
Sbjct: 161 GGWIQLVDADV 171



>gi|511004033|gb|EPB85414.1| hypothetical protein HMPREF1544_07785 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 351

 Score = 97.4 bits (241), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 56/167 (33%), Positives = 93/167 (55%), Gaps = 6/167 (3%)

Query: 46  HELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTP 105
           H +++     N+ +P+ + L+  +   VLD GCG   +W  E+ +TYP +KF G+D  + 
Sbjct: 103 HWILRAALECNYHAPVTKLLE--EGITVLDSGCGP-ATWAFEMGETYPRSKFHGIDA-SC 158

Query: 106 LLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKP 165
           + P+D    N++FV  ++ K +P+ D + D+VH R L    T+  WE   +KEL RV KP
Sbjct: 159 VFPEDIKPANVEFVIGNVAKHIPYPDSTFDYVHQRLLFLGLTDSDWES-TLKELYRVLKP 217

Query: 166 GGWIELLEIDVDG-KSLGPTSKRIISACMAKFENRGVNGLISEEIPE 211
           GG+I+L E DV    + GP+   + +      + RG+   I+ E+ E
Sbjct: 218 GGYIDLAEPDVQSLLTAGPSMFTLQTTLSNMSKARGMVPKIALELEE 264



>gi|384500229|gb|EIE90720.1| hypothetical protein RO3G_15431 [Rhizopus delemar RA 99-880]
          Length = 317

 Score = 96.3 bits (238), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 86/149 (57%), Gaps = 10/149 (6%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVWGG-NFVSPIEQELKNKKDFKVLDVGCGTTCSWIL 86
            PK+  E+EQD   S+  H  +K ++   N +  IE+ L   K   +LD+GCGT C W++
Sbjct: 53  LPKD--EIEQDRLNSQ--HFAVKALFNNKNILDSIEKSLP--KGAAILDIGCGTGC-WVM 105

Query: 87  ELSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAF 146
           E++  YP   F G+DL + + P      N +F   ++L GLPF D + DFV+MR +  AF
Sbjct: 106 EMAVNYPEHNFTGVDL-SDMFPTTIRPENAKFELMNVLGGLPFSDNTFDFVNMRFMATAF 164

Query: 147 TERQWEEVVIKELVRVCKPGGWIELLEID 175
              +W  ++IKE+ RV K  G +EL+E D
Sbjct: 165 CTNEW-PMIIKEIHRVLKDDGVVELMETD 192



>gi|384484014|gb|EIE76194.1| hypothetical protein RO3G_00898 [Rhizopus delemar RA 99-880]
          Length = 343

 Score = 96.3 bits (238), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 72/202 (35%), Positives = 102/202 (50%), Gaps = 26/202 (12%)

Query: 46  HELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTP 105
           H ++K+++ GN+      EL+N K  K+LD  CG    W LE+   +P  + IG+D+L+P
Sbjct: 147 HYILKQIFKGNY----HVELENPK--KILDSACGVGL-WSLEMGIAFPDCEIIGIDILSP 199

Query: 106 L------LPKDFSQ---NNLQFVQSDILKG-LPFEDGSIDFVHMRCLTAAFTERQWEEVV 155
                  L K  S    NN+QF   DI +  L F D + DFV  R +    +  +W  + 
Sbjct: 200 SEKYGQGLAKATSAGQINNVQFQYEDICQPTLSFSDSTFDFVFQRDVGTFMSYERWPNL- 258

Query: 156 IKELVRVCKPGGWIELLEIDVDGKSLGPTSKRI----ISACMAKFENRGVNGLISEEIPE 211
           +KE  R+ KPGG I+L+E D+   + GP    I    I+AC       GV    +  IPE
Sbjct: 259 MKEFYRIVKPGGKIQLVEYDIKYHNPGPVLTIINEWYIAACAVS----GVRSDYASFIPE 314

Query: 212 FFESTNQVEIYAEEKYSPIGNW 233
           F ES+  V I  EE   PIG W
Sbjct: 315 FMESSGFVNINREEFNVPIGEW 336



>gi|384499227|gb|EIE89718.1| hypothetical protein RO3G_14429 [Rhizopus delemar RA 99-880]
          Length = 341

 Score = 96.3 bits (238), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 88/169 (52%), Gaps = 13/169 (7%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILE 87
           +P N+ E  + +      H L K ++ GNF +P++  L N+   K LD+GCG   SW+ +
Sbjct: 46  YPSNEAEANRQSG----QHYLFKHLFQGNFFAPVDAIL-NQPGSKTLDIGCGPQASWLTD 100

Query: 88  LSKTYPLAKFIGLD---LLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTA 144
           ++  YP  +F G D   L    + +    NNL   ++D+  G  +E  + DFVH R +  
Sbjct: 101 MAMDYPQCEFHGFDIAELSFDEVERMHLPNNLILKRADLFDGFDYESNTFDFVHQRVMYN 160

Query: 145 AFTERQ--WEEVVIKELVRVCKPGGWIELLEIDVDGKSLGPTSKRIISA 191
            + + +  W   + +E++R+ KP GWIEL+E D+  K  GP     + A
Sbjct: 161 VYPQDKIPW---MFQEILRITKPNGWIELVEPDIKPKRAGPLFTTFVDA 206



>gi|511007051|gb|EPB88350.1| hypothetical protein HMPREF1544_04816 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 525

 Score = 95.5 bits (236), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 61/178 (34%), Positives = 98/178 (55%), Gaps = 14/178 (7%)

Query: 114 NNLQFVQSDILKG-LPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIELL 172
           +NL F Q +++   LPF D   DFV  R +TAAFT   W+ V + ELVRV KPGG+IELL
Sbjct: 320 HNLDFYQVNVVNAKLPFADNHFDFVKQRLVTAAFTTADWKRV-MAELVRVTKPGGYIELL 378

Query: 173 EIDVDGKSLGPTSKR----IISACMAKFENRGVNGLISEEIPEFFESTNQVEIYAEEKYS 228
           EID +  +LGP  ++    ++ A   K   R +   I+  + +  ++   +E+ ++    
Sbjct: 379 EIDYNTHNLGPNGRKWERELLEAARLK---RQMEPRIARHLADLLKTVGLIEVSSKLVSI 435

Query: 229 PIGNWGDELGKL---ALDFFVSIFSSSDELIEWIKVSKEEYEHMIAQYIKEVEIYRSY 283
           P+G+WG +LG+L    ++ F    S+S  L + + VS  EY +     I EV   +++
Sbjct: 436 PLGSWGLDLGELWKQNMENFAD--STSPLLSKLVGVSVNEYRNQWHSLIHEVRDKKAF 491



>gi|390595704|gb|EIN05108.1| S-adenosyl-L-methionine-dependent methyltransferase [Punctularia
           strigosozonata HHB-11173 SS5]
          Length = 421

 Score = 95.5 bits (236), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/272 (28%), Positives = 131/272 (48%), Gaps = 31/272 (11%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELK---NKKDFKVLDVGCGTTCSW 84
           +P    ELEQ+ +  +  H  ++ + G NFV P+ + L     + D  VLD+G GT   W
Sbjct: 116 YPLPADELEQNRQIVQ--HLCLQHLLGSNFVGPVPELLSPDGGEGDICVLDLGTGTG-RW 172

Query: 85  ILELSKTYPLAKFIGLDLLTPLLP-KDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLT 143
           ++E++  YP A F+G+D++ P+ P  DF   N+ F   +I++ L F + S D VH RC++
Sbjct: 173 VMEMAHQYPTAHFVGIDIV-PIYPASDF--ENVTFQLGNIMEPLNFANESFDIVHARCIS 229

Query: 144 AAFTERQWEEVVIKELVRVCKPGG------WIELL------EIDVDGKSLGPTSKRIISA 191
            +   R + E +++E+ RV KPGG      W          + D D     P  + +  A
Sbjct: 230 TSV--RDYPE-LLREIARVLKPGGLFIGGEWARRASFAPHRDPDRDLAVHAPGIQAMFEA 286

Query: 192 CMAKFENR-GVNGLISEEIPEFFESTNQVEIYAEEK-YSPIGNWGDELGKLALDF--FVS 247
             +   +R G++      +  +   T       EEK Y PIG+W       AL    + +
Sbjct: 287 ISSGLRDRKGIDRAFGPVMAAWLSDTGVFNYIVEEKFYMPIGDWPTHADASALRGVDYAA 346

Query: 248 IFS--SSDELIEWIKVSKEEYEHMIAQYIKEV 277
            FS  S D++ + +K+    +  +I +Y K +
Sbjct: 347 RFSRMSPDDITDHLKIVGNYFRAVIDRYAKNM 378



>gi|511009368|gb|EPB90612.1| hypothetical protein HMPREF1544_02522 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 410

 Score = 95.5 bits (236), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 58/194 (29%), Positives = 96/194 (49%), Gaps = 9/194 (4%)

Query: 46  HELMKKVWGGNFVSPIE--QELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLL 103
           H +++  +G ++ + I   ++ +      VLD+GCG+  +W +E++  +P A FIG+D  
Sbjct: 127 HYILRTAFGADYSASISLSEDQQGTSKTVVLDIGCGSG-TWTMEMATQFPHAHFIGVDKH 185

Query: 104 TPLLPKDFSQNNLQFVQSDILKG---LPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELV 160
               P D    N  F   DI +    LPF D S+D++  R L     E  W  +V KE  
Sbjct: 186 ASF-PHDIKPKNCHFKLFDISQSSVSLPFMDQSVDYIFQRDLNWDLAETTWLPLV-KEFF 243

Query: 161 RVCKPGGWIELLEIDVDGKSLGPTSKRIISACMAKFENRGVNGLISEEIPEFFESTNQVE 220
           R+ KPGGWIEL+E D++  S       + +  +  F +R  +  IS+ +  F        
Sbjct: 244 RILKPGGWIELVEPDIETYSTSAYEDFLTNKLIDAFHHRQQDPFISKRLSSFMAVAGFRR 303

Query: 221 IYAEEKYSPIGNWG 234
           I ++ +  P+G WG
Sbjct: 304 IQSDFQSIPLG-WG 316



>gi|511001640|gb|EPB83106.1| hypothetical protein HMPREF1544_10144 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 350

 Score = 95.1 bits (235), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 75/277 (27%), Positives = 135/277 (48%), Gaps = 26/277 (9%)

Query: 28  FPKNDLELEQDAKCSKLLHE---LMKKVWGGNFVSPIEQELK-NKKDFKVLDVGCGTTCS 83
            PK+D E+++       LHE   + K++ G N +    + L       +VLDV CG   +
Sbjct: 85  LPKDDKEIDR-------LHEEHFVTKELLGFNIMIEALKSLDFQNGGLEVLDVCCGP-AT 136

Query: 84  WILELSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLT 143
           W+ E S  YP  +F G+D+ + L P+     NL F ++++L+G+P+ D + DFV MR + 
Sbjct: 137 WLCETSLEYPNCRFTGIDMCS-LWPQVIRPVNLTFTEANVLQGIPYPDKTFDFVQMRFVV 195

Query: 144 AAFTERQWEEVVIKELVRVCKPGGWIELLEIDVDGKSLGPTSKRIISACMAKFENRGVNG 203
            AF   +W   +I E+ RV K GG+ + +E+D+   +  P ++    A  +   + G++ 
Sbjct: 196 LAFRTNEW-PFIISEIKRVLKDGGYFQCVELDMRIITTDPIARTYTEAFESFCASYGLDA 254

Query: 204 LISEEIPEFFESTNQVEIY-AEEKYSPIGNWGDELGKLALDFFVSIFSSS-DELIEWIKV 261
               ++         ++I  +E +  P+G WG  +G    D ++ +F  + D L  W+K 
Sbjct: 255 SAGAKLDLMLTEGGAMKILQSEYREVPLG-WGGPIG----DAYIQLFQGTLDGLSPWLKQ 309

Query: 262 SKEEYEH----MIAQYIKEVEIYRSYFINI-KFYCQK 293
           S    +H    M+    ++  I    F+ +  F  QK
Sbjct: 310 SLGITDHQNYDMLMNRTRQALIQSKSFMGLYAFLVQK 346



>gi|511011209|gb|EPB92421.1| hypothetical protein HMPREF1544_00719 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 289

 Score = 94.7 bits (234), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/226 (30%), Positives = 114/226 (50%), Gaps = 7/226 (3%)

Query: 57  FVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTPLLPKDFSQNNL 116
           F SP+ ++L   +  +VLD+GCG    W L++++ YP ++FIG+D+    + +D   +N 
Sbjct: 56  FKSPLHEKLT--QGIRVLDIGCGPGW-WTLDMARLYPNSEFIGIDMADVFITEDIP-SNA 111

Query: 117 QFVQSDILKGLP-FEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIELLEID 175
           +F   +   GL  FED S DFV  R L   F   Q+   V +E+ R+ KPGG IE+LE+ 
Sbjct: 112 KFQLLNAGTGLDYFEDESFDFVFQRFLVMGFPTDQYIRSV-EEMKRILKPGGAIEILELV 170

Query: 176 VDGKSLGPTSKRIISACMAKFENRGVNGLISEEIPEFFESTNQVEIYAEEKYSPIGNWGD 235
            + K+ GP  K I          R ++  ++++I  F  +    +I       PIG WG 
Sbjct: 171 NEYKNAGPAFKNINLWINEALVARNMDSYVADKISSFLANAGYQDIKDINYDVPIGAWGA 230

Query: 236 ELGKLALDFFVSIFSSSDELI-EWIKVSKEEYEHMIAQYIKEVEIY 280
             G+L L        +   +I +   ++ E Y+  + +  KEV+ Y
Sbjct: 231 YPGELFLAIQRLALPAVKVMITQLTSITSEVYDANMEEAFKEVDQY 276



>gi|511006015|gb|EPB87336.1| hypothetical protein HMPREF1544_05861 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 499

 Score = 94.7 bits (234), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 55/153 (35%), Positives = 88/153 (57%), Gaps = 15/153 (9%)

Query: 36  EQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLA 95
           EQD   ++  H L++  +G +F SP++ +L+  K   VLDVGCG   +W +E+S  +P +
Sbjct: 203 EQDRMVAQ--HYLLRTAFGSDFNSPLKSQLQ--KGIVVLDVGCGPG-TWTMEMSTAFPKS 257

Query: 96  KFIGLDLLTPLLPKDFSQNNLQF------VQSDILK--GLPFEDGSIDFVHMRCLTAAFT 147
            FIG+D      PKD    N  F      V + I +   LPF D SID+++ R +  A T
Sbjct: 258 TFIGIDQ-NAFYPKDIKPRNCHFRTCGSLVVTHISQTINLPFPDNSIDYIYQRDMNWALT 316

Query: 148 ERQWEEVVIKELVRVCKPGGWIELLEIDVDGKS 180
            + W+ +++ E  R+ KPGGWIE +E D++ ++
Sbjct: 317 GQTWQPLLL-EYQRILKPGGWIECVEPDLETQN 348



>gi|511010507|gb|EPB91728.1| hypothetical protein HMPREF1544_01439 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 257

 Score = 94.4 bits (233), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 48/130 (36%), Positives = 76/130 (58%), Gaps = 5/130 (3%)

Query: 46  HELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTP 105
           H  +K ++ GN +  +++ L +    +VLD+GCG+ C W++E++  YP  K  GLD+   
Sbjct: 12  HFSLKALYDGNILPSVKELLPSNA--QVLDLGCGSGC-WVMEMAIDYPQYKITGLDM-AD 67

Query: 106 LLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKP 165
           + P      N++F   +IL GLP+ D + D+VHMR L       +W   VI E+ RV KP
Sbjct: 68  MFPTTIRPENVKFELHNILNGLPYPDQTFDYVHMRLLITGLRTEEW-PTVIAEIHRVLKP 126

Query: 166 GGWIELLEID 175
           GG ++L+E D
Sbjct: 127 GGLVQLVESD 136



>gi|384490271|gb|EIE81493.1| hypothetical protein RO3G_06198 [Rhizopus delemar RA 99-880]
          Length = 389

 Score = 94.4 bits (233), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 54/144 (37%), Positives = 81/144 (56%), Gaps = 15/144 (10%)

Query: 36  EQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLA 95
           EQD   ++  H L++ ++  +F SPI  +L+  K   VLDVGCG   +W +E+S  +P +
Sbjct: 105 EQDRMVTQ--HYLLRTLFSSDFCSPIRSQLQ--KGIVVLDVGCGPG-TWTMEMSTAFPKS 159

Query: 96  KFIGLDLLTPLLPKDFSQNNLQF------VQSDILKGLPFEDGSIDFVHMRCLTAAFTER 149
            FIG+D  T   PKD    N  F      VQ  +   LPF D SID+++ R +      +
Sbjct: 160 TFIGIDQST-FFPKDIKPRNCHFRTCYPLVQEQL--PLPFPDNSIDYIYQRDMNWGLMAK 216

Query: 150 QWEEVVIKELVRVCKPGGWIELLE 173
            W+ + I+E +R+ KPGGWIE +E
Sbjct: 217 TWQPL-IQEYLRILKPGGWIEFME 239



>gi|384493124|gb|EIE83615.1| hypothetical protein RO3G_08320 [Rhizopus delemar RA 99-880]
          Length = 326

 Score = 94.4 bits (233), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 66/251 (26%), Positives = 124/251 (49%), Gaps = 19/251 (7%)

Query: 46  HELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTP 105
           H  ++  +  +F +PIE+ L+     +VLD+GCG    W  +++  +P + FIG+D+   
Sbjct: 49  HNALRLAFENDFKAPIERLLQAGGS-EVLDIGCGAGF-WTADMAARFPFSYFIGIDIDKN 106

Query: 106 LLPKDFSQNNLQFVQSDILK-GLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCK 164
           +LP      N+   + D+++  LP+ED + D++ +R +     ++ W++ V+KE +R+ K
Sbjct: 107 VLPTSPCGRNILHQRIDLIELPLPYEDATFDYIFVRSMLNTMPDQLWDD-VLKEFIRIMK 165

Query: 165 PGGWIELLEIDVDGKSLGP-----TSKRIISACMAKFENRGVNGLISEEIPEFFESTNQ- 218
            G +IE +E   D    GP     T   ++S     +     +       P    + NQ 
Sbjct: 166 KGAYIECVEAYDDLFDAGPSMNTLTQLVLMSTQQPPYSPTSKDVAARNPWPNRLANINQL 225

Query: 219 --VEIYAEEKYSPIGNWGDELGKLALDFFVSIFSSSDELIEWIK---VSKEEYEHMIAQY 273
             ++IY    ++P+G+ G E+G L L+++     +     EWI    + +EE +  I Q 
Sbjct: 226 MGMQIY--HTHTPVGHHGGEIGSLLLEYWERTIGNYRR--EWITNRWIEEEELDKTIRQM 281

Query: 274 IKEVEIYRSYF 284
            +EV  Y +Y 
Sbjct: 282 REEVNEYNTYM 292



>gi|511004034|gb|EPB85415.1| hypothetical protein HMPREF1544_07786 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 248

 Score = 93.2 bits (230), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 51/156 (32%), Positives = 92/156 (58%), Gaps = 7/156 (4%)

Query: 56  NFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTPL-LPKDFSQN 114
           NF +P+ +EL++     VLD GCG   +W  +++K +P +KF G+D+ TPL  P+    +
Sbjct: 7   NFKAPLGKELQD--GIVVLDSGCGP-ATWTFDMAKEFPSSKFHGVDI-TPLSFPEGVKPD 62

Query: 115 NLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIELLEI 174
           N +F  ++I + +P+ D + D++H R L    T   W++  +KE+ RV KPGG+IEL E 
Sbjct: 63  NCEFQVANIAEHIPYPDNTFDYIHQRLLVMGLTHESWDK-TLKEMFRVLKPGGYIELHEP 121

Query: 175 D-VDGKSLGPTSKRIISACMAKFENRGVNGLISEEI 209
           + V  ++ GP  +++ +      E+R +   I+ ++
Sbjct: 122 NFVKLRNTGPFIQQLHNTISGMLESRQIPADIALQL 157



>gi|511006590|gb|EPB87899.1| hypothetical protein HMPREF1544_05306 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 338

 Score = 92.8 bits (229), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 72/277 (25%), Positives = 138/277 (49%), Gaps = 19/277 (6%)

Query: 8   TETMSRDQKITKXXXXXXXXFPKNDLELEQDAKCSKLL--HELMKKVWGGNFVSPIEQEL 65
           T++MS   +           FP +D E++      +L+  H  +K ++GGN  + I +++
Sbjct: 59  TDSMSMSGRTFHHVANSAYWFPNDDEEMD------RLIGQHFALKTLFGGNISNIILKDI 112

Query: 66  K-NKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDIL 124
              K D  VLD+GCG   +W+++++  YP ++FIG+D+   + P +    N+ F   + L
Sbjct: 113 DMEKGDTIVLDLGCGPG-TWLMDVATEYPSSQFIGVDMCD-IFPNNIRPPNVSFQIGNAL 170

Query: 125 KGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIELLEIDV--DGKSLG 182
           + LPF D + DF+++R    A    +W  VVI+E  R+ KPGG+++++E  +   G    
Sbjct: 171 ERLPFSDNTFDFINIRLFIIALKGEEW-PVVIQEAYRILKPGGYLQIVECGMLERGNDFV 229

Query: 183 PTSKRIISACMAKFENRGVNGLISEEIPEFFESTNQVEIYAEEKYSPIGNWGDELGKLAL 242
             + +I    +   E+RG    I+ ++    E+  Q +++  E         D L K  L
Sbjct: 230 KYAGKIFKEVI---ESRGQEPYIAFKLQSLLEN-QQFKVHHYENKDVFLGKPDALSKEFL 285

Query: 243 DFFVSIFSSSDELI-EWIKVSKEEYEHMIAQYIKEVE 278
               +IF S+  ++ E +  + + Y   + +  KE++
Sbjct: 286 WDACNIFKSAQPVLQEPLGCNADNYPQFLNRLYKELQ 322



>gi|384496141|gb|EIE86632.1| hypothetical protein RO3G_11343 [Rhizopus delemar RA 99-880]
          Length = 366

 Score = 92.4 bits (228), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 53/154 (34%), Positives = 87/154 (56%), Gaps = 8/154 (5%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILE 87
            PK++ E+  D   S+  H +++  + G+F +P+    K  K   VLD+GCG+  +W +E
Sbjct: 118 LPKDESEI--DRMVSQ--HYILRTAFDGDFSAPLLSYTKKVKRVTVLDMGCGSG-TWTME 172

Query: 88  LSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKG-LPFEDGSIDFVHMRCLTAAF 146
           ++  +P   FIG+D  + L P+     N +F+  D     LPFED S+D++  R      
Sbjct: 173 MAVQFPNMHFIGIDH-SALYPQHIKPKNCRFLTLDRNDASLPFEDASVDYIFQRDANWEL 231

Query: 147 TERQWEEVVIKELVRVCKPGGWIELLEIDVDGKS 180
            +  WE + I+E  R+ KPGGWIEL+E D++ +S
Sbjct: 232 KDDAWEPL-IQEYFRILKPGGWIELVEADIETQS 264



>gi|380479314|emb|CCF43091.1| TAM domain methyltransferase [Colletotrichum higginsianum]
          Length = 397

 Score = 92.4 bits (228), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 67/213 (31%), Positives = 105/213 (49%), Gaps = 21/213 (9%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILE 87
           FP +D E E++     + H ++  + GG+  S     L+N +  KVLDVG GT   W ++
Sbjct: 125 FPNDDPEQERE----DMKHAMVVHLCGGSLHS---APLENPQ--KVLDVGTGTGI-WAID 174

Query: 88  LSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFT 147
           +   YP A  IG+DL +P+ P DF   N+QF+  D      + D + D+VH+R +  +  
Sbjct: 175 MGDEYPEADIIGIDL-SPIQP-DFVPPNVQFIVDDAEVEWVYPDDTFDYVHLRNMAPSI- 231

Query: 148 ERQWEEVVIKELVRVCKPGGWIELLEI----DVDGKSLGP--TSKRIISACMAKFENRGV 201
            ++W E+   E  RV KPGGWIE+ E+      D  ++GP     ++ +         GV
Sbjct: 232 -KKWPEL-FAEAYRVLKPGGWIEMQEMRWVYGCDDGTIGPDYAPAKMGANIKEGLARLGV 289

Query: 202 NGLISEEIPEFFESTNQVEIYAEEKYSPIGNWG 234
               +E  P   E+   V +  E K  P+G W 
Sbjct: 290 EMNAAESYPTRVENAGFVNLQHEVKKVPVGPWA 322



>gi|384496105|gb|EIE86596.1| hypothetical protein RO3G_11307 [Rhizopus delemar RA 99-880]
          Length = 267

 Score = 90.5 bits (223), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 71/128 (55%), Gaps = 3/128 (2%)

Query: 46  HELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTP 105
           H   K+++GGN +S +   L  +K   VLD+GCG+   WI+++   YP   + G D++  
Sbjct: 52  HFAYKELFGGNLLSSVCNSLDFEKGISVLDIGCGSGV-WIMDMINDYPNCTYHGCDIVDT 110

Query: 106 LLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKP 165
              K    +   +   +I+KGLP++D + DFVHMR    A    +W  + IKE +RV KP
Sbjct: 111 T-NKVLKIDQFTYSHGNIVKGLPYKDNTFDFVHMRFFIFALRAEEW-PIAIKEAIRVVKP 168

Query: 166 GGWIELLE 173
           GG ++  E
Sbjct: 169 GGMVQFYE 176



>gi|511006275|gb|EPB87591.1| hypothetical protein HMPREF1544_05573 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 334

 Score = 90.5 bits (223), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 74/262 (28%), Positives = 130/262 (49%), Gaps = 28/262 (10%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKN-----KKDFKVLDVGCGTTC 82
           FP +D E+++        H  +K ++ GN     E+  +N     +   K+LD+GCG   
Sbjct: 72  FPNDDEEMDRLVG----QHFALKTLFNGNIP---EEAFENGTIPFENGAKILDLGCGP-G 123

Query: 83  SWILELSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCL 142
           +WI++++  +P ++FIG+D+   + P +    N+ F   ++L+GL FED + D V+ R  
Sbjct: 124 TWIMDVATEFPSSEFIGVDMCD-VFPNNIRPANVTFQIGNVLEGLAFEDNTFDMVNFRMF 182

Query: 143 TAAFTERQWEEVVIKELVRVCKPGGWI-----ELLEIDVDGKSLGPTSKRIISACMAKFE 197
             AF   +W   V+KE+ RV KPGG+I      +LE+   G      + RI    M +  
Sbjct: 183 ILAFKTEEWAP-VLKEIKRVLKPGGFILSREPGMLEV---GNDFVTWAGRIFKDRMIE-- 236

Query: 198 NRGVNGLISEEIPEFFESTNQVEIYAEEKYSPIGNWGDELGKLALDFFVSIFSSSDELI- 256
            RG    I++E+ ++ E      ++  +K+S +G   D L +  L    SIF S    + 
Sbjct: 237 -RGQEPYIADEMKKYMELEGFEVVHCVKKHSFLGR-PDHLNREFLWDIRSIFKSGQPFLG 294

Query: 257 EWIKVSKEEYEHMIAQYIKEVE 278
           E ++V  E+Y   + Q +   +
Sbjct: 295 EHLQVPNEKYPQFLDQLVANCQ 316



>gi|384483931|gb|EIE76111.1| hypothetical protein RO3G_00815 [Rhizopus delemar RA 99-880]
          Length = 295

 Score = 90.1 bits (222), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 64/241 (26%), Positives = 124/241 (51%), Gaps = 21/241 (8%)

Query: 71  FKVLDVGCGTTCSW----ILELSKTYPLAKFIGLDLLTPLLPKDFSQN---------NLQ 117
            +VLD+ CG    W    IL++++ +  + F  +D  + LLP+  S +         N  
Sbjct: 55  IEVLDINCGPGL-WDGHPILDMAQDFVHSSFYLVDTHS-LLPQYASVDTSPGEQRLDNFT 112

Query: 118 FVQSDIL--KGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIELLEID 175
           F+  + L  K LPFE    DF+  R ++  + ++ W  V++KEL RV KPGG I+L+E++
Sbjct: 113 FIAHNTLQEKCLPFESDKFDFIQQRLMSFVYKQQDWP-VILKELQRVTKPGGCIQLVEVE 171

Query: 176 VDGKSLGPTSKRIISACMAKF-ENRGVNGLISEEIPEFFESTNQVEIYAEEKYSPIGNWG 234
           +  ++LGP  ++ ++       E R ++  ++ ++ +   +   ++I  +    PIG+WG
Sbjct: 172 IPPQNLGPQGEQWLAQVEKVMKEKRDIDVRVTSQLDQILSAAGLLDIQTKFVSVPIGSWG 231

Query: 235 DELGKLALDFFVSIFSSSDE-LIEWIKVSKEEYEHMIAQYIKEVEIYRSYFINIKFYCQK 293
            ++G L    +   F S+   L+E +++S  EY+  +   + E+  Y+  F NI     +
Sbjct: 232 LDIGNLWRQNYELFFESAQPILVELMEMSHSEYKRKVDAMMDELNEYKP-FSNIHLVWGR 290

Query: 294 I 294
           +
Sbjct: 291 V 291



>gi|392574788|gb|EIW67923.1| hypothetical protein TREMEDRAFT_63811 [Tremella mesenterica DSM
           1558]
          Length = 359

 Score = 89.4 bits (220), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 82/151 (54%), Gaps = 17/151 (11%)

Query: 56  NFVSPIEQELKNK-KDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTPLLPKDFSQN 114
           N+++PI   L N  KD  VLDVG G+  +W  E+++ +P A+ IG+DL  P    +   +
Sbjct: 84  NYLAPIPAYLPNAGKDKSVLDVGTGS-GAWPCEIAQEFPNAEVIGVDL-APTWNDNDLPD 141

Query: 115 NLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGG------- 167
           N++F Q DI  GLPF DG  D VH R L A    R W +  I E++R+ KPGG       
Sbjct: 142 NVEFQQGDITAGLPFPDGRFDVVHGRTLVAGI--RDWPQ-YINEMIRLVKPGGLFISHET 198

Query: 168 ---WIELLEIDVDGKSLGPTSKRIISACMAK 195
              W+   + DVD  S+ P     IS C+A+
Sbjct: 199 SFPWVLQDQPDVDHWSIAP-GFMAISECVAR 228



>gi|393214636|gb|EJD00129.1| hypothetical protein FOMMEDRAFT_91729, partial [Fomitiporia
           mediterranea MF3/22]
          Length = 260

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 106/208 (50%), Gaps = 10/208 (4%)

Query: 48  LMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLA-KFIGLDLLTPL 106
           L+  V+ G  +   ++EL+ K   +VLD G G   SWIL L+K  P + + +G+D+   +
Sbjct: 9   LLTTVYDGRLI--YDKELQLKPGSRVLDAGTGAG-SWILALAKEVPDSVELVGVDVSLAM 65

Query: 107 LPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPG 166
            P+ F  +N+  V++           S DFVH R +  AFT   W    I E+ R  KPG
Sbjct: 66  FPESF-PSNVHLVEASTTNLPDSWTNSFDFVHQRLMICAFTASDWSRA-ISEIFRALKPG 123

Query: 167 GWIELLEIDV---DGKSLGPTSKRIISACMAKFENRGVNGLISEEIPEFFESTNQVEIYA 223
           G  +++EI      G++L   ++++ +       +R     ++++IP+  E    V+I  
Sbjct: 124 GTAQIVEISAPFPSGENL-KKAEKLTTLYTEALRSRVYLYNLADDIPKIMEKAGFVDIRE 182

Query: 224 EEKYSPIGNWGDELGKLALDFFVSIFSS 251
           E + +P+GN   E+G++  D F + F S
Sbjct: 183 EIRGAPVGNKWGEIGRIGADNFTTAFRS 210



>gi|384491468|gb|EIE82664.1| hypothetical protein RO3G_07369 [Rhizopus delemar RA 99-880]
          Length = 211

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 81/148 (54%), Gaps = 19/148 (12%)

Query: 46  HELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTP 105
           H  +K+++GG              +  +LD+GCG+   W++++   YP  K+ G D++  
Sbjct: 51  HFAVKELYGG--------------EISILDIGCGSGI-WVMDMITDYPNCKYYGCDMVDT 95

Query: 106 LLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKP 165
              K+      +F   ++LKGLP+ED + D VHMR    A  E QW  +VIKELVRV KP
Sbjct: 96  T-NKNIRLPQFEFAIGNVLKGLPYEDNTFDLVHMRLFVFALREDQW-PIVIKELVRVAKP 153

Query: 166 GGWIELLEIDVD--GKSLGPTSKRIISA 191
           G  +++ E+D+    + LG   K ++++
Sbjct: 154 GCIVQVTEVDLKMPNEDLGAYHKLLVAS 181



>gi|511001982|gb|EPB83433.1| hypothetical protein HMPREF1544_09817 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 341

 Score = 89.0 bits (219), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 66/272 (24%), Positives = 133/272 (48%), Gaps = 24/272 (8%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILE 87
           FP   LE    A   +  H L+K V+  ++ +PI+ ++ +K +   LD+GCGT  SW+++
Sbjct: 52  FPSTTLE----ANRQQGEHYLLKHVFQTSYFAPID-DILSKPNTACLDIGCGTHASWLID 106

Query: 88  LSKTYPLAKFIGLDLLTPLLPKDFSQN-------NLQFVQSDILKGLPFEDGSIDFVHMR 140
           ++  +P   F G D++ P    +   +       N +  + D+  G  + D + D+ H R
Sbjct: 107 VANDFPNCTFHGFDVIQPFALNENEADVAFHIPSNCEIKKHDLFDGFGYPDCTFDYTHQR 166

Query: 141 CLTAAFTERQ--WEEVVIKELVRVCKPGGWIELLEIDVDGKSLGPTSKRIISACMAKFEN 198
            +   +   +  W   +  EL+RV K  GWIEL+E +V  K  GP   +++    +  ++
Sbjct: 167 TMHLIYHSDKVSW---MFTELMRVTKENGWIELVEPEVMPKRAGPIFGKMMIGIRSFLKD 223

Query: 199 R-GVNGLISEEIPEFFESTNQVEIYAEEKYSPIGNWGDELGKLALDFFVSIFSSSDELI- 256
           + G + L +  + +  E    V++ ++    P+  WG  +GKL  +  + +F     ++ 
Sbjct: 224 KLGSSYLQANLLCKKMEEAGLVDVKSDYGSVPVC-WGGYVGKLVYEDMLLMFQHLGPILY 282

Query: 257 EWI----KVSKEEYEHMIAQYIKEVEIYRSYF 284
           E++    + +KE Y+ +I     E   ++++F
Sbjct: 283 EYLDFEGEFNKEVYDALIDSAFDECVEFQTFF 314



>gi|169854493|ref|XP_001833921.1| hypothetical protein CC1G_01598 [Coprinopsis cinerea okayama7#130]
 gi|116505056|gb|EAU87951.1| hypothetical protein CC1G_01598 [Coprinopsis cinerea okayama7#130]
          Length = 347

 Score = 89.0 bits (219), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 65/263 (24%), Positives = 117/263 (44%), Gaps = 23/263 (8%)

Query: 46  HELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTP 105
           H ++K++ GGN++ P+   L   +D KVLD+ C     W+ E+++ +P   F G+D++ P
Sbjct: 87  HNILKRLMGGNYLGPVPAALAAGQDRKVLDL-CTGNGKWVTEMAEEFPHVSFTGIDIV-P 144

Query: 106 LLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKP 165
           +  + +  +N++F+ +D  + L +  G+ DFVH R    A       +  + E+ RV KP
Sbjct: 145 IATR-YPPDNVRFILADANQTLDWPGGTYDFVHARDTLLAIVNY---DCFVAEVARVLKP 200

Query: 166 GGWIELLE----------IDVDGKSLGPTSKRIIS-ACMAKFENRGVNGLISEEIPEFFE 214
           GG    +E           D+D K   P S R+    C A   +RG+             
Sbjct: 201 GGLFLSVEWDRSPHFHPSFDLDPKESAPASMRLSQLVCDALLHSRGMQHTSFTCSSSLAA 260

Query: 215 STNQVEIYAEEKYSPIGNW--GDELGKLALDFFVS----IFSSSDELIEWIKVSKEEYEH 268
           S +       + Y PIG W     L ++ L   V+      +  + L++   ++ +E E+
Sbjct: 261 SPHFTNHETHKLYVPIGGWHLNPMLRRVGLASKVAQTRLARACRELLVDNTPLTPDEVEN 320

Query: 269 MIAQYIKEVEIYRSYFINIKFYC 291
            I  Y+ E+         +   C
Sbjct: 321 AIQDYVDELLSTDGLMATVHVAC 343



>gi|511002580|gb|EPB84010.1| hypothetical protein HMPREF1544_09209 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 302

 Score = 87.8 bits (216), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 78/131 (59%), Gaps = 3/131 (2%)

Query: 46  HELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTP 105
           H  +K+++ GN ++ +++ L  +K   VLDVGCG   SWI+++   YP   + G D++  
Sbjct: 58  HFAVKELYEGNVLTSVKETLDFEKGISVLDVGCGAG-SWIMDMIIDYPNCTYEGCDMVQ- 115

Query: 106 LLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKP 165
           +   + + +   +   ++++ L + D + DFVHMR    A  E +W  + IKE++RV KP
Sbjct: 116 VTNSNVTPSQFHWSYGNVIEKLDYPDNTFDFVHMRLFILALRESEWP-IAIKEILRVTKP 174

Query: 166 GGWIELLEIDV 176
           GG I+LLE D+
Sbjct: 175 GGVIQLLEFDL 185



>gi|477527332|gb|ENH79155.1| methyltransferase domain-containing protein [Colletotrichum
           orbiculare MAFF 240422]
          Length = 342

 Score = 87.4 bits (215), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 64/212 (30%), Positives = 101/212 (47%), Gaps = 21/212 (9%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILE 87
           FP +D ELE++     + H ++  +  G   S     L N +  K+LDVG GT   W ++
Sbjct: 73  FPNDDWELERE----DMKHAMVVHICDGKLHS---APLDNPQ--KILDVGTGTGI-WAID 122

Query: 88  LSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFT 147
           +   YP A  +G+DL +P+ P DF  +N++F+  D      + DG+ D+VH+R +  +  
Sbjct: 123 MGDEYPEASVVGIDL-SPIQP-DFIPSNVRFLVDDAEADWVYPDGNFDYVHLRNMAPSI- 179

Query: 148 ERQWEEVVIKELVRVCKPGGWIELLEI----DVDGKSLGP--TSKRIISACMAKFENRGV 201
            R W   +  E  RV KPGGWIEL E+      D  ++ P     +++S          V
Sbjct: 180 -RNWP-ALFAEAYRVLKPGGWIELQEMRWAYGCDDGTMRPDYAPVQMVSNIKEALARLDV 237

Query: 202 NGLISEEIPEFFESTNQVEIYAEEKYSPIGNW 233
           +   +E  PE   +   V      K  P+G W
Sbjct: 238 DMYAAERYPEHAAAAGFVNGRHVVKKVPVGPW 269



>gi|384491877|gb|EIE83073.1| hypothetical protein RO3G_07778 [Rhizopus delemar RA 99-880]
          Length = 318

 Score = 87.4 bits (215), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 78/281 (27%), Positives = 132/281 (46%), Gaps = 33/281 (11%)

Query: 28  FPKNDLELEQDAKCSKLLHE---LMKKVWGGNFVSPIEQELK-NKKDFKVLDVGCGTTCS 83
            PK+D E+++       LH+   + K++ G N +    + L   K+   VLD+ CG   +
Sbjct: 56  LPKDDKEIDR-------LHDQHFITKEILGFNIMKEALKILDFEKEALCVLDICCGPA-T 107

Query: 84  WILELSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLT 143
           W+ E S  YP  +F G+D+     P+     NL F++++ILKGLP+ D S DF+ MR + 
Sbjct: 108 WLCEESLEYPNCRFTGIDMCNSC-PQVIRPVNLDFIEANILKGLPYPDKSFDFIQMRFVE 166

Query: 144 AAFTERQWEEVVIKELVRVCKPGGWIELLEIDV-----DGKSLGPTSKRIISACMAKFEN 198
            AF   +W + VI E+ R+ K GG  + +++D+     +G ++  T      +  AK+  
Sbjct: 167 LAFRLDEW-QFVISEIKRILKDGGCFQWIDVDMRVNVTNGDTIIKTYTEAFESFCAKY-- 223

Query: 199 RGVNGLISEEIPEFFESTNQVEIYAEEKYSPIGNWGDELGKLALDFFVSIFSSSDELIEW 258
             ++  +  ++     +     I  E +  P+G WG  +G   L  F         L  W
Sbjct: 224 -NLDPSVGPKLDYLLTNEKMKIIQTEYREMPLG-WGGPVGHAYLQTFQGALEG---LAPW 278

Query: 259 IKVS-----KEEYEHMIAQYIKEVEIYRSYFINI-KFYCQK 293
           +K S      +EY+ +I    K   I    F+N+  F  QK
Sbjct: 279 LKNSFNTENDQEYDFIINN-TKRAFIQSKAFMNLYAFLIQK 318



>gi|384494573|gb|EIE85064.1| hypothetical protein RO3G_09774 [Rhizopus delemar RA 99-880]
          Length = 330

 Score = 87.0 bits (214), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 75/122 (61%), Gaps = 3/122 (2%)

Query: 46  HELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTP 105
           H  +K ++GGN    + +++  +K  K+LD+GCG   +WI++++  YP ++F G+D+ + 
Sbjct: 84  HFALKTLFGGNIPKEVHKQVDMEKGIKILDLGCGPG-TWIMDMATEYPNSEFTGIDM-SD 141

Query: 106 LLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKP 165
           + P +    N+ F  +++L+ LPFED + DFV+      A  + QW   V+KE+ R+ KP
Sbjct: 142 VFPNNIRPANVTFQIANVLEPLPFEDDTFDFVNFSLFILALKKDQWIP-VMKEVKRILKP 200

Query: 166 GG 167
           GG
Sbjct: 201 GG 202



>gi|384486559|gb|EIE78739.1| hypothetical protein RO3G_03444 [Rhizopus delemar RA 99-880]
          Length = 485

 Score = 87.0 bits (214), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 69/284 (24%), Positives = 123/284 (43%), Gaps = 54/284 (19%)

Query: 46  HELMKKVWGGNFVSPIEQELKN---------------------------------KKD-- 70
           H ++K ++GGNF +P+ + L N                                 K+D  
Sbjct: 132 HFVIKHLFGGNFSAPVHEILSNSISVAKDTVFINRNSLEPITPPCDDPFSFSIGMKQDTV 191

Query: 71  FKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDIL--KGLP 128
            + LD+ CGT  +W +E++ T+P + F G+     + P      N+ F   DIL   G P
Sbjct: 192 ARGLDIVCGTG-TWAMEMASTFPESHFYGIGY-DAIYPTSIKPQNVHFSTRDILDSSGFP 249

Query: 129 FEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIELLEIDVDGKSLGPTSKRI 188
           F+D   D+VHMR +   F++    + V+ E+ RV KPGG++E+ + D   K+ GP    +
Sbjct: 250 FKDEHFDYVHMRFVWCYFSKAD-AKFVMSEVNRVLKPGGYVEMRDCDPIMKNTGPIGTNL 308

Query: 189 ISACMAK-FENRGVNGLISEEIPEFFEST-------NQVEIYAEEKYSPIGNWGDELGKL 240
                A  + +  ++   ++ +PE            +Q+     E+ +P+ N  +     
Sbjct: 309 YENLGAHIYNSHNIDATWTQHLPELLSHQAGLTDIHHQMMPITFERSTPMANCINNFLSD 368

Query: 241 ALDFFVSIFSSSDELIEWIKVSKEEYEHMIAQYIKEVEIYRSYF 284
           ++  +  +F      +E    S EE + +I + I E     SYF
Sbjct: 369 SIKSYKPLF------MESCGFSPEECDVVIQKAIDEAHHKHSYF 406



>gi|291510280|gb|ADE10096.1| AdoMet-MTases [Tremella fuciformis]
          Length = 313

 Score = 87.0 bits (214), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 61/193 (31%), Positives = 97/193 (50%), Gaps = 20/193 (10%)

Query: 54  GGNFVSPIEQELKNK-KDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTPLLPKDFS 112
           G N+++PI+  L N  +  ++LDVG G+   W +E+++ YP A+ +GLDL    + K+  
Sbjct: 55  GKNYLAPIKAVLGNDGRGKRILDVGTGSGI-WAIEMAQEYPAAEVVGLDLAP--VQKETV 111

Query: 113 QNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIELL 172
             N +F   D  KGLPF DG+ D VH R LT     R W  +V  ++VRV +PGG   L+
Sbjct: 112 PENCRFEIDDASKGLPFPDGTFDVVHARLLTVGI--RHWRGLV-NDMVRVLQPGGLAVLV 168

Query: 173 EID----VDG-------KSLGPTSKRIISACMAKFENRGVNGLI-SEEIPEFFESTNQVE 220
           E+D    +DG       + + P   +           RG++ L     IP+       ++
Sbjct: 169 EMDGMLRLDGDIPLEQQREVAPGYTKFCDYLDMAIVKRGLDNLAGGSTIPQALAQHPDLQ 228

Query: 221 IYAEEKYSPIGNW 233
              E+ Y+P+  W
Sbjct: 229 DL-EQVYAPLPFW 240



>gi|384486101|gb|EIE78281.1| hypothetical protein RO3G_02985 [Rhizopus delemar RA 99-880]
          Length = 209

 Score = 86.7 bits (213), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 55/162 (33%), Positives = 81/162 (50%), Gaps = 4/162 (2%)

Query: 68  KKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGL 127
           +K   VLDVGCG+  SWI+++   YP   + G D++     K    +   F + ++ + L
Sbjct: 4   EKGIAVLDVGCGSG-SWIMDMITDYPNCTYHGCDIVDTT-NKILKIDQFTFSRGNVAQKL 61

Query: 128 PFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIELLEID-VDGKSLGPTSK 186
           P+ + + DFVHMR L AA  E +W  + I+ELVRV K GG I+L E + V  K       
Sbjct: 62  PYANNTFDFVHMRLLVAALREDEW-PMAIRELVRVTKSGGMIQLTETEPVLNKDPSSAFY 120

Query: 187 RIISACMAKFENRGVNGLISEEIPEFFESTNQVEIYAEEKYS 228
           + I A  +    RG N  I+ E+         V+I   E  S
Sbjct: 121 KFIDAFNSACRQRGQNPQIALELKRLVSENKDVKITQSEHRS 162



>gi|392574792|gb|EIW67927.1| hypothetical protein TREMEDRAFT_63815 [Tremella mesenterica DSM
           1558]
          Length = 256

 Score = 86.7 bits (213), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 67/218 (30%), Positives = 109/218 (50%), Gaps = 23/218 (10%)

Query: 36  EQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDF---KVLDVGCGTTCSWILELSKTY 92
           E++ +   L H  +K   GGN+++PI++ L    +    ++LD+G GT   W++E++K Y
Sbjct: 24  EREWRRLNLQHAGIKVAQGGNYLAPIDKVLNKSTEGEIQRILDIGTGTGL-WVIEIAKEY 82

Query: 93  PLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWE 152
           P  + IG DL    + KD   +N+QF+  D+LKGL F DG  D +H R L +  ++  W+
Sbjct: 83  PKVEVIGADLAQDQI-KDNLPSNVQFILGDVLKGLDFPDGHFDVIHSRLLFSGMSD--WK 139

Query: 153 EVVIKELVRVCKPGGWIELLEID-------VDGKSLGPT--SKRIISACMA---KFENRG 200
             V  E+ R+ KPGG +   EI+       + G +  P+  S  +   C A       RG
Sbjct: 140 TYV-HEVARLLKPGGMLVTNEIECTPEVWLLSGPNKNPSALSSGMADWCRALRKALVARG 198

Query: 201 VNGLISEEIPEFFESTNQVEIYAEEKYS--PIGNWGDE 236
            +    E I E  + +     + EEK    P  +W D+
Sbjct: 199 CSPDAPELIKEMIKESGSFS-HVEEKLCLVPFWDWSDD 235



>gi|384497298|gb|EIE87789.1| hypothetical protein RO3G_12500 [Rhizopus delemar RA 99-880]
          Length = 159

 Score = 86.3 bits (212), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 41/86 (47%), Positives = 54/86 (62%), Gaps = 2/86 (2%)

Query: 88  LSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFT 147
           ++  YP   FIG+D L PL P+D    N+ F QSDIL GLPFED S DF+ MR    AF 
Sbjct: 1   MATEYPNTHFIGIDQL-PLFPQDIRPANVTFRQSDILAGLPFEDNSFDFIQMRLFLVAFN 59

Query: 148 ERQWEEVVIKELVRVCKPGGWIELLE 173
              W +  + E+ R+ KPGG+++LLE
Sbjct: 60  RTNWID-ALNEVYRLLKPGGYVQLLE 84



>gi|392574793|gb|EIW67928.1| hypothetical protein TREMEDRAFT_57395, partial [Tremella
           mesenterica DSM 1558]
          Length = 297

 Score = 86.3 bits (212), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 77/130 (59%), Gaps = 7/130 (5%)

Query: 46  HELMKKVWGG-NFVSPIEQEL-KNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLL 103
           H  +K   GG N+++P ++ L ++ +D ++LDVG GT   W LE++  +P A+  G+DL 
Sbjct: 31  HYALKVRQGGKNYLAPFQEVLPEDGRDCRLLDVGTGTGI-WALEMASEFPEAEVTGVDL- 88

Query: 104 TPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVC 163
            P+   +   NNL ++  D+ KG+PF DG  D VH R L A    R W+   I E++RV 
Sbjct: 89  APVQRPEILPNNLSYLMDDVSKGIPFPDGYFDAVHSRLLLAGI--RNWKS-FINEVIRVV 145

Query: 164 KPGGWIELLE 173
           +PGG I  +E
Sbjct: 146 RPGGLIVFVE 155



>gi|384498349|gb|EIE88840.1| hypothetical protein RO3G_13551 [Rhizopus delemar RA 99-880]
          Length = 291

 Score = 86.3 bits (212), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 75/128 (58%), Gaps = 4/128 (3%)

Query: 46  HELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTP 105
           H  +K ++ GN  + I  +L N  +  VLDVGCG   +W+++++  +P   F G+D+   
Sbjct: 66  HFALKILYDGNISNQIASKL-NMDNAVVLDVGCGPG-TWLMDVATEFPGGDFHGIDVYD- 122

Query: 106 LLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKP 165
           + P++    N+ F   D L+GLPF D + D V+MR L  A  + +W  ++ KE+ RV KP
Sbjct: 123 IFPRNIRPANVHFQSCDALEGLPFPDNTFDLVNMRMLYVALKKDEW-SLMFKEIYRVLKP 181

Query: 166 GGWIELLE 173
           GG+++  E
Sbjct: 182 GGFLQSCE 189



>gi|429850977|gb|ELA26202.1| methyltransferase domain-containing protein [Colletotrichum
           gloeosporioides Nara gc5]
          Length = 366

 Score = 85.9 bits (211), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 108/215 (50%), Gaps = 27/215 (12%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILE 87
           FP +D E E++     + H ++  + GG   S     L+N +  K+LD+G GT   W ++
Sbjct: 95  FPNDDAEQERE----DMKHSMVVTLCGGALHS---APLQNPQ--KILDIGTGTGI-WAID 144

Query: 88  LSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFT 147
           +   YP A+  G+DL +P+ P  +   N+ F+  D      + D SID++H+R + AA  
Sbjct: 145 MGDEYPEAQVTGIDL-SPIQPA-YVPPNVAFIVDDAEAEWLYADDSIDYIHVRNMGAAI- 201

Query: 148 ERQWEEVVIKELVRVCKPGGWIELLEI----DVDGKSLGPTSK-----RIISACMAKFEN 198
            + WE++ + +  RV KPGGWIEL E+    + D  ++GP        +++   + KF  
Sbjct: 202 -KNWEKL-LAQAYRVLKPGGWIELQEMKWNFNCDDGTMGPDYALTKMMKLVWEGLGKF-- 257

Query: 199 RGVNGLISEEIPEFFESTNQVEIYAEEKYSPIGNW 233
            G+   +++  P+  +    V    +    P+G W
Sbjct: 258 -GIEADVADTNPQRLKDAGFVHQVHDAVKVPVGEW 291



>gi|384488140|gb|EIE80320.1| hypothetical protein RO3G_05025 [Rhizopus delemar RA 99-880]
          Length = 306

 Score = 85.1 bits (209), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 75/263 (28%), Positives = 117/263 (44%), Gaps = 41/263 (15%)

Query: 46  HELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTP 105
           H ++K+V+ GN    I  +L   K  K+L+  CG    W LE++  YP  + IG+++L  
Sbjct: 44  HYILKQVFQGN----IHVKLNEPK--KILESACGVGL-WSLEMAHDYPTCQVIGMNIL-- 94

Query: 106 LLPKDFSQNNLQFVQSDILKG----------------LPFEDGSIDFVHMRCLTAAFTER 149
                F + NL F +S +  G                L F   + DFV+ R +      +
Sbjct: 95  ---PSFEKENLSFAKSSVNAGQAENICFQQGNLLTTPLSFSSNTFDFVYQRDVATILPFK 151

Query: 150 QWEEVVIKELVRVCKPGGWIELLEIDVDGKSLGPTSKRIISACMAKFENRGVNGLISEEI 209
            W  + I E  R+ K GG IEL+E D+  K  GP   +I +   A     GV    +  +
Sbjct: 152 LWPNL-INEFYRITKQGGKIELVEYDLLFKRPGPVLDKINNWYSAAAATIGVRQDYTSHL 210

Query: 210 PEFFESTNQVEIYAEEKYSPIGNW-GDEL----GKLALDFFVSIFSSSDELIEW----IK 260
            E+ +    + I  +    PIG W  D+L    G L  +   ++F S   +  W    IK
Sbjct: 211 YEYLQQAGYINIVEQTIDIPIGEWPTDQLQKQYGYLYKEQIKALFKS---MKRWWCTEIK 267

Query: 261 VSKEEYEHMIAQYIKEVEIYRSY 283
           V+ EEY+ + A  + E E Y S+
Sbjct: 268 VTPEEYDQVCADALPEFEKYNSF 290



>gi|510999200|gb|EPB80932.1| hypothetical protein HMPREF1544_12380 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 284

 Score = 84.3 bits (207), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 65/256 (25%), Positives = 117/256 (45%), Gaps = 25/256 (9%)

Query: 56  NFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTPLLPKDFSQNN 115
           +F +PI Q L      +VLD+GCG    W  +++  YP++ F G+D+   +LP      N
Sbjct: 12  DFKAPI-QRLLQAGGSEVLDIGCGAGF-WSSDMASRYPISYFTGIDIDKNVLPTSSLSKN 69

Query: 116 LQFVQSDILK-GLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIELLEI 174
           + + + D+++  LP+ED + D++ +R +     +  W++ V+KELVR+ K G +IE +E 
Sbjct: 70  VLYQRIDLIELPLPYEDATFDYIFIRSMMDTLPDSMWDD-VLKELVRIMKKGAYIECVEA 128

Query: 175 DVDGKSLGP-TSKRIISACMAKFENRGVNGLISEEIPEFFESTNQ-------------VE 220
             +    GP     I     +          ++  IP      N              ++
Sbjct: 129 YDNLFDAGPIIQSSIKHPPQSPTTPTSAYNTLTSNIPATTSQYNPWPNRIANMSQLIGMQ 188

Query: 221 IYAEEKYSPIGNWGDELGKLALDFFVSIFSSSDELIEWIK---VSKEEYEHMIAQYIKEV 277
           IY    ++P+G +G  +G L L+++  I  S     +WI    ++++E E  +     EV
Sbjct: 189 IY--HTHTPVGIYGGAIGSLLLEYWERIIKSFRR--DWITNKLIAEDELEKTVESMKNEV 244

Query: 278 EIYRSYFINIKFYCQK 293
             Y +Y        QK
Sbjct: 245 NEYNTYMSWYSVVAQK 260



>gi|389744785|gb|EIM85967.1| hypothetical protein STEHIDRAFT_147534 [Stereum hirsutum FP-91666
           SS1]
          Length = 1000

 Score = 84.3 bits (207), Expect = 3e-14,   Method: Composition-based stats.
 Identities = 53/165 (32%), Positives = 92/165 (55%), Gaps = 12/165 (7%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILE 87
           FP  ++   ++ + S + H++ +  +  +    +   +      KVLD+GCGT  SWIL+
Sbjct: 232 FPAKEVPYPRNYERSVVDHDVWETAFCKSLCESVTFHVFETPPAKVLDLGCGTG-SWILD 290

Query: 88  LSKTYPLAKFIGLDLLTPLLPKDFSQ------NNLQFVQSDILKGLPFEDGSIDFVHMRC 141
            +K +   +F+G+DL+ PL P + SQ      + + +V  + L GLPF +   DFVH++ 
Sbjct: 291 CAKLWRRCEFVGVDLV-PLQP-NLSQLRSDLGSRITWVHVNCLDGLPFPNEEFDFVHIKR 348

Query: 142 LTAAFTERQWEEVVIKELVRVCKPGGWIELLEIDV--DGKSLGPT 184
           L     E +W + +++E+VRV KPG   E++E D+   GK+  PT
Sbjct: 349 LAHGIPEDKW-DALLEEIVRVMKPGAAFEMIEEDLFFPGKNYEPT 392



>gi|429859026|gb|ELA33824.1| methyltransferase domain-containing protein [Colletotrichum
           gloeosporioides Nara gc5]
          Length = 287

 Score = 84.3 bits (207), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 65/214 (30%), Positives = 107/214 (50%), Gaps = 23/214 (10%)

Query: 28  FPKNDLELE-QDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWIL 86
           FP +DLE E +D K + +LH     + GG+  +     LKN +  ++LD+G GT   W +
Sbjct: 89  FPNDDLEQEREDMKHAMILH-----LCGGSLHN---APLKNPQ--RILDIGTGTGI-WAI 137

Query: 87  ELSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAF 146
           ++   YP A+  G+DL +P+ P ++   N+ F+  D+     + + SID++H+R +  A 
Sbjct: 138 DMGDEYPEAEVTGIDL-SPIQP-EYVPPNVSFIVDDVEAEWLYPENSIDYIHLRHMAPAI 195

Query: 147 TERQWEEVVIKELVRVCKPGGWIELLEI----DVDGKSLGP--TSKRIISACMAKFENRG 200
             + W ++ + E  RV KPGGWIEL ++    D D  S+    T  +  S      E  G
Sbjct: 196 --KNWPKL-LTEAHRVLKPGGWIELQDMKWTFDCDDGSMPSDCTLPKFTSLVKEGLEKFG 252

Query: 201 VNGLISEEIPEFFESTNQVEIYAEEKYSPIGNWG 234
           V    ++   E  E+   V    + K  P+G W 
Sbjct: 253 VELFAADHHIERLEAAGYVNQVNDTKKLPVGPWA 286



>gi|511002906|gb|EPB84327.1| hypothetical protein HMPREF1544_08922 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 502

 Score = 84.0 bits (206), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 61/217 (28%), Positives = 105/217 (48%), Gaps = 7/217 (3%)

Query: 72  KVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILK--GLPF 129
           +VLDV CG+   W+LE++  Y  ++F G+D    + P      N  F Q D+L   G P+
Sbjct: 198 RVLDVACGSGV-WVLEMATEYSNSEFYGIDAAC-IFPNCIKPPNTTFQQHDLLDKDGFPY 255

Query: 130 EDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIELLEIDVDGKSLGPTSKRII 189
            D   D++HMR +   F+    +  V+ E+ RV KPGG++E+ +ID   K  GPT+++  
Sbjct: 256 SDEYFDYIHMRLVYNCFSAVDLK-FVLAEINRVLKPGGYVEIRDIDPTIKHPGPTTEKAF 314

Query: 190 SACMAKFEN-RGVNGLISEEIPEFFESTNQV-EIYAEEKYSPIGNWGDELGKLALDFFVS 247
           S    +      V+   +  I E      ++ +IY ++     G  G     +      +
Sbjct: 315 SEFAVRMAQLNAVDVTWTPHICEILACQGELTDIYHQKVSVGFGMEGPIAVSIENSICDA 374

Query: 248 IFSSSDELIEWIKVSKEEYEHMIAQYIKEVEIYRSYF 284
           I S     +E   +S +E +  + + I+E  I+RS+F
Sbjct: 375 IRSYKKFFMEAYDLSSQECDDKLDEIIQESRIHRSFF 411



>gi|393246637|gb|EJD54146.1| S-adenosyl-L-methionine-dependent methyltransferase [Auricularia
           delicata TFB-10046 SS5]
          Length = 294

 Score = 83.6 bits (205), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 70/252 (27%), Positives = 121/252 (48%), Gaps = 22/252 (8%)

Query: 46  HELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPL-AKFIGLDLLT 104
           HE++K   GG  V+ +  +L +    KV+D   GT   W+LEL+   P  A F G+D+ T
Sbjct: 40  HEVIKHSAGGKLVA-VPVQLGDGD--KVMDSATGTGV-WLLELASRSPAGASFYGIDIST 95

Query: 105 PLLPKDFSQ-NNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVC 163
            L P   S   N+ F +  +         S   V+ R ++ AF   +W +  ++E  RV 
Sbjct: 96  HLFPAPSSTPTNVAFSKHSVFALPESFTSSFTLVNQRLVSVAFRTEEWAQA-LREYYRVV 154

Query: 164 KPGGWIELLEIDVDG-KSLGPTSKRIISACMAKFENRGVNGLISEEIPEFFESTNQVEIY 222
           +PGGW++L EI   G    GP + R++    A  + RG++   +  I ++  +   + + 
Sbjct: 155 RPGGWVQLCEIHPPGFTPQGPHTARMLGIHGAIMKMRGMDNDCALHIGDWARAAGFINVQ 214

Query: 223 AEEKYSPIG-NWGD---ELGKLALDFFVSIFSSSDELI--EWIKVSKEEYEH----MIAQ 272
               ++P+G + GD      K AL FF+++     E++    I  ++EEYE     M A+
Sbjct: 215 TMCTHAPVGVHAGDGPHNYTKSALSFFLAM----KEVVVKNSIVATEEEYEQGVKDMEAE 270

Query: 273 YIKEVEIYRSYF 284
           +   +  Y  Y+
Sbjct: 271 WNDTLGAYYPYY 282



>gi|393214528|gb|EJD00021.1| S-adenosyl-L-methionine-dependent methyltransferase [Fomitiporia
           mediterranea MF3/22]
          Length = 290

 Score = 83.2 bits (204), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 71/224 (31%), Positives = 107/224 (47%), Gaps = 24/224 (10%)

Query: 28  FPKNDLELEQ-DAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWIL 86
            P+N++E  + D++     H  + ++ GG  +  ++  ++ K   +VLD G G   SWI+
Sbjct: 19  LPRNEVERARLDSQ-----HARLTEILGGRLI--LDDSVQLKPGDRVLDSGTGA-ASWII 70

Query: 87  ELSKTYP-LAKFIGLDLLTPLLPKDFSQN-NLQFVQSDILKGLPFE-DGSIDFVHMRCLT 143
           +LS   P     IG+D+ T + PKD   N NL  + S     LP E   S   V  R L 
Sbjct: 71  DLSNHIPKTVGLIGIDISTAMFPKDLPSNVNLMEMSS---TSLPAEWSNSFTLVSQRLLM 127

Query: 144 AAFTERQWEEVVIKELVRVCKPGGWIELLEID-VDGKSLGPTS----KRIISACMAKFEN 198
           +AFT   W    + EL+RV KPGG I+L+E    D   + P +    K+     +A    
Sbjct: 128 SAFTASLWR-TALAELIRVLKPGGTIQLMESGKYDSLHISPKNLTALKKATDIALAISNL 186

Query: 199 RGVNGLIS-EEIPEFFESTNQVEIYAEEKYSPIG-NWGDELGKL 240
           RGV  +   EE+P         E+  +   SP+G  WGD LG +
Sbjct: 187 RGVLSIACVEELPTMLSEVGFSEVQIQNFRSPLGEQWGD-LGAM 229



>gi|475669176|gb|EMT66938.1| Phosphoethanolamine N-methyltransferase [Fusarium oxysporum f. sp.
           cubense race 4]
          Length = 350

 Score = 82.8 bits (203), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 101/213 (47%), Gaps = 23/213 (10%)

Query: 28  FPKNDLELE-QDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWIL 86
           FP +  E E +D K +  +H L  K+       P           K++D+G GT  SW +
Sbjct: 81  FPNDLPEQEREDMKHTVAVHLLGGKLHNAPLDHPQ----------KIIDIGTGT-GSWAI 129

Query: 87  ELSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAF 146
           ++   YP A+ IG+D L+P+ P  +   N++F+  D      + + SID VH+R ++ A 
Sbjct: 130 DMGDEYPSAEVIGID-LSPIQPP-WVPPNVRFLVDDAEAPWLYSENSIDLVHLRNMSTAI 187

Query: 147 TERQWEEVVIKELVRVCKPGGWIELLEI----DVDGKSLGP--TSKRIISACMAKFENRG 200
             + W   ++ ++ R  KPGGWIEL E       D  +L P  T  ++++   A     G
Sbjct: 188 --KDW-PALLGQIYRALKPGGWIELPEFRWVYGCDDGTLRPDFTPPQMVANIRAALAKSG 244

Query: 201 VNGLISEEIPEFFESTNQVEIYAEEKYSPIGNW 233
           +    +E+ P+       V I  E K  P+G W
Sbjct: 245 IEMHAAEKNPDRLHDAGFVNIRHEIKKVPVGPW 277



>gi|392574789|gb|EIW67924.1| hypothetical protein TREMEDRAFT_63812 [Tremella mesenterica DSM
           1558]
          Length = 340

 Score = 82.8 bits (203), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/124 (39%), Positives = 69/124 (55%), Gaps = 7/124 (5%)

Query: 54  GGNFVSPIEQELKNKKDFK--VLDVGCGTTCSWILELSKTYPLAKFIGLDLLTPLLPKDF 111
           G NF++PI++ L +  D++  VLD+G GT   W  E++  YP A  IGLDL +P+  +  
Sbjct: 82  GRNFLAPIDEVLNDGSDYRKGVLDIGTGTGI-WAREIAAEYPDADVIGLDL-SPMQSRKG 139

Query: 112 SQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIEL 171
              N +FV  D  KG PF  G  + VH R L +    R W    I E VRV +PGG + +
Sbjct: 140 VPPNCKFVVHDASKGFPFPTGFFEVVHCRLLMSGI--RDW-RAFIDEAVRVVRPGGLLVM 196

Query: 172 LEID 175
           +E D
Sbjct: 197 VECD 200



>gi|342881065|gb|EGU82047.1| hypothetical protein FOXB_07450 [Fusarium oxysporum Fo5176]
          Length = 350

 Score = 82.4 bits (202), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 62/213 (29%), Positives = 101/213 (47%), Gaps = 23/213 (10%)

Query: 28  FPKNDLELE-QDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWIL 86
           FP +  E E +D K +  +H L  K+       P           K++D+G GT  SW +
Sbjct: 81  FPNDLPEQEREDMKHTVAVHLLGGKLHNAPLDHPQ----------KIIDIGTGT-GSWAI 129

Query: 87  ELSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAF 146
           ++   YP A+ IG+D L+P+ P  +   N++F+  D      + + SID VH+R ++ A 
Sbjct: 130 DMGDEYPSAEVIGID-LSPIQPP-WVPPNVRFLVDDAEAPWLYSENSIDLVHLRNMSTAI 187

Query: 147 TERQWEEVVIKELVRVCKPGGWIELLEI----DVDGKSLGP--TSKRIISACMAKFENRG 200
             + W   ++ ++ R  KPGGWIEL E       D  +L P  T  ++++   A     G
Sbjct: 188 --KDW-PALLGQVYRALKPGGWIELPEFRWVYGCDDGTLRPDFTPPQMVANIRAALAKSG 244

Query: 201 VNGLISEEIPEFFESTNQVEIYAEEKYSPIGNW 233
           +    +E+ P+       V I  E K  P+G W
Sbjct: 245 IEMHAAEKNPDRLHDAGFVNIRHEIKKVPVGPW 277



>gi|242795021|ref|XP_002482494.1| phosphoethanolamine N-methyltransferase, putative [Talaromyces
           stipitatus ATCC 10500]
 gi|242795026|ref|XP_002482495.1| phosphoethanolamine N-methyltransferase, putative [Talaromyces
           stipitatus ATCC 10500]
 gi|218719082|gb|EED18502.1| phosphoethanolamine N-methyltransferase, putative [Talaromyces
           stipitatus ATCC 10500]
 gi|218719083|gb|EED18503.1| phosphoethanolamine N-methyltransferase, putative [Talaromyces
           stipitatus ATCC 10500]
          Length = 331

 Score = 82.0 bits (201), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 63/181 (34%), Positives = 98/181 (54%), Gaps = 20/181 (11%)

Query: 62  EQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQS 121
           +++L+N +  K+LDVG GT   W +E++ TYP A+ +G+DL +P+ PK +   N++F+  
Sbjct: 89  QKQLENPQ--KILDVGTGTGI-WAIEMADTYPSAEVVGIDL-SPIQPK-WVPVNVKFIID 143

Query: 122 DILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIELLE----IDVD 177
           DI +   F   S DF+H+RCL  + T   W E  ++   R  KPGG IEL E    ++ D
Sbjct: 144 DITQPWDFPVNSFDFIHVRCLAGSIT--NWPE-FLEHAYRHLKPGGRIELSEGRTHMECD 200

Query: 178 GKSLGPTSKRIISACMAKFENRGVN--GLISEEIPEF---FESTNQVEIYAEEKYSPIGN 232
             +   TS       +A+F NR  +  G + +  PEF    E     ++ A E+  PIG 
Sbjct: 201 DGTYPETS--YTYKWIAEF-NRISHSLGRVFDLFPEFSGLLEKAGFTDVRAHEEICPIGT 257

Query: 233 W 233
           W
Sbjct: 258 W 258



>gi|384487154|gb|EIE79334.1| hypothetical protein RO3G_04039 [Rhizopus delemar RA 99-880]
          Length = 315

 Score = 81.6 bits (200), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 61/234 (26%), Positives = 115/234 (49%), Gaps = 10/234 (4%)

Query: 46  HELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTP 105
           H  +K +  GN        +   K  K+LD+GCG   +WI++++  YP ++FIG+D+   
Sbjct: 72  HFALKTLLEGNIPKEALDHIDLDKGAKILDLGCGPG-TWIMDMATEYPNSEFIGIDMCD- 129

Query: 106 LLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKP 165
           + P +    N+ F   +IL+GLPFED + D  ++     A  + QW   ++KE+ RV KP
Sbjct: 130 IFPNNIRPVNVTFKIVNILEGLPFEDDTFDMANLTLFILALKKDQWIP-LLKEIKRVIKP 188

Query: 166 GGWIELLEIDVDGKSLGPTSKRIISACMAKFENRGVNGLISEEIPEFFESTNQVEIYAEE 225
           GG    L  ++ G      + ++ +  + +   R     I++++ EF ++T  +EI    
Sbjct: 189 GGL--FLSRELYGNEFIQWASQVFTERLIE---RDQEPCIADKMKEFIQNTG-LEIVCYT 242

Query: 226 KYSPIGNWGDELGKLALDFFVSIFSSSDELIE-WIKVSKEEYEHMIAQYIKEVE 278
           K        D L +  L    +IF +    ++  + ++ ++Y   + Q +KE +
Sbjct: 243 KKHTYPGRPDHLNREFLWDIKNIFKNCQPFLQDHLNLTSQQYPDFLEQVVKECQ 296



>gi|392586338|gb|EIW75675.1| hypothetical protein CONPUDRAFT_77306 [Coniophora puteana
           RWD-64-598 SS2]
          Length = 581

 Score = 81.3 bits (199), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/134 (36%), Positives = 79/134 (58%), Gaps = 14/134 (10%)

Query: 44  LLHELMKKVWGG-NFVSPIEQ--ELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGL 100
           L H   K  +GG N+++P  Q  E+ N     +LD+G G+   W+ E+++ +P AK +G+
Sbjct: 317 LQHRGWKATYGGKNYIAPGVQKNEIHN-----ILDLGSGSGI-WLTEMAEEFPEAKLVGV 370

Query: 101 DLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELV 160
           DL T  L K    +N+ FV +D  + LPFED + D VHMR +  +F +R    V+++E+ 
Sbjct: 371 DLATATLTKP-CPSNVTFVVADFSQRLPFEDSTFDLVHMR-IVPSFGQRL---VLMREIS 425

Query: 161 RVCKPGGWIELLEI 174
           R+ +PGG +   EI
Sbjct: 426 RILRPGGTVNFFEI 439



>gi|384485664|gb|EIE77844.1| hypothetical protein RO3G_02548 [Rhizopus delemar RA 99-880]
          Length = 218

 Score = 81.3 bits (199), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 54/175 (30%), Positives = 91/175 (52%), Gaps = 4/175 (2%)

Query: 115 NLQFVQSDIL-KGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIELLE 173
           NL F + +++ + LPFEDG  DFV  R +TA++T+  W+ V++ ELVRV KPGG I LLE
Sbjct: 21  NLDFYRVNVMDEKLPFEDGQFDFVKQRLVTASYTKEDWKRVML-ELVRVTKPGGLIGLLE 79

Query: 174 IDVDGKSLGPTSKRIISACMAKFENRGVNGLISEEIPEFFESTNQVEIYAEEKYSPIGNW 233
           ID    +LGP   +         +  G    ++  + +  ++    +I  +    P+G W
Sbjct: 80  IDYKTCNLGPKGTQFEKEMTEITQKAGFEPRMATHLSDLLKAVGLEDISTKLVSVPMGEW 139

Query: 234 GDELGKLALDFFVSIFSSSDELI-EWIKVSKEEYEHMIAQYIKEVEIYRSYFINI 287
           G +LG L  +   S   S+  L+ + + ++  EY      Y++E +  +  F N+
Sbjct: 140 GLDLGVLWKNNLESFAESTCPLMSKLMNITVAEYMERWRVYMEEAKETKP-FTNV 193



>gi|511011743|gb|EPB92948.1| hypothetical protein HMPREF1544_00022 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 305

 Score = 81.3 bits (199), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 69/261 (26%), Positives = 117/261 (44%), Gaps = 22/261 (8%)

Query: 46  HELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTP 105
           H L+K+ WG N+  P+E          ++D  C T   W +EL+  +P AK +G+D  + 
Sbjct: 51  HYLLKRTWGRNYQIPLENPSL------IIDWCCATAV-WDIELAFEFPNAKVVGIDYESV 103

Query: 106 LLP------KDFSQNNLQFVQSDILKGLP-FEDGSIDFVHMRCLTAAFTERQWEEVVIKE 158
            +       K+FS +N    Q +   GL  F D  +D++ MR +            ++KE
Sbjct: 104 TVASLTNTVKNFSFHNAMIHQGET--GLKEFGDNQVDYIMMRDVWLVNAPACKWTNLLKE 161

Query: 159 LVRVCKPGGWIELLEIDVDGKSLGPTSKRIISACMAKFENRGVNGLISEEIPEFFESTNQ 218
           + R+ KPGG+IE+ E D + KS+GP    +       +E   V+   + E+  + ++   
Sbjct: 162 IYRILKPGGYIEIYEQDTNFKSMGPKLTILEQWSDRFYEAIKVDRNTNSELGSYLKNAGY 221

Query: 219 VEIYAEEKYSPIGNWGD-----ELGKLALDFFVSIFSSSDE-LIEWIKVSKEEYEHMIAQ 272
             +  +    PIG W D     E G L  D     F  S     ++  +++ EY   + Q
Sbjct: 222 TNVNEKSIELPIGEWPDSKEMKETGYLQKDITERRFRESKRWYCKFNNLTEREYTKTLIQ 281

Query: 273 YIKEVEIYRSYFINIKFYCQK 293
            I E + Y++   +  F  QK
Sbjct: 282 AIDECDDYKTTVRSFYFSAQK 302



>gi|393221741|gb|EJD07225.1| S-adenosyl-L-methionine-dependent methyltransferase [Fomitiporia
           mediterranea MF3/22]
          Length = 285

 Score = 81.3 bits (199), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 86/281 (30%), Positives = 128/281 (45%), Gaps = 45/281 (16%)

Query: 28  FPKNDLE---LEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSW 84
            P+N++E   LE+        H  + +  GG  +   +  ++ K   +VLD G G   SW
Sbjct: 14  LPRNEVERIRLEEQ-------HAWVTEAIGGRLI--FDNSIQLKPGDRVLDSGVGA-GSW 63

Query: 85  ILELSKTYP-LAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFE-DGSIDFVHMRCL 142
            L LSK  P   + +G+D    + PKD   +N++  +   L+ LP E   S + +H R L
Sbjct: 64  TLALSKVVPDTVELVGVDPSLAMFPKDGYPSNIKVYEISTLE-LPAEWTNSFNLIHQRLL 122

Query: 143 TAAFTERQWEEVVIKELVRVCKPGGWIELLEI----DVDGKSLGPTSKR---IISACMAK 195
           +++FT   W +    EL RV KPGG I+L+EI     VD     P +K+   I  A M  
Sbjct: 123 SSSFTIPMW-QTAFSELHRVLKPGGAIQLMEIQQLGSVDESFEIPATKKVTEIAGAIMTH 181

Query: 196 FENRGVNGLISEEIPEFFESTNQVEIYAEEKYSPIG-NWGDE--LG-KLALDFF------ 245
            E  G+ G     +    E      I  E   +P+G  WG+   LG K+A  FF      
Sbjct: 182 RELLGMEG--RHRLRNLLEEAGFTGINEEFHRAPVGKQWGENGVLGAKIAEGFFRNVGSV 239

Query: 246 ------VSIFSSSDELIEWIKVSKEEYEHMIAQYIKEVEIY 280
                 + I SS DE+ E I+ +K+E+      Y    EIY
Sbjct: 240 LMAAGGLGICSSQDEVDEAIEKAKKEWADNAGIY---TEIY 277



>gi|302885854|ref|XP_003041818.1| hypothetical protein NECHADRAFT_87177 [Nectria haematococca mpVI
           77-13-4]
 gi|256722724|gb|EEU36105.1| hypothetical protein NECHADRAFT_87177 [Nectria haematococca mpVI
           77-13-4]
          Length = 354

 Score = 81.3 bits (199), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 86/160 (53%), Gaps = 14/160 (8%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILE 87
           FP ++ +LE         H LM  + G  F++PI+ +++     +VLDVG G+   W ++
Sbjct: 82  FPNDERQLE---SVDITHHYLMILLDGKLFLAPIKDDVQ-----RVLDVGTGSGI-WAID 132

Query: 88  LSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFT 147
            +  YP A+  G DL +P  PK +   N++F   D  +   ++D + DF+H+R L  A  
Sbjct: 133 FADQYPGAEVTGTDL-SPCQPK-WVPPNVRFEIDDASETWTWKDNTFDFIHIRYLFGAI- 189

Query: 148 ERQWEEVVIKELVRVCKPGGWIELLEIDVDGKSLGPTSKR 187
            R W   + KE  R C PGGWI+  E DV+ +S   TS+R
Sbjct: 190 -RDWT-ALFKEAYRCCAPGGWIQSAEADVEFRSDDGTSER 227



>gi|392574791|gb|EIW67926.1| hypothetical protein TREMEDRAFT_63814 [Tremella mesenterica DSM
           1558]
          Length = 341

 Score = 80.9 bits (198), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 63/246 (25%), Positives = 119/246 (48%), Gaps = 28/246 (11%)

Query: 54  GGNFVSPIEQELKNKKDFKV-LDVGCGTTCSWILELSKTYPLAKFIGLDLLTPLLPKDFS 112
           G N+V P+++ L+N+ + +  LDVGCGT   W++E+++ +  A+++G+DL  P+      
Sbjct: 69  GKNYVVPMDKVLENRGEGRRGLDVGCGTGV-WVIEMAREFDKAEWVGVDL-APIQTDSDL 126

Query: 113 QNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIELL 172
            +NL F+  D ++GLP+ D   D +H R L      R W+++V  E+ R+ +PGG    +
Sbjct: 127 PDNLTFIHEDAVRGLPYPDEYFDLIHCRVLYMGI--RNWKDLV-DEVARLLRPGGMAVFV 183

Query: 173 EIDVDGK------------SLGPTSKRIISACMAKFENRGVN-GLISEEIPEFFESTNQV 219
           E  V+G+             + P   +         E RG++       I ++      +
Sbjct: 184 E--VEGRWSLHEKTREEEIKIAPGFSKFCDYLAMATEKRGLDVDAAKTNIVKYIRQNGTL 241

Query: 220 EIYAEEK-YSPIGNWGDEL-----GKLALDFFVSIFSSSDELI-EWIKVSKEEYEHMIAQ 272
           E   + + + P+  W DE      GK+ L   + I  +   LI +  ++S  ++E +   
Sbjct: 242 EDVEQLRMFIPLSPWSDEPHMKASGKIMLVDAIEIPDAVRHLILDAAEISPSKFEELKKG 301

Query: 273 YIKEVE 278
           +I +V 
Sbjct: 302 WIDDVH 307



>gi|384493293|gb|EIE83784.1| hypothetical protein RO3G_08489 [Rhizopus delemar RA 99-880]
          Length = 212

 Score = 80.9 bits (198), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 77/152 (50%), Gaps = 4/152 (2%)

Query: 68  KKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGL 127
           KK   VLDVGC +   WI+++   YP   + G D++     K    N   F  ++++ GL
Sbjct: 40  KKGVSVLDVGCSSGI-WIMDMITDYPNCTYHGCDIVDTT-NKVLKLNQFTFSYANVITGL 97

Query: 128 PFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIELLEIDVD-GKSLGPTSK 186
           P+ + + DFV++R    A  E +W   VIKE++RV KPGG ++L E D+   + +     
Sbjct: 98  PYPENTFDFVNLRFFIFALREEEWPR-VIKEIIRVTKPGGMLQLTESDITLEEGISSVYH 156

Query: 187 RIISACMAKFENRGVNGLISEEIPEFFESTNQ 218
            +  A     ++RG N  I+ E+ +     N 
Sbjct: 157 SVKRAVFTACKSRGQNPQIARELEKLVLENNN 188



>gi|403412790|emb|CCL99490.1| predicted protein [Fibroporia radiculosa]
          Length = 305

 Score = 80.5 bits (197), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 68/249 (27%), Positives = 112/249 (44%), Gaps = 13/249 (5%)

Query: 8   TETMSRDQKITKXXXXXXXXFPKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQ-ELK 66
           TE    D    +        FP ++  L  D      L  L  ++  G F + I   E+ 
Sbjct: 10  TEAFPEDIDRIQHVGRVYQSFPGSEYVLPSDGPERDRL-ALQHRLLAGTFENRIMMPEIS 68

Query: 67  NKKDFKVLDVGCGTTCSWILELSKTYPLAKFI-GLDLLTPLLPKD----FSQNNLQFVQS 121
            +   ++LD GCG+   W+L+     P A  + G+D+ + L P D     ++ N+ F   
Sbjct: 69  FEAGDRILDSGCGSGV-WLLDAINQVPNAVVLEGIDIESRLFPMDSKLIATRGNMNFSIG 127

Query: 122 DILKGLPFE-DGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIELLEIDVDGKS 180
            I K LP E   +   VH R L AA    +W +  IKE++RV  PGGW++L E       
Sbjct: 128 TITK-LPSEWTATFTLVHQRLLIAALRAEEWGQA-IKEMMRVLVPGGWVQLGE--AGAWQ 183

Query: 181 LGPTSKRIISACMAKFENRGVNGLISEEIPEFFESTNQVEIYAEEKYSPIGNWGDELGKL 240
            G T+++  S     F  RG+    S+ IP    +     ++ +++   +G+W  E+G  
Sbjct: 184 AGKTTEKHRSLVDKLFVKRGLLLDCSDRIPSMLRAAGFSNVHIDKRPISLGSWAGEVGIE 243

Query: 241 ALDFFVSIF 249
           A + F+ +F
Sbjct: 244 ARENFMGVF 252



>gi|384493763|gb|EIE84254.1| hypothetical protein RO3G_08964 [Rhizopus delemar RA 99-880]
          Length = 360

 Score = 80.5 bits (197), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 96/208 (46%), Gaps = 13/208 (6%)

Query: 84  WILELSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLT 143
           W +E++  YP AK IGLD   P    D    N  + ++DI+   P    ++DFV+ R + 
Sbjct: 158 WTIEVATEYPDAKIIGLDSKLP----DIQLPNQTYYRTDIVHTWPIPANTVDFVYQRNMG 213

Query: 144 AAFTERQWEEVVIKELVRVCKPGGWIELLEIDVDGKSLGPTSKRIISACMAKFENRGVNG 203
               +  W  +V++++  V K G  IEL+E ++    LGP S  I      + + + +  
Sbjct: 214 TRLQKEHWP-IVLRQMFTVLKKGACIELVEHELFNHQLGPVSTEIREHYRDQCKQQNL-A 271

Query: 204 LISEEIPEFFESTNQVEIYAEEKYSPIGNWGDELGKLALDFFVSIFSSSDELIEWIKVSK 263
           L  ++IP          I  +    P+G W DE       F     +  +E +    ++ 
Sbjct: 272 LDPQQIPILLNQIGFEGIECKVIDVPLGEWPDETDIQKAQF----KNKKNEFMSNWGLTS 327

Query: 264 EEYEHMIAQYIKEVEIYRSYFINIKFYC 291
             Y+ M++Q ++E+E YRS+    +F C
Sbjct: 328 TAYDQMMSQAVEEIERYRSF---TRFNC 352



>gi|392594192|gb|EIW83517.1| S-adenosyl-L-methionine-dependent methyltransferase [Coniophora
           puteana RWD-64-598 SS2]
          Length = 295

 Score = 80.5 bits (197), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 67/214 (31%), Positives = 107/214 (50%), Gaps = 24/214 (11%)

Query: 48  LMKKVWGGNFV-SPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLA-KFIGLDLLTP 105
           L+K ++GGN + +P+        D  VLD G GT  +WI+++    P +    G+DL T 
Sbjct: 46  LLKDIFGGNAIYAPVAL----SGDEWVLDNGTGTG-AWIMDVRSAIPPSISMYGVDLQTR 100

Query: 106 LLPKDFSQNNLQFVQSDILKGLPFE-DGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCK 164
           L+P +   +N  F+Q  +L  LP +       V+ R L AA ++  W++ V  E+ RV K
Sbjct: 101 LVPLN-PPSNTHFLQGSLLD-LPRDWTDRFSLVNQRLLVAALSQDDWKKAV-SEIYRVLK 157

Query: 165 PGGWIELLEIDVDGKSLGPTSKRIISACMAKFEN--------RGVNGLISEEIPEFFEST 216
           PGGW+++LE  V G+   P  +    A M  F N        RG+ G   E+IP+     
Sbjct: 158 PGGWVQILE--VSGRLFTPEGRTDGHADM--FNNIAGKIRAGRGIVGDCFEDIPDLLRGQ 213

Query: 217 NQVEI-YAEEKYSPIGNWGDELGKLALDFFVSIF 249
               +   EE+  P+GN   ++G+  L   VS++
Sbjct: 214 GFRNVAVVEERRVPMGNKHGQVGERMLRNIVSLY 247



>gi|511003877|gb|EPB85263.1| hypothetical protein HMPREF1544_07944 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 514

 Score = 80.5 bits (197), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 62/234 (26%), Positives = 107/234 (45%), Gaps = 36/234 (15%)

Query: 65  LKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTPLLPKDFS------------ 112
           + N ++ K+  +  G    W LE++  YP  + IG+D++ P   + ++            
Sbjct: 263 IMNFRNIKINKMHAGL---WSLEIAHDYPFCQVIGIDVVPPSEKEGWNLATVSSLNTSSS 319

Query: 113 --------QNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCK 164
                   +NN++F   DIL+ L F D   D V+ R +      + W  + I E  RV K
Sbjct: 320 LSAGQLKKENNVKFQYGDILQTLMFPDNHFDLVYQRDVATVLPFKLWPNL-ISEFFRVTK 378

Query: 165 PGGWIELLEIDVDGKSLGPTSKRIISACMAKFENRGVNGLISEEIPEFFESTNQVEIYAE 224
           PGG I+L+E D+  KS GP   ++     +     GVN   +  I E+ E+   +++  +
Sbjct: 379 PGGQIQLVEYDLLFKSPGPVLTQVNEWYRSAAATIGVNPDYTHYITEYMENAGFIDVQVQ 438

Query: 225 EKYSPIGNWGD-----ELGKLALDFFVSIFSSSDELIEW----IKVSKEEYEHM 269
               PIG W +     + G L  +   ++F S   +  W    IKVS++EY+ +
Sbjct: 439 VYDIPIGEWPETDLERQHGYLYKEQMRALFKS---MKRWWCSEIKVSQQEYDQV 489



>gi|384483693|gb|EIE75873.1| hypothetical protein RO3G_00577 [Rhizopus delemar RA 99-880]
          Length = 232

 Score = 80.1 bits (196), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 87/155 (56%), Gaps = 7/155 (4%)

Query: 36  EQDAKCSKLLHELMKKVWGGNFVSPIE-QELKNKKDFKVLDVGCGTTCSWILELSKTYPL 94
           E +A   +L ++L+K  + G F+ P + QEL+N K   +LDVGCG   SW ++L+  YP 
Sbjct: 74  EDEADRIQLKNDLVKLAFEGEFLLPFDYQELENAK---ILDVGCGPG-SWCIDLATKYPN 129

Query: 95  AKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLP-FEDGSIDFVHMRCLTAAFTERQWEE 153
            +  G+D +     +     N      D+L GL  F D + D +H+R +  + T  Q+ +
Sbjct: 130 IQVFGVDNVDMFPLQHTLPINCHLSVCDVLHGLSQFPDANFDVIHIRFMILSLTTAQYLK 189

Query: 154 VVIKELVRVCKPGGWIELLEIDVDGKSLGPTSKRI 188
           V I +  R+ KPGG+IE+LE D+   S GP ++++
Sbjct: 190 V-ISDCWRLLKPGGYIEILETDLIVYSAGPLTQKM 223



>gi|242216589|ref|XP_002474101.1| predicted protein [Postia placenta Mad-698-R]
 gi|220726772|gb|EED80711.1| predicted protein [Postia placenta Mad-698-R]
          Length = 318

 Score = 80.1 bits (196), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 53/184 (28%), Positives = 86/184 (46%), Gaps = 11/184 (5%)

Query: 72  KVLDVGCGTTCSWILELSKTYPLA-KFIGLDLLTPLLPKD----FSQNNLQFVQSDILKG 126
            +LD G G+   W+L+     P + K  G+D+ + L P +     S+ N  F   D +  
Sbjct: 89  SILDSGTGSGI-WVLDAMSRLPASVKLYGVDIESRLFPIENESVISRGNTHF-SVDTITK 146

Query: 127 LPFE-DGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIELLEIDVDGKSLGPTS 185
           LP E   +   ++ R L AA    +WE    +E+ R   PGGW++L E  V     GP +
Sbjct: 147 LPMEWSDTFAIINQRLLVAALQSAEWEAAA-REMYRCLVPGGWVQLGE--VGPWKAGPVT 203

Query: 186 KRIISACMAKFENRGVNGLISEEIPEFFESTNQVEIYAEEKYSPIGNWGDELGKLALDFF 245
            +  S     F ++G+    +E IP    +   + +Y EE+  P+G W  E+G    D F
Sbjct: 204 HKHHSLVHTLFASKGLLLDCAEYIPALLRNAGFINVYTEERAIPVGEWAGEVGIDGRDNF 263

Query: 246 VSIF 249
           + +F
Sbjct: 264 IGVF 267



>gi|510999402|gb|EPB81043.1| hypothetical protein HMPREF1544_12258 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 508

 Score = 79.7 bits (195), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 54/164 (32%), Positives = 78/164 (47%), Gaps = 23/164 (14%)

Query: 31  NDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSK 90
           N  E E D +  +  H ++K V  GN   P+  +    K   +LD  CG    W L++++
Sbjct: 222 NGDEREYDRQLRQ--HYVLKHVLDGNIHVPVPTD----KSITILDSACGAGF-WTLDMAQ 274

Query: 91  TYPLAKFIGLDLLTPLLPKD-----------FSQNNLQFVQSDILKGLPFEDGSIDFVHM 139
           TYP AK IGLD      P D            S  N+ +   D+   L   D  ID ++ 
Sbjct: 275 TYPKAKVIGLDAF----PADDKRMKGYSNATISAPNIVYKYGDLTTQLTLPDDYIDVLYQ 330

Query: 140 RCLTAAFTERQWEEVVIKELVRVCKPGGWIELLEIDVDGKSLGP 183
           R  T+     +W   + KEL+RV KPGG+IEL+E + D +  GP
Sbjct: 331 RDTTSIIPHERWP-FLFKELMRVMKPGGYIELVEYNFDIRDPGP 373



>gi|477534569|gb|ENH86104.1| methyltransferase domain-containing protein [Colletotrichum
           orbiculare MAFF 240422]
          Length = 376

 Score = 79.7 bits (195), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 62/214 (28%), Positives = 98/214 (45%), Gaps = 23/214 (10%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILE 87
            P ++ E E++     + H +   V  G   S     L+N +  K++D+G GT   W ++
Sbjct: 106 LPNDEPEQERE----DMKHAMCVNVMNGKLHS---APLENPQ--KIVDIGTGTGI-WAID 155

Query: 88  LSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFT 147
               YP +  +G+DL +P+ P D+   N++F+  D      +  GS+DFVH R +  A  
Sbjct: 156 FGDEYPESDVLGIDL-SPIQP-DWVPPNVRFMIDDAEAEWVWPAGSLDFVHARHMCMAV- 212

Query: 148 ERQWEEVVIKELVRVCKPGGWIELLEIDV-----DGKSLGPTS---KRIISACMAKFENR 199
            + W  +V  +     +PGGWIEL E+       DG   GP      R + ACMA F + 
Sbjct: 213 -KDWPRLV-SQAREALRPGGWIELQELRFRLQCDDGTMPGPEGYGYGRFVDACMAGFRSF 270

Query: 200 GVNGLISEEIPEFFESTNQVEIYAEEKYSPIGNW 233
           G++ L  E   E   +     +       PIG W
Sbjct: 271 GIDPLAMERNAELLRAGGFGGVVERVWKVPIGTW 304



>gi|384500734|gb|EIE91225.1| hypothetical protein RO3G_15936 [Rhizopus delemar RA 99-880]
          Length = 227

 Score = 79.3 bits (194), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 63/234 (26%), Positives = 106/234 (45%), Gaps = 21/234 (8%)

Query: 73  VLDVGCGTTCSWILELSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDG 132
           +LD+G G    W LE++     A  IGLD+  P   +     NL ++++DI +  P E  
Sbjct: 3   ILDIGTGNGI-WALEIAAEQSKANIIGLDIRPPAELQG-KPKNLTYMEADITQPWPIESN 60

Query: 133 SIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIELLEIDVDGKSLGPTSKRIISAC 192
           SIDF+  R +     + QW+ V + E+ RV KP G IEL+E D+   + GP         
Sbjct: 61  SIDFIFQRHMGNIILKNQWQHV-LSEMYRVLKPEGTIELVEADLWHHNPGPVQTAFDEFH 119

Query: 193 MAKFENRGVNGLISEEIPEFFESTNQVEIYAEEKYSPIGNW------------GDELGKL 240
             +++  G++   +  + E   ST   +I +     PIG W              E+ K 
Sbjct: 120 QTQYDELGLDFKFTTTLEEELRSTGFQQIESRTLDIPIGEWPQEADLKQFGFINKEIQKA 179

Query: 241 ALDFFVSIFSSSDELIEWIKVSKEEYEHMIAQYIKEVEIYRSYFINIKFYCQKI 294
            L    S++ S     +W  V+ E+++  + + + E E YR +     +  +KI
Sbjct: 180 YLKNRKSVYMS-----KW-GVASEDFDLAVQEILTEFEEYRGFTRYNSWIAKKI 227



>gi|511000432|gb|EPB81971.1| hypothetical protein HMPREF1544_11287 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 357

 Score = 79.3 bits (194), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 79/298 (26%), Positives = 127/298 (42%), Gaps = 41/298 (13%)

Query: 10  TMSRDQKITKXXXXXXXXFPKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKK 69
           T SR Q IT+          + D    ++    + LH L+K     N    IE  +    
Sbjct: 77  TKSRRQSITEFFSGRKKSLAQEDF---REIDRLQRLHYLLKSARKSNTWGEIEGSMT--- 130

Query: 70  DFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPF 129
              ++DVG G    W LE++      K IGLDL  P   +     NL + ++DI +  P 
Sbjct: 131 ---IVDVGTGNGI-WALEMASEQLNCKVIGLDLRPPT-EQQGKPKNLNYHEADITEIWPL 185

Query: 130 EDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIELLEIDVDGKSLGPTSKRII 189
           E  S+DF+  R +  +  + QW  V + E++RV KPGG IEL+E D+   + GP  +   
Sbjct: 186 ESNSVDFIFQRNMGQSIQKDQWSHV-LSEMLRVLKPGGTIELVEADLVHHNPGPVQRAFD 244

Query: 190 SACMAKFENRGVN----GLISEEIPEFFESTNQVEIYAEEKYSPIGNW------------ 233
                +    G++    G+I++E+    E+    E+       PIG W            
Sbjct: 245 EFYQNQCSENGLDFAFTGIINKEL----EAIGFSELDHRTLDIPIGEWPQDSELKQFGFI 300

Query: 234 GDELGKLALDFFVSIFSSSDELIEWIKVSKEEYEHMIAQYIKEVEIYRSYFINIKFYC 291
             E+ K  L    S + S     +W  ++ E+YE  + + + E E Y  +    +F C
Sbjct: 301 NKEIQKAFLRNRKSFYVS-----KW-GITPEDYELAVQEVLTEFEDYHGF---SRFNC 349



>gi|429858695|gb|ELA33506.1| methyltransferase domain-containing protein [Colletotrichum
           gloeosporioides Nara gc5]
          Length = 367

 Score = 79.3 bits (194), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 62/208 (29%), Positives = 100/208 (48%), Gaps = 21/208 (10%)

Query: 34  ELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYP 93
           E EQD +  K  H +   V  G   S     L+N +  K++D+G GT   W +++   YP
Sbjct: 99  EPEQDREDMK--HAMCVNVMDGKLHS---APLENPQ--KIVDIGTGTGI-WAIDIGDEYP 150

Query: 94  LAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEE 153
            A  +G+DL +P+ P D+   N++F+  D      + + S+DFVH R +  A   + W  
Sbjct: 151 EADVLGIDL-SPIQP-DWVPPNVRFMIDDAEADWVWPENSLDFVHARHMCMAI--KNWPG 206

Query: 154 VVIKELVRVCKPGGWIELLEIDV-----DGKSLGPTS---KRIISACMAKFENRGVNGLI 205
           + + E  +  KPGGW+EL E+       DG   GP      + +  CM+ F + G++ L+
Sbjct: 207 L-LSEAYKSLKPGGWVELQELRFHLQCDDGTMPGPEQYGYGKFVDLCMSGFRSFGIDPLM 265

Query: 206 SEEIPEFFESTNQVEIYAEEKYSPIGNW 233
            E  PE   +     +  +    PIG W
Sbjct: 266 MERNPELLSNCGFQNVTEKVWKVPIGVW 293



>gi|299743279|ref|XP_001835655.2| hypothetical protein CC1G_03437 [Coprinopsis cinerea okayama7#130]
 gi|298405584|gb|EAU86226.2| hypothetical protein CC1G_03437 [Coprinopsis cinerea okayama7#130]
          Length = 1271

 Score = 79.3 bits (194), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 46/136 (33%), Positives = 77/136 (56%), Gaps = 15/136 (11%)

Query: 52  VWGGNFVSPIEQELK----NKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTPLL 107
           VW   F   I + L      +   +VLD+GCG+  +WIL  ++ +   +F+GLD++ PL 
Sbjct: 508 VWETLFCQDICESLTWHVFEEPPLRVLDIGCGSG-TWILNCARQWRETQFVGLDIV-PLH 565

Query: 108 P-------KDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELV 160
           P        DF+ + + +VQ++ L GLPF +   DFVH++ +     E +W + +  E+ 
Sbjct: 566 PDLQRVGSSDFA-SRITWVQANFLDGLPFPNDEFDFVHIKRIALGVPEDKW-DALFDEIS 623

Query: 161 RVCKPGGWIELLEIDV 176
           RV KPGG +E++E D+
Sbjct: 624 RVMKPGGALEMVEEDL 639



>gi|384485109|gb|EIE77289.1| hypothetical protein RO3G_01993 [Rhizopus delemar RA 99-880]
          Length = 212

 Score = 79.0 bits (193), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 55/205 (26%), Positives = 105/205 (51%), Gaps = 22/205 (10%)

Query: 84  WILELSKTYPLAKFIGLDLLTPL-LPKDFSQNNLQFVQSDIL--KGLPFEDGSIDFVHMR 140
           +++++    P      +D  TP+ L +   + N  F+  +I+  K LPFE    DF+   
Sbjct: 11  YLVDICNLLPQTSSTSIDSYTPVKLEERQEEKNFTFITHNIIQNKQLPFESNHFDFIQQN 70

Query: 141 CLTAAFTERQWEEVVIKELVRVCKPGGWIELLEIDVDGKSLGPTSKRIISACMAKFENRG 200
                + +  W  +++KEL+RV KPGG+I+L+E+D+    +GP ++  +     K E   
Sbjct: 71  LTAFTYKQEDWP-LILKELLRVTKPGGYIQLIEVDLTPHHMGPRTELWLEQ--GKLEQML 127

Query: 201 VN-GLISEEIPEFFESTNQVEIYAEEKYSPIGNWGDELGKLALDFFVSIFSSSDE-LIEW 258
            N GL+  +        N V I       P+G+WG ++G L  + + + F S+   LIE 
Sbjct: 128 SNIGLVDIQ-------CNFVSI-------PVGSWGLDIGHLWKENYEAFFESAKPFLIEM 173

Query: 259 IKVSKEEYEHMIAQYIKEVEIYRSY 283
           +++S  EY+  +   ++E++ Y+++
Sbjct: 174 MEISSREYKKQMRIVMEELDEYKTF 198



>gi|472585357|gb|EMS22911.1| methyltransferase type 11 [Rhodosporidium toruloides NP11]
          Length = 458

 Score = 78.6 bits (192), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 65/113 (57%), Gaps = 7/113 (6%)

Query: 67  NKKDFKVLDVGCGTTCSWILELSKT--YPLAKFIGLDLLTPLLPKDF----SQNNLQFVQ 120
           + K  +VLD+GCG    WIL  +    +  ++F+GLDL+  L+P        +  + FVQ
Sbjct: 97  DPKPRRVLDIGCGANAGWILSTAAAPGWEESRFVGLDLVPVLVPPSMLDESVRARVSFVQ 156

Query: 121 SDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIELLE 173
            + L+ LPF D   D+V + C+ +   E +W+  +I+EL RV  PGG +ELL+
Sbjct: 157 HNFLEPLPFFDEEFDYVRIACVNSGTPEHRWDS-LIEELRRVLTPGGHLELLD 208



>gi|392571088|gb|EIW64260.1| hypothetical protein TRAVEDRAFT_158346 [Trametes versicolor
           FP-101664 SS1]
          Length = 603

 Score = 78.6 bits (192), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 69/118 (58%), Gaps = 7/118 (5%)

Query: 64  ELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTPLLP----KDFSQNNLQFV 119
           + K+K   + LD+G G    W+L  ++T+P + F+GLD++    P    +  + + +++V
Sbjct: 83  DFKDKPPKRCLDIGTGLGL-WVLSSARTWPESTFVGLDMVNIQPPLQVLEPETADRVEWV 141

Query: 120 QSDILKG-LPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIELLEIDV 176
            ++IL+  LPF+D   D VHM+C+     E +W   V +E+ RV KPG  IELLE D 
Sbjct: 142 HTNILRNKLPFDDDEFDHVHMQCVALGIPENKWHS-VFEEIRRVMKPGATIELLEEDA 198



>gi|384500413|gb|EIE90904.1| hypothetical protein RO3G_15615 [Rhizopus delemar RA 99-880]
          Length = 266

 Score = 78.6 bits (192), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 90/194 (46%), Gaps = 9/194 (4%)

Query: 46  HELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTP 105
           H L+K     N  + ++  +       ++D G G    W LE++  Y  +K I LDL  P
Sbjct: 69  HYLLKSAKKSNTATQLDDSIT------IVDSGTGNGI-WALEIAAEYTHSKVIALDLKPP 121

Query: 106 LLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKP 165
              +     NL + ++DI K  P E  S+DFV  R +     +  W ++ I E+ RV KP
Sbjct: 122 TQEQG-KPPNLFYKEADITKPWPIESNSVDFVFQRSMGHVIPKEHWHQL-ISEMYRVLKP 179

Query: 166 GGWIELLEIDVDGKSLGPTSKRIISACMAKFENRGVNGLISEEIPEFFESTNQVEIYAEE 225
           GG IEL E D+   + GP  +       ++ +  G++  I+E I +  E     E+    
Sbjct: 180 GGTIELTESDLWHHNPGPMQRAFDEFFESQCDENGIDYRITETINKKIELVGFKELNHFT 239

Query: 226 KYSPIGNWGDELGK 239
              PIG W ++ GK
Sbjct: 240 LDVPIGEWPEDEGK 253



>gi|170089965|ref|XP_001876205.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164649465|gb|EDR13707.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 766

 Score = 78.2 bits (191), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 69/115 (60%), Gaps = 12/115 (10%)

Query: 72  KVLDVGCGTTCSWILELSKTYPL-----AKFIGLDL--LTPLLPKDFS---QNNLQFVQS 121
           KVL++GCGT  +WIL  ++++ L      KF+GLD+  L P +P  +    +  + +VQ 
Sbjct: 31  KVLEIGCGT-GTWILNCARSWKLRVVKDTKFVGLDIVPLFPNMPHIYPPDLEKRITWVQG 89

Query: 122 DILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIELLEIDV 176
           ++L GLPF DG  DFVH++ +     E +W + +  E+ RV KPG   E++E D+
Sbjct: 90  NLLAGLPFPDGEFDFVHIKRIALGVPEDKW-DALFDEISRVMKPGAAFEMIEEDL 143



>gi|399170960|emb|CCE28054.1| uncharacterized protein CPUR_01528 [Claviceps purpurea 20.1]
          Length = 342

 Score = 78.2 bits (191), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 67/230 (29%), Positives = 107/230 (46%), Gaps = 34/230 (14%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILE 87
           +P +D +LE    C + L  L     G  F++P+E++    K  +VLDVG G+  +W +E
Sbjct: 73  YPNDDQQLESVELCHQYLTILFD---GQLFLAPLEED----KIRRVLDVGTGS-GTWAIE 124

Query: 88  LSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFT 147
            +  +P A   G DL +P  PK +   N+ F   D      +E    DF+HMR +     
Sbjct: 125 FADQFPNASVTGTDL-SPCQPK-WVPPNVHFEIDDASLDWTWEANHFDFIHMRYIVGGIQ 182

Query: 148 ERQWEEVVIKELVRVCKPGGWIELLEIDVDGKSLGPTSKRIISACMAKFEN--RGVNGLI 205
           +  W   ++KE  R C PGGW+E +E +VD +S   T++  +   +A F    R    ++
Sbjct: 183 D--WT-TLLKEAYRCCAPGGWVESIEYEVDFRSDDGTTE--LEPVLASFGELFREAGKIL 237

Query: 206 SEEIPEFFESTNQVEIYAEEKYS---------PIGNWGD-----ELGKLA 241
           +     FF    Q + + E  +          PIG W       E+G+LA
Sbjct: 238 NR---PFFLHDIQEQAFDEAGFVEKKVIRYKLPIGPWAQDGKFAEIGRLA 284



>gi|242222589|ref|XP_002477008.1| predicted protein [Postia placenta Mad-698-R]
 gi|220723666|gb|EED77791.1| predicted protein [Postia placenta Mad-698-R]
          Length = 558

 Score = 77.8 bits (190), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 61/213 (28%), Positives = 95/213 (44%), Gaps = 13/213 (6%)

Query: 43  KLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLA-KFIGLD 101
            L H L+  ++    +      ++  + F  LD G G+   W+L++    P + K  G+D
Sbjct: 40  NLQHRLLTTIFDNRLIFAPLPSIRGDEAF--LDSGTGSGI-WLLDVLNHVPSSVKLYGID 96

Query: 102 LLTPLLPKD----FSQNNLQFVQSDILKGLPFE-DGSIDFVHMRCLTAAFTERQWEEVVI 156
           +   L P+D     S+ N+ F    I K LP E   +   V  R L AA    +W  VVI
Sbjct: 97  IEPCLFPRDNEALLSRGNIHFSVGSITK-LPAEWTDTFTLVQQRLLVAALQHAEWR-VVI 154

Query: 157 KELVRVCKPGGWIELLEIDVDGKSLGPTSKRIISACMAKFENRGVNGLISEEIPEFFEST 216
            E+ RV KP GW++L E        GP + +      A F ++G+       IP +    
Sbjct: 155 SEIFRVLKPTGWVQLCE--AGPFKAGPVTDKFRILLYALFAHKGLLLDCGVHIPIWMREA 212

Query: 217 NQVEIYAEEKYSPIGNWGDELGKLALDFFVSIF 249
               I+ EE+  P+G W  +LG    +  +SIF
Sbjct: 213 GFTNIHVEERAVPLGQWAGQLGVDGSNDIISIF 245



>gi|390603017|gb|EIN12409.1| hypothetical protein PUNSTDRAFT_124275 [Punctularia strigosozonata
           HHB-11173 SS5]
          Length = 991

 Score = 77.8 bits (190), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 51/158 (32%), Positives = 83/158 (52%), Gaps = 22/158 (13%)

Query: 28  FPK--NDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWI 85
           +P+  + L+L+QD   +K   +    V    F +P           KVLD+GCGT  +WI
Sbjct: 277 YPRSYDRLDLDQDVWETKFCQQACGSVTWHVFETPPS---------KVLDLGCGTG-TWI 326

Query: 86  LELSKTYPLAKFIGLDLLTPLLPKDFSQ-------NNLQFVQSDILKGLPFEDGSIDFVH 138
           L+ +K +    F+GLD++   L  D  +       + + +VQ++ L+ LPF D   DFVH
Sbjct: 327 LDCAKVWKKTHFVGLDVVP--LHADLQRTGYVGLASRVTWVQANFLEPLPFPDDEFDFVH 384

Query: 139 MRCLTAAFTERQWEEVVIKELVRVCKPGGWIELLEIDV 176
           ++ +     E +W   + +ELVRV KPG   E++E D+
Sbjct: 385 IKRIARGVPEDKW-NALFEELVRVMKPGAAFEMIEEDL 421



>gi|302888902|ref|XP_003043337.1| hypothetical protein NECHADRAFT_53587 [Nectria haematococca mpVI
           77-13-4]
 gi|256724253|gb|EEU37624.1| hypothetical protein NECHADRAFT_53587 [Nectria haematococca mpVI
           77-13-4]
          Length = 305

 Score = 77.8 bits (190), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 78/140 (55%), Gaps = 12/140 (8%)

Query: 36  EQDAKCSKLLHELMKKVWGGN-FVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPL 94
           E+  +   L+HE+ + +  GN + +P+ +  +     +VLDVGCGT   W +E +  +P 
Sbjct: 38  ERQQEAEDLMHEMYRIILDGNLYAAPLGENPQ-----RVLDVGCGTGI-WAIEFADEHPS 91

Query: 95  AKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEV 154
           A  +G+DL +P+ P  F   N +F   DI +   F D S D+VH+R +T    +  W E+
Sbjct: 92  ADVLGVDL-SPIQPG-FVPPNCKFEVDDINQEWTFPDNSFDYVHIRAMTGCIPD--WVEL 147

Query: 155 VIKELVRVCKPGGWIELLEI 174
             K+  +  KPGGW+E +E+
Sbjct: 148 H-KKAFKALKPGGWVEHVEL 166



>gi|342320225|gb|EGU12167.1| Proteophosphoglycan ppg4 [Rhodotorula glutinis ATCC 204091]
          Length = 458

 Score = 77.8 bits (190), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 65/113 (57%), Gaps = 7/113 (6%)

Query: 67  NKKDFKVLDVGCGTTCSWILELSKT--YPLAKFIGLDLLTPLLPKDF----SQNNLQFVQ 120
           + K  +VLD+GCG    WIL  +    +  ++F+GLDL+  L+P        +  + FVQ
Sbjct: 97  DPKPRRVLDIGCGAYAGWILSTAAALGWETSRFVGLDLVPVLVPPSMLDGPVRARVSFVQ 156

Query: 121 SDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIELLE 173
            + L+ LPF D   D+V + C+ +   E +W+  +++EL RV  PGG +ELL+
Sbjct: 157 HNFLEPLPFFDEEFDYVRIACVNSGTPEHRWDS-LMEELRRVLAPGGHLELLD 208



>gi|477510784|gb|ENH63694.1| Demethylmenaquinone methyltransferase [Fusarium oxysporum f. sp.
           cubense race 1]
          Length = 336

 Score = 77.4 bits (189), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 78/136 (57%), Gaps = 12/136 (8%)

Query: 46  HELMKKVWGGN-FVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLT 104
           HEL + V  G  + +PI +  +N     VLDVGCGT   W ++++  +P A+ +G+DL +
Sbjct: 83  HELFRAVLDGKLYEAPIGKNPQN-----VLDVGCGTGI-WAIDMADLHPSAEVVGVDL-S 135

Query: 105 PLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCK 164
           P+ P +F   N +F   DI K   F +   DF+H+R +T    +  W E ++K+  R  K
Sbjct: 136 PIQP-NFIPPNCRFEVDDINKEWTFPENKFDFIHIRYMTGTVPD--WTE-LLKKAQRHLK 191

Query: 165 PGGWIELLEIDVDGKS 180
           PGGWIE +E+  D ++
Sbjct: 192 PGGWIEHVELWGDARA 207



>gi|475670269|gb|EMT67638.1| Demethylmenaquinone methyltransferase [Fusarium oxysporum f. sp.
           cubense race 4]
          Length = 336

 Score = 77.4 bits (189), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 49/136 (36%), Positives = 78/136 (57%), Gaps = 12/136 (8%)

Query: 46  HELMKKVWGGN-FVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLT 104
           HEL + V  G  + +PI +  +N     VLDVGCGT   W ++++  +P A+ +G+DL +
Sbjct: 83  HELFRAVLDGKLYEAPIGKNPQN-----VLDVGCGTGI-WAIDMADLHPSAEVVGVDL-S 135

Query: 105 PLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCK 164
           P+ P +F   N +F   DI K   F +   DF+H+R +T    +  W E ++K+  R  K
Sbjct: 136 PIQP-NFIPPNCRFEVDDINKEWTFPENKFDFIHIRYMTGTVPD--WTE-LLKKAQRHLK 191

Query: 165 PGGWIELLEIDVDGKS 180
           PGGWIE +E+  D ++
Sbjct: 192 PGGWIEHVELWGDARA 207



>gi|302886185|ref|XP_003041983.1| hypothetical protein NECHADRAFT_64568 [Nectria haematococca mpVI
           77-13-4]
 gi|256722890|gb|EEU36270.1| hypothetical protein NECHADRAFT_64568 [Nectria haematococca mpVI
           77-13-4]
          Length = 335

 Score = 77.4 bits (189), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 60/212 (28%), Positives = 99/212 (46%), Gaps = 21/212 (9%)

Query: 29  PKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILEL 88
           P +D E  +D     ++ EL     G  F +P+    +     K+LD+G GT  SW +E+
Sbjct: 70  PNDDAEQNRDDMKHVMMLELTD---GKLFFAPVGNNPQ-----KILDLGTGTG-SWAIEV 120

Query: 89  SKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTE 148
           +  YP A  +G+D L+P+ P  +   NL+FV  DI       DG  +F+HMRC++    +
Sbjct: 121 ADMYPSASVVGVD-LSPIQPL-WVPPNLKFVVDDIEDSWMLGDG-YEFMHMRCISPWLKD 177

Query: 149 RQWEEVVIKELVRVCKPGGWIELLEIDV-----DGK-SLGPTSKRIISACMAKFENRGVN 202
              +  V+++      PGGWIE+ E+D      DG   L  +  +      A   + G+N
Sbjct: 178 ---QPTVLQQAYEHLNPGGWIEIQELDARANCDDGSLPLDSSLSKFFDTAEAAVRSFGMN 234

Query: 203 GLISEEIPEFFESTNQVEIYAEEKYSPIGNWG 234
               E++ E  ++   + +       PIG W 
Sbjct: 235 FRAGEKLGELLQNVGFINVGCIVLKVPIGAWA 266



>gi|170106044|ref|XP_001884234.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164641006|gb|EDR05269.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 301

 Score = 77.0 bits (188), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 66/259 (25%), Positives = 125/259 (48%), Gaps = 18/259 (6%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILE 87
            P ++LE E+  K     H ++ + +    V P    +  KK  KVLD   G  C+W+L 
Sbjct: 35  LPSDELERERLEK----QHRIITQAFDNKLVLP---PVILKKGDKVLDSATGG-CNWLLN 86

Query: 88  LSKTYPLA-KFIGLDLLTPLLPK-DFSQNNLQFVQSDILKGLPFE-DGSIDFVHMRCLTA 144
             K  P + +  G+D+ T L P  D   +N+    + +   LP + + +   ++ R L  
Sbjct: 87  CMKNVPSSVEIYGIDIETRLFPAADCLPDNVHLSLNSV-TNLPSKWNDTFTLINQRLLIL 145

Query: 145 AFTERQWEEVVIKELVRVCKPGGWIELLEIDVDGKSLGPTSKRIISACMAKFENRGVNGL 204
           A    +W  V +KEL RV    GW++L E+D   +  GP   +I +  +A  +++G+   
Sbjct: 146 ALQNHEWV-VALKELHRVLALKGWLQLCEVDPFIRKGGPVVDKINALRIALCDSKGLVVD 204

Query: 205 ISEEIPEFFESTNQVEIYAEEKYSPIGNWGDELGKLALDFFVSIFSSSDELIEW-----I 259
           I+ ++PE  ++   V+++   + +P+G W  + G+   D  VS++      +       I
Sbjct: 205 IASQLPEILQNAGFVDVHVVCRSTPLGKWAGKYGEDGRDNIVSLWKGLKTPVMMAGGLGI 264

Query: 260 KVSKEEYEHMIAQYIKEVE 278
             S+EE++ M+    +E++
Sbjct: 265 VHSEEEFDDMLEDLERELD 283



>gi|399171424|emb|CCE27614.1| uncharacterized protein CPUR_01088 [Claviceps purpurea 20.1]
          Length = 340

 Score = 77.0 bits (188), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 68/253 (26%), Positives = 116/253 (45%), Gaps = 25/253 (9%)

Query: 29  PKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILEL 88
           P +D +LE +  C   L  L+       F++P+E++    K  +VLDVG G+   W +E 
Sbjct: 73  PNDDQQLESEELCHHFLTILLNDQL---FLAPLEKD----KIHRVLDVGTGSGI-WAIEF 124

Query: 89  SKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTE 148
           +  +P A  IG DL +P  P+ +   NL F   D      +     DF+HMR +     +
Sbjct: 125 ADQFPNASVIGTDL-SPCQPQ-WVPPNLCFEIDDATLEWTWNANHFDFIHMRYIVGGIQD 182

Query: 149 RQWEEVVIKELVRVCKPGGWIELLEIDVDGKSLGPTS--KRIISACMAKFENRGV---NG 203
             W   ++KE  R C PGGW+E +E + + +S   T+  + ++++    F   G      
Sbjct: 183 --WS-ALLKEAYRCCAPGGWVESVEYEPEFRSDDGTTELEPVLASHGELFRKAGKALDRP 239

Query: 204 LISEEI-PEFFESTNQVEIYAEEKYSPIGNWGD-----ELGKLALDFFVSIFSSSDELIE 257
           L  EEI P+ F     +E        PIG W       ++G++  +   + +    +++ 
Sbjct: 240 LFVEEIQPQAFAEAGFIERRVARYKVPIGPWAKDRKFAQVGRIFREALENDYQGYTQML- 298

Query: 258 WIKVSKEEYEHMI 270
           W  V K E E+ +
Sbjct: 299 WQSVQKPEDEYYV 311



>gi|384496097|gb|EIE86588.1| hypothetical protein RO3G_11299 [Rhizopus delemar RA 99-880]
          Length = 198

 Score = 77.0 bits (188), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 54/86 (62%), Gaps = 2/86 (2%)

Query: 88  LSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFT 147
           ++  YP  KFIGLD+   + P      N++F   +IL GLPF D + DFV+MR +  AF 
Sbjct: 1   MAVEYPEFKFIGLDM-ADMFPTTIRPENVKFQLHNILHGLPFHDNTFDFVNMRIMLTAFL 59

Query: 148 ERQWEEVVIKELVRVCKPGGWIELLE 173
             +W   VIKE+ RV KPGG++EL+E
Sbjct: 60  IDEW-PFVIKEIYRVLKPGGFVELME 84



>gi|399170964|emb|CCE28058.1| uncharacterized protein CPUR_01532 [Claviceps purpurea 20.1]
          Length = 340

 Score = 77.0 bits (188), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 67/253 (26%), Positives = 112/253 (44%), Gaps = 25/253 (9%)

Query: 29  PKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILEL 88
           P +D +LE +  C   L  L+       F++P+E++    K  +VLDVG G+   W +E 
Sbjct: 73  PNDDQQLESEESCHHFLTMLLDDQL---FLAPLEKD----KIHRVLDVGTGSGI-WAIEF 124

Query: 89  SKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTE 148
           +  +P A  IG DL +   P+ +   N+ F   D      +     DF+HMR +     +
Sbjct: 125 ADQFPNASVIGTDL-SSCQPQ-WVPPNVSFEIDDATLEWTWNANHFDFIHMRYIVGGIQD 182

Query: 149 RQWEEVVIKELVRVCKPGGWIELLEIDVDGKS-LGPTSKRIISACMAKFENRGVNGL--- 204
             W   ++KE  R C PGGW+E +E DV+ +S  G T    + A   +   +    L   
Sbjct: 183 --WT-ALLKEAYRCCAPGGWVESVEYDVEFRSDDGTTELEPVLASYGELFRQASKILDRP 239

Query: 205 --ISEEIPEFFESTNQVEIYAEEKYSPIGNWGD-----ELGKLALDFFVSIFSSSDELIE 257
             + E  PE F+    +E    +   P+G W       E+G+   +   +      +++ 
Sbjct: 240 LFVQEIQPEAFDEAGFIEKRVAQYKIPVGPWAKDRKFAEIGQFLQEALENDLQGYTQML- 298

Query: 258 WIKVSKEEYEHMI 270
           W  V K E E+ +
Sbjct: 299 WQSVQKPEDEYHV 311



>gi|393214573|gb|EJD00066.1| S-adenosyl-L-methionine-dependent methyltransferase [Fomitiporia
           mediterranea MF3/22]
          Length = 291

 Score = 76.6 bits (187), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 61/202 (30%), Positives = 98/202 (48%), Gaps = 14/202 (6%)

Query: 48  LMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLA-KFIGLDLLTPL 106
           L+  V+ G  +   ++ ++   + +VLD G GT  +WI  L+K  P + + +G D+   L
Sbjct: 38  LVATVYDGRLI--YDKGVQLSPEGRVLDAGTGT-GAWITGLAKEVPESVQLVGTDISPAL 94

Query: 107 LPKDFSQNNLQFVQSDILKGLPFE-DGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKP 165
            PK F  +N+ FV +     LP     + DFVH R +  AFT   W    + EL RV KP
Sbjct: 95  FPKSFP-SNVCFVANSTTN-LPASWSSTFDFVHQRAMVGAFTSSDW-VAAMSELYRVLKP 151

Query: 166 GGWIELLEID---VDGKSLGPTSKRIISACMAKFENRGVNGLISEEIPEFFESTNQVEIY 222
           GG  ++++       G +L    K + +       +RG     +E IPE   +    +I 
Sbjct: 152 GGTAQIVDFTEPFPSGDNLQAVEK-MTTLFAEVLRSRGFLTNSAEHIPELMRNVGFTDIR 210

Query: 223 AEEKYSPIG-NWGDELGKLALD 243
            E + +PIG NWG E+ ++  D
Sbjct: 211 VEIRGAPIGNNWG-EIARIGTD 231



>gi|85095489|ref|XP_960101.1| hypothetical protein NCU05841 [Neurospora crassa OR74A]
 gi|28921560|gb|EAA30865.1| hypothetical protein NCU05841 [Neurospora crassa OR74A]
          Length = 387

 Score = 76.6 bits (187), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 62/218 (28%), Positives = 98/218 (44%), Gaps = 34/218 (15%)

Query: 37  QDAKCSKLL---HELMKKVWGGN-FVSPI-EQELKNKKDFKVLDVGCGTTCSWILELSKT 91
            DAK ++LL   H  M  V+ G  + SP+ ++ELKN      +D+G GT   W ++ +  
Sbjct: 116 NDAKANELLDIMHAAMVMVFDGKLYTSPLKDEELKN-----AIDIGTGTGV-WAIDFADE 169

Query: 92  YPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQW 151
           +P    IG D+ +P+ P  +   N  F  +D  +   ++D   DF+H R LT     + W
Sbjct: 170 HPNCNVIGTDI-SPIQPS-WVPPNASFEINDATREWTYKDNFFDFIHFRWLTGVM--KDW 225

Query: 152 EEVVIKELVRVCKPGGWIELLEIDV-----DG--------KSLGPTSKRIISACMAKFEN 198
           +  + +E  R CKPGGWIE L+ D      DG           GP  + +      +   
Sbjct: 226 D-CIYQEAYRCCKPGGWIEHLDTDAEFFCYDGTMPNDSAMAQWGPIWREV-----GRKTG 279

Query: 199 RGVNGLISEEIPEFFESTNQVEIYAEEKYSPIGNWGDE 236
             V  + S  +           I +E+ Y+PI  W D+
Sbjct: 280 LNVTVVSSGTMENGMRKAGFTNIVSEDHYAPIAPWSDD 317



>gi|212539277|ref|XP_002149794.1| conserved hypothetical protein [Talaromyces marneffei ATCC 18224]
 gi|210069536|gb|EEA23627.1| conserved hypothetical protein [Talaromyces marneffei ATCC 18224]
          Length = 327

 Score = 76.6 bits (187), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 59/171 (34%), Positives = 88/171 (51%), Gaps = 18/171 (10%)

Query: 72  KVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFED 131
           KVLDVG GT   W +E++  YP A+  G+DL +P+ P+ +   N++F+  DI +   F  
Sbjct: 93  KVLDVGTGTGI-WAIEMADAYPSAEITGVDL-SPIQPR-WVPPNVRFIIDDITQPWDFRT 149

Query: 132 GSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIELLE----IDVDGKSLGPTSKR 187
            S DF+H+RCL  + T+  W    + +  R  KPGG IEL E    +  D  +   TS  
Sbjct: 150 NSFDFIHVRCLAGSITD--WPG-FLAQAYRHLKPGGKIELSEGRTHMVCDDGTYPETS-- 204

Query: 188 IISACMAKFENRGVN--GLISEEIPEF---FESTNQVEIYAEEKYSPIGNW 233
                +A+F NR  N  G + ++ PEF    E+     +   E+  PIG W
Sbjct: 205 YTYKWIAEF-NRISNSLGRVFDKFPEFHGLLENAGFTSVRTHEEPCPIGTW 254



>gi|449549146|gb|EMD40112.1| hypothetical protein CERSUDRAFT_81393 [Ceriporiopsis subvermispora
           B]
          Length = 696

 Score = 76.3 bits (186), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 88/166 (53%), Gaps = 30/166 (18%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVW-----GGN-----FVSPIEQELKNKKDFKVLDVG 77
           FP N++   ++ +   + H++   +W     GG+     F +P E         +VLD+G
Sbjct: 23  FPANEVPYPRNYEKQVVDHDVWSNMWVQQLTGGSLTWHVFETPPE---------RVLDLG 73

Query: 78  CGTTCSWILELSKTYPLAKFIGLDLLTPLLPKDFSQ-------NNLQFVQSDILKGLPFE 130
           CG+   W+LE ++T+  A F GLD++ P+ P D  Q       + + +V ++ L+GLPF 
Sbjct: 74  CGS-GPWLLEAARTWKNAHFTGLDVV-PIHP-DLKQLGLSDLASRITWVHANFLEGLPFS 130

Query: 131 DGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIELLEIDV 176
           D   D+V +  +  A  E +W + + +E+ RV KPGG  EL E D+
Sbjct: 131 DEEFDYVRVTRIARAVPEHKW-DWLFEEISRVMKPGGAFELFEEDL 175



>gi|399166203|emb|CCE32995.1| uncharacterized protein CPUR_06918 [Claviceps purpurea 20.1]
          Length = 403

 Score = 76.3 bits (186), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 79/153 (51%), Gaps = 13/153 (8%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILE 87
            P +D +LE D  C   L  L+       F++P+E+E    K  +VLDVG G+   W +E
Sbjct: 73  LPNDDQQLESDKLCHHYLTILLDDKL---FLAPLEKE----KIHRVLDVGTGSGV-WAIE 124

Query: 88  LSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFT 147
               +P A  IG DL +P  P+ +   N++F   D      +++   DF+H+R +     
Sbjct: 125 FGDLFPNASVIGTDL-SPCQPQ-WVPPNVRFEVDDASLEWTWDENHFDFIHIRYILGGIQ 182

Query: 148 ERQWEEVVIKELVRVCKPGGWIELLEIDVDGKS 180
           +  W   ++KE  R C PGGW++  EID+D +S
Sbjct: 183 D--WT-ALLKEAYRCCAPGGWVQSAEIDLDFRS 212



>gi|426198624|gb|EKV48550.1| hypothetical protein AGABI2DRAFT_192130 [Agaricus bisporus var.
           bisporus H97]
          Length = 257

 Score = 76.3 bits (186), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 64/240 (26%), Positives = 114/240 (47%), Gaps = 29/240 (12%)

Query: 73  VLDVGCGTTCSWILELSKTYPLAKFI-GLDLLTPLLPKDFSQNNLQFVQSDILKGLPFE- 130
           VLD G G+   W+L L+K  P    + G+D+   + P   +  +   + S  +  LP + 
Sbjct: 23  VLDSGTGS-GHWLLSLAKEVPSTVVLRGIDISPRMFPSPTTIPDNMSLMSHSITSLPEDW 81

Query: 131 DGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIEL----------LEIDVDGKS 180
           + ++  +H R L AAF   QW+  V  E+ RV  PGGW++L          LE   + K+
Sbjct: 82  NNTVTLIHQRLLVAAFQADQWKTAV-SEMYRVLAPGGWVQLFEPREQLLSPLEAITNHKT 140

Query: 181 LGPTSKRIISACMAKFENRGVNGLISEEIPEFFESTNQVEIYAEEKYSPIGNWGDELGKL 240
           L     RI+   MA  + R +   + + +  + E T  V +  +++  PIG+W  E G L
Sbjct: 141 L-----RILERLMA--DTRHIVNDVVDHLQHWLEETGFVNLTIQKRGMPIGSWAGERGVL 193

Query: 241 ALDFFVSIFSSSDELI-----EWIKVSKEEYEHMIAQYIKEV--EIYRSYFINIKFYCQK 293
           +++  +  F +   L+       I  S+EE++  +A  ++++  +   +YF    F  QK
Sbjct: 194 SMEATLGAFEAMKPLVLKEGGLGIVSSEEEFDAALAD-LRQLCDDTPDTYFQYWLFTAQK 252



>gi|302887855|ref|XP_003042815.1| hypothetical protein NECHADRAFT_72745 [Nectria haematococca mpVI
           77-13-4]
 gi|256723728|gb|EEU37102.1| hypothetical protein NECHADRAFT_72745 [Nectria haematococca mpVI
           77-13-4]
          Length = 351

 Score = 76.3 bits (186), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 59/209 (28%), Positives = 105/209 (50%), Gaps = 24/209 (11%)

Query: 36  EQDAKCSKLLHELMKKVWGGN-FVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPL 94
           EQ  +   + H  +  V GG  ++SP++Q+++     +VLD+G GT   W ++ +  +P 
Sbjct: 82  EQQNESMDINHHQLTLVLGGKLYLSPLKQDIQ-----RVLDIGTGTGI-WAIDFADEFPT 135

Query: 95  AKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEV 154
           A+  G D+   ++   +   NL+F   D  +   F++ SID+VHMR L  +   + W   
Sbjct: 136 AEVTGTDIS--VIQPQWVPPNLKFEIEDCTQTWTFDENSIDYVHMRYLIGSI--KDWP-A 190

Query: 155 VIKELVRVCKPGGWIELLEIDVDGKSLGPTSKRIISACMAK----FENRGVN-----GLI 205
           ++KE  RVCKPGG++E  E   D +S   T  +   + MA     F+  G        ++
Sbjct: 191 LMKEAFRVCKPGGYVESYEGSPDMESDDDTVPK--DSAMADWGPIFKEAGAKISRPFTIL 248

Query: 206 SEEIP-EFFESTNQVEIYAEEKYSPIGNW 233
            E++  +  E    V+I + +  +P+G W
Sbjct: 249 HEDLARKAMEEAGFVDIESRDFKAPVGAW 277



>gi|392587262|gb|EIW76596.1| S-adenosyl-L-methionine-dependent methyltransferase [Coniophora
           puteana RWD-64-598 SS2]
          Length = 284

 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 75/129 (58%), Gaps = 9/129 (6%)

Query: 46  HELMKKVWGGNFV-SPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLT 104
           ++++KK +G N + +P+        + +VLD GCGT  +W+ ++S  +PL K IG+D+ T
Sbjct: 37  YKILKKSFGNNVLYTPVSL----SSEAEVLDSGCGTE-AWVKDMSHVFPLVKIIGIDMST 91

Query: 105 PLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCK 164
            L P++ +  N+ F++  IL          D VH   L +A T  +W  + + E++RV K
Sbjct: 92  NLFPQNSA--NITFLKHSILSLPRTWTNKFDLVHQSVLFSALTISEW-PIALAEILRVTK 148

Query: 165 PGGWIELLE 173
           PGG ++L+E
Sbjct: 149 PGGSVQLME 157



>gi|409082773|gb|EKM83131.1| hypothetical protein AGABI1DRAFT_125607 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 288

 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 65/230 (28%), Positives = 115/230 (50%), Gaps = 18/230 (7%)

Query: 59  SPIEQELKNKKDFKVLDVGCGTTCSWILELSK-TYPLAKFIGLDLLTPLLPKDFS-QNNL 116
           +P+E +     D  VLD G GT   W+ +L+K T    K+IG+D+ + L P+  +   N+
Sbjct: 48  APVELQ----DDDWVLDSGTGTGI-WLEDLAKVTSTKPKYIGIDIGSNLFPRASTLPENI 102

Query: 117 QFVQSDILKGLPFE-DGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIELLEID 175
            F    ++  LP E       VH R L AA    +WE  V +EL RV KPGGWI++ E+ 
Sbjct: 103 SFETHSVVN-LPKEWTNKFTLVHQRHLIAALRRHEWESAV-RELYRVVKPGGWIQMFEMR 160

Query: 176 VDGKSLGPTSKRIISACMAKFENRGVN-GLISEEIPEFFESTNQVEIYAEEKYSPIGNWG 234
           +   + GP   +         ++ G+    I+ ++P+F + +  V+I+ +   +P+G W 
Sbjct: 161 I--WTSGPVLAKHRDLLSKLSDDLGMMFSDIAIKLPDFLKQSGFVDIHKDTFGTPLGAWA 218

Query: 235 DELGKLALDFFVSIFSSSDELI-----EWIKVSKEEYEHMIAQYIKEVEI 279
           +  G    +  +S+F +    I       +  S+ EY+ ++ +  KEV++
Sbjct: 219 NRDGIDGKENLLSLFQAFKTPILTGGGYGVVGSEAEYDELLEEIEKEVDM 268



>gi|399170491|emb|CCE28868.1| uncharacterized protein CPUR_02558 [Claviceps purpurea 20.1]
          Length = 358

 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 70/255 (27%), Positives = 114/255 (44%), Gaps = 27/255 (10%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVWGGN-FVSPIEQELKNKKDFKVLDVGCGTTCSWIL 86
           FP +D    Q  K  +L H     +     F++P+E++    K  +VLDVG G+   W +
Sbjct: 90  FPNDD----QQIKSEELFHHFSTILLDDQLFLAPLEKD----KIHRVLDVGTGSGI-WAI 140

Query: 87  ELSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAF 146
           E +  +P A  IG DL +P  P+ +   NL F   D +    ++D   DF+HMR +    
Sbjct: 141 EFADQFPNASVIGTDL-SPCQPQ-WVPPNLCFEIDDAMLEWTYDDNHFDFIHMRYIVGGI 198

Query: 147 TERQWEEVVIKELVRVCKPGGWIELLEIDVDGKS-LGPTSKRIISACMAK-FENRG---V 201
            +  W   + KE  R C PGGW+E +E D + +S  G T    I A   + F   G    
Sbjct: 199 ED--WT-ALFKEAYRCCAPGGWVESVEYDAEFRSDDGSTQLEPILASFGELFREAGKILK 255

Query: 202 NGLISEEI-PEFFESTNQVEIYAEEKYSPIGNWGD-----ELGKLALDFFVSIFSSSDEL 255
             L  +EI P+  +    ++       +P+G W       E+G+   +   +      ++
Sbjct: 256 RPLFVQEIQPQALDEAGFIDKRVVRFKAPLGPWAKDRKFAEVGRFGREALENDLQGYTQM 315

Query: 256 IEWIKVSKEEYEHMI 270
           + W  V K E E+ +
Sbjct: 316 L-WQSVQKPEDEYHV 329



>gi|399164450|emb|CCE34654.1| uncharacterized protein CPUR_08588 [Claviceps purpurea 20.1]
          Length = 340

 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 67/256 (26%), Positives = 114/256 (44%), Gaps = 29/256 (11%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILE 87
           FP +D +LE +  C   L  L+       F+SP+E++    K  +VLDVG G+   W +E
Sbjct: 72  FPNDDQQLESEEICHHFLTVLLDDQL---FLSPLEKD----KIHRVLDVGTGSGI-WAIE 123

Query: 88  LSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFT 147
            +  +P A  +G DL +P  P+ ++  N+ F   D      +     DF+HMR +     
Sbjct: 124 FADQFPSASVVGTDL-SPCQPQ-WAPPNICFEIDDATLEWTWNANHFDFIHMRYIVGGI- 180

Query: 148 ERQWEEVVIKELVRVCKPGGWIELLEIDVDGKS-LGPTSKRIISACM-------AKFENR 199
            + W     KE  R C PGGW+E +E + +  S  G T    + A +       +K  NR
Sbjct: 181 -QDWT-AFFKEAYRCCAPGGWVESMEYECEFSSDDGSTELEPVLASIGELFREASKVLNR 238

Query: 200 GVNGLISEEIPEFFESTNQVEIYAEEKYSPIGNWGD-----ELGKLALDFFVSIFSSSDE 254
            +   + E +P+  +    ++        P+G W       E+G+ A +   +      +
Sbjct: 239 PL--FVKEILPQALDEAGFIDKRVVRYKIPVGPWAKDRKLAEVGRFAREAMENDLQGYTQ 296

Query: 255 LIEWIKVSKEEYEHMI 270
           ++ W  V K E E+ +
Sbjct: 297 ML-WKSVEKPEDEYHV 311



>gi|342881933|gb|EGU82712.1| hypothetical protein FOXB_06767 [Fusarium oxysporum Fo5176]
          Length = 304

 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 78/136 (57%), Gaps = 12/136 (8%)

Query: 46  HELMKKVWGGN-FVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLT 104
           HEL + V  G  + +PI +  +N     VLDVGCGT   W ++++  +P A+ IG+DL +
Sbjct: 79  HELFRVVLDGKLYEAPIGKNPQN-----VLDVGCGTGI-WAIDMADLHPSAEVIGVDL-S 131

Query: 105 PLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCK 164
           P+ P +F   N +F   DI K   F +   DF+H+R +T    +  W E ++K+  R  K
Sbjct: 132 PIQP-NFIPPNCRFEVDDINKEWTFPENKFDFIHIRYMTGTVPD--WTE-LLKKAQRHLK 187

Query: 165 PGGWIELLEIDVDGKS 180
           PGGWIE +E+  D ++
Sbjct: 188 PGGWIEHVELWGDARA 203



>gi|384493937|gb|EIE84428.1| hypothetical protein RO3G_09138 [Rhizopus delemar RA 99-880]
          Length = 219

 Score = 75.9 bits (185), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 63/229 (27%), Positives = 110/229 (48%), Gaps = 33/229 (14%)

Query: 88  LSKTYPLAKFIGLDLLTPL----LPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLT 143
           ++  +P  +F G D+  P+    + K    +N    ++D+  G  +E  + DFVH R + 
Sbjct: 1   MAIDFPECQFYGFDVAEPISLNEVEKLHKPDNCFIERADVFDGFSYEPNAFDFVHQRLMY 60

Query: 144 AAFTERQ--WEEVVIKELVRVCKPGGWIELLEIDVDGKSLGPTSKRIISACMAKFENRGV 201
             +   +  W   +++E++RV KP GWIEL+E D++ K  GP    ++ A         V
Sbjct: 61  NVYPHDKIPW---MLQEILRVTKPNGWIELVEPDLNPKRAGPLFTTLMKA---------V 108

Query: 202 NGLISEEIPEFFES----TNQVEIYAEEKYSPIGN----WGDELGKLALDFFVSIFSSSD 253
           N L+   + + F+      + VE    E  S  G+    WG  +GKL  +  + +F    
Sbjct: 109 NQLVQSRLGKPFQGKDLVNHMVEAGLREIKSDYGSLPCCWGGYIGKLMYEDLLIVFQHYG 168

Query: 254 ELI-EWI----KVSKEEYEHMIAQYIKEVEIYRSYFINIKF-YCQKITS 296
             I E++    +  +E+YE MI     E   Y++ FINI++ Y +K+ S
Sbjct: 169 PHIHEYLDPGSEFDREKYETMIDTAFDECAEYQT-FINIRWAYGKKVVS 216



>gi|399170480|emb|CCE28857.1| uncharacterized protein CPUR_02546 [Claviceps purpurea 20.1]
          Length = 357

 Score = 75.5 bits (184), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 65/254 (25%), Positives = 112/254 (44%), Gaps = 25/254 (9%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILE 87
           FP +D +LE +  C  LL  L+       F++P+E++    K  +VLDVG G+   W +E
Sbjct: 89  FPNDDRQLESEELCHHLLTILLDDRL---FLAPLEKD----KIHRVLDVGTGSGI-WAIE 140

Query: 88  LSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFT 147
            +  +P A  +G DL +P  P+ +   NL F   D      +     DF+HMR +     
Sbjct: 141 FADQFPNASVVGTDL-SPCQPQ-WVPPNLCFEIDDATLEWTWNANHFDFIHMRYIVGGIQ 198

Query: 148 ERQWEEVVIKELVRVCKPGGWIELLEIDVD-GKSLGPTSKRIISACMAKFENRGVNGL-- 204
           +  W   + +E  R C PGGW+E +E + +     G T    + A   +      N +  
Sbjct: 199 D--WT-ALFEEAYRCCAPGGWVESVEYEPEICSDDGSTDLEPVLASYGELFREAGNTMNR 255

Query: 205 ---ISEEIPEFFESTNQVEIYAEEKYSPIGNWGD-----ELGKLALDFFVSIFSSSDELI 256
              + E +P   +    +E    +  +PIG W       E+G+ A +   +      +++
Sbjct: 256 PLFVKEILPRALDEAGFIEKRVVQYKAPIGPWAKDRKFAEVGRFAREAAENDLQGYTQML 315

Query: 257 EWIKVSKEEYEHMI 270
            W  V + E E+ +
Sbjct: 316 -WQTVQRPEDEYHV 328



>gi|399166185|emb|CCE32977.1| uncharacterized protein CPUR_06899 [Claviceps purpurea 20.1]
          Length = 342

 Score = 75.5 bits (184), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 98/215 (45%), Gaps = 23/215 (10%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILE 87
           FP +D +LE +  C   L  L+       F++P++++    K  +VLDVG G+   W +E
Sbjct: 73  FPNDDQQLESEELCHHYLKILLDDKL---FLAPLDED----KIHRVLDVGTGSGI-WAIE 124

Query: 88  LSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFT 147
               +P A   G DL +P  P+ ++  N+ F   D      + +   DF+H+R +     
Sbjct: 125 FGDRFPNASVTGTDL-SPCQPQ-WAPPNVYFEMDDASLEWTWNENHFDFIHIRYILGGIQ 182

Query: 148 ERQWEEVVIKELVRVCKPGGWIELLEIDVDGKS-LGPTSKRIISACM-------AKFENR 199
           +  W+  + +E  R C PGGW++ +E DVD +S  G T    I A          K  NR
Sbjct: 183 D--WK-ALFREAYRCCAPGGWVQSVEADVDIRSDDGSTELEPILASYGDLFREGGKITNR 239

Query: 200 GVNGLISEEIPEFFESTNQVEIYAEEKYSPIGNWG 234
                + E  P+ F+    V+    +   PIG W 
Sbjct: 240 TF--FLREIQPQAFDEAGFVDKRTVQYKVPIGPWA 272



>gi|389750229|gb|EIM91400.1| hypothetical protein STEHIDRAFT_49603 [Stereum hirsutum FP-91666
           SS1]
          Length = 293

 Score = 75.5 bits (184), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 70/281 (24%), Positives = 126/281 (44%), Gaps = 22/281 (7%)

Query: 28  FPKNDLELEQDAKCSKLL---HELMKKVWGGNFV-SPIEQELKNKKDFKVLDVGCGTTCS 83
           FP  +  L  D++  + L   H ++K  + G  V +P+  +        VLD G G    
Sbjct: 22  FPGAEYILPVDSQEGERLLLQHNILKTAFDGKIVIAPVNLD----DALFVLDSGTGAAV- 76

Query: 84  WILELSKTYPLAKFI-GLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCL 142
           WI EL++T   +  + G+D+ T + P     +N+ F  + +           D+VH R L
Sbjct: 77  WICELARTISSSAVLHGIDIDTRMFPSS-RPSNISFSINSVTNLPAAWSDHFDYVHQRLL 135

Query: 143 TAAFTERQWEEVVIKELVRVCKPGGWIELLEIDVDGK-SLGPTSKRIISACMAKFENRGV 201
             A    +W +  +KE+ RV +PGGW++LLE    GK   G  + R+         +R +
Sbjct: 136 VVALKGSEWSKA-MKEMYRVLRPGGWVQLLEA---GKWKAGAVTIRLEELIRKVVASRQM 191

Query: 202 NGLISEEIPEFFESTNQVEIYAEEKYSPIGNWGDELGKLALDFFVSIFSSSDELIE---- 257
              + +E+P   E    V++  +++ +P+G  G   G+     F+ +F++    +     
Sbjct: 192 LFDVIDELPRLVEEGGFVKVTVDKRTAPLGRLGGPQGRDIAKNFLGVFAAMKTPVLAAGG 251

Query: 258 -WIKVSKEEYEHMIAQYIKEVEIYRSYFIN-IKFYCQKITS 296
             I  S+ E++ +I    KE + +    I  +  Y QK  S
Sbjct: 252 FGIVASEAEFDELIEATRKEWDEFEGAQIEFVAVYGQKAMS 292



>gi|302881379|ref|XP_003039604.1| hypothetical protein NECHADRAFT_55610 [Nectria haematococca mpVI
           77-13-4]
 gi|256720463|gb|EEU33891.1| hypothetical protein NECHADRAFT_55610 [Nectria haematococca mpVI
           77-13-4]
          Length = 354

 Score = 75.5 bits (184), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 81/278 (29%), Positives = 124/278 (44%), Gaps = 44/278 (15%)

Query: 37  QDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAK 96
           QD     +L  L  K+    F++P++ +++     KVLDVG GT   W ++ +  +P A 
Sbjct: 94  QDVNHHAMLLVLDDKL----FLAPLKNDIQ-----KVLDVGTGTGI-WAIDFADEFPSAT 143

Query: 97  FIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVI 156
            IG DL +P+ P  +   NL F   D      FE  S D+VHMR L  + T+  W   + 
Sbjct: 144 VIGTDL-SPIQPS-WIPPNLTFEIEDCNLTWTFEPDSFDYVHMRYLFGSITD--WN-ALF 198

Query: 157 KELVRVCKPGGWIELLEIDV----DGKSLGPTS------KRIISACMAKFENRGVNGLIS 206
               RVCKPGGW+E  E  V    D  ++ P S      K  I    AK   R    +  
Sbjct: 199 SNAYRVCKPGGWVESYEPTVVAESDDDTIPPGSAHSEWGKFFIEG--AKKMGRSCTVVED 256

Query: 207 EEIPEFFESTNQVEIYAEEKYSPIGNWG-----DELGK-----LALDFFVSIFSSSDELI 256
           +   +  E+   V+I   +K  PIG W       E+G+     L  D    +   + +L+
Sbjct: 257 DVQRKSMEAAGFVDIQYVDKKVPIGGWPRDPKQKEIGQYLQASLEQDLEGYVLYMASQLL 316

Query: 257 EWIKVSKEEYEHMIAQYIKEVEIYRSYFINIKFYCQKI 294
            W   +KEE     AQ+ +E+   R +     F+ Q++
Sbjct: 317 GW---TKEEVSVYCAQFRREMRSGRYH----AFFQQRV 347



>gi|399166191|emb|CCE32983.1| uncharacterized protein CPUR_06906 [Claviceps purpurea 20.1]
          Length = 342

 Score = 75.5 bits (184), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 64/216 (29%), Positives = 100/216 (46%), Gaps = 25/216 (11%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVWGGN-FVSPIEQELKNKKDFKVLDVGCGTTCSWIL 86
           FP +D +LE +  C    H  MK ++    F++P+E++    K  +VLDVG G+   W +
Sbjct: 73  FPNDDQQLESEELC----HHYMKVLFDDKLFLAPLEED----KIRRVLDVGTGSGI-WAI 123

Query: 87  ELSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAF 146
           E    +P A   G DL +P  P+ +   N+ F   D      +++   DF+H+R +    
Sbjct: 124 EFGDWFPNASVTGTDL-SPCQPQ-WVPPNVHFEIDDASLEWTWDENHFDFIHIRYILGGI 181

Query: 147 TERQWEEVVIKELVRVCKPGGWIELLEIDVDGKS-LGPTSKRIISACM-------AKFEN 198
            +  W+  + +E  R C PGGW++ +EID D +S  G T    I A          K  N
Sbjct: 182 QD--WK-ALFQEAYRCCAPGGWVQSVEIDGDLRSDDGSTELEPILASYGDLFREGGKVTN 238

Query: 199 RGVNGLISEEIPEFFESTNQVEIYAEEKYSPIGNWG 234
           R     + E  P+ F+    VE    +   PIG W 
Sbjct: 239 RPF--FLREIQPQAFDKAGFVEKRTVQYKVPIGPWA 272



>gi|495194818|ref|WP_007919608.1| type 11 methyltransferase [Ktedonobacter racemifer]
 gi|297548041|gb|EFH81908.1| Methyltransferase type 11 [Ktedonobacter racemifer DSM 44963]
          Length = 323

 Score = 75.5 bits (184), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/159 (32%), Positives = 83/159 (52%), Gaps = 18/159 (11%)

Query: 33  LELEQDAKCSKLLHE--LMKKVWGGNFVSPIEQELKN---KKDFKVLDVGCGTTCSWILE 87
           L+ E  A+  +L+++  L+ +  GG F      EL N   K   +++D+GCG   SW+L 
Sbjct: 19  LDPEDTAEMLRLMNQDRLVTQGMGGLF-----PELDNQLPKGYGRIIDIGCGPG-SWVLN 72

Query: 88  LSKTYPLAKFIGLDLLTPLLPKDFSQ------NNLQFVQSDILKGLPFEDGSIDFVHMRC 141
           ++  YP  + +GLD+   ++    +Q       N  F++ ++LK LPF D S D V+ R 
Sbjct: 73  VAYEYPEVEVLGLDVSKRMIKYAHTQAQTEGRENAIFMEGNVLKSLPFPDNSFDLVNARF 132

Query: 142 LTAAFTERQWEEVVIKELVRVCKPGGWIELLEIDVDGKS 180
           +        W +VV +EL R+ +PGG I L E D  G S
Sbjct: 133 MVGVIMRDVWPQVV-EELYRIVRPGGIIRLTEPDDMGTS 170



>gi|399166192|emb|CCE32984.1| uncharacterized protein CPUR_06907 [Claviceps purpurea 20.1]
          Length = 342

 Score = 75.5 bits (184), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 64/215 (29%), Positives = 99/215 (46%), Gaps = 25/215 (11%)

Query: 29  PKNDLELEQDAKCSKLLHELMKKVWGGN-FVSPIEQELKNKKDFKVLDVGCGTTCSWILE 87
           P +D +LE +  C    H  +K ++    F++P+E+E    K  +VLDVG G+   W +E
Sbjct: 74  PNDDQQLESEELC----HHYLKILFDDKLFLAPLEEE----KIHRVLDVGTGSGI-WAIE 124

Query: 88  LSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFT 147
               +P A   G DL +P  P+ +   N+ F   D      + +   DF+H+R +     
Sbjct: 125 FGDRFPNASVTGTDL-SPCQPQ-WVPPNVHFEIDDASLEWTWNENHFDFIHIRYIIGGIQ 182

Query: 148 ERQWEEVVIKELVRVCKPGGWIELLEIDVDGKS-LGPTSKRIISACMA-------KFENR 199
           +  W+  + +E  R C PGGW++ +EID + +S  G T    I A  A       K  NR
Sbjct: 183 D--WK-ALFREAYRCCAPGGWVQSVEIDCNLRSDDGSTELEPILASYADLFREGGKVTNR 239

Query: 200 GVNGLISEEIPEFFESTNQVEIYAEEKYSPIGNWG 234
                + E  P+ F+    VE    E   PIG W 
Sbjct: 240 PF--FLREIQPQAFDEVGFVEKRTVEYKVPIGPWA 272



>gi|302902186|ref|XP_003048600.1| hypothetical protein NECHADRAFT_47669 [Nectria haematococca mpVI
           77-13-4]
 gi|256729533|gb|EEU42887.1| hypothetical protein NECHADRAFT_47669 [Nectria haematococca mpVI
           77-13-4]
          Length = 311

 Score = 75.5 bits (184), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 79/281 (28%), Positives = 124/281 (44%), Gaps = 29/281 (10%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILE 87
           FP +D +LE         H L   + G  F++PI+  ++     KVLDVG G+   W ++
Sbjct: 43  FPNDDQQLE---SIDISHHSLTLLLDGQLFLAPIKDNVQ-----KVLDVGTGSGI-WAID 93

Query: 88  LSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFT 147
            +  Y  A+  G DL +P  P ++   N+QF   D  +   + D   DF+H+R L  A T
Sbjct: 94  FADQYTGAEVTGTDL-SPCQP-EWVPPNVQFEVDDATERWTWGDNHFDFIHIRYLFGAIT 151

Query: 148 ERQWEEVVIKELVRVCKPGGWIELLEIDVDGKSLGPTS--KRIISACMAKFENRGVN--- 202
              W   + KE  R C PGGW+E  E DV   S   T   + ++  C   +E  G     
Sbjct: 152 --NWH-ALFKEAYRCCAPGGWVESCEADVRLLSDDGTDELEPVLKVCDKMYEEGGKALGR 208

Query: 203 -GLISEEIPEFFESTNQVEIYAEEKYSPIGNWGDELGKLALDFFVSIFSSSD----ELIE 257
              + E   E  +    V+I   +   PIG+W  +     +  FV +   +D     L+ 
Sbjct: 209 PFFVGELQVEGLKEAGFVDIKTVDYKMPIGSWPKDPKMAQVGRFVQLTLENDLEGYSLLL 268

Query: 258 WIKVSK---EEYEHMIAQYIKEVEIYR--SYFINIKFYCQK 293
           W +V K   +E++  + Q  K +   +  SYF     Y +K
Sbjct: 269 WNQVLKWPEDEFQVFLMQTRKAIRNRKVHSYFKVRYVYGRK 309



>gi|426196999|gb|EKV46927.1| hypothetical protein AGABI2DRAFT_119103 [Agaricus bisporus var.
           bisporus H97]
          Length = 291

 Score = 75.5 bits (184), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 60/199 (30%), Positives = 93/199 (46%), Gaps = 11/199 (5%)

Query: 46  HELMKKVWGGNFV-SPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPL-AKFIGLDLL 103
           H+ + + +G   V SP+   +  K D KVLD G G+ CSW+L  + T  L  +    D+ 
Sbjct: 37  HQSITRAFGDKLVLSPV---ILTKGD-KVLDSGAGS-CSWLLHFATTLTLDIELYASDIE 91

Query: 104 TPLLPKDFSQNNLQFVQSDILKGLPFE-DGSIDFVHMRCLTAAFTERQWEEVVIKELVRV 162
           T   P +  +N   +  S +   LP +   +   VH R L +AFT   W  + I EL RV
Sbjct: 92  TRFFPINPPKNVKLWEASSV--DLPKDWSNAFQLVHQRLLISAFTSNDWP-LAISELFRV 148

Query: 163 CKPGGWIELLEIDVDGKSLGPTSKRIISACMAKFENRGVNGLISEEIPEFFESTNQVEIY 222
            KPGGW+EL E   +       + R ++A    +E        +  +P++ +    V+I 
Sbjct: 149 TKPGGWVELCEAGAEIDCPSHPNHRALTAARIAYEASDHVIQAAMLLPQWLKDAGFVKIQ 208

Query: 223 AEEKYSPIGNWGDELGKLA 241
           + E   PIG W    G+ A
Sbjct: 209 SVEGKYPIGKWAGSDGEHA 227



>gi|393214529|gb|EJD00022.1| hypothetical protein FOMMEDRAFT_53200, partial [Fomitiporia
           mediterranea MF3/22]
          Length = 261

 Score = 75.5 bits (184), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 71/254 (27%), Positives = 117/254 (46%), Gaps = 32/254 (12%)

Query: 46  HELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYP-LAKFIGLDLLT 104
           H  + +V  G  +  I++ ++     +VLD G G   SWIL LSK  P   + +G+D+  
Sbjct: 6   HAHLTEVICGRLI--IDKVIQFNPGDRVLDCGVGAG-SWILSLSKEVPDSVELVGIDISP 62

Query: 105 PLLPKDFSQNNLQFVQSDILKGLPFE-DGSIDFVHMRCLTAAFTERQWEEVVIKELVRVC 163
            + PK+   N    V S +   +P E   +   VH R L AAFT  QW +  + E+ RV 
Sbjct: 63  SMFPKEVPGNVKLHVVSSM--DMPAEWTNTFTLVHQRLLVAAFTAEQWSKD-LAEMFRVL 119

Query: 164 KPGGWIELLEI------DVDGKSLGPTSKRIISACMAKFENRGVNG-LISEEIPEFFEST 216
           KPGG I+L+EI       V  + L P +K++    +A   ++ + G      +P   E T
Sbjct: 120 KPGGTIQLMEICNYGSLHVPLEKL-PATKKVDELIIATLNHKNLLGKACGRALPRMLEET 178

Query: 217 NQVEIYAEEKYSPIG-NWGD------ELGKLALDFF---------VSIFSSSDELIEWIK 260
              ++  E+   P+G  WG+       L  + L  F         + +F S  E+ E I 
Sbjct: 179 GFSDVQVEDHQLPLGKQWGEIGIRGTRLRDVLLHGFGKTLLAEGGLGLFKSQAEIDEAIG 238

Query: 261 VSKEEYEHMIAQYI 274
            +K+E++     ++
Sbjct: 239 KAKKEWDDTPGVFV 252



>gi|302917172|ref|XP_003052390.1| hypothetical protein NECHADRAFT_35890 [Nectria haematococca mpVI
           77-13-4]
 gi|256733330|gb|EEU46677.1| hypothetical protein NECHADRAFT_35890 [Nectria haematococca mpVI
           77-13-4]
          Length = 307

 Score = 75.5 bits (184), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 71/132 (53%), Gaps = 14/132 (10%)

Query: 58  VSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTPLLPKDFSQNNLQ 117
           ++P+E++    K  + +D+GCGT   W ++ +  YP A+  G D+ +P+ P  +   NLQ
Sbjct: 59  LAPLEKD----KVHRAIDIGCGTGI-WAIDFADDYPNAEITGTDI-SPIQPS-WVPPNLQ 111

Query: 118 FVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIELLE---- 173
           F   D  +   F+  S D+VHMR L  +   R W+  +  E  RVCKPGGW+E  E    
Sbjct: 112 FEIEDCTREWTFKSNSTDYVHMRWLMGSI--RDWD-FLSSEAFRVCKPGGWVESHEASSN 168

Query: 174 IDVDGKSLGPTS 185
           ID D  ++   S
Sbjct: 169 IDSDDNTVDGNS 180



>gi|399167619|emb|CCE31634.1| uncharacterized protein CPUR_05487 [Claviceps purpurea 20.1]
          Length = 342

 Score = 75.1 bits (183), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 78/284 (27%), Positives = 127/284 (44%), Gaps = 34/284 (11%)

Query: 29  PKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILEL 88
           P +D +LE +  C  ++  L+       FV+P+E E    K  +VLDVG G+   W +E 
Sbjct: 74  PNDDQQLESEELCHHVITNLLDDQL---FVAPLEIE----KIHRVLDVGTGSGI-WAIEF 125

Query: 89  SKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTE 148
           +  +P    IG D+ +P  P+ +   N++F   D      ++    DF+H+R +  AF  
Sbjct: 126 ADRFPNTSVIGTDI-SPCQPQ-WLPPNVRFEIEDATLEWTWDTDYFDFIHIRYIFGAF-- 181

Query: 149 RQWEEVVIKELVRVCKPGGWIELLEIDVDGKS-LGPTSKRIISACM-------AKFENRG 200
           + W  +  K+  R C PGGW++ +E DVD +S  G T    + A         AK  +R 
Sbjct: 182 QNWAGL-FKKAYRCCAPGGWVQSVECDVDFRSDDGSTELEPVLASYGELFRQCAKVLDRP 240

Query: 201 VNGLISEEIPEFFESTNQVEIYAEEKYSPIGNWGD-----ELGKLALDFFVSIFSSSDEL 255
              L+ E   + F+    VE  A     PIG W       ++G++A     + F    ++
Sbjct: 241 C--LVQETQQQAFDEAGFVEQKAARYKIPIGPWAKDVKLADVGRVAKAALENDFEGYTQM 298

Query: 256 IEWIKV---SKEEYEHMIAQYIKEVEIYR--SYFINIKFYCQKI 294
           I W  V      EY   +A   K +   +  SY +    Y +K+
Sbjct: 299 I-WHNVLQRPANEYNAWLADLRKAIRNPKVHSYMMVHVMYGRKL 341



>gi|477522885|gb|ENH74927.1| hypothetical protein FOC1_g10002472 [Fusarium oxysporum f. sp.
           cubense race 1]
          Length = 355

 Score = 75.1 bits (183), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 73/285 (25%), Positives = 130/285 (45%), Gaps = 34/285 (11%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILE 87
           FP ++ +LE        L  L+    G  +++PI   ++     K LDVG G+   W ++
Sbjct: 84  FPNDEQQLESVDISHHYLTVLLD---GQLYLAPIGDNIQ-----KALDVGTGSGI-WAID 134

Query: 88  LSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFT 147
            +  +P A+    DL +P  PK +   N++F   D  +   ++D + DFVHMR L  A  
Sbjct: 135 FADQFPQAEVTATDL-SPTQPK-WVPPNVRFEIDDATETWTWKDNTFDFVHMRYLFGAI- 191

Query: 148 ERQWEEVVIKELVRVCKPGGWIELLEIDVDGKSLGPTS--KRIISACMAKFENR----GV 201
            + W   + ++  RVC PGGW+E +E D+  +S   T+  + +   C   +E      G 
Sbjct: 192 -QDWT-ALYQQAYRVCTPGGWVESVEADIHFRSDDGTAEEEEVYKLCNKLYEEGGKAIGR 249

Query: 202 NGLISEEIPEFFESTNQVEIYAEEKYSPIGNWGD-----ELG---KLALDFFVSIFSSS- 252
              + +  P+  E    V+I   +   PIG+W       E+G   KL L+  +  F    
Sbjct: 250 TFFVHDLQPKGMEEAGFVDIKTVDYKIPIGDWPKDPRLAEVGRFVKLTLENDIEAFKGYT 309

Query: 253 ----DELIEWIKVSKEEYEHMIAQYIKEVEIYRSYFINIKFYCQK 293
               + +++W K   + +   I + ++  +I+  YF+    Y +K
Sbjct: 310 LLLWNSVLQWPKDEYQVFLMGIRKALRNRKIH-GYFVVRYVYGRK 353



>gi|393214533|gb|EJD00026.1| S-adenosyl-L-methionine-dependent methyltransferase, partial
           [Fomitiporia mediterranea MF3/22]
          Length = 262

 Score = 75.1 bits (183), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 72/244 (29%), Positives = 111/244 (45%), Gaps = 29/244 (11%)

Query: 46  HELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLA-KFIGLDLLT 104
           HE +  V GG  +  +++++K     +VLD G G   SWI+ LSK  P A + IG D+ +
Sbjct: 6   HEFLTDVLGGRLI--LDKDVKLGPGDRVLDSGTGA-GSWIIALSKQVPKAVELIGTDISS 62

Query: 105 PLLPKDFSQNNLQFVQSDILKGLPFE-DGSIDFVHMRCLTAAFTERQWEEVVIKELVRVC 163
            + P+    N   F  S     LPFE   +   +  R L AA T   W   V+ EL+RV 
Sbjct: 63  AMFPEQVPDNVHLFEASS--TDLPFEWIDTFTLISQRLLCAALTVPLW-RAVLSELLRVL 119

Query: 164 KPGGWIELLEIDVDGKS----LGPTSKRIISACMAKFENRGVNGLISE-EIPEFFESTNQ 218
           KPGG I+ +E    G +    L PT    I    A    R + G+ S  E+P   E    
Sbjct: 120 KPGGTIQFMEFGQFGSTVDVNLIPTCVGAIDMATAVMTKRDLLGIQSGIELPGMLEEIGF 179

Query: 219 VEIYAEEKYSPIG-NWGD--------------ELGKLAL-DFFVSIFSSSDELIEWIKVS 262
            ++  +   +P+G  WG+                G+L + +  + I+SS  E+   I  +
Sbjct: 180 SDVRVKVYEAPVGKTWGEIGLKGEKITEGFLRATGRLLMAEGGLGIYSSQAEVDSMIDRA 239

Query: 263 KEEY 266
           K+E+
Sbjct: 240 KKEW 243



>gi|399166187|emb|CCE32979.1| uncharacterized protein CPUR_06901 [Claviceps purpurea 20.1]
          Length = 366

 Score = 75.1 bits (183), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 65/223 (29%), Positives = 106/223 (47%), Gaps = 26/223 (11%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVWGGN-FVSPIEQELKNKKDFKVLDVGCGTTCSWIL 86
           FP +D +LE +    +L H  +K +     F++P+E++    K  +VLDVG G+   W +
Sbjct: 91  FPNDDQQLESE----ELSHHYLKILLDDQLFLAPLEKD----KIHRVLDVGTGSGI-WAI 141

Query: 87  ELSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAF 146
           E    +P A   G DL +P  P+ +   N++F   D      +++   DF+H+R +    
Sbjct: 142 EFGDQFPNASVTGTDL-SPCQPQ-WVPPNVRFEVDDASLEWTWDENHFDFIHIRYILGGI 199

Query: 147 TERQWEEVVIKELVRVCKPGGWIELLEIDVDGKS-LGPTSKRIISACM-------AKFEN 198
            +  W   + +E  R C PGGW++ +E+D+D +S  G T    I A         +K  N
Sbjct: 200 QD--WT-ALFQEAYRCCAPGGWVQSVEVDLDLRSDDGSTELEPILASYGDLFREGSKITN 256

Query: 199 RGVNGLISEEIPEFFESTNQVEIYAEEKYSPIGNWGDELGKLA 241
           R     + E  P+ F+    VE    +   PIG W  +  KLA
Sbjct: 257 RPF--FLQEIQPQAFDEAGFVEKRTVQYKVPIGPWAKD-SKLA 296



>gi|302884878|ref|XP_003041333.1| hypothetical protein NECHADRAFT_52439 [Nectria haematococca mpVI
           77-13-4]
 gi|256722233|gb|EEU35620.1| hypothetical protein NECHADRAFT_52439 [Nectria haematococca mpVI
           77-13-4]
          Length = 305

 Score = 75.1 bits (183), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 84/153 (54%), Gaps = 16/153 (10%)

Query: 29  PKNDLELEQDAKCSKLLHELMKKVWGGN-FVSPIEQELKNKKDFKVLDVGCGTTCSWILE 87
           P +D + E       L+HEL + V  G  + +PI    ++     VLD+GCGT   W +E
Sbjct: 39  PNDDRQQE----AEDLIHELFRIVLDGKLYKAPIGDHPQD-----VLDIGCGTGI-WAIE 88

Query: 88  LSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFT 147
           ++  +P A+ +G+DL +P+ P +F   N +F   DI K   F +   D +H+R +T    
Sbjct: 89  MADLHPGAEVVGVDL-SPIQP-NFVPPNCKFEVDDINKDWTFPENKFDLIHIRYMTGTVP 146

Query: 148 ERQWEEVVIKELVRVCKPGGWIELLEIDVDGKS 180
           +  W E+ +K++ +  KPGGW+E +E+  D +S
Sbjct: 147 D--WTEL-LKKVHKHLKPGGWVEHVELWGDARS 176



>gi|495190294|ref|WP_007915084.1| type 11 methyltransferase [Ktedonobacter racemifer]
 gi|297550099|gb|EFH83965.1| Methyltransferase type 11 [Ktedonobacter racemifer DSM 44963]
          Length = 290

 Score = 74.7 bits (182), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 68/125 (54%), Gaps = 8/125 (6%)

Query: 72  KVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTPLLPKDFSQ------NNLQFVQSDILK 125
           +++D+GCG   +W+L ++  YP  + +G+D+   ++    +Q       N  FV+ ++LK
Sbjct: 55  RIIDMGCGP-GNWVLNVAYEYPEVEVVGIDISKLMIRYAQTQARTEERGNALFVEGNLLK 113

Query: 126 GLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIELLEIDVDGKSLGPTS 185
            LP +D S D V+ R +T     + W  VV +E  R+ +PGG + L EID  G S     
Sbjct: 114 PLPIDDASFDLVNARFMTGFVLRKDWTAVV-QEFFRILRPGGMLRLTEIDTGGISNSAAL 172

Query: 186 KRIIS 190
           + I+S
Sbjct: 173 EEILS 177



>gi|259479962|tpe|CBF70661.1| TPA: hypothetical protein ANIA_05874 [Aspergillus nidulans FGSC A4]
          Length = 284

 Score = 74.3 bits (181), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 71/139 (51%), Gaps = 8/139 (5%)

Query: 36  EQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLA 95
           E +A+   L H++  +V+    + P    L+     +VLD G GT  SW +++++  P  
Sbjct: 61  EDEAERLDLQHQIFSRVFDNRLIFPPIPRLR-----RVLDCGYGTG-SWAIDVAEQNPDC 114

Query: 96  KFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVV 155
           + IG+D+  P +  D +  NL     D+ +   F     D VH R L A     +W    
Sbjct: 115 EVIGIDIY-PFMNPDDTPENLWLQVDDLNRPFTFPSNHFDLVHSRLLAAGINRSRWPSY- 172

Query: 156 IKELVRVCKPGGWIELLEI 174
           I+++ RV KPGGW++L+EI
Sbjct: 173 IRDIKRVLKPGGWVQLVEI 191



>gi|408396178|gb|EKJ75342.1| hypothetical protein FPSE_04470 [Fusarium pseudograminearum CS3096]
          Length = 328

 Score = 74.3 bits (181), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 77/130 (59%), Gaps = 12/130 (9%)

Query: 46  HELMKKVWGGN-FVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLT 104
           HEL + V GG  + SPI +  +N     +LD+GCGT   W ++++  +P A+ +G+DL +
Sbjct: 75  HELFRIVLGGKLYQSPIGENPQN-----ILDIGCGTGI-WAIDMADLHPSAEVVGVDL-S 127

Query: 105 PLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCK 164
           P+ P +F   N +F   DI K   + +   DF+H+R +T   T   W++ ++++  R  K
Sbjct: 128 PIQP-NFVPLNCRFEVDDINKEWTYPENKFDFIHIRYMTG--TVPNWKD-LLQKAQRYLK 183

Query: 165 PGGWIELLEI 174
           PGGWIE +E+
Sbjct: 184 PGGWIEHVEL 193



>gi|399170468|emb|CCE28845.1| uncharacterized protein CPUR_02534 [Claviceps purpurea 20.1]
          Length = 340

 Score = 73.9 bits (180), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 65/254 (25%), Positives = 114/254 (44%), Gaps = 25/254 (9%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILE 87
            P +D +L+ +  C   L  L+       F++P+E++    K  +VLDVG G+   W +E
Sbjct: 72  LPNDDQQLKAEEICHHGLTILLDDQL---FLAPVEKD----KIHRVLDVGTGSGI-WAIE 123

Query: 88  LSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFT 147
            +  +P A  +G DL +P  P+ +   N+ F   D      ++D   DF+HMR +     
Sbjct: 124 FADQFPNASVVGTDL-SPCQPQ-WVPPNVCFEIDDATLEWTYDDNHFDFIHMRYIVGGIE 181

Query: 148 ERQWEEVVIKELVRVCKPGGWIELLEIDVDGKS-LGPTSKRIISACMAKFENRGVNGL-- 204
           +  W   + KE  R C PGGW+E +E DV+ +S  G T    + A   +        L  
Sbjct: 182 D--WT-ALFKEAYRCCAPGGWVESVEYDVEFRSDDGTTELEPVLASYGELFREASKILKR 238

Query: 205 ---ISEEIPEFFESTNQVEIYAEEKYSPIGNWGD-----ELGKLALDFFVSIFSSSDELI 256
              + E  P+  +    ++    +   PIG W       E+G++A +   S      +++
Sbjct: 239 PLFVHEIQPQALDEAGFIDKKIVQYKFPIGPWAKDRKLAEVGRMAWEAADSDLEGYTQML 298

Query: 257 EWIKVSKEEYEHMI 270
            W  + K + E+ +
Sbjct: 299 -WQSIQKPQDEYHV 311



>gi|409082776|gb|EKM83134.1| hypothetical protein AGABI1DRAFT_118499 [Agaricus bisporus var.
           burnettii JB137-S8]
          Length = 287

 Score = 73.9 bits (180), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 56/186 (30%), Positives = 94/186 (50%), Gaps = 9/186 (4%)

Query: 68  KKDFKVLDVGCGTTCSWILELSK-TYPLAKFIGLDLLTPLLPKDFS-QNNLQFVQSDILK 125
           K D  VL+   GT   W+ +L+K T     +IG+D+ +   P+  +  +N+ F    +L 
Sbjct: 53  KDDDWVLEGATGTGI-WLQDLAKETSTKPHYIGIDIESNFFPRASTLPSNMTFEIQSVLD 111

Query: 126 GLPFE-DGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIELLEIDVDGKSLGPT 184
            LP E       VH R L A    + WE+  IKEL RV KPGGW++L E+ +   + GP 
Sbjct: 112 -LPKEWTNKFTLVHQRLLIAGLRTQDWEQD-IKELYRVVKPGGWVQLFELKI--WTSGPA 167

Query: 185 -SKRIISACMAKFENRGVNGLISEEIPEFFESTNQVEIYAEEKYSPIGNWGDELGKLALD 243
            +K     C    +   +   ++ ++PEF + +  VEI+ + + +P+G W ++ G  A D
Sbjct: 168 LAKHWDLLCKFSHDVGIMYRDLTTKLPEFLKQSGFVEIHEDTRGTPLGTWANQDGIDAKD 227

Query: 244 FFVSIF 249
             + + 
Sbjct: 228 NLLGVL 233



>gi|317147688|ref|XP_003189941.1| hypothetical protein AOR_1_1634014 [Aspergillus oryzae RIB40]
          Length = 306

 Score = 73.6 bits (179), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 70/138 (50%), Gaps = 8/138 (5%)

Query: 37  QDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAK 96
           ++A+  +L H++  KV+    + P        +  K+LD G GT  SW +E ++ +P  K
Sbjct: 43  EEAERLELQHQVFNKVFDNRLIFP-----PIPRPQKILDCGYGTG-SWAIEAAEQHPKCK 96

Query: 97  FIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVI 156
            IGLD+   + P D   +NL     D+ +   F     D VH R L       +W    I
Sbjct: 97  VIGLDIYPYMNPDDIP-DNLCLQVDDLNRPFTFPPNHFDLVHSRLLATGINRDRWPSY-I 154

Query: 157 KELVRVCKPGGWIELLEI 174
           +++ RV KPGGW++L+EI
Sbjct: 155 RDIKRVLKPGGWVQLVEI 172



>gi|302886149|ref|XP_003041965.1| hypothetical protein NECHADRAFT_52876 [Nectria haematococca mpVI
           77-13-4]
 gi|256722872|gb|EEU36252.1| hypothetical protein NECHADRAFT_52876 [Nectria haematococca mpVI
           77-13-4]
          Length = 322

 Score = 73.6 bits (179), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 80/151 (52%), Gaps = 15/151 (9%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVWGGN-FVSPIEQELKNKKDFKVLDVGCGTTCSWIL 86
           F  ND   EQ ++   + H+ +  +  G  F++PI+ +++     KVLDVG GT   W +
Sbjct: 49  FTPND---EQQSESIDINHQSLTLLLEGKLFLAPIKPDVQ-----KVLDVGTGTGI-WAI 99

Query: 87  ELSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAF 146
           + +  YP A+ IG DL +P+ P  +   N++F   D      + D + DF+H+R L  A 
Sbjct: 100 DFADEYPNAEVIGSDL-SPIQPT-WIPPNVKFEIDDATLTWTWADNTFDFIHIRYLFGAI 157

Query: 147 TERQWEEVVIKELVRVCKPGGWIELLEIDVD 177
             R W  +  KE  R C PGGWI+  E DV+
Sbjct: 158 --RDWTGL-FKEAYRCCAPGGWIQTAEADVE 185



>gi|336256943|ref|XP_003343500.1| hypothetical protein SMAC_09744 [Sordaria macrospora k-hell]
 gi|380086665|emb|CCC05663.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 373

 Score = 73.6 bits (179), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 65/235 (27%), Positives = 107/235 (45%), Gaps = 34/235 (14%)

Query: 37  QDAKCSKLL---HELMKKVWGGN-FVSPI-EQELKNKKDFKVLDVGCGTTCSWILELSKT 91
            DAK ++LL   H  M  ++ G  + SP+ E+E++N      +D+G GT   W ++ +  
Sbjct: 102 NDAKANELLDIMHAAMVMLFDGKLYTSPLDEKEIEN-----AIDIGTGTGI-WAIDFADD 155

Query: 92  YPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQW 151
           +P    IG D+ +P+ P  +   N  F  +D  K   +++   DF+H+R LT     + W
Sbjct: 156 HPNCNVIGTDI-SPIQPT-WLPPNACFEINDATKEWTYQENYFDFIHIRWLTGVI--KDW 211

Query: 152 EEVVIKELVRVCKPGGWIELLEIDV-----DG--------KSLGPTSKRIISACMAKFEN 198
           + +  KE  R CKPGGWIE L+ D      DG           GP  K +      +F  
Sbjct: 212 DSLY-KEAYRCCKPGGWIEQLDCDAENLCFDGTMPNDSAMAQWGPIWKEVGRKTGLEF-- 268

Query: 199 RGVNGLISEEIPEFFESTNQVEIYAEEKYSPIGNWGDELGKLALDFFVSIFSSSD 253
              N + S  + +  ++     I +E+ Y P+  W D+     L  + S   + D
Sbjct: 269 ---NVVSSNTMEKGLKNAGFTNIISEDYYVPLAPWSDDPKMKQLGLYQSAALTHD 320



>gi|500253840|gb|EON97487.1| hypothetical protein UCRPA7_7099 [Togninia minima UCRPA7]
          Length = 189

 Score = 73.6 bits (179), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 44/119 (36%), Positives = 68/119 (57%), Gaps = 11/119 (9%)

Query: 57  FVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTPLLPKDFSQNNL 116
           F++PI+++++     KVLDVG GT   W ++ +  +   + IG DL +P+ P  +   NL
Sbjct: 18  FLAPIKKDVE-----KVLDVGTGTGI-WAIDFADEFENTQVIGTDL-SPIQPT-WVPPNL 69

Query: 117 QFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIELLEID 175
           +F   D L+   + +G  DFVH+R L  A  +      + KE  RVCKPGGW+E  E+D
Sbjct: 70  KFELDDALQTWSWPEGEFDFVHLRYLFGAIADWG---ALFKEAFRVCKPGGWVESCEVD 125



>gi|393238105|gb|EJD45643.1| hypothetical protein AURDEDRAFT_113983 [Auricularia delicata
           TFB-10046 SS5]
          Length = 824

 Score = 73.2 bits (178), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 80/131 (61%), Gaps = 12/131 (9%)

Query: 72  KVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTPLLP------KDFSQNNLQFVQSDILK 125
           KVLD+GCGT  +W+++ ++ +  ++F+GLD++ PL P       D +   +++VQ++ L+
Sbjct: 184 KVLDLGCGT-GTWVMDCARLWKESRFVGLDIV-PLQPDLHLLGSDIAPR-VKWVQANFLE 240

Query: 126 GLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKPGGWIELLEIDV--DGKSLGP 183
            LPF+D   DFVH+R +     E +W + +++E+ RV K GG  E++E D+   G +  P
Sbjct: 241 RLPFDDEEFDFVHVRRIARGVPETKW-DYLLEEITRVLKKGGAFEIVEEDLIFPGSADFP 299

Query: 184 TSKRIISACMA 194
             + + S  +A
Sbjct: 300 MPQDLASPAVA 310



>gi|302885268|ref|XP_003041526.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256722430|gb|EEU35813.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 343

 Score = 73.2 bits (178), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 75/269 (27%), Positives = 125/269 (46%), Gaps = 43/269 (15%)

Query: 46  HELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILELSKTYPLAKFIGLDLLTP 105
           H L   + G  +++P++ ++K     KV+D+G GT    + + +  YP A+ IG D+ +P
Sbjct: 91  HLLSLSLNGKLYLAPLKNDIK-----KVIDIGTGT----VSDFADQYPKAEVIGTDI-SP 140

Query: 106 LLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFTERQWEEVVIKELVRVCKP 165
           + P  +   NL+F   D  +   FE  S D+VHMR L  + ++  W   + KE  RVCKP
Sbjct: 141 IQPT-WIPANLKFEIEDCTQEWTFEPESFDYVHMRYLCGSISD--WS-ALFKEAFRVCKP 196

Query: 166 GGWIELLE----IDVDGKSLGPT------SKRIISACMAKFENRGVNGLISEEIPEFFES 215
           GGW+E  E    ++ D  S+  T       K  I     K  NR    L  +   +  E 
Sbjct: 197 GGWVESYEASPRMESDDGSVTETCAINEWGKFFIEG--GKKLNRTFEILDKDLQRKGMEE 254

Query: 216 TNQVEIYAEEKYSPIGNWGD-----ELGKLA-----LDFFVSIFSSSDELIEWIKVSKEE 265
              V++   +  +PIG W +     E+G+ A      D+   +   ++ ++ W   SKEE
Sbjct: 255 AGFVDVQVWDFKAPIGGWAEDPRIKEIGQFAQAALEQDYEGYVLFMANMVLGW---SKEE 311

Query: 266 YEHMIAQYIKEVEIYRSYFINIKFYCQKI 294
                AQ  +E+   + +     FY Q++
Sbjct: 312 VSTYCAQLRREIRSGKFH----PFYRQRV 336



>gi|399170476|emb|CCE28853.1| uncharacterized protein CPUR_02542 [Claviceps purpurea 20.1]
          Length = 330

 Score = 73.2 bits (178), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 70/256 (27%), Positives = 111/256 (43%), Gaps = 29/256 (11%)

Query: 28  FPKNDLELEQDAKCSKLLHELMKKVWGGNFVSPIEQELKNKKDFKVLDVGCGTTCSWILE 87
           FP +D +LE    C      L+       F++P+E++    K  +VLDVG G+   W +E
Sbjct: 62  FPNDDQQLESMELCHHYFTILLDDQL---FLAPLEKD----KIHRVLDVGTGSGI-WAIE 113

Query: 88  LSKTYPLAKFIGLDLLTPLLPKDFSQNNLQFVQSDILKGLPFEDGSIDFVHMRCLTAAFT 147
            +  +  A  IG DL +P  P+ +   N+ F   D      + +   DF+HMR +     
Sbjct: 114 FADQFRNASVIGTDL-SPCQPQ-WVPPNVSFEIDDATLDWTWSENHFDFIHMRYIVGGIQ 171

Query: 148 ERQWEEVVIKELVRVCKPGGWIELLEIDVDGKS-LGPTSKRIISAC-------MAKFENR 199
           +  W   + KE  R C PGGW+E +E DV+ +S  G T    I A         +K  NR
Sbjct: 172 D--WT-ALFKEAYRCCAPGGWVESIEYDVEFRSDDGTTELEPILASYGELFREASKILNR 228

Query: 200 GVNGLISEEIPEFFESTNQVEIYAEEKYSPIGNWGD-----ELGKLALDFFVSIFSSSDE 254
            +   +    P+  +    +E    +   PIG W       E+G+ A +          +
Sbjct: 229 PL--FVQAIQPQALDEAGFIEKKIVQYKIPIGPWAKDRKFAEVGRFARESLEKDLQGYTQ 286

Query: 255 LIEWIKVSKEEYEHMI 270
           +I W  V K E E+ +
Sbjct: 287 MI-WQSVQKPENEYHV 301