BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10268_c0_seq1-m.99 5prime_partial 2-2038(+) 679 (+)
         (678 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|358055114|dbj|GAA98883.1| hypothetical protein E5Q_05571 [Mix...   444   e-122   Mixia osmundae IAM 14324
gi|472586292|gb|EMS23820.1| long chain fatty alcohol oxidase [Rh...   439   e-120   Rhodotorula toruloides NP11
gi|342321180|gb|EGU13115.1| Long chain fatty alcohol oxidase [Rh...   436   e-119   Rhodotorula toruloides ATCC 204091
gi|511005485|gb|EPB86823.1| hypothetical protein HMPREF1544_0634...   412   e-112   Mucor circinelloides f. circinelloides 1006PhL
gi|328854653|gb|EGG03784.1| hypothetical protein MELLADRAFT_7849...   379   e-102   Melampsora larici-populina 98AG31
gi|331231798|ref|XP_003328562.1| hypothetical protein PGTG_10521...   369   1e-99   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|384493075|gb|EIE83566.1| hypothetical protein RO3G_08271 [Rhi...   359   2e-96   Rhizopus delemar RA 99-880
gi|511006580|gb|EPB87889.1| hypothetical protein HMPREF1544_0529...   354   4e-95   Mucor circinelloides f. circinelloides 1006PhL
gi|67516683|ref|XP_658227.1| hypothetical protein AN0623.2 [Aspe...   349   1e-93   Aspergillus nidulans FGSC A4
gi|189208306|ref|XP_001940486.1| long chain fatty alcohol oxidas...   348   3e-93   Pyrenophora tritici-repentis Pt-1C-BFP
gi|330919518|ref|XP_003298648.1| hypothetical protein PTT_09421 ...   345   3e-92   Pyrenophora teres f. teres 0-1
gi|358365410|dbj|GAA82032.1| long chain fatty alcohol oxidase [A...   342   2e-91   Aspergillus kawachii IFO 4308
gi|449296026|gb|EMC92046.1| hypothetical protein BAUCODRAFT_2745...   337   5e-90   Baudoinia panamericana UAMH 10762
gi|115397345|ref|XP_001214264.1| conserved hypothetical protein ...   337   9e-90   Aspergillus terreus NIH2624
gi|477509601|gb|ENH62892.1| Long-chain-alcohol oxidase FAO2 [Fus...   337   1e-89   Fusarium oxysporum f. sp. cubense race 1
gi|342880915|gb|EGU81929.1| hypothetical protein FOXB_07532 [Fus...   334   5e-89   Fusarium oxysporum Fo5176
gi|164655877|ref|XP_001729067.1| hypothetical protein MGL_3855 [...   334   5e-89   Malassezia globosa CBS 7966
gi|388853321|emb|CCF53187.1| related to long chain fatty alcohol...   334   6e-89   Ustilago hordei
gi|350638442|gb|EHA26798.1| long chain fatty alcohol oxidase [As...   333   8e-89   Aspergillus niger ATCC 1015
gi|145230147|ref|XP_001389382.1| long chain fatty alcohol oxidas...   333   9e-89   Aspergillus niger CBS 513.88
gi|452845850|gb|EME47783.1| hypothetical protein DOTSEDRAFT_6965...   333   1e-88   Dothistroma septosporum NZE10
gi|440640770|gb|ELR10689.1| hypothetical protein GMDG_04950 [Geo...   332   2e-88   Pseudogymnoascus destructans 20631-21
gi|453087089|gb|EMF15130.1| long-chain fatty alcohol dehydrogena...   332   3e-88   Sphaerulina musiva SO2202
gi|475677371|gb|EMT74381.1| Long-chain-alcohol oxidase FAO2 [Fus...   331   5e-88   Fusarium oxysporum f. sp. cubense race 4
gi|501303027|dbj|GAC92532.1| choline dehydrogenase [Pseudozyma h...   330   1e-87   Pseudozyma hubeiensis SY62
gi|71007921|ref|XP_758170.1| hypothetical protein UM02023.1 [Ust...   328   3e-87   
gi|384483270|gb|EIE75450.1| hypothetical protein RO3G_00154 [Rhi...   328   4e-87   Rhizopus delemar RA 99-880
gi|511006579|gb|EPB87888.1| hypothetical protein HMPREF1544_0529...   327   7e-87   Mucor circinelloides f. circinelloides 1006PhL
gi|482808186|gb|EOA85119.1| hypothetical protein SETTUDRAFT_2063...   327   9e-87   Setosphaeria turcica Et28A
gi|121700595|ref|XP_001268562.1| long chain fatty alcohol oxidas...   326   1e-86   Aspergillus clavatus NRRL 1
gi|477529356|gb|ENH81120.1| long chain fatty alcohol oxidase [Co...   326   1e-86   Colletotrichum orbiculare MAFF 240422
gi|240274407|gb|EER37923.1| long chain fatty acid oxidase [Ajell...   325   2e-86   Histoplasma capsulatum H143
gi|451852893|gb|EMD66187.1| hypothetical protein COCSADRAFT_2957...   325   4e-86   Bipolaris sorokiniana ND90Pr
gi|406859722|gb|EKD12785.1| hypothetical protein MBM_09014 [Mars...   324   5e-86   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|398407357|ref|XP_003855144.1| hypothetical protein MYCGRDRAFT...   324   6e-86   Zymoseptoria tritici IPO323
gi|443899677|dbj|GAC77008.1| hypothetical protein PANT_22d00298 ...   324   7e-86   Moesziomyces antarcticus T-34
gi|343428734|emb|CBQ72264.1| related to long chain fatty alcohol...   324   7e-86   Sporisorium reilianum SRZ2
gi|310798462|gb|EFQ33355.1| GMC oxidoreductase [Glomerella grami...   322   2e-85   Colletotrichum graminicola M1.001
gi|452986179|gb|EME85935.1| hypothetical protein MYCFIDRAFT_5238...   322   2e-85   Cercospora fijiensis CIRAD86
gi|302915893|ref|XP_003051757.1| hypothetical protein NECHADRAFT...   321   4e-85   Nectria haematococca mpVI 77-13-4
gi|255957169|ref|XP_002569337.1| Pc21g23700 [Penicillium chrysog...   321   5e-85   Penicillium rubens Wisconsin 54-1255
gi|239612594|gb|EEQ89581.1| long chain fatty alcohol oxidase [Aj...   319   2e-84   Blastomyces dermatitidis ER-3
gi|344229472|gb|EGV61357.1| hypothetical protein CANTEDRAFT_1086...   318   3e-84   Candida tenuis ATCC 10573
gi|225681307|gb|EEH19591.1| long chain fatty alcohol oxidase [Pa...   318   3e-84   Paracoccidioides brasiliensis Pb03
gi|295656765|ref|XP_002788971.1| long chain fatty acid oxidase [...   318   4e-84   Paracoccidioides lutzii Pb01
gi|226295053|gb|EEH50473.1| long chain fatty acid oxidase [Parac...   318   5e-84   Paracoccidioides brasiliensis Pb18
gi|407919020|gb|EKG12277.1| Glucose-methanol-choline oxidoreduct...   317   7e-84   Macrophomina phaseolina MS6
gi|452002463|gb|EMD94921.1| hypothetical protein COCHEDRAFT_1201...   316   1e-83   Bipolaris maydis C5
gi|168020954|ref|XP_001763007.1| predicted protein [Physcomitrel...   316   2e-83   Physcomitrella patens
gi|70996648|ref|XP_753079.1| long chain fatty alcohol oxidase [A...   315   2e-83   Aspergillus fumigatus Af293
gi|512198772|gb|EPE27606.1| FAD/NAD(P)-binding protein [Glarea l...   315   3e-83   Glarea lozoyensis ATCC 20868
gi|6983581|emb|CAB75351.1| long chain fatty alcohol oxidase [Can...   315   3e-83   Candida cloacae
gi|367048387|ref|XP_003654573.1| hypothetical protein THITE_2117...   315   4e-83   Thielavia terrestris NRRL 8126
gi|380477975|emb|CCF43856.1| GMC oxidoreductase [Colletotrichum ...   314   5e-83   Colletotrichum higginsianum
gi|302801652|ref|XP_002982582.1| hypothetical protein SELMODRAFT...   314   5e-83   Selaginella moellendorffii
gi|302766828|ref|XP_002966834.1| hypothetical protein SELMODRAFT...   314   6e-83   Selaginella moellendorffii
gi|460401007|ref|XP_004246021.1| PREDICTED: long-chain-alcohol o...   314   7e-83   Solanum lycopersicum
gi|302826268|ref|XP_002994642.1| hypothetical protein SELMODRAFT...   314   7e-83   Selaginella moellendorffii
gi|171678857|ref|XP_001904377.1| hypothetical protein [Podospora...   313   8e-83   Podospora anserina S mat+
gi|68487530|ref|XP_712386.1| potential long chain fatty acid alc...   313   1e-82   Candida albicans SC5314
gi|168000841|ref|XP_001753124.1| predicted protein [Physcomitrel...   313   1e-82   Physcomitrella patens
gi|261191646|ref|XP_002622231.1| long chain fatty alcohol oxidas...   313   1e-82   Blastomyces gilchristii SLH14081
gi|68487603|ref|XP_712350.1| potential long chain fatty acid alc...   313   1e-82   Candida albicans SC5314
gi|302755496|ref|XP_002961172.1| hypothetical protein SELMODRAFT...   312   2e-82   Selaginella moellendorffii
gi|440635542|gb|ELR05461.1| hypothetical protein GMDG_01756 [Geo...   312   2e-82   Pseudogymnoascus destructans 20631-21
gi|241959034|ref|XP_002422236.1| fatty alcohol oxidase, putative...   311   4e-82   Candida dubliniensis CD36
gi|46125081|ref|XP_387094.1| hypothetical protein FG06918.1 [Fus...   311   4e-82   
gi|169599110|ref|XP_001792978.1| hypothetical protein SNOG_02371...   311   4e-82   Parastagonospora nodorum SN15
gi|391865561|gb|EIT74840.1| choline dehydrogenase [Aspergillus o...   311   4e-82   Aspergillus oryzae 3.042
gi|302798701|ref|XP_002981110.1| hypothetical protein SELMODRAFT...   311   6e-82   Selaginella moellendorffii
gi|325090749|gb|EGC44059.1| long chain fatty acid oxidase [Ajell...   311   6e-82   Histoplasma capsulatum H88
gi|119494301|ref|XP_001264046.1| long chain fatty alcohol oxidas...   311   6e-82   Aspergillus fischeri NRRL 181
gi|396466184|ref|XP_003837633.1| hypothetical protein LEMA_P1234...   309   2e-81   Leptosphaeria maculans JN3
gi|119185879|ref|XP_001243546.1| hypothetical protein CIMG_02987...   309   2e-81   Coccidioides immitis RS
gi|168017712|ref|XP_001761391.1| predicted protein [Physcomitrel...   309   2e-81   Physcomitrella patens
gi|384246311|gb|EIE19802.1| FAD/NAD(P)-binding domain-containing...   309   2e-81   Coccomyxa subellipsoidea C-169
gi|238880137|gb|EEQ43775.1| hypothetical protein CAWG_02023 [Can...   309   2e-81   Candida albicans WO-1
gi|44194457|gb|AAS46878.1| fatty alcohol oxidase [Candida tropic...   309   2e-81   Candida tropicalis
gi|169773275|ref|XP_001821106.1| long chain fatty alcohol oxidas...   308   3e-81   Aspergillus oryzae RIB40
gi|358387110|gb|EHK24705.1| hypothetical protein TRIVIDRAFT_5453...   308   3e-81   Trichoderma virens Gv29-8
gi|156052058|ref|XP_001591990.1| hypothetical protein SS1G_07437...   308   4e-81   Sclerotinia sclerotiorum 1980 UF-70
gi|345563626|gb|EGX46612.1| hypothetical protein AOL_s00097g516 ...   308   5e-81   Arthrobotrys oligospora ATCC 24927
gi|408388245|gb|EKJ67931.1| hypothetical protein FPSE_11742 [Fus...   308   5e-81   Fusarium pseudograminearum CS3096
gi|6983594|emb|CAB75353.1| long chain fatty alcohol oxidase [Can...   308   5e-81   Candida tropicalis
gi|42566953|ref|NP_193673.2| Long-chain-alcohol oxidase FAO4A [A...   307   7e-81   Arabidopsis thaliana [mouse-ear cress]
gi|44194480|gb|AAS46879.1| fatty alcohol oxidase [Candida tropic...   306   1e-80   Candida tropicalis
gi|344302297|gb|EGW32602.1| fatty alcohol oxidase [Spathaspora p...   306   1e-80   Spathaspora passalidarum NRRL Y-27907
gi|344303692|gb|EGW33941.1| fatty alcohol oxidase [Spathaspora p...   306   2e-80   Spathaspora passalidarum NRRL Y-27907
gi|320032145|gb|EFW14100.1| long chain fatty alcohol oxidase [Co...   305   4e-80   Coccidioides posadasii str. Silveira
gi|303323876|ref|XP_003071927.1| GMC oxidoreductase family prote...   304   5e-80   Coccidioides posadasii C735 delta SOWgp
gi|336268292|ref|XP_003348911.1| hypothetical protein SMAC_01933...   304   7e-80   Sordaria macrospora k-hell
gi|297800118|ref|XP_002867943.1| hypothetical protein ARALYDRAFT...   304   7e-80   Arabidopsis lyrata subsp. lyrata
gi|3080368|emb|CAA18625.1| putative protein [Arabidopsis thalian...   303   1e-79   Arabidopsis thaliana [mouse-ear cress]
gi|44194515|gb|AAS46880.1| fatty alcohol oxidase [Candida tropic...   302   2e-79   Candida tropicalis
gi|225427625|ref|XP_002269629.1| PREDICTED: long-chain-alcohol o...   301   4e-79   Vitis vinifera
gi|472239781|gb|EMR84578.1| putative long chain fatty alcohol pr...   301   7e-79   Botrytis cinerea BcDW1
gi|261412041|gb|ACX81419.1| fatty alcohol oxidase [Candida tropi...   300   8e-79   Candida tropicalis
gi|495183075|ref|WP_007907865.1| glucose-methanol-choline oxidor...   300   8e-79   Ktedonobacter racemifer
gi|154309784|ref|XP_001554225.1| hypothetical protein BC1G_07362...   300   1e-78   Botrytis cinerea B05.10
gi|508778125|gb|EOY25381.1| Long-chain fatty alcohol dehydrogena...   300   1e-78   Theobroma cacao [chocolate]
gi|347827209|emb|CCD42906.1| similar to long chain fatty alcohol...   300   1e-78   Botrytis cinerea T4
gi|485451287|gb|AGK82821.1| alcohol oxidase [Solanum pimpinellif...   299   2e-78   Solanum pimpinellifolium [currant tomato]
gi|448527054|ref|XP_003869426.1| hypothetical protein CORT_0D045...   299   2e-78   Candida orthopsilosis Co 90-125
gi|148909432|gb|ABR17814.1| unknown [Picea sitchensis]                299   3e-78   Picea sitchensis
gi|147770729|emb|CAN71289.1| hypothetical protein VITISV_019349 ...   298   3e-78   Vitis vinifera
gi|242778904|ref|XP_002479333.1| long chain fatty alcohol oxidas...   298   3e-78   Talaromyces stipitatus ATCC 10500
gi|358399571|gb|EHK48908.1| hypothetical protein TRIATDRAFT_2809...   298   3e-78   Trichoderma atroviride IMI 206040
gi|212533793|ref|XP_002147053.1| long chain fatty alcohol oxidas...   298   5e-78   Talaromyces marneffei ATCC 18224
gi|399165401|emb|CCE33688.1| uncharacterized protein CPUR_07614 ...   298   5e-78   Claviceps purpurea 20.1
gi|255557817|ref|XP_002519938.1| electron carrier, putative [Ric...   298   5e-78   Ricinus communis
gi|242065798|ref|XP_002454188.1| hypothetical protein SORBIDRAFT...   298   5e-78   Sorghum bicolor [broomcorn]
gi|296423509|ref|XP_002841296.1| hypothetical protein [Tuber mel...   297   6e-78   Tuber melanosporum Mel28
gi|485451300|gb|AGK82832.1| alcohol oxidase [Solanum habrochaites]    297   6e-78   Solanum habrochaites
gi|225433197|ref|XP_002285334.1| PREDICTED: long-chain-alcohol o...   296   1e-77   Vitis vinifera
gi|356543140|ref|XP_003540021.1| PREDICTED: long-chain-alcohol o...   296   1e-77   Glycine max [soybeans]
gi|485451270|gb|AGK82806.1| alcohol oxidase [Solanum lycopersicum]    296   1e-77   Solanum lycopersicum
gi|460397771|ref|XP_004244440.1| PREDICTED: long-chain-alcohol o...   296   1e-77   Solanum lycopersicum
gi|502116266|ref|XP_004495357.1| PREDICTED: long-chain-alcohol o...   296   1e-77   Cicer arietinum [garbanzo]
gi|242065802|ref|XP_002454190.1| hypothetical protein SORBIDRAFT...   296   2e-77   Sorghum bicolor [broomcorn]
gi|357517451|ref|XP_003629014.1| GMC-type oxidoreductase, putati...   296   2e-77   Medicago truncatula
gi|326475872|gb|EGD99881.1| long chain fatty alcohol oxidase [Tr...   296   2e-77   Trichophyton tonsurans CBS 112818
gi|384252809|gb|EIE26284.1| FAD/NAD(P)-binding domain-containing...   296   2e-77   Coccomyxa subellipsoidea C-169
gi|485451292|gb|AGK82825.1| alcohol oxidase [Solanum pennellii]       295   2e-77   Solanum pennellii
gi|500260062|gb|EOO02770.1| putative long chain fatty acid oxida...   295   3e-77   Phaeoacremonium minimum UCRPA7
gi|302885348|ref|XP_003041566.1| hypothetical protein NECHADRAFT...   295   3e-77   Nectria haematococca mpVI 77-13-4
gi|340522029|gb|EGR52262.1| predicted protein [Trichoderma reese...   295   5e-77   Trichoderma reesei QM6a
gi|475667686|gb|EMT65475.1| Long-chain-alcohol oxidase FAO2 [Fus...   294   5e-77   Fusarium oxysporum f. sp. cubense race 4
gi|6983583|emb|CAB75352.1| long chain fatty alcohol oxidase [Can...   294   7e-77   Candida cloacae
gi|407645686|ref|YP_006809445.1| putative oxidoreductase [Nocard...   293   9e-77   
gi|126139129|ref|XP_001386087.1| long chain fatty acid oxidase [...   293   9e-77   Scheffersomyces stipitis CBS 6054
gi|224129586|ref|XP_002328753.1| predicted protein [Populus tric...   293   9e-77   
gi|150865867|ref|XP_001385255.2| long chain fatty acid oxidase [...   293   1e-76   Scheffersomyces stipitis CBS 6054
gi|346971164|gb|EGY14616.1| long chain fatty alcohol oxidase [Ve...   293   1e-76   Verticillium dahliae VdLs.17
gi|429861106|gb|ELA35812.1| long chain fatty alcohol oxidase [Co...   293   1e-76   Colletotrichum gloeosporioides Nara gc5
gi|470107269|ref|XP_004289971.1| PREDICTED: long-chain-alcohol o...   293   1e-76   
gi|357484415|ref|XP_003612495.1| GMC-type oxidoreductase, putati...   293   2e-76   
gi|470107267|ref|XP_004289970.1| PREDICTED: long-chain-alcohol o...   293   2e-76   Fragaria vesca subsp. vesca
gi|477512030|gb|ENH64591.1| Long-chain-alcohol oxidase FAO2 [Fus...   292   2e-76   Fusarium oxysporum f. sp. cubense race 1
gi|361129891|gb|EHL01767.1| putative Long-chain-alcohol oxidase ...   292   3e-76   Glarea lozoyensis 74030
gi|356531545|ref|XP_003534338.1| PREDICTED: long-chain-alcohol o...   292   3e-76   
gi|342865970|gb|EGU71971.1| hypothetical protein FOXB_17532 [Fus...   292   3e-76   Fusarium oxysporum Fo5176
gi|354546071|emb|CCE42800.1| hypothetical protein CPAR2_204430 [...   291   3e-76   Candida parapsilosis
gi|346324797|gb|EGX94394.1| long chain fatty alcohol oxidase [Co...   291   3e-76   Cordyceps militaris CM01
gi|302754194|ref|XP_002960521.1| hypothetical protein SELMODRAFT...   291   4e-76   Selaginella moellendorffii
gi|448090831|ref|XP_004197171.1| Piso0_004410 [Millerozyma farin...   291   5e-76   Millerozyma farinosa CBS 7064
gi|358385534|gb|EHK23131.1| hypothetical protein TRIVIDRAFT_5380...   291   7e-76   Trichoderma virens Gv29-8
gi|508714212|gb|EOY06109.1| Fatty alcohol oxidase 3 isoform 1 [T...   290   8e-76   Theobroma cacao [chocolate]
gi|379709263|ref|YP_005264468.1| putative oxidoreductase [Nocard...   290   9e-76   
gi|356533767|ref|XP_003535431.1| PREDICTED: long-chain-alcohol o...   290   9e-76   
gi|340966825|gb|EGS22332.1| hypothetical protein CTHT_0018560 [C...   290   1e-75   Chaetomium thermophilum var. thermophilum DSM 1495
gi|296803478|ref|XP_002842592.1| long chain fatty acid oxidase [...   290   1e-75   Arthroderma otae CBS 113480
gi|297831096|ref|XP_002883430.1| hypothetical protein ARALYDRAFT...   290   1e-75   Arabidopsis lyrata subsp. lyrata
gi|354546070|emb|CCE42799.1| hypothetical protein CPAR2_204420 [...   290   1e-75   Candida parapsilosis
gi|508714215|gb|EOY06112.1| Alcohol oxidase, putative isoform 4,...   290   1e-75   Theobroma cacao [chocolate]
gi|448527058|ref|XP_003869427.1| hypothetical protein CORT_0D045...   290   1e-75   Candida orthopsilosis Co 90-125
gi|482551882|gb|EOA16075.1| hypothetical protein CARUB_v10004208...   289   2e-75   Capsella rubella
gi|54022945|ref|YP_117187.1| oxidoreductase [Nocardia farcinica ...   289   2e-75   
gi|470120598|ref|XP_004296386.1| PREDICTED: long-chain-alcohol o...   289   2e-75   Fragaria vesca subsp. vesca
gi|508714217|gb|EOY06114.1| Fatty alcohol oxidase 3 isoform 6, p...   289   2e-75   Theobroma cacao [chocolate]
gi|336470050|gb|EGO58212.1| hypothetical protein NEUTE1DRAFT_825...   288   3e-75   Neurospora tetrasperma FGSC 2508
gi|356496483|ref|XP_003517097.1| PREDICTED: long-chain-alcohol o...   288   4e-75   Glycine max [soybeans]
gi|482551883|gb|EOA16076.1| hypothetical protein CARUB_v10004208...   288   4e-75   Capsella rubella
gi|400599103|gb|EJP66807.1| GMC oxidoreductase [Beauveria bassia...   288   6e-75   Beauveria bassiana ARSEF 2860
gi|260947498|ref|XP_002618046.1| hypothetical protein CLUG_01505...   288   6e-75   Clavispora lusitaniae ATCC 42720
gi|322707065|gb|EFY98644.1| long chain fatty alcohol oxidase [Me...   288   6e-75   Metarhizium robertsii ARSEF 23
gi|322698987|gb|EFY90752.1| long chain fatty alcohol oxidase [Me...   288   6e-75   Metarhizium acridum CQMa 102
gi|462421371|gb|EMJ25634.1| hypothetical protein PRUPE_ppa021498...   287   8e-75   Prunus persica
gi|482565395|gb|EOA29584.1| hypothetical protein CARUB_v10013046...   287   9e-75   Capsella rubella
gi|18403753|ref|NP_566729.1| long-chain-alcohol oxidase FAO3 [Ar...   286   1e-74   Arabidopsis thaliana [mouse-ear cress]
gi|302767562|ref|XP_002967201.1| hypothetical protein SELMODRAFT...   286   1e-74   Selaginella moellendorffii
gi|302499400|ref|XP_003011696.1| hypothetical protein ARB_02250 ...   285   2e-74   Arthroderma benhamiae CBS 112371
gi|22798796|emb|CAC87643.1| alcohol oxidase [Arabidopsis thaliana]    285   2e-74   Arabidopsis thaliana [mouse-ear cress]
gi|218191193|gb|EEC73620.1| hypothetical protein OsI_08118 [Oryz...   285   3e-74   Oryza sativa Indica Group [Indian rice]
gi|294657204|ref|XP_459506.2| DEHA2E04268p [Debaryomyces hanseni...   285   3e-74   Debaryomyces hansenii CBS767
gi|300680944|sp|B5WWZ8.1|FAO1_LOTJA RecName: Full=Long-chain-alc...   285   4e-74   Lotus japonicus
gi|115447369|ref|NP_001047464.1| Os02g0621800 [Oryza sativa Japo...   285   4e-74   
gi|389632529|ref|XP_003713917.1| long chain fatty acid oxidase [...   285   5e-74   Magnaporthe oryzae 70-15
gi|502153883|ref|XP_004509495.1| PREDICTED: long-chain-alcohol o...   284   5e-74   Cicer arietinum [garbanzo]
gi|149238970|ref|XP_001525361.1| hypothetical protein LELG_03289...   284   5e-74   Lodderomyces elongisporus NRRL YB-4239
gi|502161934|ref|XP_004512334.1| PREDICTED: long-chain-alcohol o...   284   6e-74   Cicer arietinum [garbanzo]
gi|502161931|ref|XP_004512333.1| PREDICTED: long-chain-alcohol o...   284   7e-74   
gi|449433239|ref|XP_004134405.1| PREDICTED: long-chain-alcohol o...   284   8e-74   Cucumis sativus [cucumbers]
gi|449468696|ref|XP_004152057.1| PREDICTED: long-chain-alcohol o...   283   9e-74   Cucumis sativus [cucumbers]
gi|356515032|ref|XP_003526205.1| PREDICTED: long-chain-alcohol o...   283   1e-73   
gi|326498701|dbj|BAK02336.1| predicted protein [Hordeum vulgare ...   283   1e-73   Hordeum vulgare subsp. vulgare [barley]
gi|224107463|ref|XP_002314488.1| predicted protein [Populus tric...   282   2e-73   
gi|85091650|ref|XP_959005.1| hypothetical protein NCU08977 [Neur...   282   2e-73   Neurospora crassa OR74A
gi|302652368|ref|XP_003018036.1| hypothetical protein TRV_07960 ...   282   2e-73   Trichophyton verrucosum HKI 0517
gi|223946957|gb|ACN27562.1| unknown [Zea mays] >gi|413923100|gb|...   282   2e-73   Zea mays [maize]
gi|146416233|ref|XP_001484086.1| hypothetical protein PGUG_03467...   282   3e-73   Meyerozyma guilliermondii ATCC 6260
gi|190347148|gb|EDK39369.2| hypothetical protein PGUG_03467 [Mey...   282   3e-73   Meyerozyma guilliermondii ATCC 6260
gi|258578497|ref|XP_002543430.1| conserved hypothetical protein ...   282   3e-73   Uncinocarpus reesii 1704
gi|16905179|gb|AAL31049.1|AC078893_12 putative oxidase [Oryza sa...   281   4e-73   Oryza sativa Japonica Group [Japonica rice]
gi|357474781|ref|XP_003607676.1| Annotation was added to scaffol...   281   4e-73   
gi|16905151|gb|AAL31021.1|AC078948_5 putative alcohol oxidase [O...   281   4e-73   Oryza sativa Japonica Group [Japonica rice]
gi|226499278|ref|NP_001148058.1| oxidoreductase [Zea mays] >gi|1...   281   4e-73   Zea mays [maize]
gi|356559057|ref|XP_003547818.1| PREDICTED: long-chain-alcohol o...   281   4e-73   
gi|494771433|ref|WP_007506841.1| oxidoreductase [Frankia sp. CN3...   281   5e-73   Frankia sp. CN3
gi|448527062|ref|XP_003869428.1| hypothetical protein CORT_0D045...   280   9e-73   Candida orthopsilosis Co 90-125
gi|224099953|ref|XP_002311685.1| predicted protein [Populus tric...   280   1e-72   
gi|462406299|gb|EMJ11763.1| hypothetical protein PRUPE_ppa014756...   280   1e-72   Prunus persica
gi|502110108|ref|XP_004493801.1| PREDICTED: long-chain-alcohol o...   278   4e-72   Cicer arietinum [garbanzo]
gi|16905157|gb|AAL31027.1|AC078948_11 putative alcohol oxidase [...   278   4e-72   Oryza sativa Japonica Group [Japonica rice]
gi|242034203|ref|XP_002464496.1| hypothetical protein SORBIDRAFT...   278   5e-72   Sorghum bicolor [broomcorn]
gi|327293505|ref|XP_003231449.1| long chain fatty alcohol oxidas...   278   6e-72   Trichophyton rubrum CBS 118892
gi|449466091|ref|XP_004150760.1| PREDICTED: long-chain-alcohol o...   277   7e-72   Cucumis sativus [cucumbers]
gi|315043774|ref|XP_003171263.1| fatty alcohol oxidase [Arthrode...   277   7e-72   Microsporum gypseum CBS 118893
gi|297727683|ref|NP_001176205.1| Os10g0474966 [Oryza sativa Japo...   277   7e-72   
gi|449520567|ref|XP_004167305.1| PREDICTED: LOW QUALITY PROTEIN:...   277   8e-72   
gi|356558886|ref|XP_003547733.1| PREDICTED: long-chain-alcohol o...   276   1e-71   
gi|414871101|tpg|DAA49658.1| TPA: hypothetical protein ZEAMMB73_...   276   2e-71   Zea mays [maize]
gi|326521814|dbj|BAK00483.1| predicted protein [Hordeum vulgare ...   275   3e-71   Hordeum vulgare subsp. vulgare [barley]
gi|502143811|ref|XP_004505474.1| PREDICTED: long-chain-alcohol o...   274   5e-71   Cicer arietinum [garbanzo]
gi|493588384|ref|WP_006541316.1| oxidoreductase [Frankia sp. EUN...   274   8e-71   Frankia sp. EUN1f
gi|255575851|ref|XP_002528823.1| disulfide oxidoreductase, putat...   273   1e-70   Ricinus communis
gi|242034201|ref|XP_002464495.1| hypothetical protein SORBIDRAFT...   272   2e-70   Sorghum bicolor [broomcorn]
gi|194707690|gb|ACF87929.1| unknown [Zea mays]                        271   5e-70   Zea mays [maize]
gi|482575188|gb|EOA39375.1| hypothetical protein CARUB_v10012453...   271   5e-70   Capsella rubella
gi|357146609|ref|XP_003574052.1| PREDICTED: long-chain-alcohol o...   270   1e-69   Brachypodium distachyon [annual false brome]
gi|367031472|ref|XP_003665019.1| hypothetical protein MYCTH_1035...   270   2e-69   Myceliophthora thermophila ATCC 42464
gi|357140638|ref|XP_003571871.1| PREDICTED: long-chain-alcohol o...   269   2e-69   Brachypodium distachyon [annual false brome]
gi|508702481|gb|EOX94377.1| Alcohol oxidase [Theobroma cacao]         269   2e-69   Theobroma cacao [chocolate]
gi|414871097|tpg|DAA49654.1| TPA: hypothetical protein ZEAMMB73_...   269   2e-69   Zea mays [maize]
gi|238011312|gb|ACR36691.1| unknown [Zea mays] >gi|414871095|tpg...   269   3e-69   Zea mays [maize]
gi|226533337|ref|NP_001142399.1| uncharacterized protein LOC1002...   268   3e-69   Zea mays [maize]
gi|297843212|ref|XP_002889487.1| hypothetical protein ARALYDRAFT...   268   3e-69   Arabidopsis lyrata subsp. lyrata
gi|193850549|gb|ACF22878.1| alcohol oxidase [Glycine max]             268   4e-69   Glycine max [soybeans]
gi|242034199|ref|XP_002464494.1| hypothetical protein SORBIDRAFT...   268   5e-69   Sorghum bicolor [broomcorn]
gi|462395894|gb|EMJ01693.1| hypothetical protein PRUPE_ppa018458...   267   7e-69   Prunus persica
gi|356572276|ref|XP_003554295.1| PREDICTED: long-chain-alcohol o...   267   7e-69   Glycine max [soybeans]
gi|406702016|gb|EKD05087.1| hypothetical protein A1Q2_00631 [Tri...   267   8e-69   Trichosporon asahii var. asahii CBS 8904
gi|42561674|ref|NP_171895.2| long-chain-alcohol oxidase FAO1 [Ar...   267   1e-68   Arabidopsis thaliana [mouse-ear cress]
gi|4204315|gb|AAD10696.1| Unknown protein [Arabidopsis thaliana]      266   1e-68   Arabidopsis thaliana [mouse-ear cress]
gi|116204003|ref|XP_001227812.1| hypothetical protein CHGG_09885...   266   1e-68   Chaetomium globosum CBS 148.51
gi|460404091|ref|XP_004247518.1| PREDICTED: long-chain-alcohol o...   266   1e-68   Solanum lycopersicum
gi|297803216|ref|XP_002869492.1| hypothetical protein ARALYDRAFT...   266   2e-68   Arabidopsis lyrata subsp. lyrata
gi|15235348|ref|NP_194586.1| Long-chain-alcohol oxidase FAO4B [A...   265   4e-68   Arabidopsis thaliana [mouse-ear cress]
gi|14532706|gb|AAK64154.1| unknown protein [Arabidopsis thaliana]     265   5e-68   Arabidopsis thaliana [mouse-ear cress]
gi|21554016|gb|AAM63097.1| unknown [Arabidopsis thaliana]             265   5e-68   Arabidopsis thaliana [mouse-ear cress]
gi|401888583|gb|EJT52537.1| hypothetical protein A1Q1_03669 [Tri...   264   6e-68   Trichosporon asahii var. asahii CBS 2479
gi|326507824|dbj|BAJ86655.1| predicted protein [Hordeum vulgare ...   264   6e-68   Hordeum vulgare subsp. vulgare [barley]
gi|482551887|gb|EOA16080.1| hypothetical protein CARUB_v10004212...   264   7e-68   Capsella rubella
gi|470263974|ref|XP_004361070.1| glucose-methanol-choline oxidor...   263   9e-68   Dictyostelium fasciculatum
gi|300680945|sp|B5WWZ9.1|FAO2_LOTJA RecName: Full=Long-chain-alc...   263   2e-67   Lotus japonicus
gi|219124515|ref|XP_002182547.1| predicted protein [Phaeodactylu...   263   2e-67   Phaeodactylum tricornutum CCAP 1055/1
gi|255577920|ref|XP_002529832.1| electron carrier, putative [Ric...   263   2e-67   Ricinus communis
gi|442736185|gb|AGC65582.1| fatty alcohol oxidase [Simmondsia ch...   261   5e-67   Simmondsia chinensis [goatnut]
gi|465794907|emb|CCU99594.1| unnamed protein product [Malassezia...   260   8e-67   Malassezia sympodialis ATCC 42132
gi|125532340|gb|EAY78905.1| hypothetical protein OsI_34008 [Oryz...   260   8e-67   Oryza sativa Indica Group [Indian rice]
gi|110289242|gb|AAP54248.2| GMC oxidoreductase family protein, e...   260   1e-66   Oryza sativa Japonica Group [Japonica rice]
gi|297610644|ref|NP_001064839.2| Os10g0474800 [Oryza sativa Japo...   259   1e-66   
gi|16905154|gb|AAL31024.1|AC078948_8 putative alcohol oxidase [O...   259   2e-66   Oryza sativa Japonica Group [Japonica rice]
gi|357150219|ref|XP_003575383.1| PREDICTED: long-chain-alcohol o...   259   2e-66   Brachypodium distachyon [annual false brome]
gi|302866627|ref|YP_003835264.1| glucose-methanol-choline oxidor...   259   2e-66   
gi|218184733|gb|EEC67160.1| hypothetical protein OsI_34014 [Oryz...   258   3e-66   Oryza sativa Indica Group [Indian rice]
gi|66801723|ref|XP_629786.1| glucose-methanol-choline oxidoreduc...   258   6e-66   Dictyostelium discoideum AX4
gi|315503035|ref|YP_004081922.1| glucose-methanol-choline oxidor...   258   6e-66   
gi|194708646|gb|ACF88407.1| unknown [Zea mays]                        257   7e-66   Zea mays [maize]
gi|359480305|ref|XP_002272123.2| PREDICTED: long-chain-alcohol o...   257   9e-66   Vitis vinifera
gi|284046824|ref|YP_003397164.1| glucose-methanol-choline oxidor...   256   1e-65   
gi|460404552|ref|XP_004247745.1| PREDICTED: long-chain-alcohol o...   255   3e-65   Solanum lycopersicum
gi|440473235|gb|ELQ42050.1| long chain fatty acid oxidase [Magna...   254   4e-65   Magnaporthe oryzae Y34
gi|402086916|gb|EJT81814.1| long chain fatty acid oxidase [Gaeum...   254   5e-65   Gaeumannomyces graminis var. tritici R3-111a-1
gi|336259817|ref|XP_003344707.1| hypothetical protein SMAC_06361...   254   6e-65   Sordaria macrospora k-hell
gi|154282349|ref|XP_001541970.1| conserved hypothetical protein ...   254   8e-65   Histoplasma capsulatum NAm1
gi|471559764|gb|EMR62066.1| putative long chain fatty alcohol ox...   253   2e-64   Eutypa lata UCREL1
gi|414871098|tpg|DAA49655.1| TPA: hypothetical protein ZEAMMB73_...   250   1e-63   Zea mays [maize]
gi|330845424|ref|XP_003294587.1| hypothetical protein DICPUDRAFT...   246   2e-62   Dictyostelium purpureum
gi|475502841|gb|EMT04470.1| Putative GMC-type oxidoreductase [Ae...   243   2e-61   Aegilops tauschii
gi|512187745|gb|EPE03522.1| long chain fatty acid oxidase [Ophio...   242   3e-61   Ophiostoma piceae UAMH 11346
gi|238010082|gb|ACR36076.1| unknown [Zea mays] >gi|414871094|tpg...   240   1e-60   Zea mays [maize]
gi|494732628|ref|WP_007468494.1| oxidoreductase [Segniliparus ru...   239   3e-60   
gi|320591746|gb|EFX04185.1| long-chain fatty alcohol dehydrogena...   238   4e-60   Grosmannia clavigera kw1407
gi|357441101|ref|XP_003590828.1| Annotation was added to scaffol...   236   2e-59   
gi|222612999|gb|EEE51131.1| hypothetical protein OsJ_31875 [Oryz...   231   7e-58   Oryza sativa Japonica Group [Japonica rice]
gi|296140742|ref|YP_003647985.1| glucose-methanol-choline oxidor...   229   2e-57   
gi|296140286|ref|YP_003647529.1| glucose-methanol-choline oxidor...   227   8e-57   
gi|302410647|ref|XP_003003157.1| long chain fatty alcohol oxidas...   223   1e-55   Verticillium alfalfae VaMs.102
gi|15807796|ref|NP_285451.1| GMC oxidoreductase [Deinococcus rad...   221   4e-55   Deinococcus radiodurans R1
gi|222623264|gb|EEE57396.1| hypothetical protein OsJ_07570 [Oryz...   221   6e-55   
gi|357474741|ref|XP_003607656.1| Annotation was added to scaffol...   219   2e-54   
gi|222612998|gb|EEE51130.1| hypothetical protein OsJ_31873 [Oryz...   219   3e-54   
gi|218184732|gb|EEC67159.1| hypothetical protein OsI_34012 [Oryz...   217   1e-53   
gi|498258954|ref|WP_010573110.1| GMC family oxidoreductase [Lept...   212   3e-52   
gi|225561309|gb|EEH09589.1| long chain fatty acid oxidase [Ajell...   209   3e-51   
gi|262194587|ref|YP_003265796.1| glucose-methanol-choline oxidor...   206   2e-50   
gi|498102271|ref|WP_010416427.1| GMC family oxidoreductase [Lept...   203   1e-49   
gi|298714242|emb|CBJ27378.1| oxidoreductase [Ectocarpus siliculo...   201   4e-49   
gi|118618746|ref|YP_907078.1| oxidoreductase GMC-type [Mycobacte...   201   5e-49   
gi|183981617|ref|YP_001849908.1| oxidoreductase GMC-type [Mycoba...   201   6e-49   
gi|443490029|ref|YP_007368176.1| oxidoreductase GMC-type [Mycoba...   201   7e-49   
gi|494844114|ref|WP_007570214.1| glucose-methanol-choline oxidor...   201   7e-49   
gi|296085474|emb|CBI29206.3| unnamed protein product [Vitis vini...   200   1e-48   
gi|255727681|ref|XP_002548766.1| hypothetical protein CTRG_03063...   198   4e-48   
gi|514358869|ref|WP_016550575.1| GMC oxidoreductase [Leptospira ...   198   6e-48   
gi|326483025|gb|EGE07035.1| long chain fatty alcohol oxidase [Tr...   197   8e-48   
gi|449487590|ref|XP_004157702.1| PREDICTED: long-chain-alcohol o...   197   8e-48   
gi|488041306|ref|WP_002112703.1| GMC oxidoreductase [Leptospira ...   193   2e-46   
gi|488107716|ref|WP_002179113.1| GMC oxidoreductase [Leptospira ...   193   2e-46   
gi|488059385|ref|WP_002130782.1| GMC oxidoreductase [Leptospira ...   193   2e-46   
gi|488037294|ref|WP_002108691.1| GMC oxidoreductase [Leptospira ...   193   2e-46   
gi|446431095|ref|WP_000508950.1| GMC family oxidoreductase [Lept...   192   2e-46   
gi|490902229|ref|WP_004764152.1| GMC oxidoreductase [Leptospira ...   192   3e-46   
gi|490901838|ref|WP_004763762.1| GMC oxidoreductase [Leptospira ...   192   3e-46   
gi|498257339|ref|WP_010571495.1| GMC family oxidoreductase [Lept...   192   3e-46   
gi|488021997|ref|WP_002093396.1| GMC oxidoreductase [Leptospira ...   192   3e-46   
gi|446431093|ref|WP_000508948.1| GMC family oxidoreductase [Lept...   192   3e-46   
gi|490584477|ref|WP_004449497.1| GMC oxidoreductase [Leptospira ...   192   4e-46   
gi|490892525|ref|WP_004754478.1| GMC family oxidoreductase [Lept...   192   4e-46   
gi|446431100|ref|WP_000508955.1| GMC family oxidoreductase [Lept...   192   4e-46   
gi|446431089|ref|WP_000508944.1| GMC family oxidoreductase [Lept...   191   5e-46   
gi|488036593|ref|WP_002107990.1| GMC oxidoreductase [Leptospira ...   191   5e-46   
gi|446431097|ref|WP_000508952.1| GMC family oxidoreductase [Lept...   191   5e-46   
gi|490563711|ref|WP_004428749.1| GMC oxidoreductase [Leptospira ...   191   5e-46   
gi|446431101|ref|WP_000508956.1| GMC family oxidoreductase [Lept...   191   6e-46   
gi|446431099|ref|WP_000508954.1| GMC family oxidoreductase [Lept...   191   6e-46   
gi|490587529|ref|WP_004452549.1| GMC oxidoreductase [Leptospira ...   191   6e-46   
gi|446431098|ref|WP_000508953.1| GMC family oxidoreductase [Lept...   191   6e-46   
gi|488081921|ref|WP_002153318.1| GMC family oxidoreductase [Lept...   191   6e-46   
gi|488063939|ref|WP_002135336.1| GMC oxidoreductase [Leptospira ...   191   7e-46   
gi|488027466|ref|WP_002098865.1| GMC oxidoreductase [Leptospira ...   191   7e-46   
gi|446431102|ref|WP_000508957.1| GMC family oxidoreductase [Lept...   191   7e-46   
gi|490574039|ref|WP_004439059.1| GMC oxidoreductase [Leptospira ...   191   8e-46   
gi|24212742|ref|NP_710223.1| glucose-methanol-choline oxidoreduc...   191   8e-46   
gi|514354643|ref|WP_016546363.1| GMC oxidoreductase [Leptospira ...   191   8e-46   
gi|446431088|ref|WP_000508943.1| GMC family oxidoreductase [Lept...   190   1e-45   
gi|446431096|ref|WP_000508951.1| GMC family oxidoreductase [Lept...   190   1e-45   
gi|490592046|ref|WP_004457066.1| GMC oxidoreductase [Leptospira ...   190   1e-45   
gi|296083687|emb|CBI23676.3| unnamed protein product [Vitis vini...   190   1e-45   
gi|490578149|ref|WP_004443169.1| GMC oxidoreductase [Leptospira ...   189   2e-45   
gi|446431090|ref|WP_000508945.1| GMC family oxidoreductase [Lept...   189   2e-45   
gi|463320113|gb|EMJ85927.1| GMC oxidoreductase [Leptospira kirsc...   189   2e-45   
gi|488010122|ref|WP_002081547.1| GMC oxidoreductase [Leptospira ...   189   3e-45   
gi|488009156|ref|WP_002080660.1| GMC oxidoreductase [Leptospira ...   189   3e-45   
gi|463347214|gb|EMK10847.1| GMC oxidoreductase [Leptospira santa...   188   4e-45   
gi|284045337|ref|YP_003395677.1| glucose-methanol-choline oxidor...   188   4e-45   
gi|505584627|ref|WP_015677203.1| GMC oxidoreductase [Leptospira ...   186   2e-44   
gi|463335248|gb|EMJ99965.1| GMC oxidoreductase [Leptospira sp. B...   185   5e-44   
gi|256823447|ref|YP_003147410.1| glucose-methanol-choline oxidor...   184   6e-44   
gi|495867106|ref|WP_008591685.1| GMC family oxidoreductase [Lept...   184   9e-44   
gi|183222756|ref|YP_001840752.1| oxidoreductase [Leptospira bifl...   182   3e-43   
gi|489062659|ref|WP_002972686.1| GMC oxidoreductase [Leptospira ...   181   9e-43   
gi|463322879|gb|EMJ88601.1| GMC oxidoreductase [Leptospira meyer...   177   8e-42   
gi|490924095|ref|WP_004785964.1| GMC family oxidoreductase [Lept...   177   9e-42   
gi|505589663|ref|WP_015682192.1| GMC oxidoreductase [Leptospira ...   176   2e-41   
gi|489070353|ref|WP_002980324.1| GMC oxidoreductase [Leptospira ...   176   2e-41   
gi|34497944|ref|NP_902159.1| glucose-methanol-choline oxidoreduc...   171   8e-40   
gi|494269107|ref|WP_007155604.1| GMC family oxidoreductase [Mari...   169   3e-39   
gi|488071716|ref|WP_002143113.1| GMC oxidoreductase [Leptospira ...   168   5e-39   
gi|490914470|ref|WP_004776378.1| GMC oxidoreductase [Leptospira ...   167   1e-38   
gi|281211535|gb|EFA85697.1| glucose-methanol-choline oxidoreduct...   166   3e-38   
gi|495448798|ref|WP_008173492.1| GMC family oxidoreductase [Mari...   165   3e-38   
gi|383777682|ref|YP_005462248.1| putative oxidoreductase [Actino...   163   2e-37   
gi|385333072|ref|YP_005887023.1| oxidoreductase, GMC family [Mar...   162   3e-37   
gi|496012935|ref|WP_008737514.1| glucose-methanol-choline oxidor...   161   5e-37   
gi|496273158|ref|WP_008985196.1| GMC family oxidoreductase [Alis...   161   8e-37   
gi|501086837|ref|WP_012137112.1| oxidoreductase, GMC family prot...   160   1e-36   
gi|495885066|ref|WP_008609645.1| GMC family oxidoreductase [Alis...   159   2e-36   
gi|473987312|gb|EMS51759.1| Long-chain-alcohol oxidase FAO2 [Tri...   159   3e-36   
gi|496237383|ref|WP_008950768.1| GMC family oxidoreductase [Alis...   158   4e-36   
gi|446431092|ref|WP_000508947.1| GMC family oxidoreductase, part...   157   8e-36   
gi|407693881|ref|YP_006818669.1| GMC oxidoreductase family prote...   157   9e-36   
gi|304312278|ref|YP_003811876.1| glucose-methanol-choline oxidor...   157   1e-35   
gi|120556479|ref|YP_960830.1| glucose-methanol-choline oxidoredu...   157   1e-35   
gi|94312527|ref|YP_585737.1| glucose-methanol-choline oxidoreduc...   157   2e-35   
gi|387815861|ref|YP_005431354.1| GMC family Oxidoreductase [Mari...   155   3e-35   
gi|495918221|ref|WP_008642800.1| glucose-methanol-choline oxidor...   155   5e-35   
gi|496175130|ref|WP_008899637.1| GMC family oxidoreductase [Rhei...   154   9e-35   
gi|473827626|ref|YP_007680909.1| glucose-methanol-choline oxidor...   154   1e-34   
gi|307104686|gb|EFN52938.1| hypothetical protein CHLNCDRAFT_1372...   154   1e-34   
gi|495722340|ref|WP_008446919.1| glucose-methanol-choline oxidor...   152   3e-34   
gi|497517549|ref|WP_009831747.1| GMC family oxidoreductase [Mari...   151   6e-34   
gi|496225646|ref|WP_008939681.1| oxidoreductase, GMC family prot...   151   7e-34   
gi|91790354|ref|YP_551306.1| glucose-methanol-choline oxidoreduc...   150   1e-33   
gi|498130816|ref|WP_010444972.1| GMC family oxidoreductase [Pseu...   150   1e-33   
gi|489559471|ref|WP_003464013.1| GMC family oxidoreductase [Pseu...   150   2e-33   
gi|497234243|ref|WP_009548505.1| GMC family oxidoreductase [Burk...   149   2e-33   
gi|442771043|gb|AGC71741.1| oxidoreductase, GMC family [uncultur...   149   2e-33   
gi|330505425|ref|YP_004382294.1| glucose-methanol-choline oxidor...   149   2e-33   
gi|407696276|ref|YP_006821064.1| GMC oxidoreductase family [Alca...   148   6e-33   
gi|110832946|ref|YP_691805.1| GMC oxidoreductase family protein ...   147   9e-33   
gi|167625503|ref|YP_001675797.1| glucose-methanol-choline oxidor...   147   1e-32   
gi|495640263|ref|WP_008364842.1| GMC family oxidoreductase [Pseu...   147   1e-32   
gi|495761270|ref|WP_008485849.1| GMC family oxidoreductase [Gall...   146   2e-32   
gi|495498531|ref|WP_008223187.1| GMC family oxidoreductase [Rhei...   146   2e-32   
gi|494259042|ref|WP_007151553.1| GMC family oxidoreductase [Alca...   145   3e-32   
gi|489551079|ref|WP_003455703.1| Oxidoreductase [Pseudomonas pse...   145   3e-32   
gi|494259083|ref|WP_007151574.1| glucose-methanol-choline oxidor...   145   5e-32   
gi|148550198|ref|YP_001270300.1| glucose-methanol-choline oxidor...   144   7e-32   
gi|495270728|ref|WP_007995483.1| GMC family oxidoreductase [Pseu...   144   8e-32   
gi|490507832|ref|WP_004373867.1| GMC family oxidoreductase [Pseu...   144   8e-32   
gi|508728741|emb|CCK74226.1| Oxidoreductase, GMC domain protein ...   144   9e-32   
gi|397685409|ref|YP_006522728.1| oxidoreductase [Pseudomonas stu...   144   9e-32   
gi|146309203|ref|YP_001189668.1| glucose-methanol-choline oxidor...   144   9e-32   
gi|496215925|ref|WP_008930167.1| GMC family oxidoreductase [Alca...   144   1e-31   
gi|119776130|ref|YP_928870.1| GMC family oxidoreductase [Shewane...   144   1e-31   
gi|496211567|ref|WP_008928296.1| glucose-methanol-choline oxidor...   144   1e-31   
gi|422293074|gb|EKU20375.1| glucose-methanol-choline oxidoreduct...   144   1e-31   
gi|26991798|ref|NP_747223.1| GMC family oxidoreductase [Pseudomo...   143   2e-31   
gi|495188803|ref|WP_007913593.1| GMC family oxidoreductase [Pseu...   143   2e-31   
gi|498082344|ref|WP_010396500.1| GMC family oxidoreductase [Jant...   143   2e-31   
gi|218889105|ref|YP_002437969.1| putative oxidoreductase [Pseudo...   142   3e-31   
gi|488031571|ref|WP_002102970.1| GMC oxidoreductase [Leptospira ...   142   3e-31   
gi|224103973|ref|XP_002333995.1| predicted protein [Populus tric...   142   3e-31   
gi|157963317|ref|YP_001503351.1| glucose-methanol-choline oxidor...   142   3e-31   
gi|124265543|ref|YP_001019547.1| GMC family oxidoreductase [Meth...   142   3e-31   
gi|489213000|ref|WP_003121744.1| GMC family oxidoreductase [Pseu...   142   3e-31   
gi|229593160|ref|YP_002875279.1| putative oxidoreductase [Pseudo...   142   3e-31   
gi|497369144|ref|WP_009683357.1| GMC family oxidoreductase [Pseu...   142   3e-31   
gi|494334289|ref|WP_007184266.1| GMC family oxidoreductase [Hydr...   142   4e-31   
gi|495363682|ref|WP_008088400.1| GMC family oxidoreductase [Pseu...   142   4e-31   
gi|495239395|ref|WP_007964159.1| GMC family oxidoreductase [Pseu...   142   4e-31   
gi|386014392|ref|YP_005932669.1| glucose-methanol-choline oxidor...   142   4e-31   
gi|478476568|ref|YP_007707219.1| oxidoreductase [Pseudomonas aer...   142   4e-31   
gi|489201215|ref|WP_003110407.1| GMC family oxidoreductase [Pseu...   141   6e-31   
gi|505462844|ref|WP_015649772.1| oxidoreductase [Pseudomonas aer...   141   6e-31   
gi|493151532|ref|WP_006162560.1| GMC family oxidoreductase [Cupr...   141   7e-31   
gi|15595561|ref|NP_249055.1| oxidoreductase [Pseudomonas aerugin...   141   7e-31   
gi|495340330|ref|WP_008065064.1| GMC family oxidoreductase [Pseu...   141   7e-31   
gi|489341896|ref|WP_003249067.1| GMC family oxidoreductase [Pseu...   141   7e-31   
gi|386068728|ref|YP_005984032.1| oxidoreductase [Pseudomonas aer...   141   7e-31   
gi|496211569|ref|WP_008928298.1| GMC oxidoreductase [Alcanivorax...   141   8e-31   
gi|397697420|ref|YP_006535303.1| glucose-methanol-choline oxidor...   141   8e-31   
gi|392419338|ref|YP_006455942.1| oxidoreductase [Pseudomonas stu...   141   9e-31   
gi|495250613|ref|WP_007975369.1| GMC family oxidoreductase [Pseu...   140   1e-30   
gi|386056431|ref|YP_005972953.1| putative oxidoreductase [Pseudo...   140   1e-30   
gi|426412041|ref|YP_007032140.1| glucose-methanol-choline oxidor...   140   1e-30   
gi|89899359|ref|YP_521830.1| glucose-methanol-choline oxidoreduc...   140   1e-30   
gi|489376049|ref|WP_003282784.1| GMC family oxidoreductase [Pseu...   140   1e-30   
gi|495214544|ref|WP_007939323.1| GMC family oxidoreductase [Pseu...   140   1e-30   
gi|431804945|ref|YP_007231848.1| glucose-methanol-choline oxidor...   140   1e-30   
gi|490712637|ref|WP_004575472.1| glucose-methanol-choline oxidor...   140   1e-30   
gi|490554659|ref|WP_004419752.1| GMC family oxidoreductase [Pseu...   140   1e-30   
gi|472323503|ref|YP_007655749.1| putative oxidoreductase [Pseudo...   140   1e-30   
gi|495425874|ref|WP_008150571.1| GMC family oxidoreductase [Pseu...   140   1e-30   
gi|339489846|ref|YP_004704374.1| glucose-methanol-choline oxidor...   140   2e-30   
gi|77461568|ref|YP_351075.1| glucose-methanol-choline oxidoreduc...   140   2e-30   
gi|490481768|ref|WP_004352080.1| GMC family oxidoreductase [Pseu...   140   2e-30   
gi|489396707|ref|WP_003303198.1| oxidoreductase [Pseudomonas stu...   140   2e-30   
gi|512615911|ref|YP_008100595.1| putative oxidoreductase [Pseudo...   140   2e-30   
gi|489379600|ref|WP_003286303.1| GMC family oxidoreductase [Pseu...   140   2e-30   
gi|510312014|gb|EPA97124.1| choline dehydrogenase-like flavoprot...   140   2e-30   
gi|511825027|ref|WP_016403841.1| oxidoreductase [Agarivorans alb...   139   2e-30   
gi|496883433|ref|WP_009396758.1| glucose-methanol-choline oxidor...   139   3e-30   
gi|212555121|gb|ACJ27575.1| Oxidoreductase, GMC family [Shewanel...   139   3e-30   
gi|495843966|ref|WP_008568545.1| GMC family oxidoreductase [Pseu...   139   3e-30   
gi|495228642|ref|WP_007953413.1| GMC family oxidoreductase [Pseu...   139   3e-30   
gi|495267877|ref|WP_007992632.1| GMC family oxidoreductase [Pseu...   139   4e-30   
gi|442322986|ref|YP_007363007.1| hypothetical protein MYSTI_0605...   139   4e-30   
gi|110834035|ref|YP_692894.1| GMC oxidoreductase family protein ...   139   4e-30   
gi|152989402|ref|YP_001345853.1| putative oxidoreductase [Pseudo...   139   4e-30   
gi|91794532|ref|YP_564183.1| glucose-methanol-choline oxidoreduc...   139   4e-30   
gi|495295239|ref|WP_008019992.1| GMC family oxidoreductase [Pseu...   138   4e-30   
gi|489321836|ref|WP_003229156.1| GMC family oxidoreductase [Pseu...   138   5e-30   
gi|495173065|ref|WP_007897860.1| GMC family oxidoreductase [Pseu...   138   5e-30   
gi|494255148|ref|WP_007149416.1| GMC oxidoreductase [Alcanivorax...   138   5e-30   
gi|496012937|ref|WP_008737516.1| GMC oxidoreductase [Alcanivorax...   138   5e-30   
gi|386022724|ref|YP_005940749.1| oxidoreductase [Pseudomonas stu...   138   6e-30   
gi|494076011|ref|WP_007018066.1| GMC family oxidoreductase [Berm...   138   6e-30   
gi|127511525|ref|YP_001092722.1| glucose-methanol-choline oxidor...   138   6e-30   
gi|495343342|ref|WP_008068073.1| GMC family oxidoreductase [Pseu...   138   6e-30   
gi|146284313|ref|YP_001174466.1| oxidoreductase [Pseudomonas stu...   138   6e-30   
gi|257093815|ref|YP_003167456.1| glucose-methanol-choline oxidor...   138   7e-30   
gi|489390600|ref|WP_003297160.1| oxidoreductase [Pseudomonas stu...   138   7e-30   
gi|497893110|ref|WP_010207266.1| GMC family oxidoreductase [Pseu...   137   9e-30   
gi|494850149|ref|WP_007576249.1| putative oxidoreductase GMC [Pa...   137   9e-30   
gi|217972070|ref|YP_002356821.1| glucose-methanol-choline oxidor...   137   1e-29   
gi|495220754|ref|WP_007945529.1| GMC family oxidoreductase [Pseu...   137   1e-29   
gi|495371088|ref|WP_008095801.1| GMC family oxidoreductase [Pseu...   137   1e-29   
gi|70733152|ref|YP_262925.1| GMC family oxidoreductase [Pseudomo...   137   1e-29   
gi|496014537|ref|WP_008739116.1| GMC family oxidoreductase [Alca...   137   2e-29   
gi|113969082|ref|YP_732875.1| glucose-methanol-choline oxidoredu...   137   2e-29   
gi|495316039|ref|WP_008040786.1| GMC family oxidoreductase [Pseu...   136   2e-29   
gi|489327355|ref|WP_003234648.1| oxidoreductase, GMC family prot...   136   2e-29   
gi|226941220|ref|YP_002796294.1| glucose-methanol-choline oxidor...   136   3e-29   
gi|126175679|ref|YP_001051828.1| glucose-methanol-choline oxidor...   135   3e-29   
gi|501683227|ref|YP_008003053.1| GMC-type oxidoreductase y4nJ [P...   135   3e-29   
gi|152999393|ref|YP_001365074.1| glucose-methanol-choline oxidor...   135   3e-29   
gi|167036161|ref|YP_001671392.1| glucose-methanol-choline oxidor...   135   3e-29   
gi|495301378|ref|WP_008026128.1| GMC family oxidoreductase [Pseu...   135   3e-29   
gi|386436435|gb|AFJ11847.1| glucose-methanol-choline oxidoreduct...   135   3e-29   
gi|157376995|ref|YP_001475595.1| glucose-methanol-choline oxidor...   135   4e-29   
gi|497908022|ref|WP_010222178.1| GMC family oxidoreductase [Pseu...   135   4e-29   
gi|447918864|ref|YP_007399432.1| oxidoreductase, GMC family prot...   135   4e-29   
gi|431925452|ref|YP_007238486.1| choline dehydrogenase-like flav...   135   4e-29   
gi|495323571|ref|WP_008048317.1| GMC family oxidoreductase [Pseu...   135   4e-29   
gi|491915883|ref|WP_005669484.1| hypothetical protein [Massilia ...   135   5e-29   
gi|512688243|ref|YP_008116223.1| putative oxidoreductase [Pseudo...   135   5e-29   
gi|339496038|ref|YP_004716331.1| oxidoreductase [Pseudomonas stu...   135   5e-29   
gi|386323352|ref|YP_006019469.1| glucose-methanol-choline oxidor...   135   6e-29   
gi|160874013|ref|YP_001553329.1| glucose-methanol-choline oxidor...   135   6e-29   
gi|117921833|ref|YP_871025.1| glucose-methanol-choline oxidoredu...   134   7e-29   
gi|511760133|ref|WP_016393342.1| glucose-methanol-choline oxidor...   134   7e-29   
gi|489287567|ref|WP_003195134.1| GMC family oxidoreductase [Pseu...   134   7e-29   
gi|24372471|ref|NP_716513.1| oxidoreductase GMC family [Shewanel...   134   1e-28   
gi|387896178|ref|YP_006326475.1| oxidoreductase, GMC family [Pse...   134   1e-28   
gi|308051101|ref|YP_003914667.1| glucose-methanol-choline oxidor...   134   1e-28   
gi|121603348|ref|YP_980677.1| glucose-methanol-choline oxidoredu...   134   1e-28   
gi|492258886|ref|WP_005792297.1| GMC family oxidoreductase [Pseu...   133   2e-28   
gi|498175325|ref|WP_010489481.1| GMC family oxidoreductase [Pseu...   133   2e-28   


>gi|358055114|dbj|GAA98883.1| hypothetical protein E5Q_05571 [Mixia osmundae IAM 14324]
          Length = 753

 Score =  444 bits (1143), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 241/608 (39%), Positives = 354/608 (58%), Gaps = 33/608 (5%)

Query: 15  FHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPV-IGYP-GADP- 71
           F +L+Q  RE     W  S    +RK Y +FT L     + N ++   V IGYP   DP 
Sbjct: 131 FCDLSQADRETVIRGWGNSPIFLLRKAYAAFTALTLFVVY-NAFDTASVGIGYPFNGDPM 189

Query: 72  -EANGSRFSSRNFPKYNFLEISDHDSDIKEFDTXXXXXXXXXXXXXXRLARME---NVLV 127
            ++   R   +++P + F +IS    D + FDT                   +    V+V
Sbjct: 190 RQSTDERIQ-KSYP-FKFEQIS---KDYQTFDTEILIIGSGAGGGVVSATLSKAGLQVMV 244

Query: 128 IEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQ 187
           +EKG       ++    DGY  LYE  G M+TDD +M +LAGS FGGGTT+ WSA ++PQ
Sbjct: 245 VEKGVFVPTESMNGRALDGYRNLYEAEGIMVTDDGSMNILAGSTFGGGTTVNWSASLKPQ 304

Query: 188 YFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSD 247
           ++VRE WA+ +GL YF+ +E+  ++ ++  R+G +T  I HN +NQ LI+G KK+G H D
Sbjct: 305 HYVREAWARKYGLTYFVSNEFQQSLDFVCERMGVDTKQIKHNAANQKLIDGAKKVGYHVD 364

Query: 248 NIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGK- 306
            IPQNT    H CG+C FGC YGEKQ  T TWL +A  N AKF++   VE+IL    G  
Sbjct: 365 EIPQNTGGKEHSCGFCGFGCPYGEKQGGTATWLRDAAENGAKFMQGASVERILFCPPGAL 424

Query: 307 ----------------SQKVMGVEVIINNIKRVKIHA-KRVVVSAGAIHSPALLLRSGLK 349
                           + + +G  +   + +   + A K VVVS G+++SP +L +SGL 
Sbjct: 425 MLPDAQNYKAFFYNKTNTRAVGALLKFKDGRHAIVRAHKSVVVSGGSLNSPVILQKSGLT 484

Query: 350 NKNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKI-VVGSHHP 408
           N+NIGR LH+HP   V G + +++I+ Y+G IM+ +SN  ENVDGE++GAKI ++ S   
Sbjct: 485 NRNIGRGLHLHPCGFVTGYY-DEKIEPYNGAIMTTVSNVVENVDGEHFGAKIEIIASSAG 543

Query: 409 GFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSK 468
            +  A   W  + +HK+  LEY N V +++++RDR+GGR+ TD  GK R++Y +S HD+K
Sbjct: 544 TYGAAVVGWNGSKEHKRNALEYPNSVCMIILSRDRDGGRVYTDAEGKCRVDYTISPHDAK 603

Query: 469 SMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTY 528
           SM AG+  AV++  AAGA +I T Q ++ D+IV+N    LNDP F ++  +++K G+   
Sbjct: 604 SMHAGIKAAVQMQLAAGARRISTSQRLVPDFIVKNTPASLNDPDFVEWFAQVEKAGVKPS 663

Query: 529 QTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIA 588
            +  G+  QM S  MG  P   AV+P G  W  + LYVAD+SV   A+GV  M+TTM ++
Sbjct: 664 WSSIGSAHQMGSNPMGTKPTNGAVDPRGRPWSTQGLYVADASVFREASGVNPMVTTMGVS 723

Query: 589 HYISKCIL 596
           H I+K I+
Sbjct: 724 HSIAKFII 731



>gi|472586292|gb|EMS23820.1| long chain fatty alcohol oxidase [Rhodosporidium toruloides NP11]
          Length = 712

 Score =  439 bits (1130), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 239/611 (39%), Positives = 345/611 (56%), Gaps = 39/611 (6%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNP----VIGYPGA 69
           PF +LT +QRE    KW  S    +R+ ++    L         YN        IGYP +
Sbjct: 96  PFPDLTVQQRELVLQKWRVSSLPLLRQAFRGLVSLAL----FVAYNLYDEVLFAIGYPAS 151

Query: 70  DPE---ANGSRFSSRNFPKYNFLEISDHDSDIKEFDTXXXXXXXXXXXXXXRLARME--- 123
             E   A+  R   ++FP Y F +I   +   + FDT                   +   
Sbjct: 152 GDEKRFADPDRLR-KHFP-YTFEKI---EVPYQVFDTDMLVVGSGAGGGVVASELSKKGW 206

Query: 124 NVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAF 183
           NV V+EKG +    D++  Q+DG+ +LYE  G M T+D +M VLAGS FGGGT + WSA 
Sbjct: 207 NVFVVEKGQYVKPEDMAGTQRDGFKRLYESEGLMATEDGSMNVLAGSTFGGGTVVNWSAS 266

Query: 184 MEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLG 243
           + PQ+F+RE+WAK  GLPYF+  EY  +++Y+  R+G +  ++ HN++NQ L+ G KKLG
Sbjct: 267 LRPQHFLREQWAKEHGLPYFLSTEYAKSIEYVCDRMGVSDEHLEHNRANQLLVEGSKKLG 326

Query: 244 LHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKIL--- 300
                IPQNT    H CG+C FGC Y EKQS T+TWL +A  + AKF+    VE++L   
Sbjct: 327 YPISKIPQNTGGHAHACGYCGFGCTYSEKQSGTVTWLRDAAEHGAKFMTETSVERLLFAA 386

Query: 301 -----------IDK---DGKSQKVMGVEVIINNIKRVKIHAKR-VVVSAGAIHSPALLLR 345
                      +DK       +  +G  V   N     I AK+  +VSAG IHSPA+L+R
Sbjct: 387 SPSSALPTPETLDKYTPSSSRRHCIGALVKDKNGNLAVIRAKQSTIVSAGTIHSPAVLMR 446

Query: 346 SGLKNKNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGS 405
           SGLKN  IGRNL +HP+    G++ ++ I+ + G IM+A++   EN DG ++G KI V  
Sbjct: 447 SGLKNPRIGRNLRLHPVVFTTGLY-DEHIRPWEGAIMTAVTGVQENWDGSHHGVKIEVIQ 505

Query: 406 HHPGFMFANF-PWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQ 464
             PG   A F  W S+ +HK+ M +Y N++ L+ I RDR  GR+  D  GKPR++Y ++ 
Sbjct: 506 SFPGGQAAGFIGWTSSKEHKKTMAQYGNLLTLISIARDRGSGRVFLDSEGKPRMDYTVNS 565

Query: 465 HDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVG 524
           +DS S+V G + A  I    GA +I T Q  ++DY+   G   L DPK+ +++ KI+K G
Sbjct: 566 YDSNSLVRGTIAAAEIHLVNGAKRITTAQVDVEDYVPAPGHQYLADPKWKEWVAKIEKAG 625

Query: 525 IPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTT 584
           +   +   G+  QM SC+MG  P+ S V+P G  W  + LYVAD+SV PTA+GV  M+T 
Sbjct: 626 VYPGRCAIGSAHQMGSCQMGAKPSTSVVDPRGRVWGTDGLYVADASVFPTASGVNPMITN 685

Query: 585 MNIAHYISKCI 595
           M+++H I++ I
Sbjct: 686 MSLSHSIARFI 696



>gi|342321180|gb|EGU13115.1| Long chain fatty alcohol oxidase [Rhodotorula glutinis ATCC 204091]
          Length = 721

 Score =  436 bits (1121), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 238/608 (39%), Positives = 345/608 (56%), Gaps = 33/608 (5%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYN-FNPVIGYPGADPE 72
           PF +LT +QRE    KW  S    +R+ ++    L     + N Y+     IGYP +  E
Sbjct: 105 PFPDLTVQQRELVLQKWRVSSLPLLRQAFRGLVSLALFVAY-NLYDEVLFAIGYPASGDE 163

Query: 73  ---ANGSRFSSRNFPKYNFLEISDHDSDIKEFDTXXXXXXXXXXXXXXRLARME---NVL 126
              A+  R   ++FP Y F +I   +   + FDT                   +   NV 
Sbjct: 164 KRFADPERLR-KHFP-YTFEKI---EVSYQVFDTDMLVVGSGAGGGVVASELSKKGWNVF 218

Query: 127 VIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEP 186
           V+EKG +    D++  Q+DG+ +LYE  G M T+D +M VLAGS FGGGT + WSA + P
Sbjct: 219 VVEKGQYVKPEDMAGTQRDGFKRLYESEGLMATEDGSMNVLAGSTFGGGTVVNWSASLRP 278

Query: 187 QYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHS 246
           Q+F+RE+WAK   LPYF+  EY  +++Y+  R+G +  ++ HN++NQ L+ G KKLG   
Sbjct: 279 QHFLREQWAKEHSLPYFLSTEYAKSIEYVCDRMGVSDEHLEHNRANQLLVEGSKKLGYPI 338

Query: 247 DNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKIL------ 300
             IPQNT    H CG+C FGC Y EKQS T+TWL +A  + AKF+    VE++L      
Sbjct: 339 SKIPQNTGGHAHACGYCGFGCTYSEKQSGTVTWLRDAAEHGAKFMTETSVERLLFAASPS 398

Query: 301 --------IDK---DGKSQKVMGVEVIINNIKRVKIHAKR-VVVSAGAIHSPALLLRSGL 348
                   +DK       +  +G  V   N     I AK+  +VSAG IHSPA+L+RSGL
Sbjct: 399 SPLPTPETLDKYTPSSSRRHCIGALVKDKNGNLAVIRAKQSTIVSAGTIHSPAVLMRSGL 458

Query: 349 KNKNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHP 408
           KN  IGRNL +HP+    G++ ++ I+ + G IM+A++   EN DG ++G KI V    P
Sbjct: 459 KNPRIGRNLRLHPVVFTTGLY-DEHIRPWEGAIMTAVTGVQENWDGSHHGVKIEVIQSFP 517

Query: 409 GFMFANF-PWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDS 467
           G   A F  W S+ +HK+ M +Y N++ L+ I RDR  GR+  D  GKPR++Y ++ +D 
Sbjct: 518 GGQAAGFIGWTSSKEHKKTMAQYGNLLTLISIARDRGSGRVFLDSEGKPRMDYTVNSYDG 577

Query: 468 KSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPT 527
            S+V G + A  I    GA +I T Q  ++DYI   G   L DPK+ +++ KI+K G+  
Sbjct: 578 NSLVRGTIAAAEIHLVNGAKRITTAQVDVEDYIPAPGHQYLADPKWKEWVAKIEKAGVYP 637

Query: 528 YQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNI 587
            +   G+  QM SC+MG  P+ S V+P G  W  + LYVAD+SV PTA+GV  M+T M++
Sbjct: 638 GRCAIGSAHQMGSCQMGAKPSTSVVDPRGRVWGTDGLYVADASVFPTASGVNPMITNMSL 697

Query: 588 AHYISKCI 595
           +H I++ I
Sbjct: 698 SHSIARFI 705



>gi|511005485|gb|EPB86823.1| hypothetical protein HMPREF1544_06348 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 694

 Score =  412 bits (1058), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 224/588 (38%), Positives = 341/588 (57%), Gaps = 15/588 (2%)

Query: 15  FHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLIC-ATFWLNPYNFNPVIGYPGADPEA 73
           F  L+   RE  FI W  S    +R +YK+F  L C   +  +  +    + Y     + 
Sbjct: 112 FKNLSLADREAIFINWKNSFLPQLRLLYKTFHSLSCHPAYAAHTKDLGIAMHYNDLIKDQ 171

Query: 74  NGSRFSSRNFPKYNFLEISDHDSDIKEFDTXXXXXXXXXXXXXXRLARM-ENVLVIEKGH 132
                   N P    +   +   D  EFD               +LA+  ++VLV+EKG 
Sbjct: 172 K-----YENIPDRLDMLKPEQVQDNMEFDVVIIGSGAGGGVVASQLAKAGKSVLVVEKGA 226

Query: 133 HYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVRE 192
           ++ + +   ++  G++ LYE  G   + + ++ +LAGS FGGGTT+ W A ++ Q+FVRE
Sbjct: 227 YHHEDEFIVDESKGFENLYEYGGFAPSYEGSISMLAGSVFGGGTTVNWCASLKLQHFVRE 286

Query: 193 EWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQN 252
           EWAK  GL +F+  ++ N +  +  R+G  T  I+HN+SNQ LI+GCK LG    +IPQN
Sbjct: 287 EWAKQ-GLTHFLSPKFANDLDRVFERIGATTDGIVHNKSNQVLIDGCKALGYPVADIPQN 345

Query: 253 TASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQKVMG 312
           T    H+C +C  GC+ G K  +  TWL +A  +NAKFL    V K+ I K+GK+    G
Sbjct: 346 TGGRAHECEFCYTGCRAGIKNGSMNTWLRDANQHNAKFLVKTKVNKV-ITKNGKA---AG 401

Query: 313 VEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYGVFPNK 372
           VE ++N  ++V I A +VVVSAG++ SP +L+RSGLKNKNIGRNL +HP +  +G F ++
Sbjct: 402 VECVVNYDRKVNIKANQVVVSAGSLQSPGVLIRSGLKNKNIGRNLRLHPCSITFGFF-DR 460

Query: 373 EIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQLMLEYNN 432
           EI+T+ G+IM+A+S   E+VD + YGAK+ V   HPG      PW+    HK+LM+ Y+ 
Sbjct: 461 EIRTFQGSIMTAVSGVAESVDNDGYGAKLEVPCLHPGSFSTVLPWRGAAAHKELMMRYDR 520

Query: 433 IVPLMVITRDREG-GRILTDENGKPRLEYKLSQHDSKSMVAGLLTAVRILAAAGATKIGT 491
             P+++++RD++  G +  D+     +++ LS  D KS++AG+  ++ IL AAGA ++ T
Sbjct: 521 CAPILILSRDKDSTGVVRYDDKDNAIVDFNLSSRDRKSLLAGIDRSLNILVAAGAREVHT 580

Query: 492 CQTVIDDYIVENGVNP-LNDPKFDQFLNKIKKVGIPTYQTCTGTIEQMSSCRMGDDPNKS 550
            Q  +D +I ++     +++P+F  +  ++ K G P          QM S RMG     S
Sbjct: 581 GQFGVDPFIFKDSEESRVDNPRFVAWKQEVIKYGFPQEGAGVFCAHQMGSNRMGISSKTS 640

Query: 551 AVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKCILDK 598
            V P GE WEV++LYVAD+SV PTA+GV  M+TT  IA +I+ CIL+K
Sbjct: 641 VVKPTGETWEVKDLYVADASVFPTASGVNPMVTTEAIALHIADCILNK 688



>gi|328854653|gb|EGG03784.1| hypothetical protein MELLADRAFT_78490 [Melampsora larici-populina
           98AG31]
          Length = 728

 Score =  379 bits (972), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 214/605 (35%), Positives = 338/605 (55%), Gaps = 29/605 (4%)

Query: 15  FHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYP-GADPEA 73
           F+ LT ++R+   + +S S  A  R I+    +   +  + +  +    IGYP   DP+ 
Sbjct: 114 FNNLTFQERQSILVNFSKSSLAIKRHIFSGLVLFPLSQSYHSSKHLIQSIGYPLNGDPKL 173

Query: 74  NGSRFSSRNFPKYNFLEISDHDSDIKEFDTXXXXXXXXXXXXXXRLARM-ENVLVIEKGH 132
                 ++   ++ FL +      I E D                L++   NVLV+EKG 
Sbjct: 174 LSQPNRAQKSYQFEFLNVQHGFHSILETDVLIIGSGAAGSVVASILSKSNHNVLVVEKGS 233

Query: 133 HYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVRE 192
           +Y     S +Q     K++E +G + T D  M VLA S FGGGTT+ WSA ++  Y +R+
Sbjct: 234 YYPTEQSSIKQGR---KMFEGNGMITTSDGKMNVLAASTFGGGTTVNWSASIQTPYHIRQ 290

Query: 193 EWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQN 252
            W+  +GLPYF  + + + +  +  RLG +   I H++SNQ  + GC+ LG+H D+IPQN
Sbjct: 291 AWSTQYGLPYFSTEGFTSDLNAVTHRLGVSNQFIQHSRSNQLFMKGCRDLGIHVDSIPQN 350

Query: 253 TASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGK------ 306
           TA  TH CG C +GC +GEKQ AT TWL +      KF+K   VEKIL     +      
Sbjct: 351 TAGHTHDCGMCGWGCPFGEKQGATRTWLKDCAQAGGKFMKEAVVEKILFGNKPEDLINSP 410

Query: 307 ------------SQKVMGVEVIINNIKR-VKIHAKRVVV-SAGAIHSPALLLRSGLKNKN 352
                         + +G  V + N    + I A++ VV S G+I++PA+LLRSGL    
Sbjct: 411 DYLQNHSSPSSSRSRAIGALVRVKNRSEPILIRARKAVVCSGGSINTPAVLLRSGLDGGG 470

Query: 353 -IGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPG-F 410
            +G  LH+HP + V G F ++EI+ + G+IM++IS   EN++G ++G+K+ V   +PG F
Sbjct: 471 TVGVGLHLHPCSFVTGFF-DEEIRPWEGSIMTSISCEVENLNGTHFGSKVEVMFSNPGQF 529

Query: 411 MFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSM 470
                 W+S+  HKQ M+EY N   L++I RDR+ GRI  +  G+P ++Y LS+ D +S+
Sbjct: 530 AGIGAKWRSSESHKQDMMEYKNSFTLVIICRDRDQGRITINPKGEPVIDYGLSKFDGQSL 589

Query: 471 VAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQT 530
           +AG++    ++   GA +I T Q  ++ +I +N    LN+  F +++ +++  GI +   
Sbjct: 590 LAGVIKGCEVMNRIGAKRINTPQFSVEPFI-KNENKELNEEHFQRWIEEVQCAGISSGCG 648

Query: 531 CTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHY 590
             GT  QM SC MG++P  S ++  G+ W +++LY+AD+SVLPT+TGV   +TTM +A++
Sbjct: 649 PIGTAHQMGSCPMGNNPTTSVIDENGKVWGMKSLYIADASVLPTSTGVNPAITTMGVAYH 708

Query: 591 ISKCI 595
           I KCI
Sbjct: 709 IGKCI 713



>gi|331231798|ref|XP_003328562.1| hypothetical protein PGTG_10521 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309307552|gb|EFP84143.1| hypothetical protein PGTG_10521 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 761

 Score =  369 bits (948), Expect = 1e-99,   Method: Compositional matrix adjust.
 Identities = 216/614 (35%), Positives = 326/614 (53%), Gaps = 40/614 (6%)

Query: 15  FHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADPEAN 74
           F E+   +R      W++S +A  R ++ +F  L  +  + N      +IG+P +D +  
Sbjct: 128 FLEIPVDERARILAGWASSTFALKRSLFSAFVRLPISAIYSNSRLVQALIGFP-SDGDPR 186

Query: 75  GSRFSSRNFPKYNFLEISD---------HDS---DIKEFDTXXXXXXXXXXXXXXRLARM 122
            S    R  P Y +  I           H S   ++ E D                +A+ 
Sbjct: 187 ASSLPERRKPSYPYQFIQPPLLLDSNLPHPSARLELFETDVIVVGSGAGASVVASLVAKA 246

Query: 123 E-NVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWS 181
               LVIEKG  +   +  T    G++ + E +G + T D N+ +L GS FGGGTT+ WS
Sbjct: 247 GYQTLVIEKGR-WVPTEQITGSHHGFNDMLEGNGQISTSDGNLILLLGSTFGGGTTVNWS 305

Query: 182 AFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKK 241
           A + P + VR  W +  GL YF  D +   ++ +  R+G +T  I+H+++NQ  + G + 
Sbjct: 306 ASLAPPFHVRRAWTEEHGLTYFGTDGFAEDIQAVCTRMGVSTSAIVHSKANQLFLKGART 365

Query: 242 LGLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILI 301
           LG+H D IPQNTA   H CG C  GC +GEKQ A  TWL +      KF++   VE+IL 
Sbjct: 366 LGIHVDLIPQNTAGRAHDCGMCQRGCPFGEKQGAAQTWLKDCAEAGGKFMERGKVERILF 425

Query: 302 DKDG--------------KSQKVMGVEVII---NNIKRVKIHAKRVVV-SAGAIHSPALL 343
            ++                S++   V VI+    + KR  I A+R VV  +GAI++PALL
Sbjct: 426 SEEANPGEIEIDLKRSTPSSRRRHAVGVIVYDSRSGKRAVIRARRAVVCGSGAINTPALL 485

Query: 344 LRSGLK-NKNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIV 402
           LRSGL+ N  +G  LH+HP+ AV G F +  +K + G+IM+ IS   EN +G +YG K+ 
Sbjct: 486 LRSGLRLNGAVGNGLHLHPVTAVTGWF-DAPVKPWEGSIMTLISCELENREGTHYGCKLE 544

Query: 403 VGSHHPGFMFANF-PWKSNLQHKQLMLEYNNIVPLMVITRDREGGRI-LTDENGKPRLEY 460
           V + +PGF    F PW+S+  HK  M  Y     ++V++RDR  GR+ L    G+P ++Y
Sbjct: 545 VFASNPGFYAGLFVPWRSSGAHKAYMSRYAESFTIVVLSRDRGAGRVSLEPGTGEPVIDY 604

Query: 461 KLSQHDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLND--PKFDQFLN 518
            L   D++S++ G+L A R L AAGAT+I T    +  ++         D   +F+++L 
Sbjct: 605 PLDPFDAESLLEGILVACRTLLAAGATEIATTLPNVQHFLAPPSATTGLDLHHRFEEWLA 664

Query: 519 KIKKVGIPTYQTCTGTIEQMSSCRMGDDPNK-SAVNPVGEAWEVENLYVADSSVLPTATG 577
           +I  +G+       G+  QMSSC+MG  P+K S VN  G+ W  E L+VAD SVLPTATG
Sbjct: 665 EISAIGVKPGYGVLGSAHQMSSCKMGSKPSKDSVVNEKGKVWGHEKLWVADGSVLPTATG 724

Query: 578 VPSMMTTMNIAHYI 591
           V   ++ M++AH+I
Sbjct: 725 VNPSISIMSVAHHI 738



>gi|384493075|gb|EIE83566.1| hypothetical protein RO3G_08271 [Rhizopus delemar RA 99-880]
          Length = 667

 Score =  359 bits (921), Expect = 2e-96,   Method: Compositional matrix adjust.
 Identities = 206/591 (34%), Positives = 317/591 (53%), Gaps = 55/591 (9%)

Query: 15  FHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADPEAN 74
           F  L+  +RE   + W  S     R +YK+F  L C   + +            +D  A 
Sbjct: 115 FKNLSWAEREKIILNWKDSYLPKFRGVYKTFQALACHPAYRS-----------HSDVFAK 163

Query: 75  GSRFSSR------NFPKYNFLEISDHDSDIKEFDTXXXXXXXXXXXXXXRLARM-ENVLV 127
           G  +  +      +FP+   +   D   D   FD               +LA+  ++VLV
Sbjct: 164 GMHYDLKKEDGYVSFPERLPMMKLDEVQDDMHFDAIVVGSGAGGGVVASQLAQAGKSVLV 223

Query: 128 IEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQ 187
           IEKG +Y + +    + DG+  LYE  G   T   ++ +L GS FGGGTT          
Sbjct: 224 IEKGKYYSEEEFINNELDGFTNLYEQGGFSPTLSGSVSILTGSVFGGGTT---------- 273

Query: 188 YFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSD 247
                          F ED     +  +  R+G  T  I HN  NQ L++GCK LG    
Sbjct: 274 ---------------FTED-----LDKVFERIGATTSGIKHNGPNQVLVDGCKVLGYPVA 313

Query: 248 NIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKS 307
           ++PQNT    H+C +C  GC+ G K  +  +WL +A  ++AKFL    V+++L++ DGK+
Sbjct: 314 DVPQNTGGKAHECHFCFCGCRAGVKNGSMNSWLRDAYDHHAKFLDKTKVKRVLME-DGKA 372

Query: 308 QKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYG 367
              +G+E +++  K V+I A +V++S G   SP +LLRSGLKNKNIGRNLHVHP+AA +G
Sbjct: 373 ---VGIECLVHYEKTVRIKADQVIISGGTFQSPGVLLRSGLKNKNIGRNLHVHPVAAAFG 429

Query: 368 VFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQLM 427
            F +++I+ + G+IM+AIS+  EN + + YGAKI V S HPG      PW+    HK+ M
Sbjct: 430 YF-DRKIRPFEGSIMTAISSVVENTENDGYGAKIYVPSLHPGAFSTVVPWRGAAAHKEAM 488

Query: 428 LEYNNIVPLMVITRDREG-GRILTDENGKPRLEYKLSQHDSKSMVAGLLTAVRILAAAGA 486
           L Y+   P+++I RD++  G +  D++    ++Y LS  D +S+  G++ ++ IL AAGA
Sbjct: 489 LRYDQCAPVIIIARDKDSQGSVTYDKDENVIVDYTLSNRDRRSLHEGIVRSIDILVAAGA 548

Query: 487 TKIGTCQTVIDDYIVENGVNP-LNDPKFDQFLNKIKKVGIPTYQTCTGTIEQMSSCRMGD 545
            ++ T Q  ++ +  E      +++P++  + + + K G P   +   +  QM + RMG 
Sbjct: 549 REVQTSQFGVEPFKFETSEESRIDNPRYIAWKSTVIKYGFPDEGSGVYSAHQMGTNRMGI 608

Query: 546 DPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKCIL 596
            P  S V P GE WEV+NLYVAD+SV PTA+GV  M+TT  +A +I+ CI+
Sbjct: 609 SPRTSVVKPTGETWEVKNLYVADASVFPTASGVNPMVTTEAVALHIADCII 659



>gi|511006580|gb|EPB87889.1| hypothetical protein HMPREF1544_05296 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 707

 Score =  354 bits (909), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 202/599 (33%), Positives = 328/599 (54%), Gaps = 25/599 (4%)

Query: 13  KPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYN--FNPVIGYPGAD 70
           +P  EL+++QRE   +KW  S   S+R ++K  + L       N Y+   + +I   G +
Sbjct: 110 RPLPELSRQQREDIMLKWKNSSLQSLRNLFKILSNLC----LYNAYSRKHSALIDSIGHN 165

Query: 71  PEANGSRFSSRNFPKYN--------FLEISDHDSDIKEFDTXXXXXXXXXXXXXXRLARM 122
             ANG  F   N P Y+         ++  +      EFD                LA+ 
Sbjct: 166 -AANGDAFF-ENHPDYDPVEHERIPMMQTGEATCGHLEFDVVVVGSGAGGGVAAAELAKA 223

Query: 123 E-NVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWS 181
             +VLVIEKG +Y Q ++  E++  Y  +Y+      +   ++  L+G+  GGGT + + 
Sbjct: 224 GYSVLVIEKGKYYHQSEMVHEEETCYTNMYDGGTSTTSTSGSIQCLSGATLGGGTALNYL 283

Query: 182 AFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKK 241
             ++PQ+FVREEWAK  GL YF   ++   +  +  R+G +  NI+  ++N     GC +
Sbjct: 284 VSLKPQHFVREEWAKQ-GLAYFASSQFSRDLNTVFDRIGASQENILETKTNSKFEKGCHE 342

Query: 242 LGLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILI 301
           LG H + +  NTA   H C  C  GCK G K S   TWL +A  + A+FL    V +I+ 
Sbjct: 343 LGYHIEKVFVNTAGRAHHCSRCMMGCKAGIKNSTANTWLLDALHHGARFLDRTLVTRIVT 402

Query: 302 DKDGKSQKVMGVEVIINNIKR-VKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVH 360
           +  G   K +GVE  I++ ++ V I AK+V+V+ GA+ +P LL  SGL N NIG++L + 
Sbjct: 403 NDRGT--KAVGVECQIHDTQQLVMIKAKKVIVACGALRTPGLLKASGLSNSNIGKHLRLQ 460

Query: 361 PIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSN 420
           PI   +G F ++ I+   G ++S + NA+++  G++YGAKI  G   PG + +  PW   
Sbjct: 461 PIMFGFGFF-DETIRQMDGPLISRVCNASDDCHGDHYGAKIEEGLMLPGGLASKIPWYGA 519

Query: 421 LQHKQLMLEYNNIVPLMVITRDREGGRILT--DENGKPRLEYKLSQHDSKSMVAGLLTAV 478
            +HK+LML + ++   + + RD++   ++T    N  P  EY LS+HD+KS+   +   +
Sbjct: 520 AKHKELMLRHKSVASFVNVVRDKDSVGVVTFDKSNPNPVYEYALSKHDAKSLTICIERNM 579

Query: 479 RILAAAGATKIGTCQTVIDDYIV-ENGVNPLNDPKFDQFLNKIKKVGIPTYQTCTGTIEQ 537
           RILAAAGA ++ T Q  ++ +   ++  +  ++P+F+Q+L+++ K GI    T   ++ Q
Sbjct: 580 RILAAAGARELYTSQANVEGFAFNDDETSSPDNPRFNQWLDRVSKAGISAVSTPLVSVHQ 639

Query: 538 MSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKCIL 596
           + SCRMG  P  S V P GE WE +N+Y+AD S+ PTA GV  M+T   IA ++S+ ++
Sbjct: 640 LGSCRMGTSPKSSVVQPSGETWECKNVYIADGSLFPTAVGVNPMVTIEAIALHVSRHVI 698



>gi|67516683|ref|XP_658227.1| hypothetical protein AN0623.2 [Aspergillus nidulans FGSC A4]
 gi|40746010|gb|EAA65166.1| hypothetical protein AN0623.2 [Aspergillus nidulans FGSC A4]
 gi|259489111|tpe|CBF89112.1| TPA: long chain fatty alcohol oxidase, putative (AFU_orthologue;
           AFUA_1G17110) [Aspergillus nidulans FGSC A4]
          Length = 745

 Score =  349 bits (896), Expect = 1e-93,   Method: Compositional matrix adjust.
 Identities = 203/620 (32%), Positives = 331/620 (53%), Gaps = 43/620 (6%)

Query: 3   LINSKILSIQ-KPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFN 61
           L+   ++ IQ +PF+      RE  F  WS S+   VR +Y++ T +    +     +  
Sbjct: 131 LLTGSMIPIQDQPFY-----VREQIFQGWSDSRLPPVRAVYRALTAIFKKVWVTFSPSLY 185

Query: 62  PVIGYPG----ADPEANGSRFSSRNFPKYNFLEISDHDSDIKEFDTXXXXXXXXXXXXXX 117
           P +G P       P+ NG +F    FP            ++ E D               
Sbjct: 186 PTLGVPHVPIYGTPQ-NGFQFEFLQFPP-------GQKPEMIETDVLIIGSGCGGSVAAK 237

Query: 118 RLARM-ENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGT 176
            LA   + V+V++KG+ +       +  +G++ L+E +G ++ D+S+M VL GS +GGG 
Sbjct: 238 NLAEAGKRVIVVDKGYSFTNQHFPMKPNEGFNNLFESAGAVMNDESSMAVLFGSTWGGGG 297

Query: 177 TIGWSAFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLI 236
           T+ WSA ++ Q +VR EWAK  GLP+F   E+ N++  +  R+G +  +I HN+SN+ ++
Sbjct: 298 TVNWSASLQTQAYVRREWAKR-GLPFFTSLEFQNSLDRVCDRMGVSADHINHNKSNRMIL 356

Query: 237 NGCKKLGLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYV 296
            G +KLG  +  +PQNT   TH CG C+ GC  G K+    T+L +A +  A F++   V
Sbjct: 357 EGSRKLGYSAKPVPQNTGGTTHYCGHCTLGCHTGGKKGPIETYLVDAANAGATFIEGFDV 416

Query: 297 EKILIDKDGKSQKV--------------MGVEVIINNIKRVKIHAKRVVVSAGAIHSPAL 342
           E++L  K  K+ KV               GV  +    +++ + AK+V+VS G++HSP L
Sbjct: 417 ERVLFSKK-KAGKVATGVLGTWVSRDAHFGVSGLGAVKRKIIVRAKKVIVSGGSLHSPLL 475

Query: 343 LLRSGLKNKNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIV 402
           L+RSG+KN NIGRNL++HP+A  + VF ++EI+ + G  ++A  N  E++DG  +G K+ 
Sbjct: 476 LIRSGIKNSNIGRNLYLHPVAVAHAVF-DEEIRPWEGACLTAAVNEFEDIDGHGHGFKLE 534

Query: 403 VGSHHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDEN-GKPRLEYK 461
             S  P  +   F W+  L +K  + +       + + RDR+ GR+  D N G+ R++Y 
Sbjct: 535 ALSMLPAAILPIFTWRDGLDYKLQVAKLPRSAGFITLVRDRDPGRVYPDPNDGRVRIDYD 594

Query: 462 LSQHDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIV---ENGVNPL--NDPKFDQF 516
           +S  D   MV GL+   +I   +GA +I T    +  +I    + G +PL  NDP F  +
Sbjct: 595 VSGFDRNHMVEGLVATAKISYISGAREIHTSYRDMPPFIRPAEDKGGSPLGINDPVFQAW 654

Query: 517 LNKIKKVGIPTY-QTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTA 575
           + ++++    T  +    +  QM SCRMG  P  S V+P G+ W  + LYV D+S+ P+A
Sbjct: 655 IEELRRKAPKTSDRVMWASAHQMGSCRMGTSPRHSVVDPDGQVWGTKGLYVIDASIFPSA 714

Query: 576 TGVPSMMTTMNIAHYISKCI 595
           +GV  M+T M IA ++S+ I
Sbjct: 715 SGVNPMITNMAIADHLSRKI 734



>gi|189208306|ref|XP_001940486.1| long chain fatty alcohol oxidase [Pyrenophora tritici-repentis
           Pt-1C-BFP]
 gi|187976579|gb|EDU43205.1| long chain fatty alcohol oxidase [Pyrenophora tritici-repentis
           Pt-1C-BFP]
          Length = 745

 Score =  348 bits (894), Expect = 3e-93,   Method: Compositional matrix adjust.
 Identities = 209/608 (34%), Positives = 313/608 (51%), Gaps = 36/608 (5%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYP----GA 69
           P  E     RE     W+T++   +R+I +S T+L    +         V+G P    G 
Sbjct: 142 PISEQPLHIRESILNGWATARLGVIRQIRRSLTILTKQAWIKTSLPLRRVMGIPRVPIGM 201

Query: 70  DPEANGSRFSSRNFPKYNFLEISDHD-SDIKEFDTXXXXXXXXXXXXXXRLARM-ENVLV 127
            P+             Y F++I   D  +I E D                LA     VL+
Sbjct: 202 KPDKGYD---------YEFIQIPPGDMPEIIETDVIVVGSGCGGGVCAKNLAEAGHRVLI 252

Query: 128 IEKGHHYDQCDLSTEQQDGYDKLYELSGGMLT-DDSNMYVLAGSNFGGGTTIGWSAFMEP 186
           +EK +H+        + DG+  L+ +SG  L+ DDS M ++A   +GGG T+ WSA ++ 
Sbjct: 253 VEKSYHWTPDHFPMIEVDGWHHLF-MSGSFLSSDDSTMTIVAAETWGGGGTVNWSASLQT 311

Query: 187 QYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHS 246
           Q +VR EWA    LP+F   E+ N++  +  R+G +T +I HN+ N+ L+ G +KLG  +
Sbjct: 312 QGYVRREWAAR-DLPFFTSAEFQNSLDRVCGRMGVSTEHIKHNRCNEMLLEGARKLGWTN 370

Query: 247 DNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGK 306
             +PQNT    H CG+CSFGC   EKQ   ++WL +A    AKF++  + EKI+  K   
Sbjct: 371 KAVPQNTGGNQHYCGFCSFGCGSCEKQGPVVSWLPDAARAGAKFIEGFHAEKIIFTKQDG 430

Query: 307 SQKVMGV-----EVIINN--------IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNI 353
            Q   GV        IN          +RV I AKRV+VSAG + SP LLLRSGLKN  I
Sbjct: 431 KQVATGVLGTWTSRDINGGVSGAPLTRRRVCIQAKRVIVSAGTMQSPLLLLRSGLKNPQI 490

Query: 354 GRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFA 413
           GRNL+VHP+    G + N++IK + G I++A+ +  EN+DG+ +G K+   +  P     
Sbjct: 491 GRNLYVHPV-TFLGAYHNEDIKPWEGGILTAVCSEYENLDGKGHGVKLEATNMVPSSCLM 549

Query: 414 NFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVA 472
              W+S LQ+K       N V  + I RDR+ GR+  D  +G+ R +Y  S+ D  SM+ 
Sbjct: 550 WVDWRSGLQYKLDSARLRNSVGYISIARDRDTGRVYPDPVDGRVRFQYHPSKFDKHSMME 609

Query: 473 GLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNP---LNDPKFDQFLNKIKKVGIPTYQ 529
           G++   +I    GA +I T    +  +I      P   +ND  F  +L +++  G P+ +
Sbjct: 610 GVIALAKIQYVEGAQEIFTFIPGMKPFIRSPSTPPGDGINDAAFQAWLTEVRARGFPSPE 669

Query: 530 TCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAH 589
           +   +  QM +CRM        V+P G+ W  E LYVAD+SV P+A+GV  M+T M I+ 
Sbjct: 670 SMFVSAHQMGTCRMSARSKDGVVDPHGKVWGTEGLYVADASVFPSASGVNPMVTNMAISD 729

Query: 590 YISKCILD 597
           +IS+ I D
Sbjct: 730 WISRGIAD 737



>gi|330919518|ref|XP_003298648.1| hypothetical protein PTT_09421 [Pyrenophora teres f. teres 0-1]
 gi|311328061|gb|EFQ93262.1| hypothetical protein PTT_09421 [Pyrenophora teres f. teres 0-1]
          Length = 745

 Score =  345 bits (884), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 204/607 (33%), Positives = 318/607 (52%), Gaps = 34/607 (5%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYP----GA 69
           P  E     RE     W+TS+   +R+I +S T+L    +         V+G P    G 
Sbjct: 142 PISEQPLHIRESILNGWATSRLGPLRQIRRSLTILTKQAWIKTSLPLRRVMGVPRVPIGM 201

Query: 70  DPEANGSRFSSRNFPKYNFLEISDHDS-DIKEFDTXXXXXXXXXXXXXXRLARM-ENVLV 127
            P        S+ +  Y F++I   D  +I E D                LA     VL+
Sbjct: 202 KP--------SKGY-DYEFIQIPPGDEPEIIETDVIVVGSGCGGGVCAKNLAEAGHRVLI 252

Query: 128 IEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQ 187
           +EK +H+        + DG+  L+     + +DDS+M ++AG  +GGG T+ WSA ++ Q
Sbjct: 253 VEKAYHWTPDHFPMIEVDGWHHLFMSGSFLASDDSSMTIVAGQTWGGGGTVNWSASLQTQ 312

Query: 188 YFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSD 247
            +VR EWA    LP+F   E+ N++  +  R+G +T +I  N+ N+ L+ G +KLG  + 
Sbjct: 313 GYVRREWAAR-DLPFFTSAEFQNSLDRVCGRMGVSTDHIKQNRCNEMLLEGARKLGWTNK 371

Query: 248 NIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKS 307
            +PQNT    H CG+CSFGC   EKQ   +++L +A    AKF++  + E+I++ K G  
Sbjct: 372 AVPQNTGGSQHYCGFCSFGCGSCEKQGPVVSFLPDAARAGAKFIEGFHAEQIILTKKGGK 431

Query: 308 QKVMGV-----EVIINN--------IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIG 354
           Q   GV        IN          +RV I AKRVVVSAG + SP +LLRSGLKN  IG
Sbjct: 432 QVATGVLGTWTSRDINGGVNGTPLTRRRVLIKAKRVVVSAGTMQSPLVLLRSGLKNPQIG 491

Query: 355 RNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFAN 414
           RNL+VHP+    G + +++I+ + G I++A+    EN+DG+ +G K+   +  P      
Sbjct: 492 RNLYVHPV-TFLGAYHDEDIRPWEGGILTAVCGEFENLDGKGHGPKLEATNMVPSSCLMW 550

Query: 415 FPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAG 473
             W++ LQ+K   +   N+V  + I RDR+ GR+  D  +G+ R +Y  S+ D +SM+ G
Sbjct: 551 VDWRNGLQYKLDAVRLRNMVGYISIARDRDTGRVYPDPVDGRVRFQYHPSKFDKQSMMEG 610

Query: 474 LLTAVRILAAAGATKIGTCQTVIDDYIVENGV---NPLNDPKFDQFLNKIKKVGIPTYQT 530
           ++   +I    GA +I T    ++ +I        + +ND  F  +L K++  G P+ ++
Sbjct: 611 VIALAKIQYIEGAQEIFTFIPGMEPFIRSPSTPAGDGINDAAFQAWLTKVRARGFPSPES 670

Query: 531 CTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHY 590
              +  QM +CRM        V+P G+ W  E LYVAD+SV P+A+GV  M+T M I+ +
Sbjct: 671 MFVSAHQMGTCRMSAHAKDGVVDPHGKVWGTEGLYVADASVFPSASGVNPMVTNMAISDW 730

Query: 591 ISKCILD 597
           IS+ I D
Sbjct: 731 ISRGIAD 737



>gi|358365410|dbj|GAA82032.1| long chain fatty alcohol oxidase [Aspergillus kawachii IFO 4308]
          Length = 749

 Score =  342 bits (878), Expect = 2e-91,   Method: Compositional matrix adjust.
 Identities = 198/606 (32%), Positives = 311/606 (51%), Gaps = 37/606 (6%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADPEA 73
           P HE     RE  F  W TS+ + +R +Y++ T +   T+        PV+G+P      
Sbjct: 138 PIHEQPLHVREEIFRGWETSRLSPLRGVYRACTGMFKQTWVKFSPTLAPVLGFP------ 191

Query: 74  NGSRFSSRNFP----KYNFLEISDHDS-DIKEFDTXXXXXXXXXXXXXXRLARM-ENVLV 127
              R      P    K+ FL+    D  +I E D                LA     VLV
Sbjct: 192 ---RVPVHGKPADGFKHTFLQFPAADEPEIIETDVVIVGSGCGGSVAAKNLAEAGHKVLV 248

Query: 128 IEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQ 187
           ++K +HY          + ++ ++E  G ++TDD +M VLAGS +GGG T+ WSA ++ Q
Sbjct: 249 LDKSYHYTSNHFPMNFNEAFNSMFESGGAVVTDDGSMAVLAGSTWGGGGTVNWSAALQTQ 308

Query: 188 YFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSD 247
            FVREEWAKN GLP+F   E+ N +  ++ R+G +  +I HN++N+ ++ G ++LG  + 
Sbjct: 309 GFVREEWAKN-GLPFFTSMEFQNCLDRVSERMGVDVEHIKHNKTNRFILEGARRLGYAAK 367

Query: 248 NIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKS 307
            +PQNT    H CG+C+ GC    K+  T T+L +A +  A F++     KIL       
Sbjct: 368 TVPQNTGHTEHYCGYCTLGCHSTGKKGPTETFLADAATAGATFIEGFRANKILFTDTKDG 427

Query: 308 QKVMGVEVIINN-------------IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIG 354
           Q   GVE +  +              + V I AKRVVVS G + SP LLLRSGLKN  IG
Sbjct: 428 QVASGVEGVWTSRDAYLGRSGATAVTRNVTIKAKRVVVSCGTLQSPLLLLRSGLKNPQIG 487

Query: 355 RNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFAN 414
           RNLH+HP+ A+ G   ++E + + G  ++ + N  EN+D + +G KI   S  P      
Sbjct: 488 RNLHLHPV-AIAGAVLDEEFRPWEGAALTTVVNELENLDNQGHGVKIEALSMVPAAFLPL 546

Query: 415 FPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAG 473
           FPW++ L +K  + +   +  L+++ RDR  GR+  D  +G+ R++Y +S  D K +V G
Sbjct: 547 FPWRNGLDYKLWVQKLPRMAGLIMLARDRGTGRVYPDPGDGRIRIDYAVSPTDRKHIVEG 606

Query: 474 LLTAVRILAAAGATKIGTCQTVIDDYI--VENGVNP---LNDPKFDQFLNKI-KKVGIPT 527
           ++ + ++   +GA +  T    +  +I  VE+        N+     ++ ++ +K  +  
Sbjct: 607 IIASAKMAYVSGAKEFHTSWREVPPFIRPVESDAEDTEGANNAALQAWIAEVRRKKPLDP 666

Query: 528 YQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNI 587
            +T   +  QM +CRMG  P  S V+   + W    LYV D+SV P+A+GV  M+T M I
Sbjct: 667 ERTMFASAHQMGTCRMGKSPRTSVVDSDCQVWGTRGLYVVDASVFPSASGVNPMLTNMAI 726

Query: 588 AHYISK 593
           A   S+
Sbjct: 727 ADRASR 732



>gi|449296026|gb|EMC92046.1| hypothetical protein BAUCODRAFT_274597 [Baudoinia compniacensis
           UAMH 10762]
          Length = 740

 Score =  337 bits (865), Expect = 5e-90,   Method: Compositional matrix adjust.
 Identities = 192/617 (31%), Positives = 319/617 (51%), Gaps = 39/617 (6%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADPEA 73
           P   L    RE    +WSTS    +R+++ S T L    +W+     +P +G   + P  
Sbjct: 123 PLDCLPVSTRERIIQRWSTSLVPVLRQLHVSLTSL-SRLYWIRT---SPTLGRTLSFPRI 178

Query: 74  NGSRFSSRNFPKYNFLEI---SDHDSDIKEFDTXXXXXXXXXXXXXXRLARME-NVLVIE 129
                    F  +NFL+I   S  +  + + D                LA     V+V++
Sbjct: 179 PAHPKGPETFYSFNFLQIPSASKSNPVVLQTDVVIVGSGCGGAVAAKTLAEAGLKVIVVD 238

Query: 130 KGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYF 189
           KG ++    L   + DG+++L+   G M +DD+ + VLAGS +GGG T+ WSA ++ Q F
Sbjct: 239 KGSYWSPKHLPRSELDGFNELFLNGGAMQSDDNGVAVLAGSTWGGGGTVNWSASIQTQGF 298

Query: 190 VREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNI 249
           VR EW++ FGL +F    +   +  I  R+G  T  I HN++N+ L+ G ++LG  +  +
Sbjct: 299 VRREWSEKFGLTHFTSAAFQADLDAICERMGVGTSAIEHNKANRVLLEGARRLGWAAKPV 358

Query: 250 PQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDK--DGKS 307
           PQNTA   H CG+C+ GC    K+  T T+L +A    A F++   V  ++ ++  D   
Sbjct: 359 PQNTAGEAHYCGYCTLGCGSCGKKGPTETFLPDAARAGAVFIEGFKVRNVVFEESSDASE 418

Query: 308 QKVMGVEVI-------------INNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIG 354
           + V GVE +              N+   V I A +V+++AG + +P LL RSGL N +IG
Sbjct: 419 RVVTGVEGVWTPRDNQSGAPGAANDPCEVIIKASKVIIAAGTLATPVLLRRSGLTNPHIG 478

Query: 355 RNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFAN 414
           R+LH+HP++ V  V+ +++++ + G I++++    EN+D + YGAK+   +  P      
Sbjct: 479 RHLHLHPVSFVGAVW-DQDVRPWEGGILTSVVTEFENLDHQGYGAKLESTTMLPSLFLPL 537

Query: 415 FPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTD-ENGKPRLEYKLSQHDSKSMVAG 473
           FPW+S LQ K+   +   +   + + RDR GGR+  D ++G+ RL+Y  SQ+D   ++ G
Sbjct: 538 FPWRSGLQFKEFAAKMKRMTGYISLARDRYGGRVYPDPKDGRIRLQYVTSQYDRTHILEG 597

Query: 474 LLTAVRILAAAGATKIGTCQTVIDDY------------IVENGVNPLNDPKFDQFLNKIK 521
           ++    +L   GA +I T    +D +            +  N    +ND +F  +L +++
Sbjct: 598 VVRLAELLYVQGAREIFTAIPSVDSFVRPTPDPESKVHVTSNDTPSVNDVEFGAWLQRVR 657

Query: 522 KVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSM 581
           K G+    T   +  QM SCRMG   + S V+P G  W    LY+ D+SV P+A+GV  M
Sbjct: 658 KAGL--SDTLMASAHQMGSCRMGTSASTSVVDPKGRVWGTTGLYICDASVFPSASGVNPM 715

Query: 582 MTTMNIAHYISKCILDK 598
           +T M I+  I++ I ++
Sbjct: 716 VTCMGISRGIARQIAEE 732



>gi|115397345|ref|XP_001214264.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gi|114192455|gb|EAU34155.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 749

 Score =  337 bits (863), Expect = 9e-90,   Method: Compositional matrix adjust.
 Identities = 194/622 (31%), Positives = 311/622 (50%), Gaps = 30/622 (4%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADPEA 73
           P  +   + RE  F  W TS+   +R +Y++ + +   T+ ++     PVIG+P      
Sbjct: 137 PIQDQPLEYREQVFRGWETSRLRPLRAVYRALSGIFKRTWIVSSPTICPVIGFPRVPVHG 196

Query: 74  NGSRFSSRNFPKYNFLEISDHDS-DIKEFDTXXXXXXXXXXXXXXRLARM-ENVLVIEKG 131
                    FP Y FL+I   D  +  E D                LA     VLV+EKG
Sbjct: 197 K----PEDGFP-YQFLQIPPGDEPETIETDVVIVGSGCGGGVTAKNLAEAGHKVLVVEKG 251

Query: 132 HHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVR 191
           + Y          +G + ++E S    TDD  M + AGS +GGG T+ WSA ++ Q +VR
Sbjct: 252 YQYSSRHFPMGFNEGLNSMFEASAATGTDDGTMGLFAGSTWGGGGTVNWSASLQTQGYVR 311

Query: 192 EEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQ 251
           +EWA + GLP+F   E+   +  +  R+G +  +  HN  N+ L+ G +KLG  +  +PQ
Sbjct: 312 QEWA-DAGLPFFTSFEFQRCLDRVCDRMGVSDEHQDHNFQNRMLLEGARKLGYAAKPVPQ 370

Query: 252 NTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQKVM 311
           NT    H CG+C+ GC    K+  T +WL +A    A F++    +K+L D     Q   
Sbjct: 371 NTGGTGHYCGYCTMGCHSTGKKGPTESWLADAAKAGATFMEGFRADKVLFDNTKGGQVAS 430

Query: 312 GVEVIINNI-------------KRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLH 358
           GVE    +              ++V I AK+VVV+ G++ SP LLLRSGLKN  IGRNL+
Sbjct: 431 GVEGTWTSRDSYLGLSGEGARKRKVIIKAKKVVVACGSLQSPLLLLRSGLKNSQIGRNLY 490

Query: 359 VHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWK 418
           +HP+     VF  +E + + G  ++ + N  E+ DG+ +G KI   +  P      FPW+
Sbjct: 491 LHPVVLATAVF-EEETRPWEGACLTTVVNELEDQDGKGHGVKIECVTMLPPAFLPAFPWR 549

Query: 419 SNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAGLLTA 477
             L +K+ + +  ++   +++TRDR+ GR+  D  +G+ R++Y +S +D   MV  L  +
Sbjct: 550 DGLDYKKFVAKLPHMGGFIMLTRDRDSGRVYPDPVDGRCRVDYSVSSYDRNHMVEALAAS 609

Query: 478 VRILAAAGATKIGTCQTVIDDYIV-----ENGVNPLNDPKFDQFLNKIKKVGIPTYQTCT 532
            +I   +GA +  T    +  +I       +     N+     +L ++++  +   +T  
Sbjct: 610 AKIAYISGAKEFHTSCRGLPPFIRPAEADADDAEGTNNAALQSWLAELRRKALEPERTLF 669

Query: 533 GTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYIS 592
               QM SCRMG  P  S V+P  + W  + LYV D+SV P+A+GV  M+T M IA + S
Sbjct: 670 ACAHQMGSCRMGKSPASSVVDPDCQVWGTKGLYVMDASVFPSASGVNPMVTNMAIADFAS 729

Query: 593 KCILDKKIFTVKKKRGSMLRHL 614
           + +   K  + +KK G+ +  L
Sbjct: 730 RGL--AKTLSKEKKEGAPVARL 749



>gi|477509601|gb|ENH62892.1| Long-chain-alcohol oxidase FAO2 [Fusarium oxysporum f. sp. cubense
           race 1]
          Length = 652

 Score =  337 bits (863), Expect = 1e-89,   Method: Compositional matrix adjust.
 Identities = 194/602 (32%), Positives = 316/602 (52%), Gaps = 24/602 (3%)

Query: 15  FHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADPEAN 74
           F +L+ + R      W  S  A++R ++K  +++    +  +   FN V+G+P   P  +
Sbjct: 46  FCDLSIQDRTLVLNSWQRSSLATLRVLFKQLSIIGKHVYLRSSTLFNEVVGFPSTPPGWH 105

Query: 75  GSRFSSRNFPKYNFLEISDHDSDIKEFDTXXXXXXXXXXXXXXRLARM--ENVLVIEKGH 132
                  ++P + F++ ++ D  ++                  R   M    VLV++KGH
Sbjct: 106 ----PVESYP-FEFMQFNNSDYHVQLDTDVVIVGSGCGAGVVARTIAMAGHRVLVVDKGH 160

Query: 133 HYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVRE 192
           H++   L  +Q  GY  L+E  G + ++D ++  LAGS FGGG T+ WSA ++ Q  VR+
Sbjct: 161 HFETSSLPLDQSAGYFHLFEQGGLVSSEDGSISTLAGSCFGGGGTVNWSACLQLQNTVRD 220

Query: 193 EWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQN 252
           EWA   GL +F   ++   +  +  R+G +   I  N  N  L+ G ++LG  +  +PQN
Sbjct: 221 EWADERGLEFFKSAKFQAHLDSVCERMGVSNEPINQNHGNSVLLEGGRRLGYSAKPVPQN 280

Query: 253 TASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQKVMG 312
           T +  HQ G+CS GC  G+KQ     WL +A    AKF+   YV ++L  K G  +   G
Sbjct: 281 TGNCDHQDGYCSMGCWMGKKQGPVNGWLPDAARCGAKFISGFYVNRVLFKKHGSRKVASG 340

Query: 313 VEVIIN-------NIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAV 365
           V            + + V I+AKRVV+SAG++ SP +L  SGLKNK+IGRNLH+HP + V
Sbjct: 341 VTGTWRPRDGPDASARSVTINAKRVVISAGSLCSPIVLKNSGLKNKHIGRNLHLHPTSFV 400

Query: 366 YGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQ 425
             +F  +E + + G I++++ ++ +N+DG  +G ++   +  P        W S  ++K 
Sbjct: 401 SAIF-EQETRPWEGGILTSVVSSFDNIDGHGHGVRLERPAMLPSMCLTWCNWTSGPEYKA 459

Query: 426 LMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAGLLTAVRILAAA 484
           ++ +Y ++   + ITRDR  G +  D  NG PRL Y  S+ D+ + + G+L   +IL   
Sbjct: 460 MISKYRHMEAYIAITRDRHSGHVTADPINGTPRLVYTPSKFDASNNLKGMLALAKILYTQ 519

Query: 485 GATKIGTCQTVIDDYIVE-----NGVNPLN---DPKFDQFLNKIKKVGIPTYQTCTGTIE 536
           GAT+I      ++ +I E     +G +  +   DP+F Q+L K++  G  T  T  G+  
Sbjct: 520 GATEIHPILPGLEPFIREQESLSDGAHSPSEAIDPRFSQWLKKMEAHGNKTPDTPYGSAH 579

Query: 537 QMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKCIL 596
           QM +CRM        V+  G  W  ENL VAD+SV P+A+GV  M+TTM I  +I   + 
Sbjct: 580 QMGTCRMSTKEADGVVDEFGRVWGCENLIVADASVFPSASGVNPMVTTMAICEHIGLAMA 639

Query: 597 DK 598
           ++
Sbjct: 640 EE 641



>gi|342880915|gb|EGU81929.1| hypothetical protein FOXB_07532 [Fusarium oxysporum Fo5176]
          Length = 721

 Score =  334 bits (857), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 192/602 (31%), Positives = 316/602 (52%), Gaps = 24/602 (3%)

Query: 15  FHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADPEAN 74
           F +L+ + R      W  S  A++R ++K  +++    +  +   FN V+G+P   P  +
Sbjct: 115 FCDLSIQDRTLVLNSWQRSSLATLRVLFKQLSIIGKHVYLRSSTLFNEVVGFPSTPPGWH 174

Query: 75  GSRFSSRNFPKYNFLEISDHDSDIKEFDTXXXXXXXXXXXXXXRLARM--ENVLVIEKGH 132
                  ++P + F++ ++ D  ++                  R   M    VLV++KGH
Sbjct: 175 ----PVESYP-FEFMQFNNSDYHVQLDTDVVIVGSGCGAGVVARTIAMAGHRVLVVDKGH 229

Query: 133 HYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVRE 192
           H++   L  +Q  GY  L+E  G + ++D ++  LAGS FGGG T+ WSA ++ Q  VR+
Sbjct: 230 HFETSSLPLDQSAGYFHLFEQGGLVSSEDGSISTLAGSCFGGGGTVNWSACLQLQNTVRD 289

Query: 193 EWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQN 252
           EWA   GL +F   ++   +  +  R+G +   I  N  N  L+ G ++LG  +  +PQN
Sbjct: 290 EWADERGLEFFKSAKFQAHLDSVCERMGVSNEPINQNHGNSVLLEGGRRLGYSAKPVPQN 349

Query: 253 TASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQKVMG 312
           T +  HQ G+CS GC  G+KQ     WL +A    AKF+   YV ++L    G  +   G
Sbjct: 350 TGNCDHQDGYCSMGCWMGKKQGPVNGWLPDAARCGAKFISGFYVNRVLFKNHGGRKVASG 409

Query: 313 VEVII-------NNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAV 365
           V           ++ + V I+AKRVV+SAG++ SP +L  SGLKNK+IGRNLH+HP + V
Sbjct: 410 VTGTWRPRDGPDSSARSVTINAKRVVISAGSLCSPIVLKNSGLKNKHIGRNLHLHPTSFV 469

Query: 366 YGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQ 425
             +F  +E + + G I++++ ++ +N+DG+ +G ++   +  P        W S  ++K 
Sbjct: 470 SAIF-EQETRPWEGGILTSVVSSFDNIDGQGHGVRLERPAMLPSMCLTWCNWTSGPEYKA 528

Query: 426 LMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAGLLTAVRILAAA 484
           ++ +Y ++   + ITRDR  G +  D  NG PRL Y  S+ D  + + G+L   +IL   
Sbjct: 529 MISKYRHMEAYIAITRDRHSGHVTADPINGTPRLVYTPSKFDVSNNLKGMLALAKILYTQ 588

Query: 485 GATKIGTCQTVIDDYI-----VENGVNPLN---DPKFDQFLNKIKKVGIPTYQTCTGTIE 536
           GAT+I      ++ +I     + +G +  +   DP+F Q+L K++  G  T  T  G+  
Sbjct: 589 GATEIHPILPGLEPFIRQQESLSDGAHSPSEAIDPRFSQWLKKMEAHGNKTPDTPYGSAH 648

Query: 537 QMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKCIL 596
           QM +CRM        V+  G  W  ENL VAD+SV P+A+GV  M+TTM I  +I   + 
Sbjct: 649 QMGTCRMSTKETDGVVDEFGRVWGCENLIVADASVFPSASGVNPMVTTMAICEHIGLAMA 708

Query: 597 DK 598
           ++
Sbjct: 709 EE 710



>gi|164655877|ref|XP_001729067.1| hypothetical protein MGL_3855 [Malassezia globosa CBS 7966]
 gi|159102956|gb|EDP41853.1| hypothetical protein MGL_3855 [Malassezia globosa CBS 7966]
          Length = 758

 Score =  334 bits (857), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 209/623 (33%), Positives = 321/623 (51%), Gaps = 47/623 (7%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGA--DP 71
           P  ++ Q     T + W TS    +R        L    F+ +       IGYP    D 
Sbjct: 118 PVWDVDQDAIVTTLLAWRTSPIQVLRLGQFGLIGLTMMVFYRHFEKATEAIGYPTGPTDD 177

Query: 72  EANGSRFSSRN-FPKYNF------LEISDHDSDIK-EFDTXXXXXXXXXXXXXXRLA-RM 122
                 F  +   P YNF      L +S     I  E D                LA R 
Sbjct: 178 WKTPPGFEEQTAIPHYNFQFLNDNLPLSPTSEPIDLETDVVVVGSGCGGGVVAAYLAERG 237

Query: 123 ENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSA 182
             V+V++KG +    ++   Q  G+D+++E  G + +   ++ VLAGS FGGG+TI W A
Sbjct: 238 LKVVVVDKGLYVRPEEMPLTQSFGFDQMFERLGFVPSSTMSIGVLAGSGFGGGSTINWGA 297

Query: 183 FMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKL 242
            + P+YF+R+ W+K +G+PYF    +   +     R+GT T NI HN++N  L+ G ++ 
Sbjct: 298 TLTPRYFLRQAWSKKYGMPYFESALFTQDLDACAHRMGT-TDNITHNRANTLLMLGARRA 356

Query: 243 GLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILID 302
           G     +PQN  ++ H CG C+FGC  G K    MT+L +A  + A+FL +C VE++L++
Sbjct: 357 GQPVSAVPQNNGNLPHYCGKCTFGCPSGHKHGTLMTYLRDAAEHGAQFLTHCDVERVLME 416

Query: 303 KDGKSQKVMGVEVIINNIK--RVKIHAKR-VVVSAGAIHSPALLLRSG--LKNKNIGRNL 357
            DGK+  VMG      ++K   V+IH K+ VV+SAG++++PA+LLR+    KNK IG +L
Sbjct: 417 -DGKATGVMG------HVKGQSVRIHGKQGVVISAGSVNTPAILLRTPELKKNKQIGEHL 469

Query: 358 HVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPW 417
           H+HP+A V+G + +  +  + G  ++ +SNA E VD   +GAKI V +  P    A  P+
Sbjct: 470 HLHPVAFVHGFY-DIPVYPWEGGSLTTVSNAAELVDPHGWGAKIEVMASAPSLFCAILPF 528

Query: 418 KSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGLLTA 477
           +++ QHK+L   Y      +V+ RDR+GGR+  D+ G+  ++Y LS+ D KSM+ G+  A
Sbjct: 529 QNSAQHKKLASRYRYSYTAIVLVRDRDGGRVKLDKYGRALMDYNLSKFDQKSMLEGVKRA 588

Query: 478 VRILAAAGATKIGTCQTVIDDYIVE-------------------NGVNPLND---PKFDQ 515
             I   AGA+ I   Q  +  Y                      + + P  D   P F +
Sbjct: 589 TEIHMNAGASAIAVTQFDVPLYECPKNKLPSSVPEKLLPGSYPFDSLPPQGDVMHPSFVE 648

Query: 516 FLNKIKKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTA 575
           F  +I++ G  T +   G+  QM SCRMG DP  SA +P G       L+VAD SVLP A
Sbjct: 649 FQKQIERAGFSTLRCTLGSAHQMGSCRMGADPTTSACDPRGRLRGASRLWVADGSVLPEA 708

Query: 576 TGVPSMMTTMNIAHYISKCILDK 598
           +GV  M+T +  +  I++ I ++
Sbjct: 709 SGVNPMLTILGTSRGIARNIAEE 731



>gi|388853321|emb|CCF53187.1| related to long chain fatty alcohol oxidase [Ustilago hordei]
          Length = 771

 Score =  334 bits (856), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 202/634 (31%), Positives = 313/634 (49%), Gaps = 60/634 (9%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADPE- 72
           PF +L +  RE     W TS+    RK       ++   ++ N       IGYP   P+ 
Sbjct: 120 PFAQLDRATREKIIFGWFTSRLTLFRKAASGLKGIVLLVYYRNHQPAWEAIGYPDGRPDD 179

Query: 73  -----ANGSRFSSRNFPKYNFL--EISDHDSD---IKEFDTXXXXXXXXXXXXXXRLA-R 121
                  G    +     Y F   +I+   S    I + +                LA R
Sbjct: 180 WTRPIQGGEAAPAAPVYDYKFENEKIAAQPSGSEIIVDTEVLVIGSGSGGGVAASYLAQR 239

Query: 122 MENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWS 181
               LV++KG +     +   +   Y  LYE  G + ++D ++ +LAGS FGGG+ I WS
Sbjct: 240 GVRTLVVDKGIYLHPDKVVGREDQSYGLLYEGEGILPSEDGSISILAGSTFGGGSLINWS 299

Query: 182 AFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKK 241
           A ++P++FVR+ WA  +G+PY+    + + +  +  R+G     I HN  N  L  G ++
Sbjct: 300 ASLKPRHFVRKTWADKYGVPYYNSPYFTSDLNAVCTRMGVAVAPIRHNVGNSLLALGAQR 359

Query: 242 LGLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILI 301
            G   + +PQN+   TH CG C  GC  G KQ   ++WL +A    A F+ NCYVE+IL 
Sbjct: 360 AGHPVEPVPQNSGGHTHYCGKCQLGCVSGHKQGGVVSWLKDAAEAGAAFMTNCYVERILF 419

Query: 302 DKDGKSQKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSG-LK-NKNIGRNLHV 359
           D++   ++ +G   +++  K   + AK VVVS+G+I +PALLLRS  LK NK IG+ L +
Sbjct: 420 DRN---KRAVGALAVVDGRKVKILAAKGVVVSSGSIQTPALLLRSPELKTNKMIGQTLRL 476

Query: 360 HPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGF--MFANFPW 417
           HP   V G + N  +K + G +++ + N+ E VD   +G KI V +  P     F NF  
Sbjct: 477 HPATVVTGYY-NFPVKPWEGGLLTIVDNSAEMVDPAGWGCKIEVIASSPSVHAAFQNF-- 533

Query: 418 KSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGLLTA 477
            S+ +HK  ML+Y++   +++I RDR+ GRI+ DE G+ R++Y +S  D ++++ G+L  
Sbjct: 534 SSSKEHKARMLQYSHSYTMVIICRDRDSGRIVLDEKGQARIDYTISSFDQRTLLQGILRG 593

Query: 478 VRILAAAGATKIGTCQTVIDDYIV----------ENGVNP-------------------- 507
                 AGA  I T Q  +  +             NG  P                    
Sbjct: 594 ADAHLMAGAEAIATAQATVPIFSASSLNAPKPAKSNGPAPALPVSDSIYTETTQVPATWT 653

Query: 508 --------LNDPKFDQFLNKIKKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAW 559
                   LNDP + ++  K+  VG   Y    G+  QM+SCRMG DPN SA++P G  W
Sbjct: 654 PVETVPRDLNDPAYKEWQKKVIAVGTKPYVISIGSAHQMASCRMGRDPNISALDPEGRVW 713

Query: 560 EVENLYVADSSVLPTATGVPSMMTTMNIAHYISK 593
             +NL+VAD+S +  ++GV  M+TTM  A  +++
Sbjct: 714 GAKNLWVADASAMCESSGVNPMITTMATARGVAR 747



>gi|350638442|gb|EHA26798.1| long chain fatty alcohol oxidase [Aspergillus niger ATCC 1015]
          Length = 749

 Score =  333 bits (855), Expect = 8e-89,   Method: Compositional matrix adjust.
 Identities = 197/607 (32%), Positives = 308/607 (50%), Gaps = 39/607 (6%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADPEA 73
           P HE     RE  F  W TS+ + +R +Y++ T +   T+        PV+G+P      
Sbjct: 138 PIHEQPLHVREEIFRGWETSRLSPLRGVYRACTGMFKQTWVKFSPTLAPVLGFP------ 191

Query: 74  NGSRFSSRNFP----KYNFLEISDHDS-DIKEFDTXXXXXXXXXXXXXXRLARM-ENVLV 127
              R      P    K+ FL+    D  +  E D                LA     VLV
Sbjct: 192 ---RVPVHGKPADGFKHTFLQFPPADEPETIETDVVIVGSGCGGSVAAKNLAEAGHKVLV 248

Query: 128 IEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQ 187
           ++K +HY          + +  ++E  G ++TDD +M VLAGS +GGG T+ WSA ++ Q
Sbjct: 249 LDKSYHYTSNHFPMNFNEAFTSMFESGGAVVTDDGSMAVLAGSTWGGGGTVNWSAALQTQ 308

Query: 188 YFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSD 247
            FVREEWAKN GLP+F   E+ N M  ++ R+G +  +I HN++N+ ++ G +++G  + 
Sbjct: 309 SFVREEWAKN-GLPFFTSMEFQNCMDRVSDRMGVDVEHIKHNKTNRFILEGARRMGYSAK 367

Query: 248 NIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKS 307
            +PQNT    H CG+C+ GC    K+  T T+L +A +  A F++     KI+       
Sbjct: 368 TVPQNTGHGEHYCGYCTLGCHSTGKKGPTETFLADAATAGATFIEGFRANKIIFTDTKDG 427

Query: 308 QKVMGVEVIINN------------IKR-VKIHAKRVVVSAGAIHSPALLLRSGLKNKNIG 354
           Q   GVE +  +            +KR V I AKRVVVS G + SP LLLRSGLKN +IG
Sbjct: 428 QVASGVEGVWTSRDAYLGRAGATAVKRNVTIKAKRVVVSCGTLQSPLLLLRSGLKNPHIG 487

Query: 355 RNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFAN 414
           RNLH+HP+  + G    +E + + G  ++ + N  EN+D + +G KI   S  P      
Sbjct: 488 RNLHLHPV-IIAGAVLEEEFRPWEGAALTTVVNEFENLDNQGHGVKIEALSMVPAAFLPL 546

Query: 415 FPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAG 473
           FPW++ L +K  + +   +  L+++ RD+  GR+  D  +G+ R++Y +S  D K +V G
Sbjct: 547 FPWRNGLDYKLWVQKLPRMAGLIMLARDQGSGRVYPDPGDGRIRIDYTVSPMDRKHIVEG 606

Query: 474 LLTAVRILAAAGATKIGTCQTVIDDYIVENGVNP-----LNDPKFDQFLNKI--KKVGIP 526
           L+ + ++   +GA +  T    +  +I     +       N+     ++ ++  KK   P
Sbjct: 607 LIASAKMAYVSGAKEFHTSWREVPPFIRPTDSDTEDAEGANNAALQAWIAEVRRKKPADP 666

Query: 527 TYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMN 586
             +T   +  QM +CRMG  P  S V+   + W    LYV D+SV P+A+GV  M+T M 
Sbjct: 667 E-RTMFASAHQMGTCRMGKSPRTSVVDSDCQVWGTRGLYVVDASVFPSASGVNPMITNMA 725

Query: 587 IAHYISK 593
           IA   S+
Sbjct: 726 IADRASR 732



>gi|145230147|ref|XP_001389382.1| long chain fatty alcohol oxidase [Aspergillus niger CBS 513.88]
 gi|134055497|emb|CAK44012.1| unnamed protein product [Aspergillus niger]
          Length = 749

 Score =  333 bits (855), Expect = 9e-89,   Method: Compositional matrix adjust.
 Identities = 197/607 (32%), Positives = 308/607 (50%), Gaps = 39/607 (6%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADPEA 73
           P HE     RE  F  W TS+ + +R +Y++ T +   T+        PV+G+P      
Sbjct: 138 PIHEQPLHVREEIFRGWETSRLSPLRGVYRACTGMFKQTWVKFSPTLAPVLGFP------ 191

Query: 74  NGSRFSSRNFP----KYNFLEISDHDS-DIKEFDTXXXXXXXXXXXXXXRLARM-ENVLV 127
              R      P    K+ FL+    D  +  E D                LA     VLV
Sbjct: 192 ---RVPVHGKPADGFKHTFLQFPPADEPETIETDVVIVGSGCGGSVAAKNLAEAGHKVLV 248

Query: 128 IEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQ 187
           ++K +HY          + +  ++E  G ++TDD +M VLAGS +GGG T+ WSA ++ Q
Sbjct: 249 LDKSYHYTSNHFPMNFNEAFTSMFESGGAVVTDDGSMAVLAGSTWGGGGTVNWSAALQTQ 308

Query: 188 YFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSD 247
            FVREEWAKN GLP+F   E+ N M  ++ R+G +  +I HN++N+ ++ G +++G  + 
Sbjct: 309 SFVREEWAKN-GLPFFTSMEFQNCMDRVSDRMGVDVEHIKHNKTNRFILEGARRMGYSAK 367

Query: 248 NIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKS 307
            +PQNT    H CG+C+ GC    K+  T T+L +A +  A F++     KI+       
Sbjct: 368 TVPQNTGHGEHYCGYCTLGCHSTGKKGPTETFLADAATAGATFIEGFRANKIIFTDTKDG 427

Query: 308 QKVMGVEVIINN------------IKR-VKIHAKRVVVSAGAIHSPALLLRSGLKNKNIG 354
           Q   GVE +  +            +KR V I AKRVVVS G + SP LLLRSGLKN +IG
Sbjct: 428 QVASGVEGVWTSRDAYLGRAGATAVKRNVTIKAKRVVVSCGTLQSPLLLLRSGLKNPHIG 487

Query: 355 RNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFAN 414
           RNLH+HP+  + G    +E + + G  ++ + N  EN+D + +G KI   S  P      
Sbjct: 488 RNLHLHPV-IIAGAVLEEEFRPWEGAALTTVVNEFENLDNQGHGVKIEALSMVPAAFLPL 546

Query: 415 FPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAG 473
           FPW++ L +K  + +   +  L+++ RD+  GR+  D  +G+ R++Y +S  D K +V G
Sbjct: 547 FPWRNGLDYKLWVQKLPRMAGLIMLARDQGSGRVYPDPGDGRIRIDYTVSPMDRKHIVEG 606

Query: 474 LLTAVRILAAAGATKIGTCQTVIDDYIVENGVNP-----LNDPKFDQFLNKI--KKVGIP 526
           L+ + ++   +GA +  T    +  +I     +       N+     ++ ++  KK   P
Sbjct: 607 LIASAKMAYVSGAKEFHTSWREVPPFIRPTDSDTEDAEGANNAALQAWIAEVRRKKPADP 666

Query: 527 TYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMN 586
             +T   +  QM +CRMG  P  S V+   + W    LYV D+SV P+A+GV  M+T M 
Sbjct: 667 E-RTMFASAHQMGTCRMGKSPRTSVVDSDCQVWGTRGLYVVDASVFPSASGVNPMITNMA 725

Query: 587 IAHYISK 593
           IA   S+
Sbjct: 726 IADRASR 732



>gi|452845850|gb|EME47783.1| hypothetical protein DOTSEDRAFT_69651 [Dothistroma septosporum
           NZE10]
          Length = 760

 Score =  333 bits (854), Expect = 1e-88,   Method: Compositional matrix adjust.
 Identities = 193/630 (30%), Positives = 325/630 (51%), Gaps = 49/630 (7%)

Query: 15  FHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYP----GAD 70
           F  L  + RE   + W+ ++   +R++++S   L    +         ++ YP     A 
Sbjct: 137 FDCLPIQDREQILLGWANARLPFLRQLHRSLVTLARVLWIRTSPTIGELLAYPKIPINAG 196

Query: 71  PEANGSRFSSRNFPKYNFLEIS----DHDSDIKEFDTXXXXXXXXXXXXXXRLARME-NV 125
           P   G       FP Y F++I       + ++ E D                LA     V
Sbjct: 197 PAGAG-------FP-YRFVQIPPAPVSAEPEVIETDVVIVGSGCGGAVVAKTLAEAGLKV 248

Query: 126 LVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFME 185
           LV+EK +++          +    LY   G ++++D+++ V+AGS FGGG TI WSA ++
Sbjct: 249 LVVEKSYYWPPEYFPMSDNEA-QHLYGNGGAIISNDASITVVAGSTFGGGGTINWSASLQ 307

Query: 186 PQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLH 245
           PQ  VR EWA  FGL  F   E+   + Y+  R+G +T  + HN++N  L+ G +KLG  
Sbjct: 308 PQGIVRREWAYKFGLTQFNSSEFQADLDYVCDRMGVSTAPVKHNKANIALLEGARKLGWS 367

Query: 246 SDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDK-D 304
           +  + QNT    H  G+C+ GC+   K+  T+TWL +A S  A F++   V++++ D  +
Sbjct: 368 AKPVAQNTGGEEHSDGFCTRGCRDCGKKGPTITWLPDAASAGASFMEGFDVKEVVFDDTE 427

Query: 305 GKSQKVMGVEVIINN-------------IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNK 351
              ++ +GV+ I  +              + V + A+R ++S G++++P LL RSGLKNK
Sbjct: 428 SGDRQAIGVKGIWTSRDTSGGMAGLERTTREVIVKARRTIISGGSMYTPLLLQRSGLKNK 487

Query: 352 NIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFM 411
           +IGR+LH+HP++ +  V+ +++++ + G I++++ N  EN+DG+ YGAK+   +  PG  
Sbjct: 488 HIGRHLHLHPVSMLAAVW-DEDVRPWEGPILTSVVNEFENLDGDGYGAKLECTTMIPGSF 546

Query: 412 FANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMV 471
            A FPW   L  K+  ++   +   + + RDR GGR+ +D +G+  ++Y  + +D   ++
Sbjct: 547 LAMFPWTGGLAFKEFAIKMRKMTGYISLARDRYGGRVYSDADGRCMVQYSPNTYDKNHIL 606

Query: 472 AGLLTAVRILAAAGATKIGTCQTVIDDYIV------------ENGVNPLNDPKFDQFLNK 519
            G+     I+   GA +I      I+ ++              N    L D +F  +L K
Sbjct: 607 EGIARMAEIVYVEGAREIHAAIPGIEPFVRADSGATSKVSVHANQAPSLTDIEFKDWLAK 666

Query: 520 IKKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVP 579
           ++K G P   +   +  QM SCRMG  P  SAV+  G  W  + LYVAD+SV P+A+GV 
Sbjct: 667 LRKNGFPAPGSGFFSAHQMGSCRMGTSPKNSAVDHRGRVWGTKGLYVADASVFPSASGVN 726

Query: 580 SMMTTMNIAHYISKCILDKKIFTVKKKRGS 609
            M+T M IA  I++ I+D+    VK+  GS
Sbjct: 727 PMITCMGIARGIARAIVDE----VKRSDGS 752



>gi|440640770|gb|ELR10689.1| hypothetical protein GMDG_04950 [Geomyces destructans 20631-21]
          Length = 696

 Score =  332 bits (851), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 198/602 (32%), Positives = 315/602 (52%), Gaps = 23/602 (3%)

Query: 18  LTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADPEANGSR 77
           L  + R      W T   + +R +  S T L    +      F  + GY      A  + 
Sbjct: 110 LDAQARSGVLKGWRTHYLSPIRVLGSSITSLAKINYLRTSKLFPALTGY-----SATPTG 164

Query: 78  FSSRNFPKYNFLEI-SDHDSDIKEFDTXXXXXXXXXXXXXXRLARME-NVLVIEKGHHYD 135
           +       Y FL+  +  +    EFD                LA    +VLV++K +++ 
Sbjct: 165 YEPGPTFDYKFLKFEAAAEPATLEFDVVIVGSGVGGGVSAKNLAEAGFSVLVVDKAYYHP 224

Query: 136 QCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVREEWA 195
              L   +  GY  L+E  G   + D+++  +AG+N+GGG +I WSA ++PQ +VR+EW+
Sbjct: 225 PDRLPMNEAAGYTHLFENGGFDASYDASLTFIAGANWGGGGSINWSASLQPQSYVRQEWS 284

Query: 196 KNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQNTAS 255
           ++  LP F   E+ +A+  +  R+G +T NI H+  N+ L+ G +KLG  +  +PQNT  
Sbjct: 285 RDRKLPLFETTEFQDALDRVCDRMGVSTENIEHSHGNRVLLEGARKLGYEAKAVPQNTGG 344

Query: 256 ITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQKVMGVEV 315
             H CG C  GC   EKQ   + WL +A    A+F++   VE++L +  G ++  +GV+ 
Sbjct: 345 HKHSCGRCGMGCGAAEKQGPNVCWLPDAARAGAQFMEGYQVERVLFETRGGNKTAVGVKG 404

Query: 316 II--NNIKR-VKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYGVFPNK 372
           +   + ++R V + A+RV+VSAG+++SP LLL SGLKN +IGRNL++HP   V   FP +
Sbjct: 405 VWTKDGVEREVVVKAQRVIVSAGSLNSPVLLLNSGLKNTHIGRNLYMHPANMVSAFFP-E 463

Query: 373 EIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQLMLEYNN 432
           +++ + G I++ +  + EN+DG  +GAK+      P    +   W S    K L  +Y +
Sbjct: 464 DVRPWEGAILTTVCTSFENLDGHGHGAKMEATCMIPTLSLSQMNWTSGSDWKLLAAKYRH 523

Query: 433 IVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGLLTAVRILAAAGATKIGTC 492
           +       RDR+ GRIL +     R+EY  S  D +  + GLL  ++IL   GA +I   
Sbjct: 524 MNTYASFARDRDPGRILANPK---RVEYTPSAFDRRHTLIGLLEMMKILLVGGAAEIHPH 580

Query: 493 QTVIDDYIVE--NGVNPLNDPKFDQFLNKIKKVG-IPTYQTCTGTIEQMSSCRMGDDPNK 549
            +    +IV+   G +P N P+F ++L K++ VG  P   +C G+  QM SCRM      
Sbjct: 581 LSGAPPFIVDPSAGRSPAN-PEFKEWLRKVEAVGNAPPGLSC-GSAHQMGSCRMSATEGM 638

Query: 550 SAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKCILDKKIFTVKKKRGS 609
             V+P G  WE   LYVAD+SV P+A+GV  M+T + I+  IS+ +       +KK+RG 
Sbjct: 639 GVVDPEGRVWETRGLYVADASVFPSASGVNPMVTNLAISDVISRRVAAG----LKKERGE 694

Query: 610 ML 611
            L
Sbjct: 695 RL 696



>gi|453087089|gb|EMF15130.1| long-chain fatty alcohol dehydrogenase [Mycosphaerella populorum
           SO2202]
          Length = 768

 Score =  332 bits (850), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 196/617 (31%), Positives = 326/617 (52%), Gaps = 40/617 (6%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWL-NPYNFNPVIGYPGAD-- 70
           P   LT ++RE  F+ W+ S+   +R ++KS T L C   WL N  N   ++GYP A   
Sbjct: 138 PLTGLTVREREKVFLGWAQSRIPLLRGLHKSLTQL-CRVIWLRNSPNLEAILGYPRAPIY 196

Query: 71  PEANGSRFSSRNFPKYNFLEIS---DHDSDIKEFDTXXXXXXXXXXXXXXRLARME-NVL 126
            +A  S +S      ++FL+I      +  + E D                LA     VL
Sbjct: 197 AKAAPSGYS------FHFLQIPPPVSAEPKVIETDVLIVGSGCGGAVAAKTLAEAGLKVL 250

Query: 127 VIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEP 186
           V+EK +++        +++    L++  G +++DD++M V+AG+ +GGG T+ WSA ++P
Sbjct: 251 VVEKQYYWSPEHFPMGEREATTHLFDNGGAIISDDASMTVVAGTTWGGGGTVNWSASLQP 310

Query: 187 QYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHS 246
           Q FVR EWA+ FGL +F    +   + ++  R+G +T NI HN+ N  L+ G +KLG  +
Sbjct: 311 QGFVRREWAQKFGLTHFTTSAFQADLDFVCDRMGVSTTNITHNKGNIVLLEGARKLGWAA 370

Query: 247 DNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGK 306
             + QNT    H  G+C+ GC+   K+  T+T+L +A    A F++   V KIL D+   
Sbjct: 371 KAVAQNTGGEVHHDGFCTRGCRTCSKKGPTVTFLPDAADAGATFMEGFEVTKILFDEKNT 430

Query: 307 S------------QKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIG 354
           +              + GV       + V I AKR ++SAG+++SP LL RSGLKNK+IG
Sbjct: 431 TVATGVKGIWTSRDSMSGVSGTDRTTREVIIKAKRTIISAGSVYSPLLLQRSGLKNKHIG 490

Query: 355 RNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFAN 414
           R+L +HP+  V  V+ +++++ + G I++++ N  EN+DG+ YG K+   +  P      
Sbjct: 491 RHLRLHPVNMVAAVW-DEDVRPWEGAILTSVVNEFENMDGDGYGTKLECTTMLPSSFLPL 549

Query: 415 FPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTD-ENGKPRLEYKLSQHDSKSMVAG 473
           F W+  L  K+   +   +   + + RDR GGR+ TD ++G  R++Y  S++D K ++ G
Sbjct: 550 FDWQGGLSFKEFTAKMRRMTGYIALARDRYGGRVYTDAKDGSCRIQYTPSKYDQKHILEG 609

Query: 474 LLTAVRILAAAGATKIGTCQTVIDDYI-----------VENGVNP-LNDPKFDQFLNKIK 521
           ++    I+   GA +I      I  ++           +    +P + D  F  ++ +++
Sbjct: 610 VVRLAEIMYVEGAREIHIAAPGIPPFVRPASDTDSKIFIHTNASPSVTDVDFAAWIAQVR 669

Query: 522 KVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSM 581
               P+  T   +  QM SCRMG  P+ S V+  G  W+ + LYVAD+SV P+A+GV  M
Sbjct: 670 ANAFPSPGTGFFSAHQMGSCRMGTAPHNSVVDHRGRVWDTQGLYVADASVFPSASGVNPM 729

Query: 582 MTTMNIAHYISKCILDK 598
           +T M IA  I++ I ++
Sbjct: 730 ITNMGIARGIARGIAEE 746



>gi|475677371|gb|EMT74381.1| Long-chain-alcohol oxidase FAO2 [Fusarium oxysporum f. sp. cubense
           race 4]
          Length = 692

 Score =  331 bits (849), Expect = 5e-88,   Method: Compositional matrix adjust.
 Identities = 192/595 (32%), Positives = 309/595 (51%), Gaps = 24/595 (4%)

Query: 15  FHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADPEAN 74
           F +L+ + R      W  S  A++R ++K  +++    +  +   FN V+G+P   P  +
Sbjct: 86  FCDLSIQDRTLVLNSWQRSSLATLRVLFKQLSIIGKHVYLRSSTLFNEVVGFPSTPPGWH 145

Query: 75  GSRFSSRNFPKYNFLEISDHDSDIKEFDTXXXXXXXXXXXXXXRLARM--ENVLVIEKGH 132
                S     + F++ ++ D  ++                  R   M    VLV++KGH
Sbjct: 146 PVESYS-----FEFMQFNNSDYHVQLDTDVVIVGSGCGAGVVARTIAMAGHRVLVVDKGH 200

Query: 133 HYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVRE 192
           H++   L  +Q  GY  L+E  G + ++D ++  LAGS FGGG T+ WSA ++ Q  VR+
Sbjct: 201 HFETSSLPLDQSAGYFHLFEQGGLVSSEDGSISTLAGSCFGGGGTVNWSACLQLQNTVRD 260

Query: 193 EWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQN 252
           EWA   GL +F   ++   +  +  R+G +   I  N  N  L+ G ++LG  +  +PQN
Sbjct: 261 EWADERGLGFFKSAKFQAHLDSVCERMGVSNEPINQNHGNSVLLEGGRRLGYSARPVPQN 320

Query: 253 TASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQKVMG 312
           T +  HQ G+CS GC  G+KQ     WL +A    AKF+   YV ++L  K G  +   G
Sbjct: 321 TGNCDHQDGYCSMGCWMGKKQGPVNGWLPDAARCGAKFISGFYVNRVLFKKHGGRKVATG 380

Query: 313 VEVIIN-------NIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAV 365
           V            + + V I+AKRVV+SAG++ SP +L  SGLKN +IGRNLH+HP + V
Sbjct: 381 VTGTWRPRVGPDASARSVTINAKRVVISAGSLCSPIVLKNSGLKNNHIGRNLHLHPTSFV 440

Query: 366 YGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQ 425
             +F  +E + + G I++++ ++ +N+DG  +G ++   +  P        W S  ++K 
Sbjct: 441 SAIF-EQETRPWEGGILTSVVSSFDNIDGHGHGVRLERPAMLPSMCLTWCNWTSGPEYKA 499

Query: 426 LMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAGLLTAVRILAAA 484
           ++ +Y ++   + ITRDR  G +  D  NG PRL Y  S+ D+ + + G+L   +IL   
Sbjct: 500 MISKYRHMEAYIAITRDRHSGHVTADPINGTPRLVYTPSKFDASNNLKGMLALAKILYTQ 559

Query: 485 GATKIGTCQTVIDDYI-----VENGVNPLN---DPKFDQFLNKIKKVGIPTYQTCTGTIE 536
           GAT+I      ++ +I     + +G +  +   DP F Q+L K++  G  T  T  G+  
Sbjct: 560 GATEIHPILPGLEPFIRQQESLSDGAHSPSEAIDPGFSQWLKKMEAHGNKTPDTPYGSAH 619

Query: 537 QMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYI 591
           QM +CRM        V+  G  W  ENL VAD+SV P+A+GV  M+TTM I  +I
Sbjct: 620 QMGTCRMSTKEADGVVDECGRVWGCENLIVADASVFPSASGVNPMITTMAICEHI 674



>gi|501303027|dbj|GAC92532.1| choline dehydrogenase [Pseudozyma hubeiensis SY62]
          Length = 773

 Score =  330 bits (845), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 196/633 (30%), Positives = 313/633 (49%), Gaps = 57/633 (9%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADPE- 72
           PF +L +  RE     W TS+   +RK       +I  T++ N       IGYP   P+ 
Sbjct: 120 PFTQLDRPTREKIIFGWFTSRLTLLRKASAGLRGIILLTYYRNHQPAWEAIGYPDGRPDD 179

Query: 73  -----ANGSRFSSRNFPKYNFL--EISDHDSD---IKEFDTXXXXXXXXXXXXXXRLA-R 121
                  G    +     Y F   +++   S    I + +                LA R
Sbjct: 180 WTRPIQGGEAAPAAPIYDYKFENEKVAAQPSGSEIIVDTEVLVIGSGSGGGVAGSYLAQR 239

Query: 122 MENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWS 181
               L+++KG +     +   +  GY  LYE  G + ++D ++ +LAGS FGGG++I WS
Sbjct: 240 GVRTLIVDKGIYLHPDKVVGREDQGYGLLYEGEGILPSEDGSINILAGSTFGGGSSINWS 299

Query: 182 AFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKK 241
           A ++P++FVR  WA+ +G+PY+    + + +  +  R+G     I HN  N  L  G ++
Sbjct: 300 ASLKPRHFVRRAWAEKYGVPYYNSPYFTSDLNAVCTRMGVAVAPIRHNIGNSLLALGGQR 359

Query: 242 LGLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILI 301
            G   + +PQN+   TH CG C  GC  G KQ   ++WL +A    A F+ NCYVE+IL 
Sbjct: 360 AGHPVEPVPQNSGGHTHYCGKCQLGCISGHKQGGIVSWLKDAAEAGAAFMTNCYVERILF 419

Query: 302 DKDGKSQKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSG-LK-NKNIGRNLHV 359
           DK+   ++ +G    ++  K   + +K VVVS+G++ +PALLLRS  LK NK IG+ L +
Sbjct: 420 DKN---KRAIGALATVDGRKIKILASKGVVVSSGSLQTPALLLRSPELKTNKMIGQTLRL 476

Query: 360 HPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKS 419
           HP   V G + N  +  + G +++ + N+ E VD + +G KI V +  P    A   + S
Sbjct: 477 HPATVVTGYY-NFPVNPWEGGLLTMVDNSAEMVDKDGWGCKIEVVASSPSIHAAFNNFAS 535

Query: 420 NLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGLLTAVR 479
             +HK  ML+Y++   +++I RDR+ GRI+ DE G+ R+EY +S+ D +S++ G+L    
Sbjct: 536 PKEHKSRMLQYSHSYTMVIICRDRDSGRIVLDERGQARIEYTISKFDQRSLLQGILRGAD 595

Query: 480 ILAAAGATKIGTCQTVIDDYI--------------------------------------- 500
               AGA  I T Q  +  ++                                       
Sbjct: 596 AHLMAGAEVICTAQAAVPAFVASSLSTTKPRTHNGAPNLPAPPADSIFTETTQVPATFTP 655

Query: 501 VENGVNPLNDPKFDQFLNKIKKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWE 560
           VE     LNDP + ++  ++   G   Y    G+  QM+SCRMG +P  SA++P G  W 
Sbjct: 656 VETAPRDLNDPAYKEWQKQVSTAGAAPYILSIGSAHQMASCRMGAEPKISALDPEGRVWG 715

Query: 561 VENLYVADSSVLPTATGVPSMMTTMNIAHYISK 593
            +NL+VAD+S +  ++GV  M+TTM  A  +++
Sbjct: 716 AKNLWVADASAMCESSGVNPMITTMATARGVAR 748



>gi|71007921|ref|XP_758170.1| hypothetical protein UM02023.1 [Ustilago maydis 521]
 gi|46097452|gb|EAK82685.1| hypothetical protein UM02023.1 [Ustilago maydis 521]
          Length = 772

 Score =  328 bits (841), Expect = 3e-87,   Method: Compositional matrix adjust.
 Identities = 200/632 (31%), Positives = 313/632 (49%), Gaps = 56/632 (8%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPG--AD- 70
           PF +L +  RE   + W TS+   +R        +I   ++ N       IGYP   AD 
Sbjct: 120 PFTQLDRLTREKVILGWLTSRLTLLRMASAGLKGIILLVYYRNHQPAWEAIGYPDGRADD 179

Query: 71  ---PEANGSRFSSRNFPKYNFL--EISDHDSD---IKEFDTXXXXXXXXXXXXXXRLA-R 121
              P   G          Y F   +I+   +    I + +                LA R
Sbjct: 180 WTRPTQGGEVTPPTPVYDYKFENDKIAAQATGSEIIVDTEVLVIGSGSGGGVAGSYLAQR 239

Query: 122 MENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWS 181
               L+++KG +     +   +  GY  LYE  G + +++ ++ +LAGS FGGG++I WS
Sbjct: 240 GIRTLIVDKGIYLHPDKVVGREDQGYSLLYEGEGILPSENGSINILAGSTFGGGSSINWS 299

Query: 182 AFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKK 241
           A ++P++FVR  WA+ +G+PY+    + + +  +  R+G     I HN  N  L  G ++
Sbjct: 300 ASLKPRHFVRRTWAEKYGVPYYNSPYFTSDLNAVCTRMGVAVAPIRHNIGNSLLALGAQR 359

Query: 242 LGLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILI 301
            G   + +PQN+   TH CG C  GC  G KQ   ++WL +A    A F+ NCYVE+IL 
Sbjct: 360 AGHPVEPVPQNSGGHTHYCGKCQLGCISGHKQGGIVSWLKDAAEAGAAFMTNCYVERILF 419

Query: 302 DKDGKSQKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSG-LK-NKNIGRNLHV 359
           DK+   ++ +G    ++  K   + AK VVV++G++ +PALLLRS  LK NK IG+ L +
Sbjct: 420 DKN---KRAIGALATVDGRKIKILAAKGVVVASGSLQTPALLLRSPELKTNKMIGQTLRL 476

Query: 360 HPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKS 419
           HP   V G + N  IK + G +++ + N+ E VD + +G KI V +  P    A   + S
Sbjct: 477 HPATVVTGYY-NFPIKPWEGGLLTMVDNSAEMVDKDGWGCKIEVIASSPSIHAAFNNFAS 535

Query: 420 NLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGLLTAVR 479
             +HK  ML+Y++   +++I RDR+GGR++ DE G  R++Y +S  D +S+V G+L    
Sbjct: 536 AKEHKSRMLQYSHSYTMVIICRDRDGGRVVLDEKGLARVDYTISSFDQRSLVQGILRGAD 595

Query: 480 ILAAAGATKIGTCQTVIDDYIVE---------NGV------------------------- 505
               AGA  IGT QT +  ++           NG                          
Sbjct: 596 AHLMAGAEVIGTAQTAVPAFVASSLSSAKPPTNGAPALPPPPSDSIYTETTQVPATFTPV 655

Query: 506 ----NPLNDPKFDQFLNKIKKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEV 561
                 LNDP + ++  K+   G   Y    G+  QM+SCRMG +P  SA++P G  W  
Sbjct: 656 QTVPRDLNDPAYKEWQKKVSAAGAQPYILSMGSAHQMASCRMGANPKMSALDPEGRVWGA 715

Query: 562 ENLYVADSSVLPTATGVPSMMTTMNIAHYISK 593
           +NL+VAD+S +  A+GV  M+T M  A  +++
Sbjct: 716 KNLWVADASAMCEASGVNPMITAMATARGVAR 747



>gi|384483270|gb|EIE75450.1| hypothetical protein RO3G_00154 [Rhizopus delemar RA 99-880]
          Length = 596

 Score =  328 bits (841), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 186/492 (37%), Positives = 279/492 (56%), Gaps = 15/492 (3%)

Query: 15  FHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLIC-ATFWLNPYNFNPVIGYPGADPEA 73
           F  L+   RE   + W  S  A +R +YKSF  L C   F  +   F   + Y     + 
Sbjct: 111 FKNLSLADREKAVLGWKNSYVAPLRGMYKSFHSLACHPAFKEHSKTFAEAMHY-DLKTDT 169

Query: 74  NGSRFSSRNFPKYNFLEISDHDSDIKEFDTXXXXXXXXXXXXXXRLARM-ENVLVIEKGH 132
                  R  P  +F E+ D   D+  FD               +LA+  ++VLVIEKG 
Sbjct: 170 VYENIPER-LPMLSFDEVKD---DL-HFDVIIIGSGGGGGVVAGQLAQAGKSVLVIEKGK 224

Query: 133 HYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVRE 192
           ++ + D   ++QD +  LYE      T + ++ + AGS FGGGTT+ W+A ++ Q+FVRE
Sbjct: 225 YFHEDDFFHQEQDAFVNLYENGSFSPTLNGSVSIAAGSVFGGGTTVNWAACLKLQHFVRE 284

Query: 193 EWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQN 252
           EWAK  GL YFM  ++   +  +  R+G  T  I HN SNQ L++GCK LG    +IPQN
Sbjct: 285 EWAKQ-GLSYFMSPKFSKDLDKVFDRIGATTEGIKHNGSNQVLVDGCKALGYPVADIPQN 343

Query: 253 TASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQKVMG 312
           T    H C +C  GC+ G K S   +WL +A  + AKFL    V+K+LI+K     + +G
Sbjct: 344 TGGRPHDCHFCFGGCRAGIKNSTMNSWLRDAHQHGAKFLDKTKVKKVLIEKG----RAVG 399

Query: 313 VEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYGVFPNK 372
           VE ++N  ++V+I A +VVVSAG++ SP +LLRSGLKNK IG+NL +HP    +G F +K
Sbjct: 400 VECLMNYERKVRIKADQVVVSAGSLQSPGVLLRSGLKNKQIGQNLRLHPCTITFGYF-DK 458

Query: 373 EIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQLMLEYNN 432
           +I+T+ G+IM+A+S   EN + + YG K+ +   HPG      PW+    HK+LM+ Y +
Sbjct: 459 KIRTFEGSIMTAVSTVAENPENDGYGCKLEIPCVHPGSYSTCVPWRGAAAHKELMMRYEH 518

Query: 433 IVPLMVITRDREG-GRILTDENGKPRLEYKLSQHDSKSMVAGLLTAVRILAAAGATKIGT 491
             P++++TRD++  G +  D++     +YKLS  DS+SM+ G+  +V IL AAGA +I  
Sbjct: 519 CTPILILTRDKDSRGTVQYDKDENLIADYKLSPRDSRSMLEGIARSVEILVAAGAREIHA 578

Query: 492 CQTVIDDYIVEN 503
            Q  ++ +  E+
Sbjct: 579 PQYGVEPFKFES 590



>gi|511006579|gb|EPB87888.1| hypothetical protein HMPREF1544_05295 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 704

 Score =  327 bits (838), Expect = 7e-87,   Method: Compositional matrix adjust.
 Identities = 201/601 (33%), Positives = 315/601 (52%), Gaps = 29/601 (4%)

Query: 13  KPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTML-ICATFWLNPYNFNPVIGYPGADP 71
           KPF ++ +++RE   +KW+ S +A  R+IY S   L +   ++ +       + Y G   
Sbjct: 106 KPFKDIPRREREQIVMKWNKSSFAVFRQIYNSLMGLSLTEAYFSHDTALYQGLYYDGI-- 163

Query: 72  EANGSRFSSRNFPKYNFLE------ISDHDS----DIKEFDTXXXXXXXXXXXXXXRLAR 121
              G     +  P Y  ++      I+D +         FD               +LA 
Sbjct: 164 --QGGYKHFQQQPDYQPIQHDRLKMITDQEEVAALSSMTFDVIIVGSGAGGGVVAAQLAE 221

Query: 122 ME-NVLVIEKGHHYDQCDLSTE-QQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIG 179
              +VLV+EKG +Y Q D+  +  Q  +  +YE  G        + VL+GS FGGGT I 
Sbjct: 222 AGFSVLVVEKGKYYHQQDMVPDNDQYAFSTMYEDGGISPNSTGTVNVLSGSTFGGGTAIN 281

Query: 180 WSAFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGC 239
           + A +EP   VR+ WA+  GLPYF   ++   +  +  R+G +T NI+HN  NQ LI+GC
Sbjct: 282 YLASLEPPDNVRKHWAETSGLPYFDSIQFQQDLTKVADRIGVSTDNIVHNGPNQKLIDGC 341

Query: 240 KKLGLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKI 299
           +KLG     +PQNTA  +H CG C  GC  G K S T TWL +A S+ A+FL    V  I
Sbjct: 342 RKLGHTVKTVPQNTAGRSHHCGKCYTGCAAGIKNSTTNTWLKDAASHGAQFLDCTRVNGI 401

Query: 300 LIDKDGKSQKVMGVEVIINNIKRV-KIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLH 358
           LI K     K +GV   I++ +++ ++  KR+VV+ GA+H+P+LL RSGL N NIG++L 
Sbjct: 402 LIKKG----KAVGVSCNIHHSQKIHRLFGKRIVVAGGALHTPSLLKRSGLSNPNIGQHLR 457

Query: 359 VHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWK 418
           +H  +   G++ ++      G +++ + +A EN +G ++G KI   +   G      PW 
Sbjct: 458 LHLSSICVGIY-DEATNPSQGALLTTVCDAFENWEGTHHGFKIECFTQGLGMFSGMVPWL 516

Query: 419 SNLQHKQLMLEYNNIVPLMVITRDREGG-RILTDENGKPRLEYKLSQHDSKSMVAGLLTA 477
              +HK+ ML Y N V    + RD++    +  D  GK  +   +S+HD+ ++V G++  
Sbjct: 517 GAAKHKETMLRYRNAVITFAMMRDKDSTCSVQYDPYGKLDISLDISKHDADNLVQGIVEM 576

Query: 478 VRILAAAGATKIGTCQTVIDDY-IVENGVNPLNDPKFDQFLNKIKKVGIPTYQTCTGTIE 536
            +I  AAGA +I   Q  ID +    N  + +++P+F +++   ++   P       +  
Sbjct: 577 AKIHVAAGARQIHVSQHSIDSFEFKANEASCVDNPRFLEWIKYARRQRAPV----PSSGH 632

Query: 537 QMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKCIL 596
           QM+SCRMG     SA    GE W+V  LYVADSS+ PTA GV  M+T   +A ++S+ I+
Sbjct: 633 QMASCRMGASSKTSATKSTGETWDVRYLYVADSSLFPTALGVNPMLTIEAMALHVSRHIV 692

Query: 597 D 597
           D
Sbjct: 693 D 693



>gi|482808186|gb|EOA85119.1| hypothetical protein SETTUDRAFT_20639 [Setosphaeria turcica Et28A]
          Length = 745

 Score =  327 bits (838), Expect = 9e-87,   Method: Compositional matrix adjust.
 Identities = 200/601 (33%), Positives = 318/601 (52%), Gaps = 43/601 (7%)

Query: 23  REHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYP----GADPEANGSRF 78
           R+     W  S+   +R+++ S  +L    +         V+G P    G  P       
Sbjct: 150 RQSILRSWQDSRIWPLRQLHSSLAVLSKQAWVKTSPALQRVLGVPRVPVGMKP------- 202

Query: 79  SSRNFPKYNFLEISDHDS-DIKEFDTXXXXXXXXXXXXXXRLARM-ENVLVIEKGHHYDQ 136
             +++  Y F+ I   D  ++ E D                LA +   VL++EKG+H+  
Sbjct: 203 -GKDY-DYEFIHIPPGDEPEVIETDVLVVGSGCGGGVSAKNLAEVGHRVLIVEKGYHWTP 260

Query: 137 CDLSTEQQDGYDKLYELSGGMLT-DDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVREEWA 195
                 Q DG++ L+ ++G  LT DD  + ++AG  +GGG T+ WSA ++ Q +VR EWA
Sbjct: 261 DHFPMTQADGWNHLF-MNGAFLTSDDGALSIVAGETWGGGGTVNWSASLQTQGYVRREWA 319

Query: 196 KNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQNTAS 255
              GLP+F   ++  ++  +  R+G +  +I HN +NQ L+ G +KLG  +  +PQNT  
Sbjct: 320 AQ-GLPFFTSADFQQSLDRVCERMGVSAEHIKHNPANQILLEGARKLGWTAKPVPQNTGG 378

Query: 256 ITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQKVMGVEV 315
             H CG C+FGC   EKQ   +++L +A    A+FL+  + EK+L   +  SQ   GVE 
Sbjct: 379 KQHYCGHCTFGCGSCEKQGPAVSFLPDAARAGARFLEGFHAEKVLFSNERGSQIATGVEG 438

Query: 316 I-----IN--------NIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPI 362
                 IN        N ++V I AKRVVVSAG + SP LL+RSGL N +IGRNL+VHP+
Sbjct: 439 TWVSRDINGGVAGTPMNRRKVVIKAKRVVVSAGTMQSPLLLMRSGLSNPHIGRNLYVHPV 498

Query: 363 AAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPW-KSN- 420
             V G +  ++IK + G I++++    EN+DG+ +G K+   +  P    A   W +SN 
Sbjct: 499 TFV-GAYHKQDIKPWEGGILTSVVGEFENLDGQGHGVKLEATNMAPS---ACLMWVQSNG 554

Query: 421 --LQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAGLLTA 477
             LQ+K       ++V  + I +DR+ GR+  D  +GK R  Y +S+ D + ++ GLL  
Sbjct: 555 GGLQYKLDAARLKHMVGYISIAKDRDSGRVYADPVDGKVRFSYPVSKFDRQHILEGLLGL 614

Query: 478 VRILAAAGATKIGTCQTVIDDYIVENGV---NPLNDPKFDQFLNKIKKVGIPTYQTCTGT 534
            +I    GA +I T Q  +  +I        + +ND +F  +L++++  G+P+ ++   +
Sbjct: 615 AKIQYVEGAEQIFTTQPGLRPFIRNPSAADGDGINDAEFQVWLDEVRAKGLPSPESMFIS 674

Query: 535 IEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKC 594
             QM +CRM        V+P G+ W  E LYVAD+SV P+A+GV  M+T M I+ +IS+ 
Sbjct: 675 AHQMGTCRMSARERDGVVDPQGKVWGTEGLYVADASVFPSASGVNPMVTNMAISDWISRG 734

Query: 595 I 595
           I
Sbjct: 735 I 735



>gi|121700595|ref|XP_001268562.1| long chain fatty alcohol oxidase, putative [Aspergillus clavatus
           NRRL 1]
 gi|119396705|gb|EAW07136.1| long chain fatty alcohol oxidase, putative [Aspergillus clavatus
           NRRL 1]
          Length = 752

 Score =  326 bits (836), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 191/623 (30%), Positives = 313/623 (50%), Gaps = 44/623 (7%)

Query: 3   LINSKILSIQ-KPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFN 61
           L+   I +IQ +PF     + RE  F  W TS+   +R IY++FT +   T+        
Sbjct: 132 LLTGSITAIQDQPF-----EVRERVFRSWETSRIKPLRAIYRAFTAIFKKTWISVSPTIR 186

Query: 62  PVIGYPGADPEANGSRFSSRNFP----KYNFLEISDHD-SDIKEFDTXXXXXXXXXXXXX 116
            V+G+P         R      P    +Y FL+    D  +I E D              
Sbjct: 187 LVVGFP---------RVPIHGKPADGFEYKFLQFPPGDKPEIIEADVVIVGSGCGGSVAA 237

Query: 117 XRLARME-NVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGG 175
             LA     VLV+EK +HY       +  +G+  ++E  G  ++DD +M VLAGS +GGG
Sbjct: 238 KNLAEAGYKVLVVEKSYHYPSKHFPMDFTEGFVNMFETGGATMSDDGSMAVLAGSTWGGG 297

Query: 176 TTIGWSAFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTL 235
            T+ WSA ++ Q +VR EWA N GLP+F   E+  ++ ++  R+G ++ +  HN +N+ L
Sbjct: 298 GTVNWSAALQTQGYVRREWASN-GLPFFESFEFQQSLDHVCERMGVSSEHTKHNFANRIL 356

Query: 236 INGCKKLGLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCY 295
           ++G +KLG  +  +PQNT    H CG+C+ GC   +K+  T T+L +A    A F++   
Sbjct: 357 LDGARKLGYAAKPVPQNTGGTAHYCGYCTMGCHSTDKKGPTETFLADAADAGATFVEGFR 416

Query: 296 VEKILIDKDGKSQKVMGVE-------------VIINNIKRVKIHAKRVVVSAGAIHSPAL 342
            EKIL  K    +   G++              +    + V I A +V+VS G + SP L
Sbjct: 417 AEKILFKKTKGGRVASGIQGTWTSRDSYLGTTGMDRETREVIIKADKVIVSCGTLQSPLL 476

Query: 343 LLRSGLKNKNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIV 402
           L+RSGLKN  IGRNL++HP+     VF  +EI+ + G  ++ + N  EN D + +G KI 
Sbjct: 477 LMRSGLKNPQIGRNLYLHPVVLSAAVF-EEEIRPWEGAALTTVVNEFENQDNQGHGVKIE 535

Query: 403 VGSHHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYK 461
             +  P      FPW+  L +K    +   +   + +T++R+ GR+  D  +G+ R+ Y 
Sbjct: 536 NVAMLPAVYLPTFPWRDGLDYKLWAAKLPRMTGFIALTKERDAGRVYPDPVDGRARISYS 595

Query: 462 LSQHDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIV------ENGVNPLNDPKFDQ 515
           +S +D K +V  L+   +I   +GA +  T    +  +I        N    +N+     
Sbjct: 596 VSAYDRKHIVEALVATAKIAYISGAKEFHTTSREMAPFIRPADASDPNAPEGVNNEALQA 655

Query: 516 FLNKIKKVG-IPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPT 574
           ++ ++++   +   +T   +  QM +CRMG   + S V+P  + W  + LYV D+SV P+
Sbjct: 656 WIAELRRQNPVDPERTLYASAHQMGTCRMGASSSTSVVDPNCQVWGAKGLYVMDASVFPS 715

Query: 575 ATGVPSMMTTMNIAHYISKCILD 597
           A+GV  M+T M IA + S+ + +
Sbjct: 716 ASGVNPMVTNMAIADWASQNVAE 738



>gi|477529356|gb|ENH81120.1| long chain fatty alcohol oxidase [Colletotrichum orbiculare MAFF
           240422]
          Length = 765

 Score =  326 bits (836), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 193/626 (30%), Positives = 314/626 (50%), Gaps = 51/626 (8%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPG-ADPE 72
           P H      RE     W TS+  ++R + KS  ++           F  +  Y    D +
Sbjct: 139 PVHLQPVHVRESILKAWQTSRLPNIRVLSKSLCLMAQKGAVQTSPLFRELTDYTDMPDFQ 198

Query: 73  ANGSRFSSRNFPKYNFLEI-SDHDSDIKEFDTXXXXXXXXXXXXXXRLARM-ENVLVIEK 130
            +G  F       +NFL+  S    ++ E D                LA     VLV++K
Sbjct: 199 THGEGFD------FNFLQFGSSASPEVIETDVVIVGSGCGGAVAAKVLAEAGHKVLVVDK 252

Query: 131 GHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFV 190
            ++Y    L   Q  G   LYE  G + +DD+++ ++AGS +GGG T+ WS  ++ Q FV
Sbjct: 253 SYYYPPSQLPMSQDAGCQYLYENGGFITSDDNSLNMVAGSCWGGGGTVNWSVSLQTQGFV 312

Query: 191 REEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIP 250
           R+EW++  GLP+F   ++ N++  +   +G +  +I HN  N+ L++G +KLG H+   P
Sbjct: 313 RKEWSEQRGLPFFTSPQFQNSLDKVCDFMGVSADHIRHNHRNKVLLDGSRKLGWHAATAP 372

Query: 251 QNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQKV 310
           QNT    H CG C  GC   EKQ  T++WL  A  + AKF++   VEK+  D+   S++ 
Sbjct: 373 QNTGGTEHYCGQCHLGCGSTEKQGPTVSWLPAAAGSGAKFIEGFEVEKVTFDESTGSKRA 432

Query: 311 MGV---------------EVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGR 355
            GV                +     + V + AK+V+VSAG++ SP +LLRSGL N++IGR
Sbjct: 433 TGVVGKWVSRDANGQTSGPLDQRTTREVIVKAKKVIVSAGSVSSPLVLLRSGLTNRHIGR 492

Query: 356 NLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANF 415
           NL+VHP   V G +  ++ K + G I+++  ++ E++D   +G K+      P  + ++ 
Sbjct: 493 NLYVHPCNFVGGYW-KEDAKPWEGGIITSYCSSFEDLDKAGHGVKLEPTCMIPYAILSSM 551

Query: 416 PWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAGL 474
           PW S L  K   L + +    + +TRDR+ GR+  D  +G+PR++Y +S  D  + + G+
Sbjct: 552 PWHSGLSAKLAELRFRHFGAFISLTRDRDPGRVYPDPISGRPRIDYVVSDFDRANTLEGV 611

Query: 475 LTAVRILAAAGATKIGTCQTVIDDYIVENGVNP-------------------------LN 509
           +   +I    GA++I      ++ ++ E+   P                         +N
Sbjct: 612 VALAKICYVEGASEIHAFFPGLEPFVKEDHAQPPEKSMADLSSSSHDGGDYDDGLLDGVN 671

Query: 510 DPKFDQFLNKIKKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADS 569
           DPKF  +L+K++KVG         +  QM +CRM  + ++  V P G  W  E L+VAD+
Sbjct: 672 DPKFVAWLDKLRKVGNAPPVAIFSSAHQMGTCRMAPNEDEGVVGPKGHVWGTEGLFVADA 731

Query: 570 SVLPTATGVPSMMTTMNIAHYISKCI 595
           SV P+A+GV  M+T M IA +I+  I
Sbjct: 732 SVFPSASGVNPMITNMAIADWIAGGI 757



>gi|240274407|gb|EER37923.1| long chain fatty acid oxidase [Ajellomyces capsulatus H143]
          Length = 666

 Score =  325 bits (834), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 199/618 (32%), Positives = 318/618 (51%), Gaps = 68/618 (11%)

Query: 23  REHTFIKWSTSQYASVRKIYKSF-------------TMLICATFWLNPYNFNPVIGYPGA 69
           RE  F  W+TS    +R +Y+S              T+     F   P NF PV GYP  
Sbjct: 59  REAIFRGWATSVLPPIRSLYRSLIALFHKAWVPLSPTLPAIIGFPRVPVNFTPVEGYP-- 116

Query: 70  DPEANGSRFSSRNFPKYNFLEISDHD-SDIKEFDTXXXXXXXXXXXXXXRLARM-ENVLV 127
                           Y F++    D ++    D                +A    NV+V
Sbjct: 117 ----------------YEFMQFPPGDNTEAIMTDVVIIGSGCGAAVAAKNIAEAGHNVIV 160

Query: 128 IEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQ 187
           +EK +++ +       ++G   L+E  G  ++DD ++ V++GS +GGG TI WSA ++ Q
Sbjct: 161 VEKSYYWSEKHFPMTMKEGALNLFENGGTSISDDGSVAVISGSVWGGGGTINWSASLQTQ 220

Query: 188 YFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSD 247
            +VR+EWA N GLP+F   E+  ++  +  R+G NT ++ HN +N  L+ G +KLG  + 
Sbjct: 221 SYVRQEWA-NKGLPFFTSAEFQRSLDRVCDRMGVNTEHVKHNHANHLLLEGARKLGYAAK 279

Query: 248 NIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKS 307
            +PQNT +  H CG C+ GC    K+   +T+L +A    A+F++  + E+IL  K+G +
Sbjct: 280 TVPQNTGNQEHNCGHCTLGCGSCGKKGPQVTFLADAARAGAQFIEGFHAERILF-KEGNA 338

Query: 308 ------------------QKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLK 349
                             + + G  VI    ++V I AK+V+V+ G++ SP LLLRSGLK
Sbjct: 339 GNCLAHAIEGTWTSRDLNRGISGKPVI---TRKVVIKAKKVIVACGSLQSPLLLLRSGLK 395

Query: 350 NKNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPG 409
           N  IGRNL++HP+  +  VF  +E+K + G I++A+ N  E++DG  +GAKI   +  P 
Sbjct: 396 NPQIGRNLYLHPVVLLSAVF-GEEMKPWEGAILTAVINEFEDLDGRGHGAKIETVTTVPS 454

Query: 410 FMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSK 468
           F    FPW + L++K+ + +  N+   + +TR+R GGR+  D  +G+ R+ Y  S  D K
Sbjct: 455 FFLPVFPWTNGLEYKRFVSKLRNMAGFITVTRERYGGRVYPDPVDGRCRISYTPSLFDRK 514

Query: 469 SMVAGLLTAVRILAAAGATKIGTCQTVIDDYI-----VENGVNP---LNDPKFDQFLNKI 520
           +M+  ++ A ++    GA +I T    I  +I       +   P   +N   F  ++ K+
Sbjct: 515 NMIEAIIGAAKVAYVCGAQEIYTSSRDIPSFIRPERSATDTCGPEAGINHAAFQAWIKKV 574

Query: 521 KKVGIPTY--QTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGV 578
           +    P     T   +  QM +CRMG  P  S V+P G+ W  E LYVAD+SV P+A+GV
Sbjct: 575 RHTYSPLSPEHTVFASAHQMGTCRMGTSPKSSVVSPSGKVWGTEGLYVADASVFPSASGV 634

Query: 579 PSMMTTMNIAHYISKCIL 596
             M+T M I+ + ++ IL
Sbjct: 635 NPMVTNMAISDWTTQNIL 652



>gi|451852893|gb|EMD66187.1| hypothetical protein COCSADRAFT_295770 [Bipolaris sorokiniana
           ND90Pr]
          Length = 745

 Score =  325 bits (832), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 193/595 (32%), Positives = 320/595 (53%), Gaps = 32/595 (5%)

Query: 23  REHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADPEANGSRFSSRN 82
           RE     W +++   +R++ +S T+L C   W+     +PV+      P         + 
Sbjct: 151 RESILHAWGSARLGPLRQMRRSLTIL-CKQAWIK---TSPVLRRVVGLPRVPIGMRPGKG 206

Query: 83  FPKYNFLEISDH-DSDIKEFDTXXXXXXXXXXXXXXRLARM-ENVLVIEKGHHYDQCDLS 140
           F  Y F++I    D ++ E D                LA     VL++EK +H+      
Sbjct: 207 F-NYEFIQIPPGGDPEVIETDVLVVGSGCGGGVSAKNLAEAGHRVLIVEKAYHWTPDHYP 265

Query: 141 TEQQDGYDKLYELSGGMLT-DDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVREEWAKNFG 199
             + DG+  L+ +SG  LT DD+++ V+AG + GGG T+ WSA ++ Q +VR EWA   G
Sbjct: 266 MTEVDGWHHLF-MSGSFLTSDDASVSVVAGQSLGGGGTVNWSASLQTQGYVRREWAAR-G 323

Query: 200 LPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQNTASITHQ 259
           L +F   ++  ++  +  R+G +T +I  N  N  L++G +KLG ++  +PQNT    H 
Sbjct: 324 LHFFTSADFQQSLDRVCDRMGVSTEHINQNPGNMMLLDGARKLGWNAKPVPQNTGGRQHY 383

Query: 260 CGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQKVMGVEVI--- 316
           CG+C+FGC   EKQ   +++L +A    AKFL+  + EK++       Q  MGVE     
Sbjct: 384 CGYCNFGCGSCEKQGPVVSFLPDAARAGAKFLEGFHAEKVVFSTQNGQQVAMGVEGTWVS 443

Query: 317 --IN--------NIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVY 366
             IN        N ++V I AKRV+VSAG + SP LL+RSGLKN  IG+NL++HP+    
Sbjct: 444 RDINGGVAGSPVNRRKVLIKAKRVIVSAGTLQSPLLLMRSGLKNPRIGQNLYLHPV-TFL 502

Query: 367 GVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHP--GFMFANFPWKSNLQHK 424
           G +   EIK + G I++A+    EN+DG+ +GAK+   +  P  G M+ +  WK  LQ K
Sbjct: 503 GAYHKAEIKPWEGGILTAVVGEFENLDGKGHGAKLEATNMIPSAGLMWVD--WKGGLQWK 560

Query: 425 QLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAGLLTAVRILAA 483
                  ++V  + I +D++ GR+  D  +G+ R+ Y++S+ D ++++ G+L   +I   
Sbjct: 561 LGAARLKHMVGYISIVKDKDAGRVYPDPIDGRVRVSYQVSKFDRQNIMEGILALAKIQYI 620

Query: 484 AGATKIGTCQTVIDDYIVENGV---NPLNDPKFDQFLNKIKKVGIPTYQTCTGTIEQMSS 540
            GA +I T    +  ++ +      + +N+P+F  +L +++  G  + ++   +  QM +
Sbjct: 621 EGAEEIFTTIPGLRSFVRDPSAPLGDGINNPEFQAWLAEVEAKGFQSPESMFVSAHQMGT 680

Query: 541 CRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKCI 595
           CRM     +  V+P G+ W  E LYVAD+SV P+A+GV  M+T M I+ +IS+ +
Sbjct: 681 CRMSAQEWEGVVDPQGKVWGTEGLYVADASVFPSASGVNPMVTNMAISDWISRGV 735



>gi|406859722|gb|EKD12785.1| hypothetical protein MBM_09014 [Marssonina brunnea f. sp.
           'multigermtubi' MB_m1]
          Length = 1715

 Score =  324 bits (831), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 194/609 (31%), Positives = 305/609 (50%), Gaps = 34/609 (5%)

Query: 15  FHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPY-NFNPVIGYP------ 67
           FHE     R      W TS   +++  YK  T  +    W+    NF P+ G+P      
Sbjct: 143 FHEQPIATRTQILNSWRTSSLPALQAGYKQLT-FVAKNLWIKTSPNFYPITGFPKVPDHY 201

Query: 68  --GADPEANGSRFSSRNFPKYNFLEISDHDSDIKEFDTXXXXXXXXXXXXXXRLARM-EN 124
             GA  E    +F    F      +  + +S++ E +                LA     
Sbjct: 202 TPGAHFEYQFEQFGHEGFEAGRGGK--EGESEVYETEILIVGSGCGGGVCAKNLAEAGHQ 259

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           VLV++K +++    L   ++DG   LY   G + +DD++M V+AGSN+GGG TI WSA +
Sbjct: 260 VLVVDKSYYFSPSQLPMSEKDGGIHLYVDGGVVSSDDASMIVIAGSNWGGGGTINWSASL 319

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +PQ FVR EW+K+ GLP F   ++  ++  +  R+G +  +I HN  NQ L+ G ++LG+
Sbjct: 320 QPQSFVRNEWSKDRGLPLFTSQDFQESLDRVCGRMGVSDKHIRHNHGNQVLMEGARRLGM 379

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD 304
               +PQNT    H CG C+ GC   EKQ   ++WL +A+   AKF +   VEKIL +  
Sbjct: 380 TYKAVPQNTGGNEHFCGHCTLGCGAAEKQGPVVSWLPDAQRAGAKFAEGFTVEKILFENV 439

Query: 305 GKSQKVMGVE---VIIN------------NIKRVKIHAKRVVVSAGAIHSPALLLRSGLK 349
           G  +  +G +   V  N                V I AKRV++SAG + SP +L  SGL 
Sbjct: 440 GGKKTAVGAKGTWVSRNKNGGVDGLDTDRTTASVIIRAKRVIISAGTLWSPVILQNSGLT 499

Query: 350 NKNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPG 409
           NK+IGRNL++HP+  V  V+P ++++ + G I++++  + EN+D   +GAK+      P 
Sbjct: 500 NKHIGRNLYLHPVNTVSAVYP-EDVRPWEGGILTSVVGSLENLDQHGHGAKLETTCMMPS 558

Query: 410 FMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTD-ENGKPRLEYKLSQHDSK 468
           +      W + L  K   L+Y ++   + I RDR+ GR+  D + G PR++Y  S  D  
Sbjct: 559 WCLTFMNWNNGLDWKLQALKYRHMNSFISIVRDRDTGRVYKDPDTGFPRIDYTPSVFDRA 618

Query: 469 SMVAGLLTAVRILAAAGATKIGTCQTVIDDYIV----ENGVNPLNDPKFDQFLNKIKKVG 524
             + G++   RI    GA+++         +I     +       + +FD +L  +KK G
Sbjct: 619 HALEGVIALGRINFIMGASEVHVAIAGTPPFIRTTPGKEETPEETEVRFDAWLEDVKKRG 678

Query: 525 IPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTT 584
                    +  QM +CRM    N   V+  G+ W  E LYV+D+SV P+A+GV  M+T 
Sbjct: 679 NKPPAGIFASAHQMGTCRMSRRANMGVVDMRGKVWGTEGLYVSDASVFPSASGVNPMITN 738

Query: 585 MNIAHYISK 593
           M I+ +IS+
Sbjct: 739 MAISDWISR 747



>gi|398407357|ref|XP_003855144.1| hypothetical protein MYCGRDRAFT_37086 [Zymoseptoria tritici IPO323]
 gi|339475028|gb|EGP90120.1| hypothetical protein MYCGRDRAFT_37086 [Zymoseptoria tritici IPO323]
          Length = 762

 Score =  324 bits (830), Expect = 6e-86,   Method: Compositional matrix adjust.
 Identities = 189/615 (30%), Positives = 325/615 (52%), Gaps = 46/615 (7%)

Query: 18  LTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNP-VIGYPGADPEANGS 76
           L  + RE   + W+ S+   +R +++S T L  A +W+   +  P ++ +P    +A   
Sbjct: 140 LPIRDREQIILGWARSRIPLLRGLHRSLTSLSRA-YWMRTSSTLPRLLAHPNTPIDAA-- 196

Query: 77  RFSSRNFPKYNFLEI---SDHDSDIKEFDTXXXXXXXXXXXXXXRLARME-NVLVIEKGH 132
              +  F ++ F++I   +  D ++ E D                LA     V+V+EK +
Sbjct: 197 -LPNAGF-EFRFIQIPPSAPEDVEVIETDVVIVGSGCGGAVVAKILAEAGLRVIVVEKSY 254

Query: 133 HYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVRE 192
           ++    L   + D    L+   GG +++DS M V+ G  +GGG  + WSA ++PQ FVR 
Sbjct: 255 YWSPEYLPMTEADAPYLLFGNGGGHISNDSTMTVVPGQTWGGGGVVNWSASLQPQGFVRR 314

Query: 193 EWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQN 252
           EW++ FGL +F    +   +  +  R+G    N+ HN++N  L+ G +KLG  +  +PQN
Sbjct: 315 EWSEKFGLKHFTTSAFQADLDAVCERMGVGLTNVKHNKANTVLMEGARKLGWSAKPVPQN 374

Query: 253 TASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILI---DKDGKSQK 309
           T    H  G+C+ GC+   K+  T+T+L +A    A+F++   V++IL    + DG  Q 
Sbjct: 375 TGGELHPDGYCTRGCRSCGKKGPTVTFLPDAAKCGARFIEGFDVQEILFGATNPDGTKQT 434

Query: 310 ---------------VMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIG 354
                          V G +V     +++ I+A+R ++S G++++P LL RSGLKN++IG
Sbjct: 435 TGIKGIWTSRDGHGGVAGPDV---TRRQLIINARRTIISGGSVYTPILLSRSGLKNRHIG 491

Query: 355 RNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFAN 414
           R+L +HP+A +  V+ +++++ + G I++++ N  EN+DGE YGAK+   +  P      
Sbjct: 492 RHLRLHPVAMLGAVW-DEDVRPWEGAILTSVCNEFENLDGEGYGAKLEATTMMPSSFLPL 550

Query: 415 FPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTD--ENGKPRLEYKLSQHDSKSMVA 472
           FPW   LQ K+   +   +   + + RDR GGR+  D  E G+  ++Y  S++D + ++A
Sbjct: 551 FPWTGGLQFKEFTAKMRRMTGYIALARDRYGGRVFPDPKEPGRAIIQYHPSKYDKQHILA 610

Query: 473 GLLTAVRILAAAGATKIGTCQTVIDDYI-----------VENGVNP-LNDPKFDQFLNKI 520
           GL+    I+   GA +I      ++ ++           V +  +P ++D  F  +L+K+
Sbjct: 611 GLVGLAEIMYVEGAREIFATIPGLEPFVRPSSDAAANISVHSTASPSVSDEAFQSWLHKL 670

Query: 521 KKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPS 580
           K +G P   T   +  QM SCRMG   + S V+  G+ W  E LYVAD+SV P+A+GV  
Sbjct: 671 KTIGFPYPDTGFISAHQMGSCRMGSSKHNSVVDGKGKVWGAEGLYVADASVFPSASGVNP 730

Query: 581 MMTTMNIAHYISKCI 595
           M+T M IA  I++ I
Sbjct: 731 MITVMGIARGIARGI 745



>gi|443899677|dbj|GAC77008.1| hypothetical protein PANT_22d00298 [Pseudozyma antarctica T-34]
          Length = 766

 Score =  324 bits (830), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 201/634 (31%), Positives = 312/634 (49%), Gaps = 66/634 (10%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADPE- 72
           PF +L +  RE     W TS+   +RK       +    ++ N       IGYP   P+ 
Sbjct: 120 PFAQLDRATREKIIFGWFTSRLTLLRKASAGLKGITLLVYYRNHQPAWEAIGYPDGRPDD 179

Query: 73  -----ANGSRFSSRNFPKYNFL--EISDHDSD---IKEFDTXXXXXXXXXXXXXXRLA-R 121
                  G    + +   Y F   +I+   S    I + +                LA R
Sbjct: 180 WTRPSQGGEASPAVSVYDYKFENEKIAAQPSGSEIIVDTEVLVIGSGSGGGVAGSYLAQR 239

Query: 122 MENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWS 181
               L+++KG +     +   +  GY  LYE  G M ++D ++ +LAGS FGGG++I WS
Sbjct: 240 GVRTLIVDKGIYLHPDKVVGREDQGYGLLYEGEGIMPSEDGSINILAGSTFGGGSSINWS 299

Query: 182 AFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKK 241
           A ++P++FVR+ W+  +G+PY+    + + +  +  R+G     I HN  N  L  G ++
Sbjct: 300 ASLKPRHFVRKAWSDKYGVPYYNSPYFTSDLNAVCTRMGVAVAPIRHNVGNSLLALGAQR 359

Query: 242 LGLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILI 301
            G   + +PQN+   TH CG C  GC  G KQ   ++WL +A    A F+ NCYVE++L 
Sbjct: 360 AGHPVEPVPQNSGGHTHYCGKCQLGCISGHKQGGVVSWLRDAAEAGAAFMTNCYVERVLF 419

Query: 302 DKDGKSQKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSG-LK-NKNIGRNLHV 359
           DK+   ++ +G    ++  K   + AK VVVS+G++ +PALLLRS  LK NK IG+ L +
Sbjct: 420 DKN---KRAVGALATVDGRKVKILAAKGVVVSSGSLQTPALLLRSPELKSNKMIGQTLRL 476

Query: 360 HPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGF--MFANFPW 417
           HP   V G + N  IK + G +++ + N+ E VD + +G KI V +  P     F+NF  
Sbjct: 477 HPATVVTGYY-NFPIKPWEGGLLTMVDNSAEMVDKDGWGCKIEVIASSPSIHAAFSNF-- 533

Query: 418 KSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGLLTA 477
            S   HK  ML Y++   +++I RDR+ GRI+ D+ GK R+EY +S  D +S++ G+L  
Sbjct: 534 SSAKDHKSRMLRYSHSYTMVIICRDRDSGRIVLDDQGKARVEYTISPFDQRSLIQGILRG 593

Query: 478 VRILAAAGATKIGTCQTVIDDYIVEN--GVNP---------------------------- 507
                 AGA  I T QT +  +   +   V P                            
Sbjct: 594 ADAHLMAGAEAISTVQTGVPAFEAASLGSVQPPSSGAPAPAPPTSDSIYTETTQVPATWT 653

Query: 508 --------LNDPKFDQFLNKIKKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAW 559
                   LN+P +  +  KI       Y    G+  QM+SCRMG +P  SA++P G  W
Sbjct: 654 PVQTVPRDLNNPAYKAWQQKIP------YICSIGSAHQMASCRMGGNPKISALDPEGRVW 707

Query: 560 EVENLYVADSSVLPTATGVPSMMTTMNIAHYISK 593
             +NL+VAD+S +P ++GV  M+TTM  A  +++
Sbjct: 708 GAKNLWVADASAMPESSGVNPMITTMATARGVAR 741



>gi|343428734|emb|CBQ72264.1| related to long chain fatty alcohol oxidase [Sporisorium reilianum
           SRZ2]
          Length = 771

 Score =  324 bits (830), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 202/632 (31%), Positives = 310/632 (49%), Gaps = 57/632 (9%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPG--AD- 70
           PF +L +  RE     W TS+    RK       +I   ++ N       IGYP   AD 
Sbjct: 120 PFAQLDRATREKIIFGWFTSRLTLFRKASAGLKGIILLVYYRNHQPAWEAIGYPDGRADD 179

Query: 71  ---PEANGSRFSSRNFPKYNFL--EISDHDSD---IKEFDTXXXXXXXXXXXXXXRLA-R 121
              P   G    +     Y F   +I+   S    I + +                LA R
Sbjct: 180 WTRPSQAGEAAPAAPVYDYKFENEKIAAQPSGSEIIVDTEVLVIGSGSGGGVAGSYLAQR 239

Query: 122 MENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWS 181
               L+++KG +     +   +  GY  LYE  G + ++D ++ +LAGS FGGG++I  S
Sbjct: 240 GVRTLIVDKGIYLHPDKVVGREDQGYGLLYEGEGILPSEDGSINILAGSTFGGGSSIN-S 298

Query: 182 AFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKK 241
           A ++P++FVR  WA+ +G+PY+    + + +  +  R+G     I HN  N  L  G ++
Sbjct: 299 ASLKPRHFVRRTWAEKYGVPYYNSPFFTSDLNAVCTRMGVAVAPIRHNIGNSLLALGAQR 358

Query: 242 LGLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILI 301
            G   + +PQN+   TH CG C  GC  G KQ   ++WL +A    A F+ NCYVE+IL 
Sbjct: 359 AGHPVEPVPQNSGGHTHYCGKCQLGCISGHKQGGVVSWLKDAAEAGAAFMTNCYVERILF 418

Query: 302 DKDGKSQKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSG-LK-NKNIGRNLHV 359
           DK+   ++ +G    ++  K   + AK VVVS+G++ +PALLLRS  LK NK IG+ L +
Sbjct: 419 DKN---KRAVGALATVDGRKIKILAAKGVVVSSGSLQTPALLLRSPELKTNKMIGQTLRL 475

Query: 360 HPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKS 419
           HP   V G + N  IK + G +++ + N+ E VD + +G KI V +  P    A   + S
Sbjct: 476 HPATIVTGYY-NFPIKPWEGGLLTMVDNSAEMVDKDGWGCKIEVIASSPSIHAAFNNFAS 534

Query: 420 NLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGLLTAVR 479
             +HK  ML Y++   +++I RDR+ GRI+ DE G+ R++Y +S  D +S+V G+L    
Sbjct: 535 PKEHKSRMLRYSHSYTMVIICRDRDSGRIVLDEKGQARIDYTISPFDRRSLVQGILRGAD 594

Query: 480 ILAAAGATKIGTCQTVIDDYI--------------------------------------V 501
               AG   I T Q  +  ++                                      V
Sbjct: 595 AHLMAGVEVICTAQAAVPAFVTSSLSAAKPPTNGTPAATIPPVDSIYTETTQVPATFTPV 654

Query: 502 ENGVNPLNDPKFDQFLNKIKKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEV 561
           E     LNDP +  +L K+   G   Y    G+  QM+SCRMG +P  SA++P G  W  
Sbjct: 655 ETVPRDLNDPAYKDWLKKVATAGAQPYILSIGSAHQMASCRMGANPKISALDPEGRVWGA 714

Query: 562 ENLYVADSSVLPTATGVPSMMTTMNIAHYISK 593
           +NL+VAD+S +P ++GV  M+TTM  A  +++
Sbjct: 715 KNLWVADASAMPESSGVNPMITTMATARGVAR 746



>gi|310798462|gb|EFQ33355.1| GMC oxidoreductase [Glomerella graminicola M1.001]
          Length = 767

 Score =  322 bits (825), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 197/632 (31%), Positives = 319/632 (50%), Gaps = 54/632 (8%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADPEA 73
           P H    + RE     W TS+  ++R + K+  +L   +       F  +  Y    PE+
Sbjct: 140 PVHLQPLEVREKILQAWQTSRMPTIRLLTKTICLLAQKSAVQTSPLFRELTDYSDV-PES 198

Query: 74  --NGSRFSSRNFPKYNFLEISDHDSD-IKEFDTXXXXXXXXXXXXXXRLARM-ENVLVIE 129
             +G  F       +NF++    D+  + E D                LA     VL+++
Sbjct: 199 QKHGEGFD------FNFMQFEASDAPAVVETDIVIVGSGCGGAVAAKVLAEQGHKVLIVD 252

Query: 130 KGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYF 189
           K ++Y    L   Q  G   LYE  G + +DD ++ +LAGS +GGG TI WS  ++ Q F
Sbjct: 253 KSYYYPPSQLPMAQDTGCQFLYENGGIITSDDGSLNLLAGSCWGGGGTINWSVSLQTQGF 312

Query: 190 VREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNI 249
           VR+EW++  GL +F   ++ N +  +   +G  T  + HN  N+ L++G +KLG H+   
Sbjct: 313 VRQEWSEQRGLSFFTSPQFQNCLDRVCDFMGVTTDGVRHNHRNKVLLDGARKLGWHAATA 372

Query: 250 PQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQK 309
           PQNT    H CG C  GC   EKQ  T++WL  A ++ AKF++   V+K+  D+   S++
Sbjct: 373 PQNTGGADHYCGQCHLGCGSTEKQGTTVSWLPAAAASGAKFIEGFEVDKVNFDESSGSKR 432

Query: 310 VMGV--------------EVIINNIKR-VKIHAKRVVVSAGAIHSPALLLRSGLKNKNIG 354
             GV                +   I R V + AK+V+V+AG++ SP +LLRSGL N++IG
Sbjct: 433 ATGVVGKWVSRGADGSTSAPLDQRITREVIVKAKKVIVAAGSVSSPLVLLRSGLTNRHIG 492

Query: 355 RNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFAN 414
            NLHVHP   V G F  ++ K + G I+++  ++ E++D   +G K+      P  + A 
Sbjct: 493 HNLHVHPCNMVGG-FWKEDCKPWEGGIITSYCSSFEDLDKAGHGVKLEPTCMIPYAVLAT 551

Query: 415 FPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAG 473
            PW S LQ K   L + ++   + +TRDR+ GR+  D  +G+PR++Y +S  D  + + G
Sbjct: 552 MPWHSGLQAKLSELRFRHLGSFISLTRDRDTGRVYPDPVSGRPRIDYVISDFDRANTLEG 611

Query: 474 LLTAVRILAAAGATKIGTCQTVIDDYI---------------------VENG----VNPL 508
           ++   +I    GA +I      ++ ++                      ENG    +   
Sbjct: 612 VIALCKICHVEGAIEIHAGIPGLEPFVREEDSAGLLEKTASATSSSPGSENGDETILQGA 671

Query: 509 NDPKFDQFLNKIKKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVAD 568
           NDP+F  +L+K++KVG         +  QM +CRM  + ++  V P G  W  E+L+VAD
Sbjct: 672 NDPRFVAWLDKVRKVGNAPPVGIFTSAHQMGTCRMALNEDEGVVGPKGHVWGTEDLFVAD 731

Query: 569 SSVLPTATGVPSMMTTMNIAHYISKCILDKKI 600
           +SV P+A+GV  M+T M IA +I+  + DK++
Sbjct: 732 ASVFPSASGVNPMVTNMAIADWIAMNV-DKEV 762



>gi|452986179|gb|EME85935.1| hypothetical protein MYCFIDRAFT_52380 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 767

 Score =  322 bits (825), Expect = 2e-85,   Method: Compositional matrix adjust.
 Identities = 187/616 (30%), Positives = 325/616 (52%), Gaps = 36/616 (5%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADPEA 73
           P   L+ K+RE   + W+ ++   +R + +S T L  A +         ++GY  A P  
Sbjct: 142 PLDALSLKEREQVILGWNRARLPLLRGLGRSLTQLARALWLRTSPTVGTLLGYTRA-PIF 200

Query: 74  NGSRFSSRNFPKYNFLEI---SDHDSDIKEFDTXXXXXXXXXXXXXXRLARME-NVLVIE 129
           +  R +   +P + F++I   S  + ++ E D                LA     V+V++
Sbjct: 201 D--RAAPAGYP-FTFVQIPQSSLPEPEVIETDVVIVGSGCGGAVAAKYLAEAGLKVVVVD 257

Query: 130 KGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYF 189
           + +++        +      L+   G + + D ++ V+AG+ +GGG  I WSA ++PQ +
Sbjct: 258 QSYYWSPEHFPMAESQAGAHLFGNGGIVTSTDGSISVVAGATWGGGGVINWSASLQPQGY 317

Query: 190 VREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNI 249
           VR EWA+ FGLP+F    +   +  + AR+G +  +I HN+ N  L+ G +KLG  +  +
Sbjct: 318 VRREWAQKFGLPHFNGSAFQADLDAVCARMGVSANHINHNKGNTVLLEGARKLGWSAKAV 377

Query: 250 PQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQK 309
           PQNT    H  G+C+ GC+   K+  T+T+L +A    A+F++   V+ I  D +  + K
Sbjct: 378 PQNTGGEVHDDGFCTRGCRSCGKKGTTVTFLPDAAEAGARFIEGLEVKVITFD-EADATK 436

Query: 310 VMGVE-----------VIINN--IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRN 356
             GV+           V  N+   + V I AKR +VS G++++P LLL+SGLKNK+IGR+
Sbjct: 437 TTGVKGTWVSRDQAGGVAGNHRATREVVIKAKRTIVSGGSLYTPILLLKSGLKNKHIGRH 496

Query: 357 LHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFP 416
           LH+HP+  V  V+ +++++ + G I++++ N  EN+DG+ YGAK+   +  P      + 
Sbjct: 497 LHLHPVNMVAAVW-DEDVRPWEGPILTSVVNEFENLDGDGYGAKLECTTMLPSSFLPLYE 555

Query: 417 WKSNLQHKQLMLEYNNIVPLMVITRDREGGRI-LTDENGKPRLEYKLSQHDSKSMVAGLL 475
           WK  L  K+  L+   +   + + RDR GGR+ L  ++G+  ++Y  S +D   ++ G++
Sbjct: 556 WKGGLAFKEFTLKMRRMTGYISLARDRYGGRVYLNPKDGRLTIDYSPSTYDKNHILEGIV 615

Query: 476 TAVRILAAAGATKIGTCQTVIDDYI------------VENGVNPLNDPKFDQFLNKIKKV 523
               +L   GA +I T    +D +I              N    + DP F ++  K++  
Sbjct: 616 RLAELLYVEGAREIYTAIPGVDAFIRPSADTDAKVSLSPNSSPSITDPDFVEWTKKVRAN 675

Query: 524 GIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMT 583
           G+P+ QT   +  QM +CRMG  P  S V+  G  W  +NLY+AD+SV P+A+GV  M+T
Sbjct: 676 GMPSPQTPYFSAHQMGTCRMGTSPTNSVVDDRGRVWGTQNLYIADTSVFPSASGVNPMIT 735

Query: 584 TMNIAHYISKCILDKK 599
            M I+  I++ I++++
Sbjct: 736 CMGISRGIARGIVNEE 751



>gi|302915893|ref|XP_003051757.1| hypothetical protein NECHADRAFT_37686 [Nectria haematococca mpVI
           77-13-4]
 gi|256732696|gb|EEU46044.1| hypothetical protein NECHADRAFT_37686 [Nectria haematococca mpVI
           77-13-4]
          Length = 745

 Score =  321 bits (823), Expect = 4e-85,   Method: Compositional matrix adjust.
 Identities = 191/603 (31%), Positives = 306/603 (50%), Gaps = 41/603 (6%)

Query: 23  REHTFIKWSTSQYASVRKIYKSFTML----ICATFWLNPYNFNPVIGYPGADPEANGSRF 78
           RE     W+TS     R + K F+ L    IC T   NP  F  + GY           +
Sbjct: 148 REAILKSWATSSRDVWRTLAKIFSTLALKSICQT---NPI-FRQISGY-----SDTPKDW 198

Query: 79  SSRNFPKYNFLEI-SDHDSDIKEFDTXXXXXXXXXXXXXXRLARM-ENVLVIEKGHHYDQ 136
             +   KY+FL++ +  D+ + E D                LA     VLV++K +H++ 
Sbjct: 199 QPKPGFKYSFLQLEAADDTHVIETDVVIVGSGCGGGVSAKNLAEAGHRVLVVDKAYHFEP 258

Query: 137 CDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVREEWAK 196
             L   Q      L++  G  +TDD+   V AGS +GGG T+ WS  ++PQ FVR EWA 
Sbjct: 259 SHLPMPQDAASTHLFDNGGFYITDDNGCNVAAGSTWGGGGTVNWSVCLKPQDFVRREWAD 318

Query: 197 NFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQNTASI 256
           + GLP+F    +   +  +    G  T +I HN  N+ L++G +KLG  +   PQNTA  
Sbjct: 319 S-GLPFFTSSAFDECLDRVWEFQGAGTDSIRHNHRNRVLLSGSEKLGWTAHPAPQNTADK 377

Query: 257 THQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQKVMGVEVI 316
            H CG C  GC   EK+    +WL +A +  A+F++   V+K+L   DG+S   +  E +
Sbjct: 378 EHYCGQCHLGCGLAEKRGPATSWLPDAANAGARFMEGFQVDKVLFGPDGQSATGVEGEWV 437

Query: 317 INNI---------KRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYG 367
             +          +RV + AK+V+++AG++ SP +L++SG+ N+++G NLH+HP   V  
Sbjct: 438 SRDTGKGDSDRVKRRVVVKAKKVILAAGSLWSPVVLMKSGINNQHLGANLHLHPCNFVSA 497

Query: 368 VFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQLM 427
           V+  +E++ + G I+++ S   +NVDG  YG K+      P  M +  PW+  L+ K  +
Sbjct: 498 VY-REEVRPWEGGIITSYSPQFDNVDGSGYGVKLETTCMVPYTMLSMVPWRGGLEVKLQL 556

Query: 428 LEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAGLLTAVRILAAAGA 486
            +Y ++   + ITRDR+ GR+  D   G+PR++Y  S +D    + G+    +I    GA
Sbjct: 557 AKYRHMNGWISITRDRDAGRVYPDPTTGRPRIDYTPSDYDRAHTLQGVEALAKICHVTGA 616

Query: 487 TKIGTCQTVIDDYI---------VENGVNPL-----NDPKFDQFLNKIKKVGIPTYQTCT 532
           T+I      ++ +I            G  P+     +DP+F  +L ++++VG        
Sbjct: 617 TEIRPLLPGLEPFIRTGEPPSEHAIEGNGPVADPETSDPEFAAWLRRVREVGNKPPAASW 676

Query: 533 GTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYIS 592
            +  QM +CRM    +   V+  G  W  ENLY+AD SV P+A+GV  M+T M IA +IS
Sbjct: 677 SSAHQMGTCRMSASKDDGVVDDRGRVWGTENLYLADGSVFPSASGVNPMITVMAIADWIS 736

Query: 593 KCI 595
           + +
Sbjct: 737 RGV 739



>gi|255957169|ref|XP_002569337.1| Pc21g23700 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211591048|emb|CAP97267.1| Pc21g23700 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 750

 Score =  321 bits (823), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 193/623 (30%), Positives = 318/623 (51%), Gaps = 31/623 (4%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADPEA 73
           P  +   + RE     W TS+   +R IY+  T ++   + +      PV+G+P     A
Sbjct: 137 PIQDQPVEFREKVVRGWDTSRLPPLRAIYRGLTAIVKKCWIITSPTIGPVLGFPRL--PA 194

Query: 74  NGSRFSSRNFPKYNFLEISDHDS-DIKEFDTXXXXXXXXXXXXXXRLARM-ENVLVIEKG 131
           +G    +  F +Y FL+    D  +  E D                LA     VLV+EK 
Sbjct: 195 HGKH--ADGF-QYEFLQFPPGDQPETIETDVVIVGSGCGGSVTAKNLAEAGHRVLVVEKS 251

Query: 132 HHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVR 191
           + Y          +G+  ++E  G + +DD +M VLAGS +GGG T+ WSA ++ Q +VR
Sbjct: 252 YSYPSNTFPMGPNEGFVNMFENGGAISSDDGSMAVLAGSTWGGGGTVNWSASLQTQGYVR 311

Query: 192 EEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQ 251
           +EWA + GLP+F   ++  ++  +  R+G N  ++ HN  N+ ++ G +KLG  +  +PQ
Sbjct: 312 QEWA-DAGLPFFTSLDFQKSLDRVCHRMGVNEEHVEHNHQNRVILEGARKLGYAAKTVPQ 370

Query: 252 NTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKIL----------- 300
           NT    H CG+C+ GC  G K+  T ++L +A    A F++   VEK+L           
Sbjct: 371 NTGHGEHYCGYCTLGCASGGKKGPTESFLVDAAQAGASFMEGFCVEKVLFTNVNGRKVAS 430

Query: 301 -IDKDGKSQKV-MGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLH 358
            +    KS+   +G+  I    ++V I AK+VV+SAG + SP LLLRSGL N  IGRNL+
Sbjct: 431 GVQGTWKSRDSHLGLGGIAAVERKVIIKAKKVVISAGTLQSPLLLLRSGLNNPQIGRNLY 490

Query: 359 VHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWK 418
           +HP+     VF N+E   + G+ ++ + N  E++DG  +G KI   S  P      FPW+
Sbjct: 491 LHPVMGAGAVF-NEETHPWEGSALTTVVNEFEDLDGNGHGVKIESVSMMPSVFIPIFPWR 549

Query: 419 SNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAGLLTA 477
            +L++K    +       + +T+DR+ GR+  D  +G+ R++Y +S  D K +V  ++  
Sbjct: 550 DSLEYKLWAAKMRRSTSFITLTKDRDTGRVYPDPVDGRCRIDYTVSAFDRKHIVEAMIAC 609

Query: 478 VRILAAAGATKIGTCQTVIDDYIVENGVNP-----LNDPKFDQFLNKI-KKVGIPTYQTC 531
            +I    GAT+  T    +  +I     +P      ND     +++++ +K  +   +  
Sbjct: 610 AKIAYITGATEFHTVYRDLPPFIRPETSDPEAPDGTNDAALQNWIDELRRKSPLNPGRGL 669

Query: 532 TGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYI 591
             +  QM +CRM   P    V+P  + W  + LYV D+SV P+A+GV  M+T M IA + 
Sbjct: 670 FASAHQMGTCRMSKSPKLGVVDPNCQVWGTDGLYVVDASVFPSASGVNPMVTNMAIADWA 729

Query: 592 SKCILDKKIFTVKKKRGSMLRHL 614
           S+  L + + TV+ + GS++  L
Sbjct: 730 SRN-LARAMGTVRGE-GSLIARL 750



>gi|239612594|gb|EEQ89581.1| long chain fatty alcohol oxidase [Ajellomyces dermatitidis ER-3]
 gi|327357976|gb|EGE86833.1| long chain fatty alcohol oxidase [Ajellomyces dermatitidis ATCC
           18188]
          Length = 757

 Score =  319 bits (817), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 196/602 (32%), Positives = 321/602 (53%), Gaps = 36/602 (5%)

Query: 23  REHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADPEANGSRFSSRN 82
           RE  F  W+TS    +R +Y+S   L    +         ++G+P          F++  
Sbjct: 150 REAIFRGWATSVLPPMRTVYRSLIALFHKAWIPLSPTLPALVGFPRVP-----VGFTTAE 204

Query: 83  FPKYNFLEISDHD-SDIKEFDTXXXXXXXXXXXXXXRLARM-ENVLVIEKGHHYDQCDLS 140
              Y FL++   D ++    D                ++    +V+V+EK +++ +    
Sbjct: 205 GYPYEFLQLPPGDNTEAIYVDVVIIGSGCGAAVAAKNISEAGHSVIVVEKSYYWSEKHFP 264

Query: 141 TEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVREEWAKNFGL 200
              ++G   L+E  G  ++DD ++ V++GS +GGG TI WSA ++ Q +VR+EWAK  G+
Sbjct: 265 MTMKEGTSNLFENGGATVSDDGSVAVISGSTWGGGGTINWSASLQTQNYVRQEWAKK-GM 323

Query: 201 PYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQNTASITHQC 260
           P+F   E+  ++  +  R+G NT ++ HN +N+ L+ G +KLG  +  +PQNT +  H C
Sbjct: 324 PFFTSSEFQKSLDRVCERMGVNTEHVKHNSANRLLLEGARKLGYAATTVPQNTGNQEHSC 383

Query: 261 GWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQKVM--GVEVI-- 316
           G C+ GC    K+   +T+L +A    A+F++  + ++IL  ++G +   +  GVE    
Sbjct: 384 GHCTLGCGSCGKKGPQVTYLADAARAGAQFIEGFHADRILF-REGNAGNCLAHGVEGTWT 442

Query: 317 ---INN-------IKR-VKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAV 365
              IN        IKR V I AK+++VS G++ SP LLLRSGLKN  IGRNL++HP+  +
Sbjct: 443 SRDINQGVCGEPVIKRKVVIKAKKIIVSCGSLQSPLLLLRSGLKNPQIGRNLYLHPVVIL 502

Query: 366 YGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQ 425
             VF  +E+K + G+I++++ N  EN+DG  +GAKI   +  P F    FPW + L++K+
Sbjct: 503 SAVF-GQEMKPWEGSILTSVVNEFENLDGHGHGAKIETLTTVPSFFLPVFPWNNGLEYKR 561

Query: 426 LMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAGLLTAVRILAAA 484
            +    N+  L+ +TR+R GGR+  D  +G+ R+ Y  S  D K+M+  ++ A +I    
Sbjct: 562 FVSNLRNMAGLITLTRERYGGRVYPDPVDGRCRISYTPSHFDRKNMIEAVIGAAKIAYVC 621

Query: 485 GATKIGTCQTVIDDYI-----VENGVNP---LNDPKFDQFLNKIKKVGIP--TYQTCTGT 534
           GA +I T    I  +I           P   +N   F  ++ K++    P     T   +
Sbjct: 622 GAQEIYTTSRDIPTFIRPERLATEACGPEAGINHSAFQAWVKKVRHTYSPLTPEHTVFAS 681

Query: 535 IEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKC 594
             QM +CRMG  P  S V+P G+ W  E LYVAD+SV P+A+GV  M+T M I+ + S+ 
Sbjct: 682 AHQMGTCRMGTSPKTSVVDPSGKVWGTEGLYVADASVFPSASGVNPMITNMAISDWTSQN 741

Query: 595 IL 596
           I+
Sbjct: 742 IV 743



>gi|344229472|gb|EGV61357.1| hypothetical protein CANTEDRAFT_108652 [Candida tenuis ATCC 10573]
          Length = 699

 Score =  318 bits (816), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 195/592 (32%), Positives = 308/592 (52%), Gaps = 22/592 (3%)

Query: 17  ELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATF-WLNPYNFNPVIGYPGADPEANG 75
           E++  Q+     KW  S  + +R +Y+S   L  AT+  L     N  IGYPG D     
Sbjct: 101 EMSNDQKAQLLSKWRDSSLSVLRNLYRSIYALTIATYSTLGGDLHNMAIGYPGRDLREEL 160

Query: 76  SRFSSRNFPKYNFLEISDHDSD---IKEFDTXXXXXXXXXXXXXXRL-ARMENVLVIEKG 131
                 N  KY  ++    D     +   D                L     N LV+EK 
Sbjct: 161 YEGQLPNSYKYEMIDRVKSDGTELYLPNIDALIIGSGAGAGVVAHTLQTEGYNCLVLEKA 220

Query: 132 HHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVR 191
            +YD  +   +  +G  KLYE SG   T    +++LAGS+FGGGTT+ WSA ++  + VR
Sbjct: 221 KYYDFSEFVFDDAEGLKKLYENSGAFSTKTQELFLLAGSSFGGGTTVNWSASLKTPFKVR 280

Query: 192 EEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQ 251
           +EW  +FG+ +F +++Y   M Y+  ++G +  N+ H+ SNQ +++  ++LG  S  I Q
Sbjct: 281 KEWYDDFGVDFFAQEDYDTCMDYVFKQMGVSNENLNHSHSNQLIMDSTERLGYQSSLIGQ 340

Query: 252 NTA-SITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQKV 310
           NT     H CG+C  GCKYG KQ +   WL +A     KFL    V KI I K GK+   
Sbjct: 341 NTGLHKNHDCGFCYLGCKYGIKQGSQACWLRDAAEKGCKFLDQVRVIKI-IHKHGKATAA 399

Query: 311 MGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYGVFP 370
           + ++        +K   K+ +VS G +++P +L  SG KNKNIG NL +HP+    G  P
Sbjct: 400 LCLDKTTGFRFTIK-GPKKFIVSGGTLNTPLVLKDSGFKNKNIGSNLKLHPVTCTIGFHP 458

Query: 371 NK-EIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANF-PWKSNLQHKQLML 428
            +  ++ +   IM+A+S    ++DG+++G +I    H P FM A+F PW  + Q +  +L
Sbjct: 459 KEVNMEAFHHPIMTAVSTEVADLDGKHHGPRIESVLHAP-FMEASFMPWYDSDQLRTDLL 517

Query: 429 EYNNIVPLMVITRDREGGRILTD--ENGKPRLEYKLSQHDSKSMVAGLLTAVRILAAAGA 486
           +YN    ++VITRD   G++ +D  +  K  ++Y +++ D  +++ G L A  +L   G 
Sbjct: 518 KYNQTSAMLVITRDVGSGKVYSDPRQPEKVLVDYTMNKFDVNALLEGFLVAADMLYMDGV 577

Query: 487 TKIGTCQTVIDDYIVENGVNP-----LNDPKFDQFLNKIKKVGIPTYQTCTGTIEQMSSC 541
            +I + Q+    +       P     + D  + ++   +KKVG  ++    G+  QMSSC
Sbjct: 578 IEIKSSQSWTPQF---KSTKPKHERKITDKDYVEWRKAVKKVGFSSFGPAYGSAHQMSSC 634

Query: 542 RM-GDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYIS 592
           RM G  P + AV+  G  +E +N+ VAD+SV PTA+G   M+TTM+IA +I+
Sbjct: 635 RMSGKGPKQGAVDQKGRLFECKNIIVADASVFPTASGANPMVTTMSIARHIA 686



>gi|225681307|gb|EEH19591.1| long chain fatty alcohol oxidase [Paracoccidioides brasiliensis
           Pb03]
          Length = 757

 Score =  318 bits (816), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 212/656 (32%), Positives = 338/656 (51%), Gaps = 58/656 (8%)

Query: 4   INSKILSIQ-----KPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLIC-ATFWLNP 57
           +NS+ +S        P    + + RE  F  W+TS    +R IY+S  +L   A   L+P
Sbjct: 126 LNSRPISFALTGYFAPIQCHSYRVREAIFRGWATSTLPPMRTIYRSLILLFNKAWISLSP 185

Query: 58  YNFNPVIGYPGADPEANGSRFSSRNFPKYNFLEISDHD-SDIKEFDTXXXXXXXXXXXXX 116
                ++G+P    +       S  +P Y F++I   D ++I   +              
Sbjct: 186 -TLPEILGFP----QVPIGYAPSEGYP-YQFVQIPPGDNAEIISTEVVVIGSGCGAAVAA 239

Query: 117 XRLARM-ENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGG 175
             LA    +V+V+EK +H+ +       +     ++E  G  ++DD ++  ++GS +GGG
Sbjct: 240 KNLAEAGHSVIVLEKAYHFPERHFPMTMRHASSNMFENGGANISDDGSIAAISGSTWGGG 299

Query: 176 TTIGWSAFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTL 235
            TI WSA ++ Q +VR+EWAK  G+P+F   EY   +  +  R+G NT ++ HN  N+ L
Sbjct: 300 GTINWSASIQTQSYVRQEWAKK-GMPFFTSSEYQKCLDRVCERMGVNTEHVNHNNPNRVL 358

Query: 236 INGCKKLGLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCY 295
           ++G +KLG  +  +PQNT +  H CG C+ GC  G K    +T+L +A    A+F++  Y
Sbjct: 359 LDGARKLGYAAQTVPQNTGNQEHWCGHCTLGCASGCKNGPHVTFLADAARAGAQFIEGFY 418

Query: 296 VEKILIDKDGKSQKVM--GVEVI-----INN-------IKR-VKIHAKRVVVSAGAIHSP 340
            E+IL  K+G     +  GV+ I     IN+       IKR V I A++VVV+ G++ +P
Sbjct: 419 AERILF-KEGNVGNCLAHGVQGIWTSRDINHGTSGQPVIKRKVVIKARKVVVACGSLQTP 477

Query: 341 ALLLRSGLKNKNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAK 400
            LLLRSGLKN  IGRNL++HP+  +  VF  +E+  + G I++++    ENVDG+ +GAK
Sbjct: 478 LLLLRSGLKNPQIGRNLYLHPVVVLSAVF-KEEMLPWEGGILTSMVTEFENVDGQGHGAK 536

Query: 401 IVVGSHHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLE 459
           I   +  P F    FPW   + +K+       +   + +TR+R+ GR+  D  +G+ R+ 
Sbjct: 537 IETLTAVPSFFLPVFPWNDGIMYKRFAATLRKMAGFITLTRERDAGRVYPDPVDGRCRIA 596

Query: 460 YKLSQHDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYI-----VENGVNP---LNDP 511
           Y  S  D K+M+  ++ A +I    GA +I T    I  +I     V     P   +N  
Sbjct: 597 YTPSHFDRKNMMEAVIGAAKIAYVCGAQEIYTTSRDIPTFIRPERLVTETCRPEEGINHT 656

Query: 512 KFDQFLNKIKKVGIPTY--QTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADS 569
            F  ++ K++ V  P    +T   +  QM +CRMG+ P  S V+P G+ W  E LYV D+
Sbjct: 657 SFQAWIKKVRHVYSPLAPERTAFASAHQMGTCRMGNAPKSSVVDPTGKVWGTEGLYVTDA 716

Query: 570 SVLPTATGVPSMMTTMNIAHYISKCILDKKIFTVKKKRGSMLRHLSFKDTSFEPKL 625
           SV P+A+GV  M+T M I+ + S+ +        K  RG        +D SF P+L
Sbjct: 717 SVFPSASGVNPMVTNMAISDWTSRNV-------SKVLRG--------EDVSFAPRL 757



>gi|295656765|ref|XP_002788971.1| long chain fatty acid oxidase [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226285840|gb|EEH41406.1| long chain fatty acid oxidase [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 757

 Score =  318 bits (814), Expect = 4e-84,   Method: Compositional matrix adjust.
 Identities = 213/656 (32%), Positives = 337/656 (51%), Gaps = 58/656 (8%)

Query: 4   INSKILSIQ-----KPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLIC-ATFWLNP 57
           +NS+ +S        P    + + RE  F  W+TS    +R IY+S  +L   A   L+P
Sbjct: 126 LNSRPISFALTGYFAPIQCHSYRVREAIFRGWATSTLPPMRTIYRSLILLFNKAWISLSP 185

Query: 58  YNFNPVIGYPGADPEANGSRFSSRNFPKYNFLEISDHD-SDIKEFDTXXXXXXXXXXXXX 116
                ++G+P    +       S  +P Y F++I   D ++I   +              
Sbjct: 186 -TLPEILGFP----QVPIGYAPSEGYP-YQFVQIPPGDNAEIISTEVVVIGSGCGAAVAA 239

Query: 117 XRLARM-ENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGG 175
             LA    +V+V+EK +H+ +       +     ++E  G  ++DD ++  ++GS +GGG
Sbjct: 240 KNLAEAGHSVIVLEKAYHFPERHFPMTMRHASSNMFENGGANISDDGSIAAISGSTWGGG 299

Query: 176 TTIGWSAFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTL 235
            TI WSA ++ Q +VR+EWAK  G+P+F   EY   +  +  R+G NT ++ HN  N+ L
Sbjct: 300 GTINWSASIQTQSYVRQEWAKK-GMPFFTSSEYQKCLDRVCERMGVNTEHVNHNNPNRVL 358

Query: 236 INGCKKLGLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCY 295
           ++G +KLG  +  +P NT +  H CG C+ GC  G K    +T+L +A    A+F++  Y
Sbjct: 359 LDGARKLGYAAQTVPLNTGNQEHWCGHCTLGCASGCKNGPHVTFLADAARAGAQFIEGFY 418

Query: 296 VEKILIDKDGKSQKVM--GVEVI-----INN-------IKR-VKIHAKRVVVSAGAIHSP 340
            E+IL  K+G     +  GV+ I     IN+       IKR V I A++VVV+ G++ +P
Sbjct: 419 AERILF-KEGNVGNCLAHGVQGIWTSRDINHGTSGQPVIKRKVVIKARKVVVACGSLQTP 477

Query: 341 ALLLRSGLKNKNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAK 400
            LLLRSGLKN  IGRNL++HP+  +  VF  +E+  + G I++++    ENVDG+ +GAK
Sbjct: 478 LLLLRSGLKNPQIGRNLYMHPVVVLSAVF-KEEMLPWEGGILTSMVTEFENVDGQGHGAK 536

Query: 401 IVVGSHHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLE 459
           I   +  P F    FPW   L +K+       +V  + +TR+R+ GR+  D  +G+ R+ 
Sbjct: 537 IETLTAVPSFFLPVFPWNDGLMYKRFAATLRKMVGFITLTRERDAGRVYPDPVDGRCRIA 596

Query: 460 YKLSQHDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYI-----VENGVNP---LNDP 511
           Y  S  D K+M+  ++ A +I    GA +I T    I  +I     V     P   +N  
Sbjct: 597 YTPSHFDRKNMMEAVIGAAKIAYVCGAQEIYTTSRDIPTFIRPERLVTETCRPEEGINHT 656

Query: 512 KFDQFLNKIKKVGIPTY--QTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADS 569
            F  ++ K++ V  P    +T   +  QM +CRMG  P  S V+P G+ W  E LYV D+
Sbjct: 657 SFQAWIKKVRHVYSPLAPERTAFASAHQMGTCRMGTTPKSSVVDPTGKVWGTEGLYVTDA 716

Query: 570 SVLPTATGVPSMMTTMNIAHYISKCILDKKIFTVKKKRGSMLRHLSFKDTSFEPKL 625
           SV P+A+GV  M+T M I+ + S+ +        K  RG        +D SF P+L
Sbjct: 717 SVFPSASGVNPMVTNMAISDWTSRNV-------SKVLRG--------EDVSFAPRL 757



>gi|226295053|gb|EEH50473.1| long chain fatty acid oxidase [Paracoccidioides brasiliensis Pb18]
          Length = 757

 Score =  318 bits (814), Expect = 5e-84,   Method: Compositional matrix adjust.
 Identities = 212/656 (32%), Positives = 338/656 (51%), Gaps = 58/656 (8%)

Query: 4   INSKILSIQ-----KPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLIC-ATFWLNP 57
           +NS+ +S        P    + + RE  F  W+TS    +R IY+S  +L   A   L+P
Sbjct: 126 LNSRPISFALTGYFAPIQCHSYRVREAIFRGWATSTLPPMRTIYRSLILLFNKAWISLSP 185

Query: 58  YNFNPVIGYPGADPEANGSRFSSRNFPKYNFLEISDHD-SDIKEFDTXXXXXXXXXXXXX 116
                ++G+P    +       S  +P Y F++I   D ++I   +              
Sbjct: 186 -TLPEILGFP----QVPIGYAPSEGYP-YQFVQIPPGDNAEIISTEVVIIGSGCGAAVAA 239

Query: 117 XRLARM-ENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGG 175
             LA    +V+V+EK +H+ +       +     ++E  G  ++DD ++  ++GS +GGG
Sbjct: 240 KNLAEAGHSVIVLEKAYHFPERHFPMTMRHASSNMFENGGANISDDGSIAAISGSTWGGG 299

Query: 176 TTIGWSAFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTL 235
            TI WSA ++ Q +VR+EWAK  G+P+F   EY   +  +  R+G NT ++ HN  N+ L
Sbjct: 300 GTINWSASIQTQSYVRQEWAKK-GMPFFTSSEYQKCLDRVCERMGVNTEHVNHNNPNRVL 358

Query: 236 INGCKKLGLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCY 295
           ++G +KLG  +  +PQNT +  H CG C+ GC  G K    +T L +A    A+F++  Y
Sbjct: 359 LDGARKLGYAAQTVPQNTGNQEHWCGHCTLGCASGCKNGPHVTLLADAARAGAQFIEGFY 418

Query: 296 VEKILIDKDGKSQKVM--GVEVI-----INN-------IKR-VKIHAKRVVVSAGAIHSP 340
            E+IL  K+G     +  GV+ I     IN+       IKR V I A++VVV+ G++ +P
Sbjct: 419 AERILF-KEGNVGNCLAHGVQGIWTSRDINHGTSGQPVIKRKVVIKARKVVVACGSLQTP 477

Query: 341 ALLLRSGLKNKNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAK 400
            LLLRSGLKN  IGRNL++HP+  +  VF  +E+  + G I++++    ENVDG+ +GAK
Sbjct: 478 LLLLRSGLKNPQIGRNLYLHPVVVLSAVF-KEEMLPWEGGILTSMVTEFENVDGQGHGAK 536

Query: 401 IVVGSHHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLE 459
           I   +  P F    FPW   + +K+       +   + +TR+R+ GR+  D  +G+ R+ 
Sbjct: 537 IETLTAVPSFFLPVFPWNDGIMYKRFAATLRKMAGFITLTRERDAGRVYPDPVDGRCRIA 596

Query: 460 YKLSQHDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYI-----VENGVNP---LNDP 511
           Y  S  D K+M+  ++ A +I    GA +I T    I  +I     V    +P   +N  
Sbjct: 597 YTPSHFDRKNMMEAVIGAAKIAYVCGAQEIYTTSRDIPTFIRPERLVTETCSPEEGINHT 656

Query: 512 KFDQFLNKIKKVGIPTY--QTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADS 569
            F  ++ K++ V  P    +T   +  QM +CRMG+ P  S V+P G+ W  E LYV D+
Sbjct: 657 SFQAWIKKVRHVYSPLAPERTAFASAHQMGTCRMGNAPKSSVVDPTGKVWGTEGLYVTDA 716

Query: 570 SVLPTATGVPSMMTTMNIAHYISKCILDKKIFTVKKKRGSMLRHLSFKDTSFEPKL 625
           SV P+A+GV  M+T M I+ + S+ +        K  RG        +D SF P+L
Sbjct: 717 SVFPSASGVNPMVTNMAISDWTSRNV-------SKVLRG--------EDVSFAPRL 757



>gi|407919020|gb|EKG12277.1| Glucose-methanol-choline oxidoreductase [Macrophomina phaseolina
           MS6]
          Length = 748

 Score =  317 bits (813), Expect = 7e-84,   Method: Compositional matrix adjust.
 Identities = 186/604 (30%), Positives = 315/604 (52%), Gaps = 29/604 (4%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADPEA 73
           PF +     R     +W  ++    R++ +  T LI   +         V+G+P      
Sbjct: 139 PFAKQPVDIRIAILQRWGIARTPIFRQLNRLLTTLIKQNWAKTSATLGRVLGFPRV--PV 196

Query: 74  NGSRFSSRNFPKYNFLEISDHDS-DIKEFDTXXXXXXXXXXXXXXRLARM-ENVLVIEKG 131
           +GS    + F ++ F+++   D  +  + D                LA     V+++EK 
Sbjct: 197 HGS--VGKGF-EFEFIQMPPGDGPETLDTDVVIVGSGCGAGVCAKNLAEAGHRVIIVEKS 253

Query: 132 HHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVR 191
           +++    L  +  +G+  L+   G +++D+S + V AG  FGGG  + WSA ++ Q +VR
Sbjct: 254 YYWPPEHLPMKDTEGFSHLFMNGGSIISDESCVSVAAGQTFGGGGFVNWSASLQTQGYVR 313

Query: 192 EEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQ 251
           +EWA   GLP F   E+  ++  +  R+G  T  I HN +N  L+ G +KLG     +PQ
Sbjct: 314 QEWADQ-GLPLFTSAEFQKSLDIVCERMGVATDPIRHNPTNNHLLEGARKLGWSCKPVPQ 372

Query: 252 NTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQKVM 311
           N+    H CG CS GC   EKQ   +++L +A  + A+F++   V+KIL ++    +  +
Sbjct: 373 NSGGAEHYCGSCSLGCASYEKQGPHVSFLPDAARSGARFIEGIEVQKILFEEKKGKRIAV 432

Query: 312 GVEVIINN-------------IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLH 358
           GV  +  +              + V I AKRV+V+ G + SP LLLRSGL N NIGR+LH
Sbjct: 433 GVRGLWVSRDENGGVAGTPCITRDVIIKAKRVIVAGGTMQSPLLLLRSGLNNPNIGRHLH 492

Query: 359 VHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWK 418
           +HP+ +  G    +    + G I++A+ N  EN+DG+ +GAK+   +  P       PW 
Sbjct: 493 LHPV-SFLGAVHKERTNPWEGGILTAVVNEFENLDGKGHGAKLEAITMLPSVWLTLAPWI 551

Query: 419 SNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAGLLTA 477
             L++K+ +    ++V  + + RDR+ GR+  D  +G+ RL Y LS  D K+++ G++  
Sbjct: 552 GGLEYKEFVPRMKHMVGYISLARDRDTGRVYPDPADGRCRLSYPLSWFDKKNILEGVIGL 611

Query: 478 VRILAAAGATKIGT----CQTV--IDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQTC 531
            ++   AGA++I T    C      +  + ++ +  +N+ KF ++L ++++ G+P+  T 
Sbjct: 612 AKVQYVAGASEIFTTIPGCPAFKRTEAAMEKDDLEGINNEKFQEWLKEVRRYGLPSPGTL 671

Query: 532 TGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYI 591
             +  QM +CRMG  P  S V+  G+ W  E LYVAD+SV P+A+GV  M+T M IA ++
Sbjct: 672 FLSAHQMGTCRMGASPRTSVVDAEGKVWGTEGLYVADASVFPSASGVNPMVTVMAIADWL 731

Query: 592 SKCI 595
           S+ I
Sbjct: 732 SRNI 735



>gi|452002463|gb|EMD94921.1| hypothetical protein COCHEDRAFT_1201414 [Bipolaris maydis C5]
 gi|477584697|gb|ENI01788.1| hypothetical protein COCC4DRAFT_52836 [Bipolaris maydis ATCC 48331]
          Length = 745

 Score =  316 bits (810), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 192/600 (32%), Positives = 317/600 (52%), Gaps = 42/600 (7%)

Query: 23  REHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPY-NFNPVIGYP----GADPEANGSR 77
           RE     W +++   +R++ +S T+L C   W+        V+G P    G  P   G  
Sbjct: 151 RESILHAWGSARLGPLRQMRRSLTIL-CKQAWIKTSPALRRVLGLPRVPIGMRP---GKG 206

Query: 78  FSSRNFPKYNFLEIS-DHDSDIKEFDTXXXXXXXXXXXXXXRLARM-ENVLVIEKGHHYD 135
           F       Y F++I    D ++ E D                LA     VL++EK +H+ 
Sbjct: 207 FD------YEFIQIPPGDDPEVIETDVLVVGSGCGGGVSAKNLAEAGHRVLIVEKAYHWT 260

Query: 136 QCDLSTEQQDGYDKLYELSGGMLT-DDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVREEW 194
                  + DG+  L+ +SG  LT DD+++ V+AG ++GGG T+ WSA ++ Q +VR EW
Sbjct: 261 PDHYPMAEVDGWHHLF-MSGSFLTSDDASVSVVAGQSWGGGGTVNWSASLQTQGYVRREW 319

Query: 195 AKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQNTA 254
           A   GLP+F   ++  ++  +  R+G +T +   N  N  L++G +KLG ++  +PQNT 
Sbjct: 320 AAR-GLPFFTSADFQQSLDRVCDRMGVSTEHTKQNPGNMMLLDGARKLGWNAKPVPQNTG 378

Query: 255 SITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQKVMGVE 314
              H CG+C+FGC   EKQ   +++L +A    A+F++  + EKI+       Q   GVE
Sbjct: 379 GKQHYCGYCNFGCGSCEKQGPVVSFLPDAARAGAQFVEGFHAEKIVFSTQNGQQVATGVE 438

Query: 315 VI-----IN--------NIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHP 361
                  +N        N ++V I AKRV+VSAG + SP LL+RSGLKN  IG+NL++HP
Sbjct: 439 GTWVSRDVNGGVAGSPVNRRKVLIKAKRVIVSAGTLQSPLLLMRSGLKNPRIGQNLYLHP 498

Query: 362 IAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHP--GFMFANFPWKS 419
           +    G +   EI  + G I++A+    EN+DG+ +GAK+   +  P  G M+ +  WK 
Sbjct: 499 V-TFLGAYHKAEINPWEGGILTAVVGEFENLDGKGHGAKLEATNMVPSTGLMWVD--WKG 555

Query: 420 NLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAGLLTAV 478
            LQ K       ++V  + I +D++ GR+  D  +G+ R+ Y++S+ D ++++ G+L   
Sbjct: 556 GLQWKLDAARLKHMVGYISIVKDKDAGRVYADPVDGRVRVSYQVSKFDRQNIMQGILALA 615

Query: 479 RILAAAGATKIGTCQTVIDDYIVENGV---NPLNDPKFDQFLNKIKKVGIPTYQTCTGTI 535
           +I    GA +I T    +  ++ +      + +N+  F  +L +++  G  + ++   + 
Sbjct: 616 KIQYIEGAEEIFTTIPGLRSFVRDPSAPLGDGINNAGFQAWLAEVEAKGFQSPESMFVSA 675

Query: 536 EQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKCI 595
            QM +CRM     +  V+P G  W  E LYVAD+SV P+A+GV  M+T M I+ +IS+ I
Sbjct: 676 HQMGTCRMSAQEWEGVVDPQGRVWGTEGLYVADASVFPSASGVNPMVTNMAISDWISRGI 735



>gi|168020954|ref|XP_001763007.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162685819|gb|EDQ72212.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 775

 Score =  316 bits (809), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 178/482 (36%), Positives = 273/482 (56%), Gaps = 16/482 (3%)

Query: 124 NVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAF 183
            V+++EKG ++   DL+T +      ++E  G + TDD  + ++AG+  GGGT I WSA 
Sbjct: 287 QVVILEKGKYFRTEDLTTLEGPSQMAMFEKLGSLATDDGGVNLVAGATVGGGTAINWSAC 346

Query: 184 MEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLG 243
            E    V +EW +  GL  F    Y  AMK I  RL         N  N  L  GC+KL 
Sbjct: 347 FETPSHVLQEWKQISGLELFTSTRYKLAMKKIWHRLNVQPNIARENLQNSVLRAGCEKLS 406

Query: 244 LHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEA-KSNNAKFLKNCYVEKILID 302
                + +N A + H CGWC++GC  G+K S T TWL +A +S NA  L  C  ++IL  
Sbjct: 407 AEVGTLARN-APVDHDCGWCTYGCPSGQKGSTTSTWLKDAAESKNAVLLSECEAQRILFS 465

Query: 303 KD---GKSQKVMGVEVII-NNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLH 358
           K+    K  K  GV  ++ ++ KR+ I A+ VVV++G++ +P LLL SGL+N NIG+ LH
Sbjct: 466 KNHSGRKHYKARGVMAVVGSSKKRIFIEAQSVVVASGSLMTPPLLLNSGLRNPNIGKGLH 525

Query: 359 VHPIAAVYGVFPNKEI---KTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANF 415
           +HP+  ++G FP +       Y G IM++ S   +  +G    A + V S HPG  FA+F
Sbjct: 526 LHPVVFMWGYFPEESGFPGTCYEGAIMTSYSPIYKK-NGSFPVALLEVPSTHPG-SFASF 583

Query: 416 -PWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGL 474
            PW S    K+ M  ++  V L  +TRD   G++  + +GKP+++Y L+  D ++++ G+
Sbjct: 584 QPWTSAADFKERMRRFSRTVTLCAVTRDTSNGQVSVEADGKPKIDYTLNAVDEETILEGI 643

Query: 475 LTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQTCTGT 534
              +R+L AAGAT+IGT Q   + + V+      N    + ++ +++  G+   +   G+
Sbjct: 644 EKGLRVLIAAGATEIGTHQQDGERFCVKGA----NSRDIEAYIKRVRSRGVKKNKIIIGS 699

Query: 535 IEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKC 594
              M SC+MG DP +SAV+  GE WEVE LYV+D SVLP+A GV  M+T  ++A+ I+  
Sbjct: 700 GHHMGSCKMGSDPRRSAVDGEGETWEVEGLYVSDGSVLPSAIGVNPMVTIQSVAYCIAHS 759

Query: 595 IL 596
           +L
Sbjct: 760 VL 761



>gi|70996648|ref|XP_753079.1| long chain fatty alcohol oxidase [Aspergillus fumigatus Af293]
 gi|66850714|gb|EAL91041.1| long chain fatty alcohol oxidase, putative [Aspergillus fumigatus
           Af293]
 gi|159131815|gb|EDP56928.1| long chain fatty alcohol oxidase, putative [Aspergillus fumigatus
           A1163]
          Length = 753

 Score =  315 bits (808), Expect = 2e-83,   Method: Compositional matrix adjust.
 Identities = 188/607 (30%), Positives = 298/607 (49%), Gaps = 32/607 (5%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGAD--- 70
           P  +   + RE  F  W TS+   +R IY++FT +   T+         V+G P      
Sbjct: 139 PIQDQPFEIREKIFSSWETSRIKPLRAIYRAFTAIFKKTWATVSPTIRSVVGCPRVPIHG 198

Query: 71  PEANGSRFSSRNFPKYNFLEISDHDSDIKEFDTXXXXXXXXXXXXXXRLARMENVLVIEK 130
             A+G  +    FP     E  D D  I                   R      VLV+EK
Sbjct: 199 KPADGFEYEFLQFPPGAEPETIDTDVVIVGSGCGGSVAAKNLAEAGYR------VLVVEK 252

Query: 131 GHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFV 190
            +HY       +  +G+  ++E  G   +DD ++ VLAGS +GGG T+ WSA ++ Q +V
Sbjct: 253 SYHYPSKYFPMDFNEGFVSMFENGGATTSDDGSIAVLAGSTWGGGGTVNWSASLQTQGYV 312

Query: 191 REEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIP 250
           R EWA   GLP+F   EY  A+  +  R+G +  +  HN SN+ L++G +KLG  +  +P
Sbjct: 313 RREWASK-GLPFFESHEYQQALDRVCDRMGVSNDHTEHNYSNRVLLDGARKLGYAAQPVP 371

Query: 251 QNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQKV 310
           QNT    H CG+C+ GC    K+    T+L +A      F++    +KI        +  
Sbjct: 372 QNTGGSNHYCGYCTMGCHSCGKKGPRETFLADAAKAGTTFIEGFRADKIRFKNTKGGRVA 431

Query: 311 MGVEVIINN-------------IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
            GVE    +              ++V I+A +V+VS G +HSP LLLRSGLKN  IGRNL
Sbjct: 432 CGVEGTWTSRDSYLGTAGPDRTTRKVIINASKVIVSCGTLHSPLLLLRSGLKNPQIGRNL 491

Query: 358 HVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPW 417
           ++HP+     VF ++EI+ + G+ ++ + N  E+ DG+ +G KI      P      FPW
Sbjct: 492 YLHPVVLSCAVF-DEEIRPWEGSALTIVVNEFEDQDGQGHGVKIENVVMLPALYLPTFPW 550

Query: 418 KSNLQHKQLMLEYNNIVPLMVITRDREGGRILTD-ENGKPRLEYKLSQHDSKSMVAGLLT 476
           +  L +K    +   +   + +T++R+ GR+  D  +G+ R++Y +S +D K +V  L+ 
Sbjct: 551 RDGLDYKLWAAKLPRMSGFIALTKERDAGRVYPDPADGRVRIDYTVSAYDRKHIVEALIA 610

Query: 477 AVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPK--FDQFLNKI-----KKVGIPTYQ 529
             +I   +GA +  T    +  +I     +  N P+   +Q L        +K  +   +
Sbjct: 611 TAKIAYISGAREFHTSNREMPPFIRPTEASDPNAPEGVTNQALQAWIAVLRRKNPVDPER 670

Query: 530 TCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAH 589
           T   +  QM +CRMG  P  S V+P  + W  + LYV D+SV P+A+GV  M+T M IA 
Sbjct: 671 TQYASAHQMGTCRMGSSPRTSVVDPECQVWGTQGLYVMDASVFPSASGVNPMVTNMAIAD 730

Query: 590 YISKCIL 596
           + S+ ++
Sbjct: 731 WASRKVV 737



>gi|512198772|gb|EPE27606.1| FAD/NAD(P)-binding protein [Glarea lozoyensis ATCC 20868]
          Length = 738

 Score =  315 bits (807), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 191/602 (31%), Positives = 306/602 (50%), Gaps = 28/602 (4%)

Query: 15  FHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPY-NFNPVIGYPGADPEA 73
           FH+     RE     W  S   ++  +YK   M+I    WLN   +F  ++G PG     
Sbjct: 137 FHDQPIHIREAILESWRVSYLPTLNLVYKQM-MVIAKNVWLNTSPSFRELVGIPGGPDHV 195

Query: 74  NGSRFSSRNFPKYNFLEISDHDSDIKEFDTXXXXXXXXXXXXXXRLARM-ENVLVIEKGH 132
              +    +F ++N    S    +I E D                +A     VLV++K +
Sbjct: 196 KLEKPFENDFLQFN----SGTAPEIVETDVVIVGSGCGGGVCAKNIAEAGHRVLVVDKAY 251

Query: 133 HYDQCDLSTEQQDGYDKLYELSGGMLT-DDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVR 191
           H     L   +Q+G  KL+E  G MLT DD ++ V AGS +GGG TI WSA ++PQ FVR
Sbjct: 252 HIPAAQLPLSEQNGLRKLFE-GGAMLTSDDGSIAVAAGSAWGGGGTINWSASLQPQEFVR 310

Query: 192 EEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQ 251
            EW+++ GL  F   E+ + +  +   +G ++ +I HN +N  L+ G +KLG  +  +PQ
Sbjct: 311 REWSQDKGLEVFESAEFQDCLDTVCKHMGVSSDHIRHNHANNNLLEGSRKLGFSAKAVPQ 370

Query: 252 NTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQKVM 311
           NT    H CG C+ GC   EKQ   + WL +A    A+ ++   V+ ++ D+D  + K  
Sbjct: 371 NTGGKEHYCGHCTLGCGSSEKQGPAVAWLPDAVRAGAQMVEGFRVDHVIFDEDDPT-KAT 429

Query: 312 GVEVIIN-------------NIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLH 358
           GV+ +                 + V + AK+V++S+G + SP +L  SGL+N +IGRNLH
Sbjct: 430 GVKGLWTARDDTGEFDSEGRTTREVIVKAKKVIISSGTLWSPIILQNSGLRNYHIGRNLH 489

Query: 359 VHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWK 418
           +HP+  +  +FP    + + G I++++    EN+DG  +GAK+      P      FPW 
Sbjct: 490 LHPVNMLSAIFPTS-TRPWEGGILTSVCTTFENLDGLGHGAKLETTVMLPSMFLVGFPWY 548

Query: 419 SNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAGLLTA 477
           S LQ K+  L++ N+   + I RDR+ GR+  D   G PR++Y  S  D K ++ G++  
Sbjct: 549 SGLQFKRNALKFRNMNGFISIARDRDTGRVYPDPTTGTPRVKYTPSVFDRKHILEGVIGL 608

Query: 478 VRILAAAGATKIGTCQTVIDDYIVENGVNP---LNDPKFDQFLNKIKKVGIPTYQTCTGT 534
            +I    GA +I    +    +I +   NP   + DP F  ++ + ++ G     T   +
Sbjct: 609 AKIAYIQGAVEIHPFTSAGRPFIRDPNANPGAGITDPHFQNWIKEFREGGNKPPATSFSS 668

Query: 535 IEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKC 594
             QM +CRM     +  V+  G  W  + LYVAD+SV P+A+GV  M+T M +A +IS+ 
Sbjct: 669 AHQMGTCRMSRTEAEGVVDDKGRVWGCKGLYVADASVFPSASGVNPMVTNMAVAEWISRG 728

Query: 595 IL 596
           ++
Sbjct: 729 VV 730



>gi|6983581|emb|CAB75351.1| long chain fatty alcohol oxidase [Candida cloacae]
          Length = 698

 Score =  315 bits (807), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 181/586 (30%), Positives = 305/586 (52%), Gaps = 16/586 (2%)

Query: 22  QREHTFIKWSTSQYASVRKIYKSFTMLICATF-WLNPYNFNPVIGYPGADPEANGSRFSS 80
           QRE     W  S   + R++++ +     +TF  L        +GYPG +       +  
Sbjct: 107 QREELLRSWRDSPLTAKRRLFRVYASFTLSTFNKLGTDLHFKALGYPGRELRTQIQDYEV 166

Query: 81  RNFPKYNFLEISDHDSD---IKEFDTXXXXXXXXXXXXXXRLARME-NVLVIEKGHHYDQ 136
             F +Y+F+E   H+     + + D                L       LV+EKG ++  
Sbjct: 167 DPF-RYSFMEKLKHEGHELFLPDIDVLIIGSGSGAGVVAQTLTESGLKSLVLEKGKYFAS 225

Query: 137 CDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVREEWAK 196
            +L     DG + L+E  G + + +  ++++AGS FGGG+T+ WSA ++  + VR+EW  
Sbjct: 226 EELCMTDLDGNEALFESGGTIPSTNQQLFMIAGSTFGGGSTVNWSACLKTPFKVRKEWYD 285

Query: 197 NFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQNTASI 256
           +FGL +    +Y + M Y+  ++G +T +I H+ +N  +++G  KLG     + QNT   
Sbjct: 286 DFGLDFVATQQYDDCMDYVWKKMGASTEHIEHSAANAVIMDGAAKLGYAHRALEQNTGGH 345

Query: 257 THQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQKVMGVEVI 316
            H CG C  GC++G KQ     W  E     +KF++   VEKIL  K GK+  ++  +  
Sbjct: 346 VHDCGMCHLGCRFGIKQGGVNCWFREPSEKGSKFMEQVVVEKILQHK-GKATGILCRDT- 403

Query: 317 INNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYGVFPNK-EIK 375
            + IK      K+ VVS G++ +P LL +SG KNK+IG NL +HP++   G F N+ + +
Sbjct: 404 ESGIKFKITGPKKYVVSGGSLQTPVLLQKSGFKNKHIGANLKLHPVSVALGDFGNEVDFE 463

Query: 376 TYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQLMLEYNNIVP 435
            Y   +M+A+ NA +++DG+ +G +I    H P      +PW+S  Q ++ +L+Y   VP
Sbjct: 464 AYKRPLMTAVCNAVDDLDGKAHGTRIEAILHAPYVTAPFYPWQSGAQARKNLLKYKQTVP 523

Query: 436 LMVITRDREGGRILTDENGKPR---LEYKLSQHDSKSMVAGLLTAVRILAAAGATKIGTC 492
           L++++RD   G +  D+  KP    ++Y +++ D  S++ G L A  IL   GA +I + 
Sbjct: 524 LLLLSRDTSSGTVTYDKQ-KPDVLVVDYTVNKFDRNSILQGFLVASDILYIEGAKEILSP 582

Query: 493 QTVIDDYIVENG--VNPLNDPKFDQFLNKIKKVGIPTYQTCTGTIEQMSSCRM-GDDPNK 549
           Q  +  +          + D  + ++   + K+   +Y +  G+  QMSSCRM G  P  
Sbjct: 583 QAWVPTFKSNKPKHARSIKDEDYVKWRETVAKIPFDSYGSPYGSAHQMSSCRMSGKGPGY 642

Query: 550 SAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKCI 595
            A +  G  +E  N+YVAD+SV+PTA+GV  M+TTM  A +++ C+
Sbjct: 643 GACDTKGRLFECNNVYVADASVMPTASGVNPMITTMAFARHVALCL 688



>gi|367048387|ref|XP_003654573.1| hypothetical protein THITE_2117674 [Thielavia terrestris NRRL 8126]
 gi|347001836|gb|AEO68237.1| hypothetical protein THITE_2117674 [Thielavia terrestris NRRL 8126]
          Length = 761

 Score =  315 bits (806), Expect = 4e-83,   Method: Compositional matrix adjust.
 Identities = 197/622 (31%), Positives = 303/622 (48%), Gaps = 35/622 (5%)

Query: 2   SLINSK-----ILSIQKPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLN 56
           S++N++     + S  KP   L    R      WSTS   ++R ++KS + +    +  +
Sbjct: 128 SILNTRPGSLLLTSHAKPLPALPITDRLKILRSWSTSPLWALRSLFKSLSTVGKLVYIRS 187

Query: 57  PYNFNPVIGYPGADPEANGSRFSSRNFPKYNFLEISDHDSDIKEF--DTXXXXXXXXXXX 114
              F  + G+P A P A  +  +S  F    F   S+      E   D            
Sbjct: 188 SAAFPVLTGFP-AVPTAWAATSTSHPFTFLQFHPSSNSRKTPVEVTTDVAIVGSGCGAGV 246

Query: 115 XXXRLAR----MENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGS 170
              RLAR      +VLV+EKG H D       Q  G   L+E  G + TDD +M V AG+
Sbjct: 247 VAHRLAREFGPALSVLVLEKGRHVDARHFPLSQAAGLATLFEAGGVIETDDGSMTVTAGA 306

Query: 171 NFGGGTTIGWSAFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQ 230
            FGGG TI WSA ++ Q FVR EWA+  GLP+F  DE+   +  +   +G     +  N 
Sbjct: 307 CFGGGGTINWSASLQTQDFVRAEWARERGLPFFESDEFQACLDRVCHVMG--VAEVPPNH 364

Query: 231 SNQTLINGCKKLGLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKF 290
           +N+ L+ G +KLG  +  +PQN     H  G+C+ GC  GEK      W  EA     KF
Sbjct: 365 ANRVLLEGARKLGYQAKAVPQNCGGKEHDDGYCALGCWRGEKMGPVNGWFPEAARQGVKF 424

Query: 291 LKNCYVEKILIDKDGKSQKVMGVEVIINNIK----RVKIHAKRVVVSAGAIHSPALLLRS 346
            +   VEK+L ++   ++   GV+ +  + +     V + AK+VV+S G + SP +LL S
Sbjct: 425 AEGMKVEKVLFEQKKGAKVATGVKGVWTSREGEKVEVIVRAKKVVISCGTLWSPVVLLNS 484

Query: 347 GLKNKNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSH 406
           GLKN +IG+NLH+HP   V G+F +++++ + G  ++++  + EN+D + +G K+   + 
Sbjct: 485 GLKNPHIGKNLHLHPTNFVSGIF-DEDVRPWEGGSLTSVVTSFENLDSKGHGVKLEAMTM 543

Query: 407 HPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDEN-GKPRLEYKLSQH 465
            P F     PW + +++K     Y ++   + I RDR+ G +  D + G PR+ Y  S  
Sbjct: 544 MPSFCLPFLPWTTGIEYKLRAAHYRHLNTFIAICRDRDSGSVHRDPSTGAPRVAYTPSDF 603

Query: 466 DSKSMVAGLLTAVRILAAAGATK----IGTCQTVIDDYIVEN---GVNPLN--------D 510
           D    + G+L   RIL A GA +    I  C   I          G  P N         
Sbjct: 604 DRAHNLRGVLELCRILHAHGAREIHPSIAGCPPFIRSAARRRSGEGSTPENADGEQGEEA 663

Query: 511 PKFDQFLNKIKKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSS 570
            +F+++L  ++ +G     T   +  QM SCRM        V+  G  W  + LYVAD+S
Sbjct: 664 KEFERWLAGVRALGNKPPVTPFASAHQMGSCRMSARAKDGVVDSRGRVWGTKGLYVADAS 723

Query: 571 VLPTATGVPSMMTTMNIAHYIS 592
           V P+A+GV  M+TTM IA +I+
Sbjct: 724 VFPSASGVNPMVTTMAIADWIA 745



>gi|380477975|emb|CCF43856.1| GMC oxidoreductase [Colletotrichum higginsianum]
          Length = 576

 Score =  314 bits (805), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 176/553 (31%), Positives = 287/553 (51%), Gaps = 47/553 (8%)

Query: 86  YNFLEISDHDSD-IKEFDTXXXXXXXXXXXXXXRLARM-ENVLVIEKGHHYDQCDLSTEQ 143
           +NF++    D+  + E D                LA     VLV++K ++Y    L   Q
Sbjct: 13  FNFMQFEASDAPAVVETDVVIVGSGCGGAVAAKVLAEAGHKVLVVDKSYYYSPSQLPMSQ 72

Query: 144 QDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVREEWAKNFGLPYF 203
             G   LYE SG + +DD+++ ++AGS +GGG T+ WS  ++ Q FVR+EW++  GLP+F
Sbjct: 73  DSGCQFLYESSGFITSDDNSLNMVAGSCWGGGGTVNWSVSLQTQGFVRKEWSEKRGLPFF 132

Query: 204 MEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQNTASITHQCGWC 263
              ++ N +  +   +G    ++ HN  NQ L++G +KLG H+   PQNTA   H CG C
Sbjct: 133 TSPQFQNCLDKVCDFMGVGADHVRHNHRNQVLLDGSRKLGWHATTAPQNTAGTEHYCGQC 192

Query: 264 SFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDK-DGKSQKVMGV--------- 313
             GC   EKQ  T++WL  A ++ A+F++   VEK+  D+  G S++  GV         
Sbjct: 193 HLGCASTEKQGPTVSWLPAAAASGARFIEGFEVEKVTFDESSGGSKRATGVVGKWVSRGT 252

Query: 314 ------EVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYG 367
                  +     + V + AK+V+V+AG+I SP +LLRSGL N++IGRNL+VHP   V G
Sbjct: 253 DGSTGAPLDQRTTREVIVKAKKVIVAAGSISSPLVLLRSGLTNRHIGRNLYVHPCNFVGG 312

Query: 368 VFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQLM 427
            +  ++ K + G I+++  ++ E++D   +G K+      P  + ++ PW S LQ K   
Sbjct: 313 YW-KEDCKPWEGGIITSYCSSFEDLDKAGHGVKLEATCMVPYTILSSMPWHSGLQAKLSE 371

Query: 428 LEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAGLLTAVRILAAAGA 486
           L + +    + +TRDR+ GR+  D   G+PR++Y +S  D    + G++   +I    GA
Sbjct: 372 LRFRHFGAFISLTRDRDTGRVYPDPITGRPRVDYVVSDFDRAHTLEGVIALCKICYVEGA 431

Query: 487 TKIGTCQTVIDDYIVENGVNP---------------------------LNDPKFDQFLNK 519
            +I      ++ ++ E+   P                           +N P+F  +L+K
Sbjct: 432 IEIHAGIPGLEPFVREDRAEPPEKTAAAAAAESGSLGSESGDEAILDGVNXPRFVAWLDK 491

Query: 520 IKKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVP 579
           ++KV          +  QM +CRM  + ++  V P G  W  E L+VAD+SV P+A+GV 
Sbjct: 492 LRKVNNAPPVAIFSSAHQMGTCRMAPNEDEGVVGPKGHVWGTEGLFVADASVFPSASGVN 551

Query: 580 SMMTTMNIAHYIS 592
            M+T M IA +I+
Sbjct: 552 PMVTNMAIADWIA 564



>gi|302801652|ref|XP_002982582.1| hypothetical protein SELMODRAFT_116855 [Selaginella moellendorffii]
 gi|300149681|gb|EFJ16335.1| hypothetical protein SELMODRAFT_116855 [Selaginella moellendorffii]
          Length = 656

 Score =  314 bits (805), Expect = 5e-83,   Method: Compositional matrix adjust.
 Identities = 198/641 (30%), Positives = 315/641 (49%), Gaps = 51/641 (7%)

Query: 7   KILSIQKPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFW--LNPYNFNP-- 62
           K     K F E+  ++RE    +W+ S     R  +K F   I  TF+  ++   +NP  
Sbjct: 11  KAYPYDKKFSEVPLEEREKLMYQWANSDDDDSRLNFKIFKTFILNTFYSKVDASGYNPTW 70

Query: 63  -VIGYPGADPEA------------NGSRFSSRNFP------KYNFLEISDHDSDIK---- 99
             IGY G DP +              + F  R  P      K+    + D  S +K    
Sbjct: 71  EAIGYAGPDPNSMKATLPPKPSALKSAVFDVREHPDLRAVLKHTGYTLLDDISHLKPALL 130

Query: 100 --------------EFDTXXXXXXXXXXXXXXRLARME-NVLVIEKGHHYDQCDLSTEQQ 144
                         + D                L+     VL++EKG ++ + DLS  +Q
Sbjct: 131 PSNKLEDGEDVIGIKCDVIIVGAGSGGSVPAQVLSTAGLKVLLLEKGRYFAREDLSLLEQ 190

Query: 145 DGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVREEWAKNFGLPYFM 204
             + +LYE  G + TDD    +++ +  GGGT I W+A  +    VR+EWA+  GLP F 
Sbjct: 191 PTFSELYEEGGFLATDDFAYSLMSAAVVGGGTCINWAASFQTPPHVRQEWAEECGLPMFT 250

Query: 205 EDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQNTASITHQCGWCS 264
            ++Y  A+  I  ++G      + +  N  L  GC +LGLHS NIP+N AS  H CG C+
Sbjct: 251 SEKYQQALDLICKKIGVQPNATVESFQNAVLRKGCVELGLHSANIPRN-ASPEHYCGCCN 309

Query: 265 FGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILI-DKDGKSQKVMGV--EVIINNIK 321
            GC+ G KQ+ T TWL EA +  A  L      ++L  D   K +K +GV    + +  K
Sbjct: 310 MGCRRGMKQATTETWLVEAAAAGATILTGTKGLQVLFTDGTKKEKKAIGVLATTLGDQPK 369

Query: 322 RVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYGVFPNKEI---KTYS 378
           ++ I AK  +VS G+I +P LL+RSGL N NIG++ H+HP+  V+G FP++E     ++ 
Sbjct: 370 KLIIEAKATIVSTGSIMTPPLLIRSGLTNPNIGKHFHIHPVLGVWGYFPDEEKNPGASFE 429

Query: 379 GTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMV 438
           G IM+A S  +   D   YG  ++  S HPG   +   WKS  QHK+ M  +  +  +++
Sbjct: 430 GGIMTAFSAVSARWDTVGYGPVLMTPSFHPGQYASVVTWKSGAQHKEAMRRFRRVSQVVL 489

Query: 439 ITRDREGGRILTD-ENGKPRLEYKLSQHDSKSMVAGLLTAVRILAAAGATKIGTCQTVID 497
            TRD+  G I  D +  +  +EY L  +D +  + G    +R+L AAGA ++GT     +
Sbjct: 490 FTRDKGAGSIGVDKKTDEITIEYTLDPYDEEVCLEGAEKGLRVLKAAGAVEVGTHHHDAE 549

Query: 498 DYIVENGVNPLNDPK-FDQFLNKIKKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVG 556
            +      +   + K F+++L  ++  G+   +    +   + SCRMG  P  S ++  G
Sbjct: 550 SFTFGKSTSWKEEKKRFEEYLASVRSKGLKPNRLPMVSYHLLGSCRMGSSPENSVIDAKG 609

Query: 557 EAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKCILD 597
           E W+ E L++ D+SV PT TG+  M+T  +IA+  ++ I++
Sbjct: 610 ETWDAEGLFLTDASVFPTPTGLNPMVTIQSIAYCTAQNIVE 650



>gi|302766828|ref|XP_002966834.1| hypothetical protein SELMODRAFT_87621 [Selaginella moellendorffii]
 gi|300164825|gb|EFJ31433.1| hypothetical protein SELMODRAFT_87621 [Selaginella moellendorffii]
          Length = 747

 Score =  314 bits (804), Expect = 6e-83,   Method: Compositional matrix adjust.
 Identities = 184/485 (37%), Positives = 263/485 (54%), Gaps = 27/485 (5%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+VIEKG +Y    LS  +      +YE  G + T D  + ++AGS  GGGT + W+A +
Sbjct: 267 VVVIEKGKYYVGDQLSLLEGPSMRAMYEGGGLLTTADGGINLMAGSTVGGGTVMNWAASL 326

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTI-NIIHNQS--NQTLINGCKK 241
                VREEW+   GL  F  +EY  AM  +  RLG  T+ N   ++S  N+ L +GCKK
Sbjct: 327 RTPQAVREEWSSVHGLKLFTSEEYEAAMDKVCERLGVETLGNEEEHESFQNKVLRSGCKK 386

Query: 242 LGLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILI 301
           +GL  + IP N     H+CG C FGCK   KQ    TWL +A    A  L  C  E+IL+
Sbjct: 387 IGLDVETIPTNCRGRRHKCGLCGFGCKSRTKQGTHETWLMDAVDAGAVILCGCNAERILL 446

Query: 302 D----KDGKSQKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
           +    +  K  K  GV +     K + I AK  V S GA+++P LL +SGL N++IG NL
Sbjct: 447 EPGELRSAKQWKAGGV-IATGGGKSLFIRAKATVTSCGALNTPVLLQKSGLVNRHIGSNL 505

Query: 358 HVHPIAAVYGVFPNKEI----KTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFA 413
           H+HP   ++G  P+ E     +   G IMSA+S   + V        + V + +PG +  
Sbjct: 506 HLHPSQLLWGYVPSGEGLPAGRISDGPIMSAVSRIADAV--------LEVPAFYPGGLGV 557

Query: 414 NFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGK---PRLEYKLSQHDSKSM 470
            FPW+S L  K+ ML Y+ +  ++VITRDR  G +    +     P++ Y +S  D K++
Sbjct: 558 MFPWRSGLSFKEQMLRYSRLAHVVVITRDRGSGTVRPSSSSSSQLPKVTYTISAEDEKTL 617

Query: 471 VAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQT 530
            AG   A+R+L AAGA ++GT     D  +VE      ++   ++FL  I    +     
Sbjct: 618 KAGAEKAIRVLIAAGAVEVGTQHPDGDSLVVEGS----DEKALEKFLRVIGSKQLTHAAM 673

Query: 531 CTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHY 590
            T +  QM SCRMG+DP  SAV+P GEAWE   L+VAD+SV PTA GV  M+T  ++A  
Sbjct: 674 ATASAHQMGSCRMGNDPASSAVDPRGEAWESTGLFVADTSVFPTALGVNPMVTAQSVALC 733

Query: 591 ISKCI 595
           I+K +
Sbjct: 734 IAKSV 738



>gi|460401007|ref|XP_004246021.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum
           lycopersicum]
          Length = 776

 Score =  314 bits (804), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 181/495 (36%), Positives = 271/495 (54%), Gaps = 36/495 (7%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG +  + +LS  +    D++Y  SG ++T D ++ +LAGS  GGG+T+ WSA +
Sbjct: 286 VIVLEKGSYLARSNLSLLEGPSMDQMYLGSGLLITQDMDVMLLAGSTVGGGSTVNWSASI 345

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +    V +EW++++ L  F  + Y  AM+ +  ++G  +        N  L  GC++LG 
Sbjct: 346 QTPRHVLKEWSESYNLRLFESELYKEAMEIVCEKMGVQSEIEDEGFQNMILRKGCQELGY 405

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNE-AKSNNAKFLKNC-YVEKILID 302
             + IP N  S  H CGWCS GCK G+K+  + TWL +  KS N   L  C  +E I  +
Sbjct: 406 PVETIPTNAPS-DHYCGWCSMGCKDGKKKGTSETWLVDLVKSGNGAILPECEALEVIHEE 464

Query: 303 KDGKS--QKVMGVEVIINNIKRVK----IHAKRVVVSAGAIHSPALLLRSGLKNKNIGRN 356
           K+G S   K +GV     NI+ ++    + +   +++ GA+ +P+LL++SGLKN NIGRN
Sbjct: 465 KNGNSGKSKAIGVAFAFQNIEGMREICMVKSTVTIIACGALSTPSLLIKSGLKNPNIGRN 524

Query: 357 LHVHPIAAVYGVFPNK-----------EIKTYSGTIMSAISNATENVDGENYGAKIVVGS 405
           LH+HP+   +G FP+            E K+Y G IM+A+S    N +G  YGA I    
Sbjct: 525 LHLHPVVIAWGYFPDSPSNSNETWPKAEKKSYEGGIMTAMSKVVANFEGSGYGAVIQTPG 584

Query: 406 HHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQH 465
            HPG   A  PW S L  K  M +Y+    +  + RD+  G   +  +    + YKL Q 
Sbjct: 585 LHPGMFSALMPWVSGLDFKMRMSKYSRTAYIFALARDKGSGEAFSPYS----VSYKLDQT 640

Query: 466 DSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENG----VNPLNDPKFDQFLNKIK 521
           D +++ AGL   +RILAAAGA +IGT Q        E G    VN  +  +F++F+ +  
Sbjct: 641 DEENLKAGLEKTLRILAAAGAEEIGTQQ--------EKGRSLKVNEASTKEFERFVREES 692

Query: 522 KVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSM 581
            + I  +     +  QM SCRMG DP  S VN  GE WEVE L++ DSSV PTA GV  M
Sbjct: 693 SIEIGKHSVPICSAHQMGSCRMGTDPKTSVVNSKGETWEVEGLFLGDSSVCPTAIGVNPM 752

Query: 582 MTTMNIAHYISKCIL 596
           +T   I++  ++ +L
Sbjct: 753 VTIQAISYCTAQSVL 767



>gi|302826268|ref|XP_002994642.1| hypothetical protein SELMODRAFT_138935 [Selaginella moellendorffii]
 gi|300137249|gb|EFJ04292.1| hypothetical protein SELMODRAFT_138935 [Selaginella moellendorffii]
          Length = 656

 Score =  314 bits (804), Expect = 7e-83,   Method: Compositional matrix adjust.
 Identities = 198/641 (30%), Positives = 314/641 (48%), Gaps = 51/641 (7%)

Query: 7   KILSIQKPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFW--LNPYNFNP-- 62
           K     K F E+  ++RE    +W+ S     R  +K F   I  TF+  ++   +NP  
Sbjct: 11  KAYPYDKKFSEVPLEEREKLMYQWANSDDDDSRLNFKIFKTFILNTFYSKVDASGYNPTW 70

Query: 63  -VIGYPGADPEA------------NGSRFSSRNFP------KYNFLEISDHDSDIK---- 99
             IGY G DP +              + F  R  P      K+    + D  S +K    
Sbjct: 71  EAIGYAGPDPNSMKATLPPKPSALKSAVFDVREHPDLRAVLKHTGYTLLDDISHLKPALL 130

Query: 100 --------------EFDTXXXXXXXXXXXXXXRLARME-NVLVIEKGHHYDQCDLSTEQQ 144
                         + D                L+     VL++EKG ++ + DLS  +Q
Sbjct: 131 PSNKLEDGEDVIGIKCDVIIVGAGSGGSVPAQVLSTAGLKVLLLEKGRYFAREDLSLLEQ 190

Query: 145 DGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVREEWAKNFGLPYFM 204
             + +LYE  G + TDD    +++ +  GGGT I W+A  +    VR+EWA+  GLP F 
Sbjct: 191 PTFSELYEEGGFLATDDFAYSLMSAAVVGGGTCINWAASFQTPPHVRQEWAEECGLPMFT 250

Query: 205 EDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQNTASITHQCGWCS 264
            ++Y  A+  I  ++G      + +  N  L  GC +LGLHS NIP+N AS  H CG C+
Sbjct: 251 SEKYQQALDLICKKIGVQPNATVESFQNAVLRKGCVELGLHSANIPRN-ASPEHYCGCCN 309

Query: 265 FGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILI-DKDGKSQKVMGV--EVIINNIK 321
            GC+ G KQ+ T TWL EA +  A  L      ++L  D   K +K +GV    + +  K
Sbjct: 310 MGCRRGMKQATTETWLVEAAAAGATILTGTKGLQVLFTDGTKKEKKAIGVLATTLGDQPK 369

Query: 322 RVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYGVFPNKEI---KTYS 378
           ++ I AK  +VS G+I +P LL+RSGL N NIG++ H+HP+  V+G FP +E     ++ 
Sbjct: 370 KLIIEAKATIVSTGSIMTPPLLIRSGLTNPNIGKHFHIHPVLGVWGYFPEEEKNPGASFE 429

Query: 379 GTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMV 438
           G IM+A S  +   D   YG  ++  S HPG   +   WKS  QHK+ M  +  +  +++
Sbjct: 430 GGIMTAFSAVSARWDTVGYGPVLMTPSFHPGQYASVVTWKSGAQHKEAMRRFRRVSQVVL 489

Query: 439 ITRDREGGRILTD-ENGKPRLEYKLSQHDSKSMVAGLLTAVRILAAAGATKIGTCQTVID 497
            TRD+  G I  D +  +  +EY L  +D +  + G    +R+L AAGA ++GT     +
Sbjct: 490 FTRDKGAGSIGVDKKTDEITIEYTLDPYDEEVCLEGAEKGLRVLKAAGAVEVGTHHHDAE 549

Query: 498 DYIVENGVNPLNDPK-FDQFLNKIKKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVG 556
            +      +   + K F+++L  ++  G+   +    +   + SCRMG  P  S ++  G
Sbjct: 550 SFTFGKSTSWKEEKKRFEEYLASVRSKGLKPNRLPMVSYHLLGSCRMGSSPENSVIDAKG 609

Query: 557 EAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKCILD 597
           E W+ E L++ D+SV PT TG+  M+T  +IA+  ++ I++
Sbjct: 610 ETWDAEGLFLTDASVFPTPTGLNPMVTIQSIAYCTAQNIVE 650



>gi|171678857|ref|XP_001904377.1| hypothetical protein [Podospora anserina S mat+]
 gi|170937499|emb|CAP62157.1| unnamed protein product [Podospora anserina S mat+]
          Length = 752

 Score =  313 bits (803), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 197/603 (32%), Positives = 305/603 (50%), Gaps = 24/603 (3%)

Query: 8   ILSIQKPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYP 67
           + S   P  +L  + R      W  S+  +VR ++KS T L    F  +   F P+ G+P
Sbjct: 146 LTSYGTPLPQLGLEDRTRVLEGWRESRLWAVRGLFKSMTTLGKLGFLRSSNTFAPLTGFP 205

Query: 68  GADPEANGSRFSSRNFPKYNFLEISDHDSDIKEFDTXXXXXXXXXXXXXXRLA----RME 123
               E      ++ +FP + F+  +       E D               RLA    +  
Sbjct: 206 SVPKEW----VATSSFP-FEFIRPTAE----VETDVVIIGSGCGSGVVTNRLANTFGKGV 256

Query: 124 NVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAF 183
            VLV+EKG H+D       Q  G   ++E  G + +DD ++ V AGS FGGG T+ WSA 
Sbjct: 257 KVLVLEKGGHFDASYFPMSQTVGLSAMFEAGGVVESDDGSITVTAGSCFGGGGTVNWSAS 316

Query: 184 MEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLG 243
           ++PQ FVR++WA+ + +P+F   E+   + ++  ++G  T  I  N  NQ L+NG ++ G
Sbjct: 317 LQPQDFVRKDWAETYKMPFFDGREFQECLNHVWEKMGV-TDKITPNHGNQVLLNGGRQTG 375

Query: 244 LHSDNI-PQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNA-KFLKNCYVEKILI 301
                I PQNT    H CG+C+ GC  GEK      W  EA    A +F++    E++L 
Sbjct: 376 CKRCKIVPQNTRGQPHNCGYCTLGCANGEKMGPVNGWFPEAAEKGAVEFMEGFRAERVLF 435

Query: 302 DKDGKSQKVM-GVEVIINNIK-----RVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGR 355
           D+  KS+KV  GV  +    +     +V + AK+VVVSAG + SP +L+ SG+KN  +G+
Sbjct: 436 DEKKKSKKVACGVAGVWTPKEGGEPIKVVVKAKKVVVSAGTLWSPVVLMNSGIKNPQVGK 495

Query: 356 NLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANF 415
           NL++HP+  V G F +++I+ + G  ++ +    E++DG+ +GAK+   S  P       
Sbjct: 496 NLYLHPVNFVAGAF-DEDIRPWEGGSLTTVVGDFEDLDGKGHGAKLEAMSMMPSLALPFL 554

Query: 416 PWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAGL 474
            W+S   +K +  +Y +I   + I RDR+ G I  D   G PR+ Y  S  D      G+
Sbjct: 555 TWRSGSDYKLMAAKYRHINQYISIIRDRDTGYIYRDPYTGDPRISYTPSDFDRAHNFVGV 614

Query: 475 LTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQTCTGT 534
           L   +IL A GA +I  C      ++   G     D  F ++L K+KK G         +
Sbjct: 615 LELCKILHATGAREIHPCLPGFQPFVRSQGDPKKTDKAFKKWLRKLKKHGNKPPVAPFVS 674

Query: 535 IEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKC 594
             QM +CRM        V+P G  W+ E LYVAD+SV PTA+GV  M+TTM +A ++++ 
Sbjct: 675 AHQMGTCRMSAKAKDGVVDPRGRVWDTEGLYVADASVFPTASGVNPMVTTMALADWVARG 734

Query: 595 ILD 597
           I +
Sbjct: 735 ICE 737



>gi|68487530|ref|XP_712386.1| potential long chain fatty acid alcohol oxidase [Candida albicans
           SC5314]
 gi|46433769|gb|EAK93199.1| potential long chain fatty acid alcohol oxidase [Candida albicans
           SC5314]
          Length = 704

 Score =  313 bits (803), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 187/593 (31%), Positives = 311/593 (52%), Gaps = 20/593 (3%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFN-PVIGYPGADPE 72
           P  ++T K+RE     W  S  A+ R+++++   L   T        +   I +P  D  
Sbjct: 103 PIKDMTLKERETLLASWRDSPLAAKRRLFRAICALSGTTIVRLASELHLKAIHFPQRDLR 162

Query: 73  ANGSRFSSRNFPKYNFLEISDHDSD---IKEFDTXXXXXXXXXXXXXXRLAR-MENVLVI 128
                    +  +Y+F+E    +     + + D                LA      LV+
Sbjct: 163 ETAYEGQVIDPFRYDFMEKPSFEGAEIYLPDIDVIIIGSGAGSGVVAHTLANDGYKTLVL 222

Query: 129 EKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQY 188
           EKG ++   +L  +   G  +LY+  G + T +  M +LAGS FGGGTT+ WSA ++  +
Sbjct: 223 EKGKYFSASELQFDDHTGVKQLYQGGGAVATLNQQMLILAGSTFGGGTTVNWSACIKTPF 282

Query: 189 FVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDN 248
            VR+EW  +FG+ +   D Y     Y+  ++G +T  I H+ +N+ ++ G KKLG  S  
Sbjct: 283 KVRKEWYDDFGVEFAATDSYDKDQDYVFKQMGASTDGITHSLANEVIMEGGKKLGYASKE 342

Query: 249 IPQNTASITHQ-CGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKS 307
           I QN+    H  CG+C  GCKYG KQ + + W  +A +N +KF++   V KIL +K+G +
Sbjct: 343 INQNSGGHPHHPCGFCHLGCKYGIKQGSVVNWFRDAAANGSKFMEQVRVVKIL-NKNGIA 401

Query: 308 QKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYG 367
             V+  + +   +       K+ VVSAG++++P +L  SG KNKNIGRNL +HP+  V+G
Sbjct: 402 YGVL-CQDVATGVNFTITGPKKYVVSAGSLNTPTVLANSGFKNKNIGRNLTLHPVTTVFG 460

Query: 368 VFPNKEIKT--YSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQ 425
            F  +E++   +  +IM+A+    +++DG  +GAKI    + P    A  PW+ + + ++
Sbjct: 461 DF-GREVQADHFHNSIMTAVCTQVDDLDGRAHGAKIETILNAPFLQAAFLPWRGSNEFRR 519

Query: 426 LMLEYNNIVPLMVITRDREGGRILTDENGKPRL--EYKLSQHDSKSMVAGLLTAVRILAA 483
            +L YNN+V +++ITRD   G +  D      L  +Y +++ D  +++  LL    +L  
Sbjct: 520 DLLRYNNMVAMLLITRDSTSGTVKGDPYRPDALYVDYTINKFDRNALLQALLITADMLYI 579

Query: 484 AGATKIGTCQTVIDDYIVENGV----NPLNDPKFDQFLNKIKKVGIPTYQTCTGTIEQMS 539
            GA +I + Q+ +   I E+ V      ++D  + ++  K+  +    Y    G+  QMS
Sbjct: 580 EGAKRILSPQSWVP--IFESNVPKDQRSIDDKDYVEWRKKVAGIPFDQYGAAYGSAHQMS 637

Query: 540 SCRM-GDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYI 591
           SCRM G  P   AV+  G+ +E  N+YVAD+SVLPTA+G   M++TM +A +I
Sbjct: 638 SCRMSGKGPGYGAVDTNGKLYECSNVYVADASVLPTASGANPMISTMTVARHI 690



>gi|168000841|ref|XP_001753124.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162695823|gb|EDQ82165.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 699

 Score =  313 bits (802), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 208/647 (32%), Positives = 312/647 (48%), Gaps = 76/647 (11%)

Query: 13  KPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFW--LNPYNFNPV---IGYP 67
           + F  LT ++RE     WSTS  + +R+++KS   +   T +  +N    N     IGY 
Sbjct: 42  RKFANLTPEEREKMLQGWSTSLLSPLRRLFKSMKSITGYTLYSKINDEGENAAWKAIGYT 101

Query: 68  GADPEAN-----------------------GSRF----SSRNFPKYNFLE---------- 90
           G DP                          G R      ++ F   + ++          
Sbjct: 102 GMDPTVRSRSKEEYWKPRPLGDGHVDAKEAGVRLKAILGAKGFSVLDEIKSFRVQSRKWG 161

Query: 91  ISDHDSDI-KEFDTXXXXXXXXXXXXXXRLARME-NVLVIEKGHHYDQCDLSTEQQDGYD 148
            S+  SDI  E D                LA+    VLV+EKG ++   D+++ +  G  
Sbjct: 162 YSESSSDIYMECDVVIVGSGSGGGVMAAVLAKQGFKVLVLEKGQYFAAQDITSLEGPGMV 221

Query: 149 KLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWS-AFMEPQYFVREEWAKNFGLPYFMEDE 207
            +YE  G   TDD  + ++AG   GGGT + W  +F  P++ VR EW  + GL  F   +
Sbjct: 222 NMYEKMGAQSTDDGGVSLIAGKTVGGGTAVNWCVSFKTPEH-VRNEWVNDHGLDLFTSAQ 280

Query: 208 YGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQNTASITHQCGWCSFGC 267
           Y  AM+ +  RL        H+  N  L+ GCKKLG     + +N  S  H CGWCS+GC
Sbjct: 281 YEQAMQAVWKRLAVQPEVDKHSLQNTVLLEGCKKLGYECGTLQRN-CSPGHYCGWCSYGC 339

Query: 268 KYGEKQSATMTWLNEA-KSNNAKFLKNCYVEKILIDKD---GKSQKVMGVEVIIN-NIKR 322
             G+KQS   TWL +A  + NA  L NC+ + +  D +    K++K  GV   I     R
Sbjct: 340 PTGKKQSTAETWLVDAVNTGNAVILSNCHAKHVFHDANPGGKKARKGHGVVATIGEGSTR 399

Query: 323 VKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYGVFPNK---EIKTYSG 379
           + + A   V++ GA+ +P LLLRSGLKN NIG+ L VHP    +G FP +   + K+Y G
Sbjct: 400 IFVKANATVIACGALLTPPLLLRSGLKNPNIGKYLRVHPATTCFGYFPEEVEPKGKSYEG 459

Query: 380 TIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVI 439
            IM+  S  T     E YG  +  G  HP    A  PW+S    K+ +L +     + V+
Sbjct: 460 GIMTTYSPVTLRKPTE-YGGLLETGVFHPAVFAAFHPWQSGADGKERLLHHARTSHITVV 518

Query: 440 TRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDY 499
           TRD+  G    D +G P   YK+S +D ++++AG++ ++RIL AAGA +IGT Q   + +
Sbjct: 519 TRDKGFGTAKIDNDGLPMYSYKISPYDEQTLIAGMIQSLRILVAAGAVEIGTQQLDGERF 578

Query: 500 -----------------IVENGVNPLNDPKFDQFLNKIKKVGIPTYQTCTGTIEQMSSCR 542
                            +V  G  P    + +++L+++K+           +  Q+ SCR
Sbjct: 579 KHCNSNWPIRTDSSNCIVVTAGATP---AQIEEYLDRVKRRRARQSSIQIASAHQLGSCR 635

Query: 543 MGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAH 589
           MG  P  SAV+  GE WE E ++VAD SVLPT++GV  M+T  +IA+
Sbjct: 636 MGTSPRTSAVDARGETWEAEGVFVADGSVLPTSSGVNPMVTIQSIAY 682



>gi|261191646|ref|XP_002622231.1| long chain fatty alcohol oxidase [Ajellomyces dermatitidis
           SLH14081]
 gi|239589997|gb|EEQ72640.1| long chain fatty alcohol oxidase [Ajellomyces dermatitidis
           SLH14081]
          Length = 751

 Score =  313 bits (801), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 196/602 (32%), Positives = 320/602 (53%), Gaps = 42/602 (6%)

Query: 23  REHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADPEANGSRFSSRN 82
           RE  F  W+TS    +R +Y+S   L    +         ++G+P          F++  
Sbjct: 150 REAIFRGWATSVLPPMRTVYRSLIALFHKAWIPLSPTLPALVGFPRVP-----VGFTTAE 204

Query: 83  FPKYNFLEISDHD-SDIKEFDTXXXXXXXXXXXXXXRLARM-ENVLVIEKGHHYDQCDLS 140
              Y FL++   D ++    D                ++    +V+V+EK +++ +    
Sbjct: 205 GYPYEFLQLPPGDNTEAIYVDVVIIGSGCGAAVAAKNISEAGHSVIVVEKSYYWSEKHFP 264

Query: 141 TEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVREEWAKNFGL 200
              ++G   L+E  G  ++DD ++ V++GS +GGG TI WSA ++ Q +VR+EWAK  G+
Sbjct: 265 MTMKEGTSNLFENGGATVSDDGSVAVISGSTWGGGGTINWSASLQTQNYVRQEWAKK-GM 323

Query: 201 PYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQNTASITHQC 260
           P+F   E+  ++  +  R+G NT ++ HN +N+ L+ G +KLG  +  +PQNT +  H C
Sbjct: 324 PFFTSSEFQKSLDRVCERMGVNTEHVKHNSANRLLLEGARKLGYAATTVPQNTGNQEHSC 383

Query: 261 GWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQKVM--GVEVI-- 316
           G C+ GC    K+   +T+L +A    A+F++  + ++IL  ++G +   +  GVE    
Sbjct: 384 GHCTLGCGSCGKKGPQVTYLADAARAGAQFIEGFHADRILF-REGNAGNCLAHGVEGTWT 442

Query: 317 ---INN-------IKR-VKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAV 365
              IN        IKR V I AK+++VS G++ SP LLLRSGLKN  IGRNL++HP   V
Sbjct: 443 SRDINQGVCGEPVIKRKVVIKAKKIIVSCGSLQSPLLLLRSGLKNPQIGRNLYLHP---V 499

Query: 366 YGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQ 425
           +G    +E+K + G+I++++ N  EN+DG  +GAKI   +  P F    FPW + L++K+
Sbjct: 500 FG----QEMKPWEGSILTSVVNEFENLDGHGHGAKIETLTTVPSFFLPVFPWNNGLEYKR 555

Query: 426 LMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAGLLTAVRILAAA 484
            +    N+  L+ +TR+R GGR+  D  +G+ R+ Y  S  D K+M+  ++ A +I    
Sbjct: 556 FVSNLRNMAGLITLTRERYGGRVYPDPVDGRCRISYTPSHFDRKNMIEAVIGAAKIAYVC 615

Query: 485 GATKIGTCQTVIDDYI-----VENGVNP---LNDPKFDQFLNKIKKVGIP--TYQTCTGT 534
           GA +I T    I  +I           P   +N   F  ++ K++    P     T   +
Sbjct: 616 GAQEIYTTSRDIPTFIRPERLATEACGPEAGINHSAFQAWVKKVRHTYSPLTPEHTVFAS 675

Query: 535 IEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKC 594
             QM +CRMG  P  S V+P G+ W  E LYVAD+SV P+A+GV  M+T M I+ + S+ 
Sbjct: 676 AHQMGTCRMGTSPKTSVVDPSGKVWGTEGLYVADASVFPSASGVNPMITNMAISDWTSQN 735

Query: 595 IL 596
           I+
Sbjct: 736 IV 737



>gi|68487603|ref|XP_712350.1| potential long chain fatty acid alcohol oxidase [Candida albicans
           SC5314]
 gi|46433730|gb|EAK93161.1| potential long chain fatty acid alcohol oxidase [Candida albicans
           SC5314]
          Length = 704

 Score =  313 bits (801), Expect = 1e-82,   Method: Compositional matrix adjust.
 Identities = 187/593 (31%), Positives = 311/593 (52%), Gaps = 20/593 (3%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFN-PVIGYPGADPE 72
           P  ++T K+RE     W  S  A+ R+++++   L   T        +   I +P  D  
Sbjct: 103 PIKDMTLKERETLLASWRDSPLAAKRRLFRAICALSGTTIVRLASELHLKAIHFPQRDLR 162

Query: 73  ANGSRFSSRNFPKYNFLEISDHDSD---IKEFDTXXXXXXXXXXXXXXRLAR-MENVLVI 128
                    +  +Y+F+E    +     + + D                LA      LV+
Sbjct: 163 ETAYEGQVIDPFRYDFMEKPSFEGAEIYLPDIDVIIIGSGAGSGVVAHTLANDGYKTLVL 222

Query: 129 EKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQY 188
           EKG ++   +L  +   G  +LY+  G + T +  M +LAGS FGGGTT+ WSA ++  +
Sbjct: 223 EKGKYFSASELQFDDHTGVKQLYQGGGAVATLNQQMLILAGSTFGGGTTVNWSACIKTPF 282

Query: 189 FVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDN 248
            VR+EW  +FG+ +   D Y     Y+  ++G +T  I H+ +N+ ++ G KKLG  S  
Sbjct: 283 KVRKEWYDDFGVEFAATDSYDKDQDYVFKQMGASTDGITHSLANEVIMEGGKKLGYASKE 342

Query: 249 IPQNTASITHQ-CGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKS 307
           I QN+    H  CG+C  GCKYG KQ + + W  +A +N +KF++   V KIL +K+G +
Sbjct: 343 INQNSGGHPHHPCGFCHLGCKYGIKQGSVVNWFRDAAANGSKFMEQVRVVKIL-NKNGIA 401

Query: 308 QKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYG 367
             V+  + +   +       K+ VVSAG++++P +L  SG KNKNIGRNL +HP+  V+G
Sbjct: 402 YGVL-CQDVATGVNFTITGPKKYVVSAGSLNTPTVLANSGFKNKNIGRNLTLHPVTTVFG 460

Query: 368 VFPNKEIKT--YSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQ 425
            F  +E++   +  +IM+A+    +++DG  +GAKI    + P    A  PW+ + + ++
Sbjct: 461 DF-GREVQADHFHNSIMTAVCTQVDDLDGRAHGAKIETILNAPFLQAAFLPWRGSNEFRR 519

Query: 426 LMLEYNNIVPLMVITRDREGGRILTDENGKPRL--EYKLSQHDSKSMVAGLLTAVRILAA 483
            +L YNN+V +++ITRD   G +  D      L  +Y +++ D  +++  LL    +L  
Sbjct: 520 DLLRYNNMVAMLLITRDSTSGTVKGDPYRPDALYVDYTINKFDRNALLQALLITADMLYI 579

Query: 484 AGATKIGTCQTVIDDYIVENGV----NPLNDPKFDQFLNKIKKVGIPTYQTCTGTIEQMS 539
            GA +I + Q+ +   I E+ V      ++D  + ++  K+  +    Y    G+  QMS
Sbjct: 580 EGAKRILSPQSWVP--IFESNVPKDQRSIDDKDYVEWRKKVAGIPFDQYGAAYGSAHQMS 637

Query: 540 SCRM-GDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYI 591
           SCRM G  P   AV+  G+ +E  N+YVAD+SVLPTA+G   M++TM +A +I
Sbjct: 638 SCRMSGKGPGYGAVDTNGKLFECSNVYVADASVLPTASGANPMISTMTVARHI 690



>gi|302755496|ref|XP_002961172.1| hypothetical protein SELMODRAFT_73531 [Selaginella moellendorffii]
 gi|300172111|gb|EFJ38711.1| hypothetical protein SELMODRAFT_73531 [Selaginella moellendorffii]
          Length = 747

 Score =  312 bits (799), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 183/485 (37%), Positives = 263/485 (54%), Gaps = 27/485 (5%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+VIEKG +Y    LS  +      +YE  G + T D  + ++AGS  GGGT + W+A +
Sbjct: 267 VVVIEKGKYYVGDQLSLLEGPSMRAMYEGGGLLTTADGGINLMAGSTVGGGTVMNWAASL 326

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTI-NIIHNQS--NQTLINGCKK 241
                VREEW+   GL  F  +EY  AM  +  RLG  T+ N   ++S  N+ L +GCKK
Sbjct: 327 RTPQAVREEWSSVHGLKLFTSEEYEAAMDKVCERLGVETLGNEEEHESFQNKVLRSGCKK 386

Query: 242 LGLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILI 301
           +GL  + IP N     H+CG C FGCK   KQ    TWL +A    A  L  C  E+IL+
Sbjct: 387 IGLDVETIPTNCRGRRHKCGLCGFGCKSRTKQGTHETWLMDAVDAGAVILCGCNAERILL 446

Query: 302 D----KDGKSQKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
           +    +  K  K  GV +     K + I AK  V S GA+++P LL +SGL N++IG NL
Sbjct: 447 EPGELRSAKQWKAGGV-IATGGGKSLFIRAKATVTSCGALNTPVLLQKSGLVNRHIGSNL 505

Query: 358 HVHPIAAVYGVFPNKEI----KTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFA 413
           H+HP   ++G  P+ E     +   G IMSA+S   + V        + V + +PG +  
Sbjct: 506 HLHPSQLLWGYVPSGEGLPAGRISDGPIMSAVSRIADAV--------LEVPAFYPGGLGV 557

Query: 414 NFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGK---PRLEYKLSQHDSKSM 470
            FPW+S L  K+ ML Y+ +  ++VITRD+  G +    +     P++ Y +S  D K++
Sbjct: 558 MFPWRSGLSFKEQMLRYSRLAHVVVITRDQGSGTVRPSSSSSSQLPKVTYTISAEDEKTL 617

Query: 471 VAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQT 530
            AG   A+R+L AAGA ++GT     D  +VE      ++   ++FL  I    +     
Sbjct: 618 KAGAEKAIRVLIAAGAVEVGTQHPDGDSLVVEGS----DEKALEKFLRVIDSKQLTHAAM 673

Query: 531 CTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHY 590
            T +  QM SCRMG+DP  SAV+P GEAWE   L+VAD+SV PTA GV  M+T  ++A  
Sbjct: 674 ATASAHQMGSCRMGNDPASSAVDPRGEAWESTGLFVADTSVFPTALGVNPMVTAQSVALC 733

Query: 591 ISKCI 595
           I+K +
Sbjct: 734 IAKSV 738



>gi|440635542|gb|ELR05461.1| hypothetical protein GMDG_01756 [Geomyces destructans 20631-21]
          Length = 721

 Score =  312 bits (799), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 188/608 (30%), Positives = 310/608 (50%), Gaps = 28/608 (4%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADPEA 73
           P  +L  K R      W T   +++R +  +FT  I    ++      P I    A P  
Sbjct: 132 PLDQLDIKSRTAILQNWGTHYLSAMRTLCNTFTS-IGKMIYIKSSRLFPAITGFSAIP-- 188

Query: 74  NGSRFSSRNFPKYNFLEISDHDSD-IKEFDTXXXXXXXXXXXXXXRLARME-NVLVIEKG 131
              ++S     +Y FL+  +  +  I  FD                LA    +VLV++K 
Sbjct: 189 --LKYSPGPSYEYTFLQFPESQTPAILNFDVVIVGSGLGGGISAKNLAEAGFSVLVVDKA 246

Query: 132 HHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVR 191
           +HY    L   + +G   L+E  G + ++DS++ VL GSNFGGG T+ WSA ++PQ FVR
Sbjct: 247 YHYTSAQLPMTEAEGMILLFENGGIIPSEDSSINVLTGSNFGGGGTVNWSAALQPQSFVR 306

Query: 192 EEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQ 251
           +EWA++  LP F    +  ++  +  R+G +  +I HN  N+ L+ G +++G  +  +PQ
Sbjct: 307 KEWAEDRNLPLFTSATFQESLDRVWERMGVSDKHIRHNHGNRVLLEGARRMGHTAKAVPQ 366

Query: 252 NTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQKVM 311
           NTA   H CG C  GC   EKQ  T+ WL +A    A+F++   VEK+L++     +K +
Sbjct: 367 NTAGNEHYCGHCIMGCSSSEKQGPTVCWLPDAARAGAQFVEGLAVEKVLMN----GKKAV 422

Query: 312 GVEVI----INNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYG 367
           GV+ +        + V + AKRV+V+AG+I+SP +L+ SG+KN  IGR+L++HP+  V  
Sbjct: 423 GVKGLWTSRAGGKREVIVKAKRVIVAAGSIYSPHILMNSGIKNNQIGRHLYLHPVNVVSA 482

Query: 368 VFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQLM 427
            F  +E++ + G I++ + ++ EN+DG  +G K+      P    +   W S    K   
Sbjct: 483 FF-KEEVRPWEGGILTTVCSSFENLDGHGHGVKLEATCMLPSLCLSMVNWDSGTSWKTTA 541

Query: 428 LEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGLLTAVRILAAAGAT 487
            +Y ++   + +TRDR+ GR+L      P++EY  S  D + ++ GL+   R+L   GA 
Sbjct: 542 AKYPHMNSYISLTRDRDPGRVLHG----PKIEYTPSAFDRRHVLRGLIEMSRMLLVVGAR 597

Query: 488 KIGTCQTVIDDYIVE----NGVNPLNDPKFDQFLNKIKKVGIPTYQTCTGTIEQMSSCRM 543
           +I      I  +IV+    +    + DP+F +++  ++ VG            QM S RM
Sbjct: 598 EIHINVPGIRPFIVDETGGDATCEIVDPRFLKWIAHVEAVGNSPPNATFACAHQMGSNRM 657

Query: 544 GDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKCILDKKIFTV 603
                   V+P G  W  + LY+ D+SV P+A+GV  M+T + I+   S+ I       +
Sbjct: 658 SAKKADGVVDPEGRVWGTKGLYITDASVFPSASGVNPMVTNLAISDITSRGIAAG----L 713

Query: 604 KKKRGSML 611
           KK+ G+ L
Sbjct: 714 KKETGTKL 721



>gi|241959034|ref|XP_002422236.1| fatty alcohol oxidase, putative [Candida dubliniensis CD36]
 gi|223645581|emb|CAX40240.1| fatty alcohol oxidase, putative [Candida dubliniensis CD36]
          Length = 707

 Score =  311 bits (797), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 190/610 (31%), Positives = 321/610 (52%), Gaps = 27/610 (4%)

Query: 3   LINSKILSIQ-----KPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATF--WL 55
           ++ S+IL+        P  ++T K+RE     W  S  A+ R+++++   L   T     
Sbjct: 90  ILGSRILAPTLTNSLTPIKDMTLKEREALLASWRDSPLATKRRLFRAVCALAGTTIVRLA 149

Query: 56  NPYNFNPVIGYPGADPEANGSRFSSRNFPKYNFLEISDHDSD---IKEFDTXXXXXXXXX 112
           +  +F   I +P  D           +  +Y F+E    +     + + D          
Sbjct: 150 SELHFK-AIHFPQKDLRETAYEGQIIDPFRYEFMEKPTFEGAEIYLPDIDAIIIGSGAGS 208

Query: 113 XXXXXRLAR-MENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSN 171
                 LA      L++EKG ++   +L  +   G  +LY+  G ++T +  M +LAGS 
Sbjct: 209 GVVAHTLANDGYKTLILEKGKYFSSSELQFDDYSGVKQLYQGGGAVVTLNQQMLILAGST 268

Query: 172 FGGGTTIGWSAFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQS 231
           FGGGTT+ WSA ++  + VR+EW  +FG+ +   D Y     Y+  ++G +T  I H+ +
Sbjct: 269 FGGGTTVNWSACIKTPFKVRKEWYDDFGVEFAATDTYDKDQDYVFKQMGASTDGITHSLA 328

Query: 232 NQTLINGCKKLGLHSDNIPQNTASITHQ-CGWCSFGCKYGEKQSATMTWLNEAKSNNAKF 290
           N+ ++ G KKLG  S  I QN+    H  CG+C  GCKYG KQ +   W  +A +N +KF
Sbjct: 329 NEVIMEGGKKLGYASKEINQNSGGHPHHPCGFCHLGCKYGIKQGSVANWFRDAAANGSKF 388

Query: 291 LKNCYVEKILIDKDGKSQKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKN 350
           ++   V KIL +K+G +  V+  + +   +       K+ VVSAG++++P +L  SG KN
Sbjct: 389 MEQVRVVKIL-NKNGIAYGVL-CQDVATGVNFTITGPKKYVVSAGSLNTPTVLTNSGFKN 446

Query: 351 KNIGRNLHVHPIAAVYGVFPNKEIKT--YSGTIMSAISNATENVDGENYGAKIVVGSHHP 408
           K+IGRNL +HP+  V+G F  K+++   +  +IM+A+    +++DG+ +GAKI    + P
Sbjct: 447 KHIGRNLTLHPVTTVFGDF-GKDVQADHFHNSIMTAVCTQVDDLDGKAHGAKIETILNAP 505

Query: 409 GFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRL--EYKLSQHD 466
               A  PW+ + + ++ +L YNN+V +++ITRD   G +  D N    L  +Y +++ D
Sbjct: 506 FLQAAFLPWRGSNEFRRDLLRYNNMVAMLLITRDSTSGTVKGDPNRPDALYVDYTVNKFD 565

Query: 467 SKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGV----NPLNDPKFDQFLNKIKK 522
             +++  LL    +L   GA +I + Q+ +   I E+ V      ++D  + ++  K+  
Sbjct: 566 RNALLQALLITADMLYIEGAKRILSPQSWVP--IFESNVPKDQRSIDDKDYVEWRKKVAG 623

Query: 523 VGIPTYQTCTGTIEQMSSCRM-GDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSM 581
           +    Y    G+  QMSSCRM G  P   AV+  G+ +E  N+YVAD+SVLPTA+G   M
Sbjct: 624 IPFDQYGAAYGSAHQMSSCRMSGKGPAFGAVDTNGKLFECSNVYVADASVLPTASGANPM 683

Query: 582 MTTMNIAHYI 591
           ++TM +A +I
Sbjct: 684 ISTMTVARHI 693



>gi|46125081|ref|XP_387094.1| hypothetical protein FG06918.1 [Fusarium graminearum PH-1]
          Length = 925

 Score =  311 bits (797), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 189/620 (30%), Positives = 306/620 (49%), Gaps = 41/620 (6%)

Query: 8   ILSIQKPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYP 67
           I    +P +      RE     W+TS       + K+ + L   ++       + + GY 
Sbjct: 130 ITGYWQPIYNQPAHVREAIIKSWATSPRERWSALAKTMSSLSFKSYAQTSSLLSQLSGY- 188

Query: 68  GADPEANGSRFSSRNFPKYNFLEISDHDSD-IKEFDTXXXXXXXXXXXXXXRLARM-ENV 125
                     +  +    Y+F++I   D   + E D                LA     V
Sbjct: 189 ----SDTPQHWQPKQSFDYSFIQIEAGDEPHVIETDVVIVGSGCGGGVSAKNLAEAGHKV 244

Query: 126 LVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFME 185
           LV++K +HY    L   Q+ G   L++  G + T+DS   V AGS +GGG T+ WS  ++
Sbjct: 245 LVVDKAYHYPAKHLPMSQEAGCAHLFDSGGFITTEDSGATVTAGSAWGGGGTVNWSVCLK 304

Query: 186 PQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLH 245
           PQ FVR+EWA + GLP F    +  ++  +    G  T  I HN  N+ L+NG  KLG  
Sbjct: 305 PQGFVRKEWADS-GLPLFTSPAFDESLDRVWEFQGAGTDQIRHNHRNKVLLNGSSKLGWA 363

Query: 246 SDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDG 305
           S   P NT    H CG C  GC   EK+    +WL +A    A+F++   V++++ D DG
Sbjct: 364 SSPAPVNTGGREHFCGQCHLGCGLAEKRGPATSWLPDAAKAGAQFMEGFQVDQVMFDADG 423

Query: 306 KSQKVMGVE--------------VIINNIK-RVKIHAKRVVVSAGAIHSPALLLRSGLKN 350
             Q  +GVE               + + +K RV + AK+V+++AG+I SP +L++SG+ N
Sbjct: 424 --QTAIGVEGDWLSRDSEGGVSDSVGDRVKRRVVVKAKKVILAAGSIWSPVVLMKSGITN 481

Query: 351 KNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGF 410
           +++G NLH+HP   V  V+  +E + + G I+++ S+  +N DG  YG K+      P  
Sbjct: 482 QHVGANLHIHPCNFVTAVY-KEETRPWEGGIITSYSSEFDNTDGSGYGTKLETTCMVPFT 540

Query: 411 MFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDEN-GKPRLEYKLSQHDSKS 469
           + +   W   L  K  M +Y ++   + +TRDR+GGR+  D + G+PR++Y  S +D   
Sbjct: 541 IMSQPSWLGGLNAKLHMTKYRHMDGWISLTRDRDGGRVFPDPSTGRPRIDYTTSDYDRAH 600

Query: 470 MVAGLLTAVRILAAAGATKIGTCQTVIDDYIVE---------NGVNPL-----NDPKFDQ 515
            + G+    +I    GAT+I      ++ +I +         +   P+     +DP F  
Sbjct: 601 TMQGVEGLAKICYVTGATEIRPLLPGLESFIRDGECSSEHSLDSKGPVADPETSDPAFAA 660

Query: 516 FLNKIKKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTA 575
           +L ++++VG     T  G+  QM +CRM    ++  V+  G  W+ ENLYVAD+SV P+A
Sbjct: 661 WLARLREVGNKPPTTTWGSAHQMGTCRMSASRDEGVVDEKGRVWDTENLYVADASVFPSA 720

Query: 576 TGVPSMMTTMNIAHYISKCI 595
           +GV  M+T M IA +IS+ +
Sbjct: 721 SGVNPMITIMAIADWISRGV 740



>gi|169599110|ref|XP_001792978.1| hypothetical protein SNOG_02371 [Phaeosphaeria nodorum SN15]
 gi|160704537|gb|EAT90583.2| hypothetical protein SNOG_02371 [Phaeosphaeria nodorum SN15]
          Length = 735

 Score =  311 bits (797), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 188/594 (31%), Positives = 302/594 (50%), Gaps = 35/594 (5%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYP----GA 69
           P  E     RE     WST++   +R++++S ++L   T+     +   V+G P    G 
Sbjct: 150 PISEQPAHIREAIVFGWSTARIGVLRQLHRSLSVLTKQTWIKITPSLRRVLGVPRVPVGM 209

Query: 70  DPEANGSRFSSRNFPKYNFLEISDHDS-DIKEFDTXXXXXXXXXXXXXXRLARME-NVLV 127
            P   G  +       Y FL+    D+ +I E D                LA     V+V
Sbjct: 210 QP---GKGYD------YEFLQFPPGDNPEIIETDVIIVGSGCGGGVSAKNLAEAGFRVIV 260

Query: 128 IEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQ 187
            EK +H+        +  G++ L+     + +DD++  ++AG ++GGG T+ WSA ++ Q
Sbjct: 261 AEKAYHWSPDHYPMAESHGWNHLFMNGAFISSDDTSTSIVAGQSWGGGGTVNWSASLQTQ 320

Query: 188 YFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSD 247
            +VR EWA N GLP+F   EY  A+  +  R+G +   I HN +N  L+ G +KLG    
Sbjct: 321 GYVRREWADN-GLPFFTSAEYQEALDRVCNRMGVSADFIKHNPANVKLLEGARKLGWSHK 379

Query: 248 NIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKS 307
            +PQNT    H CG+C+FGC   EKQ  ++++L +A    A F++    EKI+    G  
Sbjct: 380 PVPQNTGGAQHYCGYCTFGCGSCEKQGPSVSYLPDAARAGANFIEGFDAEKIVFSNKGGK 439

Query: 308 QKVMGVEVIINN-------------IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIG 354
           +   G++    +              ++V I+AKRV+VSAG + SP LLLRSGL N  IG
Sbjct: 440 RVATGLQGTWTSRDANGGVAGAPLITRKVLINAKRVIVSAGTMQSPLLLLRSGLTNPQIG 499

Query: 355 RNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFAN 414
           RNL VHP+A +  + P +EIK + G I++++ N  EN+DG+ +G K+   +  P      
Sbjct: 500 RNLAVHPVAVLGAIHP-EEIKPWEGGILTSVVNEYENLDGKGHGVKLEATNMIPSSWLIW 558

Query: 415 FPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAG 473
             WK  LQ+K       ++V  + + ++++ GR+  D  +G+ R +Y  S+   + ++ G
Sbjct: 559 LDWKGGLQYKLDAARLKHMVGYISLAKEKDTGRVYPDPVDGRVRFQYSPSKVAKQHIMEG 618

Query: 474 LLTAVRILAAAGATKIGTC----QTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQ 529
           LL   +I    GAT+I T     +    D  V    + +ND +F  +L ++K  G PT +
Sbjct: 619 LLALAKIQYVEGATEIFTVIPGMRPFKRDPSVPQSGDGINDTEFQAWLAEVKARGFPTPE 678

Query: 530 TCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMT 583
           +   +  QM +CRM        V+P G+ W  E +YV D+SV P+A+GV  M+T
Sbjct: 679 SVFVSAHQMGTCRMSAREKDGVVDPQGKVWGTEGVYVTDASVFPSASGVNPMVT 732



>gi|391865561|gb|EIT74840.1| choline dehydrogenase [Aspergillus oryzae 3.042]
          Length = 748

 Score =  311 bits (797), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 198/623 (31%), Positives = 313/623 (50%), Gaps = 40/623 (6%)

Query: 13  KPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLN-PYNFNPVIGYPGADP 71
           +PFH      RE  F  W TS+   +R IY++ +  IC   WL       P IG+P    
Sbjct: 142 QPFH-----VRERIFCSWETSRLKPLRVIYRALSA-ICKRTWLTYSPTLCPTIGFPRVP- 194

Query: 72  EANGSRFSSRNFPKYNFLEI-SDHDSDIKEFDTXXXXXXXXXXXXXXRLARME-NVLVIE 129
             +GS   +  F +Y FL+  S H  +  E D                LA     V+V+E
Sbjct: 195 -VHGS--PADGF-EYEFLQFPSGHGPETIETDVVIVGSGCGGSVTAKNLAEAGYKVVVVE 250

Query: 130 KGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYF 189
           K + Y          +G   ++E  G + T+D ++ + AG+ +GGG TI WSA ++ Q +
Sbjct: 251 KAYQYSTKYFPMNFSEGSVSMFEGGGAVSTNDGSIGIFAGATWGGGGTINWSAALQTQNY 310

Query: 190 VREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNI 249
           VREEWAK  GLP+F   E+ N++  +  R+G +  +  HN+ N+ L+ G  KLG  ++ +
Sbjct: 311 VREEWAKG-GLPFFTSLEFQNSLDRVCERMGVSADHTTHNKQNRVLLEGAHKLGYAANPV 369

Query: 250 PQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQK 309
           PQNT    H CG C+ GC    K+  T ++L +A    A F++    EK+L  +    + 
Sbjct: 370 PQNTGGTEHYCGHCTMGCHSAGKKGPTESFLVDAAHAGATFVEGFRAEKVLFTETKGGRV 429

Query: 310 VMGVE---------VIINNIKRVK----IHAKRVVVSAGAIHSPALLLRSGLKNKNIGRN 356
             GVE         + ++ +  VK    I AKRVVVS G + SP LLLRSGLKN  IGRN
Sbjct: 430 ASGVEGTWTSRDAYLGVSGVGAVKRKLIIKAKRVVVSCGTLQSPLLLLRSGLKNPQIGRN 489

Query: 357 LHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFP 416
           LH+HP+     VF +++ + + G  ++A+ N  EN+D + +G KI   +  P      FP
Sbjct: 490 LHLHPVVISGAVF-DEQTRPWEGAALTAVVNEFENLDKQGHGVKIECLTMLPPAFLPAFP 548

Query: 417 WKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAGLL 475
           W+  L+ K+ + +  ++   + +T+DR+ GR+  D  +G+PR++Y +S  D K ++  L+
Sbjct: 549 WRDGLEWKRFVAKLPHMAGFITLTKDRDSGRVYPDPVDGRPRVDYTVSAFDRKHILEALV 608

Query: 476 TAVRILAAAGATKIGTCQTVIDDYIVEN------GVNPLNDPKFDQFLNKIKKVGIPTYQ 529
              ++   +GA +  T    I  +I              N+     ++ + +   +   +
Sbjct: 609 ATAKMAYISGAKEFHTSSREIPPFIRPEDSSDTASAEGTNNAALQAWIAEARSKTLDPEK 668

Query: 530 TCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAH 589
           T      QM +CRMG  P  S V+P  + W    LYV D+SV P+A+GV  M+T M IA 
Sbjct: 669 TTFAAAHQMGTCRMGSSPRTSVVDPDCQVWGTRGLYVVDASVFPSASGVNPMVTNMAIAD 728

Query: 590 YISKCILDKKIFTVKKKRGSMLR 612
           + S+ I      ++ K+ G M R
Sbjct: 729 WASQNIAR----SLGKEGGVMAR 747



>gi|302798701|ref|XP_002981110.1| hypothetical protein SELMODRAFT_114089 [Selaginella moellendorffii]
 gi|300151164|gb|EFJ17811.1| hypothetical protein SELMODRAFT_114089 [Selaginella moellendorffii]
          Length = 656

 Score =  311 bits (796), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 195/635 (30%), Positives = 313/635 (49%), Gaps = 51/635 (8%)

Query: 13  KPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFW--LNPYNFNP---VIGYP 67
           K F E+  ++RE    +W+ S     R  +K F   I  T +  ++   +NP    IGY 
Sbjct: 17  KKFSEVPLEEREKLMYQWANSDDDDSRLNFKIFKTFILNTVYSKVDAKGYNPTWEAIGYA 76

Query: 68  GADPEA------------NGSRFSSRNFP------KYNFLEISDHDSDIK---------- 99
           G DP +              + F  R  P      K+    + D  S +K          
Sbjct: 77  GPDPNSMKATLPPKPSALKSAVFDVREHPDLRGVLKHTGYTLLDDISHLKPALLPSNKLE 136

Query: 100 --------EFDTXXXXXXXXXXXXXXRLARME-NVLVIEKGHHYDQCDLSTEQQDGYDKL 150
                   + D                L+     VL++EKG ++ + DLS  +Q  + +L
Sbjct: 137 DGEDVIGIKCDVIIVGAGSGGSVPAQVLSTAGLKVLLLEKGRYFAREDLSLLEQPTFSEL 196

Query: 151 YELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVREEWAKNFGLPYFMEDEYGN 210
           YE  G + TDD    +++ +  GGGT I W+A  +    VR+EWA+  GLP F  ++Y  
Sbjct: 197 YEEGGFLATDDVAYSLMSAAVVGGGTCINWAASFQTPPHVRQEWAEECGLPMFTSEKYQQ 256

Query: 211 AMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQNTASITHQCGWCSFGCKYG 270
           A+  I  ++G      + +  N  L  GC +LGLHS NIP+N AS  H CG C+ GC+ G
Sbjct: 257 ALDLICKKIGVQPNATVESFQNAVLRKGCVELGLHSANIPRN-ASPEHYCGCCNMGCRRG 315

Query: 271 EKQSATMTWLNEAKSNNAKFLKNCYVEKILI-DKDGKSQKVMGV--EVIINNIKRVKIHA 327
            KQ+ T TWL EA +  A  L      ++L  D   K +K +GV    + +  K++ I A
Sbjct: 316 MKQATTETWLVEAAAAGATILTGTKGLQVLFTDGTKKEKKAIGVLATTLGDQPKKLIIEA 375

Query: 328 KRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYGVFPNKEI---KTYSGTIMSA 384
           K  +VS G+I +P LL+RSGL N NIG++ H+HP+  V+G FP++E     ++ G IM+A
Sbjct: 376 KATIVSTGSIMTPPLLIRSGLTNPNIGKHFHIHPVLGVWGYFPDEEKNPGASFEGGIMTA 435

Query: 385 ISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDRE 444
            S  +   D   YG  ++  S HPG   +   WKS  QHK+ M  +  +  +++ TRD+ 
Sbjct: 436 FSAVSARWDTVGYGPVLMTPSFHPGQYASVVTWKSGAQHKEAMRRFRRVSQVVLFTRDKG 495

Query: 445 GGRILTD-ENGKPRLEYKLSQHDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVEN 503
            G I  D +  +  +EY L  +D +  + G    +R+L AAGA ++GT     + +    
Sbjct: 496 AGSIGVDKKTDEITIEYTLDPYDEEVCLEGAEKGLRVLKAAGAVEVGTHHHDAESFTFGK 555

Query: 504 GVNPLNDPK-FDQFLNKIKKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVE 562
             +   + K F+++L  ++  G+   +    +   + SCRMG  P  S ++  GE W+ E
Sbjct: 556 STSWKEEKKRFEEYLASVRSKGLKPNRLPMVSYHLLGSCRMGSSPENSVIDAKGETWDAE 615

Query: 563 NLYVADSSVLPTATGVPSMMTTMNIAHYISKCILD 597
            L++ D+SV PT TG+  M+T  +IA+  ++ +++
Sbjct: 616 GLFLTDASVFPTPTGLNPMVTIQSIAYCTAQNVVE 650



>gi|325090749|gb|EGC44059.1| long chain fatty acid oxidase [Ajellomyces capsulatus H88]
          Length = 730

 Score =  311 bits (796), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 193/600 (32%), Positives = 307/600 (51%), Gaps = 59/600 (9%)

Query: 23  REHTFIKWSTSQYASVRKIYKSF-------------TMLICATFWLNPYNFNPVIGYPGA 69
           RE  F  W+TS    +R +Y+S              T+     F   P NF PV GYP  
Sbjct: 150 REAIFRGWATSVLPPIRSLYRSLIALFHKAWVPLSPTLPAIIGFPRVPVNFTPVEGYP-- 207

Query: 70  DPEANGSRFSSRNFPKYNFLEISDHD-SDIKEFDTXXXXXXXXXXXXXXRLARM-ENVLV 127
                           Y F++    D ++    D                +A    NV+V
Sbjct: 208 ----------------YEFMQFPPGDNTEAIMTDVVIIGSGCGAAVAAKNIAEAGHNVIV 251

Query: 128 IEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQ 187
           +EK +++ +       ++G   L+E  G  ++DD ++ V++GS +GGG TI WSA ++ Q
Sbjct: 252 VEKSYYWSEKHFPMTMKEGALNLFENGGTSISDDGSVAVISGSVWGGGGTINWSASLQTQ 311

Query: 188 YFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSD 247
            +VR+EWA N GLP+F   E+  ++  +  R+G NT ++ HN +N  L+ G +KLG  + 
Sbjct: 312 SYVRQEWA-NKGLPFFTSAEFQRSLDRVCDRMGVNTEHVKHNHANHLLLEGARKLGYAAK 370

Query: 248 NIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKS 307
            +PQNT +  H CG C+ GC    K+          + N    L +  +E     +D  +
Sbjct: 371 TVPQNTGNQEHNCGHCTLGCGSCGKKG--------PQGNAGNCLAHA-IEGTWTSRD-LN 420

Query: 308 QKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYG 367
           + + G  VI    ++V I AK+V+V+ G++ SP LLLRSGLKN  IGRNL++HP+  +  
Sbjct: 421 RGISGKPVI---TRKVVIKAKKVIVACGSLQSPLLLLRSGLKNPQIGRNLYLHPVVLLSA 477

Query: 368 VFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQLM 427
           VF  +E+K + G I++A+ N  E++DG  +GAKI   +  P F    FPW + L++K+ +
Sbjct: 478 VF-GEEMKPWEGAILTAVINEFEDLDGRGHGAKIETVTTVPSFFLPVFPWTNGLEYKRFV 536

Query: 428 LEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAGLLTAVRILAAAGA 486
            +  N+   + +TR+R GGR+  D  +G+ R+ Y  S  D K+M+  ++ A ++    GA
Sbjct: 537 SKLRNMAGFITVTRERYGGRVYPDPVDGRCRISYTPSLFDRKNMIEAIIGAAKVAYVCGA 596

Query: 487 TKIGTCQTVIDDYI-----VENGVNP---LNDPKFDQFLNKIKKVGIP--TYQTCTGTIE 536
            +I T    I  +I       +   P   +N   F  ++ K++    P     T   +  
Sbjct: 597 QEIYTSSRDIPSFIRPERSATDTCGPEAGINHAAFQAWIKKVRHTYSPLSPEHTVFASAH 656

Query: 537 QMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKCIL 596
           QM +CRMG  P  S V+P G+ W  E LYVAD+SV P+A+GV  M+T M I+ + ++ IL
Sbjct: 657 QMGTCRMGTSPKSSVVSPSGKVWGTEGLYVADASVFPSASGVNPMVTNMAISDWTTQNIL 716



>gi|119494301|ref|XP_001264046.1| long chain fatty alcohol oxidase, putative [Neosartorya fischeri
           NRRL 181]
 gi|119412208|gb|EAW22149.1| long chain fatty alcohol oxidase, putative [Neosartorya fischeri
           NRRL 181]
          Length = 753

 Score =  311 bits (796), Expect = 6e-82,   Method: Compositional matrix adjust.
 Identities = 188/622 (30%), Positives = 301/622 (48%), Gaps = 37/622 (5%)

Query: 4   INSKILSI-----QKPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPY 58
           +NSK  S+       P  +   + RE  F  W TS+   +R IY++FT +   T+     
Sbjct: 124 LNSKAGSLILTGSTTPIQDQPFEIREKIFSAWETSRIKPLRAIYRAFTAIFKKTWATASP 183

Query: 59  NFNPVIGYPGAD---PEANGSRFSSRNFPKYNFLEISDHDSDIKEFDTXXXXXXXXXXXX 115
               V+G P        A+G  +    FP  +  E  D D  I                 
Sbjct: 184 TIRAVVGCPRVPIHGKPADGFEYEFLQFPPGDEPETIDTDVVIVGSGCGGSVAAKNLAEA 243

Query: 116 XXRLARMENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGG 175
             R      VLV+EK +HY          +G+  ++E  G   +DD ++ VLAGS +GGG
Sbjct: 244 GYR------VLVVEKSYHYPSKYFPMNFNEGFVSMFENGGATTSDDGSIAVLAGSTWGGG 297

Query: 176 TTIGWSAFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTL 235
            T+ WSA ++ Q +VR EWA   GLP+F   EY  A+  +  R+G +  +  HN  N+ L
Sbjct: 298 GTVNWSASLQTQGYVRREWASK-GLPFFESYEYQQALDRVCDRMGVSNDHTEHNYGNRVL 356

Query: 236 INGCKKLGLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCY 295
           ++G +KLG  +  +PQNT   +H CG+C+ GC    K+    T+L +A      F++   
Sbjct: 357 LDGARKLGYAAKPVPQNTGGSSHYCGYCTMGCHSCGKKGPRETFLADAAKAGTTFIEGFR 416

Query: 296 VEKILIDKDGKSQKVMGVEVIINN-------------IKRVKIHAKRVVVSAGAIHSPAL 342
            +KI        +   GVE    +              ++V I+A +V+VS G +HSP L
Sbjct: 417 ADKIRFKMTKGGRVASGVEGTWTSRDSYLGTAGPDRTSRKVIINAAKVIVSCGTLHSPLL 476

Query: 343 LLRSGLKNKNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIV 402
           LLRSGLKN  IGRNL++HP+     VF ++EI+ + G+ ++ + N  E+ D + +G KI 
Sbjct: 477 LLRSGLKNPQIGRNLYLHPVVLSCAVF-DEEIRPWEGSALTTVVNEFEDQDSQGHGVKIE 535

Query: 403 VGSHHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTD-ENGKPRLEYK 461
                P      FPW+  L +K    +   +   + +T++R+ GR+  D  +G+ R++Y 
Sbjct: 536 NVVMLPALYLPTFPWRDGLDYKLWAAKLPRMSGFIALTKERDAGRVYPDPADGRVRIDYT 595

Query: 462 LSQHDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIV------ENGVNPLNDPKFDQ 515
           +S +D K +V  L+   +I   +GA +  T    +  +I        N    + +P    
Sbjct: 596 VSAYDRKHIVEALIATAKIAYISGAREFHTSNREMPPFIRPTEASDPNAPEGVTNPALQA 655

Query: 516 FLNKI-KKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPT 574
           ++  + +K  +   +T   +  QM +CRMG  P  S V P  + W    LYV D+SV P+
Sbjct: 656 WIADLRRKNPVDPERTQYASAHQMGTCRMGSSPRTSVVGPDCQVWGTRGLYVMDASVFPS 715

Query: 575 ATGVPSMMTTMNIAHYISKCIL 596
           A+GV  M+T M IA + S+ ++
Sbjct: 716 ASGVNPMVTNMAIADWASRKVV 737



>gi|396466184|ref|XP_003837633.1| hypothetical protein LEMA_P123410.1 [Leptosphaeria maculans JN3]
 gi|312214195|emb|CBX94189.1| hypothetical protein LEMA_P123410.1 [Leptosphaeria maculans JN3]
          Length = 1463

 Score =  309 bits (792), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 195/593 (32%), Positives = 308/593 (51%), Gaps = 28/593 (4%)

Query: 23  REHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADPEANGSRFSSRN 82
           RE     W+ ++   +R I++S TML   T+         +IG P       G R   + 
Sbjct: 242 RERIIQGWAKARLPPMRTIHRSLTMLAKQTWIQISPTIRRLIGVPRV---PTGMR-PGKG 297

Query: 83  FPKYNFLEISDHD-SDIKEFDTXXXXXXXXXXXXXXRLARM-ENVLVIEKGHHYDQCDLS 140
           F  Y FL+    D  ++ E D                L+     V+V+EK +H+      
Sbjct: 298 F-DYEFLQFPPGDKPEVIETDVVIVGSGCGGGVCAKNLSEAGHRVVVVEKAYHWTPDHFP 356

Query: 141 TEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVREEWAKNFGL 200
             +  G++ L+     + +DDS++ V+AG  +GGG T+ WSA ++ Q FVR EWA   GL
Sbjct: 357 MSEDKGWNHLFMSGAFISSDDSSLSVVAGQAWGGGGTVNWSASLQTQGFVRREWAAK-GL 415

Query: 201 PYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQNTASITHQC 260
           P+F   E+  ++  + AR+G +T +I HN+ N+ L+ G +KLG     +PQNT    H C
Sbjct: 416 PFFTSAEFQESLDRVCARMGVSTNHIKHNRGNEMLLEGARKLGWSHKAVPQNTGGHQHDC 475

Query: 261 GWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILI-DKDG--KSQKVMGVEVII 317
           G+C+FGC   EKQ   +++L +A    A+F++  + EKIL  D  G   +  V G  V  
Sbjct: 476 GYCTFGCGSCEKQGPAVSFLPDAARAGAQFIEGFHAEKILFSDHKGTKTATAVQGTWVSR 535

Query: 318 NN---------IKR-VKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYG 367
           ++         ++R V I A+R++VSAG + SP LLLRSGL N +IGRNL+VHP+  V G
Sbjct: 536 DSNGGVAGPPLVRRNVLIKARRIIVSAGTMQSPLLLLRSGLTNPHIGRNLYVHPV-MVLG 594

Query: 368 VFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQLM 427
              N+ IK + G I++A+    EN+DG+ +G K+   +  P        WKS L +K   
Sbjct: 595 AIHNEVIKPWEGAILTAVVGEYENLDGKGHGVKLEATNMIPSSWLMWLDWKSALGYKLDA 654

Query: 428 LEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAGLLTAVRILAAAGA 486
               ++   + I RDR+ GR+  D  +G+ R +Y  +  D +S++ GL+    I    GA
Sbjct: 655 ARLRHMAGYIAIARDRDPGRVYPDPVDGRVRFQYTPTAFDKRSILEGLVALANIQYIEGA 714

Query: 487 TKIGTCQTVIDDYIVENGV--NP--LNDPKFDQFLNKIKKVGIPTYQTCTGTIEQMSSCR 542
           ++I T       +I +     +P  +ND +F  +L+ I+K G P  +    +  QM +CR
Sbjct: 715 SEIFTVLPGTPPFIRDPATPCSPAGINDARFQTWLDGIRKRGFPP-EAVFVSAHQMGTCR 773

Query: 543 MGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKCI 595
           M   P    V+P G  W    LYVAD+SV P+A+GV  M+T + ++  +S+ +
Sbjct: 774 MSRLPRDGVVDPEGAVWGTRGLYVADASVFPSASGVNPMVTNLAVSDMVSRRV 826



>gi|119185879|ref|XP_001243546.1| hypothetical protein CIMG_02987 [Coccidioides immitis RS]
 gi|392870248|gb|EAS32038.2| long chain fatty alcohol oxidase [Coccidioides immitis RS]
          Length = 754

 Score =  309 bits (792), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 195/621 (31%), Positives = 327/621 (52%), Gaps = 43/621 (6%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNP-VIGYPGADPE 72
           PF       RE     W TS + ++R+ ++S   L C   W +     P V+G P     
Sbjct: 140 PFRLQPVHVRESVLRAWETSYFPALRRAHRSLVAL-CHKSWTSISPTLPKVLGLPRVPVH 198

Query: 73  ANGSRFSSRNFPKYNFLEISDHDS-DIKEFDTXXXXXXXXXXXXXXRLARME-NVLVIEK 130
                 +   +P Y FL+    D+ +I E D                LA     V+V EK
Sbjct: 199 GK----TGEGYP-YTFLQFPAGDAMEIIETDVVIVGSGCGAGVAAKNLAEAGYRVIVAEK 253

Query: 131 GHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFV 190
            +++ +         G   LY   G  ++DD ++ VL+GS +GGG TI WSA ++ Q +V
Sbjct: 254 SYYFSENHYPMTAAAGTVHLYANGGAEISDDGSISVLSGSTWGGGGTINWSASLQTQSYV 313

Query: 191 REEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIP 250
           R+EWAK+ GL  F    + +++  +   +G +T +I HN SN  L+ G +KLG ++  +P
Sbjct: 314 RQEWAKS-GLDLFTSMAFQDSLDRVCDYMGASTDHIEHNFSNSVLLEGARKLGYNAKAVP 372

Query: 251 QNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILID-KDGKSQK 309
           QNT +  H CG+C+ GC    KQ   +++L +A    A F++   V+K+  D +D K  K
Sbjct: 373 QNTGNQKHYCGYCTLGCASATKQGPAVSFLADAARAGATFIEGFEVDKVRFDTRDPKRPK 432

Query: 310 V-MGVEVIINN-------------IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGR 355
           V +GV+    +              K++ + AK+V++S G++ SP LLLRSGLKN +IGR
Sbjct: 433 VAVGVKGTWRSRDANGLTHGQPLVSKKLIVKAKKVIISCGSLQSPLLLLRSGLKNSHIGR 492

Query: 356 NLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANF 415
           NLH+HP+  V  ++ + E + + G I++++ +  ENVDG  +G KI   +  P F   +F
Sbjct: 493 NLHLHPVMIVGAIY-DHETRPWEGGILTSVVSDFENVDGTGHGTKIEALTMMPSFFLPSF 551

Query: 416 PWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAGL 474
            WK+ L +K       N+   + + RDR+ G +  D  +G+ R++Y  S +D K ++ G+
Sbjct: 552 TWKNGLDYKLFAANLRNMSGFISLARDRDTGSVYPDPVDGRCRIKYTPSAYDRKHILEGV 611

Query: 475 LTAVRILAAAGATKIGTCQTVIDDYI--------VENGVNPLNDPKFDQFLNKIKKVG-I 525
           + + +I   +GA +I T    +  ++        +E G+   N+P F  ++ ++++   +
Sbjct: 612 IASAKIAYVSGAKEIRTTCHSVPPFVRPKEPADSLEEGI---NNPAFQAWIQQLRQSDPL 668

Query: 526 PTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTM 585
           PT+ +   +  QM +CRMG    KS V+P G+ W  + LYV D+SV P+A+GV  M+T M
Sbjct: 669 PTWGSSFASAHQMGTCRMGSSARKSVVDPSGQVWGTDGLYVMDASVFPSASGVNPMVTNM 728

Query: 586 NIAHYISKCILDKKIFTVKKK 606
            I  + S+C+++    T+KK+
Sbjct: 729 AITDWTSRCLVE----TMKKE 745



>gi|168017712|ref|XP_001761391.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162687397|gb|EDQ73780.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 685

 Score =  309 bits (792), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 175/480 (36%), Positives = 262/480 (54%), Gaps = 14/480 (2%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG ++   D+ST +      ++E  G M TDD  + ++AG + GGGTTI WS  +
Sbjct: 204 VVVLEKGQYFAAQDMSTLEGPTLLNMFEKMGAMATDDGGVALIAGKSVGGGTTINWSVSL 263

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +    VR+EWA   GL  F  + Y  A + +  R+        H+  N  L  GCKKLG 
Sbjct: 264 KTPQNVRDEWANEHGLDMFNSERYDKATQAVCDRISVQPNVDKHSIQNIILREGCKKLGY 323

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEA-KSNNAKFLKNCYVEKILIDK 303
           H   + +N AS  H CGWC++GC  G+KQS   TWL +A  + NA  L NC  + +    
Sbjct: 324 HHGTLSRNCAS-DHYCGWCTYGCPTGKKQSTAQTWLVDAVNTGNALILSNCTADYVFHGA 382

Query: 304 DG---KSQKVMGVEV-IINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHV 359
           +    K  K  GV   I+    RV I A   VVS GA+ +P LLL+SGLKN NIG+ L +
Sbjct: 383 NPGGVKGSKAQGVAATIVGGPNRVYIKANATVVSCGALMTPVLLLKSGLKNPNIGKYLRL 442

Query: 360 HPIAAVYGVFP---NKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFP 416
           HP +  YG FP     E + Y G IM+  +        E YG  +  G  HPG   A   
Sbjct: 443 HPASTCYGYFPEGTGPEGRPYEGGIMTEYAPVNFRKPTE-YGGLLETGVFHPGAFSAFHA 501

Query: 417 WKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGLLT 476
           W S   +K+ +L +     + V+ RD+  G +  D+   P++ YK+S++D ++ VAG++ 
Sbjct: 502 WGSGADNKERLLRHGRTSHITVVVRDKGFGTVEIDKGRNPKISYKMSKYDQETTVAGMVQ 561

Query: 477 AVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQTCTGTIE 536
           ++R+L AAGA ++G+ Q   + +  + G +P +    + +LN++++ G         +  
Sbjct: 562 SLRVLVAAGAVEVGSQQLGAERFNAK-GASPSD---IEAYLNRVERRGASETTAQIISAH 617

Query: 537 QMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKCIL 596
           Q+ SCRMG  P+ SA +P GE WEVE L+V D SVLPTA GV  M+T  ++A   ++ I+
Sbjct: 618 QLGSCRMGTSPSTSAADPRGEIWEVEGLFVGDGSVLPTAPGVNPMVTIQSVAFCTAEHIV 677



>gi|384246311|gb|EIE19802.1| FAD/NAD(P)-binding domain-containing protein, partial [Coccomyxa
           subellipsoidea C-169]
          Length = 513

 Score =  309 bits (791), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 174/484 (35%), Positives = 260/484 (53%), Gaps = 16/484 (3%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG      +L   ++  ++++YE+   M T D+ + +LAGS  GGGT + W A  
Sbjct: 28  VVVLEKGRFTPAAELPLRERQSFEEMYEMGSLMTTQDAGVNILAGSTLGGGTRVNWQASF 87

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           E    VR EWA   GLP    ++Y  A++ +  RLG  T    H+  N+ L  G + LG+
Sbjct: 88  ETPAHVRREWATEHGLPAIASEQYDRALRAVCTRLGVTTGIKQHSCPNEKLKAGLEALGV 147

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD 304
           H   IP+N  S  H CG C FGC  G+KQ AT T+L +A    AK     +       ++
Sbjct: 148 HCGEIPRNC-SREHSCGHCCFGCPSGDKQDATGTYLADAARIGAKIFTGGHSLPFFQLRN 206

Query: 305 G-KSQKVMGVEVIINNI------KRVKIHAKRVVVSAGAIHSPALLLRSGLK-NKNIGRN 356
               ++  G+  +  +        R+   A+ V+ SAGA+H+PALLLRS +  N N+GRN
Sbjct: 207 AWMKRRATGIAALTTSAFPNGRQWRIVFKARYVISSAGALHTPALLLRSKISVNGNVGRN 266

Query: 357 LHVHPIAAVYGVFPN--KEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFAN 414
           L +HP  AV G   +  +EI T+ G+I S  SNA  + DG  YG  +   S HPG M A+
Sbjct: 267 LRLHPATAVIGGTLDVPEEILTWKGSIFSVFSNAVADWDGSGYGPLLQTPSAHPGLMAAS 326

Query: 415 FPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGL 474
            PW S + +K+L      +  ++V+TRDR  GR+   ++G PRL Y    HD  +M+ G+
Sbjct: 327 IPWLSGVDYKRLCAWMPYVSIVLVLTRDRGSGRVTIGKDGLPRLRYWPDAHDRANMMKGM 386

Query: 475 LTAVRILAAAGATKIGTCQTVIDD---YIVENGVN-PLNDP-KFDQFLNKIKKVGIPTYQ 529
              +R LAA G+  +GT Q    +   +    G N  + DP  FD FL++++  GI    
Sbjct: 387 EAGLRALAAGGSLMVGTLQGGSREATRFEAARGTNGAMTDPAAFDGFLDRVRAEGIHKNG 446

Query: 530 TCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAH 589
               +  QM + RMG     S V+  GE W V NLYV+D+S+ PT+TGV  M+T   +A+
Sbjct: 447 MTVFSAHQMGTARMGASAKTSVVDERGECWHVANLYVSDASLFPTSTGVNPMITVEAMAY 506

Query: 590 YISK 593
            +++
Sbjct: 507 MVAE 510



>gi|238880137|gb|EEQ43775.1| hypothetical protein CAWG_02023 [Candida albicans WO-1]
          Length = 704

 Score =  309 bits (791), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 185/593 (31%), Positives = 310/593 (52%), Gaps = 20/593 (3%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFN-PVIGYPGADPE 72
           P  ++T K+RE     W  S  A+ R+++++   L   T        +   I +P  D  
Sbjct: 103 PIKDMTLKERETLLASWRDSPLAAKRRLFRAICALSGTTIVRLASELHLKAIHFPQRDLR 162

Query: 73  ANGSRFSSRNFPKYNFLEISDHDSD---IKEFDTXXXXXXXXXXXXXXRLAR-MENVLVI 128
                    +  +Y+F+E    +     + + D                LA      LV+
Sbjct: 163 ETAYEGQVIDPFRYDFMEKPSFEGAEIYLPDIDVIIIGSGAGSGVVAHTLANDGYKTLVL 222

Query: 129 EKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQY 188
           EKG ++   +L  +   G  +LY+  G + T +  M +LAGS FGGGTT+ WSA ++  +
Sbjct: 223 EKGKYFSASELQFDDHTGVKQLYQGGGAVATLNQQMLILAGSTFGGGTTVNWSACIKTPF 282

Query: 189 FVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDN 248
            VR+EW  +FG+ +   D Y     Y+  ++  +T  I H+ +N+ ++ G KKLG  S  
Sbjct: 283 KVRKEWYDDFGVEFAATDSYDKDQDYVFKQMSASTDGITHSLANEVIMEGGKKLGYASKE 342

Query: 249 IPQNTASITHQ-CGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKS 307
           I QN+    H  CG+C  GCKYG KQ + + W  +A +N +KF++   V KIL +K+G +
Sbjct: 343 INQNSGGHPHHPCGFCHLGCKYGIKQGSVVNWFRDAAANGSKFMEQVRVVKIL-NKNGIA 401

Query: 308 QKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYG 367
             V+  + +   +       K+ VVSAG++++P +L  SG KNK+IGRNL +HP+  V+G
Sbjct: 402 YGVL-CQDVATGVNFTITGPKKYVVSAGSLNTPTVLANSGFKNKHIGRNLTLHPVTTVFG 460

Query: 368 VFPNKEIKT--YSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQ 425
            F  +E++   +  +IM+A+    +++DG  +GAKI    + P    A  PW+ + + ++
Sbjct: 461 DF-GREVQADHFHNSIMTAVCTQVDDLDGRAHGAKIETILNAPFLQAAFLPWRGSNEFRR 519

Query: 426 LMLEYNNIVPLMVITRDREGGRILTDENGKPRL--EYKLSQHDSKSMVAGLLTAVRILAA 483
            +L YNN+V +++ITRD   G +  D      L  +Y +++ D  +++  LL    +L  
Sbjct: 520 DLLRYNNMVAMLLITRDSTSGTVKGDPYRPDALYVDYTINKFDRNALLQALLITADMLYI 579

Query: 484 AGATKIGTCQTVIDDYIVENGV----NPLNDPKFDQFLNKIKKVGIPTYQTCTGTIEQMS 539
            GA +I + Q+ +   I E+ V      ++D  + ++  K+  +    Y    G+  QMS
Sbjct: 580 EGAKRILSPQSWVP--IFESNVPKDQRSIDDKDYVEWRKKVAGIPFDQYGAAYGSAHQMS 637

Query: 540 SCRM-GDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYI 591
           SCRM G  P   AV+  G+ +E  N+YVAD+SVLPTA+G   M++TM +A +I
Sbjct: 638 SCRMSGKGPGYGAVDTNGKLYECSNVYVADASVLPTASGANPMISTMTVARHI 690



>gi|44194457|gb|AAS46878.1| fatty alcohol oxidase [Candida tropicalis]
          Length = 704

 Score =  309 bits (791), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 182/599 (30%), Positives = 323/599 (53%), Gaps = 20/599 (3%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATF--WLNPYNFNPVIGYPGADP 71
           P  +++ + RE     W  S  A+ RK+++  + L   TF    N  +    I YPG + 
Sbjct: 103 PIKDMSLEDREKLLASWRDSPIAAKRKLFRLVSTLTLVTFTRLANELHLK-AIHYPGRED 161

Query: 72  EANGSRFSSRNFPKYNFLE---ISDHDSDIKEFDTXXXXXXXXXXXXXXRLARME-NVLV 127
                     +  KY FLE       +  + + D                L       LV
Sbjct: 162 REKAYETQEIDPFKYQFLEKPKFYGAELYLPDIDVIIIGSGAGAGVVAHTLTNDGFKSLV 221

Query: 128 IEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQ 187
           +EKG ++   +L+ + +DG  +LY+  G + T +  ++VLAGS FGGGTT+ WSA ++  
Sbjct: 222 LEKGRYFSNSELNFDDKDGVQELYQSGGTLTTVNQQLFVLAGSTFGGGTTVNWSACLKTP 281

Query: 188 YFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSD 247
           + VR+EW   FG+ +  ++ Y  A  Y+  ++G +T  I H+ +N+ +I G KKLG  + 
Sbjct: 282 FKVRKEWYDEFGVDFAADEAYDKAQDYVWQQMGASTEGITHSLANEIIIEGGKKLGYKAK 341

Query: 248 NIPQNTASIT-HQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGK 306
            + QN+     H+CG+C  GCK+G KQ +   W  +A ++ ++F++   V +IL +K G 
Sbjct: 342 VLDQNSGGHPHHRCGFCYLGCKHGIKQGSVNNWFRDAAAHGSQFMQQVRVLQIL-NKKGI 400

Query: 307 SQKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVY 366
           +  ++  E ++   K      K+ VV+AGA+++P++L+ SG KNKNIG+NL +HP++ V+
Sbjct: 401 AYGIL-CEDVVTGAKFTITGPKKFVVAAGALNTPSVLVNSGFKNKNIGKNLTLHPVSVVF 459

Query: 367 GVFPNKEIKT--YSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHK 424
           G F  K+++   +  +IM+A+ +   ++DG+ +G +I    + P    +  PW+ + + +
Sbjct: 460 GDF-GKDVQADHFHNSIMTALCSEAADLDGKGHGCRIETILNAPFIQASFLPWRGSNEAR 518

Query: 425 QLMLEYNNIVPLMVITRDREGGRILTDENGKPR---LEYKLSQHDSKSMVAGLLTAVRIL 481
           + +L YNN+V +++++RD   G + +    KP    +EY +++ D  S++  LL    +L
Sbjct: 519 RDLLRYNNMVAMLLLSRDTTSGSV-SSHPTKPEALVVEYDVNKFDRNSILQALLVTADLL 577

Query: 482 AAAGATKIGTCQTVIDDYIVENGVN--PLNDPKFDQFLNKIKKVGIPTYQTCTGTIEQMS 539
              GA +I + Q  +  +  +   +   + D  + ++  K+ K+   TY +  G+  QMS
Sbjct: 578 YIQGAKRILSPQPWVPIFESDKPKDKRSIKDEDYVEWRAKVAKIPFDTYGSPYGSAHQMS 637

Query: 540 SCRM-GDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKCILD 597
           SCRM G  P   AV+  G  +E  N+YVAD+S+LPTA+G   M+TTM +A +++  + D
Sbjct: 638 SCRMSGKGPKYGAVDTDGRLFECSNVYVADASLLPTASGANPMVTTMTLARHVALGLAD 696



>gi|169773275|ref|XP_001821106.1| long chain fatty alcohol oxidase [Aspergillus oryzae RIB40]
 gi|238491238|ref|XP_002376856.1| long chain fatty alcohol oxidase, putative [Aspergillus flavus
           NRRL3357]
 gi|83768967|dbj|BAE59104.1| unnamed protein product [Aspergillus oryzae RIB40]
 gi|220697269|gb|EED53610.1| long chain fatty alcohol oxidase, putative [Aspergillus flavus
           NRRL3357]
          Length = 748

 Score =  308 bits (790), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 197/623 (31%), Positives = 313/623 (50%), Gaps = 40/623 (6%)

Query: 13  KPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLN-PYNFNPVIGYPGADP 71
           +PFH      RE  F  W TS+   +R IY++ +  IC   WL       P IG+P    
Sbjct: 142 QPFH-----VRERIFCSWETSRLKPLRVIYRALSA-ICKRTWLTYSPTLCPTIGFPRVP- 194

Query: 72  EANGSRFSSRNFPKYNFLEISDHDS-DIKEFDTXXXXXXXXXXXXXXRLARME-NVLVIE 129
             +GS   +  F +Y FL+    D  +  E D                LA     V+V+E
Sbjct: 195 -VHGS--PADGF-EYEFLQFPSGDGPETIETDVVIVGSGCGGSVTAKNLAEAGYKVVVVE 250

Query: 130 KGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYF 189
           K + Y          +G   ++E  G + T+D ++ + AG+ +GGG TI WSA ++ Q +
Sbjct: 251 KAYQYSTKYFPMNFSEGSVSMFEGGGAVSTNDGSIGIFAGATWGGGGTINWSAALQTQNY 310

Query: 190 VREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNI 249
           VREEWAK  GLP+F   E+ N++  +  R+G +  +  HN+ N+ L+ G  KLG  ++ +
Sbjct: 311 VREEWAKG-GLPFFTSLEFQNSLDRVCERMGVSADHTTHNKQNRVLLEGAHKLGYAANPV 369

Query: 250 PQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQK 309
           PQNT    H CG C+ GC    K+  T ++L +A    A F++    EK+L  +    + 
Sbjct: 370 PQNTGGTEHYCGHCTMGCHSAGKKGPTESFLVDAAHAGATFVEGFRAEKVLFTETKGGRV 429

Query: 310 VMGVE---------VIINNIKRVK----IHAKRVVVSAGAIHSPALLLRSGLKNKNIGRN 356
             GVE         + ++ +  VK    I AKRVVVS G + SP LLLRSGLKN  IGRN
Sbjct: 430 ASGVEGTWTSRDAYLGVSGVGAVKRKLIIKAKRVVVSCGTLQSPLLLLRSGLKNPQIGRN 489

Query: 357 LHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFP 416
           LH+HP+     VF +++ + + G  ++A+ N  EN+D + +G KI   +  P      FP
Sbjct: 490 LHLHPVVISGAVF-DEQTRPWEGAALTAVVNEFENLDKQGHGVKIECLTMLPPAFLPAFP 548

Query: 417 WKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAGLL 475
           W+  L+ K+ + +  ++   + +T+DR+ GR+  D  +G+PR++Y +S  D K ++  L+
Sbjct: 549 WRDGLEWKRFVAKLPHMAGFITLTKDRDSGRVYPDPVDGRPRVDYTVSAFDRKHILEALV 608

Query: 476 TAVRILAAAGATKIGTCQTVIDDYIVENGVNPL------NDPKFDQFLNKIKKVGIPTYQ 529
              ++   +GA +  T    I  +I     +        N+     ++ + +   +   +
Sbjct: 609 ATAKMAYISGAKEFHTSSREIPPFIRPEDASDAASAEGTNNAALQAWIAEARSKTLDPEK 668

Query: 530 TCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAH 589
           T      QM +CRMG  P  S V+P  + W    LYV D+SV P+A+GV  M+T M IA 
Sbjct: 669 TTFAAAHQMGTCRMGSSPRTSVVDPDCQVWGTRGLYVVDASVFPSASGVNPMVTNMAIAD 728

Query: 590 YISKCILDKKIFTVKKKRGSMLR 612
           + S+ I      ++ K+ G M R
Sbjct: 729 WASQNIAR----SLGKEGGVMAR 747



>gi|358387110|gb|EHK24705.1| hypothetical protein TRIVIDRAFT_54537 [Trichoderma virens Gv29-8]
          Length = 733

 Score =  308 bits (790), Expect = 3e-81,   Method: Compositional matrix adjust.
 Identities = 193/606 (31%), Positives = 299/606 (49%), Gaps = 35/606 (5%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLIC-ATFWLNPYNFNPVIGYPGADPE 72
           P  +     RE     W+T++  S+R + KS T L   A    NPY F  + GY  +D  
Sbjct: 135 PVTQQPSSVREAILKSWTTARLQSLRGLAKSLTTLASKANGTTNPY-FKKLSGY--SDVP 191

Query: 73  ANGSRFSSRNFPKYNFLEISDHDSDIKEF--DTXXXXXXXXXXXXXXRLARM-ENVLVIE 129
            +       +F    F+++   D D+ E   D                LA     VLV++
Sbjct: 192 TDWKPVQGFDF---KFIQLRPGD-DVHEITTDVVIVGSGPGGGVCAKNLAEAGHKVLVVD 247

Query: 130 KGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYF 189
           KG+H+        Q    + L++  G  +++D++  + A S +GGG TI WS   + Q F
Sbjct: 248 KGYHFPPSHFPMPQMTALNHLFDHGGAYVSEDTSTAITAASCWGGGGTINWSVSFKLQDF 307

Query: 190 VREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNI 249
           VR+EW+   GLP F   E+   M  +   +G  T  I HN  N  L++GC KLG H    
Sbjct: 308 VRKEWSDE-GLPLFTSPEFDECMDRVCDFIGAGTDAIRHNFRNNLLLDGCNKLGWHGGVA 366

Query: 250 PQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQK 309
           PQNTA+  H CG C  GC  GEK+   + WL  A    A+F++   V+K+L D DG +  
Sbjct: 367 PQNTANKEHYCGHCHLGCGLGEKRGPAVAWLPAAADAGAEFMEGFTVDKVLFDDDGTT-- 424

Query: 310 VMGVE----------VIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHV 359
             GVE          V     ++V I AK+V+VSAG   SP +L++SG++N  +G+NLH+
Sbjct: 425 ATGVEGSWLARDDEDVEGRTQRKVVIKAKKVIVSAGTFWSPVILMKSGIQNPQLGQNLHL 484

Query: 360 HPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKS 419
           HP+  +  V   +E + + G I+++ S   EN+DG+ +G K+      P   FA   W  
Sbjct: 485 HPVNCLM-VVHRQETRPWEGGIITSWSGEFENLDGKGHGTKLEPLCMVPYMAFAMQHWTG 543

Query: 420 NLQHKQLMLEYNNIVPLMVITRDREGGRILTD-ENGKPRLEYKLSQHDSKSMVAGLLTAV 478
            L  K   ++Y ++   + + RDR+ GR+  D E G PR+EY  S  D ++ + G++   
Sbjct: 544 GLDTKLTTMKYRHLSSFISLARDRDSGRVFVDPETGGPRIEYTTSDFDRENNLEGIIGLA 603

Query: 479 RILAAAGATKIGTCQTVIDDYI---------VENGVNPLNDPKFDQFLNKIKKVGIPTYQ 529
           +I    GAT+I      +  ++         V++      D  F ++L  ++ +      
Sbjct: 604 KIAYVGGATEIRAHYPGVPPFLPNAAEQEKHVQDEDPEFTDAAFGKWLQHLRTMSNKPPL 663

Query: 530 TCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAH 589
           T  G+  QM +CRM        V+  G  W  +NLYVADSSV P+A+GV  M+T M+IA 
Sbjct: 664 TAFGSAHQMGTCRMSATKESGVVDQKGSVWGTKNLYVADSSVFPSASGVNPMVTVMSIAD 723

Query: 590 YISKCI 595
           +IS+ +
Sbjct: 724 WISRGV 729



>gi|156052058|ref|XP_001591990.1| hypothetical protein SS1G_07437 [Sclerotinia sclerotiorum 1980]
 gi|154705214|gb|EDO04953.1| hypothetical protein SS1G_07437 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 757

 Score =  308 bits (789), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 178/598 (29%), Positives = 307/598 (51%), Gaps = 33/598 (5%)

Query: 23  REHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPG-ADPEANGSRFSSR 81
           R+     W  S +  +R I K+ ++L    +     NF+ V G+    D    G  +   
Sbjct: 149 RQSILTNWRNSYFFPLRAIAKTMSLLGKHIWLKTSPNFDKVTGFAKIPDHYKPGPHY--- 205

Query: 82  NFPKYNFLEISDHDS-DIKEFDTXXXXXXXXXXXXXXRLAR-MENVLVIEKGHHYDQCDL 139
              +Y FL+ +  D   I E D                LA     VLV+EK +++    L
Sbjct: 206 ---EYEFLQFTASDEPQIIETDVVIVGSGCGGAVCAKNLAEDGHKVLVVEKSYYFSPSHL 262

Query: 140 STEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVREEWAKNFG 199
              +      L+E  G ++ DDS+M + AGS++GGG T+ WSA ++ Q FVR+EWA++ G
Sbjct: 263 PMSEATSGIHLFENGGVIMNDDSSMSITAGSSWGGGGTVNWSASLQTQGFVRKEWAEDRG 322

Query: 200 LPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQNTASITHQ 259
           L +F   ++   +  +  R+G +  +I H+  NQ L+ G +KLG ++ ++PQNT    H 
Sbjct: 323 LKFFGSTDFQECLDRVCERMGVSAEHIRHSHGNQVLLEGSRKLGFNAKSVPQNTGGHEHY 382

Query: 260 CGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQKVMGVEVIINN 319
           CG CS GC   +KQ  T++WL +A    A+F++   V+ ++ D++ + +K +GV+ +  +
Sbjct: 383 CGHCSNGCGSSQKQGPTVSWLPDAAKAGAEFIEGFKVDHVIFDEEDE-KKAVGVKGVWTS 441

Query: 320 ---------------IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAA 364
                          ++ V + AK+V++S G + +P +L  SGL N  IGRNL++HP++ 
Sbjct: 442 RNSRGGVDGPLSDKIVREVIVKAKKVIISTGTLWTPVILKNSGLTNSQIGRNLYLHPVSM 501

Query: 365 VYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHK 424
           V  VFP ++++ + G I++++  + EN+D   +GAK+      P    +   + +  + K
Sbjct: 502 VGAVFP-EDVRPWEGGILTSVCTSFENLDSHGHGAKLEATCMMPSLCISTLNYPTGFESK 560

Query: 425 QLMLEYNNIVPLMVITRDREGGRILTD-ENGKPRLEYKLSQHDSKSMVAGLLTAVRILAA 483
              L Y ++   + I RDR+ G +  D + G PR+ Y  S+ D   +  G+L   +I   
Sbjct: 561 FKSLLYRHMNVFISIARDRDTGIVYPDAKTGLPRISYTPSEFDRGHIRQGVLALTKICYV 620

Query: 484 AGATKIGTCQTVIDDY------IVENGVNPLNDPKFDQFLNKIKKVGIPTYQTCTGTIEQ 537
           +GA +I    + I+ Y      +  +  +P +DP F  +L  +         +   +  Q
Sbjct: 621 SGAKEIHVTASGINPYTRSPSSLSTDSNDPSSDPAFQTWLTTLSNTSTKPPLSQFASAHQ 680

Query: 538 MSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKCI 595
           M + RM   P    V+P G+ W+ ENLYV+D+SV P+A+GV  M+T M I+ +IS+ I
Sbjct: 681 MGTSRMSTRPENGVVDPKGKVWDTENLYVSDASVFPSASGVNPMITIMAISDWISRGI 738



>gi|345563626|gb|EGX46612.1| hypothetical protein AOL_s00097g516 [Arthrobotrys oligospora ATCC
           24927]
          Length = 751

 Score =  308 bits (788), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 201/638 (31%), Positives = 328/638 (51%), Gaps = 53/638 (8%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADPEA 73
           P ++ T+++RE     WST++ A++RK++K+F  +    +  +  +++   G+PG     
Sbjct: 119 PLYQKTRQEREEIISGWSTARMAALRKVFKAFATIARLLWARSSASWHAAAGFPGYPFSK 178

Query: 74  NG---------SRFSSRNFPKYNFLEISDH----DSDIK-EFDTXXXXXXXXXXXXXXRL 119
            G         S  ++   P++ F ++S      D  I+                    L
Sbjct: 179 EGEEELKVTMESAATAEASPEFVFEDLSHRAPSADGAIQLSTSILIIGSGCGGGVVAGHL 238

Query: 120 ARM---ENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGT 176
           A+      ++V+EKG  Y +      ++DG  KLYE  G + ++D ++ V AGS +GGG+
Sbjct: 239 AKALPHHQLMVVEKGFWYPKHKAPVNERDGLSKLYEEGGTLQSNDGSLAVFAGSTWGGGS 298

Query: 177 TIGWSAFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYIN--ARLGTNTINIIHNQSNQT 234
           +I W    +     R EW K +GL +    E+ + + Y++   ++ T   N  HN SN  
Sbjct: 299 SINWGVSWQLPARTRREWNKKYGLQFAESPEFQDCLDYVSNVGKVQTWKENE-HNSSNMV 357

Query: 235 LINGCKKLGLHSDNIPQNTASITHQ----CG-WCSFGCK--------YGEKQSATMTWLN 281
           ++NG  +LG     +PQN           CG +C+  CK         G K + T T+L 
Sbjct: 358 IVNGSHRLGEACVTVPQNIVGDADAHNKICGAFCALTCKGSGANIAGRGGKVAVTKTYLA 417

Query: 282 EAKSNNAKFLKNCYVEKILIDKDGKSQKVMGVEVI--------INNIKRVKIHAKRVVVS 333
           +A+   A+FL+   V K++ DK G    V G E +            ++V I AK+VVVS
Sbjct: 418 DARERGARFLQGFDVTKLVFDKRGN---VTGAEGLWRADPSEPAGTGRKVFISAKKVVVS 474

Query: 334 AGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVD 393
            G +++P +L +SGL N  IGRNLH+HP+      +  +E + + G+I+S  +    N+D
Sbjct: 475 GGTLNTPVILQKSGLSNWWIGRNLHLHPVVFCLAEW-EEETRPWEGSIISVANTEHTNLD 533

Query: 394 GENYGAKIVVGSHHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTD-E 452
            + +GA I      PG   A  PWKS+L  K+ ML YN++  L+VI RDR+ GRI+ D +
Sbjct: 534 NDGHGAVIEGMLMLPGLGTAVLPWKSSLDFKKRMLRYNHLTNLVVICRDRDSGRIILDPK 593

Query: 453 NGKPRLEYKLSQHDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPK 512
           +GK R+EY +S+ D   ++  L+ A++I  AAGA KI T   V+   I E   +   D K
Sbjct: 594 SGKARVEYTVSEFDKSHLMESLVAAMKINHAAGAQKIYT--PVVAGPIYERLDDKDEDKK 651

Query: 513 -FDQFLNKIKKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSV 571
            FD  + K++K+G+       G+  QM +CRMG  P   A N  G+ WE   LYVAD+S+
Sbjct: 652 AFDDVVAKLRKIGLTNDGCSYGSAHQMGTCRMGPTPRMGACNEKGKVWERNGLYVADASL 711

Query: 572 LPTATGVPSMMTTMNIAHYISKCILDKKIFTVKKKRGS 609
           +P ++GV  M+TT  +A ++++ I    +  + K+ GS
Sbjct: 712 MPASSGVNPMITTQGLAEWVARGI----VLDILKEEGS 745



>gi|408388245|gb|EKJ67931.1| hypothetical protein FPSE_11742 [Fusarium pseudograminearum CS3096]
          Length = 746

 Score =  308 bits (788), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 189/620 (30%), Positives = 304/620 (49%), Gaps = 41/620 (6%)

Query: 8   ILSIQKPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYP 67
           I    +P +      RE     W+TS       + K+ + L   ++       + + GY 
Sbjct: 130 ITGYWQPIYNQPAHVREAIIKSWATSPRERWSALAKTMSSLSFKSYAQTSSLLSQLSGY- 188

Query: 68  GADPEANGSRFSSRNFPKYNFLEISDHDSD-IKEFDTXXXXXXXXXXXXXXRLARM-ENV 125
                     +  +    Y+F++I   D   + E D                LA     V
Sbjct: 189 ----SDTPQHWQPKQSFDYSFIQIEAGDEPHVIETDIVIVGSGCGGGVSAKNLAEAGHKV 244

Query: 126 LVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFME 185
           LV++K +HY    L   Q+ G   L++  G + T+DS   V AGS +GGG T+ WS  ++
Sbjct: 245 LVVDKAYHYPAKHLPMSQEAGCAHLFDSGGFITTEDSGATVTAGSAWGGGGTVNWSVCLK 304

Query: 186 PQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLH 245
           PQ FVR+EWA N GLP F    +  ++  +    G  T  I HN  N+ L+NG  KLG  
Sbjct: 305 PQDFVRKEWA-NSGLPLFTSPAFDESLDRVWEFQGAGTDQIRHNHRNRVLLNGSSKLGWA 363

Query: 246 SDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDG 305
           S   P NT    H CG C  GC   EK+    +WL +A    A+F++   V++++ D DG
Sbjct: 364 SAPAPVNTGGREHFCGQCHLGCGLAEKRGPATSWLPDAAKAGAQFMEGFQVDQVMFDTDG 423

Query: 306 KSQKVMGVE--------------VIINNIK-RVKIHAKRVVVSAGAIHSPALLLRSGLKN 350
             Q  +GVE               + + +K RV + AK+V+++AG+I SP +L++SG+ N
Sbjct: 424 --QTAIGVEGDWLSRDSEGGVSDPVGDRVKRRVVVKAKKVILAAGSIWSPVVLMKSGITN 481

Query: 351 KNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGF 410
           +++G NLH+HP   V  V+  +E + + G I+++ S+  +N DG  YG K+      P  
Sbjct: 482 QHVGANLHIHPCNFVTAVY-KEETRPWEGGIITSYSSEFDNTDGSGYGTKLETTCMVPFT 540

Query: 411 MFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDEN-GKPRLEYKLSQHDSKS 469
           + +   W   L  K  M +Y ++   + +TRDR+GGR+  D + G+PR++Y  S +D   
Sbjct: 541 IMSQPSWLGGLNAKLHMTKYRHMDAWISLTRDRDGGRVFPDPSTGRPRIDYITSDYDRAH 600

Query: 470 MVAGLLTAVRILAAAGATKIGTCQTVIDDYIVE---------NGVNPL-----NDPKFDQ 515
            + G+    +I    GA +I      ++ +I           +   P+     +DP F  
Sbjct: 601 TMQGVEGLAKICYVTGAAEIRPLLPNLESFIRSGECSSEHSLDSKGPVADPETSDPAFAA 660

Query: 516 FLNKIKKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTA 575
           +L ++++VG     T  G+  QM +CRM    ++  V+  G  W+ ENLYVAD+SV P+A
Sbjct: 661 WLVRLREVGNKPPTTTWGSAHQMGTCRMSASRDEGVVDEKGRVWDTENLYVADASVFPSA 720

Query: 576 TGVPSMMTTMNIAHYISKCI 595
           +GV  M+T M IA +IS+ +
Sbjct: 721 SGVNPMITIMAIADWISRGV 740



>gi|6983594|emb|CAB75353.1| long chain fatty alcohol oxidase [Candida tropicalis]
          Length = 704

 Score =  308 bits (788), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 187/595 (31%), Positives = 314/595 (52%), Gaps = 22/595 (3%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFN-PVIGYPGADPE 72
           P  E++  +RE     W  S  A+ R++++  + L  +TF     + +   I YP  D  
Sbjct: 103 PIREMSLPERERLLASWRDSPIAAKRRLFRLVSSLTLSTFVRLASDLHLKAIHYPERDLR 162

Query: 73  ANGSRFSSRNFPKYNFLEISDHD---SDIKEFDTXXXXXXXXXXXXXXRLAR-MENVLVI 128
                    +  KY+F E    D   S + + D                LA      LV+
Sbjct: 163 EKAYESQEIDPFKYSFEEKPKFDGAESYLPDIDVIIIGSGAGAGVVAHTLANDGYKTLVL 222

Query: 129 EKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQY 188
           EKG ++   +L+   +DG  +LY+  G + T +  M++LAGS FGGGTT+ WSA ++  +
Sbjct: 223 EKGRYFSNLELNFNDKDGVQELYQGGGALTTTNQQMFILAGSTFGGGTTVNWSACLKTPF 282

Query: 189 FVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDN 248
            VR+EW  ++G+ +  ++ Y  A  Y+  ++G +T  I H+ +N  +I G KKLG  S  
Sbjct: 283 KVRKEWYVDYGVEFAADETYDMAQDYVWKQMGASTEGITHSLANNVVIEGAKKLGYKSKP 342

Query: 249 IPQNTASITHQ-CGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKS 307
           I QN+    H  CG+C  GCKYG KQ +   W  +A +N +KF++   V +I I+K G +
Sbjct: 343 IDQNSGGHPHHPCGFCHLGCKYGIKQGSVNNWFRDAAANGSKFMQQVRVLQI-INKKGIA 401

Query: 308 QKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYG 367
             ++  E +   +K      K+ VV+AGA+++P +L  SG KNK+IG+NL +HP++ V+G
Sbjct: 402 SGIL-CEDVATGVKFTITGPKKYVVAAGALNTPIVLNNSGFKNKHIGKNLTLHPVSTVFG 460

Query: 368 VFPNKEIKT--YSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQ 425
            F  KE++   +  +IM+++     ++DG+ +G +I    + P    +  PW+ + + ++
Sbjct: 461 DF-GKEVQADHFHKSIMTSLCYEVADLDGKGHGCRIETILNAPFIQASLLPWRGSDEVRR 519

Query: 426 LMLEYNNIVPLMVITRDREGGRILTDENGKPR---LEYKLSQHDSKSMVAGLLTAVRILA 482
            +L YNN+V +++ TRD   G +  D   KP    ++Y +S+ D  +++   L    +L 
Sbjct: 520 DLLRYNNMVAMLLTTRDTTSGSVSADPK-KPEALIVDYDVSKFDKNAILQAFLITSDMLH 578

Query: 483 AAGATKIGTCQTVIDDYIVENG----VNPLNDPKFDQFLNKIKKVGIPTYQTCTGTIEQM 538
             GA +I + Q  +   I E+        ++D  + ++  K  K+   +Y +  G+  QM
Sbjct: 579 IEGAKRILSPQAWVP--IFESSKPRDERSIDDKDYVEWRAKAAKIPFDSYGSAYGSAHQM 636

Query: 539 SSCRM-GDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYIS 592
           S+CRM G  P   AV+  G  +E  N+YVAD+SVLPTA+G   M+TTM  A  I+
Sbjct: 637 STCRMSGKGPKYGAVDTDGRLFECSNVYVADASVLPTASGANPMITTMTFARNIA 691



>gi|42566953|ref|NP_193673.2| Long-chain-alcohol oxidase FAO4A [Arabidopsis thaliana]
 gi|300680983|sp|O65709.2|FAO4A_ARATH RecName: Full=Long-chain-alcohol oxidase FAO4A; AltName:
           Full=Long-chain fatty alcohol oxidase 4A
 gi|332658774|gb|AEE84174.1| Long-chain-alcohol oxidase FAO4A [Arabidopsis thaliana]
          Length = 726

 Score =  307 bits (787), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 216/666 (32%), Positives = 320/666 (48%), Gaps = 100/666 (15%)

Query: 13  KPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFW--LNPYNFN---PVIGYP 67
           + F  L +K+RE   + WS+S ++ +R ++++  ++    F+  ++    N     IGY 
Sbjct: 90  RRFCRLPEKRREEILLNWSSSYFSLLRMLFRTIKLISALVFFTQVDEKGRNLAWKAIGYN 149

Query: 68  GADP------------------------------------EANGSRFSSRNFP------K 85
           G  P                                    EA   + + R F        
Sbjct: 150 GPSPDHSDHEVELNEEKKKKKPEEIFGPLYNGIVDLKSPREAVEKKLAGRGFAVSNQKRN 209

Query: 86  YNFLEISDHDSDIKEFDTXXXXXXXXXXXXXXRLARME-NVLVIEKGHHYDQCDLSTEQQ 144
            N   ISD    I + D                LA+    VLVIE G++Y +  LS  + 
Sbjct: 210 TNGSSISDPVMKI-QCDAVVVGSGSGGGVAAGVLAKAGYKVLVIESGNYYARSKLSLLEG 268

Query: 145 DGYDKLYELSGGML-TDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVREEWAKNFGLPYF 203
              D +Y LSGG+L T D+N+ +LAGS  GGG+TI WSA ++    V +EWA+   L  F
Sbjct: 269 QAMDDMY-LSGGLLATSDTNVVILAGSTVGGGSTINWSASIKTPEHVMKEWAEKSKLEMF 327

Query: 204 MEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQNTASITHQCGWC 263
             D Y  AM  +  R+G     +    +N+ L  GC+KLGL   NIP+N  S  H CG+C
Sbjct: 328 GSDLYREAMDVVCKRMGVQCGFVEEGFNNEVLRKGCEKLGLPVKNIPRNAPS-DHYCGFC 386

Query: 264 SFGCKYGEKQSATMTWLNE-AKSNNAKFLKNCYVEKILID-KDGKSQKVMGVEVIINNIK 321
             GCK G+KQ  + TWL +  +S+N   L  C   +++ D + GK +K  GV        
Sbjct: 387 CLGCKKGQKQGTSETWLVDLVESDNGLILPGCQATEVMYDCEQGKKKKATGVAFAFGEEI 446

Query: 322 RVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYGVF------PNKEIK 375
            V + ++  +V+ GA+ +P LL RSGLKN NIGRNL +HP+   +G F      P K+ K
Sbjct: 447 YV-VESRVTIVACGALRTPHLLKRSGLKNSNIGRNLCLHPVVMAWGWFPEEDKWPEKKKK 505

Query: 376 TYSGTIMSAISNATENVDGENYGAKIV-VGSHHPGFMFANFPWKSNLQHKQLMLEYNNIV 434
           +Y G IM+A+S+        +YG  ++   + HPG      PW S+   K  ML+++   
Sbjct: 506 SYEGGIMTAMSSVVIEETHSSYGEMVIQTPALHPGMFSGIIPWTSSKDFKTRMLKFSRTA 565

Query: 435 PLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGLLTAVRILAAAGATKIGTCQT 494
            +  + RD+  G I    + K  ++Y L+  D +S+  GL   ++ILAAAGA +IGT  +
Sbjct: 566 HIFALLRDKGTGTI----DSKTYIDYNLNDEDEESLKNGLERVLKILAAAGAEEIGTHHS 621

Query: 495 -------------VIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQTCTGTIEQMSSC 541
                         I+ ++ E    PL D                + Q C+    QM SC
Sbjct: 622 EGRSLNVRTASSLEIERFVREESSKPLKD---------------LSGQICSA--HQMGSC 664

Query: 542 RMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKCILDKKIF 601
           RMG  P +SAV P GE WEVE L+VAD+SV PTA GV  M+T  +IA+ I   ++D    
Sbjct: 665 RMGIRPEESAVRPTGETWEVERLFVADTSVFPTALGVNPMVTVQSIAYCIGLNVVD---- 720

Query: 602 TVKKKR 607
            +KKK+
Sbjct: 721 VLKKKK 726



>gi|44194480|gb|AAS46879.1| fatty alcohol oxidase [Candida tropicalis]
          Length = 704

 Score =  306 bits (785), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 184/600 (30%), Positives = 315/600 (52%), Gaps = 22/600 (3%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFN-PVIGYPGADPE 72
           P  ++T K+RE     W  S  A+ R++++  + L   TF       +   I YPG D  
Sbjct: 103 PIKDMTLKEREQLLASWRDSPIAAKRRLFRLISSLTLTTFTRLASELHLKAIHYPGRDLR 162

Query: 73  ANGSRFSSRNFPKYNFLEISDHDSD---IKEFDTXXXXXXXXXXXXXXRLARME-NVLVI 128
                    +  +Y+F+E    D     + + D                LA      LV+
Sbjct: 163 EKAYETQVVDPFRYSFMEKPKFDGAELYLPDIDVIIIGSGAGAGVMAHTLANDGFKTLVL 222

Query: 129 EKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQY 188
           EKG ++   +L+    DG  +LY+  G + T +  M++LAGS  GGGTT+ WSA ++  +
Sbjct: 223 EKGKYFSNSELNFNDADGVKELYQGKGALATTNQQMFILAGSTLGGGTTVNWSACLKTPF 282

Query: 189 FVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDN 248
            VR+EW   FGL +  ++ Y  A  Y+  ++G +T  I H+ +N+ ++ G KKLG  S  
Sbjct: 283 KVRKEWYDEFGLEFAADEAYDKAQDYVWKQMGASTDGITHSLANEVVVEGGKKLGYKSKE 342

Query: 249 IPQNTAS-ITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKS 307
           I QN      H CG+C  GCKYG KQ +   W  +A ++ +KF++   V +IL +K+G +
Sbjct: 343 IEQNNGGHPDHPCGFCYLGCKYGIKQGSVNNWFRDAAAHGSKFMQQVRVVQIL-NKNGVA 401

Query: 308 QKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYG 367
             ++  E +   ++      K+ VVSAG++++P +L  SG KNK+IG+NL +HP++ V+G
Sbjct: 402 YGIL-CEDVETGVRFTISGPKKFVVSAGSLNTPTVLTNSGFKNKHIGKNLTLHPVSTVFG 460

Query: 368 VFPNKEIKT--YSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQ 425
            F  ++++   +  +IM+++     ++DG+ +G +I    + P    +  PW+ + + ++
Sbjct: 461 DF-GRDVQADHFHKSIMTSLCYEVADLDGKGHGCRIETILNAPFIQASLLPWRGSDEVRR 519

Query: 426 LMLEYNNIVPLMVITRDREGGRILTDENGKPR---LEYKLSQHDSKSMVAGLLTAVRILA 482
            +L YNN+V +++ITRD   G +  D   KP    ++Y++++ D  +++   L    +L 
Sbjct: 520 DLLRYNNMVAMLLITRDTTSGSVSADPK-KPDALIVDYEINKFDKNAILQAFLITSDMLY 578

Query: 483 AAGATKIGTCQTVIDDYIVENG----VNPLNDPKFDQFLNKIKKVGIPTYQTCTGTIEQM 538
             GA +I + Q  +   I E+        + D  + ++  K  K+   TY +  G+  QM
Sbjct: 579 IEGAKRILSPQPWVP--IFESNKPKEQRTIKDKDYVEWRAKAAKIPFDTYGSAYGSAHQM 636

Query: 539 SSCRM-GDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKCILD 597
           S+CRM G  P   AV+  G  +E  N+YVAD+SVLPTA+G   M++TM  A  I+  + D
Sbjct: 637 STCRMSGKGPKYGAVDTDGRLFECSNVYVADASVLPTASGANPMISTMTFARQIALGLAD 696



>gi|344302297|gb|EGW32602.1| fatty alcohol oxidase [Spathaspora passalidarum NRRL Y-27907]
          Length = 699

 Score =  306 bits (785), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 182/590 (30%), Positives = 311/590 (52%), Gaps = 18/590 (3%)

Query: 16  HELTQKQREHTFIKWSTSQYASVRKIYKS-FTMLICATFWLNPYNFNPVIGYPGADPEAN 74
           H++T K+RE   + W  S+   +RK+++S +++ +     L         GYPG +    
Sbjct: 100 HDMTLKEREKLLLSWRDSKVPLMRKLFRSVYSITMSGCVLLADDLHLQACGYPGKELRDE 159

Query: 75  GSRFSSRNFPKYNFLEISDHDSD---IKEFDTXXXXXXXXXXXXXXRLARME-NVLVIEK 130
             +    +   Y F+E    +     + + +                LA      L++EK
Sbjct: 160 AYKNQIVDDFSYEFMERPTTEGAELYLPDIEAVIIGSGCGAGAVAHTLAESGFKSLILEK 219

Query: 131 GHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFV 190
           G ++    L+    +G   L++  G + T+D  +++LAGSNFGGG+T+ WSA ++  + V
Sbjct: 220 GKYFSTSQLNFSDLEGVSNLFQSGGPISTNDQELFILAGSNFGGGSTVNWSASIKTPFKV 279

Query: 191 REEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIP 250
           R+EW   FGL +   D Y    +Y+  ++GT+T  I H+ +N  L+ GC+KLG ++  I 
Sbjct: 280 RKEWYDEFGLDFVATDTYDKCQEYVWNKMGTSTEGIHHSYANNMLLEGCEKLGYNAKVID 339

Query: 251 QNTAS-ITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQK 309
           QNT     H+CG+C  GCK+  KQS    W  E  +  +KF++   V +I I  +G +Q 
Sbjct: 340 QNTGGHPQHRCGFCHLGCKFAIKQSTPNNWFREPAATGSKFMEQVKVLEI-IHHNGYAQG 398

Query: 310 VMGVEVIINNIKRVKIHAKRV-VVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYGV 368
           V+  + +     + KI   RV + S G++++P +L  SG +NKNIG NL +HP  A++G 
Sbjct: 399 VVCQDTVTG--VKFKITGPRVYITSGGSLNTPVILQDSGFRNKNIGSNLKLHPATAIFGD 456

Query: 369 FPNK-EIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQLM 427
           F N+   K Y+ +IM+++    +++DG  +GAKI    + P F  A+ PW  +   ++ M
Sbjct: 457 FGNEVRTKAYADSIMTSVCTEVDDLDGNAHGAKIETILNAPLFQNAHLPWFGSDAARRHM 516

Query: 428 LEYNNIVPLMVITRDREGGRILTDENGKPR---LEYKLSQHDSKSMVAGLLTAVRILAAA 484
           L YNN+  ++++ RD   G I +D   +P    ++Y++++ D +S++  L+T   IL   
Sbjct: 517 LRYNNMTAMLLLARDTSSGSIRSDPE-RPDSYYIDYQVNKFDRQSLMKALVTTADILYIQ 575

Query: 485 GATKIGTCQTVIDDYIV--ENGVNPLNDPKFDQFLNKIKKVGIPTYQTCTGTIEQMSSCR 542
           GA KI + Q  +  +    +     + D  +  + N +  +    Y T  G+  QM+SCR
Sbjct: 576 GAKKIISPQPSVPVFESDKQKEERSIKDEDYVAWRNSVSTMSFYPYSTSFGSAHQMASCR 635

Query: 543 M-GDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYI 591
           M G  P   A +  G  +E  N++VAD+SV+PT++GV  M+TT  +A YI
Sbjct: 636 MSGKGPEYGACDEKGRLFECGNVFVADASVMPTSSGVNPMITTYTLARYI 685



>gi|344303692|gb|EGW33941.1| fatty alcohol oxidase [Spathaspora passalidarum NRRL Y-27907]
          Length = 702

 Score =  306 bits (783), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 192/607 (31%), Positives = 314/607 (51%), Gaps = 25/607 (4%)

Query: 16  HELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFN-PVIGYPGADPEAN 74
            ++T +QRE     W  S  A  RK+++S   +  AT+     + +   +GYPG +    
Sbjct: 104 RDMTLEQREKLLASWRDSNIALRRKLFRSVYAITIATYTRLANDLHLQAVGYPGRELRDT 163

Query: 75  GSRFSSRNFPKYNFLEISDHDSD---IKEFDTXXXXXXXXXXXXXXRLARMEN---VLVI 128
                  +  +Y+F+E    D     +   D                L+  EN    L++
Sbjct: 164 AYEKQVVDDFRYDFMEKPTADGQELYLPYIDAIIIGSGCGAGAVAHTLS--ENGFKSLIL 221

Query: 129 EKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQY 188
           EKG ++   + + +  DG   L+E  G + T D   ++LAGSNFGGG+T+ WSA ++  +
Sbjct: 222 EKGKYFSNSEFNFDDLDGVTNLFEGGGTISTTDQETFILAGSNFGGGSTVNWSASLKTPF 281

Query: 189 FVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDN 248
            VR+EW  +FGL +   + Y    +Y+  ++   T  I H+ +NQ ++ G  KLG     
Sbjct: 282 KVRKEWYDDFGLEFVASEVYDKCQQYVCDKMHVGTDKIKHSFANQVIMEGGAKLGYAVKA 341

Query: 249 IPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQ 308
           I QNTA   H CG+C  GCK+G KQS    W  EA    +KF++   V +IL  K G + 
Sbjct: 342 IDQNTAGQEHPCGFCHVGCKFGIKQSTPNNWFREAAVTGSKFMEQVKVVQILHSK-GIAN 400

Query: 309 KVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYGV 368
            V+  +  +  +K      ++ +VS G++++P +L  SG KN++IG+NL +HP++ + G 
Sbjct: 401 GVL-CQDTVTGVKFKITGPRKYIVSGGSLNTPVILQNSGFKNRHIGKNLKLHPVSVLTGD 459

Query: 369 FPNK-EIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQLM 427
           F N    K Y  +IM+++    +++DG+ +GAKI    + P    A  PW S+ + ++ M
Sbjct: 460 FGNDVRAKPYENSIMTSVCTEVDDLDGKAHGAKIETVLNAPFLQQAFLPWFSSDETRRSM 519

Query: 428 LEYNNIVPLMVITRDREGGRILTDENGKPR---LEYKLSQHDSKSMVAGLLTAVRILAAA 484
           L YNN+V L++ITRD+  G I  D + +P    ++Y +++ D  +++  LLTA  +L   
Sbjct: 520 LRYNNMVSLLLITRDKSSGSIRADPD-RPDAFIIDYHVNKFDRHALMVALLTAADMLYIQ 578

Query: 485 GATKIGTCQTVIDDYIVENG----VNPLNDPKFDQFLNKIKKVGIPTYQTCTGTIEQMSS 540
           GA KI T    +   I E+        + D  + ++   + K+    Y T  GT  QM+S
Sbjct: 579 GAKKIITPLPNVP--IFESDKLKYKRSIEDVDYVEWRAAVSKMKFYPYGTSFGTAHQMAS 636

Query: 541 CRM-GDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKCILDKK 599
           CRM G  P   A +  G  +E  N+YVAD+S++PTA+G   M+TT  ++ Y+   I+  K
Sbjct: 637 CRMSGKGPKYGACDERGRLFECSNVYVADASIMPTASGANPMITTYALSRYVGLNIV--K 694

Query: 600 IFTVKKK 606
             T K K
Sbjct: 695 DLTTKAK 701



>gi|320032145|gb|EFW14100.1| long chain fatty alcohol oxidase [Coccidioides posadasii str.
           Silveira]
          Length = 754

 Score =  305 bits (781), Expect = 4e-80,   Method: Compositional matrix adjust.
 Identities = 194/621 (31%), Positives = 325/621 (52%), Gaps = 43/621 (6%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNP-VIGYPGADPE 72
           PF       RE     W TS + ++R+ ++S   L C   W +     P V+G P     
Sbjct: 140 PFRLQPLHVRESVLRAWETSYFPALRRAHRSLVAL-CHKSWTSSSPTLPKVLGLPRVPVH 198

Query: 73  ANGSRFSSRNFPKYNFLEISDHDS-DIKEFDTXXXXXXXXXXXXXXRLARME-NVLVIEK 130
                 +   +P Y FL+    D+ +I E D                LA     V+V EK
Sbjct: 199 GK----TGEGYP-YTFLQFPAGDAMEIIETDVVIVGSGCGAGVAAKNLAEAGYRVIVAEK 253

Query: 131 GHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFV 190
            +H+ +         G   LY   G  ++DD ++ VL+GS +GGG TI WSA ++ Q +V
Sbjct: 254 SYHFSENHYPMTAAAGTVHLYANGGAEISDDGSISVLSGSTWGGGGTINWSASLQTQSYV 313

Query: 191 REEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIP 250
           R+EWAK+ GL  F    + +++  +   +G +T +I HN SN  L+ G +KLG ++  +P
Sbjct: 314 RQEWAKS-GLDLFTSMAFQDSLDRVCDYMGASTDHIEHNFSNSVLLEGARKLGYNAKAVP 372

Query: 251 QNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILID-KDGKSQK 309
           QNT +  H CG+C+ GC    KQ   +++L +A    A F++   V+ +  D +D K  K
Sbjct: 373 QNTGNQKHYCGYCTLGCASATKQGPAVSFLADAARAGATFIEGFEVDVVRFDTRDPKRPK 432

Query: 310 V-MGVEVIINN-------------IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGR 355
           V +GV+    +              K++ + AK+V++S G++ SP LLLRSGLKN +IGR
Sbjct: 433 VAVGVKGTWRSRDANGLTHGQPLVSKKLIVKAKKVIISCGSLQSPLLLLRSGLKNSHIGR 492

Query: 356 NLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANF 415
           NLH+HP+  V  ++ + E + + G I++++ +  ENVDG  +G KI   +  P F   +F
Sbjct: 493 NLHLHPVMIVGAIY-DHETRPWEGGILTSVVSDFENVDGTGHGTKIEALTMMPSFFLPSF 551

Query: 416 PWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAGL 474
            WK+ L +K       N+   + + RDR+ G +  D  +G+ R++Y  S +D K ++ G+
Sbjct: 552 TWKNGLDYKLFAANLRNMSGFISLARDRDTGSVYPDPVDGRCRIKYTPSAYDRKHILEGV 611

Query: 475 LTAVRILAAAGATKIGTCQTVIDDYI--------VENGVNPLNDPKFDQFLNKIKKVG-I 525
           + + +I   +GA +I T    +  ++        +E G+   N+P F  ++ ++++   +
Sbjct: 612 IASAKIAYVSGAKEIRTTCHSVPPFVRPKEPTGSLEEGI---NNPAFQAWIQQLRQSDPL 668

Query: 526 PTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTM 585
           PT+ +   +  QM +CRMG    KS V+P G+ W  + LYV D+SV P+A+GV  M+T M
Sbjct: 669 PTWGSSFASAHQMGTCRMGSSARKSVVDPSGQVWGTDGLYVMDASVFPSASGVNPMVTNM 728

Query: 586 NIAHYISKCILDKKIFTVKKK 606
            I  + S+ +++    T+KK+
Sbjct: 729 AITDWTSRRLVE----TMKKE 745



>gi|303323876|ref|XP_003071927.1| GMC oxidoreductase family protein [Coccidioides posadasii C735
           delta SOWgp]
 gi|240111634|gb|EER29782.1| GMC oxidoreductase family protein [Coccidioides posadasii C735
           delta SOWgp]
          Length = 754

 Score =  304 bits (779), Expect = 5e-80,   Method: Compositional matrix adjust.
 Identities = 194/621 (31%), Positives = 325/621 (52%), Gaps = 43/621 (6%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNP-VIGYPGADPE 72
           PF       RE     W TS + ++R+ ++S   L C   W +     P V+G P     
Sbjct: 140 PFRLQPLHVRESVLRAWETSYFPALRRAHRSLVAL-CHKSWTSSSPTLPKVLGLPRVPVH 198

Query: 73  ANGSRFSSRNFPKYNFLEISDHDS-DIKEFDTXXXXXXXXXXXXXXRLARME-NVLVIEK 130
                 +   +P Y FL+    D+ +I E D                LA     V+V EK
Sbjct: 199 GK----TGEGYP-YTFLQFPAGDAMEIIETDVVIVGSGCGAGVAAKNLAEAGYRVIVAEK 253

Query: 131 GHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFV 190
            +H+ +         G   LY   G  ++DD ++ VL+GS +GGG TI WSA ++ Q +V
Sbjct: 254 SYHFSENHYPMTAAAGTVHLYANGGAEISDDGSISVLSGSTWGGGGTINWSASLQTQSYV 313

Query: 191 REEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIP 250
           R+EWAK+ GL  F    + +++  +   +G +T +I HN SN  L+ G +KLG ++  +P
Sbjct: 314 RQEWAKS-GLDLFTSMAFQDSVDRVCDYMGASTDHIEHNFSNSVLLEGARKLGYNAKAVP 372

Query: 251 QNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILID-KDGKSQK 309
           QNT +  H CG+C+ GC    KQ   +++L +A    A F++   V+ +  D +D K  K
Sbjct: 373 QNTGNQKHYCGYCTLGCASATKQGPAVSFLADAARAGATFIEGFEVDVVRFDTRDPKRPK 432

Query: 310 V-MGVEVIINN-------------IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGR 355
           V +GV+    +              K++ + AK+V++S G++ SP LLLRSGLKN +IGR
Sbjct: 433 VAVGVKGTWRSRDANGLTHGQPLVSKKLIVKAKKVIISCGSLQSPLLLLRSGLKNSHIGR 492

Query: 356 NLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANF 415
           NLH+HP+  V  ++ + E + + G I++++ +  ENVDG  +G KI   +  P F   +F
Sbjct: 493 NLHLHPVMIVGAIY-DHETRPWEGGILTSVVSDFENVDGTGHGTKIEALTMMPSFFLPSF 551

Query: 416 PWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAGL 474
            WK+ L +K       N+   + + RDR+ G +  D  +G+ R++Y  S +D K ++ G+
Sbjct: 552 TWKNGLDYKLFAANLRNMSGFISLARDRDTGSVYPDPVDGRCRIKYTPSAYDRKHILEGV 611

Query: 475 LTAVRILAAAGATKIGTCQTVIDDYI--------VENGVNPLNDPKFDQFLNKIKKVG-I 525
           + + +I   +GA +I T    +  ++        +E G+   N+P F  ++ ++++   +
Sbjct: 612 IASAKIAYVSGAKEIRTTCHSVPPFVRPKEPTGSLEEGI---NNPAFQAWIQQLRQSDPL 668

Query: 526 PTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTM 585
           PT+ +   +  QM +CRMG    KS V+P G+ W  + LYV D+SV P+A+GV  M+T M
Sbjct: 669 PTWGSSFASAHQMGTCRMGSSARKSVVDPSGQVWGTDGLYVMDASVFPSASGVNPMVTNM 728

Query: 586 NIAHYISKCILDKKIFTVKKK 606
            I  + S+ +++    T+KK+
Sbjct: 729 AITDWTSRRLVE----TMKKE 745



>gi|336268292|ref|XP_003348911.1| hypothetical protein SMAC_01933 [Sordaria macrospora k-hell]
 gi|380094170|emb|CCC08387.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 739

 Score =  304 bits (778), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 186/614 (30%), Positives = 308/614 (50%), Gaps = 46/614 (7%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYN-FNPVIGYPGADPE 72
           P  +     RE     W+TS + + R ++K+FT +I    WL     F  V G+P     
Sbjct: 138 PIQDQPLHIRESILRSWATSWFGTPRVLFKTFT-VIAKVIWLQTSPLFRTVTGFPDVPVN 196

Query: 73  ANGSRFSSRNFPKYNFLEISDHDSDIKEFDTXXXXXXXXXXXXXXRLARM-ENVLVIEKG 131
            N  R     F ++   + S ++    E D                LA     VLV+EKG
Sbjct: 197 WNPGRTEGFGFLQF---DTSVNEPATVETDVVIIGSGCGGGVCAKVLAEAGHRVLVVEKG 253

Query: 132 HHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVR 191
           +++D   L   +  G   L+E +G + + DS++ V+AGS +GGG +I WS  ++ Q +VR
Sbjct: 254 YYFDPSQLPMPRDQGGFHLFENNGFVNSVDSSINVVAGSCWGGGGSINWSVSLQTQGYVR 313

Query: 192 EEWAKNFGLPYFMEDEYGNAMKYINARLG-TNTINIIHNQSNQTLINGCKKLGLHSDNIP 250
           +EW++  GLP+F   EY   +  +   +G     ++  +   Q L++G +KLG  +   P
Sbjct: 314 KEWSEQHGLPFFESGEYQTCLDRVCEFMGVVGGDDVRQSYRGQKLLDGSRKLGYAAQVCP 373

Query: 251 QNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKS--- 307
           QN+    H CG C  GC   EKQ   ++WL  A    A F++    ++IL D+   S   
Sbjct: 374 QNSGGKEHWCGHCHLGCASAEKQGPAVSWLPAAAKRGATFMEGFSADRILWDESESSLSW 433

Query: 308 ---------QKVMGVEVII------------NNIKRVKIHAKRVVVSAGAIHSPALLLRS 346
                    ++ +GVE                  ++V I AK+V+V+AG ++SP +L +S
Sbjct: 434 FGFGGNNNKRRAVGVEGTWTARDTKGGVTGEQKTRKVIIKAKKVIVAAGTLNSPLILQKS 493

Query: 347 GLKNKNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSH 406
           GL +++IGRNL++HP+  + G +   ++K + G I++++  A EN+DG+ +G K+     
Sbjct: 494 GLNSRHIGRNLYLHPVNFL-GAYYEDDVKPWEGGIITSVCTAFENLDGQGHGVKLEGTCM 552

Query: 407 HPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQH 465
            P  +    PW+  L +K   L Y ++   + + RDR+ GR+  D   GKP +EY +S  
Sbjct: 553 LPYAILTQLPWRGALAYKLACLRYRHLNAWISLARDRDTGRVYADPITGKPSIEYTVSPF 612

Query: 466 DSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVG- 524
           D+  ++ GL+   +I        +       +DY  + GV    DP F+ +L  +++ G 
Sbjct: 613 DAAHILEGLIALAKI------AYVSEQPASEEDY--DKGV---KDPLFESWLKTLRERGN 661

Query: 525 IPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTT 584
            P Y   T +  QM +CRM   P    V+P G+ W  E LYVAD+SV P+A+GV  M+T 
Sbjct: 662 APPYPPYT-SAHQMGTCRMSSTPENGVVDPKGKVWGTEGLYVADASVFPSASGVNPMITN 720

Query: 585 MNIAHYISKCILDK 598
           M IA +I++ ++ +
Sbjct: 721 MAIADWIARGVVGE 734



>gi|297800118|ref|XP_002867943.1| hypothetical protein ARALYDRAFT_914728 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297313779|gb|EFH44202.1| hypothetical protein ARALYDRAFT_914728 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 725

 Score =  304 bits (778), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 187/496 (37%), Positives = 266/496 (53%), Gaps = 47/496 (9%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGML-TDDSNMYVLAGSNFGGGTTIGWSAF 183
           VLV+E G +Y +  LS  +    D +Y LSGG+L T D+N+ +LAGS  GGG+TI WSA 
Sbjct: 248 VLVVESGTYYARSKLSLLEGQAMDDMY-LSGGLLATSDTNVVILAGSTVGGGSTINWSAS 306

Query: 184 MEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLG 243
           ++    V +EWA+   L  F  D Y  AM  +  R+G     +    +N+ L  GC++LG
Sbjct: 307 IKTPEHVIKEWAEKSKLEMFGSDLYREAMDVVCERMGVQCGFVEEGFNNEILRKGCEELG 366

Query: 244 LHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNE-AKSNNAKFLKNCYVEKILID 302
           L   NIP+N AS  H CG+C  GCK G+KQ  + TWL +  +S N   L  C   ++L D
Sbjct: 367 LPVKNIPRNAAS-DHYCGFCCLGCKKGQKQGTSETWLVDLVESGNGLILPGCEAMEVLYD 425

Query: 303 -KDGKSQKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHP 361
              GK +K  GV         V + +K  VV+ GA+ +P LL RSGL+N NIGRNL +HP
Sbjct: 426 CGRGKKKKATGVAFAYGEEIYV-VESKTTVVACGALRTPHLLKRSGLRNGNIGRNLCLHP 484

Query: 362 IAAVYGVFPN------KEIKTYSGTIMSAISNATENVDGENYGAKIV-VGSHHPGFMFAN 414
           +   +G FP+      K+ K+Y G IM+A+S+        +YG  ++   + HPG     
Sbjct: 485 VVMAWGWFPDEDKWPEKKKKSYEGGIMTAMSSVVNAETHSSYGEMVIQTPALHPGMFSGI 544

Query: 415 FPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGL 474
            PW S+   K  ML+++    +  + RD+  G I    N K  ++Y L+  D +S+ +GL
Sbjct: 545 IPWTSSKDFKTRMLKFSRTAHIFALLRDKGTGTI----NSKSYIDYNLNDEDEESLKSGL 600

Query: 475 LTAVRILAAAGATKIGTCQT-------------VIDDYIVENGVNPLNDPKFDQFLNKIK 521
              ++ILAAAGA +IGT  +              I+ ++ E    PL D           
Sbjct: 601 DRVLKILAAAGAEEIGTHHSEGRSLNVRTASTLEIERFVREESSKPLKD----------- 649

Query: 522 KVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSM 581
                + Q C+    QM SCRMG  P +SAV P GE WEVE L+VAD+SV PTA GV  M
Sbjct: 650 ----LSGQICSA--HQMGSCRMGIRPEESAVRPTGETWEVEGLFVADTSVFPTALGVNPM 703

Query: 582 MTTMNIAHYISKCILD 597
           +T  +IA+ I   ++D
Sbjct: 704 VTVQSIAYCIGLNVVD 719



>gi|3080368|emb|CAA18625.1| putative protein [Arabidopsis thaliana]
 gi|7268733|emb|CAB78940.1| putative protein [Arabidopsis thaliana]
          Length = 678

 Score =  303 bits (777), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 188/506 (37%), Positives = 271/506 (53%), Gaps = 51/506 (10%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGML-TDDSNMYVLAGSNFGGGTTIGWSAF 183
           VLVIE G++Y +  LS  +    D +Y LSGG+L T D+N+ +LAGS  GGG+TI WSA 
Sbjct: 201 VLVIESGNYYARSKLSLLEGQAMDDMY-LSGGLLATSDTNVVILAGSTVGGGSTINWSAS 259

Query: 184 MEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLG 243
           ++    V +EWA+   L  F  D Y  AM  +  R+G     +    +N+ L  GC+KLG
Sbjct: 260 IKTPEHVMKEWAEKSKLEMFGSDLYREAMDVVCKRMGVQCGFVEEGFNNEVLRKGCEKLG 319

Query: 244 LHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNE-AKSNNAKFLKNCYVEKILID 302
           L   NIP+N  S  H CG+C  GCK G+KQ  + TWL +  +S+N   L  C   +++ D
Sbjct: 320 LPVKNIPRNAPS-DHYCGFCCLGCKKGQKQGTSETWLVDLVESDNGLILPGCQATEVMYD 378

Query: 303 -KDGKSQKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHP 361
            + GK +K  GV         V + ++  +V+ GA+ +P LL RSGLKN NIGRNL +HP
Sbjct: 379 CEQGKKKKATGVAFAFGEEIYV-VESRVTIVACGALRTPHLLKRSGLKNSNIGRNLCLHP 437

Query: 362 IAAVYGVF------PNKEIKTYSGTIMSAISNATENVDGENYGAKIV-VGSHHPGFMFAN 414
           +   +G F      P K+ K+Y G IM+A+S+        +YG  ++   + HPG     
Sbjct: 438 VVMAWGWFPEEDKWPEKKKKSYEGGIMTAMSSVVIEETHSSYGEMVIQTPALHPGMFSGI 497

Query: 415 FPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGL 474
            PW S+   K  ML+++    +  + RD+  G I    + K  ++Y L+  D +S+  GL
Sbjct: 498 IPWTSSKDFKTRMLKFSRTAHIFALLRDKGTGTI----DSKTYIDYNLNDEDEESLKNGL 553

Query: 475 LTAVRILAAAGATKIGTCQT-------------VIDDYIVENGVNPLNDPKFDQFLNKIK 521
              ++ILAAAGA +IGT  +              I+ ++ E    PL D           
Sbjct: 554 ERVLKILAAAGAEEIGTHHSEGRSLNVRTASSLEIERFVREESSKPLKD----------- 602

Query: 522 KVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSM 581
                + Q C+    QM SCRMG  P +SAV P GE WEVE L+VAD+SV PTA GV  M
Sbjct: 603 ----LSGQICSA--HQMGSCRMGIRPEESAVRPTGETWEVERLFVADTSVFPTALGVNPM 656

Query: 582 MTTMNIAHYISKCILDKKIFTVKKKR 607
           +T  +IA+ I   ++D     +KKK+
Sbjct: 657 VTVQSIAYCIGLNVVD----VLKKKK 678



>gi|44194515|gb|AAS46880.1| fatty alcohol oxidase [Candida tropicalis]
          Length = 704

 Score =  302 bits (774), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 184/600 (30%), Positives = 312/600 (52%), Gaps = 22/600 (3%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFN-PVIGYPGADPE 72
           P  ++T K+RE     W  S  A+ R++++  + L   TF     + +   I YPG D  
Sbjct: 103 PIKDMTLKEREQLLAAWRDSPIAAKRRLFRLISSLTLTTFTRLASDLHLRAIHYPGRDLR 162

Query: 73  ANGSRFSSRNFPKYNFLEISDHDSD---IKEFDTXXXXXXXXXXXXXXRLAR-MENVLVI 128
                    +  +Y+F+E    D     + + D                LA      LV+
Sbjct: 163 EKAYETQVVDPFRYSFMEKPKFDGTELYLPDIDVIIIGSGAGAGVMAHTLANDGYKTLVL 222

Query: 129 EKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQY 188
           EKG ++   +L+    DG  +LY+    + T +  M++LAGS  GGGTT+ WSA ++  +
Sbjct: 223 EKGKYFSNSELNFNDADGMKELYQGKCALTTTNQQMFILAGSTLGGGTTVNWSACLKTPF 282

Query: 189 FVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDN 248
            VR+EW   FGL +  ++ Y  A  Y+  ++G +T  I H+ +N  ++ G KKLG  S  
Sbjct: 283 KVRKEWYDEFGLEFAADEAYDKAQDYVWKQMGASTEGITHSLANAVVVEGGKKLGYKSKE 342

Query: 249 IPQNTAS-ITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKS 307
           I QN      H CG+C  GCKYG KQ +   W  +A ++ +KF++   V +IL +K G +
Sbjct: 343 IEQNNGGHPDHPCGFCYLGCKYGIKQGSVNNWFRDAAAHGSKFMQQVRVVQILHNK-GVA 401

Query: 308 QKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYG 367
             ++  E +   +K      K+ VVSAG++++P +L  SG KNK+IG+NL +HP++ V+G
Sbjct: 402 YGIL-CEDVETGVKFTISGPKKFVVSAGSLNTPTVLTNSGFKNKHIGKNLTLHPVSTVFG 460

Query: 368 VFPNKEIKT--YSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQ 425
            F  ++++   +  +IM+++     ++DG+ +G +I    + P    +  PW+ + + ++
Sbjct: 461 DF-GRDVQADHFHKSIMTSLCYEVADLDGKGHGCRIETILNAPFIQASLLPWRGSDEVRR 519

Query: 426 LMLEYNNIVPLMVITRDREGGRILTDENGKPR---LEYKLSQHDSKSMVAGLLTAVRILA 482
            +L YNN+V +++ITRD   G +  D   KP    ++Y +++ D  +++   L    +L 
Sbjct: 520 DLLRYNNMVAMLLITRDTTSGSVSADPK-KPDALIVDYDINKFDKNAILQAFLITSDMLY 578

Query: 483 AAGATKIGTCQTVIDDYIVENG----VNPLNDPKFDQFLNKIKKVGIPTYQTCTGTIEQM 538
             GA +I + Q  +   I E+        + D  + ++  K  K+   TY +  G+  QM
Sbjct: 579 IEGAKRILSPQAWVP--IFESNKPKEQRTIKDKDYVEWRAKAAKIPFDTYGSAYGSAHQM 636

Query: 539 SSCRM-GDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKCILD 597
           S+CRM G  P   AV+  G  +E  N+YVAD+SVLPTA+G   M++TM  A  I+  + D
Sbjct: 637 STCRMSGKGPKYGAVDTDGRLFECSNVYVADASVLPTASGANPMISTMTFARQIALGLAD 696



>gi|225427625|ref|XP_002269629.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Vitis vinifera]
          Length = 793

 Score =  301 bits (771), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 184/505 (36%), Positives = 265/505 (52%), Gaps = 39/505 (7%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGML-TDDSNMYVLAGSNFGGGTTIGWSAF 183
           VLV+EKG++  + +LS  +    D++Y L GGML TDD+ + +LAGS  GGG+TI WSA 
Sbjct: 300 VLVLEKGNYCARSNLSLLEGPTLDQMY-LYGGMLATDDTGVIILAGSTVGGGSTINWSAS 358

Query: 184 MEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLG 243
           +     VR+EW     L  F    Y  AM  +  ++G  +       +N  L  GC++LG
Sbjct: 359 IRTPQHVRKEWCDQHELELFDSQLYKEAMDVVCEKMGVQSEIYEEGLNNAVLRRGCQELG 418

Query: 244 LHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWL-NEAKSNNAKFLKNCYVEKILID 302
               +IP+N+    H CGWC FGCK G K+    TWL +   S N   L  C   K+L +
Sbjct: 419 YPVTDIPRNSQP-KHYCGWCCFGCKDGRKKGTAETWLVDMMNSGNGVILPGCEAIKVLHN 477

Query: 303 -KDGKSQKV---MGVEVIINNIKRV-KIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
            K G+++     +  E     +K V  + +K  +V+ GAI +P LL RSGLKN NIG+NL
Sbjct: 478 RKKGRARSTATGVAFEFEYKGVKEVFMVESKVTIVACGAISTPGLLKRSGLKNPNIGKNL 537

Query: 358 HVHPIAAVYGVFPNK------------EIKTYSGTIMSAISNATENVDGENYGAKIVVGS 405
           H+HP+A  +G FP              E ++Y G IM+ +S    + +G  YGA I   S
Sbjct: 538 HLHPVAMAWGHFPEPTPLSPSPGCPGLEKRSYEGEIMTVMSTVVADFEGSGYGAVIQTPS 597

Query: 406 HHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQH 465
            HPG      PW S    K  M+ Y+    +  + RD+  G I +       + Y++ + 
Sbjct: 598 LHPGMFSVLMPWISGPDMKDRMIRYSRTAHIFALARDKGSGTISSPST----ISYQMDET 653

Query: 466 DSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENG----VNPLNDPKFDQFLNKIK 521
           D +++  G+   +RILAAAGA +IGT           NG    V  ++   F++F+ +  
Sbjct: 654 DEENLKRGMEKLLRILAAAGAEEIGTHNC--------NGRSINVKKVSSHAFEKFVKEES 705

Query: 522 KVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSM 581
              +    T   +  QM SCRMG DP  SAVN +GE WEVE LYVAD+SV PTA GV  M
Sbjct: 706 SRALRDLSTPVCSAHQMGSCRMGVDPRSSAVNQMGETWEVEGLYVADTSVFPTALGVNPM 765

Query: 582 MTTMNIAHYISKCILDKKIFTVKKK 606
           +T   IA+  +K +++  +   KKK
Sbjct: 766 VTVQAIAYSTAKSVVE--VLRRKKK 788



>gi|472239781|gb|EMR84578.1| putative long chain fatty alcohol protein [Botryotinia fuckeliana
           BcDW1]
          Length = 757

 Score =  301 bits (770), Expect = 7e-79,   Method: Compositional matrix adjust.
 Identities = 183/606 (30%), Positives = 299/606 (49%), Gaps = 49/606 (8%)

Query: 23  REHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGA-DPEANGSRFSSR 81
           RE     W  S +  +R I K+ ++L    +     NF+ V G+    D    G  +   
Sbjct: 149 RESILTNWRNSYFFPLRAIAKTMSVLGKHIWLKTSPNFDRVTGFAKVPDHYKPGPHY--- 205

Query: 82  NFPKYNFLEISDHDSD-IKEFDTXXXXXXXXXXXXXXRLAR-MENVLVIEKGHHYDQCDL 139
              +Y FL+ S  +   I E D                LA     V+V+EK ++Y    L
Sbjct: 206 ---EYEFLQFSAGEEPWIMETDVVIVGSGCGGAVCAKNLAENGHKVVVVEKSYYYPPSQL 262

Query: 140 STEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVREEWAKNFG 199
              +      L+E  G ++ DDS+M ++AGSN+GGG TI WSA ++ Q +VR+EWA++ G
Sbjct: 263 PMSEATSGIHLFENGGVIMNDDSSMSIVAGSNWGGGGTINWSASLQTQDYVRKEWAEDRG 322

Query: 200 LPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQNTASITHQ 259
           L +F   ++   +  +  R+G +  ++  N  NQ L+ G +KLG ++  +PQNT    H 
Sbjct: 323 LKFFGSTDFQECLDRVCERMGVSAEHVRQNHGNQVLLEGSRKLGFNAKPVPQNTGGNEHY 382

Query: 260 CGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDK--DGKSQKVMGVEVII 317
           CG CS GC   +KQ   ++WL +A    A+F++   V+ ++ D+  + K+  V GV    
Sbjct: 383 CGHCSNGCGSSQKQGPVVSWLPDAAKAGAEFIEGFKVDHVIFDESDEKKAVGVKGVWTSR 442

Query: 318 NN------------IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAV 365
           NN            ++ V + AK+V+VS G + +P +L  SGL N  IGRNL++HP++ V
Sbjct: 443 NNQGGIDGPLSGKTVREVIVKAKKVIVSTGTLWTPVILKNSGLTNPQIGRNLYLHPVSMV 502

Query: 366 YGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQ 425
             VFP +++K + G I++++  + EN+D   +G K+      P        + +   +K 
Sbjct: 503 GAVFP-EDVKPWEGGILTSVCTSFENLDSHGHGVKLETTCMMPSLCLPTLNYPTGFDYKF 561

Query: 426 LMLEYNNIVPLMVITRDREGGRILTD-ENGKPRLEYKLSQHDSKSMVAGLLTAVRILAAA 484
             L Y ++   + I RDR+ G +  D + G PR+ Y  S  D   ++ G++   +I   +
Sbjct: 562 KSLFYRHMNVFISIARDRDTGIVYPDVKTGLPRISYTPSDFDRGHILQGVVALAKICYVS 621

Query: 485 GATKIGTCQTVIDDYIVENGVNPL---------------NDPKFDQFLNKIKKVGIPTYQ 529
           GA +I         +I   GV P                +DP F  +L  +  +      
Sbjct: 622 GAREI---------HITTQGVEPFIRSPSSLSDKSNDFSSDPAFQTWLTTLSTINTKPPA 672

Query: 530 TCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAH 589
           +   +  QM + RM   P    V+P G+ W VENLYV+D+SV P+A+GV  M+T M I+ 
Sbjct: 673 SQFASAHQMGTSRMSTRPENGVVDPKGKVWGVENLYVSDASVFPSASGVNPMVTNMAISD 732

Query: 590 YISKCI 595
           +IS+ I
Sbjct: 733 WISRGI 738



>gi|261412041|gb|ACX81419.1| fatty alcohol oxidase [Candida tropicalis]
          Length = 664

 Score =  300 bits (769), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 178/583 (30%), Positives = 313/583 (53%), Gaps = 20/583 (3%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATF--WLNPYNFNPVIGYPGADP 71
           P  +++ + RE     W  S  A+ RK+++  + L   TF    N  +    I YPG + 
Sbjct: 87  PIKDMSLEDREKLLASWRDSPIAAKRKLFRLVSTLTLVTFTRLANELHLK-AIHYPGRED 145

Query: 72  EANGSRFSSRNFPKYNFLEISDHDSD---IKEFDTXXXXXXXXXXXXXXRLARME-NVLV 127
                     +  KY F+E    D     + + D                LA      LV
Sbjct: 146 REKAYETQEIDPFKYQFMEKPKFDGAELYLPDIDVIIIGSGAGAGVVAHTLANDGFKSLV 205

Query: 128 IEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQ 187
           +EKG ++   +L+ + +DG  +LY+  G + T +  ++VLAGS FGGGTT+ WSA ++  
Sbjct: 206 LEKGKYFSNSELNFDDKDGVQELYQSGGTLTTVNQQLFVLAGSTFGGGTTVNWSACLKTP 265

Query: 188 YFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSD 247
           + VR+EW   FG+ +  ++ Y  A  Y+  ++G +T  I H+ +N+ +I G KKLG  + 
Sbjct: 266 FKVRKEWYDEFGVDFAADEAYDKAQDYVWQQMGASTEGITHSLANEIIIEGGKKLGYKAK 325

Query: 248 NIPQNTAS-ITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGK 306
            + QN+     H+CG+C  GCK+G KQ +   W  +A ++ ++F++   V +IL +K G 
Sbjct: 326 VLDQNSGGHPQHRCGFCYLGCKHGIKQGSVNNWFRDAAAHGSQFMQQVRVLQIL-NKKGI 384

Query: 307 SQKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVY 366
           +  ++  E ++   K      K+ VV+AGA+++P++L+ SG KNKNIG+NL +HP++ V+
Sbjct: 385 AYGIL-CEDVVTGAKFTITGPKKFVVAAGALNTPSVLVNSGFKNKNIGKNLTLHPVSVVF 443

Query: 367 GVFPNKEIKT--YSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHK 424
           G F  K+++   +  +IM+A+ +   ++DG+ +G +I    + P    +  PW+ + + +
Sbjct: 444 GDF-GKDVQADHFHNSIMTALCSEAADLDGKGHGCRIETILNAPFIQASFLPWRGSNEAR 502

Query: 425 QLMLEYNNIVPLMVITRDREGGRILTDENGKPR---LEYKLSQHDSKSMVAGLLTAVRIL 481
           + +L YNN+V +++++RD   G + +    KP    +EY +++ D  S++  LL    +L
Sbjct: 503 RDLLRYNNMVAMLLLSRDTTSGSV-SAHPTKPEALVVEYDVNKFDRNSILQALLVTADLL 561

Query: 482 AAAGATKIGTCQTVIDDYIVENGVN--PLNDPKFDQFLNKIKKVGIPTYQTCTGTIEQMS 539
              GA +I + Q  +  +  +   +   + D  + ++  K+ K+   TY +  G+  QMS
Sbjct: 562 YIQGAKRILSPQAWVPIFESDKPKDKRSIKDEDYVEWRAKVAKIPFDTYGSPYGSAHQMS 621

Query: 540 SCRM-GDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSM 581
           SCRM G  P   AV+  G  +E  N+YVAD+S+LPTA+G   M
Sbjct: 622 SCRMSGKGPKYGAVDTDGRLFECSNVYVADASLLPTASGANPM 664



>gi|495183075|ref|WP_007907865.1| glucose-methanol-choline oxidoreductase [Ktedonobacter racemifer]
 gi|297556602|gb|EFH90466.1| glucose-methanol-choline oxidoreductase [Ktedonobacter racemifer
           DSM 44963]
          Length = 684

 Score =  300 bits (769), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 166/474 (35%), Positives = 272/474 (57%), Gaps = 15/474 (3%)

Query: 123 ENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTD-DSNMYVLAGSNFGGGTTIGWS 181
           ++V+V+EKG + ++ + + ++     +LY L+ G+LT  D  + +LAGS  GGGT + W+
Sbjct: 209 KSVIVLEKGGYNNEANFTLQEAQATPELY-LNHGLLTSKDLGVVILAGSTLGGGTVVNWT 267

Query: 182 AFMEPQYFVREEWAKNFGL-PYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCK 240
                   V EEW    GL   F   +Y  +   +  R+  NT N  HN+ N+ L +GCK
Sbjct: 268 TSFRTPIDVLEEWETISGLRGRFTNAQYQESFAAVEQRIQVNTENSAHNRQNRLLYDGCK 327

Query: 241 KLGLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKIL 300
            LG H++ IP+N      +CG C +GC+YG KQS   T+L +A  +  + + NC   K+L
Sbjct: 328 ALGYHTEEIPRNAVGCDQRCGTCGYGCRYGAKQSTMKTYLQDAFDHGTRIIVNCQANKVL 387

Query: 301 IDKDGKSQKVMGVEVIIN----NIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRN 356
           ++ +G+ Q V+    ++N        + +HAK VVV+AG +++PA+LLRSGL NK+IG++
Sbjct: 388 ME-NGQVQGVLA--TVLNKEAGRTYELTLHAKTVVVAAGTLNTPAILLRSGLTNKHIGQH 444

Query: 357 LHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFP 416
           LH+HP   + G++P+K +  + G + SA S+    +DG NYG K+ V   HPG +    P
Sbjct: 445 LHLHPTTTLAGLYPDK-VYPWQGVMQSAYSDQFGRLDG-NYGYKLEVPPAHPGLLGLATP 502

Query: 417 WKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGLLT 476
           W S  ++++ M +  +I  ++V++RD+  G +  D +G+P + Y +S +D K ++ GL  
Sbjct: 503 WFSAREYREQMAQAAHIATIIVLSRDKGEGSVTLDRHGEPIINYVVSVYDRKHLMHGLRQ 562

Query: 477 AVRILAAAGATKIGTCQTVIDDYIVENGVN-PLNDPKFDQFLNKIKKVGIPTYQTCTGTI 535
           + RI  AAGA +I T         V+ G +  ++     +F   I++ G+   +  T T 
Sbjct: 563 SARIHFAAGAREIVTLHN--QRTGVKRGSDGSVSAQDLREFDRAIERHGMGPNRNMTFTA 620

Query: 536 EQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAH 589
            QM +CRMG+DP  S  N  GE + V+ L+VAD S+ P A+GV  M++ M + H
Sbjct: 621 HQMGTCRMGNDPKTSVTNEHGEVYGVKGLFVADGSLFPAASGVNPMLSIMALVH 674



>gi|154309784|ref|XP_001554225.1| hypothetical protein BC1G_07362 [Botryotinia fuckeliana B05.10]
          Length = 757

 Score =  300 bits (768), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 182/606 (30%), Positives = 299/606 (49%), Gaps = 49/606 (8%)

Query: 23  REHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGA-DPEANGSRFSSR 81
           RE     W  S +  +R I K+ ++L    +     NF+ V G+    D    G  +   
Sbjct: 149 RESILTNWRNSYFFPLRAIAKTMSVLGKHIWLKTSPNFDRVTGFAKVPDHYKPGPHY--- 205

Query: 82  NFPKYNFLEISDHDSD-IKEFDTXXXXXXXXXXXXXXRLAR-MENVLVIEKGHHYDQCDL 139
              +Y FL+ S  +   I E D                LA     V+V+EK ++Y    L
Sbjct: 206 ---EYEFLQFSAGEEPWIMETDVVIVGSGCGGAVCAKNLAENGHKVVVVEKSYYYPPSQL 262

Query: 140 STEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVREEWAKNFG 199
              +      L+E  G ++ DDS+M ++AGSN+GGG TI WSA ++ Q +VR+EWA++ G
Sbjct: 263 PMSEATSGIHLFENGGVIMNDDSSMSIVAGSNWGGGGTINWSASLQTQDYVRKEWAEDRG 322

Query: 200 LPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQNTASITHQ 259
           L +F   ++   +  +  R+G +  ++  N  NQ L+ G +KLG ++  +PQNT    H 
Sbjct: 323 LKFFGSTDFQECLDRVCERMGVSAEHVRQNHGNQVLLEGSRKLGFNAKPVPQNTGGNEHY 382

Query: 260 CGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDK--DGKSQKVMGVEVII 317
           CG CS GC   +KQ   ++WL +A    A+F++   V+ ++ D+  + K+  V GV    
Sbjct: 383 CGHCSNGCGSSQKQGPVVSWLPDAAKAGAEFIEGFKVDHVIFDESDEKKAVGVKGVWTSR 442

Query: 318 NN------------IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAV 365
           NN            ++ V + AK+V++S G + +P +L  SGL N  IGRNL++HP++ V
Sbjct: 443 NNQGGIDGPLSGKTVREVIVKAKKVIISTGTLWTPVILKNSGLTNPQIGRNLYLHPVSMV 502

Query: 366 YGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQ 425
             VFP +++K + G I++++  + EN+D   +G K+      P        + +   +K 
Sbjct: 503 GAVFP-EDVKPWEGGILTSVCTSFENLDSHGHGVKLETTCMMPSLCLPTLNYPTGFDYKF 561

Query: 426 LMLEYNNIVPLMVITRDREGGRILTD-ENGKPRLEYKLSQHDSKSMVAGLLTAVRILAAA 484
             L Y ++   + I RDR+ G +  D + G PR+ Y  S  D   ++ G++   +I   +
Sbjct: 562 KSLFYRHMNVFISIARDRDTGIVYPDVKTGLPRISYTPSDFDRGHILQGVVALAKICYVS 621

Query: 485 GATKIGTCQTVIDDYIVENGVNPL---------------NDPKFDQFLNKIKKVGIPTYQ 529
           GA +I         +I   GV P                +DP F  +L  +  +      
Sbjct: 622 GAREI---------HITTQGVEPFIRSPSSLSDKSNDFSSDPAFQTWLTTLSTINTKPPA 672

Query: 530 TCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAH 589
           +   +  QM + RM   P    V+P G+ W VENLYV+D+SV P+A+GV  M+T M I+ 
Sbjct: 673 SQFASAHQMGTSRMSTRPENGVVDPKGKVWGVENLYVSDASVFPSASGVNPMVTNMAISD 732

Query: 590 YISKCI 595
           +IS+ I
Sbjct: 733 WISRGI 738



>gi|508778125|gb|EOY25381.1| Long-chain fatty alcohol dehydrogenase family protein [Theobroma
            cacao]
          Length = 1140

 Score =  300 bits (767), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 178/489 (36%), Positives = 263/489 (53%), Gaps = 26/489 (5%)

Query: 125  VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGML-TDDSNMYVLAGSNFGGGTTIGWSAF 183
            VLV+EKG+++ + +LS  +    D++Y +SGGML TDD  + +LAGS  GGG+TI WSA 
Sbjct: 653  VLVLEKGNYFARSNLSLLEGPSMDQMY-MSGGMLATDDMGVVILAGSTVGGGSTINWSAS 711

Query: 184  MEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLG 243
            ++    V  EW     L  F    Y  AM  +  ++G  +  +    +N  L  GC++LG
Sbjct: 712  IKTPQHVINEWCDRCKLELFDSKLYKEAMDVVCEKMGVQSEIVEEGFNNAVLRKGCEELG 771

Query: 244  LHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNE-AKSNNAKFLKNCYVEKIL-- 300
               ++IP+N+    H CGWC  GCK G K+  + TWL +   S N   L  C   K+L  
Sbjct: 772  YPVNDIPRNSPP-DHYCGWCCMGCKDGRKKGTSETWLVDLVNSGNGVILPGCEAIKVLHK 830

Query: 301  IDKDGKSQKVMGVEVIINNIKRVKI---HAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
              K     +  G+   +  +    I    +K  +V+ GA+ +P LL RSGLKN NIG+NL
Sbjct: 831  RRKGRGRNRATGIAFQLEYVGAKDICIVESKVTIVACGALSTPPLLKRSGLKNANIGKNL 890

Query: 358  HVHPIAAVYGVFPN---------KEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHP 408
            H+HP+A  +G FP+         KE K+Y G IM+A+S    N+D   YGA +   + HP
Sbjct: 891  HLHPVAMAWGYFPDAPLSSGWPEKEKKSYEGGIMTAMSTVVANMDKSGYGAVLQTPALHP 950

Query: 409  GFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSK 468
            G   A  PW S    K+ ML ++    +  + RD+  G + + ++    + YK+   D +
Sbjct: 951  GMFSALMPWLSGADMKRRMLRFSRTAHIFALARDKGSGDVYSPDS----IGYKMEATDEE 1006

Query: 469  SMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTY 528
            ++  GL   +RILAAAGA +IGT         V+      +  +F++F+ +     +   
Sbjct: 1007 NLKKGLDKILRILAAAGAEEIGTHHCKGKSINVKQA----SSHEFERFVKEESSRPLRDL 1062

Query: 529  QTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIA 588
             T   +  QM SCRMG DP +S VN +GE WEVE L+VADSSV PTA GV  M+T   IA
Sbjct: 1063 NTQICSAHQMGSCRMGIDPKQSVVNQMGETWEVEGLFVADSSVFPTALGVNPMVTIQAIA 1122

Query: 589  HYISKCILD 597
            +  ++ +LD
Sbjct: 1123 YCTAQSVLD 1131



>gi|347827209|emb|CCD42906.1| similar to long chain fatty alcohol oxidase [Botryotinia fuckeliana
           T4]
          Length = 757

 Score =  300 bits (767), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 182/606 (30%), Positives = 299/606 (49%), Gaps = 49/606 (8%)

Query: 23  REHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGA-DPEANGSRFSSR 81
           RE     W  S +  +R I K+ ++L    +     NF+ V G+    D    G  +   
Sbjct: 149 RESILTNWRNSYFFPLRAIAKTMSVLGKHIWLKTSPNFDRVTGFAKVPDHYKPGPHY--- 205

Query: 82  NFPKYNFLEISDHDSD-IKEFDTXXXXXXXXXXXXXXRLAR-MENVLVIEKGHHYDQCDL 139
              +Y FL+ S  +   I E D                LA     V+V+EK ++Y    L
Sbjct: 206 ---EYEFLQFSAGEEPWIIETDVVIVGSGCGGAVCAKNLAENGHKVVVVEKSYYYPPSQL 262

Query: 140 STEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVREEWAKNFG 199
              +      L+E  G ++ DDS+M ++AGSN+GGG TI WSA ++ Q +VR+EWA++ G
Sbjct: 263 PMSEATSGIHLFENGGVIMNDDSSMSIVAGSNWGGGGTINWSASLQTQDYVRKEWAEDRG 322

Query: 200 LPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQNTASITHQ 259
           L +F   ++   +  +  R+G +  ++  N  NQ L+ G +KLG ++  +PQNT    H 
Sbjct: 323 LKFFGSTDFQECLDRVCERMGVSAEHVRQNHGNQVLLEGSRKLGFNAKPVPQNTGGNEHY 382

Query: 260 CGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDK--DGKSQKVMGVEVII 317
           CG CS GC   +KQ   ++WL +A    A+F++   V+ ++ D+  + K+  V GV    
Sbjct: 383 CGHCSNGCGSSQKQGPVVSWLPDAAKAGAEFIEGFKVDHVIFDESDEKKAVGVKGVWTSR 442

Query: 318 NN------------IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAV 365
           NN            ++ V + AK+V++S G + +P +L  SGL N  IGRNL++HP++ V
Sbjct: 443 NNQGGIDGPLSGKTVREVIVKAKKVIISTGTLWTPVILKNSGLTNPQIGRNLYLHPVSMV 502

Query: 366 YGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQ 425
             VFP +++K + G I++++  + EN+D   +G K+      P        + +   +K 
Sbjct: 503 GAVFP-EDVKPWEGGILTSVCTSFENLDSHGHGVKLETTCMMPSLCLPTLNYPTGFDYKF 561

Query: 426 LMLEYNNIVPLMVITRDREGGRILTD-ENGKPRLEYKLSQHDSKSMVAGLLTAVRILAAA 484
             L Y ++   + I RDR+ G +  D + G PR+ Y  S  D   ++ G++   +I   +
Sbjct: 562 KSLFYRHMNVFISIARDRDTGIVYPDVKTGLPRISYTPSDFDRGHILQGVVALAKICYVS 621

Query: 485 GATKIGTCQTVIDDYIVENGVNPL---------------NDPKFDQFLNKIKKVGIPTYQ 529
           GA +I         +I   GV P                +DP F  +L  +  +      
Sbjct: 622 GAREI---------HITTQGVEPFIRSPSSLSDKSNDFSSDPAFQTWLTTLSTINTKPPA 672

Query: 530 TCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAH 589
           +   +  QM + RM   P    V+P G+ W VENLYV+D+SV P+A+GV  M+T M I+ 
Sbjct: 673 SQFASAHQMGTSRMSTRPENGVVDPKGKVWGVENLYVSDASVFPSASGVNPMVTNMAISD 732

Query: 590 YISKCI 595
           +IS+ I
Sbjct: 733 WISRGI 738



>gi|485451287|gb|AGK82821.1| alcohol oxidase [Solanum pimpinellifolium]
          Length = 746

 Score =  299 bits (766), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 177/495 (35%), Positives = 264/495 (53%), Gaps = 33/495 (6%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           VLV+EKG +  + +LS  +    D+++  +G M+T D ++++LAGS  GGG+TI WSA +
Sbjct: 253 VLVLEKGSYLARTNLSLLEGPSMDQMFLGNGLMMTKDMDVFLLAGSTVGGGSTINWSASI 312

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +    V +EW   + L  F  + Y  A++ I  ++G           N  L  GC++LG 
Sbjct: 313 DTPSHVLKEWCDIYNLELFQSEFYKEALETIREKMGVQDKIDEEGFQNMILRKGCEELGY 372

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNE-AKSNNAKFLKNCYVEKILIDK 303
           + +NIP+N  S  H CGWCS GCK G K+    TWL +  KS N   ++ C   +++ + 
Sbjct: 373 NVENIPRNAHS-NHYCGWCSMGCKDGSKKGTNETWLVDLVKSGNGAIIQECEALEVIHEH 431

Query: 304 DGK--SQKVMGVEVIINNIKRVK----IHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
                  K +GV     +   VK    + +K  +V+ GA+ +P+LL RSGLKN NIG+NL
Sbjct: 432 KNNYNKSKAIGVACEFQHDDGVKEIFMVKSKVTIVACGALSTPSLLKRSGLKNPNIGKNL 491

Query: 358 HVHPIAAVYGVFP---------NKEI------KTYSGTIMSAISNATENVDGENYGAKIV 402
           HVHP+   +G FP         N E+      K+Y G IMSA+S    N +   YG  I 
Sbjct: 492 HVHPVVFAWGHFPDTNSTDNVKNSEVWPESDKKSYEGGIMSAMSKVVANTEEPGYGVVIQ 551

Query: 403 VGSHHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKL 462
             S HPG      PW S L  K  M +Y+    +  + RD+  G  ++  +    + YKL
Sbjct: 552 TPSLHPGMFSVVMPWISGLDIKMRMCKYSRTAHIFALARDKGSGETVSPYS----ISYKL 607

Query: 463 SQHDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIV-ENGVNPLNDPKFDQFLNKIK 521
            Q D +++  G+   +RILAAAGA +IGT       + V E+ V+     +F+ F+ +  
Sbjct: 608 DQIDEQNLKVGIEKLLRILAAAGAEEIGTHHVKGRKFKVKESSVD-----EFESFVKEES 662

Query: 522 KVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSM 581
             G+    T   +  QM SCRMG DP  S VNP GE WEVE+L++ D+SV PTA GV  M
Sbjct: 663 SRGLKNLSTPICSAHQMGSCRMGIDPKISVVNPKGETWEVEDLFIGDTSVFPTALGVNPM 722

Query: 582 MTTMNIAHYISKCIL 596
           +T   I++  ++ +L
Sbjct: 723 LTVQAISYCTAQNVL 737



>gi|448527054|ref|XP_003869426.1| hypothetical protein CORT_0D04510 [Candida orthopsilosis Co 90-125]
 gi|380353779|emb|CCG23291.1| hypothetical protein CORT_0D04510 [Candida orthopsilosis]
          Length = 704

 Score =  299 bits (765), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 178/593 (30%), Positives = 315/593 (53%), Gaps = 24/593 (4%)

Query: 17  ELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWL--NPYNFNPVIGYPGADPEAN 74
           +++ K+RE     W  S   + R++++    L   T  +  N  ++   I YPG   +  
Sbjct: 106 DMSLKEREQLMASWRDSPIPAKRRLFRMVHALTLNTMAVLGNELHYK-AIHYPGKYKKEK 164

Query: 75  GSRFSSRNFPKYNFL---EISDHDSDIKEFDTXXXXXXXXXXXXXXRLAR-MENVLVIEK 130
                  +  +Y+ L   E  D +  + + D                LA      L++EK
Sbjct: 165 PYEGYQADPFRYDMLPKPEFEDAELYLTDIDVVIIGSGAGAGVVAHTLANDGYKSLILEK 224

Query: 131 GHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFV 190
           G ++   + +   +DG ++LY+  G + +    +++LAGS FGGGTT+ WSA ++  + V
Sbjct: 225 GKYFSPSEYTFTDKDGLEQLYQGHGLLTSTSQEIFILAGSTFGGGTTVNWSACLKTPFKV 284

Query: 191 REEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIP 250
           R+EW  ++GL +   D Y    +Y+  ++G +T  I H+ +N+ L+ G +KLG  S  I 
Sbjct: 285 RKEWYDDYGLDFAATDSYDKCQEYVWKQMGASTEGIKHSLANEVLVEGGQKLGYASKAIE 344

Query: 251 QNTAS-ITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQK 309
           QN+     H CG+C  GCK+G KQ +++ W   A +N +KF+    V +IL  K+G +  
Sbjct: 345 QNSGGHHGHPCGFCHLGCKHGIKQGSSVNWFRAAAANGSKFMDQVRVLQIL-HKNGVATG 403

Query: 310 VMGVEVIINNIKRVKIHA-KRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYGV 368
           ++  + +    ++ KI   KR VVS G++++P +L  SG KNK+IG+NL +HP+  V+G 
Sbjct: 404 LLCQDEVTG--RKFKITGPKRFVVSGGSLNTPVVLQNSGFKNKHIGKNLTLHPVTTVFGD 461

Query: 369 F-PNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQLM 427
           F P  E   +  +IM+++    +++DG+ +GAKI    + P    A  PW+ + + ++ +
Sbjct: 462 FGPEVEADHFDNSIMTSVCTQVDDLDGKAHGAKIETILNTPFIQAALLPWRGSDEARKDL 521

Query: 428 LEYNNIVPLMVITRDREGGRILTDENGKPR---LEYKLSQHDSKSMVAGLLTAVRILAAA 484
           L YN++  +++ITRD   G +  D N +P    ++Y +S++D  +++   L    IL   
Sbjct: 522 LRYNHMCAMLLITRDTSTGSVTCDPN-RPEALYIDYNVSKYDRNALLQAFLVTSDILYIE 580

Query: 485 GATKIGTCQTVIDDYIVENGV----NPLNDPKFDQFLNKIKKVGIPTYQTCTGTIEQMSS 540
           GA +I + Q  +   I E+ +      + D  + ++  K+ K+    Y T  G+  QMSS
Sbjct: 581 GAVRILSPQPWVP--IFESKIPKDKRSITDKDYVEWRQKVAKIPFDNYGTPYGSAHQMSS 638

Query: 541 CRM-GDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYIS 592
           CRM G  P   A +  G+ +E  N+Y+AD+S +PTA+G   M++TM IA +++
Sbjct: 639 CRMSGKGPKYGACDTKGKLFEASNIYIADASCMPTASGANPMISTMTIARHVA 691



>gi|148909432|gb|ABR17814.1| unknown [Picea sitchensis]
          Length = 743

 Score =  299 bits (765), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 201/624 (32%), Positives = 306/624 (49%), Gaps = 53/624 (8%)

Query: 13  KPFHELTQKQREHTFIKWSTSQYASVRKI-YKSFTMLICATFW--LNPYNFNPV---IGY 66
           +PF ++ Q  RE   + WS  +  +  K  +K F +    TF+   +    NP    IGY
Sbjct: 118 QPFSDVQQVSREQILLDWSRGRRITFLKFAFKLFKICCLFTFYTVADENAENPAWKGIGY 177

Query: 67  PGADPE----ANG----------SRFSSRNFPKY----NFLEISDHDSDIKE------FD 102
               PE    A+G          S  S ++ PK      F    + +   KE       D
Sbjct: 178 SPPKPETDRVASGRPLEKGVIDLSSASEQDLPKLFQDRGFTVTEEENLSGKEKAWKVECD 237

Query: 103 TXXXXXXXXXXXXXXRLARME-NVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDD 161
                           LA+    V+V+EKG +Y + DL+  +   +D++YE  G + T+D
Sbjct: 238 AVVVGSGSGGGVAAGVLAKAGYRVIVLEKGKYYARDDLTLLEGPSFDQMYESGGILPTND 297

Query: 162 SNMYVLAGSNFGGGTTIGWSAFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGT 221
             + V+AG+  GGG+ I WSA +     V +EW+K  GLP F   +Y +AM  +  RLG 
Sbjct: 298 GKVLVMAGATVGGGSAINWSASIRTPPHVLKEWSKQHGLPLFESHDYQDAMNAVCGRLGV 357

Query: 222 NTINIIHNQSNQTLINGCKKLGLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLN 281
                  +  N  L  GC KLG   + +P+N+    H CG C FGC+ G K+ A  TWL 
Sbjct: 358 QDGCSKESFQNSVLSTGCAKLGFRFEKVPRNSTE-DHFCGSCCFGCRKGNKKGADETWLV 416

Query: 282 EAKSNNAKFLKNCYVEKILIDKDGKS--QKVMGVEVIINNIKR-VKIHAKRVVVSAGAIH 338
           +A ++ +  L  C  EK+L  +   S  Q+  GV       +R + + AK  V + G++ 
Sbjct: 417 DAMNSGSLILAGCKAEKVLCQEIPGSWKQRAAGVVAAFGPKRRSIFVQAKVTVAACGSLL 476

Query: 339 SPALLLRSGLKNKNIGRNLHVHPIAAVYGVFP-NKEI--KTYSGTIMSAISNATENVDGE 395
           +P LL  SGL+N NIGRNLH+HP+   +G FP NKE   K + G I++ I       +  
Sbjct: 477 TPLLLRSSGLRNPNIGRNLHLHPVQMAWGFFPENKEPAGKPHEGGIITTICKEGAKWEQS 536

Query: 396 NYGAKIVVGSHHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGK 455
            YG  I   +  PG   +  PW S L  K+ M +Y+    +  + RDR  G +     G+
Sbjct: 537 GYGTIIQTPAIAPGSFASMIPWTSGLDMKERMQKYHRTAHVFCLARDRGSGSV----GGE 592

Query: 456 PRLEYKLSQHDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQ 515
             L+Y+ ++ D  ++  GL   V+IL AAGAT++GT ++  +   V+       D + ++
Sbjct: 593 KDLDYRFAESDKDNLKEGLRRCVQILIAAGATEVGTHRSDGERLAVKGA----TDDEIEE 648

Query: 516 FLN---KIKKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVL 572
           FLN   K ++   PT+     +  QM SCRMG D     V+  GE+WEVE L+V D S+L
Sbjct: 649 FLNNKGKGRRGVWPTFF----SAHQMGSCRMGKDEESGGVDWKGESWEVEGLFVCDGSLL 704

Query: 573 PTATGVPSMMTTMNIAHYISKCIL 596
           PT+ GV  M+T  ++A  ++  IL
Sbjct: 705 PTSVGVNPMITIQSLAFCVANYIL 728



>gi|147770729|emb|CAN71289.1| hypothetical protein VITISV_019349 [Vitis vinifera]
          Length = 741

 Score =  298 bits (764), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 173/490 (35%), Positives = 277/490 (56%), Gaps = 30/490 (6%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG+++   D S+ +    ++L+E  G + T D  M +LAGS  GGG+ I WSA +
Sbjct: 257 VVVLEKGNYFTATDYSSLEGPSMNQLFESGGILPTVDGKMMILAGSTVGGGSAINWSASI 316

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +    V +EWA++  LP F   +Y +AM  +  R+G           NQ L  GC+ LGL
Sbjct: 317 KTPKSVLQEWAEDHKLPLFGSSQYFSAMDAVCERIGVTETCAEEGFQNQVLRKGCENLGL 376

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD 304
             D +P+N++   H CG CS+GC+ G+K+    TWL +A +  A  +  C  E+ +++ +
Sbjct: 377 KVDLVPRNSSE-KHYCGSCSYGCRSGDKKGTDSTWLVDAVACGAVIITGCKAERFILETN 435

Query: 305 G----KSQKVMGV--EVIINNIK-RVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
                K +K +GV  + + NNIK R++I AK  + + G++ +P L++ SGLKN++IG+NL
Sbjct: 436 EYGRVKRKKCLGVIAKTLNNNIKNRIQIEAKVTISACGSLLTPPLMISSGLKNQHIGQNL 495

Query: 358 HVHPIAAVYGVFPNK----EIKTYSGTIMSAISNATENVDGENYGAKIVVGSHH--PGFM 411
           H+HP+A ++G FP+     E K Y G I++++      V  E+   + ++ +    PG  
Sbjct: 496 HLHPVAMIWGYFPDSNSEFEGKAYEGGIITSM----HKVVSEDCQVRAIIETPALGPGSF 551

Query: 412 FANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMV 471
            A  PW+S L  K+ M+ Y   V L  + RD   G++  +     R+ Y LS  D +++ 
Sbjct: 552 AALCPWESGLDMKKRMVRYGRTVHLFAMVRDEGTGKVKVE----GRISYNLSAIDKENLR 607

Query: 472 AGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTY--- 528
           AG+   +RIL AAGA ++GT ++  D   +++    +N+ + ++FL+ +  V  P     
Sbjct: 608 AGVRQGLRILIAAGAVEVGTYRS--DGQRLKS--KGINEKELEEFLDSVSAVEGPQSFVD 663

Query: 529 -QTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNI 587
             T TGT  QM SCRMG    + AV+  GE+WE   L+V D SVLPTA GV  M+T  + 
Sbjct: 664 KWTITGTAHQMGSCRMGQSEKEGAVDENGESWEAAGLFVCDGSVLPTAVGVNPMITIQST 723

Query: 588 AHYISKCILD 597
           A+ +SK I D
Sbjct: 724 AYCLSKKIAD 733



>gi|242778904|ref|XP_002479333.1| long chain fatty alcohol oxidase, putative [Talaromyces stipitatus
           ATCC 10500]
 gi|218722952|gb|EED22370.1| long chain fatty alcohol oxidase, putative [Talaromyces stipitatus
           ATCC 10500]
          Length = 1196

 Score =  298 bits (764), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 188/611 (30%), Positives = 311/611 (50%), Gaps = 44/611 (7%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADPEA 73
           P    +   RE     W TS+   +R++ +S  +L    + +N    N +IG+P     A
Sbjct: 135 PVQNQSFDAREKVLNSWLTSRLPQLRQVARSVMLLSKRQWLVNSPTANQIIGFPRV--PA 192

Query: 74  NGSRFSSRNFPKYNFLEISDHDS-DIKEFDTXXXXXXXXXXXXXXRLARM-ENVLVIEKG 131
            G    + +F +Y FL+    D  +  E D                LA     V+V+EK 
Sbjct: 193 YGK--PAESF-EYEFLQFPPGDGIETIETDVVIVGSGCGGGVAAKNLAEAGHRVIVVEKA 249

Query: 132 HHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVR 191
           +HY        Q   +  ++E  G  +TDD  M V+AG+ +GGG T+ W A ++ Q +VR
Sbjct: 250 YHYPSSYYPMTQSSAFAHMFEQGGNCITDDGYMAVVAGATWGGGGTVNWGASLQTQNYVR 309

Query: 192 EEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQS--NQTLINGCKKLGLHSDNI 249
           +EWA   GLP+F   E+ N+M  +  R+G   ++  + QS  N+  + G +KLG ++  I
Sbjct: 310 QEWADT-GLPFFTSSEFQNSMDRVCQRMG---VHAEYEQSFQNKITLEGSRKLGYNAQII 365

Query: 250 PQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQK 309
           P N+ +  H CG C+ GC  G KQ   ++WL +A    A F++     K+L       + 
Sbjct: 366 PTNSGNQPHYCGHCTLGCHSGGKQGPAVSWLVDAAKAGAVFVEGFNAGKVLFKNVNGKKV 425

Query: 310 VMGVEVIINN-------------IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRN 356
             G++ +  +              ++V+I AK+V+VS G++ SP LL+RSG+K+ ++GR+
Sbjct: 426 ASGIQGVWTSRDTHLGTSGRDVTRRKVQITAKKVIVSCGSLQSPLLLMRSGIKSSHLGRH 485

Query: 357 LHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFP 416
           LH+HP+     +F  +E + + G  ++ +    EN+DG  +G KI   +  P      FP
Sbjct: 486 LHLHPVLMASAIF-EEETRPWDGDCLTTLVTDFENLDGHGHGLKIENVTMVPSMYLTTFP 544

Query: 417 WKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAGLL 475
           W   LQ+K+L    N++   + +TRD++ GR+  D  +G PR++Y +S  D K ++ GL+
Sbjct: 545 WFDGLQYKKLAASMNHMAGFITLTRDKDSGRVYPDPISGHPRVDYTISSFDRKHILEGLI 604

Query: 476 TAVRILAAAGATKIGTCQTVIDDYI------------VENGVNPLNDPKFDQFLNKIKKV 523
            A +I   +GAT+  T    +  +I            + NGV   NDP+F  ++++ +K 
Sbjct: 605 AAAKIAYVSGATEFHTSYRDMPPFIRSKTPKTETEDDINNGV---NDPEFQFWISEFRKR 661

Query: 524 GIPTYQTCT-GTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMM 582
                +  T  +  QM +CRM + P    V+P G+ W  E LYVAD+SV P+A+GV  M+
Sbjct: 662 SPLVAEVGTAASAHQMGTCRMSNSPKNGVVDPDGQVWGTEGLYVADASVFPSASGVNPMV 721

Query: 583 TTMNIAHYISK 593
           T M I  + S+
Sbjct: 722 TNMAITDWNSR 732



>gi|358399571|gb|EHK48908.1| hypothetical protein TRIATDRAFT_280929 [Trichoderma atroviride IMI
           206040]
          Length = 742

 Score =  298 bits (764), Expect = 3e-78,   Method: Compositional matrix adjust.
 Identities = 195/615 (31%), Positives = 308/615 (50%), Gaps = 43/615 (6%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLIC-ATFWLNPYNFNPVIGYPGADPE 72
           P  +     RE     W+TS+ ++ R + KS   L   A    NPY  + + GYP    +
Sbjct: 134 PITQQPTNAREAIIKSWTTSRLSTFRALAKSMVALAGKANSTTNPY-LHKISGYPDVPKD 192

Query: 73  ANGSRFSSRNFPKYNFLEI----SDHDSDIKEF--DTXXXXXXXXXXXXXXRLARM-ENV 125
                +       Y FL++    +  + D+ E   D                LA     V
Sbjct: 193 -----WKPAEGYDYVFLQVPPAAAGKEDDVHEITTDVVIVGSGPGGGVCAKNLAEAGHEV 247

Query: 126 LVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFME 185
           LV++KG+H+    L   Q  G + L++ SG  +++D+++ + +GS +GGG ++ WS   +
Sbjct: 248 LVVDKGYHFHPTYLPMPQSAGLEYLFDHSGAYVSEDTSISMTSGSCWGGGGSVNWSVCFK 307

Query: 186 PQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLH 245
            Q +VR+EWA   GLP F   E+   M  +   +G  +  I HN SN  L++GCKKLG H
Sbjct: 308 LQDYVRKEWADE-GLPLFASAEFDECMDRVWDFIGAGSEAIRHNFSNNKLLDGCKKLGWH 366

Query: 246 SDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDG 305
           +   PQNTA+  H CG C  GC  GEK      WL  A    A F++   VEK+L D+DG
Sbjct: 367 AGVAPQNTANKEHYCGHCHLGCGLGEKMGPAQAWLPAAAEAGADFMEGFTVEKVLFDEDG 426

Query: 306 KSQKVMGVE---------------VIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKN 350
            +   +GV+               +     ++V I AK+V++SAG   SP +L++SG++N
Sbjct: 427 VT--AIGVQGSWLSRDEQGGLHKGIGDRTQRKVVIKAKKVILSAGTFWSPVILMKSGVEN 484

Query: 351 KNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGF 410
             +GRNLH+HP+  +  V   +EI+ + G I+++ S   EN+DG+ +G K+      P  
Sbjct: 485 PQLGRNLHLHPVNFLMAV-NRQEIRPWEGGIITSWSGEFENLDGKGHGVKLEPLCMMPYM 543

Query: 411 MFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTD-ENGKPRLEYKLSQHDSKS 469
            F+   W S L  K   + Y +I   + + RDR+ GR+  D E G+PR+EY  S  D ++
Sbjct: 544 AFSLQSWSSGLDTKLFTMRYRHINNFISLARDRDSGRVFVDPETGEPRIEYSPSDFDREN 603

Query: 470 MVAGLLTAVRILAAAGATKIGTCQTVIDDYI---------VENGVNPLNDPKFDQFLNKI 520
            + G++   +I    GAT+I      +  +I         V++      D  F ++L  +
Sbjct: 604 NLEGVIGLAKIAYVGGATEIRAHIYGLPPFIPNASEQAKHVQDKDPEFTDAAFGKWLQHL 663

Query: 521 KKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPS 580
           + +G     +  G+  QM +CRM        V+  G  W  +NLYVADSSV P+A+GV  
Sbjct: 664 RTLGNKPPVSAFGSAHQMGTCRMSASNESGVVDERGSVWGKKNLYVADSSVFPSASGVNP 723

Query: 581 MMTTMNIAHYISKCI 595
           M+T M+IA +IS+ +
Sbjct: 724 MVTVMSIADWISRGV 738



>gi|212533793|ref|XP_002147053.1| long chain fatty alcohol oxidase, putative [Talaromyces marneffei
           ATCC 18224]
 gi|210072417|gb|EEA26506.1| long chain fatty alcohol oxidase, putative [Talaromyces marneffei
           ATCC 18224]
          Length = 755

 Score =  298 bits (762), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 184/610 (30%), Positives = 302/610 (49%), Gaps = 39/610 (6%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGA---D 70
           P    +   RE     W +S+   +R++ +S  +L    + +N    N +IG+P      
Sbjct: 136 PIQNQSFDAREKVLNNWLSSRLPQLRQVGRSVMLLAKRQWLINSPTSNEIIGFPRVPVYG 195

Query: 71  PEANGSRFSSRNFPKYNFLEISDHDSDIKEFDTXXXXXXXXXXXXXXRLARMENVLVIEK 130
             A+   F    FP  + +E  + D  I                   R      V+V+EK
Sbjct: 196 KPADTFDFQFLQFPPGDGVETIETDVVIVGSGCGGAVAAKNLAAAGHR------VVVVEK 249

Query: 131 GHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFV 190
            +HY        Q   +  ++E    ++T+D  M VLAG+ +GGG T+ W A ++ Q +V
Sbjct: 250 AYHYPSSYFPMTQGSAFAHMFEQGCNLITNDGCMGVLAGATWGGGGTVNWGASLQTQNYV 309

Query: 191 REEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIP 250
           R+EWA   GLP+F   E+ N++  +  R+G +T     +  N+  + G +KLG ++  IP
Sbjct: 310 RQEWADT-GLPFFTSPEFQNSLDRVCHRMGVHT-EYEQSFQNKVTLEGSRKLGYNAQIIP 367

Query: 251 QNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQKV 310
            N+ +  H CG C+ GC    KQ    +WL +A    A F++    +K+L D     +  
Sbjct: 368 TNSGNAPHYCGHCTLGCHTVGKQGPVASWLVDAAKAGALFIEGFTADKVLFDNVEGKKVA 427

Query: 311 MGVEVIINNI-------------KRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
            GVE    +              ++V+I AK+V+VS G ++SP LL+RSG+KN ++GRNL
Sbjct: 428 AGVEGEWTSRDTHLGTSSKDVTRRKVQIKAKKVIVSCGTLNSPLLLMRSGIKNSHLGRNL 487

Query: 358 HVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPW 417
           H+HP+     VF  ++ + + G  ++ +    EN+DG  +G KI   +  PG   A FPW
Sbjct: 488 HLHPVMLGAAVF-EEQTQPWEGDCLTTLVTDFENLDGHGHGVKIENVAMVPGMFLAAFPW 546

Query: 418 KSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAGLLT 476
            S LQ+K+       +   + +TRD++ GR+  D  +G PR++Y  S  D K ++ GL+ 
Sbjct: 547 FSGLQYKKFAANLGRMAGFIALTRDKDTGRVYPDPISGGPRVDYTTSAFDRKHILEGLIA 606

Query: 477 AVRILAAAGATKIGTCQTVIDDYI------------VENGVNPLNDPKFDQFLNKIKKVG 524
           A +I   +GA +  T    +  +I            +      +NDP+F  ++ + +K  
Sbjct: 607 AAKIAYVSGAKEFHTSYRDMRPFIRSKKTETAEADDINTTDGGINDPEFQAWIREFRKKA 666

Query: 525 IPTYQTCTG-TIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMT 583
               ++ T  +  QM +CRM D P K  V+P G+ W+ E LYVAD+SV P+A+GV  M+T
Sbjct: 667 PLVAESGTAASAHQMGTCRMSDSPRKGVVDPDGQVWDTEGLYVADASVFPSASGVNPMVT 726

Query: 584 TMNIAHYISK 593
            M I  + S+
Sbjct: 727 NMAITDWTSR 736



>gi|399165401|emb|CCE33688.1| uncharacterized protein CPUR_07614 [Claviceps purpurea 20.1]
          Length = 781

 Score =  298 bits (762), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 176/606 (29%), Positives = 299/606 (49%), Gaps = 42/606 (6%)

Query: 23  REHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADPEANGSRFSSRN 82
           R+     W++S   ++R + KS   +      L+    + + GY     +      ++ +
Sbjct: 179 RQAILQSWASSPLPALRTLAKSLVQMAQKANSLHSRFLHDISGYSDIPSDWK----NTES 234

Query: 83  FPKYNFLEISDHDSDIKEFDTXXXXXXXXXXXXXXRLARM-----ENVLVIEKGHHYDQC 137
           +P Y F++I     D+  ++                 A+        VLV++KG+++   
Sbjct: 235 YP-YTFIQIPPGGKDLSPYELSTDVLIVGSGCGGGVSAKTLSEAGHKVLVVDKGYYFPPS 293

Query: 138 DLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVREEWAKN 197
            L   Q+     LYE  G + +D ++  V+ G+++GGG T+ WS     Q +VR+EWA  
Sbjct: 294 QLPMTQESASHYLYEGGGVLTSDSASTGVVCGASWGGGGTVNWSVCFRLQDYVRDEWASR 353

Query: 198 FGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQNTASIT 257
            GLP F   E+   M  +   +G +   + HN  NQ L++  + L      + QNTA   
Sbjct: 354 -GLPLFASAEFDACMDRVWEFIGASKAGLRHNARNQALMDALETLRWKGGAVEQNTAGRE 412

Query: 258 HQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQKVMGVEVII 317
           H CG C  GC   EK+    +WL  A    A+F++   VE+++  +DG++   +GVE + 
Sbjct: 413 HYCGRCHLGCNSAEKRGPATSWLPAAGEAGAEFMEGFAVERVVFGEDGRT--AIGVEGLW 470

Query: 318 NNI---------------KRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPI 362
                             +RV + AKRV+++AG++ SP LL +SG+KN N+GR+LH+HP 
Sbjct: 471 TGRGEGGTLHGKMEERTQRRVFVRAKRVILAAGSMWSPVLLAKSGVKNPNVGRHLHLHPT 530

Query: 363 AAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQ 422
             V GVF   ++ ++ G I+++  N  EN+DG  +G K+    + P   F+   W+  L 
Sbjct: 531 NFVSGVFGKTDMTSWEGGIITSYVNEFENLDGHGHGVKLEPTCNVPYTTFSLQSWRDGLD 590

Query: 423 HKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAGLLTAVRIL 481
            K L L+Y +I   + +TRDR+ GR+  D  +G PR++Y +S  D +  + G++   +I 
Sbjct: 591 AKVLALKYRHIGTYISLTRDRDTGRVYPDPVHGTPRIQYDMSDFDREHTLEGVIALAKIC 650

Query: 482 AAAGATKIGTCQTVIDDYIV----------ENGVNP-LNDPKFDQFLNKIKKV-GIPTYQ 529
             A AT+I      +  ++           ++G +P   DP F  ++ ++++    P   
Sbjct: 651 YVARATEIRAHLAGLAPFVARDGGKRQAEHQSGTDPEFTDPDFAAWIKRLRRADNKPPTA 710

Query: 530 TCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAH 589
            C  +  QM SCRM  D     V+  G  W    LYVAD+SV P+A+GV  M+T M +A 
Sbjct: 711 MCV-SAHQMGSCRMSADEESGVVDMQGRVWGTSGLYVADASVFPSASGVNPMVTAMALAD 769

Query: 590 YISKCI 595
           +IS+ +
Sbjct: 770 WISRGV 775



>gi|255557817|ref|XP_002519938.1| electron carrier, putative [Ricinus communis]
 gi|223540984|gb|EEF42542.1| electron carrier, putative [Ricinus communis]
          Length = 710

 Score =  298 bits (762), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 172/481 (35%), Positives = 254/481 (52%), Gaps = 17/481 (3%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           VLV+EKG+++ + +LS  +    D++Y   G M TDD  + +LAGS  GGG+TI WSA +
Sbjct: 232 VLVLEKGNYFARSNLSLLEGPTMDQMYLSGGLMATDDMGVVLLAGSTVGGGSTINWSASI 291

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +    V  EW   + L  F    Y  A+  +  ++G  +   +   +N+ L  GC++LG 
Sbjct: 292 KTPQHVISEWTNCYDLEIFGSKLYKEALDVVCEKMGVQSEIHVEGFNNEILRKGCEELGY 351

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTW-LNEAKSNNAKFLKNCYVEKILIDK 303
              NIP+N+A   H CGWC  GCK G+K+    TW L+   S N   L  C V KIL  +
Sbjct: 352 PVSNIPRNSAP-DHYCGWCCLGCKDGKKKGTCETWLLDLVNSGNGAILPRCEVIKILHKR 410

Query: 304 DGKSQKVMGVEVIINNIKRVKIH---AKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVH 360
               +   GV        + +++   +K  +++ GA+ SP LL RSGLKN NIGRNLH+H
Sbjct: 411 KSNRKAATGVVFGFEYKGKKELYVVESKVTIIACGALSSPPLLRRSGLKNPNIGRNLHLH 470

Query: 361 PIAAVYGVFPNK----EIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFP 416
           P+   +G FP      E K+Y G IM+A+S    N D   YGA I   S HPG   +  P
Sbjct: 471 PVTMAWGYFPEAWPEVEKKSYEGGIMTAMSTVVANFDKSGYGAVIQTPSLHPGMFSSLMP 530

Query: 417 WKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGLLT 476
           W S    K  M  Y+    +  + RD+  G +    N    + Y++   D K++  G+  
Sbjct: 531 WVSGADIKMQMCRYSRTAHIFALGRDKGSGTV----NSPSSITYQMKAADEKNLQNGIEK 586

Query: 477 AVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQTCTGTIE 536
            +RILAAAGA +IGT   +     V+      +  +F++F+ + +   +        +  
Sbjct: 587 ILRILAAAGAEEIGTHHCIGRRLNVKTA----SYHEFEKFVKEERARPMRDLSNQICSAH 642

Query: 537 QMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKCIL 596
           QM SCRMG +P  S VN  GE WE+E LY+AD+SV PTA GV  M+T   IA+  ++ +L
Sbjct: 643 QMGSCRMGVNPKHSVVNQTGETWEIEGLYLADASVFPTALGVNPMVTVQAIAYCTAQSVL 702

Query: 597 D 597
           +
Sbjct: 703 E 703



>gi|242065798|ref|XP_002454188.1| hypothetical protein SORBIDRAFT_04g026370 [Sorghum bicolor]
 gi|241934019|gb|EES07164.1| hypothetical protein SORBIDRAFT_04g026370 [Sorghum bicolor]
          Length = 773

 Score =  298 bits (762), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 177/493 (35%), Positives = 268/493 (54%), Gaps = 33/493 (6%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+VIEKG+++   D +  +    ++LYE  G + T   +  VLAGS  GGGT + WSA +
Sbjct: 282 VVVIEKGNYFTARDYTAIEAPSMEQLYEGGGAVSTLSGSALVLAGSTVGGGTAVNWSACI 341

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +    VREEWA + GLP F  DEY  AM  +  RLG           N+ L  GC+KLG 
Sbjct: 342 KTPDDVREEWASDQGLPLFATDEYAAAMDKVFERLGVTAGCAEEGLQNKVLRKGCEKLGY 401

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD 304
             +++ +N+ S  H CG C +GC+ G+K+    TWL +A S  A  L  C  EK+L+++ 
Sbjct: 402 KVESVSRNS-SEGHYCGSCGYGCRSGDKRGTDRTWLVDAVSRGAVILTGCKAEKLLLERT 460

Query: 305 G------KSQKVMGVEVIINN---IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGR 355
           G      ++++ +GV     N    + +++ A+  V + G++ +P LL  SGL N++IG+
Sbjct: 461 GTGGAESRAKRCVGVVARSTNPTITRTLEVRARVTVSACGSLLTPVLLRGSGLSNRHIGK 520

Query: 356 NLHVHPIAAVYGVFPNK----EIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFM 411
           NLH+HP A V+G FP+     + KTY G I++++ +  E   G    A+ ++ +   G  
Sbjct: 521 NLHLHPTALVWGYFPDTMPDLKGKTYEGGIITSL-HKVEGAPGAP--ARAILETPAMGLA 577

Query: 412 FAN--FPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKS 469
            A   FPW S    K+ ML Y   V L  + RDR  G +L    G+ R+ Y L   D+++
Sbjct: 578 GAGTLFPWVSGSDLKERMLRYGRTVHLFSLVRDRGSGSVL----GERRVAYHLDATDAEN 633

Query: 470 MVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIP--- 526
           M  GL  A+RILAAAGA +IGT ++    +          +   ++FL+ +  V  P   
Sbjct: 634 MREGLRRALRILAAAGAAEIGTHRSDGQRFACRGA----TEAALEEFLDGVDVVRGPQSK 689

Query: 527 --TYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTT 584
              +  C  T  QM SCRMG      AV+  GE+WEVE+LYV D SVLP+A GV  M+T 
Sbjct: 690 AEAWSLCC-TAHQMGSCRMGVTARDGAVDARGESWEVESLYVCDGSVLPSAVGVNPMVTI 748

Query: 585 MNIAHYISKCILD 597
            ++A+ ++  I +
Sbjct: 749 QSVAYCLATGIAE 761



>gi|296423509|ref|XP_002841296.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295637533|emb|CAZ85487.1| unnamed protein product [Tuber melanosporum]
          Length = 718

 Score =  297 bits (761), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 192/636 (30%), Positives = 305/636 (47%), Gaps = 61/636 (9%)

Query: 14  PFHELTQKQREHTFIKW----STSQYASVRKIYKSFTMLICATFWLNPYN--FNPVIGYP 67
           PFH    + RE   + W    S   +  +R   K+ T L    +  N     +   +GYP
Sbjct: 97  PFHRQPVRVREDLIVSWLDQSSRLLFPPIRGFAKAITALTMMVWTRNADTDMYYGAVGYP 156

Query: 68  GADPEANGSRFSSRN-----FPKYNFLEISDHDSDIKEFDTXXXXXXXXXXXXXXRLA-R 121
               E  G+   + +     F K+ FL+ S  +  + E D               RLA  
Sbjct: 157 ----EKTGAGVKALDGEPGDFYKFEFLDFSTSEKKVLECDVVIVGSGCGGAVAAARLAGE 212

Query: 122 MENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWS 181
              V+V+++G           + +  +KL+       T D  + +++G  FGGG  + W+
Sbjct: 213 GLEVVVVDRGEWVSPDQFPLRETEALNKLFSNGLASTTADGVIALISGETFGGGGVVNWA 272

Query: 182 AFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKK 241
           A ++ Q FVREEWA    LP+F+ ++Y + +  +  R+G  T  I HN  NQ +I GC+K
Sbjct: 273 ASLQTQGFVREEWATKHKLPFFLSNDYQDCLDKVCERMGVTTEGIKHNHRNQAMIEGCRK 332

Query: 242 LGLHSDNIPQNTASITHQCGWCSFGCKYG----------------------EKQSATMTW 279
           LG  +  +PQNT +          G K G                       K   T TW
Sbjct: 333 LGYSTVAVPQNTGATLP-------GDKEGIVREHADGYCGNGCGCGKKGDGRKMGTTHTW 385

Query: 280 LNEAKSNNAKFLKNCYVEKILIDKDGKSQKVMGVEVIINNIK-RVKIHAKRVVVSAGAIH 338
           L +A    A+F+++ Y +++L   D K+ K MGV       K  +KI AK+V+VSAG+++
Sbjct: 386 LPDAARAGARFIQSYYTDRVLFSTDAKT-KAMGVTGTWGPQKVPLKIMAKKVIVSAGSLN 444

Query: 339 SPALLLRSGLKNKNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYG 398
           SP LLLRSGL N NIG++LH+HP   +   FP +    + G+ ++      EN+DG  +G
Sbjct: 445 SPCLLLRSGLTNPNIGKHLHLHPGVTIQAFFPER-TDPWVGSPLTTACTQFENLDGSYHG 503

Query: 399 AKIVVGSHHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRL 458
            K+   +  P    +  PW S+   K+ +L Y +      I RDR+ G +  +  G+P +
Sbjct: 504 GKLETAAMGPLMAASPLPWLSSASLKRTLLNYRHSGLFFTIQRDRDSGMVTLNTCGEPVV 563

Query: 459 EYKLSQHDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDP-----KF 513
           +Y +S+ D + +   LL   +IL   GA +I   +   ++    +  +  NDP     +F
Sbjct: 564 KYTISEADREMIQTSLLGLAKILYVQGAEEILPAE---EEGPYGHATHQFNDPGIMDRRF 620

Query: 514 DQFLNKIKKVGIPTYQTCTGTIEQMSSCRMGDDPN-KSAVNPVGEAWEVENLYVADSSVL 572
            ++L K    G+   +T  G+  QM SCRMG+D    S V+P G  W  E L VAD+SVL
Sbjct: 621 QRWLKKFAGHGMGGEKTVYGSAHQMGSCRMGNDGGVGSVVDPKGRVWGTEGLLVADASVL 680

Query: 573 PTATGVPSMMTTMNIAHYISKCILDKKIFTVKKKRG 608
           P+A GV  M+T M I+ +I+  ++ +    +K +RG
Sbjct: 681 PSACGVNPMITVMAISEWIAGGVVTE----LKPQRG 712



>gi|485451300|gb|AGK82832.1| alcohol oxidase [Solanum habrochaites]
          Length = 746

 Score =  297 bits (761), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 175/495 (35%), Positives = 262/495 (52%), Gaps = 33/495 (6%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           VLV+EKG +  + +LS  +    D+++  +G M+T D ++++LAGS  GGG+TI WSA +
Sbjct: 253 VLVLEKGSYLARTNLSLLEGPSMDQMFLGNGLMMTKDMDVFLLAGSTVGGGSTINWSASI 312

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +    V +EW   + L  F  + Y  A++ I  ++G           N  L  GC++LG 
Sbjct: 313 DTPSHVLKEWCDIYELELFQSEFYKEALETIRKKMGVQDKIDEEGFQNMILRKGCEELGY 372

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNE-AKSNNAKFLKNCYVEKILIDK 303
           + +NIP+N  S  H CGWCS GCK G K+    TWL +  KS N   ++ C   +++ + 
Sbjct: 373 NVENIPRNAHS-NHYCGWCSMGCKDGSKKGTNETWLVDLVKSGNGAIIQECEALEVIHEH 431

Query: 304 DGK--SQKVMGVEVIINNIKRVK----IHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
                  K +GV     +   VK    + +K  +V+ GA+ +P+LL RSGLKN NIG+NL
Sbjct: 432 KNNYNKSKAIGVACEFQHDDGVKEIFMVRSKVTIVACGALSTPSLLKRSGLKNPNIGKNL 491

Query: 358 HVHPIAAVYG---------------VFPNKEIKTYSGTIMSAISNATENVDGENYGAKIV 402
           HVHP+   +G               V+P  E K+Y G IMS +S    N +   YG  I 
Sbjct: 492 HVHPVVFAWGHFPDTDSTDNVKNFEVWPESEKKSYEGGIMSVMSKVVANTEEPGYGVVIQ 551

Query: 403 VGSHHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKL 462
             S HPG      PW S L  K  M +Y+    +  + RD+  G  ++  +    + YKL
Sbjct: 552 TPSLHPGMFSVVMPWISGLDIKMRMCKYSRTAHIFALARDKGSGETVSPYS----ISYKL 607

Query: 463 SQHDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIV-ENGVNPLNDPKFDQFLNKIK 521
            Q D +++  G+   +RILAAAGA +IGT       + V E+ V+     +F+ F+ +  
Sbjct: 608 DQIDEQNLKVGIEKLLRILAAAGAEEIGTHHVKGRKFKVKESSVD-----EFESFVKEES 662

Query: 522 KVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSM 581
             G+    T   +  QM SCRMG DP  S VNP GE WEVE+L++ D+SV PTA GV  M
Sbjct: 663 SRGLKDLSTPICSAHQMGSCRMGIDPKISVVNPKGETWEVEDLFIGDTSVFPTALGVNPM 722

Query: 582 MTTMNIAHYISKCIL 596
           +T   I++  ++ +L
Sbjct: 723 LTVQAISYCTAQNVL 737



>gi|225433197|ref|XP_002285334.1| PREDICTED: long-chain-alcohol oxidase FAO1 [Vitis vinifera]
          Length = 741

 Score =  296 bits (759), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 173/490 (35%), Positives = 274/490 (55%), Gaps = 30/490 (6%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG ++   D S+ +    ++L+E  G + T D  M +LAGS  GGG+ I WSA +
Sbjct: 257 VVVLEKGTYFTATDYSSLEGPSMNQLFESGGILPTVDGKMMILAGSTVGGGSAINWSASI 316

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +    V  EWA+   LP F   +Y +AM  +  R+G     +     NQ L  GC+ LGL
Sbjct: 317 KTPKSVLHEWAEEHKLPLFGSSQYFSAMDAVCERIGVTETCVEEGFQNQVLQKGCENLGL 376

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD 304
             D +P+N++   H CG CS+GC+ G+K+    TWL +A +  A  +  C  E+ +++ +
Sbjct: 377 KVDLVPRNSSE-KHYCGSCSYGCRSGDKKGTDSTWLVDAVACGAVIITGCKAERFILETN 435

Query: 305 G----KSQKVMGV--EVIINNIK-RVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
                K +K +GV  + + NNIK R++I AK  + + G++ +P L++ SGLKN++IG+NL
Sbjct: 436 EYGRVKRKKCLGVIAKTLNNNIKNRIQIEAKVTISACGSLLTPPLMISSGLKNQHIGQNL 495

Query: 358 HVHPIAAVYGVFPNK----EIKTYSGTIMSAISNATENVDGENYGAKIVVGSHH--PGFM 411
           H+HP+A V+G FP+     E K Y G I++++      V  E+   + ++ +    PG  
Sbjct: 496 HLHPVAMVWGYFPDSNSEFEGKAYEGGIITSM----HKVVSEDCQVRAIIETPALGPGSF 551

Query: 412 FANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMV 471
            A  PW+S L  K+ M+ Y   V L  + RD   G++  +     R+ Y LS  D +++ 
Sbjct: 552 AALCPWESGLDMKKRMVRYGRTVHLFAMVRDEGTGKVKVE----GRISYNLSAIDKENLR 607

Query: 472 AGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTY--- 528
           AG+   +RIL AAGA ++GT ++  D   +++    +N+ + ++FL+ +     P     
Sbjct: 608 AGVRQGLRILIAAGAVEVGTYRS--DGQRLKS--KGINEKELEEFLDSVSAAEGPQSFVD 663

Query: 529 -QTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNI 587
             T TGT  QM SCRMG    + AV+  GE+WE   L+V D SVLPTA GV  M+T  + 
Sbjct: 664 KWTITGTAHQMGSCRMGKSEKEGAVDENGESWEAAGLFVCDGSVLPTAVGVNPMITIQST 723

Query: 588 AHYISKCILD 597
           A+ +SK I D
Sbjct: 724 AYCLSKKIAD 733



>gi|356543140|ref|XP_003540021.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Glycine max]
          Length = 751

 Score =  296 bits (759), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 176/489 (35%), Positives = 262/489 (53%), Gaps = 25/489 (5%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG+++   D S+ +    ++LYE  G + + DS + VLAGS  GGG+ + WSA +
Sbjct: 267 VVVLEKGNYFSTQDYSSLEGPSMNQLYETGGILASVDSRVLVLAGSTVGGGSAVNWSACI 326

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +  + V  EW++N  LP+F   EY +AM+ +  R+G           NQ L  GC+ LGL
Sbjct: 327 KTPHKVLNEWSENHKLPFFSSQEYLSAMETVCERIGVTENCTQEGFQNQVLRKGCQNLGL 386

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDK- 303
             D +P+N++   H CG C +GC  GEKQ    TWL +A   +A  +  C  E+ L++  
Sbjct: 387 KVDYVPRNSSG-NHYCGSCGYGCPKGEKQGTQATWLVDAVERDAVIITGCKAERFLLESN 445

Query: 304 ---DGKSQKVMGVEVIINNIK---RVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
              +G+ +K +GV     N +   +++I AK  + + GA+ +P LL+ SGLKNKNIG+NL
Sbjct: 446 RSGNGRKKKCLGVMAKALNSRVTMKLQIEAKVTISAGGALLTPPLLISSGLKNKNIGKNL 505

Query: 358 HVHPIAAVYGVFPNK-----EIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMF 412
           H+HP+   +G FP       + K Y G I++++          +  A I   S  P    
Sbjct: 506 HLHPVLMTWGYFPESNDSEFKGKVYEGGIITSVHKVPSTDSNSDSRAIIETPSLGPASFA 565

Query: 413 ANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVA 472
           A  PW+S L  K+ ML Y     L+ I RD   G++ T+     R+ YKL++ D ++M A
Sbjct: 566 ALCPWESGLDFKERMLNYPRTSHLITIIRDMACGQVSTE----GRISYKLNEIDKENMKA 621

Query: 473 GLLTAVRILAAAGATKIGT----CQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTY 528
           GL  A++IL AAGA ++GT     Q +  D I EN V        D        +    Y
Sbjct: 622 GLKQALKILIAAGAVEVGTHRSDGQRLKCDGIGENEVQEF----LDSVCPMEGALSPGEY 677

Query: 529 QTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIA 588
                +  QM SCRMG +  + AV+  GE WE E L+V D+SVLP+A GV  M+T  + A
Sbjct: 678 WNIYSSAHQMGSCRMGVNEKEGAVDENGETWEAEGLFVCDASVLPSAVGVNPMITVQSTA 737

Query: 589 HYISKCILD 597
           + IS  I D
Sbjct: 738 YCISNRIAD 746



>gi|485451270|gb|AGK82806.1| alcohol oxidase [Solanum lycopersicum]
          Length = 746

 Score =  296 bits (759), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 174/495 (35%), Positives = 263/495 (53%), Gaps = 33/495 (6%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           VLV+EKG +  + +LS  +    D+++  +G M+T D ++++LAGS  GGG+TI WSA +
Sbjct: 253 VLVLEKGSYLARTNLSLLEGPSMDQMFLGNGLMMTKDMDVFLLAGSTVGGGSTINWSASI 312

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +    V +EW   + L  F  + Y  A++ I  ++G           N  L  GC++LG 
Sbjct: 313 DTPSHVLKEWCDIYELELFQSEFYKEALETIREKMGVQDKIDEEGFQNMILRKGCEELGY 372

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNE-AKSNNAKFLKNCYVEKILIDK 303
           + +NIP+N  S  H CGWCS GCK G K+    TWL +  KS N   ++ C   +++ + 
Sbjct: 373 NVENIPRNAHS-NHYCGWCSMGCKDGSKKGTNETWLVDLVKSGNGAIIQECEALEVIHEH 431

Query: 304 DGKSQKVMGVEVII-----NNIKRV-KIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
                K   + V       N +K +  + +K  +V+ GA+ +P+LL RSGLKN NIG+NL
Sbjct: 432 KNNYNKSKAIGVACEFQHDNGVKEIFMVKSKVTIVACGALSTPSLLKRSGLKNPNIGKNL 491

Query: 358 HVHPIAAVYGVFP---------NKEI------KTYSGTIMSAISNATENVDGENYGAKIV 402
           HVHP+   +G FP         N E+      K+Y G IMS +S    N +   YG  I 
Sbjct: 492 HVHPVVFAWGHFPDTNSTDNVKNSEVWPESDKKSYEGGIMSVMSKVVANTEEPGYGVVIQ 551

Query: 403 VGSHHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKL 462
             + HPG      PW S L  K  M +Y+    +  + RD+  G  ++  +    + YKL
Sbjct: 552 TPALHPGMFSVVMPWISGLDIKMRMCKYSRTAHIFALARDKGSGETVSPYS----ISYKL 607

Query: 463 SQHDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIV-ENGVNPLNDPKFDQFLNKIK 521
            Q D +++  G+   +RILAAAGA +IGT       + V E+ V+     +F+ F+ +  
Sbjct: 608 DQIDEQNLKVGIEKLLRILAAAGAEEIGTHHVKGRKFKVKESSVD-----EFESFVKEES 662

Query: 522 KVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSM 581
             G+    T   +  QM SCRMG DP  S VNP GE WEVE+L++ D+SV PTA GV  M
Sbjct: 663 SRGLKNLSTPICSAHQMGSCRMGIDPKISVVNPKGETWEVEDLFIGDTSVFPTALGVNPM 722

Query: 582 MTTMNIAHYISKCIL 596
           +T   I++  ++ +L
Sbjct: 723 LTVQAISYCTAQNVL 737



>gi|460397771|ref|XP_004244440.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Solanum
           lycopersicum]
          Length = 774

 Score =  296 bits (758), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 174/495 (35%), Positives = 263/495 (53%), Gaps = 33/495 (6%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           VLV+EKG +  + +LS  +    D+++  +G M+T D ++++LAGS  GGG+TI WSA +
Sbjct: 281 VLVLEKGSYLARTNLSLLEGPSMDQMFLGNGLMMTKDMDVFLLAGSTVGGGSTINWSASI 340

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +    V +EW   + L  F  + Y  A++ I  ++G           N  L  GC++LG 
Sbjct: 341 DTPSHVLKEWCDIYELELFQSEFYKEALETIREKMGVQDKIDEEGFQNMILRKGCEELGY 400

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNE-AKSNNAKFLKNCYVEKILIDK 303
           + +NIP+N  S  H CGWCS GCK G K+    TWL +  KS N   ++ C   +++ + 
Sbjct: 401 NVENIPRNAHS-NHYCGWCSMGCKDGSKKGTNETWLVDLVKSGNGAIIQECEALEVIHEH 459

Query: 304 DGKSQKVMGVEVII-----NNIKRV-KIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
                K   + V       N +K +  + +K  +V+ GA+ +P+LL RSGLKN NIG+NL
Sbjct: 460 KNNYNKSKAIGVACEFQHDNGVKEIFMVKSKVTIVACGALSTPSLLKRSGLKNPNIGKNL 519

Query: 358 HVHPIAAVYGVFP---------NKEI------KTYSGTIMSAISNATENVDGENYGAKIV 402
           HVHP+   +G FP         N E+      K+Y G IMS +S    N +   YG  I 
Sbjct: 520 HVHPVVFAWGHFPDTNSTDNVKNSEVWPESDKKSYEGGIMSVMSKVVANTEEPGYGVVIQ 579

Query: 403 VGSHHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKL 462
             + HPG      PW S L  K  M +Y+    +  + RD+  G  ++  +    + YKL
Sbjct: 580 TPALHPGMFSVVMPWISGLDIKMRMCKYSRTAHIFALARDKGSGETVSPYS----ISYKL 635

Query: 463 SQHDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIV-ENGVNPLNDPKFDQFLNKIK 521
            Q D +++  G+   +RILAAAGA +IGT       + V E+ V+     +F+ F+ +  
Sbjct: 636 DQIDEQNLKVGIEKLLRILAAAGAEEIGTHHVKGRKFKVKESSVD-----EFESFVKEES 690

Query: 522 KVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSM 581
             G+    T   +  QM SCRMG DP  S VNP GE WEVE+L++ D+SV PTA GV  M
Sbjct: 691 SRGLKNLSTPICSAHQMGSCRMGIDPKISVVNPKGETWEVEDLFIGDTSVFPTALGVNPM 750

Query: 582 MTTMNIAHYISKCIL 596
           +T   I++  ++ +L
Sbjct: 751 LTVQAISYCTAQNVL 765



>gi|502116266|ref|XP_004495357.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Cicer arietinum]
          Length = 744

 Score =  296 bits (758), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 173/484 (35%), Positives = 276/484 (57%), Gaps = 27/484 (5%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           VLV+EKG+++ Q D S+ +    ++LYEL G   + D N+ +LAGS  GGG+ + WSA +
Sbjct: 263 VLVLEKGNYFTQNDYSSLEGPSLNELYELGGTFASCDGNIAILAGSTVGGGSAVNWSASI 322

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
               +V +EW++N  LP F   EY +AM  +  R+G     +     NQ L  GC+KLGL
Sbjct: 323 RTPDYVLKEWSENHKLPLFSSHEYVSAMDMVCKRIGVTDTCVEEGLQNQVLRKGCEKLGL 382

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEK-ILID- 302
             D +P+N+ S  H CG C++GC+ GEKQ   +TWL +A  + A  L  C  +K IL+D 
Sbjct: 383 QVDYVPRNS-SQHHYCGSCNYGCRKGEKQGTDVTWLADAVDDGAVILTRCKAKKFILVDN 441

Query: 303 KDG--KSQKVMGV--EVIINNIK-RVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
           K+G  + +K +G+    +  NI  R+++ AK  + S GA+ +P L++ SGLKNKNIG NL
Sbjct: 442 KEGCVRRKKCLGLMANFLTENITWRLQVEAKATISSCGALSTPPLMISSGLKNKNIGNNL 501

Query: 358 HVHPIAAVYGVFPNK----EIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFA 413
           H+HP+   +G FP+     + ++Y G I+++I       D     A I   +  PG    
Sbjct: 502 HLHPVLMTWGYFPDSISDLKGRSYEGGIITSIHKVLS--DDSKVKAIIETPALAPGTFST 559

Query: 414 NFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQH-DSKSMVA 472
            FPW+S    K+ ML Y+ +V  + I +D+  G + ++     R++Y+L +  D +++  
Sbjct: 560 LFPWESGFGFKERMLRYSRMVHFITIIQDKSCGEVKSE----GRIKYELDEEFDKENIKD 615

Query: 473 GLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQ--- 529
           GL  A+RIL AAGA ++GT ++  D   +    +  N+ + ++F+  +   G P      
Sbjct: 616 GLQQALRILIAAGAVEVGTHRS--DGQRI--ACSGSNEKELNKFVESVYATGGPMSHGEN 671

Query: 530 -TCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIA 588
            +   +  QM SCR+G    + AV+  G++WE E L+V DSS+LPTA GV  M+T  ++A
Sbjct: 672 WSIYASAHQMGSCRVGVTEKEGAVDENGQSWEAEGLFVCDSSLLPTAIGVNPMITIQSVA 731

Query: 589 HYIS 592
           + I+
Sbjct: 732 YCIA 735



>gi|242065802|ref|XP_002454190.1| hypothetical protein SORBIDRAFT_04g026390 [Sorghum bicolor]
 gi|241934021|gb|EES07166.1| hypothetical protein SORBIDRAFT_04g026390 [Sorghum bicolor]
          Length = 776

 Score =  296 bits (758), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 173/494 (35%), Positives = 268/494 (54%), Gaps = 34/494 (6%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
            +VIEKG+++   D +  +    + LYE  G + T   +  +LAGS  GGGT + WSA +
Sbjct: 288 AVVIEKGNYFTSSDYTAVEAPSMEHLYEGGGFVSTLSGSALLLAGSTVGGGTAVNWSACI 347

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +    VREEWA+N GLP F  DEY  AM  +  RLG           N+ L  GC+KLG 
Sbjct: 348 KTPDDVREEWARNQGLPLFATDEYAAAMDKVFERLGVTAGCAEEGLQNKVLRKGCEKLGY 407

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDK- 303
             +++ +N+ S  H CG C +GC+ G+K+    TWL +A +  A  L  C  EK+L+++ 
Sbjct: 408 KVESVSRNS-SEGHYCGSCGYGCRTGDKRGTDRTWLVDAVTRGAVILTGCKAEKLLLERM 466

Query: 304 ------DGKSQKVMGVEVIINN---IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIG 354
                 DG++++ +GV     N    + +++ A+  V + G++ +P LL  SGL N++IG
Sbjct: 467 VTGGRADGRAKRCVGVVARSTNPAITRTLEVRARATVSACGSLLTPVLLRGSGLSNRHIG 526

Query: 355 RNLHVHPIAAVYGVFPNK----EIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGF 410
           +NLH+HP A V+G FP+     + KTY G I++++ +  E   G    A+ ++ +   G 
Sbjct: 527 KNLHLHPTALVWGYFPDTMPDLKGKTYEGGIITSL-HKVEGAPGAP--ARAILETPAMGL 583

Query: 411 MFAN--FPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSK 468
             A   FPW S    K+ +L Y   V L  + RDR  G +    +G+ R+ Y L   D +
Sbjct: 584 AGAGTQFPWVSGSDMKERILRYGRTVHLFSMVRDRGSGTV----HGERRVAYHLDATDRE 639

Query: 469 SMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIP-- 526
           +M  GL  A+R+LAAAGA +IGT ++    ++         +   ++FL+ +  V  P  
Sbjct: 640 NMREGLRRALRVLAAAGAAEIGTHRSDGQRFVCRGA----TEAALEEFLDGVDVVRGPQS 695

Query: 527 ---TYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMT 583
               +  C  T  QM SCRMG      AV+  GE+WEVE+LYV D SVLP+A GV  M+T
Sbjct: 696 KAEAWSLCC-TAHQMGSCRMGATARDGAVDARGESWEVESLYVCDGSVLPSAVGVNPMVT 754

Query: 584 TMNIAHYISKCILD 597
             ++A+ ++  I +
Sbjct: 755 IQSVAYCLATGIAE 768



>gi|357517451|ref|XP_003629014.1| GMC-type oxidoreductase, putative [Medicago truncatula]
 gi|355523036|gb|AET03490.1| GMC-type oxidoreductase, putative [Medicago truncatula]
          Length = 810

 Score =  296 bits (758), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 174/499 (34%), Positives = 271/499 (54%), Gaps = 29/499 (5%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           VLV+EKG ++ + +LS  +    D++Y  +G + TDD ++ VLAGS  GGG+ I WSA +
Sbjct: 325 VLVLEKGSYFARNNLSLLEGPTLDQMYLANGLIATDDMSVLVLAGSTVGGGSAINWSASI 384

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +    V +EW     L  F  + Y  AM  +  ++G  +       +N  L  GC+++G 
Sbjct: 385 KTPSHVCKEWCDRHELELFESELYKEAMDAVCEKMGVQSEFEEEGFNNAILRKGCQEMGY 444

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNE-AKSNNAKFLKNCYVEKILI-D 302
              NIP+N A   H CGWC  GCK G+K+  + TWL +  KS N   L NC   ++L  +
Sbjct: 445 PVSNIPRN-APPDHYCGWCCLGCKDGKKKGTSETWLVDLVKSGNGAILPNCEAIQVLYRE 503

Query: 303 KDGKSQKV---MGVEVIINNIKRV-KIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLH 358
           K G  +K+   +  E+  N  K +  + +K  +V+ GA+ +P+LL RSGLKN+NIGRNLH
Sbjct: 504 KKGTDRKIAKGVAFEIDYNGKKDICVVESKVTIVACGALCTPSLLKRSGLKNENIGRNLH 563

Query: 359 VHPIAAVYGVFPNK----------EIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHP 408
           +HP+   +G FP+             K+Y G IM+A+S    + +   YGA I   S HP
Sbjct: 564 LHPVTMAWGYFPDAPSSPELWPEGHKKSYEGGIMTAMSTVVADFNATGYGAVIQTPSLHP 623

Query: 409 GFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSK 468
           G      PW S +  K  M +++    +  + RD+  G +    +   R+ Y++   D +
Sbjct: 624 GLFSVLMPWSSGMDIKDRMRKFSRTAHVFALARDQGSGTV----DSPTRISYQMKNVDKE 679

Query: 469 SMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTY 528
           ++  G+   +RILAAAGA +IGT     ++      V  ++  +F++F+ +   + +   
Sbjct: 680 NLHKGIEKVLRILAAAGAEEIGT----HNNKGRSLNVKEVSYHEFEKFVKEESSMPLTDL 735

Query: 529 QTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIA 588
            T   +  QM SCRMG +P +S VN  GE WEVE LY+AD+SV PTA GV  M+T   IA
Sbjct: 736 STPVCSAHQMGSCRMGTNPKESVVNQTGETWEVEGLYLADTSVFPTALGVNPMVTVQAIA 795

Query: 589 HYISKCILDKKIFTVKKKR 607
           +  ++ +L+     +K+KR
Sbjct: 796 YCTAQHVLE----VLKRKR 810



>gi|326475872|gb|EGD99881.1| long chain fatty alcohol oxidase [Trichophyton tonsurans CBS
           112818]
          Length = 749

 Score =  296 bits (757), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 193/609 (31%), Positives = 303/609 (49%), Gaps = 37/609 (6%)

Query: 12  QKPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADP 71
           + PF       R      W +S    +R  +++   L   ++  +  +   V+G+P    
Sbjct: 134 RTPFQHQPYHVRRQILSSWRSSYLPPLRAAHRALVALTKKSWVGSSPSLPLVLGFPNV-- 191

Query: 72  EANGSRFSSRNFPKYNFLEISDHDS-DIKEFDTXXXXXXXXXXXXXXRLARM-ENVLVIE 129
             +G+  +S +FP Y+FL+    D  +I E D                LA     V+V+E
Sbjct: 192 PVHGA--TSESFP-YSFLQFPAGDGPEIIETDVVIVGSGCGAGVAAKNLAEAGHRVIVVE 248

Query: 130 KGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYF 189
           K + +          +G   L+   G  L+DD ++ V++GS +GGG TI WSA ++ Q  
Sbjct: 249 KSYFFPNDHYPMSGCEGAFHLFSNGGAELSDDGSIGVVSGSTWGGGGTINWSASLQTQSM 308

Query: 190 VREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNI 249
           VREEWA N GLP F    Y  ++  +   +G +   I  N  N  L+ G +KLG  +  +
Sbjct: 309 VREEWA-NAGLPLFTSSAYQTSLDRVCDYMGVSADFIQQNHGNSVLMEGARKLGYSAKAV 367

Query: 250 PQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD-GKSQ 308
           PQNT    H CG+C+ GC  G KQ   +T+L +A    A F++    EK+L  +   K +
Sbjct: 368 PQNTGHQKHACGYCALGCAAGIKQGPAVTFLADAARAGATFIEGFKAEKVLFGRKLVKGK 427

Query: 309 KV-MGVEVIINN-------------IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIG 354
           +V +GV     +              ++V I A +VVVS G + SP LLLRSGLKN  IG
Sbjct: 428 RVAIGVRGTWTSRDASGATHGTPAITRKVVIKANKVVVSCGTLESPLLLLRSGLKNPQIG 487

Query: 355 RNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFAN 414
           RNLH+HP+  +  +F + E + + G+I++++ +  EN+DG  +G+KI      P F    
Sbjct: 488 RNLHLHPVIIMSAMF-DHETRPWEGSILTSLVSDFENLDGRGHGSKIEAVVMLPNFFLPL 546

Query: 415 FPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDEN-GKPRLEYKLSQHDSKSMVAG 473
             W + L +K        +   + +TRDR+ GR+  D N G+ R+EY  S  D K ++ G
Sbjct: 547 MAWDNGLDYKTFAANARRMAGFISLTRDRDTGRVYPDPNDGRCRIEYTPSAFDRKHILEG 606

Query: 474 LLTAVRILAAAGATKIGTCQTVIDDYI--------VENGVNPLNDPKFDQFLNKIKK-VG 524
           ++ A +I   +GA +I +    I  +          + GV   N+  F +++ K++  V 
Sbjct: 607 IIGAAKIAYVSGAREIRSSSLAIPTFTRPETSSDAADEGV---NNAAFQEWIKKLRTGVP 663

Query: 525 IPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTT 584
           +PT Q+   +  QM +CRMG  P  S V+P G  W    LYVAD+SV P+A+GV  M+T 
Sbjct: 664 LPTEQSMFASAHQMGTCRMGISPKTSVVDPTGMVWGTSGLYVADASVFPSASGVNPMITN 723

Query: 585 MNIAHYISK 593
           M I    S+
Sbjct: 724 MAITDVTSR 732



>gi|384252809|gb|EIE26284.1| FAD/NAD(P)-binding domain-containing protein, partial [Coccomyxa
           subellipsoidea C-169]
          Length = 519

 Score =  296 bits (757), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 173/480 (36%), Positives = 248/480 (51%), Gaps = 17/480 (3%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSA-F 183
           VLV+EKG +    +L  +++  +  +YE  G M TD++ + +LAG+  GGGT I WSA F
Sbjct: 36  VLVVEKGTYTRAQELPLQERQAFGTMYEGGGLMTTDNAGINILAGATLGGGTRINWSASF 95

Query: 184 MEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLG 243
             P + VR EWA+  GL  F  +EY +A+  +  RLG  T  + H+ +N  L  G K+LG
Sbjct: 96  ATPDH-VRNEWAQEHGLDVFASEEYDHALAAVTERLGVTTGILEHSNANSKLQAGLKQLG 154

Query: 244 LHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDK 303
            H   IP+NT S  H CG CSFGC  GEK+  T T+L +A  N      +        D 
Sbjct: 155 AHCGEIPRNT-SREHSCGHCSFGCPSGEKRDTTSTFLTDAV-NGVVIASSPPAAAAGDDH 212

Query: 304 DGKSQKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLK-NKNIGRNLHVHPI 362
              SQ             R+ +    VV +AGA+H+PALLLRSG+    N+G NL +HP 
Sbjct: 213 PAGSQN--------RRPWRLLLRCTHVVAAAGALHTPALLLRSGVTVAGNVGTNLRMHPA 264

Query: 363 AAVYGVFPN-KEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNL 421
             V   FP  + I  + G IMS  S    + +G  YG  +   S HPG   A+FPW S  
Sbjct: 265 TVVTATFPKARPILGWEGAIMSVFSREAADWEGSGYGPLLATPSGHPGLTAASFPWPSGG 324

Query: 422 QHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGLLTAVRIL 481
           +++   LE+      +V  RDR+ GR+    +G+PR++Y  S  D  SMV G+   +R L
Sbjct: 325 EYRAKSLEFPYTAGALVYVRDRDCGRVYLGSDGQPRVQYWPSARDRISMVKGMELGLRAL 384

Query: 482 AAAGATKIGT---CQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQTCTGTIEQM 538
            AAGA  + T   C+        E      N    +++L  ++  G+   +    T  QM
Sbjct: 385 VAAGAQSVMTLHSCRYFTFTPETEANGTLKNSEALEEYLRSVRTEGVQLNRMAVLTAHQM 444

Query: 539 SSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKCILDK 598
            S RMG     S  +P GE W+VE LY+ D+S LPT+TGV  M+T   +A  I+  + ++
Sbjct: 445 GSARMGTSRATSVADPQGECWDVEGLYICDASALPTSTGVNPMVTVEAVAFVIASRLANR 504



>gi|485451292|gb|AGK82825.1| alcohol oxidase [Solanum pennellii]
          Length = 746

 Score =  295 bits (756), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 174/495 (35%), Positives = 262/495 (52%), Gaps = 33/495 (6%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           VLV+EKG +  + +LS  +    D+++  +G M+T D ++++LAGS  GGG+TI WSA +
Sbjct: 253 VLVLEKGSYLARTNLSLLEGPSMDQMFLGNGLMMTKDMDVFLLAGSTVGGGSTINWSASI 312

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +    V +EW   + L  F  + Y  A++ I  ++G           N  L  GC++LG 
Sbjct: 313 DTPSHVLKEWCDIYELELFQSEFYKEALETIREKMGVQDKIDEEGFQNMILRKGCEELGY 372

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNE-AKSNNAKFLKNCYVEKILIDK 303
           + +NIP+N  S  H CGWCS GCK G K+    TWL +  KS N   ++ C   +++ + 
Sbjct: 373 NVENIPRNAHS-NHYCGWCSMGCKDGSKKGTNETWLVDLVKSGNGAIIQECEALEVIHEH 431

Query: 304 DGK--SQKVMGVEVIINNIKRVK----IHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
                  K +GV     +   VK    + +K  +V+ GA+ +P+LL RSGLKN NIG+NL
Sbjct: 432 KNNYNKSKAIGVACEFQHDDGVKEIFMVRSKVTIVACGALSTPSLLKRSGLKNPNIGKNL 491

Query: 358 HVHPIAAVYG---------------VFPNKEIKTYSGTIMSAISNATENVDGENYGAKIV 402
           HVHP+   +G               V+P  + K+Y G IMS +S    N +   YG  I 
Sbjct: 492 HVHPVVFAWGHFPDTDSTDNVKNFEVWPESDKKSYEGGIMSVMSKVVANTEEPGYGVVIQ 551

Query: 403 VGSHHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKL 462
             S HPG      PW S L  K  M +Y+    +  + RD+  G  ++  +    + YKL
Sbjct: 552 TPSLHPGMFSVVMPWISGLDIKMRMCKYSRTAHIFALARDKGSGETVSPYS----ISYKL 607

Query: 463 SQHDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIV-ENGVNPLNDPKFDQFLNKIK 521
            Q D +++  G+   +RILAAAGA +IGT       + V E+ V+     +F+ F+ +  
Sbjct: 608 DQIDEQNIKVGIEKLLRILAAAGAEEIGTHHVKGRKFKVKESSVD-----EFESFVKEES 662

Query: 522 KVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSM 581
             G+    T   +  QM SCRMG DP  S VNP GE WEVE+L++ D+SV PTA GV  M
Sbjct: 663 SRGLKDLSTPICSAHQMGSCRMGIDPKISVVNPKGETWEVEDLFIGDTSVFPTALGVNPM 722

Query: 582 MTTMNIAHYISKCIL 596
           +T   I++  ++ +L
Sbjct: 723 LTVQAISYCTAQNVL 737



>gi|500260062|gb|EOO02770.1| putative long chain fatty acid oxidase protein [Togninia minima
           UCRPA7]
          Length = 741

 Score =  295 bits (756), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 185/622 (29%), Positives = 297/622 (47%), Gaps = 62/622 (9%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADPE- 72
           PFH+     RE     W TS ++ +R + KS + +    +      F  V GYP      
Sbjct: 138 PFHQQPAHVRESILQGWRTSWFSKIRVLAKSVSTIAQLGWIQTAPIFRQVSGYPDVPVGW 197

Query: 73  ANGSRFSSRNFPKYNFLEISDHDSDIK---EFDTXXXXXXXXXXXXXXRLARM-ENVLVI 128
             G  F      +Y+FL+     S      E D                LA     VLV+
Sbjct: 198 KAGPHF------EYSFLQFPGSASPEAVELETDIVIVGSGCGGAVCAKVLAEAGHRVLVV 251

Query: 129 EKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQY 188
           +KG+++    L   Q+ G   LYE  G + + DS++  +AGS +GGG T+ WS  ++ Q 
Sbjct: 252 DKGYYFPPTALPMPQEAGARYLYENQGFVNSADSSIVAVAGSTWGGGGTVNWSVSLQTQG 311

Query: 189 FVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDN 248
           +VR EWA+  GL +F    + +++  +   +G    N+  +   Q +++G KKLG H+  
Sbjct: 312 YVRREWAEEKGLSFFATQAFQDSLDRVCEFMGVRDDNVRQSHRGQVVLDGSKKLGWHAKP 371

Query: 249 IPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQ 308
           +PQN+    H CG C  GC   +KQ   ++WL  A    A+FL+   V+K+L DK  K+ 
Sbjct: 372 LPQNSGGSEHYCGHCHLGCGSSDKQGPAVSWLPAAARAGAEFLEGFQVDKVLFDKSRKAT 431

Query: 309 KVMG----------VEVIINNIKR--VKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRN 356
            V+G          V   ++   R  V I AK+V+V+ G++ SP +LL+SGLKN++IGRN
Sbjct: 432 GVVGKWTSRDGNGSVSGSLDQRTRRHVTIKAKKVIVACGSLWSPIVLLKSGLKNRHIGRN 491

Query: 357 LHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFP 416
           LH+HP                   I+++  ++ EN+DG  +G K+      P  + ANFP
Sbjct: 492 LHLHPWG-----------------IITSYCSSFENIDGHGHGTKLEATCMVPYAVLANFP 534

Query: 417 WKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENG-KPRLEYKLSQHDSKSMVAGLL 475
             S L  K   + Y +    + +TRDR+ G +  D  G +P L+Y  S  D    + G++
Sbjct: 535 CPSGLDFKLSAMRYRHFDAFISLTRDRDSGSVHLDPKGERPILDYTPSAFDRAHSLEGVI 594

Query: 476 TAVRILAAAGATKIGTCQTVIDDYIVENGVNP---------------------LNDPKFD 514
              ++L   GA +I      ++ +I ++   P                     ++DP F 
Sbjct: 595 GLCKLLYITGAVEIRAFLPGVEPFIRKDASTPTSSINEQVTRSDKAMEELDLGISDPAFM 654

Query: 515 QFLNKIKKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPT 574
            +L+ ++ VG         +  QM +CRM        V+  G  W  ++LYVAD+SV P+
Sbjct: 655 AWLDHVRAVGNAPPTAIFISAHQMGTCRMSSHQGDGVVDAKGSVWGTKDLYVADASVFPS 714

Query: 575 ATGVPSMMTTMNIAHYISKCIL 596
           A+GV  M+TTM IA +I++ ++
Sbjct: 715 ASGVNPMVTTMAIADWIARGVV 736



>gi|302885348|ref|XP_003041566.1| hypothetical protein NECHADRAFT_77262 [Nectria haematococca mpVI
           77-13-4]
 gi|256722470|gb|EEU35853.1| hypothetical protein NECHADRAFT_77262 [Nectria haematococca mpVI
           77-13-4]
          Length = 719

 Score =  295 bits (755), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 190/599 (31%), Positives = 296/599 (49%), Gaps = 48/599 (8%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADPEA 73
           PF +L+ K R      W TS  AS R ++K  + +    +      F+ + GYP A    
Sbjct: 138 PFSKLSIKDRTRVLHSWRTSSLASFRVLFKQLSQIAKHIYVRASPLFDEITGYPSAPSGW 197

Query: 74  NGSRFSSRNFPKYNFLEISDHDSDIKEFDTXXXXXXXXXXXXXXRLARM-ENVLVIEKGH 132
           +        F  +N    S H   + E D                +A     V+V++KG+
Sbjct: 198 HPVESYPFEFTDFN---TSRHPIQL-ETDVIVVGSGCGAGVVARAIATAGHRVIVVDKGY 253

Query: 133 HYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVRE 192
           H++   L  +  +G+  L+E SG + ++D ++ V AGS FGGG TI WSA ++ Q  VR+
Sbjct: 254 HFETSSLPLDHSEGFFHLFEQSGMLASEDGSITVTAGSCFGGGGTINWSACLQTQNTVRD 313

Query: 193 EWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQN 252
           EWA   GL +F   E+   +  +   +G +   I HN  N TL+ G +KLG  +  +PQN
Sbjct: 314 EWADERGLTFFNSSEFQAHLDSVCEHMGVSDEFIRHNHGNSTLLEGGRKLGFSAKPVPQN 373

Query: 253 TASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD-GK--SQK 309
           T +  H  G C+ GC  GEKQ     W  +A    AKF++   VE++L  K  GK  ++ 
Sbjct: 374 TGNCEHHDGHCAMGCGRGEKQGPVNGWFPDAAKCGAKFIQGFKVERVLFKKKRGKQVARG 433

Query: 310 VMGVEVIINN----IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAV 365
           V+G     N+     + V I AKRVVVSAG++ SP +L  SGL+                
Sbjct: 434 VIGTWTPKNSKDTTPRVVTIKAKRVVVSAGSLCSPIILKNSGLR---------------- 477

Query: 366 YGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQ 425
                       +G I++++  + +N+DG+ +G K+   S  P        W S L +K 
Sbjct: 478 -----------AAGGILTSVVTSLDNLDGKGHGVKLERVSMIPSMSLPWLNWTSGLDYKL 526

Query: 426 LMLEYNNIVPLMVITRDREGGRILTDEN-GKPRLEYKLSQHDSKSMVAGLLTAVRILAAA 484
           L+ +Y ++   + ITRDR+ G++L D   G PR+ Y  S++D++S + G++   +IL   
Sbjct: 527 LLSKYPHMEIFIAITRDRDSGQVLADPTRGTPRVAYTPSKYDTRSNLTGMIALAKILYVQ 586

Query: 485 GATKIGTCQTVIDDYI--VENGVNPLNDP------KFDQFLNKIKKVGIPTYQTCTGTIE 536
           GA +I      +  +I   E   NP++D       +F  +L +++  G  T +T   +  
Sbjct: 587 GAREIHPALPGLRPFIRAQEGSANPVDDSAGITDGRFQSWLKEMEAHGNKTPETPFCSAH 646

Query: 537 QMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKCI 595
           QMSSCRM    ++  V+  G+ W  E LYVAD+SVLP+A+GV  M+TTM I   I   I
Sbjct: 647 QMSSCRMSAKESEGVVDQFGKVWGCEGLYVADASVLPSASGVNPMVTTMAICERIGTGI 705



>gi|340522029|gb|EGR52262.1| predicted protein [Trichoderma reesei QM6a]
          Length = 739

 Score =  295 bits (754), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 189/611 (30%), Positives = 303/611 (49%), Gaps = 39/611 (6%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLIC-ATFWLNPYNFNPVIGY---PGA 69
           P  +     RE     W+TS+ A++R + KS   L   A    +PY +  + GY   P  
Sbjct: 135 PITQQPASVREAIVKSWTTSRLATLRGLAKSLATLANKANGTTSPY-YKKLSGYSDVPKD 193

Query: 70  DPEANGSRFSSRNFPKYNFLEISDHDSDIKEFDTXXXXXXXXXXXXXXRLARM-ENVLVI 128
                G  F     P  N  ++ D  +D+                    LA     VLV+
Sbjct: 194 WKPVQGFDFKFIKLPPGN--DVHDLTTDV-----VIVGSGPGGAVCAKNLAEAGHKVLVV 246

Query: 129 EKGHHYDQCDLSTEQQDGYDKLYELSGGM-LTDDSNMYVLAGSNFGGGTTIGWSAFMEPQ 187
           +KG+H+    L   Q    + L++  GG  +++D++  + +GS +GGG TI WS   + Q
Sbjct: 247 DKGYHFPPSSLPMPQDAALNYLFDNGGGAYVSEDASTALTSGSCWGGGGTINWSVCFKLQ 306

Query: 188 YFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSD 247
            FVR+EWA   GLP F   ++   +  +   +G  T  + HN  N  L +GCKKLG H+ 
Sbjct: 307 DFVRQEWADE-GLPLFTSRDFDECVDRVWEYIGAGTEAVRHNFRNGVLFDGCKKLGWHAG 365

Query: 248 NIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKS 307
              QNTA+  H CG C  GC  G K+  T++WL  A +  A+F++   VE++L D DG +
Sbjct: 366 IAAQNTANKNHDCGHCHLGCGSGIKRGPTVSWLPAAAAAGAEFMEGLSVERVLFDSDGTT 425

Query: 308 QK-VMGV------------EVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIG 354
              V G             +V     + V I AK+V+V AG+  SP +LL+SG++N  IG
Sbjct: 426 ATGVQGTWLSRDAEGGLDKDVAERTQRNVIIRAKKVIVCAGSFWSPVILLKSGIQNPQIG 485

Query: 355 RNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFAN 414
           +NLH+HP+  +  V   ++ + + G+I+++ S   EN+DG+ +GAK+      P   F+ 
Sbjct: 486 QNLHLHPVNCLMAVH-RQQTRPWEGSIITSWSGEFENLDGKGHGAKLEALCMVPYIAFSL 544

Query: 415 FPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTD-ENGKPRLEYKLSQHDSKSMVAG 473
             W   L  K   ++Y+     + + RDR+ GR+  D E G PR++Y  S  D ++ + G
Sbjct: 545 QGWTGGLDAKLTTMKYHYSSSFISLARDRDSGRVFVDPETGGPRIDYTTSDFDRENNLEG 604

Query: 474 LLTAVRILAAAGATKIGTCQTVIDDYI---------VENGVNPLNDPKFDQFLNKIKKVG 524
           ++   ++   +GAT++      +  ++         V++      DP F ++L +++ +G
Sbjct: 605 IIGLAKVAYVSGATEMRVHYPGVPPFLPNAAEQEKHVQDKDPEFTDPAFAKWLQQLRTMG 664

Query: 525 IPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTT 584
                T  G+  QM +CRM        V+  G  W   NLYVADSSV P+A+GV  M+T 
Sbjct: 665 NKPPLTSFGSAHQMGTCRMSATREAGVVDERGSVWGTSNLYVADSSVFPSASGVNPMVTV 724

Query: 585 MNIAHYISKCI 595
           M IA +IS+ +
Sbjct: 725 MAIADWISRGV 735



>gi|475667686|gb|EMT65475.1| Long-chain-alcohol oxidase FAO2 [Fusarium oxysporum f. sp. cubense
           race 4]
          Length = 751

 Score =  294 bits (753), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 192/627 (30%), Positives = 300/627 (47%), Gaps = 56/627 (8%)

Query: 8   ILSIQKPFHELTQKQREHTFIKWSTS---QYASVRKI-----YKSFTMLICATFWLNPYN 59
           I    +P +      RE     W+TS   +++++ K      +K+++    A + L+ Y+
Sbjct: 136 ITGYWQPIYNQPAHVREAILKSWATSPKERWSTLAKTMSAMSFKAYSQTSSALYELSGYS 195

Query: 60  FNPVIGYPGADPEANGSRFSSRNFPKYNFLEISD-HDSDIKEFDTXXXXXXXXXXXXXXR 118
             P    P               F +Y+FL+I    D+   E D                
Sbjct: 196 DAPKDWQP------------KETF-EYDFLQIEPGDDAHAIETDVVIIGSGCGGGVCAKN 242

Query: 119 LARM-ENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTT 177
           LA     V+V++K +HY    L   Q      LY+ +G  +T+DS   V +GS +GGG T
Sbjct: 243 LAEAGHKVIVVDKAYHYPSTHLPMAQDAACSHLYDNAGFFMTEDSGCTVTSGSAWGGGGT 302

Query: 178 IGWSAFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLIN 237
           + WS  ++PQ FVREEWA   GLP+F   E+   +  +    G  T  I HN  N+ L+N
Sbjct: 303 VNWSVCLKPQDFVREEWADE-GLPFFTSAEFDECLDRVWEFQGAGTDQIRHNHRNRVLLN 361

Query: 238 GCKKLGLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVE 297
           G  KLG  +   P NT    H CG C  GC   EK+   ++WL +A    A+F++   V+
Sbjct: 362 GSSKLGWTARPAPVNTGGREHFCGQCHLGCGLAEKRGPAVSWLPDAAKAGAQFMEGFQVD 421

Query: 298 KILIDKDGKSQKVMGVEVII-------------NNIK-RVKIHAKRVVVSAGAIHSPALL 343
           KIL D DG  Q  +G+E                N IK RV++ AK+V+++AG++ SP +L
Sbjct: 422 KILFDYDG--QTAIGIEGEWVSRDSAGDMSDSNNRIKRRVRVRAKKVILAAGSLWSPIVL 479

Query: 344 LRSGLKNKNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVV 403
             SG+ N N+G NLH+HP   V  V+  +E   + G I+++     +NVDG  YG K+  
Sbjct: 480 KNSGITNPNVGANLHLHPCNFVTAVW-KEETIPWEGGIITSYCPQFDNVDGTGYGTKLET 538

Query: 404 GSHHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKL 462
               P  + +   W S L  K  M +  ++   + +TRDR+ G +  D   G+PR++Y  
Sbjct: 539 TCMVPFTILSQPSWTSGLDAKLHMTKLRHMNAWISLTRDRDAGSVFPDPTTGRPRIDYTP 598

Query: 463 SQHDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVE-----------NG--VNP-L 508
           S  D    + G+    +I    GA +I      ++ ++             NG   +P  
Sbjct: 599 SDFDRAHTIQGVEALAKICYVTGAVEIRPLLKGLEPFVRRGEASSEHSLDSNGSVADPET 658

Query: 509 NDPKFDQFLNKIKKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVAD 568
            DP F  +L+++++VG         +  QM +CRM    ++  V+  G  W  +NLYVAD
Sbjct: 659 TDPAFATWLDRVREVGNKPPTAPWSSAHQMGTCRMSASSDEGVVDEKGRVWGTDNLYVAD 718

Query: 569 SSVLPTATGVPSMMTTMNIAHYISKCI 595
            SV P+A+GV  M+T M IA +IS+ +
Sbjct: 719 GSVFPSASGVNPMITIMAIADWISRGV 745



>gi|6983583|emb|CAB75352.1| long chain fatty alcohol oxidase [Candida cloacae]
          Length = 698

 Score =  294 bits (752), Expect = 7e-77,   Method: Compositional matrix adjust.
 Identities = 179/608 (29%), Positives = 303/608 (49%), Gaps = 22/608 (3%)

Query: 2   SLINSKILSIQKPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFN 61
           +L NS  L       ++   QRE     W  S + + RK+++ +       F     + +
Sbjct: 92  ALTNSTTL-----IRDMDLSQREELLRSWRDSPFTTKRKLFRVYNSFTLNAFSKTATDLH 146

Query: 62  -PVIGYPGADPEANGSRFSSRNFPKYNFLEISDHDSDIKEF-DTXXXXXXXXXXXXXXRL 119
              +GYPG +       +    F +Y FLE    D     F D                 
Sbjct: 147 FKALGYPGRELRTQIQDYEVDPF-RYTFLEKPQQDGQELHFPDIDVLIIGSGSGAGVVAQ 205

Query: 120 ARMEN---VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGT 176
              EN    LV+EKG ++   +L+    +G + L+E  G + + +  ++++AGS FGGG+
Sbjct: 206 TLSENGLKSLVLEKGKYFSNDELTMNDLEGSEALFENGGALSSTNQQIFIIAGSTFGGGS 265

Query: 177 TIGWSAFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLI 236
           T+ WSA ++  + VR+EW  NFGL +     Y + M Y+  ++G +  NI H+ +N  ++
Sbjct: 266 TVNWSACLKTPFKVRKEWYDNFGLDFVATQYYEDCMDYVWKKMGASNENIDHSGANSVIL 325

Query: 237 NGCKKLGLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYV 296
            G KKLG     + QN     H CG C  GC++G KQ +   W      N +KF++   V
Sbjct: 326 EGSKKLGYPHRAVEQNNGGKIHDCGMCHLGCRFGIKQGSVNCWFRGPSENGSKFMQQVLV 385

Query: 297 EKILIDKDGKSQKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRN 356
           +KIL  +DGK+  V+  +V +  +K      K++VV      +   + +SG KNK+IG N
Sbjct: 386 DKIL-QRDGKAVGVLCRDV-VTGVKFKITGPKKIVVFWWFFANSGFVTKSGFKNKHIGAN 443

Query: 357 LHVHPIAAVYGVFPNK-EIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANF 415
           L +HP++   G F N  + + Y   IM++I N  E++DG+ +G +I    + P  +   F
Sbjct: 444 LKLHPVSLTLGDFGNNVDFEAYRKPIMTSICNKVEDLDGKAHGTRIEAMLNAPYGVAPFF 503

Query: 416 PWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPR---LEYKLSQHDSKSMVA 472
           PWKS  + ++ +L Y   VP+++++RD   G +  D+  KP    ++Y L++ D  S++ 
Sbjct: 504 PWKSGAESRKDLLRYKQTVPILLLSRDTTSGSVTYDKQ-KPDALVIDYLLNKFDRNSILQ 562

Query: 473 GLLTAVRILAAAGATKIGTCQTVIDDYIVENG---VNPLNDPKFDQFLNKIKKVGIPTYQ 529
           G L A  +L   GA++      +   +   +       + D  +  +  K+ K+   +Y 
Sbjct: 563 GFLIASDLLYIEGASRDHVTYKLGYQWFKSSKPKHARSIEDEDYVNWRAKVAKIPFDSYG 622

Query: 530 TCTGTIEQMSSCRM-GDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIA 588
           +  G+  QMS+CRM G  P   A +  G+ +E  N+YVAD+S LPTA+G   M++TM+ A
Sbjct: 623 SPYGSAHQMSTCRMSGKGPGYGACDTKGKLFECSNVYVADASTLPTASGANPMVSTMSFA 682

Query: 589 HYISKCIL 596
            ++S  I+
Sbjct: 683 RHVSLGIV 690



>gi|407645686|ref|YP_006809445.1| putative oxidoreductase [Nocardia brasiliensis ATCC 700358]
 gi|504798224|ref|WP_014985326.1| oxidoreductase [Nocardia brasiliensis]
 gi|407308570|gb|AFU02471.1| putative oxidoreductase [Nocardia brasiliensis ATCC 700358]
          Length = 650

 Score =  293 bits (751), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 180/587 (30%), Positives = 287/587 (48%), Gaps = 28/587 (4%)

Query: 15  FHELTQKQREHTFIKWSTSQYASVRKIYKSF--TMLICATFWLNPYNFNPV---IGYPGA 69
           F  L+Q++RE   ++   S+   VR I+++     L+       P   NP+   IGYP  
Sbjct: 77  FSTLSQQEREQALLRLGDSRLGPVRAIFQALKQASLLAYNVTPGPTGTNPLWREIGYPA- 135

Query: 70  DPEANGSRFSSRNFPKYNFLEISDHDSDIKEFDTXXXXXXXXXXXXXXRLARMENVLVIE 129
            P+               + E +    D+    +               L    +V+V+E
Sbjct: 136 -PQGPLGSAPQPALTPLRYTENTTLTCDVVIVGSGAGGGTAAAVLAEAGL----DVIVLE 190

Query: 130 KGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYF 189
           +G++YD  D    +    ++LY  + G  + +  + ++AG+  GGGT + WS  +     
Sbjct: 191 RGNYYDDRDFGAGELAALEQLY--APGASSAEGQITLVAGTCLGGGTVVNWSTSLPTPDT 248

Query: 190 VREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNI 249
           VR EWA   G   F E E+  A+K ++ RL         +  +  L  G + LG     +
Sbjct: 249 VRAEWAA-LGAKQFAEAEFDEALKVVSERLAVTDTRSPLSARDGVLERGAQALGWDVSTL 307

Query: 250 PQNTASIT---HQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGK 306
           P+N         +CG C +GC+ G KQS T TWL +A +  A+ + +  V +I + K+G+
Sbjct: 308 PRNVTDACDAGKECGSCGYGCRVGAKQSVTKTWLADAAAAGARLVVDANVRRIHV-KNGR 366

Query: 307 SQKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVY 366
           ++   GV     +  ++++ A+ VVV+AGA+ +PALL RSGL N+NIGR+L +HP AAV+
Sbjct: 367 AE---GVSATTESGAQIEVRARAVVVTAGAVQTPALLRRSGLGNENIGRHLRLHPAAAVF 423

Query: 367 GVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQL 426
           GVF  +E++ + G +   I     N+DG  YG     G  HPG       W+    H++ 
Sbjct: 424 GVF-EEELRGWEGALQGRICREHANLDGNGYGVLYETGPVHPGLALGFMGWRGADAHRRT 482

Query: 427 MLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGLLTAVRILAAAGA 486
           +L++    P+ VITRDR+ G +  D++G+P + Y+LS +D+  +  G+  A  IL AAGA
Sbjct: 483 LLDFARTTPIGVITRDRDSGTVTVDKSGEPIVNYRLSPYDAAHLHTGIEGAAGILEAAGA 542

Query: 487 TKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQTCTGTIEQMSSCRMGDD 546
            +I +      DY       P       +F    +  G    +   G +  M S RMG  
Sbjct: 543 RRIFSGHQAGVDY------EPGRRGSHAEFAAACRAAGYGPGRCAMGALHIMGSARMGGS 596

Query: 547 PNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISK 593
           P  SA +P G  W+V N+ VAD S  PTA+GV  M++   IAH  +K
Sbjct: 597 PQLSATDPDGATWDVPNVVVADGSCFPTASGVNPMLSIEAIAHMNAK 643



>gi|126139129|ref|XP_001386087.1| long chain fatty acid oxidase [Scheffersomyces stipitis CBS 6054]
 gi|126093369|gb|ABN68058.1| long chain fatty acid oxidase [Scheffersomyces stipitis CBS 6054]
          Length = 699

 Score =  293 bits (751), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 177/593 (29%), Positives = 307/593 (51%), Gaps = 24/593 (4%)

Query: 17  ELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFN-PVIGYPGADPEANG 75
           ++T +QRE     W  S   + R+ ++       +TF     + +   IGYPG +     
Sbjct: 101 DMTVEQREQLLQSWRDSPIVTKRRAFRMVHAAAVSTFARMATDLHLKAIGYPGVETR--- 157

Query: 76  SRFSSRNFP---KYNFL---EISDHDSDIKEFDTXXXXXXXXXXXXXXRLARME-NVLVI 128
            +  +   P   KY+ L   ++  ++  I + D                +A      LV+
Sbjct: 158 EKLYADQVPDTFKYSMLKKPQVDGYELHIPDVDVLIIGSGSGAGVVAHTIAEAGYKALVL 217

Query: 129 EKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQY 188
           EKG ++   + +     GY  LYE  G +++ +  ++VLAGS FGGG+ I WSA ++  +
Sbjct: 218 EKGKYFSSEEFTFNDLTGYQNLYEQQGALVSSNQQLFVLAGSTFGGGSAINWSACLKTPF 277

Query: 189 FVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDN 248
            VR+EW  +FGL +   + +     Y+  ++G N  NI H+ +N+ ++ G  KLG     
Sbjct: 278 KVRKEWYDDFGLEWAASESFDKCTDYVWTQMGANKNNINHSLANKVILEGGAKLGYKVKE 337

Query: 249 IPQNT-ASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKS 307
           + QN  A   H CG+C  GCKYG KQS+   W  E     + F+    V K+L ++ G +
Sbjct: 338 VEQNNGAHADHSCGFCHLGCKYGIKQSSPACWFREPADKGSLFMDQVKVIKVLHNR-GVA 396

Query: 308 QKVMGVEVIINNIKRVKIHA-KRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVY 366
             V+  +++    K+ KI   K+ VVS G++ +P +L  SG +NK+IG NL +HPI+ V+
Sbjct: 397 IGVLCEDILTG--KQFKITGPKKYVVSGGSLCTPVVLQNSGFRNKHIGANLKLHPISIVF 454

Query: 367 GVFPNKEIKT--YSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHK 424
           G F  +E +   +   I++++    +++DG+ +GAKI    + P       PW+++ + +
Sbjct: 455 GNF-GREARADPHEHPILTSVCTEVDDLDGKAHGAKIETVLNAPFLESVFLPWQNSDKLR 513

Query: 425 QLMLEYNNIVPLMVITRDREGGRILTDENGKPRL--EYKLSQHDSKSMVAGLLTAVRILA 482
           + +L+Y N+  +++ITRD+  G +  D N    L  +Y ++Q+D  +++   +T   +L 
Sbjct: 514 EDLLKYQNLATMLLITRDKSSGYVRADSNAPNSLIVDYTVNQYDRNALLQAFVTTADMLY 573

Query: 483 AAGATKIGTCQTVIDDYIVENGVN--PLNDPKFDQFLNKIKKVGIPTYQTCTGTIEQMSS 540
             GA +I   Q  +  +  E   +   + D  F  + N + K+G+ +Y    G+  QMSS
Sbjct: 574 IQGAKEIFGSQAWLPVFKSEKPKHERAITDQDFVDWRNAVLKIGLDSYGNVYGSAHQMSS 633

Query: 541 CRM-GDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYIS 592
           CRM G  P   A +  G  +E +N+YVAD+S +PTA+G   M+TTM IA +++
Sbjct: 634 CRMSGKGPRYGACDENGHLFECKNVYVADASAMPTASGANPMITTMAIARHVA 686



>gi|224129586|ref|XP_002328753.1| predicted protein [Populus trichocarpa]
 gi|222839051|gb|EEE77402.1| predicted protein [Populus trichocarpa]
          Length = 748

 Score =  293 bits (751), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 175/492 (35%), Positives = 262/492 (53%), Gaps = 33/492 (6%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           VLV+EKG+++ + +LS  +    D++Y  +G + +DD  + VLAGS  GGG+TI WSA +
Sbjct: 260 VLVLEKGNYFARNNLSLLEGPSMDQMYLGAGMLASDDMGVVVLAGSTVGGGSTINWSASI 319

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +    V  EW++ + L  F    Y  A+  +  ++G  +       ++  L  GC++LG 
Sbjct: 320 KTPQHVINEWSETYDLELFDSKLYKEALDAVCEKMGVQSDIDEEGFNSAVLRRGCEELGY 379

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNE-AKSNNAKFLKNCYVEKIL--- 300
             + IP+N+    H CGWC FGCK G K+    TWL +   S N   L  C   K+L   
Sbjct: 380 PVNTIPRNSVP-DHYCGWCCFGCKDGRKKGTCETWLKDMVNSGNGAILPGCEAIKVLHER 438

Query: 301 ---IDKDGKSQKVMGVEVIINNIKRV-KIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRN 356
               D+   S    G E   N +K +  + +K  +V+ GA+ +PALL  SGLKN NIG++
Sbjct: 439 KKGKDRSTASGVAFGFEY--NGMKDLCVVESKVTIVAGGALSTPALLKASGLKNANIGKH 496

Query: 357 LHVHPIAAVYGVFPNKEI----------KTYSGTIMSAISNATENVDGENYGAKIVVGSH 406
           LH+HP+   +G FP   I          K+Y G IM+A+S    NV+   YGA I   S 
Sbjct: 497 LHLHPVTMAWGYFPEAPISTTAWPEEQKKSYEGGIMTAMSTVVANVNKSGYGAVIQTPSL 556

Query: 407 HPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHD 466
           HPG      PW S    K+ M  ++    +  + RDR  G +    N    + Y++   D
Sbjct: 557 HPGMFSGLIPWISGADMKRRMCRFSRTAHVFALARDRGSGTV----NSPSSINYRMDAED 612

Query: 467 SKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNK--IKKVG 524
            K++  GL   +RILAAAGA +IGT  +          V  ++  +F++F+ +   + + 
Sbjct: 613 EKNLQEGLEKTLRILAAAGAEEIGTHHSTGKSL----NVKKVSYREFERFVKEESARPLR 668

Query: 525 IPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTT 584
             T Q C+    QM SCRMG +P +SAVN +GEAWEVE L+VAD+SV PTA GV  M+T 
Sbjct: 669 DLTGQICSA--HQMGSCRMGVNPKESAVNQMGEAWEVEGLFVADTSVFPTALGVNPMVTV 726

Query: 585 MNIAHYISKCIL 596
             IA+  ++ ++
Sbjct: 727 QAIAYCTAQSVV 738



>gi|150865867|ref|XP_001385255.2| long chain fatty acid oxidase [Scheffersomyces stipitis CBS 6054]
 gi|149387123|gb|ABN67226.2| long chain fatty acid oxidase [Scheffersomyces stipitis CBS 6054]
          Length = 697

 Score =  293 bits (751), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 191/610 (31%), Positives = 320/610 (52%), Gaps = 28/610 (4%)

Query: 3   LINSKILS-----IQKPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNP 57
           +++S+ILS       K   E+T ++RE     W  S   + RK+Y+S   L  + F    
Sbjct: 83  VLDSRILSPLLTGTTKLIREMTLEEREALIKSWRDSFILAKRKLYRSVHALTISCF---- 138

Query: 58  YNFNPVIGYPGAD-PEANGSRFSSRNFP----KYNFLE-ISDHDSDIKEFDTXXXXXXXX 111
             F+  + +   D PE   S   +        KY+ L+  S  D  +++ D         
Sbjct: 139 VRFSSELHHLAVDFPEREVSESLNDGLVGDTFKYSILDRPSVQDWVLEDIDVVIIGSGSG 198

Query: 112 XXXXXXRLA-RMENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGS 170
                  LA      LV+EKG +Y   +LS    +GY  LYE  G +++ ++ + VLAGS
Sbjct: 199 AGVVAHTLASEGYKSLVLEKGKYYSNDELSFNDDEGYKNLYENGGTVVSSNTQITVLAGS 258

Query: 171 NFGGGTTIGWSAFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQ 230
            FGGG+T+ WSA ++  + VR+EW   FG+ +   ++Y N M Y+  ++G +   I H+ 
Sbjct: 259 TFGGGSTVNWSACLKTTFKVRKEWYDEFGIDWIATEDYDNCMDYVFDKMGASVDGIEHSL 318

Query: 231 SNQTLINGCKKLGLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKF 290
           +NQ +I+G +K G     I QNT +  H CG C  GCK G KQ +   W  +A +   +F
Sbjct: 319 ANQVVIDGAEKCGYKHKTIHQNTGNQKHDCGLCYKGCKSGIKQGSANCWFRDAANKGTQF 378

Query: 291 LKNCYVEKILIDKDGKSQKVMGVEVIINNIKRVKIH-AKRVVVSAGAIHSPALLLRSGLK 349
           L    V K L+ ++GK+  V+  + +    K+ KI  AK+ VVS G++++P +L  SG K
Sbjct: 379 LDQVVVLK-LLHRNGKAVGVLCEDKVTG--KKFKISGAKKYVVSGGSLNTPVILQNSGFK 435

Query: 350 NKNIGRNLHVHPIAAVYGVFPNKEIKT--YSGTIMSAISNATENVDGENYGAKIVVGSHH 407
           NK+IG NL +HP+ A+ G F  +++K+  +   IM+++    +++DG+ +GAK+      
Sbjct: 436 NKHIGSNLKLHPVTAMLGDF-GRDVKSDPFIKPIMTSVCTERDDLDGKAHGAKVETLLAT 494

Query: 408 PGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTD--ENGKPRLEYKLSQH 465
           P      +PW  +   +Q +L Y +I P+++ITRD+  G +  D  + G   ++Y+++  
Sbjct: 495 PYIESIFYPWNGSDGLRQDLLRYQSIAPMLIITRDKSSGTVRADPKKPGSIIIDYEVNVF 554

Query: 466 DSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVE--NGVNPLNDPKFDQFLNKIKKV 523
           D  +++   L A  +L   GA +I   Q     +  +       L D  +  +  K + +
Sbjct: 555 DRNALLQTSLIAADLLYIEGAKEIIGPQFKSPRFKSDKPKEQRTLQDKDYVAWRKKFESI 614

Query: 524 GIPTYQTCTGTIEQMSSCRM-GDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMM 582
               Y T  G+  QMS+CR+ G  P++ A++  G  +E +N+YVAD+SV+PTA+GV  M+
Sbjct: 615 PFDFYATAYGSAHQMSTCRISGKGPSQGALDQHGRLYECKNVYVADASVMPTASGVNPMV 674

Query: 583 TTMNIAHYIS 592
           TTM  A +I+
Sbjct: 675 TTMAFARHIA 684



>gi|346971164|gb|EGY14616.1| long chain fatty alcohol oxidase [Verticillium dahliae VdLs.17]
          Length = 762

 Score =  293 bits (751), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 188/622 (30%), Positives = 304/622 (48%), Gaps = 54/622 (8%)

Query: 12  QKPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLIC-ATFWLNPYNFNPVIGYPGAD 70
           Q+P H      RE     W TS+ +S+R + K FT L   AT   +P  F  + GY   D
Sbjct: 144 QQPLH-----IREAILQGWQTSRLSSMRVLTKVFTTLAQKATLQTSPL-FKELTGY--TD 195

Query: 71  PEANGSRFSSRNFPKYNFLEISDHDSDIK-EFDTXXXXXXXXXXXXXXRLARM-ENVLVI 128
             ++     S  F    F++    D  +  E D                LA     VLV+
Sbjct: 196 LPSDHEPVDSYEF---KFMQFPASDEPVSLETDAVIVGSGCGGAVVAKHLAEAGHRVLVV 252

Query: 129 EKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQY 188
           +K +H+    L   Q  G + L+E  G + +DDS + ++AGS +GGG  I WS  ++ Q 
Sbjct: 253 DKSYHFPAAQLPLAQDMGCEYLFEGGGFLGSDDSCLNLVAGSCWGGGGNINWSVSLQTQG 312

Query: 189 FVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDN 248
           FVR EWAK  GLP+F   ++ + +  ++  +G ++ ++ HN  N+ +++G +KLG H+  
Sbjct: 313 FVRSEWAKK-GLPFFTSAQFQSCLDKVSDVMGVSSDHVRHNHRNRVMLDGARKLGWHAAA 371

Query: 249 IPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDK---DG 305
            PQNT    H CG C  GC    K+   ++WL  A    A+ ++   V ++  D    D 
Sbjct: 372 APQNTGGTEHYCGRCHLGCGSAGKKGTAVSWLPAAAEAGAECIEGLEVNEVTFDTTDGDK 431

Query: 306 KSQKVMGVEVIINN------------IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNI 353
           K+  V+G  V  +              ++V I AK+V+V+ G++ SP +LL+SGL N++I
Sbjct: 432 KATGVVGTWVSRDATGGVSSPSSERITRKVVIKAKKVIVACGSLWSPLVLLKSGLTNRHI 491

Query: 354 GRNLHVHPIAAVYGVFPNKEIKTYSGT----------------IMSAISNATENVDGENY 397
           G+NL+VHP   V G +  +E+  + G                 I+++ S A EN+DG  +
Sbjct: 492 GQNLYVHPCNMV-GAYWKEEVTPWEGKHNQTFGPSLLANQPGGIITSYSTAFENLDGAGH 550

Query: 398 GAKIVVGSHHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTD-ENGKP 456
           G K+      P  +  + PW S L  K   L+Y +    + +TR+R+ G +  D   G+P
Sbjct: 551 GVKLEPTCAVPYTVLTSMPWHSGLSSKLAALKYRHFGGFIALTRERDPGYVYPDPRTGRP 610

Query: 457 RLEYKLSQHDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNP------LND 510
           R+ Y  S  D    + G++   +I    GA +I      ++ ++     N       +ND
Sbjct: 611 RIAYTPSDFDRAHTLEGVVALAKICYIEGAEEIQAFFPGLEPFVRGEARNEEGEEAGVND 670

Query: 511 PKFDQFLNKIKKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSS 570
           P F  +L +++ VG         +  QM +CRM  + ++  V+P G  +  E LYVAD+S
Sbjct: 671 PAFTAWLERVRAVGNKPPNALFTSAHQMGTCRMAANEDEGVVDPRGRVFGTEGLYVADAS 730

Query: 571 VLPTATGVPSMMTTMNIAHYIS 592
           V P+A+GV  M+T M IA +I+
Sbjct: 731 VFPSASGVNPMITNMAIAEWIA 752



>gi|429861106|gb|ELA35812.1| long chain fatty alcohol oxidase [Colletotrichum gloeosporioides
           Nara gc5]
          Length = 735

 Score =  293 bits (751), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 191/619 (30%), Positives = 302/619 (48%), Gaps = 81/619 (13%)

Query: 23  REHTFIKWSTSQYASVRKIYKSFTMLI--CATFWLNPYNFNPVIGYPG-ADPEANGSRFS 79
           RE     W TS+  ++R + KS  +L   CA    +P  F  +  Y    D + +G  F 
Sbjct: 144 RERMLKAWQTSRVPTIRVLSKSLCLLAQKCAVQ-TSPL-FRELTDYTDMPDFQTHGEGFD 201

Query: 80  SRNFPKYNFLEI-SDHDSDIKEFDTXXXXXXXXXXXXXXRLARM-ENVLVIEKGHHYDQC 137
                 +NF++  S     I E D                L+     VLV++K +++   
Sbjct: 202 ------FNFMQFESSASPAIVETDVVIVGSGCGGAVAAKVLSEAGHKVLVVDKSYYFPPS 255

Query: 138 DLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVREEWAKN 197
            L   Q  G   L                     +GGG T+ WS  ++ Q FVR+EW++ 
Sbjct: 256 QLPMTQDTGCQYLC--------------------WGGGGTVNWSVSLQTQGFVRKEWSEQ 295

Query: 198 FGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQNTASIT 257
            GLP+F   ++ N++  +   +G +   I HN  N+ L++G +KLG H+   PQNT    
Sbjct: 296 RGLPFFTSPQFQNSLDKVCDFMGVSADKIKHNHRNKVLLDGSRKLGWHAATAPQNTGGAE 355

Query: 258 HQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQKVMGV---- 313
           H CG C  GC   EKQ  T++WL  A ++ AKF++   VEK+  D+   S++  GV    
Sbjct: 356 HYCGQCHLGCGSTEKQGPTVSWLPAAAASGAKFIEGFEVEKVTFDESTGSKRATGVVGKW 415

Query: 314 -----------EVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPI 362
                       V     ++V I AK+V++SAG++ SP +LLRSGL N++IGRNL+VHP 
Sbjct: 416 ISRDSNGNVSTPVEQRTTRQVIIKAKKVIMSAGSVSSPLVLLRSGLTNRHIGRNLYVHPC 475

Query: 363 AAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQ 422
             V G +  KE     G I+++  +  E++D   +G K+      P  + ++ PW+S L 
Sbjct: 476 NFVGGYW--KE-----GGIITSYCSTFEDLDKAGHGVKLEPTCMIPYAILSSMPWQSGLA 528

Query: 423 HKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAGLLTAVRIL 481
            K   L + +    + +TRDR+ GR+  D   G+PR++Y +S  D  + + G++   +I 
Sbjct: 529 AKMAELRFRHFGAFISLTRDRDPGRVYPDPITGRPRIDYVVSDFDRANTLEGVIALAKIC 588

Query: 482 AAAGATKI-----GTCQTVIDDYIV--------------ENG------VNPLNDPKFDQF 516
              GA++I     G    V +D+                ENG      ++ +NDPKF+ +
Sbjct: 589 YVEGASEIHAFFPGLAPFVKEDHAEPPEKSMADLSSSSHENGLEHDGTLDGVNDPKFNAW 648

Query: 517 LNKIKKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTAT 576
           L +++KVG         +  QM +CRM  + ++  V P G  W  ENL+VAD+SV P+A+
Sbjct: 649 LEEVRKVGNAPPVAIFSSAHQMGTCRMAPNEDEGVVGPKGHVWGTENLFVADASVFPSAS 708

Query: 577 GVPSMMTTMNIAHYISKCI 595
           GV  M+T M IA +I+  I
Sbjct: 709 GVNPMITNMAIADWIAAGI 727



>gi|470107269|ref|XP_004289971.1| PREDICTED: long-chain-alcohol oxidase FAO2-like isoform 2 [Fragaria
           vesca subsp. vesca]
          Length = 743

 Score =  293 bits (750), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 176/502 (35%), Positives = 268/502 (53%), Gaps = 29/502 (5%)

Query: 123 ENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSA 182
           + V+V+EKG+++   D S  +    ++LYE  G M + D  M +LAGS  GGG+ + WSA
Sbjct: 255 QKVVVLEKGNYFVPKDYSLLEGPSMNELYESGGIMASKDGKMMILAGSTVGGGSAVNWSA 314

Query: 183 FMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKL 242
            +     V EEW  +  +P F   +Y +AM  +  R+G        N  NQ L  GC+KL
Sbjct: 315 SIRTPNSVLEEWFVDHKIPLFGSPDYQSAMDAVCKRIGVTDSCTEENMQNQILRKGCEKL 374

Query: 243 GLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILID 302
           GL  D++P+N+ S  H CG C++GC  G+KQ    TWL +A    A  L  C  E+ +++
Sbjct: 375 GLKVDSVPRNS-SADHYCGSCNYGCPTGDKQGTDSTWLVDAVKCGAVILTGCKAERFIME 433

Query: 303 KD---GKSQK-VMGVEVII---NNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGR 355
            D   G S+K  +GV+ I    N  K+++I AK  + + G++ +P L++ SGLKN NIGR
Sbjct: 434 NDHQGGTSRKRCLGVQAISLCKNITKKIQIEAKVTISACGSLLTPPLMITSGLKNPNIGR 493

Query: 356 NLHVHPIAAVYGVFPNKEI----KTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFM 411
           NLH+HP+   +G FP        K + G I++++       D +N  A +   +  P   
Sbjct: 494 NLHLHPVLLAWGNFPEDSSEFKGKAFEGGIITSLHKVVSE-DNQNVRAIVETAALGPASF 552

Query: 412 FANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMV 471
               PW S L  K  + +Y     L  + RD+  G +  +     ++EY+L + D +++ 
Sbjct: 553 ATLVPWVSGLDMKDRVAKYARTAHLFALVRDKGSGEVRAEN----KIEYRLDRSDKENIQ 608

Query: 472 AGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIP----T 527
           AGL  AVRIL AAGA ++GT +      IV  G    +    ++FL+ +  VG P     
Sbjct: 609 AGLRQAVRILIAAGAVEVGTYRN-DGQRIVCKGTKKED---LEEFLDSVIAVGGPRTRGE 664

Query: 528 YQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNI 587
           Y T   T  QM SC+MG    +  V+  GE+WE E L+V D S+LPTA GV  M+T  + 
Sbjct: 665 YWTMYSTAHQMGSCKMGATEKEGGVDENGESWEAEGLFVCDGSLLPTAIGVNPMITIQST 724

Query: 588 AHYISKCILDKKIFTVKKKRGS 609
           A+ +SK I D    ++KK++ S
Sbjct: 725 AYCVSKKIAD----SLKKEKAS 742



>gi|357484415|ref|XP_003612495.1| GMC-type oxidoreductase, putative [Medicago truncatula]
 gi|355513830|gb|AES95453.1| GMC-type oxidoreductase, putative [Medicago truncatula]
          Length = 853

 Score =  293 bits (749), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 172/503 (34%), Positives = 268/503 (53%), Gaps = 33/503 (6%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           VLV+EKG +  + +LS  +    D++Y+  G + TDD N+++L+GS  GGG+ I WSA +
Sbjct: 362 VLVLEKGGYSARNNLSLLEGPTMDQMYQAGGLVATDDMNIFILSGSTVGGGSAINWSACI 421

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +    V +EW +  GL  F  + Y  AM+ +  ++G  +       +N  L  GC+++G 
Sbjct: 422 KTPQHVCKEWCEKHGLELFESELYQEAMEAVCEKMGVQSEIEEEGFNNAILRKGCQEMGY 481

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNE-AKSNNAKFLKNCYVEKILIDK 303
             +NIP+N AS  H CGWC  GCK G+K+  + TWL +  KS N   L  C   K+L  K
Sbjct: 482 PVNNIPRN-ASPDHYCGWCCLGCKDGKKKGTSETWLVDLVKSGNGAILPGCTAMKVLHKK 540

Query: 304 DG----KSQKVMGVEVIINNIKRV-KIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLH 358
                 K+ + +  E      K +  + +K  +V+ G +++P+LL RSGLKN NIGRNLH
Sbjct: 541 KKGSGEKTARGVAFEFEYRGSKDICVVESKVTIVACGTLNTPSLLKRSGLKNNNIGRNLH 600

Query: 359 VHPIAAVYGVFPNKEI--------------KTYSGTIMSAISNATENVDGENYGAKIVVG 404
           +HP+   +G FP+  +              K+Y G IM+A+S      +   YGA I   
Sbjct: 601 LHPVVMAWGYFPDTPVEPTGASEVWPETWKKSYEGGIMTAMSPVVAEFEKSGYGAVIQTP 660

Query: 405 SHHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQ 464
           + HPG      PW S    K  M +++    +  + RD+  G +    +   R+ Y++  
Sbjct: 661 ALHPGTFSIVMPWVSGSDIKDRMRKFSRTAHIFALARDQGSGNV----HSPSRISYEMED 716

Query: 465 HDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVG 524
            D +++  G+   +RILAAAGA +IGT     +   V+N     +  +F+QF+ K     
Sbjct: 717 VDEENLQKGIDKVLRILAAAGAEEIGTHHNKGNTLNVKNA----SYHEFEQFVKKESSRS 772

Query: 525 IPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTT 584
           +    T   +  QM SCRMG +P +S V   GE WEVE+L+VAD+SV PTA G+  M+T 
Sbjct: 773 LTDLSTPLCSAHQMGSCRMGSNPKESVVKETGETWEVEDLFVADASVFPTALGMNPMITV 832

Query: 585 MNIAHYISKCILDKKIFTVKKKR 607
            +IA+  ++ +L      +K+KR
Sbjct: 833 QSIAYCTAQSVLQ----VLKRKR 851



>gi|470107267|ref|XP_004289970.1| PREDICTED: long-chain-alcohol oxidase FAO2-like isoform 1 [Fragaria
           vesca subsp. vesca]
          Length = 743

 Score =  293 bits (749), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 176/502 (35%), Positives = 268/502 (53%), Gaps = 29/502 (5%)

Query: 123 ENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSA 182
           + V+V+EKG+++   D S  +    ++LYE  G M + D  M +LAGS  GGG+ + WSA
Sbjct: 255 QKVVVLEKGNYFVPKDYSLLEGPSMNELYESGGIMASKDGKMMILAGSTVGGGSAVNWSA 314

Query: 183 FMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKL 242
            +     V EEW  +  +P F   +Y +AM  +  R+G        N  NQ L  GC+KL
Sbjct: 315 SIRTPNSVLEEWFVDHKIPLFGSPDYQSAMDAVCKRIGVTDSCTEENMQNQILRKGCEKL 374

Query: 243 GLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILID 302
           GL  D++P+N+ S  H CG C++GC  G+KQ    TWL +A    A  L  C  E+ +++
Sbjct: 375 GLKVDSVPRNS-SADHYCGSCNYGCPTGDKQGTDSTWLVDAVKCGAVILTGCKAERFIME 433

Query: 303 KD---GKSQK-VMGVEVII---NNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGR 355
            D   G S+K  +GV+ I    N  K+++I AK  + + G++ +P L++ SGLKN NIGR
Sbjct: 434 NDHQGGTSRKRCLGVQAISLCKNITKKIQIEAKVTISACGSLLTPPLMITSGLKNPNIGR 493

Query: 356 NLHVHPIAAVYGVFPNKEI----KTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFM 411
           NLH+HP+   +G FP        K + G I++++       D +N  A +   +  P   
Sbjct: 494 NLHLHPVLLAWGNFPEDSSEFKGKAFEGGIITSLHKVVSE-DNQNVRAIVETAALGPASF 552

Query: 412 FANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMV 471
               PW S L  K  + +Y     L  + RD+  G +  +     ++EY+L + D +++ 
Sbjct: 553 ATLVPWVSGLDMKDRVAKYARTAHLFALVRDKGSGEVRAEN----KIEYRLDRSDKENIQ 608

Query: 472 AGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIP----T 527
           AGL  AVRIL AAGA ++GT +      IV  G    +    ++FL+ +  VG P     
Sbjct: 609 AGLRQAVRILIAAGAVEVGTYRN-DGQRIVCKGTKKED---LEEFLDSVIAVGGPRTRGE 664

Query: 528 YQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNI 587
           Y T   T  QM SC+MG    +  V+  GE+WE E L+V D S+LPTA GV  M+T  + 
Sbjct: 665 YWTMYSTAHQMGSCKMGATEKEGGVDENGESWEAEGLFVCDGSLLPTAIGVNPMITIQST 724

Query: 588 AHYISKCILDKKIFTVKKKRGS 609
           A+ +SK I D    ++KK++ S
Sbjct: 725 AYCVSKKIAD----SLKKEKAS 742



>gi|477512030|gb|ENH64591.1| Long-chain-alcohol oxidase FAO2 [Fusarium oxysporum f. sp. cubense
           race 1]
          Length = 751

 Score =  292 bits (748), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 188/627 (29%), Positives = 296/627 (47%), Gaps = 56/627 (8%)

Query: 8   ILSIQKPFHELTQKQREHTFIKWSTS---QYASVRKI-----YKSFTMLICATFWLNPYN 59
           I    +P +      RE     W+TS   +++++ K      +K+++    A + L+ Y+
Sbjct: 136 ITGYWQPIYNQPAHVREAILKSWATSPKERWSTLAKTMSAMSFKAYSQTSSALYQLSGYS 195

Query: 60  FNPVIGYPGADPEANGSRFSSRNFPKYNFLEISD-HDSDIKEFDTXXXXXXXXXXXXXXR 118
             P               +  +   +Y+FL+I    D+   E D                
Sbjct: 196 DAP-------------KDWQPKETFEYDFLQIEPGDDAHAIETDVVIIGSGCGGGVCAKN 242

Query: 119 LARM-ENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTT 177
           LA     V+V++K +HY    L   Q      LY+ +G  +T+DS   V +GS +GGG T
Sbjct: 243 LAEAGHKVIVVDKAYHYPSTHLPMAQDAACAHLYDNAGFFMTEDSGCTVTSGSAWGGGGT 302

Query: 178 IGWSAFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLIN 237
           + WS  ++PQ FVREEWA   GLP+F   E+   +  +    G  T  I HN  N+ L+N
Sbjct: 303 VNWSVCLKPQDFVREEWADE-GLPFFTSAEFDECLDRVWEFQGAGTDQIRHNHRNRVLLN 361

Query: 238 GCKKLGLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVE 297
           G  KLG  +   P NT    H CG C  GC   EK+   ++WL +A    A+F++   V+
Sbjct: 362 GSSKLGWTARPAPVNTGGREHFCGQCHLGCGLAEKRGPAVSWLPDAAKAGAQFMEGFQVD 421

Query: 298 KILIDKDGKSQKVMGVEVII-------------NNIK-RVKIHAKRVVVSAGAIHSPALL 343
           KIL D DG  Q  +G+E                N IK RV + AK+VV++AG++ SP +L
Sbjct: 422 KILFDYDG--QTAIGIEGEWVSRDSAGDMSDSNNRIKRRVIVRAKKVVLAAGSLWSPIVL 479

Query: 344 LRSGLKNKNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVV 403
             SG+ N N+G NLH+HP   V  V+  +E   + G I+++     +NVDG  YG K+  
Sbjct: 480 KNSGITNPNVGANLHLHPCNFVTAVW-KEETIPWEGGIITSYCPQFDNVDGSGYGTKLET 538

Query: 404 GSHHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKL 462
               P  + +   W S L  K  M +  ++   + +TRDR+ G +  D   G+PR++Y  
Sbjct: 539 TCMVPFTILSQPSWTSGLDAKLHMTKLRHMNAWISLTRDRDAGSVFPDPTTGRPRIDYTP 598

Query: 463 SQHDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNP--------------L 508
           S  D    + G+    +I    GA +I      ++ ++     +                
Sbjct: 599 SDFDRAHTIQGVEALAKICYVTGAVEIRPLLKGLEPFVRRGEASSEHSLDSKGSVADPET 658

Query: 509 NDPKFDQFLNKIKKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVAD 568
            DP F  +L+++++VG         +  QM +CRM    ++  V+  G  W  +NLYVAD
Sbjct: 659 TDPAFAAWLDRVREVGNKPPTAPWSSAHQMGTCRMSASSDEGVVDEKGRVWGTDNLYVAD 718

Query: 569 SSVLPTATGVPSMMTTMNIAHYISKCI 595
            SV P+A+GV  M+T M IA +IS+ +
Sbjct: 719 GSVFPSASGVNPMITIMAIADWISRGV 745



>gi|361129891|gb|EHL01767.1| putative Long-chain-alcohol oxidase FAO2 [Glarea lozoyensis 74030]
          Length = 721

 Score =  292 bits (747), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 185/602 (30%), Positives = 295/602 (49%), Gaps = 45/602 (7%)

Query: 15  FHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPY-NFNPVIGYPGADPEA 73
           FH+     RE     W  S   ++  +YK   M+I    WLN   +F  ++G PG     
Sbjct: 137 FHDQPIHIREAILESWRVSYLPTLNLVYKQM-MVIAKNVWLNTSPSFRELVGIPGGPDHV 195

Query: 74  NGSRFSSRNFPKYNFLEISDHDSDIKEFDTXXXXXXXXXXXXXXRLARM-ENVLVIEKGH 132
              +    +F ++N    S    +I E D                +A     VLV++K +
Sbjct: 196 KLEKPFENDFLQFN----SGTAPEIVETDVVIVGSGCGGGVCAKNIAEAGHRVLVVDKAY 251

Query: 133 HYDQCDLSTEQQDGYDKLYELSGGMLT-DDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVR 191
           H     L   +Q+G  KL+E  G MLT DD ++ V AGS +GGG TI WSA ++PQ FVR
Sbjct: 252 HIPAAQLPLSEQNGLRKLFE-GGAMLTSDDGSIAVAAGSAWGGGGTINWSASLQPQEFVR 310

Query: 192 EEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQ 251
            EW+++ GL  F   E+ + +  +   +                  G +KLG  +  +PQ
Sbjct: 311 REWSQDKGLEVFESAEFQDCLDTVCKHM-----------------EGSRKLGFSAKAVPQ 353

Query: 252 NTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQKVM 311
           NT    H CG C+ GC   EKQ   + WL +A    A+ ++   V+ ++ D+D  + K  
Sbjct: 354 NTGGKEHYCGHCTLGCGSSEKQGPAVAWLPDAVRAGAQMVEGFRVDHVIFDEDDPT-KAT 412

Query: 312 GVEVIIN-------------NIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLH 358
           GV+ +                 + V + AK+V++S+G + SP +L  SGL+N +IGRNLH
Sbjct: 413 GVKGLWTARDDTGEFDSEGRTTREVIVKAKKVIISSGTLWSPIILQNSGLRNYHIGRNLH 472

Query: 359 VHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWK 418
           +HP+  +  +FP    + + G I++++    EN+DG  +GAK+      P      FPW 
Sbjct: 473 LHPVNMLSAIFPTS-TRPWEGGILTSVCTTFENLDGLGHGAKLETTVMLPSMFLVGFPWY 531

Query: 419 SNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAGLLTA 477
           S LQ K+  L++ N+   + I RDR+ GR+  D   G PR++Y  S  D K ++ G++  
Sbjct: 532 SGLQFKRNALKFRNMNGFISIARDRDTGRVYPDPTTGTPRVKYTPSVFDRKHILEGVIGL 591

Query: 478 VRILAAAGATKIGTCQTVIDDYIVENGVNP---LNDPKFDQFLNKIKKVGIPTYQTCTGT 534
            +I    GA +I    +    +I +   NP   + DP F  ++ + ++ G     T   +
Sbjct: 592 AKIAYIQGAVEIHPFTSAGRPFIRDPNANPGAGITDPHFQNWIKEFREGGNKPPATSFSS 651

Query: 535 IEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKC 594
             QM +CRM     +  V+  G  W  + LYVAD+SV P+A+GV  M+T M +A +IS+ 
Sbjct: 652 AHQMGTCRMSRTEAEGVVDDKGRVWGCKGLYVADASVFPSASGVNPMVTNMAVAEWISRG 711

Query: 595 IL 596
           ++
Sbjct: 712 VV 713



>gi|356531545|ref|XP_003534338.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
          Length = 748

 Score =  292 bits (747), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 175/499 (35%), Positives = 273/499 (54%), Gaps = 30/499 (6%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGML-TDDSNMYVLAGSNFGGGTTIGWSAF 183
           VLV+EKG +  + +LS  +    D++Y L+GG++ +DD  +++L+GS  GGG+ I WSA 
Sbjct: 262 VLVLEKGGYSAKNNLSLLEGPTMDQMY-LNGGLVASDDMGVFILSGSTVGGGSAINWSAC 320

Query: 184 MEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLG 243
           ++    V +EW    GL  F  + Y  A+  +  ++G  +       +N  L  GC+++G
Sbjct: 321 IKTPQHVCKEWCDKHGLELFESELYREALDAVCGKMGVQSEIEDEGFNNAILRKGCQEMG 380

Query: 244 LHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNE-AKSNNAKFLKNCYVEKIL-I 301
              +NIP+N+ S  H CGWC  GCK G K+  + TWL +  KS N   L  C   K+L  
Sbjct: 381 YPVNNIPRNSPS-NHYCGWCCMGCKDGRKKGTSETWLVDLVKSGNGAILPGCEAIKVLHK 439

Query: 302 DKDGKSQKV---MGVEVIINNIKRV-KIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
            K+GK +K+   +  E      K V  + +K  +V+ GA+ +PALL RSGL+N+NIG+NL
Sbjct: 440 KKEGKDRKIARGVAFEFEYKGTKDVCVVESKVTIVACGALSTPALLKRSGLRNQNIGKNL 499

Query: 358 HVHPIAAVYGVFPN---KEI------KTYSGTIMSAISNATENVDGENYGAKIVVGSHHP 408
           H+HP+   +G FP+    E+      K+Y G IM+A+S      +   YGA I   S HP
Sbjct: 500 HLHPVVMAWGYFPDAPESEVWPEAYKKSYEGGIMTAMSTVVAEFEQSGYGAVIQTPSLHP 559

Query: 409 GFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSK 468
           G      PW S +  +  M +++    +  + RD+  G +   +    R+ YK +  D +
Sbjct: 560 GMFSIVTPWTSGIDIRDRMRKFSRTAHIFALARDQGSGTVKAPD----RISYKPADVDEE 615

Query: 469 SMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTY 528
           ++  G+   +RILAAAGA +IGT         V+     ++  +F++F+ +     +   
Sbjct: 616 NLKKGIEKVLRILAAAGAEEIGTHHNKGRTLNVKQ----VSYHEFEKFVKEESSRSLTDL 671

Query: 529 QTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIA 588
            T   +  QM SCRMG +P +S VNP GE WEVE LYVAD+SV PTA GV  M+T   IA
Sbjct: 672 TTPLCSAHQMGSCRMGSNPKQSVVNPTGETWEVEGLYVADASVFPTALGVNPMVTVQAIA 731

Query: 589 HYISKCILDKKIFTVKKKR 607
           +  ++ +++     +K+KR
Sbjct: 732 YCTAQSVVE----VLKRKR 746



>gi|342865970|gb|EGU71971.1| hypothetical protein FOXB_17532 [Fusarium oxysporum Fo5176]
          Length = 751

 Score =  292 bits (747), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 187/627 (29%), Positives = 296/627 (47%), Gaps = 56/627 (8%)

Query: 8   ILSIQKPFHELTQKQREHTFIKWSTS---QYASVRKI-----YKSFTMLICATFWLNPYN 59
           I    +P +      RE     W+TS   +++++ K      +K+++    A + L+ Y+
Sbjct: 136 ITGYWQPIYNQPAHVREAILKSWATSPKERWSTLAKTMSAMSFKAYSQTSSALYQLSGYS 195

Query: 60  FNPVIGYPGADPEANGSRFSSRNFPKYNFLEISD-HDSDIKEFDTXXXXXXXXXXXXXXR 118
             P               +  +   +Y+FL+I    D+   E D                
Sbjct: 196 DAP-------------KDWQPKETFEYDFLQIEPGDDAHAIETDVVIIGSGCGGGVCAKN 242

Query: 119 LARM-ENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTT 177
           LA     V+V++K +HY    L   Q      LY+ +G  +T+DS   V +GS +GGG T
Sbjct: 243 LAEAGHKVIVVDKAYHYPSTHLPMAQDAACAHLYDNAGFFMTEDSGCTVTSGSAWGGGGT 302

Query: 178 IGWSAFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLIN 237
           + WS  ++PQ FVREEWA   GLP+F   E+   +  +    G  T  I HN  N+ L+N
Sbjct: 303 VNWSVCLKPQDFVREEWADE-GLPFFTSAEFDECLDRVWEFQGAGTDQIRHNHRNRVLLN 361

Query: 238 GCKKLGLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVE 297
           G  KLG  +   P NT    H CG C  GC   EK+   ++WL +A    A+F++   V+
Sbjct: 362 GSSKLGWTARPAPVNTGGREHFCGQCHLGCGLAEKRGPAVSWLPDAAKAGAQFMEGFQVD 421

Query: 298 KILIDKDGKSQKVMGVEVII-------------NNIK-RVKIHAKRVVVSAGAIHSPALL 343
           KIL D DG  Q  +G+E                N IK RV + AK+V+++AG++ SP +L
Sbjct: 422 KILFDYDG--QTAIGIEGEWVSRDSAGDMSDSNNRIKRRVIVRAKKVILAAGSLWSPIVL 479

Query: 344 LRSGLKNKNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVV 403
             SG+ N N+G NLH+HP   V  V+  +E   + G I+++     +NVDG  YG K+  
Sbjct: 480 KNSGITNPNVGANLHLHPCNFVTAVW-KEETIPWEGGIITSYCPQFDNVDGSGYGTKLET 538

Query: 404 GSHHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKL 462
               P  + +   W S L  K  M +  ++   + +TRDR+ G +  D   G+PR++Y  
Sbjct: 539 TCMVPFTILSQPSWTSGLDAKLHMTKLRHMNAWISLTRDRDAGSVFPDPTTGRPRIDYTP 598

Query: 463 SQHDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNP--------------L 508
           S  D    + G+    +I    GA +I      ++ ++     +                
Sbjct: 599 SDFDRAHTIQGVEALAKICYVTGAVEIRPLLKGLEPFVRRGEASSEHSLDSKGSVADPET 658

Query: 509 NDPKFDQFLNKIKKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVAD 568
            DP F  +L+++++VG         +  QM +CRM    ++  V+  G  W  +NLYVAD
Sbjct: 659 TDPAFAAWLDRVREVGNKPPTAPWSSAHQMGTCRMSASSDEGVVDEKGRVWGTDNLYVAD 718

Query: 569 SSVLPTATGVPSMMTTMNIAHYISKCI 595
            SV P+A+GV  M+T M IA +IS+ +
Sbjct: 719 GSVFPSASGVNPMITIMAIADWISRGV 745



>gi|354546071|emb|CCE42800.1| hypothetical protein CPAR2_204430 [Candida parapsilosis]
          Length = 704

 Score =  291 bits (746), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 159/481 (33%), Positives = 271/481 (56%), Gaps = 13/481 (2%)

Query: 126 LVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFME 185
           LV+EKG +Y   + +    +G   LY+ SG + + +S + +LAGSNFGGGTT+ WSA  +
Sbjct: 220 LVLEKGKYYSPSEFNFTDNEGLKALYQSSGTLASTNSQISILAGSNFGGGTTVNWSASFK 279

Query: 186 PQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLH 245
             + VR+EW   +GL +   D Y    +Y+  ++G +T  I H+  NQ +++GC  LG  
Sbjct: 280 TPFKVRKEWYDEYGLNFAATDSYDKCQEYVFKQMGASTKGIKHSFGNQVIMSGCDTLGYS 339

Query: 246 SDNIPQNTAS-ITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD 304
           +  I QN+     HQCG+C  GCK+G KQ + + W   A +  +KF+    V + L  +D
Sbjct: 340 AKEINQNSGGHPAHQCGFCYLGCKHGIKQGSAVNWFRAAAATGSKFMDQVRVLQTL-HRD 398

Query: 305 GKSQKVMGVEVIINNIKRVKIHA-KRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIA 363
           G +  ++  +      ++ KI   K+ VV+ G++++P +L  SG KNK+IG+NL +HP  
Sbjct: 399 GVATSLLCQDQATG--RKFKISGPKKFVVAGGSLNTPVVLQNSGFKNKHIGKNLKLHPAI 456

Query: 364 AVYGVFPNK-EIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQ 422
            V+G F ++ +   +  +IM+A+    +++DG+ +GAKI    + P    A  PW+ + +
Sbjct: 457 TVFGDFGSEVQADHHKNSIMTAVCTQIDDLDGKAHGAKIETILNAPFIQAALLPWRGSDE 516

Query: 423 HKQLMLEYNNIVPLMVITRDREGGRILTDENGKPR---LEYKLSQHDSKSMVAGLLTAVR 479
            ++ +L+YN +  ++VI RD   G +  D   +P    ++Y +++ D   ++ GLL    
Sbjct: 517 IRKDLLKYNQLFGMIVIARDTSNGSVAGDPQ-RPESLYIDYSVNKFDRNVLLQGLLVTAD 575

Query: 480 ILAAAGATKIGTCQTVIDDY--IVENGVNPLNDPKFDQFLNKIKKVGIPTYQTCTGTIEQ 537
           IL   GA +I + Q+ I  +   V      + D  + ++  K+ K  + +Y    G+  Q
Sbjct: 576 ILYIEGAERILSPQSSIPVFESKVSKDKRSITDRDYVEWREKVAKTPLDSYGVPYGSAHQ 635

Query: 538 MSSCRM-GDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKCIL 596
           MSSCRM G  P   A +  G+ +E  N+Y+AD+S +PTA+GV  M+TTM++A ++  C+ 
Sbjct: 636 MSSCRMSGKGPKYGACDTKGKLFEASNIYIADASCMPTASGVNPMVTTMSVARHVGLCLC 695

Query: 597 D 597
           D
Sbjct: 696 D 696



>gi|346324797|gb|EGX94394.1| long chain fatty alcohol oxidase [Cordyceps militaris CM01]
          Length = 784

 Score =  291 bits (746), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 188/611 (30%), Positives = 298/611 (48%), Gaps = 42/611 (6%)

Query: 15  FHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADPEAN 74
           FH      R+     W +S+   +R + KS   L   +   +      + G+     E  
Sbjct: 161 FHRQPLAVRQQILKNWRSSRLLPLRIVLKSMNALTRKSLGASSRFIRELGGF-----EEL 215

Query: 75  GSRFSSRNFPKYNFLEISDHDSD-IKEFDTXXXXXXXXXXXXXXRLARM-ENVLVIEKGH 132
              ++ +    + FL+I D  S    E D                LA     VLV +KG+
Sbjct: 216 PKNWALKQGYDFQFLQIPDGTSKHTIETDVIIVGSGCGGGVAAKNLAEAGHRVLVADKGY 275

Query: 133 HYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVRE 192
           H+        Q  G   +YE +G +++  S + V AG  +GGG T+ WS  ++PQ +VR 
Sbjct: 276 HFGPESFPLTQV-GNKHIYENNGLVISKSSAISVAAGETWGGGGTVNWSVCLKPQDYVRR 334

Query: 193 EWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQN 252
           EW    GLP F   E+ + +  + + +G     + HN  N+ +++G +KLG HS    QN
Sbjct: 335 EWVAA-GLPLFGSAEFDDCIDRVWSAIGAGQATVRHNHQNEVVLDGSRKLGWHSSVCDQN 393

Query: 253 TASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQKVMG 312
           T  + H CG C  GC   EK+   + +L +A    A+F++   VE+++   DG +    G
Sbjct: 394 TGGVEHYCGRCHLGCGSNEKRGPAVAFLPDAAEAGAEFIEGFRVERVVFAADGVT--ATG 451

Query: 313 VEVI---------------INNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
           VE +                   +RV I AK+VVVSAG++ SPALL +SG+KN  IGRNL
Sbjct: 452 VEGVWTARSDDGTVHSAPETRRQRRVLIKAKKVVVSAGSLWSPALLQKSGVKNPQIGRNL 511

Query: 358 HVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPW 417
           H+HP A + G F N+    + G I++A +   +N+D + +G K+   +  P  +FA  P+
Sbjct: 512 HLHPAAFLVGHF-NEAEPQWEGGIITAYNGEFQNLDKKGHGVKLETMAMLPYVLFAIQPF 570

Query: 418 KSNLQHKQLMLEYNNIVPLMVITRDREGGRILTD-ENGKPRLEYKLSQHDSKSMVAGLLT 476
           +S L  K  +     +  ++ ITRDR+ GRI  D   G P ++Y +S  D++  + G+  
Sbjct: 571 ESGLDSKLCVARMKQLHTVISITRDRDTGRITADPATGAPVIDYDVSAFDAEHSLDGIEA 630

Query: 477 AVRILAAAGATKIGTCQTVIDDYIV------------ENGVNP-LNDPKFDQFLNKIKKV 523
             +++   GA+ +      +  ++V            + G +P   DP F  +L  ++ V
Sbjct: 631 IAKLMYVMGASALYPTIPNVRPFVVARDGDPVLQAGYQEGTDPEFTDPHFAAWLKHLRAV 690

Query: 524 GIPT-YQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMM 582
           G     +    +  QM SCRM   P+  AV+P G+ W  ENLYVAD SV P+A+GV  M+
Sbjct: 691 GGKAGGEISYLSAHQMGSCRMSAKPSGGAVDPKGKVWGCENLYVADGSVFPSASGVNPMV 750

Query: 583 TTMNIAHYISK 593
           T + IA YIS+
Sbjct: 751 TILAIADYISR 761



>gi|302754194|ref|XP_002960521.1| hypothetical protein SELMODRAFT_74601 [Selaginella moellendorffii]
 gi|300171460|gb|EFJ38060.1| hypothetical protein SELMODRAFT_74601 [Selaginella moellendorffii]
          Length = 724

 Score =  291 bits (746), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 174/485 (35%), Positives = 255/485 (52%), Gaps = 16/485 (3%)

Query: 118 RLARME-NVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGT 176
           RLA+    V+V+EKG ++ +  LS  +      +YE SG + T+D ++ +LAG+  GGG+
Sbjct: 230 RLAQQGFKVVVLEKGGYFPRRGLSLLEGPSMKAMYEQSGALTTEDGSVILLAGTTLGGGS 289

Query: 177 TIGWSAFMEPQYFVREEWAKNFGLP-YFMEDEYGNAMKYINARLGTNTINIIHNQSNQTL 235
            + W+A ++    V +EW  + GL   F   EY +AM+ +  RLG   +    +  N+ L
Sbjct: 290 AVNWAASLKTPKHVLDEWT-SLGLEDRFGGPEYQHAMEAVCQRLGVQDVCTEESFQNRVL 348

Query: 236 INGCKKLGLHSDNIPQNTASITHQCGWCSFGCKYG---EKQSATMTWLNEAKSNNAKFLK 292
             GC K G    +IP+N A   H CG+C FGC       KQSA  TWL +A +  A  + 
Sbjct: 349 RRGCTKKGYSVGDIPRNAAR-DHGCGFCGFGCPAAAAVRKQSACDTWLCDAATAGAVVVT 407

Query: 293 NCYVEKILIDKDG----KSQKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGL 348
            C V++IL    G    +S +  G+        R  + ++  V + GA+ +P LL RSG 
Sbjct: 408 GCRVDRILTAPQGGQGERSYRARGISSRAGE-ARFYVESRVTVAACGALFTPPLLRRSGG 466

Query: 349 KNKNIGRNLHVHPIAAVYGVFPNKEI---KTYSGTIMSAISNATENVDGENYGAKIVVGS 405
           +N +IGR+L VHP+ A +G FP ++I    +Y+G IM+A S+     D   YG+ +    
Sbjct: 467 RNPHIGRHLSVHPVVAAWGYFPREDILPGNSYTGGIMTAFSSEAARWDTTGYGSILETPC 526

Query: 406 HHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQH 465
            HPG      PW+S +  K+ ML +     ++V+ RDR  G +     GK  LEY L   
Sbjct: 527 VHPGNYAVLAPWRSGVDAKRQMLRFPRTATIIVLNRDRGRGTVDETPGGKLILEYPLCFS 586

Query: 466 DSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPK-FDQFLNKIKKVG 524
           D +S+V G   AVR L AAGA  +G      + + V+    PL   K  + FL ++    
Sbjct: 587 DRESLVEGTELAVRALVAAGAEAVGLHSVAGEIFSVDQSWTPLQREKELEIFLKRVLGRM 646

Query: 525 IPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTT 584
                T   +  QM SCRMG D   S V+P  E+WEVE L+V D SVLPTA+GV  M+T 
Sbjct: 647 FQRLSTPIISAHQMGSCRMGTDQRCSVVDPNCESWEVEGLFVGDGSVLPTASGVNPMITI 706

Query: 585 MNIAH 589
            +IAH
Sbjct: 707 QSIAH 711



>gi|448090831|ref|XP_004197171.1| Piso0_004410 [Millerozyma farinosa CBS 7064]
 gi|448095270|ref|XP_004198202.1| Piso0_004410 [Millerozyma farinosa CBS 7064]
 gi|359378593|emb|CCE84852.1| Piso0_004410 [Millerozyma farinosa CBS 7064]
 gi|359379624|emb|CCE83821.1| Piso0_004410 [Millerozyma farinosa CBS 7064]
          Length = 698

 Score =  291 bits (745), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 186/612 (30%), Positives = 313/612 (51%), Gaps = 31/612 (5%)

Query: 3   LINSKILSIQKPF-------HELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWL 55
           +++S++LS   PF        E++ K+ E T   W  S  A  R+++     L  ++F  
Sbjct: 83  VLDSRVLS--PPFTGSLKLIREMSDKEVEATLKAWKDSPIALKRRLFILVRTLTFSSFVR 140

Query: 56  NPYNF-NPVIGYPGADPEANGSRFSSRNFPKYNF-LEISD------HDSDIKEFDTXXXX 107
              N  N  IGYP    E   S +   N+ + NF  +++D      H+  +   D     
Sbjct: 141 LTSNLHNEAIGYPAV--EKRESLY--ENYQEDNFTYKMADKPSEEGHELYMPNIDVLVIG 196

Query: 108 XXXXXXXXXXRLARM-ENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYV 166
                      LA      LV+EKG ++   +L+ +  +G   LYE +G   +    + V
Sbjct: 197 SGCGAGAVVQTLAESGHTCLVLEKGKYFKNSELNFDDYEGLSNLYERNGAFASSSQEIVV 256

Query: 167 LAGSNFGGGTTIGWSAFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINI 226
           LAGSNFGGG+TI WSA +   + VR+EW  ++GL +   D +   ++Y+  ++G +   +
Sbjct: 257 LAGSNFGGGSTINWSACLPTPFKVRKEWYDDYGLEWAATDLFDECLQYVWKQIGASLDGV 316

Query: 227 IHNQSNQTLINGCKKLGLHSDNIPQNTAS-ITHQCGWCSFGCKYGEKQSATMTWLNEAKS 285
            H+ SNQ L+ G KKLG  +  I QN  +   H CG+C  GCKYG KQ  T  W  EA  
Sbjct: 317 KHSFSNQVLLEGSKKLGYRAKEIAQNNGNHENHSCGFCYLGCKYGIKQGCTSCWFREAAE 376

Query: 286 NNAKFLKNCYVEKILIDKDGKSQKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLR 345
             ++F+    V ++   K GK+  V+  + I N +K      K+ VV  G++++P LL +
Sbjct: 377 KGSQFMDQVRVLRV-NHKGGKAVSVL-CQNIENGVKFTIKGPKKFVVCGGSLNTPILLQQ 434

Query: 346 SGLKNKNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGS 405
           SG KNK+IG NL +HP   ++G F  K    ++  +++++    +++DG+ +GAKI    
Sbjct: 435 SGFKNKHIGSNLKLHPSTVLFGDF-GKNTNPFNEALLTSVVTEVDDLDGKAHGAKIETIV 493

Query: 406 HHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDEN--GKPRLEYKLS 463
           H P      +PW S+ Q ++ +L YN +  +++ITRD   G +  D    G  +++Y ++
Sbjct: 494 HAPFLEATYYPWHSSTQMRKDILRYNKLSAMLIITRDTSSGAVHGDPEKIGAIKVDYSVN 553

Query: 464 QHDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVN--PLNDPKFDQFLNKIK 521
             D ++    +L A  IL   G  +I   +  I  +      +   L+D  + ++ + + 
Sbjct: 554 SFDRRAAQEAILKAADILYIEGVKEIIHPEPSIPTFKSNKPKDERSLDDEDYRKWHDVLD 613

Query: 522 KVGIPTYQTCTGTIEQMSSCRM-GDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPS 580
           K     Y +  G+  QMSSCRM G  P+  A +  G  +E +NL+VAD+S++PTA+GV  
Sbjct: 614 KSNFKLYGSIFGSAHQMSSCRMSGKGPSYGACDTKGRLFECKNLFVADASLMPTASGVNP 673

Query: 581 MMTTMNIAHYIS 592
           M+T + +A +++
Sbjct: 674 MITVLTMARFVA 685



>gi|358385534|gb|EHK23131.1| hypothetical protein TRIVIDRAFT_53801 [Trichoderma virens Gv29-8]
          Length = 755

 Score =  291 bits (744), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 187/611 (30%), Positives = 308/611 (50%), Gaps = 40/611 (6%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADPEA 73
           PF+  +   R      W TS++AS++ ++K  T+L   T+         +IGYP   P+ 
Sbjct: 137 PFYLQSIANRTSILNAWRTSRFASLQVLFKQMTLLGKNTWIKTSPTVYRMIGYPEVPPDH 196

Query: 74  N-GSRFSSRNFPKYNFLEISDHDSDIKEFDTXXXXXXXX--XXXXXXRLARM-ENVLVIE 129
             G+++      ++ FL++    SD     T                 LA    +VLV++
Sbjct: 197 QPGNQY------EFQFLQLPP-GSDTANITTEILIIGSGCGAGVCAKNLAESGHSVLVVD 249

Query: 130 KGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYF 189
           K +H+        +  G+ +L+E  G + +DD ++ V+AG+ +GGG TI WS  ++ Q F
Sbjct: 250 KSYHFTSSYFPMSESTGFQQLFENGGTIQSDDGSIAVMAGATWGGGGTINWSVSLQTQDF 309

Query: 190 VREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNI 249
           VR+EWA+  GL +F  +++  ++  +  R+G     + HN  N+ L+   ++LG H    
Sbjct: 310 VRKEWAEEKGLEFFTSEKFQESLDRVCERMGVTADGLRHNHGNRVLMEASRRLGAHVKAA 369

Query: 250 PQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQK 309
           PQN A   H CG C+ GC   EKQ   +TWL +A    A F++   V+ +L D D KSQK
Sbjct: 370 PQNIAGGDHLCGRCTLGCASAEKQGPAITWLPDAAKAGATFMEGLQVDHLLFD-DSKSQK 428

Query: 310 -VMGVEVIINN---------IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHV 359
            V+G + +  +          + V IHAK+V+VS G++ SP +LL S LKNK+IG+NLH+
Sbjct: 429 TVIGAKGVWTSNPQSGKDKVTREVVIHAKKVIVSCGSLWSPIVLLNSNLKNKHIGQNLHL 488

Query: 360 HPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKS 419
           HP+  V  V    +++ + G I++ + ++ EN+DG  +G K+      P    +   W +
Sbjct: 489 HPVNFVTAVH-KSDVRPWEGPILTVVDSSLENLDGHGHGTKLEASCMLPSLALSFLNWST 547

Query: 420 NLQHKQLMLEYNNIVPLMVITRDREGGRILTD-ENGKPRLEYKLSQHDSKSMVAGLLTAV 478
            L  K  +L+Y +    + +TRDR+ G +  D + GKPR+ Y  S  D +  + G++   
Sbjct: 548 GLDFKAQVLKYRHSNSYISLTRDRDPGCVYRDPQTGKPRIRYTPSNFDRRHTMEGVIALA 607

Query: 479 RILAAAGATKIGTCQTVIDDYIVENGVN-PLN---------------DPKFDQFLNKIKK 522
                 GA +I      +  ++     + PL+               + +F  +L+K+K 
Sbjct: 608 TRNFICGAEEIHVGFPGVQPFVRNPDPSFPLSFESQSPSPAQGEEDVNVRFSAWLSKVKS 667

Query: 523 VGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMM 582
            G         +  QM + RM   P+   V+  G  W  E LYVAD+SVLP+A+GV  M+
Sbjct: 668 AGNAPPAATFASAHQMGTNRMSSKPSLGVVDVKGRVWGTEGLYVADASVLPSASGVNPMV 727

Query: 583 TTMNIAHYISK 593
           TTM I  +IS+
Sbjct: 728 TTMAICDWISR 738



>gi|508714212|gb|EOY06109.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 gi|508714213|gb|EOY06110.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
 gi|508714214|gb|EOY06111.1| Fatty alcohol oxidase 3 isoform 1 [Theobroma cacao]
          Length = 750

 Score =  290 bits (743), Expect = 8e-76,   Method: Compositional matrix adjust.
 Identities = 174/489 (35%), Positives = 267/489 (54%), Gaps = 28/489 (5%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG ++   D S  +    D+LYE  G + + D  M +LAGS  GGG+ I WSA +
Sbjct: 266 VVVLEKGSYFAPSDYSPFEGPSMDQLYESGGILPSIDGQMLILAGSTVGGGSAINWSASI 325

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +    + +EWA++  LP F   EY +AM  +  R+G           NQ L  GCK LGL
Sbjct: 326 KTPKSILQEWAEDCQLPLFGSPEYLSAMDNVCERIGVTENCKEEGFQNQILRKGCKNLGL 385

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD 304
             +N+P+N+ S +H CG C FGC+ G+K+    TWL +A SN A  L  C  EK +++K+
Sbjct: 386 EVENVPRNS-SESHYCGSCGFGCRRGDKKGTDRTWLVDAVSNGAVILTGCKAEKFILEKN 444

Query: 305 ----GKSQKVMGVEVIINN---IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
                +  K +GV    +N    K++ I AK  + + GA+ +P L+  SGLKN+NIGRNL
Sbjct: 445 KICSKRKLKCLGVIAKTSNKNITKKLHIEAKVTISACGALFTPLLMHSSGLKNRNIGRNL 504

Query: 358 HVHPIAAVYGVFPNKEI----KTYSGTIMSAISNATENVDGEN-YGAKIVVGSHHPGFMF 412
           H+HP+   +G FP+ +     K Y G I++++      V  +N   A I   S  P    
Sbjct: 505 HLHPVLMAWGYFPDSDSEFKGKVYEGGIITSVHKV---VAADNKVRAIIETPSLGPAQYA 561

Query: 413 ANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVA 472
           A  PW+S L  K+ ML ++    ++ I RD+  G++    +   R+ YK    D ++M +
Sbjct: 562 ALCPWESGLDMKRRMLNFSRTAHMITIIRDQGSGKV----HAGGRVTYKFDALDRQNMQS 617

Query: 473 GLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQT-- 530
           GL  A+RIL AAGA ++GT ++  D   +      +++ + ++FL  +  V  P +    
Sbjct: 618 GLRQALRILVAAGAVEVGTHRS--DGQSIR--CKGISNKELEEFLESVSPVEGPMFPAEK 673

Query: 531 --CTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIA 588
                +  QM SCRMG +  + AV+  GE+WE E L+V D+SVLP A GV  M+T  + A
Sbjct: 674 WVTHTSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPGAIGVNPMITVQSTA 733

Query: 589 HYISKCILD 597
           + +SK I +
Sbjct: 734 YCLSKRIAE 742



>gi|379709263|ref|YP_005264468.1| putative oxidoreductase [Nocardia cyriacigeorgica GUH-2]
 gi|504117302|ref|WP_014351288.1| oxidoreductase [Nocardia cyriacigeorgica]
 gi|374846762|emb|CCF63832.1| putative oxidoreductase [Nocardia cyriacigeorgica GUH-2]
          Length = 651

 Score =  290 bits (743), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 186/587 (31%), Positives = 286/587 (48%), Gaps = 27/587 (4%)

Query: 15  FHELTQKQREHTFIKWSTSQYASVRKIYKSF--TMLICATFWLNPYNFNPV---IGYPGA 69
           F  LT  +RE   +++  S++A  R ++++     L+       P   NP+   +GYP  
Sbjct: 77  FSALTPDEREQALLRFGDSRFAVKRTLFQALKSAALLSYNVTPGPTGENPLWKQMGYPA- 135

Query: 70  DPEANGSRFSSRNFPKYNFLEISDHDSDIKEFDTXXXXXXXXXXXXXXRLARMENVLVIE 129
            P    +  +          E +  + D+    +               L    +V+V+E
Sbjct: 136 -PPGPRATATGPALEPLRLTEPTTLECDVVIVGSGAGGGTAAAVLADAGL----DVVVLE 190

Query: 130 KGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYF 189
           +G +YD  D  T + DG  +LY   G   T +  + + AGS  GGGT + WS  +     
Sbjct: 191 RGDYYDDRDFGTGEMDGLLRLYA-PGPQATTEGQLTLAAGSCLGGGTVVNWSTSLPTPDD 249

Query: 190 VREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNI 249
           VR EWA +FG+P F   E+ +A+  +  RLG N  +   +  +  L  G   LG   D +
Sbjct: 250 VRAEWA-DFGVPQFTATEFDDALAVVQQRLGVNRDHSPLSARDAVLERGATALGWDVDTL 308

Query: 250 PQNTASITH---QCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGK 306
           P+N +        CG C +GC+ G KQS T TWL +A  + A+ + +  V +I + K+G+
Sbjct: 309 PRNVSDACDTGVDCGSCGYGCRLGAKQSVTKTWLQDAAGHGARLVVDANVRRIEV-KNGR 367

Query: 307 SQKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVY 366
           ++   GV        R+ + A+ VVV+AGAI +PALL RSGL++  IGR L +HP AAVY
Sbjct: 368 AE---GVTAETGTGVRIDVRARAVVVAAGAIQTPALLRRSGLRDDTIGRYLRLHPAAAVY 424

Query: 367 GVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQL 426
           GVF ++EI+ + G + + I    +N+DG  YG     G   PG       W+    H+  
Sbjct: 425 GVF-DEEIRPWEGGLQARICRHDQNLDGNGYGVIYETGPVQPGLAVGFMNWRGAAAHRAT 483

Query: 427 MLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGLLTAVRILAAAGA 486
           ML+  +   + VITRDR+ GR+  D +G+P + Y+LS +D   +  G+  A +IL AAGA
Sbjct: 484 MLDLAHTGVVGVITRDRDHGRVTVDRSGEPVVSYRLSDYDRAHLRTGIGGAAQILEAAGA 543

Query: 487 TKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQTCTGTIEQMSSCRMGDD 546
            +I +       Y       P       +F+      G    Q     +  M S RMG  
Sbjct: 544 RRIFSGHQAGVAY------EPGTRGSHAEFVAAGDAAGYGPGQCSMAALHIMGSARMGGS 597

Query: 547 PNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISK 593
              SA +P G  WEV N+ VAD+S  PT++GV  M+T   IA+  +K
Sbjct: 598 RELSATDPDGATWEVPNIVVADASCFPTSSGVNPMVTIEAIAYMNAK 644



>gi|356533767|ref|XP_003535431.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Glycine max]
          Length = 782

 Score =  290 bits (743), Expect = 9e-76,   Method: Compositional matrix adjust.
 Identities = 173/487 (35%), Positives = 270/487 (55%), Gaps = 26/487 (5%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           VLV+EKG+++   D S+ +    ++LYEL G   + D  M +L G+  GGG+ + W+A +
Sbjct: 299 VLVLEKGNYFTPNDYSSLEGPSLNELYELGGTFASRDGKMAILTGTTVGGGSAVNWAASI 358

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
               FV EEW K+  L  F   EY +AM  +  R+G     I     NQ L  GCK LGL
Sbjct: 359 RTPDFVLEEWGKDHKLSLFSSHEYLSAMDMVCKRIGVTDKCIEEGLQNQVLRKGCKNLGL 418

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD 304
             D +P+N++   H CG C++GC  GEKQ   +TWL +A  + A  L     E+ ++ K 
Sbjct: 419 PVDYVPRNSSE-RHYCGSCNYGCTRGEKQGTEVTWLVDAVDHGAVILTGTKAERFILGKK 477

Query: 305 GKS-----QKVMGV--EVIINNIK-RVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRN 356
            K      +K +GV   V+ NNI  R+K+ AK  V + GA+ +P L++ SGLKNK+IG+N
Sbjct: 478 NKGGGVRRKKCLGVMANVVTNNITWRLKVEAKVTVSACGALFTPPLMISSGLKNKHIGKN 537

Query: 357 LHVHPIAAVYGVFP--NKEI--KTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMF 412
           LH+HP+   +G FP  N E+  K Y G I++++       D     A +   +  PG + 
Sbjct: 538 LHLHPVLMSWGYFPDSNSELKGKCYEGGIITSVHKVVSE-DYSKVKAIVETPALGPGALS 596

Query: 413 ANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVA 472
              PW S L  K  ML+Y+  V L+ I RD   G + ++     R+ Y+L + D +++  
Sbjct: 597 TLIPWVSGLDFKDRMLKYSRTVHLITIIRDMGCGEVRSE----GRVHYELDESDKENIRD 652

Query: 473 GLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKV-GIPTYQ-- 529
           G+  A+RIL AAGA ++GT ++  D + +E   N  N+ + ++F+  +    G+ +++  
Sbjct: 653 GVKQALRILIAAGAVEVGTHRS--DGHRIE--CNGKNEKELERFVESVYATEGLMSHEEK 708

Query: 530 -TCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIA 588
            +   +  QM SCRMG    + AV+  G +WE E L+V D+S+LPTA GV  M+T  + A
Sbjct: 709 WSIYSSAHQMGSCRMGMSEKEGAVDENGMSWEAEGLFVCDASLLPTAIGVNPMITIQSTA 768

Query: 589 HYISKCI 595
           + ++K I
Sbjct: 769 YCVAKRI 775



>gi|340966825|gb|EGS22332.1| hypothetical protein CTHT_0018560 [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 786

 Score =  290 bits (742), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 191/603 (31%), Positives = 308/603 (51%), Gaps = 37/603 (6%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLN--PYNFNPVIGYPGADP 71
           P   L+ + R      W+TS   S+R ++KS T L     WL   PY F P+ G+P   P
Sbjct: 149 PLPLLSIQDRTKILRSWATSPLWSIRALFKSMTTL-GKLAWLRSTPY-FAPLTGFPRV-P 205

Query: 72  EANGSRFSSRNFPKYNFLEISDHDSDIKE-----FDTXXXXXXXXXXXXXXRLA----RM 122
            A  +   S+++P Y FL+ S    D+K       D               +LA    + 
Sbjct: 206 AAWVA--GSKSYP-YEFLQFSP-GPDVKAPVEIATDVVIVGSGCGAGVVAHKLATEFGKG 261

Query: 123 ENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSA 182
            NVLVIEKG H+D       Q  G   L+E  G + +DD ++ V AG+ FGGG T+ WSA
Sbjct: 262 LNVLVIEKGWHFDASHFPMSQTTGLANLFEAGGVIESDDGSITVTAGACFGGGGTVNWSA 321

Query: 183 FMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKL 242
            ++PQ FVR+EWA+   L +F  +++   +  +   +G     +  +  N+ L+ G K+L
Sbjct: 322 SLQPQDFVRKEWAQERKLEFFETEDFQKCLDRVWKHMGVTGDKLTPSHGNKVLLEGAKRL 381

Query: 243 GLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILID 302
           G  +  +PQN     H  G+C+ GC  GEK      W  EA     KF++   V+K+L D
Sbjct: 382 GYTAKIVPQNCGDNAHHDGYCTLGCWKGEKNGPVNGWFPEAAEQGVKFVEGMKVDKVLFD 441

Query: 303 KDGKSQKVMGVEVIIN-----NIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
                +  +GVE +          +V + +K+VVVS G + SP +L+ SGLKN  IG+NL
Sbjct: 442 VKKGKRVAVGVEGVWTPRGGAEQVKVVVKSKKVVVSCGTLWSPVVLMNSGLKNPQIGKNL 501

Query: 358 HVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPW 417
           ++HP   V GVF ++ ++ + G  ++++ +  +N+DG+ +G K+         +F   PW
Sbjct: 502 YLHPTNFVMGVF-DENVQPWEGGCLTSVVSDFDNLDGKGHGVKLEA-------IF--LPW 551

Query: 418 KSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAGLLT 476
            +   +K    +Y ++   + I RDR+ G I  D  +G PR+ Y  S  D    + G++ 
Sbjct: 552 TTGQNYKLHAAKYPHLNAFIAICRDRDTGHIYRDPVSGCPRIAYTPSDFDRAHNLRGIIE 611

Query: 477 AVRILAAAGATKIGTCQTVIDDYIV--ENGVNPLNDPKFDQFLNKIKKVGIPTYQTCTGT 534
             RIL ++GA +I      ++ ++V  +   +   D  F++++ ++K+ G     T   +
Sbjct: 612 LSRILFSSGAREIVPALPGLEPFVVSADKSADKTKD-DFEKWIARLKQHGNRPPSTPFAS 670

Query: 535 IEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKC 594
             QM +CRM        V+P G  W  E LYVAD+SV P+A+GV  M+T M IA +I++ 
Sbjct: 671 AHQMGTCRMSAREKDGVVDPRGRVWGTEGLYVADASVFPSASGVNPMITVMAIAEHIARG 730

Query: 595 ILD 597
           I++
Sbjct: 731 IVE 733



>gi|296803478|ref|XP_002842592.1| long chain fatty acid oxidase [Arthroderma otae CBS 113480]
 gi|238838911|gb|EEQ28573.1| long chain fatty acid oxidase [Arthroderma otae CBS 113480]
          Length = 753

 Score =  290 bits (742), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 193/612 (31%), Positives = 293/612 (47%), Gaps = 43/612 (7%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVI-GYPGADPE 72
           PF       R   F  W TS    +R  +++   L     W+      PV+ G+P     
Sbjct: 136 PFQHHPYSVRRKIFSSWRTSYLPPLRAAHRALVAL-SKKAWVGVSPSLPVVLGFPNVPVH 194

Query: 73  ANGSRFSSRNFPKYNFLEISDHDS-DIKEFDTXXXXXXXXXXXXXXRLARM-ENVLVIEK 130
               R +S N+P Y+FL++   D  +I E D                LA     V+V+EK
Sbjct: 195 ----RMTSENYP-YSFLQLPAGDQPEIIETDVVIVGSGCGAGVAAKNLAEAGHRVIVVEK 249

Query: 131 GHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFV 190
            + +         ++G   ++   G  L+DD ++ V++GS +GGG TI WSA ++ Q  V
Sbjct: 250 SYFFPNNRYPMAGREGTFHMFSNGGAELSDDGSIGVVSGSTWGGGGTINWSAALQTQSMV 309

Query: 191 REEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIP 250
           REEWA N GLP+F    Y  ++  +   +G ++  I  N  N  L+ G +KLG  +  +P
Sbjct: 310 REEWA-NGGLPFFTSSAYQTSLDRVCDYMGVSSDFIEQNHGNSVLLEGARKLGYTARAVP 368

Query: 251 QNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQKV 310
           QNT    H CG+C+ GC  G KQ   +T+L +A    A F++    EK+L  K     K 
Sbjct: 369 QNTGHQKHDCGYCTLGCAAGIKQGPAVTFLADAARAGATFIEGFKAEKVLFGKKLFKGKK 428

Query: 311 MGVEVIINNIKR---VKIHAKRVVV------------SAGAIHSPALLLRSGLKNKNIGR 355
           + V V      R      H +  V             S G + SP LLLRSG+ N  +GR
Sbjct: 429 VAVGVQGTWTSRDASGATHGEPTVTRKVVIKAKKVVVSCGTLESPLLLLRSGISNPQVGR 488

Query: 356 NLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANF 415
           NLH+HP+  +  VF   E + + G I++++ +  EN+DG  +G+KI      P F     
Sbjct: 489 NLHLHPVVIMSAVF-EHETRPWEGAILTSLVSDFENLDGRGHGSKIEAVVMLPSFFLPLM 547

Query: 416 PWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDEN-GKPRLEYKLSQHDSKSMVAGL 474
           PWK  L  K        +   + +TRDR+ GR+  D N G+ R+EY  S  D K ++ G+
Sbjct: 548 PWKDGLDFKIFASNARRMAGFISLTRDRDTGRVYPDPNDGRCRIEYTPSAFDRKHILEGI 607

Query: 475 LTAVRILAAAGATKIGTCQTVIDDYI------------VENGVNPLNDPKFDQFLNKIKK 522
           + A +I   +GA +I T    I  ++            V+ G+   N+  F +++ K++ 
Sbjct: 608 IGAAKIAYVSGAKEIRTSSQAIPTFVRPEPSAMSDADLVDEGI---NNAAFQEWIKKLRT 664

Query: 523 -VGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSM 581
            V +P  Q+   +  QM +CRMG  P  S V+P G  W    LYVAD+SV P+A+GV  M
Sbjct: 665 GVPLPVEQSMFASAHQMGTCRMGTSPKTSVVDPTGMVWGTSGLYVADASVFPSASGVNPM 724

Query: 582 MTTMNIAHYISK 593
           +T M I    S+
Sbjct: 725 ITNMAITDLTSR 736



>gi|297831096|ref|XP_002883430.1| hypothetical protein ARALYDRAFT_479855 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297329270|gb|EFH59689.1| hypothetical protein ARALYDRAFT_479855 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 743

 Score =  290 bits (742), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 169/485 (34%), Positives = 271/485 (55%), Gaps = 28/485 (5%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG ++   D    +  G DKLYE  G + + D N+ VLAG+  GGG+ + WSA +
Sbjct: 257 VVVLEKGSYFTPSDYRPFEGPGLDKLYENGGILPSVDGNLMVLAGATVGGGSAVNWSACI 316

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +    V +EW+++  +P F   EY +AM+ +  R+G      + +  NQ L  GC+ LG+
Sbjct: 317 KTPKSVLQEWSEDQNIPLFATKEYVSAMEVVWERMGVTDKCEMESFQNQVLRKGCQNLGV 376

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD 304
           + +N+P+N+ S +H CG C +GC  G+K+ +  TWL +A S  A  L  C  E+ +++K+
Sbjct: 377 NVENVPRNS-SESHYCGSCGYGCIQGDKKGSDRTWLVDAVSQGAVILTGCKAERFILEKN 435

Query: 305 -----GKSQKVMGV--EVIINNI-KRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRN 356
                GK  K +GV  + +  NI K +KI AK  V + GA+ +P L++ SGL+N++IG+N
Sbjct: 436 SGNEGGKKMKCLGVMAKSLNGNIAKTLKIEAKVTVSAGGALLTPPLMISSGLRNRHIGKN 495

Query: 357 LHVHPIAAVYGVFPNKEI-----KTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFM 411
           LH+HP+   +G FP KE      K+Y G I++++S      D E   A I   +  PG  
Sbjct: 496 LHLHPVLMAWGYFPMKESSNFKGKSYEGGIITSVSKVLSE-DSE-VRAIIETPALGPGSF 553

Query: 412 FANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMV 471
               PW S L  K+ M  Y+    L+ I RDR  G + T+     R+ Y + + D  ++ 
Sbjct: 554 SVLCPWTSGLDMKKRMARYSRTASLITIVRDRGSGEVKTE----GRISYAVDKTDRDNLK 609

Query: 472 AGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQT- 530
           AGL  +++IL AAGA ++GT ++     I +      ++   ++FL+ +     P   T 
Sbjct: 610 AGLRQSLKILIAAGAEEVGTHRSDGQRLICKGS----DENSIEEFLDSVSTEEGPKGMTE 665

Query: 531 ---CTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNI 587
                 +  QM SCR+G++  + A++  GE+WE E L+V D+S LP+A GV  M+T M+ 
Sbjct: 666 KWNVYSSAHQMGSCRIGENEKEGAIDLNGESWEAEKLFVCDASALPSAVGVNPMITVMST 725

Query: 588 AHYIS 592
           A+ IS
Sbjct: 726 AYCIS 730



>gi|354546070|emb|CCE42799.1| hypothetical protein CPAR2_204420 [Candida parapsilosis]
          Length = 704

 Score =  290 bits (741), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 185/626 (29%), Positives = 323/626 (51%), Gaps = 45/626 (7%)

Query: 2   SLINSKILS-----IQKPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLN 56
           S ++S+I++       K    +T K+RE     W  S   + R++++    L   T  + 
Sbjct: 86  SALDSRIIAPTLTNSMKLVKHMTLKEREELMASWRDSPIPAKRRLFRLVHALTLNTMAIL 145

Query: 57  PYNFN-PVIGYPG------------ADPEANGSRFSSRNFPKYNFLEISDHDSDIKEFDT 103
               +   I YPG            ADP      F     PK  F +   H +DI   D 
Sbjct: 146 GDELHYQAIRYPGKELKDKPYEGFQADP------FRYDMLPKPEFEDAELHLTDI---DV 196

Query: 104 XXXXXXXXXXXXXXRLAR-MENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDS 162
                          LA      LV+EKG ++   + +   ++G + L++  G + + ++
Sbjct: 197 IIIGSGAGAGVVAHTLANDGYKSLVLEKGKYFSPSEFNFTDKEGLETLFQGHGLLTSTNN 256

Query: 163 NMYVLAGSNFGGGTTIGWSAFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTN 222
            ++VLAGS FGGGTT+ WSA +   + VR+EW  ++GL +   D Y     Y+  ++G +
Sbjct: 257 EIFVLAGSTFGGGTTVNWSACLRTPFKVRKEWYDDYGLDFAATDSYDKCQDYVWKQMGAS 316

Query: 223 TINIIHNQSNQTLINGCKKLGLHSDNIPQNTAS-ITHQCGWCSFGCKYGEKQSATMTWLN 281
           T  I H+ +N+ +I G KKLG  S  I QN+     H CG+C  GCK+G KQ +++ W  
Sbjct: 317 TEGIKHSLANEIVIEGGKKLGYASKAIEQNSGGHPGHSCGFCHIGCKHGIKQGSSVNWFR 376

Query: 282 EAKSNNAKFLKNCYVEKILIDKDGKSQKVMGVEVIINNIKRVKIHA-KRVVVSAGAIHSP 340
           +A +N +KF+    V +IL  K G +  ++  + +    ++ KI   K+ VV+ G++++P
Sbjct: 377 DAAANGSKFMDQVRVLQIL-HKKGVAVGLLCQDEVTG--RKFKITGPKKFVVAGGSLNTP 433

Query: 341 ALLLRSGLKNKNIGRNLHVHPIAAVYGVF-PNKEIKTYSGTIMSAISNATENVDGENYGA 399
            +L  SG KNK+IG+NL +HP+  V+G F  + E   +  +IM+++    +++DG+ +GA
Sbjct: 434 VVLQNSGFKNKHIGKNLTLHPVTTVFGDFGQDVEADHFDNSIMTSVCTQVDDLDGKAHGA 493

Query: 400 KIVVGSHHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPR-- 457
           KI    + P    A  PW+ + + ++ +L YN++  +++ITRD   G +  D   +P   
Sbjct: 494 KIETILNTPFIQAALLPWRGSDEARKDLLRYNHMCAMLLITRDTSTGSVSADPK-RPEAL 552

Query: 458 -LEYKLSQHDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGV----NPLNDPK 512
            ++Y +S++D  +++   L    +L   GA +I + Q  +   I E+ +      + D  
Sbjct: 553 YIDYNVSKYDRNALLQAFLVTSDMLYIEGAQRILSPQPWVP--IFESKIPKDKRSITDKD 610

Query: 513 FDQFLNKIKKVGIPTYQTCTGTIEQMSSCRM-GDDPNKSAVNPVGEAWEVENLYVADSSV 571
           + ++  K+ K+   +Y T  G+  QMSSCRM G  P   A +  G+ +E  N+Y+AD+S 
Sbjct: 611 YVEWREKVAKIPFDSYGTPYGSAHQMSSCRMSGKGPKYGACDTKGKLFEASNIYIADASC 670

Query: 572 LPTATGVPSMMTTMNIAHYISKCILD 597
           +PTA+G   M++TM IA +++  + D
Sbjct: 671 MPTASGANPMISTMAIARHVALGLCD 696



>gi|508714215|gb|EOY06112.1| Alcohol oxidase, putative isoform 4, partial [Theobroma cacao]
 gi|508714216|gb|EOY06113.1| Alcohol oxidase, putative isoform 4, partial [Theobroma cacao]
          Length = 657

 Score =  290 bits (741), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 174/489 (35%), Positives = 267/489 (54%), Gaps = 28/489 (5%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG ++   D S  +    D+LYE  G + + D  M +LAGS  GGG+ I WSA +
Sbjct: 176 VVVLEKGSYFAPSDYSPFEGPSMDQLYESGGILPSIDGQMLILAGSTVGGGSAINWSASI 235

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +    + +EWA++  LP F   EY +AM  +  R+G           NQ L  GCK LGL
Sbjct: 236 KTPKSILQEWAEDCQLPLFGSPEYLSAMDNVCERIGVTENCKEEGFQNQILRKGCKNLGL 295

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD 304
             +N+P+N+ S +H CG C FGC+ G+K+    TWL +A SN A  L  C  EK +++K+
Sbjct: 296 EVENVPRNS-SESHYCGSCGFGCRRGDKKGTDRTWLVDAVSNGAVILTGCKAEKFILEKN 354

Query: 305 ----GKSQKVMGVEVIINN---IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
                +  K +GV    +N    K++ I AK  + + GA+ +P L+  SGLKN+NIGRNL
Sbjct: 355 KICSKRKLKCLGVIAKTSNKNITKKLHIEAKVTISACGALFTPLLMHSSGLKNRNIGRNL 414

Query: 358 HVHPIAAVYGVFPNKEI----KTYSGTIMSAISNATENVDGEN-YGAKIVVGSHHPGFMF 412
           H+HP+   +G FP+ +     K Y G I++++      V  +N   A I   S  P    
Sbjct: 415 HLHPVLMAWGYFPDSDSEFKGKVYEGGIITSVHKV---VAADNKVRAIIETPSLGPAQYA 471

Query: 413 ANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVA 472
           A  PW+S L  K+ ML ++    ++ I RD+  G++    +   R+ YK    D ++M +
Sbjct: 472 ALCPWESGLDMKRRMLNFSRTAHMITIIRDQGSGKV----HAGGRVTYKFDALDRQNMQS 527

Query: 473 GLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQT-- 530
           GL  A+RIL AAGA ++GT ++  D   +      +++ + ++FL  +  V  P +    
Sbjct: 528 GLRQALRILVAAGAVEVGTHRS--DGQSIR--CKGISNKELEEFLESVSPVEGPMFPAEK 583

Query: 531 --CTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIA 588
                +  QM SCRMG +  + AV+  GE+WE E L+V D+SVLP A GV  M+T  + A
Sbjct: 584 WVTHTSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPGAIGVNPMITVQSTA 643

Query: 589 HYISKCILD 597
           + +SK I +
Sbjct: 644 YCLSKRIAE 652



>gi|448527058|ref|XP_003869427.1| hypothetical protein CORT_0D04520 [Candida orthopsilosis Co 90-125]
 gi|380353780|emb|CCG23292.1| hypothetical protein CORT_0D04520 [Candida orthopsilosis]
          Length = 704

 Score =  290 bits (741), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 183/596 (30%), Positives = 307/596 (51%), Gaps = 20/596 (3%)

Query: 15  FHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWL--NPYNFNPVIGYPGAD-P 71
             ++T  QRE     +  S     R ++KS   L   T  +  N  ++   I YPG +  
Sbjct: 104 IRDMTLDQREQLLKSFRDSPIFVKRVLFKSVLTLTINTLLVLGNELHYK-AIRYPGRELR 162

Query: 72  EANGSRFSSRNFPKYNFL---EISDHDSDIKEFDTXXXXXXXXXXXXXXRLAR-MENVLV 127
           E     F +  F +Y+ L   E  + +  + + D                LA      LV
Sbjct: 163 EEAYEGFKADPF-RYDMLSKPEFDNANLHLTDIDVVIIGSGAGAGVVAHTLANDGYKSLV 221

Query: 128 IEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQ 187
           +EKG +Y + + +   ++G D LY+  G + + +S + +LAGSNFGGGTT+ WSA ++  
Sbjct: 222 LEKGKYYARSNFNFNDKEGIDSLYQNRGILTSTNSQILLLAGSNFGGGTTVNWSASLKTP 281

Query: 188 YFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSD 247
           + VR+EW  ++GL +     Y   + YI  ++G +T  I H+ +NQ L++GCK L     
Sbjct: 282 FKVRKEWYDDYGLNFAATGSYDECLGYIWKQMGVSTEGIKHSYANQVLMDGCKALDYPVK 341

Query: 248 NIPQNTAS-ITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGK 306
            I QN+     H CG+C  GCK+G KQ +++ W   A +N +KF+    V KIL  K+G 
Sbjct: 342 EIDQNSGGHPAHSCGFCYLGCKHGIKQGSSVNWFRAAAANGSKFMDQVRVVKIL-HKNGV 400

Query: 307 SQKVMGVEVIINNIKRVKIHA-KRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAV 365
           +  ++  + +    ++ KI   K+ VV+ G++++P +L  SG KNKNIG+NL +HP  +V
Sbjct: 401 ASGLLCQDTVTG--RKFKITGPKKFVVAGGSLNTPIVLQNSGFKNKNIGKNLKLHPGVSV 458

Query: 366 YGVF-PNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHK 424
            G F  + +      +IM+ +    +++DG+ +G KI    + P F  A  PWK + Q +
Sbjct: 459 LGDFGRDVQADHCKNSIMTVVCTKVDDLDGKAHGCKIETLLNAPFFQAAALPWKDSKQIQ 518

Query: 425 QLMLEYNNIVPLMVITRDREGGRILTDENGKPRL--EYKLSQHDSKSMVAGLLTAVRILA 482
           Q +L +N +  + +I RD   G +  D      L  +Y +++ D   ++  +L    IL 
Sbjct: 519 QDLLRHNQLCAMALICRDTSSGSVYGDPQRPDALYVDYSINKFDKNILLQAILVTADILY 578

Query: 483 AAGATKIGTCQTVIDDYIVENGV--NPLNDPKFDQFLNKIKKVGIPTYQTCTGTIEQMSS 540
             GA +I + Q  +  +  +       + D  F ++  K+ K+ I  + T   +  QMSS
Sbjct: 579 VEGAERILSPQAWVPIFETKKSKRNRSIKDKDFVEWKEKVAKLPIDNHATALASAHQMSS 638

Query: 541 CRM-GDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKCI 595
           CRM G  P   A +  G+ +E  N+Y+AD+S +PTA+GV  M+TTM++A ++  C+
Sbjct: 639 CRMSGKGPKYGACDTKGKLFEASNIYIADASCMPTASGVNPMVTTMSLARHVGLCL 694



>gi|482551882|gb|EOA16075.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
          Length = 761

 Score =  289 bits (740), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 177/485 (36%), Positives = 262/485 (54%), Gaps = 23/485 (4%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGML-TDDSNMYVLAGSNFGGGTTIGWSAF 183
           VLV+E G++Y + +LS  +    + +Y LSGG+L T D+N+ +LAGS  GGG+TI WSA 
Sbjct: 282 VLVVESGNYYARSNLSLLEGQAMEDMY-LSGGLLATSDTNVVILAGSTVGGGSTINWSAS 340

Query: 184 MEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLG 243
           ++    V +EW +   L  F  D Y  AM  +  R+G     +    +N+ L  GC++LG
Sbjct: 341 IKTPEHVMKEWTEKSKLEMFGSDLYREAMDVVCERMGVQCGFVEEGFNNEILRKGCEELG 400

Query: 244 LHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNE-AKSNNAKFLKNCYVEKILID 302
           L   NIP+N  S  H CG C  GCK G+KQ  + TWL +  +S N   L  C   ++L +
Sbjct: 401 LPVKNIPRNAPS-DHYCGHCCLGCKKGQKQGTSETWLVDLVQSGNGLILPGCKAMEVLYE 459

Query: 303 -KDGK--SQKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHV 359
            + GK   +K  GV         V + ++  VV+ GA+ +P LL RSGLKN NIGRNL +
Sbjct: 460 CEQGKKNKKKATGVAFAFGEEIYV-VESRATVVACGALRTPHLLKRSGLKNGNIGRNLCL 518

Query: 360 HPIAAVYGVF------PNKEIKTYSGTIMSAISNATENVDGENYGAKIV-VGSHHPGFMF 412
           HP+   +G F      P K+  +Y G IM+A+S+        +YG  ++   + HPG   
Sbjct: 519 HPVVMAWGWFPEGEKWPEKKKMSYEGGIMTAMSSVVNAETQSSYGETVIQTPALHPGMFS 578

Query: 413 ANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVA 472
              PW S+   K  ML+++    +  + RD+  G I    N K  ++Y L+  D +S+  
Sbjct: 579 GVTPWASSKDFKTRMLKFSRTAHIFALLRDKGTGTI----NSKSYIDYNLNDEDEESLKK 634

Query: 473 GLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQTCT 532
           GL   ++I+AAAGA +IGT  +      V       +  +F++F+ +     +       
Sbjct: 635 GLEEVLKIMAAAGAEEIGTHNSEGKSLNVRRA----SAVEFERFVREESSKPLKNLSGQI 690

Query: 533 GTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYIS 592
            +  QM SCRMG  P +SAV P GE WEVE L+VAD+SV PTA GV  M+T  +IA+ I 
Sbjct: 691 CSAHQMGSCRMGIRPEESAVRPTGETWEVEGLFVADTSVFPTALGVNPMVTVQSIAYCIG 750

Query: 593 KCILD 597
             ++D
Sbjct: 751 LNVVD 755



>gi|54022945|ref|YP_117187.1| oxidoreductase [Nocardia farcinica IFM 10152]
 gi|499520868|ref|WP_011207508.1| oxidoreductase [Nocardia farcinica]
 gi|54014453|dbj|BAD55823.1| putative oxidoreductase [Nocardia farcinica IFM 10152]
          Length = 664

 Score =  289 bits (740), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 177/588 (30%), Positives = 285/588 (48%), Gaps = 33/588 (5%)

Query: 13  KPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPY--NFNPV---IGYP 67
           +PF   +  +RE   +K   S+    R ++++       ++++ P    FNP+   +GYP
Sbjct: 88  RPFSRRSPTEREQLLLKLGASRLGVKRALFQALKQGSLLSYYVTPGPDGFNPLWKEMGYP 147

Query: 68  GADPEANGSRFSSRNFPKYNFLEISDH---DSDIKEFDTXXXXXXXXXXXXXXRLARMEN 124
           G        + ++   P  + L  +     D D+    +               L    +
Sbjct: 148 GPP-----GQLAAAPRPALDPLRCTAPTTLDCDVVVVGSGAGGGTAAAVLAEAGL----D 198

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+E+G +YD  D    + D   +LY   G   T +  + +++G+  GGGT + WS  +
Sbjct: 199 VVVLERGDYYDDADFGNGELDALTRLYA-PGPNATAEGQLTLVSGTCLGGGTVVNWSTSL 257

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
                VR EWA + G   F EDE+G A+  +  RL         ++ +  L  G + LG 
Sbjct: 258 RTPDSVRAEWA-SLGATQFAEDEFGAALDAVERRLSVTYDKSPISRRDSVLERGVRALGW 316

Query: 245 HSDNIPQNTASIT---HQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILI 301
               +P+N         +CG C +GC+ G KQS T TWL +A +  A+ +    V +I++
Sbjct: 317 DIGPLPRNVTDACDAGEECGRCGYGCRVGAKQSVTKTWLADAAARGARLVVGADVRRIVV 376

Query: 302 DKDGKSQKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHP 361
            + G ++   GV  + +N   + + AK VVVS GAI +PALL RSGL+NKNIG +L +HP
Sbjct: 377 -RGGTAE---GVVAVTDNGAELTVRAKAVVVSGGAIQTPALLRRSGLRNKNIGAHLRLHP 432

Query: 362 IAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNL 421
            +AV+G F  +E++ + G + + IS    ++DG  YG     G  HPG +     W+   
Sbjct: 433 ASAVFGTF-EEEVRPWEGGLQTRISRKHADLDGAGYGVIYETGPMHPGMLVGFMNWRGGA 491

Query: 422 QHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGLLTAVRIL 481
           +H++ ML+  +   + VITRDR+ GR+  D+ G P + Y +S  D   +  G+L A  IL
Sbjct: 492 EHRRAMLDLAHTAAIGVITRDRDSGRVEVDKAGHPIVHYTISDRDRDHLHTGILGAASIL 551

Query: 482 AAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQTCTGTIEQMSSC 541
            AAGA KI +       Y       P       +F    +  G    +     +  M S 
Sbjct: 552 EAAGAKKIFSGHQAGPVY------QPGVRGSHAEFAAACQAAGYRPGRCGMAALHIMGSA 605

Query: 542 RMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAH 589
           RMG   +  A++P G  WEV N+ VAD+S  PT++GV  M++   IA+
Sbjct: 606 RMGGSRDTCALDPDGATWEVPNVVVADASCFPTSSGVNPMVSIEAIAY 653



>gi|470120598|ref|XP_004296386.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Fragaria vesca
           subsp. vesca]
          Length = 765

 Score =  289 bits (739), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 176/488 (36%), Positives = 269/488 (55%), Gaps = 28/488 (5%)

Query: 123 ENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSA 182
           + V+V+EKG+++   D S+ +    D+LYE  G + T D  + + AGS  GGG+ + WSA
Sbjct: 269 QKVIVLEKGNYFTASDYSSLEGPSQDQLYESGGILATFDGKVMLQAGSTVGGGSAVNWSA 328

Query: 183 FMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKL 242
            + P   + +EWAK+  + +F   EY +AM  +  R+G     +     NQ L  GC+ L
Sbjct: 329 CIRPPDSLLQEWAKDQKIAFFGGSEYVSAMNAVWERIGVTESCVEEGFQNQVLRKGCETL 388

Query: 243 GLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILID 302
           GL     P+N+ S  H CG C +GCK GEK+    TWL +A  + A  L  C  E+ ++ 
Sbjct: 389 GLDVHFTPRNS-SEKHYCGSCGYGCKKGEKKGTDTTWLVDAVDHGAVILSGCKAERFVLA 447

Query: 303 KDGKS-----QKVMGV--EVIINNI-KRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIG 354
           K  KS     +K +GV  + + NNI KR++I AK  + + GA+ +P L++ SGLKN++IG
Sbjct: 448 KSYKSGSMRKKKCLGVVAKSLSNNITKRLQIEAKVTISACGALLTPPLMISSGLKNRHIG 507

Query: 355 RNLHVHPIAAVYGVFP---NKEI--KTYSGTIMSAISNATENVDGENYGAKIVVGSHHPG 409
           RNLH+HP+   +G FP   N E   K+Y G I++++       +     A I   +  PG
Sbjct: 508 RNLHLHPVLMAWGYFPDSINSEFKGKSYKGGIITSVHEVVS--EDSKPRAIIETPALGPG 565

Query: 410 FMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKS 469
              A  PW+S L  K+ ML ++    L+ I RD+  G I T+     R  Y+L   D ++
Sbjct: 566 SFAALCPWESGLDMKKRMLRFSRTAHLITIIRDKGSGVIRTE----GRASYELDVSDKEN 621

Query: 470 MVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTY- 528
           M AG+  A+RIL AAGA ++GT ++  D   ++     ++    ++FL+K+     P   
Sbjct: 622 MKAGMRQALRILIAAGAVEVGTHRS--DGLRLK--CEGIDKEGLEEFLDKVSAEEGPQSL 677

Query: 529 ---QTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTM 585
               T   +  QM SCRMG +  + AV+  GE+WE E L+V D SVLP+A GV  M+T  
Sbjct: 678 VEKWTPYSSAHQMGSCRMGINEKEGAVDQNGESWEAEGLFVCDGSVLPSAVGVNPMITIE 737

Query: 586 NIAHYISK 593
           + A+Y+SK
Sbjct: 738 STAYYLSK 745



>gi|508714217|gb|EOY06114.1| Fatty alcohol oxidase 3 isoform 6, partial [Theobroma cacao]
          Length = 655

 Score =  289 bits (739), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 173/489 (35%), Positives = 267/489 (54%), Gaps = 28/489 (5%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG ++   D S  +    D+LYE  G + + D  M +LAGS  GGG+ I WSA +
Sbjct: 177 VVVLEKGSYFAPSDYSPFEGPSMDQLYESGGILPSIDGQMLILAGSTVGGGSAINWSASI 236

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +    + +EWA++  LP F   EY +AM  +  R+G           NQ L  GCK LGL
Sbjct: 237 KTPKSILQEWAEDCQLPLFGSPEYLSAMDNVCERIGVTENCKEEGFQNQILRKGCKNLGL 296

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD 304
             +N+P+N++  +H CG C FGC+ G+K+    TWL +A SN A  L  C  EK +++K+
Sbjct: 297 EVENVPRNSSE-SHYCGSCGFGCRRGDKKGTDRTWLVDAVSNGAVILTGCKAEKFILEKN 355

Query: 305 ----GKSQKVMGVEVIINN---IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
                +  K +GV    +N    K++ I AK  + + GA+ +P L+  SGLKN+NIGRNL
Sbjct: 356 KICSKRKLKCLGVIAKTSNKNITKKLHIEAKVTISACGALFTPLLMHSSGLKNRNIGRNL 415

Query: 358 HVHPIAAVYGVFPNKEI----KTYSGTIMSAISNATENVDGEN-YGAKIVVGSHHPGFMF 412
           H+HP+   +G FP+ +     K Y G I++++      V  +N   A I   S  P    
Sbjct: 416 HLHPVLMAWGYFPDSDSEFKGKVYEGGIITSVHKV---VAADNKVRAIIETPSLGPAQYA 472

Query: 413 ANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVA 472
           A  PW+S L  K+ ML ++    ++ I RD+  G++    +   R+ YK    D ++M +
Sbjct: 473 ALCPWESGLDMKRRMLNFSRTAHMITIIRDQGSGKV----HAGGRVTYKFDALDRQNMQS 528

Query: 473 GLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQT-- 530
           GL  A+RIL AAGA ++GT ++  D   +      +++ + ++FL  +  V  P +    
Sbjct: 529 GLRQALRILVAAGAVEVGTHRS--DGQSIR--CKGISNKELEEFLESVSPVEGPMFPAEK 584

Query: 531 --CTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIA 588
                +  QM SCRMG +  + AV+  GE+WE E L+V D+SVLP A GV  M+T  + A
Sbjct: 585 WVTHTSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPGAIGVNPMITVQSTA 644

Query: 589 HYISKCILD 597
           + +SK I +
Sbjct: 645 YCLSKRIAE 653



>gi|336470050|gb|EGO58212.1| hypothetical protein NEUTE1DRAFT_82541 [Neurospora tetrasperma FGSC
           2508]
 gi|350290258|gb|EGZ71472.1| long-chain fatty alcohol dehydrogenase [Neurospora tetrasperma FGSC
           2509]
          Length = 763

 Score =  288 bits (737), Expect = 3e-75,   Method: Compositional matrix adjust.
 Identities = 192/637 (30%), Positives = 303/637 (47%), Gaps = 61/637 (9%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYN-FNPVIGYPGADPE 72
           P  +     RE     WS+S + + R +YK FT  I    WL     F  V GYP  D  
Sbjct: 138 PIQDQPLHIRESILRSWSSSWFGTPRTLYKIFTA-IAKVLWLQTSPLFRTVTGYP--DVP 194

Query: 73  ANGSRFSSRNFPKYNFLEISDHDSDIKEFDTXXXXXXXXXXXXXXRLARME---NVLVIE 129
            N +   + +F    FL+     S+    DT                   E    VLV++
Sbjct: 195 INWNPGPTEDF---GFLQFDTSVSEPATVDTDVVIIGSGCGGGVCAKVLAEAGHRVLVVD 251

Query: 130 KGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYF 189
           KG++++   L    +     L+E +G + + D ++  +AGS +GGG ++ WS  ++   +
Sbjct: 252 KGYYFNPAQLPMPMEQSGFHLFENNGLVNSVDGSINAVAGSCWGGGGSVNWSVSLQTPGY 311

Query: 190 VREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQ-SNQTLINGCKKLGLHSDN 248
           VR+EW++  GLP+F   E+ N +  +   +G  + + +      Q L+ G +KLG  +  
Sbjct: 312 VRKEWSEQHGLPFFESAEFQNCLDRVYEFMGVVSGDKVRTTYRGQKLLEGSRKLGYEAHV 371

Query: 249 IPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKS- 307
            PQN     H CG C  GC   EKQ   ++WL  A    A F++   V+KIL D+   S 
Sbjct: 372 CPQNNGGKEHWCGHCPLGCGSAEKQGPAVSWLPAAAKKGATFMEGFSVDKILWDESSSSS 431

Query: 308 --------QKVMGVE------------VIINNIKRVKIHAKRVVVSAGAIHSPALLLRSG 347
                   +K +GVE            +     ++V I AK+V+VSAG ++SP +L RSG
Sbjct: 432 SWFGSGGKKKAVGVEGTWTARDTNGGVIGERKTRKVVIKAKKVIVSAGTLNSPLILHRSG 491

Query: 348 LKNKNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHH 407
           L N +IGRNLHVHP+  + G +   ++  + G +++ I  A EN+DG+ +G K+      
Sbjct: 492 LNNHHIGRNLHVHPVKFI-GAYYEDDVNPWEGGVITTICTAFENLDGQGHGVKLEDTCML 550

Query: 408 PGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHD 466
           P  + +  PW+  L  K   L Y  +   + ++RDR+ GR+  D   GK  +EY +S  D
Sbjct: 551 PHSILSQVPWRGALSWKLSCLRYPQLSAWLSLSRDRDTGRVYADPVTGKLCIEYTISSFD 610

Query: 467 SKSMVAGLLTAVRILAAAGATKI---------------GTCQTVIDDYIVENGVNPLNDP 511
           +     G++   +I    GA++I               GT  T  ++   E+    + DP
Sbjct: 611 ASLNFEGIIALAKIAYVTGASEIDPFLPGVEPFVRSSPGTPSTPTEEAKEEDYDKGVKDP 670

Query: 512 KFDQFLNKI-----KKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYV 566
            F+++L+ +          P Y +      QM +CRM   P    V+P G+ W  E LYV
Sbjct: 671 LFEKWLSTLLHQRDNAPLCPPYVSA----HQMGTCRMSSKPENGVVDPKGKVWGTEGLYV 726

Query: 567 ADSSVLPTATGVPSMMTTMNIAHYISKCI---LDKKI 600
           AD+SV P+A+GV  M+T M IA +I+  +   L KKI
Sbjct: 727 ADASVFPSASGVNPMVTNMAIADWIANGVARDLGKKI 763



>gi|356496483|ref|XP_003517097.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
          Length = 809

 Score =  288 bits (737), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 173/499 (34%), Positives = 273/499 (54%), Gaps = 30/499 (6%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGML-TDDSNMYVLAGSNFGGGTTIGWSAF 183
           VLV+EKG +  + +LS  +    D++Y L+GG++ +DD  +++L+GS  GGG+ I WSA 
Sbjct: 323 VLVLEKGGYSARNNLSLLEGPTMDQMY-LNGGLVASDDMGVFILSGSTVGGGSAINWSAC 381

Query: 184 MEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLG 243
           ++    V +EW+   GL  F  + Y  A+  +  ++   +       +N  L  GC+++G
Sbjct: 382 IKTPQHVCKEWSDKHGLELFESELYREALNAVCEKMEVQSEIEDEGFNNAILRKGCQEMG 441

Query: 244 LHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNE-AKSNNAKFLKNCYVEKIL-I 301
               NIP+N+AS  H CGWC  GCK G K+  + TWL +  KS N   L  C   K+L  
Sbjct: 442 YPVSNIPRNSAS-DHYCGWCCMGCKDGRKKGTSETWLVDLVKSGNGAILPGCEAIKVLHK 500

Query: 302 DKDGKSQKV---MGVEVIINNIKRV-KIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
            K+G+ +K+   +  E      K +  + +K  +V+ GA+ +PALL +SGL+N+NIGRNL
Sbjct: 501 KKEGRDRKIARGVAFEFEYKGTKDICVVESKVTIVACGALSTPALLKKSGLRNQNIGRNL 560

Query: 358 HVHPIAAVYGVFPN---KEI------KTYSGTIMSAISNATENVDGENYGAKIVVGSHHP 408
           H+HP+A  +G FP+    E+      K+Y G IM+A+S      +   YGA I   S HP
Sbjct: 561 HLHPVAMAWGYFPDAPESEVWPEAYKKSYEGGIMTAMSTVVAEFEQSGYGAVIQTPSLHP 620

Query: 409 GFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSK 468
           G      PW S +  +  M +++    +  + RD+  G +   +    R+ YK +  D +
Sbjct: 621 GMFSIVTPWTSGIDIRDRMRKFSRTAHIFALARDQGSGTVKAPD----RISYKPAGVDEE 676

Query: 469 SMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTY 528
           ++  G+   +RILAAAGA +IGT         V+     +   +F++F+ +     +   
Sbjct: 677 NLKKGIEKVLRILAAAGAEEIGTHHNKGRTLNVKQ----VRYHEFEKFVKEESSRSLTDL 732

Query: 529 QTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIA 588
            T   +  QM SCRMG +P +SAVN  GE WEVE LYVAD+SV PTA GV  M+T   IA
Sbjct: 733 TTPLCSAHQMGSCRMGSNPKQSAVNQTGETWEVEGLYVADTSVFPTALGVNPMVTVQAIA 792

Query: 589 HYISKCILDKKIFTVKKKR 607
           +  ++ +++     +++KR
Sbjct: 793 YCTAQSVVE----VLRRKR 807



>gi|482551883|gb|EOA16076.1| hypothetical protein CARUB_v10004208mg [Capsella rubella]
          Length = 598

 Score =  288 bits (737), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 177/485 (36%), Positives = 262/485 (54%), Gaps = 23/485 (4%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGML-TDDSNMYVLAGSNFGGGTTIGWSAF 183
           VLV+E G++Y + +LS  +    + +Y LSGG+L T D+N+ +LAGS  GGG+TI WSA 
Sbjct: 119 VLVVESGNYYARSNLSLLEGQAMEDMY-LSGGLLATSDTNVVILAGSTVGGGSTINWSAS 177

Query: 184 MEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLG 243
           ++    V +EW +   L  F  D Y  AM  +  R+G     +    +N+ L  GC++LG
Sbjct: 178 IKTPEHVMKEWTEKSKLEMFGSDLYREAMDVVCERMGVQCGFVEEGFNNEILRKGCEELG 237

Query: 244 LHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNE-AKSNNAKFLKNCYVEKILID 302
           L   NIP+N  S  H CG C  GCK G+KQ  + TWL +  +S N   L  C   ++L +
Sbjct: 238 LPVKNIPRNAPS-DHYCGHCCLGCKKGQKQGTSETWLVDLVQSGNGLILPGCKAMEVLYE 296

Query: 303 -KDGK--SQKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHV 359
            + GK   +K  GV         V + ++  VV+ GA+ +P LL RSGLKN NIGRNL +
Sbjct: 297 CEQGKKNKKKATGVAFAFGEEIYV-VESRATVVACGALRTPHLLKRSGLKNGNIGRNLCL 355

Query: 360 HPIAAVYGVF------PNKEIKTYSGTIMSAISNATENVDGENYGAKIV-VGSHHPGFMF 412
           HP+   +G F      P K+  +Y G IM+A+S+        +YG  ++   + HPG   
Sbjct: 356 HPVVMAWGWFPEGEKWPEKKKMSYEGGIMTAMSSVVNAETQSSYGETVIQTPALHPGMFS 415

Query: 413 ANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVA 472
              PW S+   K  ML+++    +  + RD+  G I    N K  ++Y L+  D +S+  
Sbjct: 416 GVTPWASSKDFKTRMLKFSRTAHIFALLRDKGTGTI----NSKSYIDYNLNDEDEESLKK 471

Query: 473 GLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQTCT 532
           GL   ++I+AAAGA +IGT  +      V       +  +F++F+ +     +       
Sbjct: 472 GLEEVLKIMAAAGAEEIGTHNSEGKSLNVRRA----SAVEFERFVREESSKPLKNLSGQI 527

Query: 533 GTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYIS 592
            +  QM SCRMG  P +SAV P GE WEVE L+VAD+SV PTA GV  M+T  +IA+ I 
Sbjct: 528 CSAHQMGSCRMGIRPEESAVRPTGETWEVEGLFVADTSVFPTALGVNPMVTVQSIAYCIG 587

Query: 593 KCILD 597
             ++D
Sbjct: 588 LNVVD 592



>gi|400599103|gb|EJP66807.1| GMC oxidoreductase [Beauveria bassiana ARSEF 2860]
          Length = 764

 Score =  288 bits (736), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 188/634 (29%), Positives = 312/634 (49%), Gaps = 47/634 (7%)

Query: 2   SLINSKILSI-----QKPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLN 56
           SL+N++  S+       PF       R+   I W +S+   +R + KS   L   +   +
Sbjct: 138 SLLNTRYGSLLLTGRWTPFVRQPLAVRQQILINWRSSRLLPLRIVLKSMNALTRKSLGAS 197

Query: 57  PYNFNPVIGYPGADPEANGSRFSSRNFPKYNFLEISDHDSD-IKEFDTXXXXXXXXXXXX 115
               N + G+     EA    +  ++   + F+++ D  S    E D             
Sbjct: 198 SRYINDLGGF-----EALPKNWERKDGFDFKFIQVPDGTSTHTIETDVIIVGSGCGGAVS 252

Query: 116 XXRLARM-ENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGG 174
              LA     VLV +KG+H+        Q      +YE +G +++  S + V AG  +GG
Sbjct: 253 AKNLAEAGHRVLVADKGYHFAPESFPLSQVSN-KHIYENNGLVISKSSAISVAAGETWGG 311

Query: 175 GTTIGWSAFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQT 234
           G T+ WS  ++PQ +VR+EW  N GLP F   E+ + +  +   LG N   I HN  N+ 
Sbjct: 312 GGTVNWSVCLKPQDYVRKEWV-NAGLPLFGSSEFDDCIDRVWTSLGANQTAIRHNHQNEV 370

Query: 235 LINGCKKLGLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNC 294
           +++G KKLG HS+   QNT    H CG C  GC   EK+   + +L +A    A+F++  
Sbjct: 371 VLHGSKKLGWHSNVCDQNTGGAEHYCGRCHLGCSANEKRGPAVAYLPDAADAGAEFIEGF 430

Query: 295 YVEKILIDKDGKSQKVMGVEVI---------------INNIKRVKIHAKRVVVSAGAIHS 339
            V++++   DG +    GVE +                   ++V I AK+V++SAG++ S
Sbjct: 431 RVDRVVFAADGVT--ATGVEGVWTARSDDGTVHSLPETRRQRKVLIKAKKVLLSAGSLWS 488

Query: 340 PALLLRSGLKNKNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGA 399
           P LL +SG+KN  +GRNL++HP A + G F N+    + G I++A +   +N+D + +G 
Sbjct: 489 PTLLQKSGVKNPQVGRNLYLHPAAFLVGHF-NELEPQWEGGIITAYNGEFQNLDKKGHGV 547

Query: 400 KIVVGSHHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRL 458
           K+   +  P  +FA  P++     K  +     +  ++ ITRDR+ GRI+ D   G P +
Sbjct: 548 KLETMAMLPYVLFAIQPFEDGFDSKLCVARMKQLHTVISITRDRDPGRIIADPVTGVPVI 607

Query: 459 EYKLSQHDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIV------------ENGVN 506
           +Y +S  D++  + G+    +++   GAT +      +  ++V            ++G +
Sbjct: 608 DYDVSSFDAEHSLDGVEAIAKLMYVMGATALYPTIPNVRPFVVARDGDAVAQKNYQDGTD 667

Query: 507 P-LNDPKFDQFLNKIKKVGIPT-YQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENL 564
           P   DP F ++L  ++ VG     +    +  QM SCRM    +   V+P G+ W  ENL
Sbjct: 668 PEFTDPTFAKWLKHLRDVGSKAGGEVSYLSAHQMGSCRMSAKKSGGVVDPKGKVWGCENL 727

Query: 565 YVADSSVLPTATGVPSMMTTMNIAHYISKCILDK 598
           YVAD SVLP+A+GV  M+T + I+ YIS+ + D+
Sbjct: 728 YVADGSVLPSASGVNPMVTILAISDYISRQLADE 761



>gi|260947498|ref|XP_002618046.1| hypothetical protein CLUG_01505 [Clavispora lusitaniae ATCC 42720]
 gi|238847918|gb|EEQ37382.1| hypothetical protein CLUG_01505 [Clavispora lusitaniae ATCC 42720]
          Length = 701

 Score =  288 bits (736), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 178/611 (29%), Positives = 304/611 (49%), Gaps = 26/611 (4%)

Query: 2   SLINSKILS-----IQKPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFW-L 55
           +++ S+ LS       K   E+   ++    + W  S + +  KI+     L   TF  +
Sbjct: 85  TVLGSRTLSPALTGTTKLLREMDDDEKARILLSWRNSPFETKNKIFSLILTLTVTTFQRI 144

Query: 56  NPYNFNPVIGYPGADPEANGSRFSSRNFPKYNFLEISDHDSD---IKEFDTXXXXXXXXX 112
            P      + +P  D   +      R+  +Y  +     ++    +   D          
Sbjct: 145 MPDLHAEAMRFPKTDARESLHEDYKRDDFEYTMMSPPVEENVELYVPHIDALIIGSGSGA 204

Query: 113 XXXXXRLARME-NVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSN 171
                 LA+     LV+EKG +Y   +   + + G+  LYE  G + T ++   +LAG+ 
Sbjct: 205 GVVAHTLAKSGIKCLVLEKGKYYKNQEFVFDDKSGFKALYEGGGNIATTNAQTLLLAGAT 264

Query: 172 FGGGTTIGWSAFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQS 231
           FGGG+TI WSA ++  + VR+EW  N G+ +   + Y   M Y+  ++G +T  I H+ +
Sbjct: 265 FGGGSTINWSACIKTPFKVRKEWYDNHGVEWVANESYDTDMDYVFQQMGASTECITHSHT 324

Query: 232 NQTLINGCKKLGLHSDNIPQNTASIT-HQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKF 290
           N+ L+ G  KLG  +  I QN    T H CG C  GCK+G KQ +   W  +A SN  +F
Sbjct: 325 NKVLLEGASKLGYPARPIHQNNGRHTNHSCGLCHLGCKWGIKQGSANHWFRDAASNGTEF 384

Query: 291 LKNCYVEKILIDKDGKSQKVMGVEVIINNIKRVKIHA----KRVVVSAGAIHSPALLLRS 346
           +    V++IL +K G     + V V   N++  KI      K+ VVS+G++ +P LL +S
Sbjct: 385 MDQVLVQRILRNKRG-----LAVGVECTNLRNGKIFTIRGPKKYVVSSGSLQTPVLLQKS 439

Query: 347 GLKNKNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSH 406
           G +N+NIG++L +HPI+A++GV+ + + + Y+ +IM++I + T ++DG+ +GA+I    H
Sbjct: 440 GFRNRNIGKHLKLHPISAIFGVW-DDDTEPYNHSIMTSICSQTADLDGKAHGARIETLLH 498

Query: 407 HPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRL--EYKLSQ 464
            P    A FPW S+ Q +Q ML+Y      +++ RD   G +  D +    L  +Y +++
Sbjct: 499 TPMLESAFFPWSSSDQLRQDMLKYQKTGAFILLARDTSSGTVSYDASKDDALLVDYTINK 558

Query: 465 HDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENG--VNPLNDPKFDQFLNKIKK 522
            D  S+   +L A  I+   G  +I      +  +          + D  + ++    + 
Sbjct: 559 FDRYSIQQAMLAAADIIYVEGGKEIIHPYWKVRRFTSSKPKEERAITDKDYQEWRKHCEN 618

Query: 523 VGIPTYQTCTGTIEQMSSCRM-GDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSM 581
           + +  +    G+  QMS+CRM G  P   A +  G  +E EN++VADSS+LPTA+G   M
Sbjct: 619 IPLSAFGLSYGSAHQMSTCRMSGKGPADGACDTTGRLYECENVFVADSSLLPTASGANPM 678

Query: 582 MTTMNIAHYIS 592
           +TTM  A + +
Sbjct: 679 ITTMAFARHTA 689



>gi|322707065|gb|EFY98644.1| long chain fatty alcohol oxidase [Metarhizium anisopliae ARSEF 23]
          Length = 771

 Score =  288 bits (736), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 184/612 (30%), Positives = 300/612 (49%), Gaps = 47/612 (7%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADPEA 73
           P  +   K RE     W+TS+   +R + K+   +      ++   F  + GY  A  + 
Sbjct: 170 PITQQPTKVREAILKSWATSRLTPLRMLAKALAQMAQKANAIHSPYFREISGYSDAPKD- 228

Query: 74  NGSRFSSRNFPKYNFLEISDHDSDIKEF--DTXXXXXXXXXXXXXXRLARM-ENVLVIEK 130
               +      +YNF+ +    + + E   D                +A     VLV++K
Sbjct: 229 ----WKPVEGYEYNFIRVP-AGTGVHEITTDVVIVGSGCGGAVSAKNIAEAGHKVLVVDK 283

Query: 131 GHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFV 190
           G+H+    L   Q  G   L++  G   +D S+M V  G  +GGG T+ WS     Q FV
Sbjct: 284 GYHFPPSQLPMTQASGSHHLFDAGGVFFSDSSSMGVACGGCWGGGGTVNWSVCFRLQDFV 343

Query: 191 REEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIP 250
           REEWA   GLP F   ++ ++M  +   +G +   I  N  NQ L++G +KLG     + 
Sbjct: 344 REEWAAA-GLPLFTSSDFDDSMDRVWDFIGASKDAIRQNPRNQALLDGTQKLGWKGGVVE 402

Query: 251 QNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQKV 310
           QNT    H CG C  GC   EK+  T+ WL  A    A+F++   V++++  +DG +   
Sbjct: 403 QNTGGKEHYCGQCHLGCGSAEKRGPTVAWLPAAGDAGAEFMEGFAVDRVVFAEDGVT--A 460

Query: 311 MGVEVI---------------INNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGR 355
           +GVE                     +RV + AK+V++S G++ SP +L +SG+KN N+G+
Sbjct: 461 VGVEGTWTARDENGGVHTPQNTRTQRRVVVKAKKVIISGGSMWSPLILTKSGIKNPNVGK 520

Query: 356 NLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANF 415
           +LH+HP+  V  +F  K++ ++ G I+++  +  EN+DG+ +G K+      P     N 
Sbjct: 521 HLHLHPVNLVSAIFGKKDLASWEGGIITSYVDEFENLDGKGHGVKL-----EP---VVNV 572

Query: 416 PWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTD-ENGKPRLEYKLSQHDSKSMVAGL 474
            W+  +  K L L+Y +I   +V+TRDR+ GR+  D   G PR++Y  S  D +  + G+
Sbjct: 573 TWRDGIDAKLLALKYRHIGTFIVLTRDRDTGRVYPDPRKGTPRIQYDTSDFDREHTIEGI 632

Query: 475 LTAVRILAAAGATKIGTCQTVIDDYIVENGV------NPLNDPKFD--QFLNKIKKVGIP 526
           +   +I    GAT+I      ++ ++  +G           DP+F   +F   IKK+ + 
Sbjct: 633 IALAKICYVTGATEIRPHLHHLEPFVASDGGKRQVEHQAGKDPEFTDPEFAAWIKKLRVA 692

Query: 527 TYQTCTG---TIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMT 583
             Q  T    +  QM SCRM  D +   V+  G+ W   NLYVAD+SV P+A+GV  M+T
Sbjct: 693 DNQGPTAMWMSAHQMGSCRMSADEDTGVVDMKGKVWGANNLYVADASVFPSASGVNPMVT 752

Query: 584 TMNIAHYISKCI 595
            M +A +IS+ +
Sbjct: 753 AMALADWISRGV 764



>gi|322698987|gb|EFY90752.1| long chain fatty alcohol oxidase [Metarhizium acridum CQMa 102]
          Length = 738

 Score =  288 bits (736), Expect = 6e-75,   Method: Compositional matrix adjust.
 Identities = 181/612 (29%), Positives = 302/612 (49%), Gaps = 47/612 (7%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADPEA 73
           P  +   K RE     W+TS+   +R + K+   +      ++   F  + GY  +D   
Sbjct: 137 PITQQPTKVREAILKSWATSRLTPLRVLAKALAQMAQKANAIHSPYFREISGY--SDVPK 194

Query: 74  NGSRFSSRNFPKYNFLEISDHDSDIKEF--DTXXXXXXXXXXXXXXRLARM-ENVLVIEK 130
           +       +   YNF++ +   + + E   D                +A     VLV++K
Sbjct: 195 DWKPVEGYD---YNFVQ-APAGTGVHEITTDVVIVGSGCGGAVSAKNIAEAGHKVLVVDK 250

Query: 131 GHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFV 190
           G+H+    L   Q  G   LY+  G   +D S+M +  G  +GGG T+ WS     Q +V
Sbjct: 251 GYHFPPSQLPMTQASGSHHLYDAGGVFFSDSSSMGIACGGCWGGGGTVNWSVCFRLQDYV 310

Query: 191 REEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIP 250
           REEWA   GLP F   ++ ++M  +   +G +   I  N  NQ L+ G +KLG     + 
Sbjct: 311 REEWAAA-GLPLFTSSDFDDSMDRVWDFIGASKDTIRQNPRNQALLEGAQKLGWKGGVVE 369

Query: 251 QNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQKV 310
           QNT    H CG C  GC   EK+  ++ WL  A    A+F++   V++++  +DG +   
Sbjct: 370 QNTGGKEHYCGQCHLGCGSAEKRGPSVAWLPAAGDAGAEFMEGFAVDRVVFAEDGVT--A 427

Query: 311 MGVEVI---------------INNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGR 355
           +GVE                     +RV I AK+V++S G++ SP +L +SG+KN N+G+
Sbjct: 428 VGVEGTWTARDENGGVHAPQNTRTQRRVVIKAKKVIISGGSMWSPVILTKSGIKNPNVGK 487

Query: 356 NLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANF 415
           +LH+HP+  V  +F NK++ ++ G I+++  +  EN+DG+ +G K+      P     N 
Sbjct: 488 HLHLHPVNLVSAIFGNKDLASWEGGIITSYVDEFENLDGKGHGVKL-----EP---VVNV 539

Query: 416 PWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTD-ENGKPRLEYKLSQHDSKSMVAGL 474
            W+  +  K L L+Y +I   +V+TRDR+ GR+ +D   G PR++Y  S  D +  + G+
Sbjct: 540 TWRDGIDAKLLALKYRHIGTFIVLTRDRDTGRVYSDPRKGTPRVQYDTSDFDREHTIEGI 599

Query: 475 LTAVRILAAAGATKIGTCQTVIDDYIVEN----------GVNP-LNDPKFDQFLNKIKKV 523
           +   +I    GAT+I      ++ ++  +          G +P   DP+F  ++ K++ V
Sbjct: 600 IALAKICYVTGATEIRPHLNHLEPFVASDGGKRQAEHQAGKDPEFTDPEFAAWIKKLRVV 659

Query: 524 GIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMT 583
                     +  QM SCRM  D +   V+  G+ W   NLYVAD+SV P+A+GV  M+T
Sbjct: 660 DNQGPTVMWMSAHQMGSCRMSADEDTGVVDMKGKVWGANNLYVADASVFPSASGVNPMVT 719

Query: 584 TMNIAHYISKCI 595
            M++A +IS+ +
Sbjct: 720 VMSLADWISRGV 731



>gi|462421371|gb|EMJ25634.1| hypothetical protein PRUPE_ppa021498mg, partial [Prunus persica]
          Length = 721

 Score =  287 bits (735), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 176/488 (36%), Positives = 267/488 (54%), Gaps = 26/488 (5%)

Query: 123 ENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSA 182
           + V+V+EKG++Y   D S+ +    D++YE  G   T D  + + AGS  GGG+ + WSA
Sbjct: 236 QKVVVLEKGNYYTHSDYSSLEGPSQDQMYESGGIFATIDGKLVIQAGSTVGGGSAVNWSA 295

Query: 183 FMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKL 242
            +     V EEWAK+  + +F E EY +AM  +  R+G     +     NQ L  GC+ L
Sbjct: 296 CIRTPDNVLEEWAKDHEIRFFGEPEYVSAMDTVCERIGVTDNCVEEGFQNQVLRKGCENL 355

Query: 243 GLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILID 302
           GL  D +P+N++   H CG C +GC+ GEK+    TWL +A  + A  L  C  EK +++
Sbjct: 356 GLGVDFVPRNSSE-KHYCGSCGYGCRKGEKKGTDSTWLLDAVDHGAVILTGCRAEKFVLE 414

Query: 303 --KDGKSQK-----VMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGR 355
             K G  +K     VMG  +  N  K+++I AK  + + GA+ +P L++ SGLKNKNIGR
Sbjct: 415 NIKSGSLRKKKCSGVMGKSLSNNISKKLQIEAKVTISACGALLTPPLMISSGLKNKNIGR 474

Query: 356 NLHVHPIAAVYGVFP--NKEI--KTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFM 411
           NLH+HP+   +G FP  N E   K Y G I++++ +   +VD +   A I   +  PG  
Sbjct: 475 NLHLHPVLMAWGYFPESNSEFKGKIYEGGIITSV-HKVASVDSK-VKAIIETPALGPGAF 532

Query: 412 FANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMV 471
            +  PW S    K+ ML+Y     L+ I RDR  G ++       R+ Y+    D +++ 
Sbjct: 533 SSLCPWVSGEDIKKRMLKYGRTCHLISIIRDRGSGIVMKG----GRVSYEFEASDKENLE 588

Query: 472 AGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTY--- 528
           AGL  A+RIL AAGA ++GT ++  D   ++     +   K ++FL+ +     P     
Sbjct: 589 AGLRQALRILIAAGAVEVGTHRS--DGLRIK--CKGIEKEKLEEFLDMVSAEKGPQSLVE 644

Query: 529 -QTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNI 587
             T   +  QM SCRMG +  + AV+  GE+WE E L+V D+SVLP+A GV  M+T  + 
Sbjct: 645 NWTTYSSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPSAVGVNPMITIQST 704

Query: 588 AHYISKCI 595
           A+ +SK I
Sbjct: 705 AYCLSKRI 712



>gi|482565395|gb|EOA29584.1| hypothetical protein CARUB_v10013046mg [Capsella rubella]
          Length = 744

 Score =  287 bits (734), Expect = 9e-75,   Method: Compositional matrix adjust.
 Identities = 172/494 (34%), Positives = 272/494 (55%), Gaps = 44/494 (8%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG +Y   +    +  G DKLYE  G + + D N+ VLAG+  GGG+ + WSA +
Sbjct: 256 VVVLEKGSYYTPSEYLPFEGPGMDKLYENGGILPSVDGNIMVLAGATVGGGSAVNWSACI 315

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +    V +EW+++  +P+F   EY  AM+ +  R+G      + +  NQ L  GC+ LG 
Sbjct: 316 KTPKTVLQEWSEDQKIPFFGTKEYVLAMEAVWERMGVTEKCEMESLQNQVLRKGCENLGF 375

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD 304
           + +N+P+N++   H CG C +GC+ G+K+ +  TWL +A S+ A  L     E+ +++K+
Sbjct: 376 NVENVPRNSSE-KHYCGSCGYGCRQGDKKGSDRTWLVDAVSHGAVILTGSKAERFILEKN 434

Query: 305 -----GKSQKVMGV--EVIINNI-KRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRN 356
                GK  K +GV  + +  NI K++KI AK  V + GA+ +P L++ SGL+N++IGRN
Sbjct: 435 CSNKGGKKMKCLGVVAKSLNGNIEKKIKIEAKVTVSAGGALLTPPLMISSGLRNRHIGRN 494

Query: 357 LHVHPIAAVYGVFPNK-------EIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPG 409
           LH+HP+   +G FP+K       + K+Y G I++++S      D E   A I   +  PG
Sbjct: 495 LHLHPVLMAWGYFPDKASSNFNIKGKSYEGGIITSVSKVLSE-DSE-VRAIIETPALGPG 552

Query: 410 FMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKS 469
                 PW S L  K+ M  Y+    L+ I RDR  G + T+     R+ Y + + D  +
Sbjct: 553 SFSVLCPWTSGLDMKKRMARYSRTANLITIVRDRGSGEVKTE----GRISYVVDKTDRDN 608

Query: 470 MVAGLLTAVRILAAAGATKIGT---------CQTVIDDYIVE--NGVNPLNDPKFDQFLN 518
           + AGL  ++RIL AAGA ++GT         C+ V +D I E  + V+    PK      
Sbjct: 609 IKAGLRQSLRILIAAGAEEVGTHRSDGQRLICKGVDEDSIQEFLDAVSTEEGPK------ 662

Query: 519 KIKKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGV 578
                G+        +  QM SCR+G++  + A++  GE+WE E L+V D+S LP+A GV
Sbjct: 663 -----GMTEKWNVYSSAHQMGSCRIGENEKEGAIDLNGESWEAEKLFVCDASALPSAVGV 717

Query: 579 PSMMTTMNIAHYIS 592
             M+T M+ A+ IS
Sbjct: 718 NPMITVMSTAYCIS 731



>gi|18403753|ref|NP_566729.1| long-chain-alcohol oxidase FAO3 [Arabidopsis thaliana]
 gi|75274448|sp|Q9LW56.1|FAO3_ARATH RecName: Full=Long-chain-alcohol oxidase FAO3; AltName:
           Full=Long-chain fatty alcohol oxidase 3
 gi|13605692|gb|AAK32839.1|AF361827_1 AT3g23410/MLM24_23 [Arabidopsis thaliana]
 gi|11994326|dbj|BAB02285.1| unnamed protein product [Arabidopsis thaliana]
 gi|27363420|gb|AAO11629.1| At3g23410/MLM24_23 [Arabidopsis thaliana]
 gi|332643241|gb|AEE76762.1| long-chain-alcohol oxidase FAO3 [Arabidopsis thaliana]
          Length = 746

 Score =  286 bits (732), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 164/489 (33%), Positives = 271/489 (55%), Gaps = 34/489 (6%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG ++   +    +  G DKLYE  G + + D +  VLAG+  GGG+ + WSA +
Sbjct: 258 VVVLEKGSYFTPSEHRPFEGPGLDKLYENGGILPSVDGSFMVLAGATVGGGSAVNWSACI 317

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +    V +EW+++  +P F   EY  AM+ +  R+G      + +  NQ L  GC+ LG 
Sbjct: 318 KTPKSVLQEWSEDQNIPLFGTKEYLTAMEVVWKRMGVTEKCELESFQNQILRKGCENLGF 377

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD 304
           + +N+P+N++  +H CG C +GC+ G+K+ +  TWL +A  + A  L  C  E+ +++K+
Sbjct: 378 NVENVPRNSSE-SHYCGSCGYGCRQGDKKGSDRTWLVDAVGHGAVILTGCKAERFILEKN 436

Query: 305 -----GKSQKVMGV--EVIINNI-KRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRN 356
                GK  K +GV  + +  NI K +KI AK  V + GA+ +P L++ SGL+N+NIG+N
Sbjct: 437 GSNKGGKQMKCLGVMAKSLNGNIAKMLKIEAKVTVSAGGALLTPPLMISSGLRNRNIGKN 496

Query: 357 LHVHPIAAVYGVFPNKEIK-------TYSGTIMSAISNATENVDGENYGAKIVVGSHH-- 407
           LH+HP+   +G FP+KE         +Y G I++++S     V  E+   + ++ +    
Sbjct: 497 LHLHPVLMAWGYFPDKESSNISFKGNSYEGGIITSVS----KVLSEDSEVRAIIETPQLG 552

Query: 408 PGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDS 467
           PG      PW S L  K+ M  Y+    L+ I RDR  G + T+     R+ Y + + D 
Sbjct: 553 PGSFSVLTPWTSGLDMKKRMARYSRTASLITIVRDRGSGEVKTE----GRINYTVDKTDR 608

Query: 468 KSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIK----KV 523
            ++ AGL  ++RIL AAGA ++GT ++     I +     +N+    +FL+ +       
Sbjct: 609 DNLKAGLRESLRILIAAGAEEVGTHRSDGQRLICKG----VNENSIQEFLDSVSTEEGAK 664

Query: 524 GIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMT 583
           G+        +  QM SCR+G++  + A++  GE+WE E L+V D+S LP+A GV  M+T
Sbjct: 665 GMTEKWNVYSSAHQMGSCRIGENEKEGAIDLNGESWEAEKLFVCDASALPSAVGVNPMIT 724

Query: 584 TMNIAHYIS 592
            M+ A+ IS
Sbjct: 725 VMSTAYCIS 733



>gi|302767562|ref|XP_002967201.1| hypothetical protein SELMODRAFT_87684 [Selaginella moellendorffii]
 gi|300165192|gb|EFJ31800.1| hypothetical protein SELMODRAFT_87684 [Selaginella moellendorffii]
          Length = 724

 Score =  286 bits (732), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 199/626 (31%), Positives = 295/626 (47%), Gaps = 53/626 (8%)

Query: 13  KPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFW--LNPYNFNPV---IGYP 67
           +PF  L   +RE   + WS S +  ++ ++K         F+   +    NP    IGY 
Sbjct: 90  QPFPLLELGKREKILLNWSRSIFHKLQMLFKVVKCYTLFKFYSRADKKGRNPAWKAIGYE 149

Query: 68  GADP-----------------EANGSRFSSR-------NFPKYNFLE-------ISDHDS 96
             +P                 +A    F SR          K + LE        S  D 
Sbjct: 150 VPEPVLEHEEPLPSPLERRLVDAKAPDFQSRLAELGCAMLDKVDHLEERNDPSTASGKDF 209

Query: 97  DIKEFDTXXXXXXXXXXXXXXRLARME-NVLVIEKGHHYDQCDLSTEQQDGYDKLYELSG 155
            IK  D               RLA+    V+V+EKG ++ +  LS  +      +YE SG
Sbjct: 210 GIK-CDVVVVGSGSGGSVIAARLAQQGFKVVVLEKGGYFPRRGLSLLEGPSMKAMYEQSG 268

Query: 156 GMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVREEWAKNFGLP-YFMEDEYGNAMKY 214
            + T+D ++ +LAG+  GGG+ + W+A ++    V +EW  + GL   F   EY +AM+ 
Sbjct: 269 ALTTEDGSVILLAGTTLGGGSAVNWAASLKTPKHVLDEWT-SLGLENRFGGPEYQHAMEA 327

Query: 215 INARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQNTASITHQCGWCSFGCKYG---E 271
           +  RLG        +  N+ L  GC + G    +IP+N A   H CG+C FGC       
Sbjct: 328 VCQRLGVQDGCTEESFQNRVLRRGCTEKGYSVGDIPRNAAR-DHGCGFCGFGCPAAAAVR 386

Query: 272 KQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDG----KSQKVMGVEVIINNIKRVKIHA 327
           KQSA  TWL +A +  A  +  C V++I+    G    +S +  G+        R  + +
Sbjct: 387 KQSACDTWLCDAATAGAVVVTGCRVDRIVTAPQGGQGERSYRARGISSRAGE-ARFYVES 445

Query: 328 KRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYGVFPNKEI---KTYSGTIMSA 384
           +  V + GA+ +P LL RSG +N +IGR+L VHP+ A +G FP ++I    +Y+G IM+A
Sbjct: 446 RVTVAACGALFTPPLLRRSGGRNPHIGRHLSVHPVVAAWGYFPREDILPGNSYTGGIMTA 505

Query: 385 ISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDRE 444
            S+     D   YG+ +     HPG      PW+S +  K+ ML +     ++V+ RDR 
Sbjct: 506 FSSEAARWDTTGYGSILETPCVHPGNYAVLAPWRSGVDAKRQMLRFPRTATIIVLNRDRG 565

Query: 445 GGRILTDENGKPRLEYKLSQHDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENG 504
            G +     GK  L+Y L   D +S+V G   AVR L AAGA  +G      + + V+  
Sbjct: 566 RGTVDETPGGKLILDYPLCFSDRESLVEGTELAVRALVAAGAEAVGLHSVAGEIFSVDQS 625

Query: 505 VNPLNDPK-FDQFLNKIKKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVEN 563
             PL   K  + FL ++         T   +  QM SCRMG D   S V+P  E+WEVE 
Sbjct: 626 WTPLQREKELEIFLKRVLGRMFQRLSTPIISAHQMGSCRMGTDQRCSVVDPNCESWEVEG 685

Query: 564 LYVADSSVLPTATGVPSMMTTMNIAH 589
           L+V D SVLPTA+GV  M+T  +IAH
Sbjct: 686 LFVGDGSVLPTASGVNPMITIQSIAH 711



>gi|302499400|ref|XP_003011696.1| hypothetical protein ARB_02250 [Arthroderma benhamiae CBS 112371]
 gi|291175248|gb|EFE31056.1| hypothetical protein ARB_02250 [Arthroderma benhamiae CBS 112371]
          Length = 749

 Score =  285 bits (730), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 189/609 (31%), Positives = 294/609 (48%), Gaps = 37/609 (6%)

Query: 12  QKPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADP 71
           + PF       R      W +S    +R  +++   L   ++  +  +   V+G+P    
Sbjct: 134 RTPFQHQPYHVRRQILSSWRSSYLPLLRAAHRALVALTKKSWVGSSPSLPLVLGFPNV-- 191

Query: 72  EANGSRFSSRNFPKYNFLEISDHDS-DIKEFDTXXXXXXXXXXXXXXRLARM-ENVLVIE 129
             +G+  +S  FP Y+FL+    D  +I E D                LA     V+V+E
Sbjct: 192 PVHGA--TSEGFP-YSFLQFPAGDGPEIIETDVVIVGSGCGAGVAAKNLAEAGHRVIVVE 248

Query: 130 KGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYF 189
           K + +          +G   L+   G  L+DD ++ V++GS +GGG TI WSA ++ Q  
Sbjct: 249 KSYFFPNDHYPMSGSEGAFHLFSNGGAELSDDGSIGVVSGSTWGGGGTINWSASLQTQSM 308

Query: 190 VREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNI 249
           VREEWA N GLP F    Y  ++  +   +G +T  I  N  N  L+ G +KLG  +  +
Sbjct: 309 VREEWA-NSGLPLFTSSAYQTSLDRVCDYMGVSTDFIQQNHGNSVLMEGARKLGYSAKAV 367

Query: 250 PQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQK 309
           PQNT    H CG+C+ GC  G KQ   +T+L +A    A F++    EK+L  +     K
Sbjct: 368 PQNTGHQKHACGYCALGCAAGIKQGPAVTFLADAARAGATFIEGFKAEKVLFGRKLVKGK 427

Query: 310 VMGVEVIINNIKR---VKIHAKRVVV------------SAGAIHSPALLLRSGLKNKNIG 354
            + + V      R      H K  +             S G + SP LLLRSGLKN  IG
Sbjct: 428 KVAIGVRGTWTSRDASGATHGKPAITRKVVIKAKKVVVSCGTLESPLLLLRSGLKNPQIG 487

Query: 355 RNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFAN 414
           RNLH+HP+  +  +F + E + + G+I++++ +  EN+DG  +G+KI      P F    
Sbjct: 488 RNLHLHPVIIMSAMF-DHETRPWEGSILTSLVSDFENLDGRGHGSKIEAVVMLPNFFLPL 546

Query: 415 FPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDEN-GKPRLEYKLSQHDSKSMVAG 473
             W + L +K        +   + +TRDR+ GR+  D N G+ R+EY  S  D K ++ G
Sbjct: 547 MAWDNGLDYKIFAANARRMAGFISLTRDRDTGRVYPDPNDGRCRIEYTPSAFDRKHILEG 606

Query: 474 LLTAVRILAAAGATKIGTCQTVIDDYI--------VENGVNPLNDPKFDQFLNKIKK-VG 524
           ++ A +I   +GA +I +    I  +          + GV   N+  F +++ K++  V 
Sbjct: 607 IIGAAKIAYVSGAREIRSSSLAIPTFTRPETSSDAADEGV---NNAAFQEWVKKLRTGVP 663

Query: 525 IPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTT 584
           +PT Q+   +  QM +CRMG  P  S V+P G  W    LYVAD+SV P+A+GV  M+T 
Sbjct: 664 LPTEQSMFASAHQMGTCRMGISPKTSVVDPTGMVWGTSGLYVADASVFPSASGVNPMVTN 723

Query: 585 MNIAHYISK 593
           M I    S+
Sbjct: 724 MAITDVTSR 732



>gi|22798796|emb|CAC87643.1| alcohol oxidase [Arabidopsis thaliana]
          Length = 678

 Score =  285 bits (730), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 164/489 (33%), Positives = 271/489 (55%), Gaps = 34/489 (6%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG ++   +    +  G DKLYE  G + + D +  VLAG+  GGG+ + WSA +
Sbjct: 190 VVVLEKGSYFTPSEHRPFEGPGLDKLYENGGILPSVDGSFMVLAGATVGGGSAVNWSACI 249

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +    V +EW+++  +P F   EY  AM+ +  R+G      + +  NQ L  GC+ LG 
Sbjct: 250 KTPKSVLQEWSEDQNIPLFGTKEYLTAMEVVWKRMGVTEKCELESFQNQILRKGCENLGF 309

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD 304
           + +N+P+N++  +H CG C +GC+ G+K+ +  TWL +A  + A  L  C  E+ +++K+
Sbjct: 310 NVENVPRNSSE-SHYCGSCGYGCRQGDKKGSDRTWLVDAVGHGAVILTGCKAERFILEKN 368

Query: 305 -----GKSQKVMGV--EVIINNI-KRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRN 356
                GK  K +GV  + +  NI K +KI AK  V + GA+ +P L++ SGL+N+NIG+N
Sbjct: 369 GSNKGGKQMKCLGVMAKSLNGNIAKMLKIEAKVTVSAGGALLTPPLMISSGLRNRNIGKN 428

Query: 357 LHVHPIAAVYGVFPNKEIK-------TYSGTIMSAISNATENVDGENYGAKIVVGSHH-- 407
           LH+HP+   +G FP+KE         +Y G I++++S     V  E+   + ++ +    
Sbjct: 429 LHLHPVLMAWGYFPDKESSNISFKGNSYEGGIITSVS----KVLSEDSEVRAIIETPQLG 484

Query: 408 PGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDS 467
           PG      PW S L  K+ M  Y+    L+ I RDR  G + T+     R+ Y + + D 
Sbjct: 485 PGSFSVLTPWTSGLDMKKRMARYSRTASLITIVRDRGSGEVKTE----GRINYTVDKTDR 540

Query: 468 KSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIK----KV 523
            ++ AGL  ++RIL AAGA ++GT ++     I +     +N+    +FL+ +       
Sbjct: 541 DNLKAGLRESLRILIAAGAEEVGTHRSDGQRLICKG----VNENSIQEFLDSVSTEEGAK 596

Query: 524 GIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMT 583
           G+        +  QM SCR+G++  + A++  GE+WE E L+V D+S LP+A GV  M+T
Sbjct: 597 GMTEKWNVYSSAHQMGSCRIGENEKEGAIDLNGESWEAEKLFVCDASALPSAVGVNPMIT 656

Query: 584 TMNIAHYIS 592
            M+ A+ IS
Sbjct: 657 VMSTAYCIS 665



>gi|218191193|gb|EEC73620.1| hypothetical protein OsI_08118 [Oryza sativa Indica Group]
          Length = 770

 Score =  285 bits (729), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 165/485 (34%), Positives = 255/485 (52%), Gaps = 21/485 (4%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+VIEKG+++   D ++ +    ++LYE  G + T +    +LAGS  GGG+ + WSA +
Sbjct: 288 VVVIEKGNYFTSRDYTSFEGPSINQLYESGGFVTTMNGGGLLLAGSTVGGGSAVNWSACL 347

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +   FVR EWA   GLP F   +Y  AM  +  RLG  +        N+ L  GC+KLG 
Sbjct: 348 KTPEFVRREWAAAHGLPLFASPDYAAAMDKVFERLGVTSGCTEEGLQNKVLRKGCEKLGY 407

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD 304
             D + +N+ S  H CG C FGC+ G+K+    TWL +A    A  L  C  EK+++++ 
Sbjct: 408 KVDAVARNS-SEGHYCGSCGFGCRTGDKRGTDTTWLVDAVGRGAVILTGCKAEKLVLERG 466

Query: 305 G-KSQKVMGVEVIINN---IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVH 360
           G + ++ +GV     N    K +++ AK  V +AG++ +P LL RSGL N +IG+NLH+H
Sbjct: 467 GARGRRCVGVVARSTNPAITKTLEVRAKVTVSAAGSLLTPVLLQRSGLTNPHIGKNLHLH 526

Query: 361 PIAAVYGVFPNK----EIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFP 416
           P A  +G FP+     + K Y G I++++     +  G  + A +              P
Sbjct: 527 PTALAWGYFPDTMPDLKGKAYEGGIITSMHKVETSGAGAPHRAILETPMMAVAATGTQMP 586

Query: 417 WKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGLLT 476
           W S    K+ ML +   V +  + RDR  G +    +G+ R+ Y+L   D + +  GL  
Sbjct: 587 WLSGRDSKERMLRFARTVHIFSLVRDRGSGTV----HGERRVAYRLDAADREDIRDGLRR 642

Query: 477 AVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQTCT---- 532
           A+R+L AAGA ++GT ++       E     L +   ++FL+ +  V  P  ++ T    
Sbjct: 643 ALRVLVAAGAAEVGTHRSDGQRLRCEG----LTEESLEEFLDGVTVVRGPQSRSETWGLF 698

Query: 533 GTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYIS 592
            +   M SCRMG      AV+  GE+WE E LYV D SVLPTA GV  M+T  ++A+ ++
Sbjct: 699 CSAHHMGSCRMGATAGDGAVDARGESWEAERLYVCDGSVLPTAVGVNPMITIQSVAYCLA 758

Query: 593 KCILD 597
             I D
Sbjct: 759 NGIAD 763



>gi|294657204|ref|XP_459506.2| DEHA2E04268p [Debaryomyces hansenii CBS767]
 gi|199432514|emb|CAG87732.2| DEHA2E04268p [Debaryomyces hansenii CBS767]
          Length = 699

 Score =  285 bits (729), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 175/595 (29%), Positives = 302/595 (50%), Gaps = 26/595 (4%)

Query: 15  FHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFW-LNPYNFNPVIGYPGADP-- 71
             ++  K+RE     W  S   S R+++K    L   TF  L P   N VIGYPG +   
Sbjct: 101 IRDMGYKEREELLRSWQNSNLESFRRLFKLLYSLSITTFIKLCPDLHNQVIGYPGKEMRD 160

Query: 72  ------EANGSRFSSRNFPKYNFLEISDHDSDIKEFDTXXXXXXXXXXXXXXRLARMENV 125
                 E +  R+S    P  + L   + D  I    +              +       
Sbjct: 161 EIYENIEIDPFRYSMLEHPTGDELYAPNIDVLIIGSGSGAGVVAHTLSNDGHK------C 214

Query: 126 LVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFME 185
           LV+EKG ++   +L  +++DG   LYE  G + T +    +LAGS FGGG+T+ WSA ++
Sbjct: 215 LVLEKGKYFHPTELVFDEKDGNKNLYESRGVLTTVNQQTMILAGSTFGGGSTVNWSACLK 274

Query: 186 PQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLH 245
             + VR+EW  ++G+ +   + Y     Y+  ++G    ++ H+ SNQ ++NG +KLG  
Sbjct: 275 TPFKVRKEWYDDYGVDWAANELYDKCADYVWNKMGATLDSVKHSFSNQVILNGAEKLGYT 334

Query: 246 SDNIPQNTAS-ITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD 304
           +  + QN  +   H CG+C  GCK+  KQ ++  W  +A     +F+    V K+L    
Sbjct: 335 AKPVEQNNGNHPNHSCGFCHLGCKFNVKQGSSACWFRDASEKGCQFMDQVKVVKVL-HSG 393

Query: 305 GKSQKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAA 364
           GK+   +  +    +   +K   K+ VV  G++++P +L  SG KNKNIG NL +HP+  
Sbjct: 394 GKAVGALCQDTQTGHEFTIK-GPKKFVVCGGSLNTPVVLQNSGFKNKNIGANLKLHPVTV 452

Query: 365 VYGVF-PNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQH 423
           ++G F  +   K ++ +I++ +    +++DG+ +GAKI    H P       PW+S+ + 
Sbjct: 453 IFGDFGKDNNTKPFNESILTTVCTEVDDLDGKAHGAKIETVLHTPLLESVFMPWQSSDKA 512

Query: 424 KQLMLEYNNIVPLMVITRDREGGRILTDENGKPR---LEYKLSQHDSKSMVAGLLTAVRI 480
           +Q +L YN++  +++ITRD+  G I  D   KP    ++Y ++++D  +++  +L +  +
Sbjct: 513 RQDLLRYNHLAAMLIITRDKSSGTIRADAT-KPDSLIIDYSINKYDRNALLQAILVSADM 571

Query: 481 LAAAGATKIGTCQTVIDDYIVENG--VNPLNDPKFDQFLNKIKKVGIPTYQTCTGTIEQM 538
           L   GA +I   Q  + ++          + D  + Q+   + K  + T+    G+  QM
Sbjct: 572 LYVEGAKEIIHPQRWVPNFQSNKPKEERSVKDRDYVQWRESVSKTKLDTFGCPYGSAHQM 631

Query: 539 SSCRM-GDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYIS 592
           SSCR+ G  P   A +  G  +E +N+YVAD+S +PTA+G   M++TM+IA  I+
Sbjct: 632 SSCRISGKGPKYGACDNKGRLYECKNVYVADASAMPTASGANPMISTMSIARLIA 686



>gi|300680944|sp|B5WWZ8.1|FAO1_LOTJA RecName: Full=Long-chain-alcohol oxidase FAO1; AltName:
           Full=Long-chain fatty alcohol oxidase 1
 gi|209570220|emb|CAP15762.1| long chain fatty alcohol oxidase FAO1 [Lotus japonicus]
          Length = 749

 Score =  285 bits (728), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 174/498 (34%), Positives = 273/498 (54%), Gaps = 42/498 (8%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG+++   D S+ +    D+LYE  G + + DS + +LAGS  GGG+ + WSA +
Sbjct: 262 VVVLEKGNYFAPRDYSSLEGPSMDQLYETGGILASVDSRILLLAGSTVGGGSAVNWSACI 321

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +  + V +EW++N  L  F   EY +AM+ +  R+G           NQ L  GC+ LGL
Sbjct: 322 KTPHEVLKEWSENHNLSLFSTSEYLSAMETVCERIGVTESCTHEGFQNQVLRKGCQNLGL 381

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD 304
             D +P+N++   H CG C +GC  GEKQ    TWL +A  N A  +  C  E+ L++ +
Sbjct: 382 KVDYVPRNSSG-NHFCGSCGYGCPKGEKQGTQDTWLVDAVENGAVIITGCKAERFLLENN 440

Query: 305 ----GKSQKVMGV--EVIINNIK-RVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
               G+ +K +GV  + + + +  +++I AK  + + GA+ +P L++ SGLKNKNIG+NL
Sbjct: 441 RNGSGRKKKCLGVLAKALSSRVTMKLQIEAKVTISAGGALLTPPLMISSGLKNKNIGKNL 500

Query: 358 HVHPIAAVYGVFPNK----EIKTYSGTIMSAISNATENVDGENYG---AKIVVGSHHPGF 410
           H+HP+   +G FP      + K + G I++++       D  +Y    A I   S  PG 
Sbjct: 501 HLHPVLMTWGYFPESTSELKGKIFEGGIITSVHKVPSR-DSNSYSDTRAIIETPSLGPGS 559

Query: 411 MFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSM 470
             +  PW+S L  K+ ML Y     L+ I RD+  G++ T+     R+ YKLS  D ++M
Sbjct: 560 FASLCPWESGLDFKERMLNYPRTAHLITIIRDKACGQVTTE----GRVSYKLSAFDKENM 615

Query: 471 VAGLLTAVRILAAAGATKIGT---------CQTVIDDYIVE--NGVNPLNDPKFDQFLNK 519
             GL  A+RIL AAGA ++GT         C  V ++ + E  + V P+     +  L+ 
Sbjct: 616 KCGLQQALRILKAAGAVEVGTHRSDGQRVKCGEVSENEMAEFIDSVCPM-----EGALSP 670

Query: 520 IKKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVP 579
            +   I T      +  QM SCRMG +  + AV+  GE+WE + L+V D+S+LPTA GV 
Sbjct: 671 GENWNIYT------SAHQMGSCRMGMNEKEGAVDENGESWEAQGLFVCDASLLPTAVGVN 724

Query: 580 SMMTTMNIAHYISKCILD 597
            M+T  + A+ IS  ++D
Sbjct: 725 PMITIQSTAYCISNRVVD 742



>gi|115447369|ref|NP_001047464.1| Os02g0621800 [Oryza sativa Japonica Group]
 gi|47847770|dbj|BAD21547.1| putative alcohol oxidase [Oryza sativa Japonica Group]
 gi|113536995|dbj|BAF09378.1| Os02g0621800 [Oryza sativa Japonica Group]
          Length = 770

 Score =  285 bits (728), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 165/485 (34%), Positives = 255/485 (52%), Gaps = 21/485 (4%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+VIEKG+++   D ++ +    ++LYE  G + T +    +LAGS  GGG+ + WSA +
Sbjct: 288 VVVIEKGNYFTSRDYTSFEGPSINQLYESGGFVTTMNGGGLLLAGSTVGGGSAVNWSACL 347

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +   FVR EWA   GLP F   +Y  AM  +  RLG  +        N+ L  GC+KLG 
Sbjct: 348 KTPEFVRREWAAAHGLPLFATPDYAAAMDKVFERLGVTSGCTEEGLQNKVLRKGCEKLGY 407

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD 304
             D + +N+ S  H CG C FGC+ G+K+    TWL +A    A  L  C  EK+++++ 
Sbjct: 408 KVDAVARNS-SEGHYCGSCGFGCRTGDKRGTDTTWLVDAVGRGAVILTGCKAEKLVLERG 466

Query: 305 G-KSQKVMGVEVIINN---IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVH 360
           G + ++ +GV     N    K +++ AK  V +AG++ +P LL RSGL N +IG+NLH+H
Sbjct: 467 GARGRRCVGVVARSTNPAITKTLEVRAKVTVSAAGSLLTPVLLQRSGLTNPHIGKNLHLH 526

Query: 361 PIAAVYGVFPNK----EIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFP 416
           P A  +G FP+     + K Y G I++++     +  G  + A +              P
Sbjct: 527 PTALAWGYFPDTMPDLKGKAYEGGIITSMHKVETSGAGAPHRAILETPMMAVAATGTQMP 586

Query: 417 WKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGLLT 476
           W S    K+ ML +   V +  + RDR  G +    +G+ R+ Y+L   D + +  GL  
Sbjct: 587 WLSGRDSKERMLRFARTVHIFSLVRDRGSGTV----HGERRVAYRLDAADREDIRDGLRR 642

Query: 477 AVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQTCT---- 532
           A+R+L AAGA ++GT ++       E     L +   ++FL+ +  V  P  ++ T    
Sbjct: 643 ALRVLVAAGAAEVGTHRSDGQRLRCEG----LTEEALEEFLDGVTVVRGPQSRSETWGLF 698

Query: 533 GTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYIS 592
            +   M SCRMG      AV+  GE+WE E LYV D SVLPTA GV  M+T  ++A+ ++
Sbjct: 699 CSAHHMGSCRMGATAGDGAVDARGESWEAERLYVCDGSVLPTAVGVNPMITIQSVAYCLA 758

Query: 593 KCILD 597
             I D
Sbjct: 759 NGIAD 763



>gi|389632529|ref|XP_003713917.1| long chain fatty acid oxidase [Magnaporthe oryzae 70-15]
 gi|351646250|gb|EHA54110.1| long chain fatty acid oxidase [Magnaporthe oryzae 70-15]
          Length = 788

 Score =  285 bits (728), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 176/627 (28%), Positives = 299/627 (47%), Gaps = 49/627 (7%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGY------- 66
           P HE     RE     WS S+   +R + KS +M     +      F    GY       
Sbjct: 157 PVHEQPLHIREAIVRGWSVSRLTDIRLLVKSLSMFAQIAWLQCSPLFKQASGYIDVPHNW 216

Query: 67  -PGADPEANGSRFSSRNFPKYNFLEISDHDSDIKEFDTXXXXXXXXXXXXXXRLARM-EN 124
            PG   +    +F      + N   +S     + + D                L+     
Sbjct: 217 KPGPSFDFEFLQFGRPPNVEDNLAPVS---PAVIDTDIVIVGSGCGGGVCAKILSEAGHK 273

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V++KG+++        Q+ G   L E  G ++T D +  + AGS +GGG TI WS  +
Sbjct: 274 VVVVDKGYYFTPDQFPMPQEQGSRLLCENGGVVVTADGSTNIAAGSTWGGGGTINWSVCL 333

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTIN---IIHNQSNQTLINGCKK 241
           + Q FVR EW+++ GL +F  +E+ + +  +   +G    +   +      Q L++GC+K
Sbjct: 334 QTQGFVRREWSQDRGLVFFETEEFQDCLDRVCDYMGAGRGSEHAVKQTHRGQVLLDGCRK 393

Query: 242 LGLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILI 301
           LG H+  +PQN+    H CG C  GC   EKQS  ++WL  AK   A F++   V+KI  
Sbjct: 394 LGWHAAALPQNSGGAEHWCGRCMMGCGSAEKQSPAVSWLPAAKKAGATFIEGFQVDKITF 453

Query: 302 DKDGKSQKVMGVEVIINN---------------IKRVKIHAKRVVVSAGAIHSPALLLRS 346
           D+    +   GV     +               +++V I AK+V+VSAG++ SP +L +S
Sbjct: 454 DEASGGKVATGVVGTWTSRDSSGGVTGPKEQRAVRKVSIKAKKVIVSAGSLWSPVILSKS 513

Query: 347 GLKNKNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSH 406
           G+KN+++G NL++HP   + G +  ++I+ + G I+++   + E++DG  +G K+     
Sbjct: 514 GVKNRHLGHNLYLHPCNFI-GAYYKEDIQAWDGGIITSFCTSFEDLDGHGHGVKLEPTCQ 572

Query: 407 HPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQH 465
            P    +  PWKS+   K   ++Y ++   + +TRDR+ GRI  D   G P + Y  S  
Sbjct: 573 IPYTNMSMLPWKSSTDFKAAAIKYRHMDVYIALTRDRDSGRIQVDPTTGTPVVHYTPSDF 632

Query: 466 DSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYI-----------------VENGVNPL 508
           D    + G++   +     GAT+I      ++ +I                 V+     +
Sbjct: 633 DRAHTLEGVIATAKCCYLMGATEIRAFLPGVEPFIRRPTSASSTTSADTNDDVKKSNLGV 692

Query: 509 NDPKFDQFLNKIKKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVAD 568
           +DP F  ++ ++++VG         +  QM +CRMG +  +  V+P G  W  +NL+VAD
Sbjct: 693 SDPDFAAWIKEVRRVGNRPPVAPFSSAHQMGTCRMGINEGEGVVDPKGHVWGYKNLFVAD 752

Query: 569 SSVLPTATGVPSMMTTMNIAHYISKCI 595
           +SV P+A+GV  M+T M I+ YI++ +
Sbjct: 753 ASVFPSASGVNPMITNMAISDYIARGV 779



>gi|502153883|ref|XP_004509495.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Cicer arietinum]
          Length = 824

 Score =  284 bits (727), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 173/494 (35%), Positives = 260/494 (52%), Gaps = 35/494 (7%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           VLV+EKG ++ + ++S  +    D++Y  +G + T D ++ +LAGS  GGG+TI WSA +
Sbjct: 339 VLVLEKGSYFARNNVSLLEGPTMDQMYLSNGLIATTDMSVLILAGSTVGGGSTINWSASI 398

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +  + V +EW     L  F    Y  AM  +  ++G  +       +N  L  GC ++G 
Sbjct: 399 KTPHHVCKEWCDIHELELFESTLYKEAMDVVCKKMGVQSDFEEEGFNNAVLRKGCHEMGY 458

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNE-AKSNNAKFLKNCYVEKIL-ID 302
             +NIP+N A   H CGWC  GCK G K+  + TWL +  KS N   L  C   +IL  +
Sbjct: 459 PVNNIPRN-APPNHYCGWCCMGCKDGTKKGTSETWLVDLVKSGNGAILPKCEAIQILHRE 517

Query: 303 KDGKSQKVM-GVEVII---NNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLH 358
           K G  +K   GV   I    N     + +K  +++ GA+ +P+LL RSGLKN+NIGRNLH
Sbjct: 518 KKGSDRKTASGVAFAIEYNGNKDICVVESKVTIIACGALSTPSLLKRSGLKNENIGRNLH 577

Query: 359 VHPIAAVYGVFPN----------KEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHP 408
           +HP+   +G FPN          +  K+Y G IM+A+S      +   YGA I   S HP
Sbjct: 578 LHPVTMAWGYFPNSPSSSKLWPEEHKKSYEGGIMTAMSTVVAEFNKSGYGAVIQTPSLHP 637

Query: 409 GFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSK 468
           G      PW S +  K  M +++    +  + RD+  G +    +    + Y +   D +
Sbjct: 638 GLFSILMPWNSGMDIKDRMRKFSRTAHVFALARDQGSGTV----DSPSCISYHMKDADKE 693

Query: 469 SMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPK-----FDQFLNKIKKV 523
           ++  G+   +RILAAAGA +IGT           N  N LN  K     F++F+ +   +
Sbjct: 694 NLKKGIEKVLRILAAAGAEEIGTHN---------NKGNRLNVKKVSYHEFEKFVKEESSM 744

Query: 524 GIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMT 583
            +    T   +  QM SCRMG++P  S VN +GE WEVE+LY+AD+SV PTA GV  M+T
Sbjct: 745 ELTDLSTPICSAHQMGSCRMGNNPKDSVVNQMGETWEVEDLYIADASVFPTALGVNPMVT 804

Query: 584 TMNIAHYISKCILD 597
              IA+  ++ +L+
Sbjct: 805 IQAIAYCTAQHVLE 818



>gi|149238970|ref|XP_001525361.1| hypothetical protein LELG_03289 [Lodderomyces elongisporus NRRL
           YB-4239]
 gi|146450854|gb|EDK45110.1| hypothetical protein LELG_03289 [Lodderomyces elongisporus NRRL
           YB-4239]
          Length = 704

 Score =  284 bits (727), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 177/589 (30%), Positives = 302/589 (51%), Gaps = 16/589 (2%)

Query: 17  ELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFW-LNPYNFNPVIGYPGADPEANG 75
           ++  KQRE        S  ++ RK+++    L    F  L     N  I YPG     + 
Sbjct: 106 DMDLKQREALIASLRDSPISAKRKLFRLVCSLTLKVFASLGDELHNKAIHYPGKSVRESA 165

Query: 76  SRFSSRNFPKYNFLEISDHDSD---IKEFDTXXXXXXXXXXXXXXRLARME-NVLVIEKG 131
                 +  +Y F+     D     + + D                LA      L++EKG
Sbjct: 166 YDGHVVDPFRYEFVSKPQFDGAELYLPDIDVIIIGSGAGAGVVAHTLANDGFKSLILEKG 225

Query: 132 HHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVR 191
            ++   +   +  +G  +LY+  G + T +S +++LAGS FGGGTT+ WSA ++  + VR
Sbjct: 226 KYFLPQEYVFDDCEGMQELYQSEGVVTTTNSQLFILAGSTFGGGTTVNWSACLKTPFKVR 285

Query: 192 EEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQ 251
           +EW  ++GL +   D Y     Y+  ++G +T  I H+ +N+ +I G KKLG  S  I Q
Sbjct: 286 KEWYDDYGLDFAATDTYDKCQDYVWKQMGASTEGITHSLANEVVIEGGKKLGYKSKEIDQ 345

Query: 252 NTASITHQ-CGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKSQKV 310
           N+    H  CG+C  GC+YG KQ + + W  +A +  +KF++   V +I I K+G +  +
Sbjct: 346 NSGGHPHHPCGFCFLGCRYGIKQGSAVNWFRDAAARGSKFMQQVRVLQI-IHKNGVATGL 404

Query: 311 MGVEVIINNIKRVKIHA-KRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYGVF 369
           +  +       + KI   K+ VVSAG++++P +L  SG KNK+IG+NL +HP+  V+G F
Sbjct: 405 LCQDEETGT--KFKITGPKKFVVSAGSLNTPVVLQNSGFKNKHIGKNLTLHPVTTVFGDF 462

Query: 370 PNKEIKTYSG-TIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQLML 428
                  +S  +IM+++    +++DG+ +GAKI    + P    A  PW+ + + ++ +L
Sbjct: 463 GQDVQANHSDKSIMTSVCTQVDDLDGKAHGAKIETILNTPAIQAAFLPWRGSDETRKDLL 522

Query: 429 EYNNIVPLMVITRDREGGRILTDENGKPRL--EYKLSQHDSKSMVAGLLTAVRILAAAGA 486
            YN +  +++ITRD   G +  D N    L  +Y +S+ D  +++  +L    +L   GA
Sbjct: 523 RYNQMCAMLLITRDTSTGSVKVDPNRPESLYVDYTVSKFDKNALLQAMLITSDMLYIEGA 582

Query: 487 TKIGTCQTVIDDYIVENG--VNPLNDPKFDQFLNKIKKVGIPTYQTCTGTIEQMSSCRM- 543
            +I + Q  +  +  +       + D  + ++  K+ K+ +  Y T  G+  QMSSCRM 
Sbjct: 583 KRILSPQPWVPVFESDTPKEKRSIKDQDYVEWRAKVAKIPLDDYGTPYGSAHQMSSCRMS 642

Query: 544 GDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYIS 592
           G  P   A +  G  +E  N+Y+AD+S LPTA+G   M+TTM I+ +++
Sbjct: 643 GKGPKYGACDTKGRLFEASNIYIADASCLPTASGANPMITTMAISRHVA 691



>gi|502161934|ref|XP_004512334.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X2 [Cicer
           arietinum]
          Length = 816

 Score =  284 bits (727), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 175/504 (34%), Positives = 263/504 (52%), Gaps = 35/504 (6%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGML-TDDSNMYVLAGSNFGGGTTIGWSAF 183
           VLV+EKG +  + +LS  +    D++Y+ SGGML TDD +++VL+GS  GGG+ I WSA 
Sbjct: 325 VLVLEKGGYSARSNLSLLEGPTLDQMYQ-SGGMLATDDMSVFVLSGSTVGGGSAINWSAS 383

Query: 184 MEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLG 243
           ++    V +EW +  GL  F  + Y  AM  +  ++G  +       +N  L  GC++LG
Sbjct: 384 IKTPQHVCKEWCEKHGLELFESELYREAMDVVCEKMGVQSEIEEEGFNNTILRRGCQELG 443

Query: 244 LHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNE-AKSNNAKFLKNC----YVEK 298
                IP+N+ S  H CGWC  GCK G K+  + TWL +  KS N   L  C     + K
Sbjct: 444 YPVSTIPRNSPS-DHYCGWCFMGCKDGRKKGTSETWLVDLVKSGNGAILPGCEVLKVLYK 502

Query: 299 ILIDKDGKSQKVMGVEVIINNIKRV-KIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
                D K+ + +  E      K +  + +K  +V+ GA+++PALL RSGLKN NIGRNL
Sbjct: 503 KKKGSDQKTARGVAFEFEYKGSKDICVVESKVTIVACGALNTPALLKRSGLKNNNIGRNL 562

Query: 358 HVHPIAAVYGVFPNKEI--------------KTYSGTIMSAISNATENVDGENYGAKIVV 403
           H+HP+   +G FP+                 K+Y G IM+A+S      +   YGA I  
Sbjct: 563 HLHPVVMAWGYFPDSSAESTGETEVWPEAWKKSYEGGIMTAMSPVVAEFENSGYGAVIQT 622

Query: 404 GSHHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLS 463
            + HPG      PW S    K  M +++    +  + RD+  G++    +   R+ Y++ 
Sbjct: 623 PALHPGTFSIVMPWISGKDIKDRMRKFSRTAHIFALARDKGSGKV----DSPNRINYQME 678

Query: 464 QHDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKV 523
             D +++  G+   +RILAAAGA +IGT         V+      +  + ++F+ +    
Sbjct: 679 DVDEENLQKGIEKVLRILAAAGAEEIGTHHNKGRTLNVKQA----SKLELEKFVKEESSR 734

Query: 524 GIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMT 583
            +    T   +  QM SCRMG +P +SAV   GE WEVE+LYVADSSV PTA G+  M+T
Sbjct: 735 PLTKLSTPLCSAHQMGSCRMGSNPKESAVKQTGETWEVEDLYVADSSVFPTALGLNPMIT 794

Query: 584 TMNIAHYISKCILDKKIFTVKKKR 607
             +IA+    C     +  +K+KR
Sbjct: 795 IQSIAY----CTAQSVLHALKRKR 814



>gi|502161931|ref|XP_004512333.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like isoform X1 [Cicer
           arietinum]
          Length = 834

 Score =  284 bits (726), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 175/504 (34%), Positives = 263/504 (52%), Gaps = 35/504 (6%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGML-TDDSNMYVLAGSNFGGGTTIGWSAF 183
           VLV+EKG +  + +LS  +    D++Y+ SGGML TDD +++VL+GS  GGG+ I WSA 
Sbjct: 343 VLVLEKGGYSARSNLSLLEGPTLDQMYQ-SGGMLATDDMSVFVLSGSTVGGGSAINWSAS 401

Query: 184 MEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLG 243
           ++    V +EW +  GL  F  + Y  AM  +  ++G  +       +N  L  GC++LG
Sbjct: 402 IKTPQHVCKEWCEKHGLELFESELYREAMDVVCEKMGVQSEIEEEGFNNTILRRGCQELG 461

Query: 244 LHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNE-AKSNNAKFLKNC----YVEK 298
                IP+N+ S  H CGWC  GCK G K+  + TWL +  KS N   L  C     + K
Sbjct: 462 YPVSTIPRNSPS-DHYCGWCFMGCKDGRKKGTSETWLVDLVKSGNGAILPGCEVLKVLYK 520

Query: 299 ILIDKDGKSQKVMGVEVIINNIKRV-KIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
                D K+ + +  E      K +  + +K  +V+ GA+++PALL RSGLKN NIGRNL
Sbjct: 521 KKKGSDQKTARGVAFEFEYKGSKDICVVESKVTIVACGALNTPALLKRSGLKNNNIGRNL 580

Query: 358 HVHPIAAVYGVFPNKEI--------------KTYSGTIMSAISNATENVDGENYGAKIVV 403
           H+HP+   +G FP+                 K+Y G IM+A+S      +   YGA I  
Sbjct: 581 HLHPVVMAWGYFPDSSAESTGETEVWPEAWKKSYEGGIMTAMSPVVAEFENSGYGAVIQT 640

Query: 404 GSHHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLS 463
            + HPG      PW S    K  M +++    +  + RD+  G++    +   R+ Y++ 
Sbjct: 641 PALHPGTFSIVMPWISGKDIKDRMRKFSRTAHIFALARDKGSGKV----DSPNRINYQME 696

Query: 464 QHDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKV 523
             D +++  G+   +RILAAAGA +IGT         V+      +  + ++F+ +    
Sbjct: 697 DVDEENLQKGIEKVLRILAAAGAEEIGTHHNKGRTLNVKQA----SKLELEKFVKEESSR 752

Query: 524 GIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMT 583
            +    T   +  QM SCRMG +P +SAV   GE WEVE+LYVADSSV PTA G+  M+T
Sbjct: 753 PLTKLSTPLCSAHQMGSCRMGSNPKESAVKQTGETWEVEDLYVADSSVFPTALGLNPMIT 812

Query: 584 TMNIAHYISKCILDKKIFTVKKKR 607
             +IA+    C     +  +K+KR
Sbjct: 813 IQSIAY----CTAQSVLHALKRKR 832



>gi|449433239|ref|XP_004134405.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Cucumis sativus]
          Length = 738

 Score =  284 bits (726), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 163/485 (33%), Positives = 264/485 (54%), Gaps = 24/485 (4%)

Query: 123 ENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSA 182
           + V+++EKG+++   D S+ +    ++LYE      TDD  + +LAGS  GGG+ + WSA
Sbjct: 254 QKVMILEKGNYFIASDYSSLEGPSLEQLYEAGAIFATDDGKVLILAGSTVGGGSAVNWSA 313

Query: 183 FMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKL 242
            ++    V +EWA++  +P+F   EY  AM  +  R+G +         NQ L  GC+ L
Sbjct: 314 SIKTPDHVLQEWAESHKIPFFGTSEYQVAMDAVCKRIGVSEDCEEEGFQNQVLRKGCENL 373

Query: 243 GLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILID 302
           GL  + +P+N+ +  H CG C +GC+ GEKQ    TWL +A ++ A  + NC  E+ +++
Sbjct: 374 GLKVEKVPRNSTT-GHYCGSCGYGCRKGEKQGTDSTWLVDAVNHGAVIITNCKAERFILE 432

Query: 303 KDG----KSQKVMGV--EVIINNI-KRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGR 355
           ++     K  K +GV   V  +NI K++ I AK  + + GA+ +P L++ SGL+NK+IGR
Sbjct: 433 RNKNGSMKKSKCLGVIANVWSDNITKKLHIKAKATISACGALLTPPLMISSGLRNKHIGR 492

Query: 356 NLHVHPIAAVYGVFPNK----EIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFM 411
           NLH+HP+   +G FP      + K+Y G I++++          N    I      PG  
Sbjct: 493 NLHLHPVLMTWGYFPESNSGFKGKSYEGGIITSVHKVVSEESKSNPKTIIETPLLGPGSC 552

Query: 412 FANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMV 471
               PW S L  KQ ML+Y+     + I RD   G + ++     R+ Y LS+ D +++ 
Sbjct: 553 AVLVPWVSGLDIKQRMLKYSRTAHFITIVRDSGSGAVRSE----GRVSYNLSEEDRENLK 608

Query: 472 AGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVG----IPT 527
            GL  ++RIL AAGAT++GT ++  D   +E     +   + ++FL+ +   G    +  
Sbjct: 609 KGLRQSLRILVAAGATEVGTHRS--DGQRLE--CKGIGKEELEEFLDSVSAEGGLLSLSK 664

Query: 528 YQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNI 587
                 +  QM SC++G    + A++  GE+WE E L+V D+SVLPTA GV  M+T  + 
Sbjct: 665 DWNVYTSAHQMGSCKIGVSETEGAIDQNGESWEAEGLFVCDASVLPTAVGVNPMITIQST 724

Query: 588 AHYIS 592
           A+ IS
Sbjct: 725 AYCIS 729



>gi|449468696|ref|XP_004152057.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Cucumis sativus]
 gi|449531315|ref|XP_004172632.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Cucumis sativus]
          Length = 738

 Score =  283 bits (725), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 168/487 (34%), Positives = 266/487 (54%), Gaps = 25/487 (5%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG+++   D S+ +    ++LYE  G   T D  + +LAG+  GGG+ I WSA +
Sbjct: 260 VVVLEKGNYFVAEDYSSLEGPSMNELYESGGLKSTLDGKVMLLAGTTVGGGSAINWSASI 319

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +    + +EW+ ++ +P +   +Y  AM  +  R+G      + +  NQ L  GC+ LGL
Sbjct: 320 KTPKSILDEWSTDYKIPLYGSIDYQLAMDAVCDRIGVTEECPVESFQNQVLRKGCENLGL 379

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILID-- 302
             D++ +N+ S  H CG C +GC+ G+K+    TWL +A    A  L  C  +K ++D  
Sbjct: 380 KVDSVSRNS-SKDHYCGSCCYGCRVGDKKGTDTTWLVDAVEYGAVILTGCQADKFILDNT 438

Query: 303 -KDGKSQKVMGVEVII---NNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLH 358
               K ++ +GV       N  K++ I AK  + + G++ +P LL+ SGL+NKNIG NLH
Sbjct: 439 NNTSKRKRCIGVIATPRSKNITKKLHIEAKATISACGSLLTPPLLIASGLRNKNIGTNLH 498

Query: 359 VHPIAAVYGVFPNK----EIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFAN 414
           +HP++ V+G FP +    + K Y G +++++          N  A I   +  P    A 
Sbjct: 499 LHPVSLVWGYFPEELSDFKGKIYEGGLITSLHKVVSKYS--NSHAIIETPAVGPASFAAL 556

Query: 415 FPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGL 474
           FPW S  + K  M++Y+    L  + RD+  G I    N    ++Y+L+Q D +++  GL
Sbjct: 557 FPWTSGREMKDAMVKYSRTAHLFALIRDQGAGEIKVKAN----VKYRLNQTDKENLRIGL 612

Query: 475 LTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPT----YQT 530
             A+RIL AAGAT++GT ++  D   +       N  + ++FL+ ++ VG P     Y T
Sbjct: 613 RQALRILIAAGATEVGTYRS--DGQRIR--CQGTNKEELEEFLDSVEAVGGPLSRQKYWT 668

Query: 531 CTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHY 590
              +  QMSSCRMG    + AV+  GE+WE E L+V D SVLPTA GV  M+T  + A+ 
Sbjct: 669 MYCSAHQMSSCRMGSTKEEGAVDENGESWEAEGLFVCDGSVLPTAVGVNPMITIQSTAYC 728

Query: 591 ISKCILD 597
           ISK I +
Sbjct: 729 ISKKIAE 735



>gi|356515032|ref|XP_003526205.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Glycine max]
          Length = 821

 Score =  283 bits (725), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 175/491 (35%), Positives = 265/491 (53%), Gaps = 30/491 (6%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG+++   D S+ +    ++LYE  G + + DS + VLAGS  GGG+ + WSA +
Sbjct: 338 VVVLEKGNYFTPQDYSSLEGPSMNQLYETGGILASVDSRVLVLAGSTVGGGSAVNWSACI 397

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +  + V +EW+++  LP+F   EY +AM+ +  R+G           NQ L  GC+ LGL
Sbjct: 398 KTPHKVLKEWSESHKLPFFSSQEYLSAMENVCERIGVTENCSQEGFQNQVLRKGCQNLGL 457

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDK- 303
             D +P+N++   H C  C +GC  GEKQ    TWL +A   +A  +  C  E+ L++  
Sbjct: 458 KVDYVPRNSSG-NHYCS-CGYGCPKGEKQGTQDTWLADAVERDAVIITGCKAERFLLESN 515

Query: 304 ---DGKSQKVMGVEVIINNIK---RVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
              +G+ +K +GV     N +   +++I AK  + + GA+ +P LL+ SGLKNKNIG+NL
Sbjct: 516 RSGNGRKKKCLGVTAKTLNSRITMKLQIEAKVTISAGGALLTPPLLISSGLKNKNIGKNL 575

Query: 358 HVHPIAAVYGVFPNK-----EIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMF 412
           H+HP+   +G FP       + K Y G I++++          +  A I      P    
Sbjct: 576 HLHPVLMTWGYFPESNDSEFKGKVYEGGIITSVHKVPSPDSNSDSRAIIETPLLGPASFA 635

Query: 413 ANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVA 472
           A  PW+S    K+ ML Y     L+ I RD   G++ T+     R+ YKL++ D ++M A
Sbjct: 636 ALCPWESGQDFKERMLNYPRTSHLITIIRDMACGQVTTE----GRISYKLNEVDKENMKA 691

Query: 473 GLLTAVRILAAAGATKIGT----CQTVIDDYIVENGVNPLNDP--KFDQFLNKIKKVGIP 526
           GL  A+RIL AAGA ++GT     Q +  D I EN V    D     +  L+  +K  I 
Sbjct: 692 GLKQALRILIAAGAVEVGTHRSDGQRLKCDGIGENEVQEFLDSVCPMEGALSPGEKWNIY 751

Query: 527 TYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMN 586
           +      +  QM SCRMG    + AV+  GE WE E L+V D+SVLP+A GV  M+T  +
Sbjct: 752 S------SAHQMGSCRMGVSEKEGAVDENGETWEAEGLFVCDASVLPSAVGVNPMITVQS 805

Query: 587 IAHYISKCILD 597
            A+ IS  I+D
Sbjct: 806 TAYCISNRIVD 816



>gi|326498701|dbj|BAK02336.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 759

 Score =  283 bits (725), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 196/647 (30%), Positives = 304/647 (46%), Gaps = 60/647 (9%)

Query: 2   SLINSKILSIQKPF----HELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATF---W 54
           +L  ++ LS   PF     E+   +RE    +WS        +++     + C      W
Sbjct: 113 ALCGARCLSWSSPFVHRFAEMPVDRREDALRRWSRETMIPPLRLFFLLVKVYCLYVFYSW 172

Query: 55  LNPYNFNP---VIGY-PGADPEANGSRFSSRNFPKYNFLEISDHDSDIKEFDTXXXXXXX 110
            +  + NP    IGY P  D  A     +S   P  + +  + H +D     +       
Sbjct: 173 TDDNSENPHWQAIGYSPPTDEAAEQEEQASIKRPLEDGVVETIHQTDASLPTSLAEKGLA 232

Query: 111 XXXXXXXRLARME------------------------NVLVIEKGHHYDQCDLSTEQQDG 146
                   + R+E                         V+VIEKG+++   D ++ +   
Sbjct: 233 VTEDAARNVCRIECDVVIVGSGCGGGVAAAVLAGAGHKVVVIEKGNYFTARDYTSIEGPS 292

Query: 147 YDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVREEWAKNFGLPYFMED 206
             +LYE  G M T   +  +LAGS  GGG+ + WSA ++    VR+EWA   GLP F + 
Sbjct: 293 MSQLYEYGGFMSTLSGSGLLLAGSTVGGGSAVNWSACIKTPDSVRKEWAAAHGLPLFDKS 352

Query: 207 EYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQNTASITHQCGWCSFG 266
           EY  AM  +  RLG  +      + N+ L  GC+KLG + + + +N+ S  H CG C +G
Sbjct: 353 EYTAAMDVVFKRLGVTSGCKEEGRQNKVLRKGCEKLGYNVEPVSRNS-SEGHFCGSCGYG 411

Query: 267 CKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILI-DKDGK-SQKVMGVEVIINN---IK 321
           C+ G+K+    TWL +A S  A  L     EK+L  D  GK  ++  GV    +N    +
Sbjct: 412 CRTGDKRGTDTTWLVDAVSRGAVILTGSKAEKLLFTDAAGKRGKRCAGVVAASSNPAITR 471

Query: 322 RVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYGVFPNKEI-----KT 376
           ++++ AK  V + G++ +P LL  SGLKN +IG+NLH+HPIA  +G FP  ++     K 
Sbjct: 472 KLEVRAKVTVAAGGSLLTPVLLRGSGLKNPHIGKNLHLHPIAMAWGYFPPDKMPELKGKM 531

Query: 377 YSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQLMLEYNNIVPL 436
           Y G I++++     + DG  + A +      P      FPW S    K+ ML Y   V +
Sbjct: 532 YEGGIITSLHKVEADGDGLPHRAILETPLMGPAAAGTQFPWVSGRDMKERMLNYGRTVHI 591

Query: 437 MVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGLLTAVRILAAAGATKIGTCQTVI 496
             + RD   G +    +G+ R+ Y L   D ++   GL  A+RIL AAGAT++GT ++  
Sbjct: 592 FSLVRDHGSGTV----HGERRIAYHLDPVDRENQREGLRRALRILVAAGATEVGTHRSDG 647

Query: 497 DDYIVENGVNPLNDPKFDQFLNKIKKVGIPT-----YQTCTGTIEQMSSCRMGDDPNKSA 551
                +       D + ++FL+ +  V  P      +  C  T  QM SCRM       A
Sbjct: 648 QKLRCKGA----TDEEVEEFLDGVSGVRGPQSKSEKWSLCC-TAHQMGSCRMAATAGDGA 702

Query: 552 VNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKCILDK 598
           V+  GE+WEVE LYV D SVLP A GV  M+T  ++A+ ++  I ++
Sbjct: 703 VDTRGESWEVERLYVCDGSVLPGAVGVNPMITIQSVAYCLATGIAEQ 749



>gi|224107463|ref|XP_002314488.1| predicted protein [Populus trichocarpa]
 gi|222863528|gb|EEF00659.1| predicted protein [Populus trichocarpa]
          Length = 716

 Score =  282 bits (722), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 172/491 (35%), Positives = 265/491 (53%), Gaps = 28/491 (5%)

Query: 123 ENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSA 182
           + V V+EKG+++   D S  +    D+LYE  G + T D+ M ++AGS  GGG+ + WSA
Sbjct: 233 QKVFVLEKGNYFTATDYSGLEGPSMDQLYESGGKLATTDAEMLIMAGSAVGGGSAVNWSA 292

Query: 183 FMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKL 242
            ++    V +EWA    +P F   EY +AM  +  R+G           NQ L  GC+ L
Sbjct: 293 SIKTPNSVLQEWAGTQKIPLFGSSEYFSAMDAVCTRIGVTESCGEEGFQNQVLRKGCESL 352

Query: 243 GLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILID 302
           G+    +P+N+ S  H CG C +GC  GEK+    TWL +A  + A  L  C  E+ +++
Sbjct: 353 GIPVKTVPRNS-SERHYCGSCGYGCLKGEKKGTDRTWLVDAVDHGAVILTGCKAERFMLE 411

Query: 303 KD----GKSQKVMGV--EVIINNIK-RVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGR 355
           K+     + +K +GV  +++ NNI+ R++I AK  + + GA+ +P L++ SGLKN+NIGR
Sbjct: 412 KNEGGSKRKKKCVGVTAKIVNNNIRTRLQIEAKVTISACGALLTPPLMISSGLKNQNIGR 471

Query: 356 NLHVHPIAAVYGVFP--NKEI--KTYSGTIMSAISNATENVDGE-NYGAKIVVGSHHPGF 410
           NLH+HP+   +G FP  N E   K Y G I++A+    E + G+ N  A I   +  P  
Sbjct: 472 NLHLHPVLMAWGYFPESNSEFKGKVYEGGIITAVH---EVLTGDSNARAIIETPALGPSS 528

Query: 411 MFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSM 470
             A  PW S    K  M +Y     L+ I RD   G++ T+     R+ Y L   D +++
Sbjct: 529 FVALCPWVSGHDMKDRMAKYARTAHLIAIIRDSGSGKVTTEG----RISYNLDAMDKENL 584

Query: 471 VAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQT 530
            AGL  A+RIL AAGA ++GT ++  D   ++     +     ++FL+ +     P    
Sbjct: 585 KAGLRQALRILVAAGAVEVGTHRS--DGQRIK--CRGIKKEDLEEFLDTVYATAGPLSPV 640

Query: 531 ----CTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMN 586
                  +  QM SCRMG +  + AV+  GE+WE E L+V D+SVLP+A GV  M+T  +
Sbjct: 641 EDWMLYTSAHQMGSCRMGINKKEGAVDENGESWEAEGLFVCDASVLPSAVGVNPMITIQS 700

Query: 587 IAHYISKCILD 597
            A+ +SK I +
Sbjct: 701 TAYCLSKKIAE 711



>gi|85091650|ref|XP_959005.1| hypothetical protein NCU08977 [Neurospora crassa OR74A]
 gi|28920401|gb|EAA29769.1| predicted protein [Neurospora crassa OR74A]
          Length = 763

 Score =  282 bits (722), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 188/634 (29%), Positives = 304/634 (47%), Gaps = 55/634 (8%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYN-FNPVIGYPGADPE 72
           P  +     RE     WS+S + + R +YK FT L     WL     F  V GYP  D  
Sbjct: 138 PIQDQPLHIRESILRSWSSSWFGTPRTLYKIFTAL-AKVLWLQTSPLFRTVTGYP--DVP 194

Query: 73  ANGSRFSSRNFPKYNFLEISDHDSDIKEFDTXXXXXXXXXXXXXXRLARM-ENVLVIEKG 131
            N +   + +F    F    D  + + + D                LA     VLV++KG
Sbjct: 195 INWNPGPTEDFGFLQFDTSVDEPATV-DTDVVIIGSGCGGGVCAKVLAEAGHRVLVVDKG 253

Query: 132 HHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVR 191
           ++++   L    +     L+E +G + + D ++  +AGS +GGG ++ WS  ++   +VR
Sbjct: 254 YYFNPSQLPMPMEQSGFHLFENNGLVNSVDGSINAVAGSCWGGGGSVNWSVSLQTPGYVR 313

Query: 192 EEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQ-SNQTLINGCKKLGLHSDNIP 250
           +EW++  GLP+F   E+ N +  +   +G  + + +      Q L+ G +KLG  +   P
Sbjct: 314 KEWSEQHGLPFFESAEFQNCLDRVYEFMGVVSGDKVRTTYRGQKLLEGSRKLGYEAHVCP 373

Query: 251 QNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGKS--- 307
           QN     H CG C  GC   EKQ   ++WL  A    A F++   V+KIL D+   S   
Sbjct: 374 QNNGGKEHWCGHCPLGCGSAEKQGPAVSWLPAAAKKGATFMEGFSVDKILWDESSSSSSW 433

Query: 308 ------QKVMGVE------------VIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLK 349
                 +K +GVE            +     ++V I AK+V+VSAG ++SP +L RSGL 
Sbjct: 434 FGSGGKKKAVGVEGTWTARDTNGGVIGERKTRKVVIKAKKVIVSAGTLNSPLILHRSGLN 493

Query: 350 NKNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPG 409
           N +IGRNLHVHP+  + G +   ++  + G +++ I  A EN+DG+ +G K+      P 
Sbjct: 494 NHHIGRNLHVHPVKFL-GAYYEDDVNPWEGGVITTICTAFENLDGQGHGVKLEDTCMLPH 552

Query: 410 FMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSK 468
            + +  PW+  L  K   L Y  +   + ++RDR+ GR+  D   GK  +EY +S  D+ 
Sbjct: 553 SILSQVPWRGALSWKLSCLRYPQLSAWLSLSRDRDTGRVYADPVTGKLCIEYTISSFDAS 612

Query: 469 SMVAGLLTAVRILAAAGATKIGTCQTVIDDYIV---------------ENGVNPLNDPKF 513
               G++   +I    GA++I      ++ ++                E+    + DP F
Sbjct: 613 LNFEGIIALAKIAYVTGASEIDPFLPGVEPFVRSSSGTSSTPTEEATEEDYDKGVKDPLF 672

Query: 514 DQFLNKI--KKVGIPTYQTCTGTI--EQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADS 569
           +++L+ +  ++   P    C   I   QM +CRM   P    V+P G+ W  E LYVAD+
Sbjct: 673 EKWLSTLLHQRDNAP---ICPPYISAHQMGTCRMSSKPENGVVDPKGKVWGTEGLYVADA 729

Query: 570 SVLPTATGVPSMMTTMNIAHYISKCI---LDKKI 600
           SV P+A+GV  M+T M IA +I+  +   L KK+
Sbjct: 730 SVFPSASGVNPMVTNMAIADWIANGVARDLGKKV 763



>gi|302652368|ref|XP_003018036.1| hypothetical protein TRV_07960 [Trichophyton verrucosum HKI 0517]
 gi|291181637|gb|EFE37391.1| hypothetical protein TRV_07960 [Trichophyton verrucosum HKI 0517]
          Length = 749

 Score =  282 bits (722), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 189/609 (31%), Positives = 296/609 (48%), Gaps = 37/609 (6%)

Query: 12  QKPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADP 71
           + PF       R      W +S    +R  +++   L   ++  +  +   V+G+P    
Sbjct: 134 RTPFQHQPYHVRRQILSSWRSSYLPPLRAAHRALIALTKKSWVGSSPSLPLVLGFPNV-- 191

Query: 72  EANGSRFSSRNFPKYNFLEISDHDS-DIKEFDTXXXXXXXXXXXXXXRLARM-ENVLVIE 129
             +G+  +S +FP Y+FL+    D  +I E D                LA     V+V+E
Sbjct: 192 PVHGA--TSESFP-YSFLQFPAGDGPEIIETDVVIVGSGCGAGVAAKNLAEAGHRVIVVE 248

Query: 130 KGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYF 189
           K + +          +G   L+   G  L+DD ++ V++GS +GGG TI WSA ++ Q  
Sbjct: 249 KSYFFPNDHYPMSGSEGAFHLFSNGGAELSDDGSIGVVSGSTWGGGGTINWSASLQTQSM 308

Query: 190 VREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNI 249
           VREEWA N GLP F    Y  ++  +   +G +T  I  N  N  L+ G +KLG  +  +
Sbjct: 309 VREEWA-NSGLPLFTSSAYQTSLDRVCDYMGVSTDFIQQNHGNSVLMEGARKLGYSAKAV 367

Query: 250 PQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD-GKSQ 308
           PQNT    H CG+C+ GC  G KQ   +T+L +A    A F++    EK+L  +   K +
Sbjct: 368 PQNTGHQKHACGYCALGCAAGIKQGPAVTFLADAARAGATFIEGFKAEKVLFGRKLAKGK 427

Query: 309 KV-MGVE-VIINNIKRVKIHAKRVVV------------SAGAIHSPALLLRSGLKNKNIG 354
           KV +GV     +       H K  +             S G + SP LLLRSGLKN  IG
Sbjct: 428 KVAIGVRGTWTSRDASGATHGKPAITRKVVIKAKKVVVSCGTLESPLLLLRSGLKNPQIG 487

Query: 355 RNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFAN 414
           RNL +HP+  +  +F + E + + G+I++++ +  EN+DG  +G+KI      P F    
Sbjct: 488 RNLRLHPVIIMSAMF-DHETRPWEGSILTSLVSDFENLDGRGHGSKIEAVVMLPNFFLPL 546

Query: 415 FPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDEN-GKPRLEYKLSQHDSKSMVAG 473
             W + L +K        +   + +TRDR+ GR+  D N G+ R+EY  S  D K ++ G
Sbjct: 547 MAWDNGLDYKIFAANARRMAGFISLTRDRDTGRVYPDPNDGRCRIEYTPSAFDRKHILEG 606

Query: 474 LLTAVRILAAAGATKIGTCQTVIDDYI--------VENGVNPLNDPKFDQFLNKIKK-VG 524
           ++ A +I   +GA +I +    I  +          + GV   N+  F +++ K++  V 
Sbjct: 607 IIGAAKIAYVSGAREIRSSSLAIPTFTRPETSSDAADEGV---NNAAFQEWIKKLRTGVP 663

Query: 525 IPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTT 584
           +P  Q+   +  QM +CRMG  P  S V+P G  W    LYVAD+SV P+A+GV  M+T 
Sbjct: 664 LPPEQSMFASAHQMGTCRMGISPKTSVVDPTGMVWGTSGLYVADASVFPSASGVNPMITN 723

Query: 585 MNIAHYISK 593
           M I    S+
Sbjct: 724 MAITDLTSR 732



>gi|223946957|gb|ACN27562.1| unknown [Zea mays]
 gi|413923100|gb|AFW63032.1| oxidoreductase [Zea mays]
          Length = 768

 Score =  282 bits (722), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 173/492 (35%), Positives = 258/492 (52%), Gaps = 32/492 (6%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+VIEKG+++   D +  +    + LYE  G + T  ++  +LAGS  GGGT + WSA +
Sbjct: 279 VVVIEKGNYFTARDYTAIEAPSMEHLYEGGGFVSTLSASALLLAGSTVGGGTAVNWSACI 338

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +    VR EWA++ GLP F   EY  AM  +  RLG           N+ L  GC++LG 
Sbjct: 339 KTPDDVRGEWARDRGLPLFATGEYAAAMDKVFERLGVTAGCAEEGLQNKVLRKGCERLGY 398

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILID-- 302
             +++ +N+ S  H CG C +GC+ G+K+    TWL +A S  A  L  C  EK+L++  
Sbjct: 399 KVESVSRNS-SEGHYCGSCGYGCRTGDKRGTDSTWLVDAVSRGAVILTGCKAEKLLLEPG 457

Query: 303 --KDGKSQKVMGVEVIINN--IKRVKIHAKRVVVSA-GAIHSPALLLRSGLKNKNIGRNL 357
              DG++++ +GV     N  I R      RV VSA G++ +P LL  SGL+N++IG+NL
Sbjct: 458 SAADGRAKRCVGVVARSTNPAITRTLEVTARVTVSACGSLLTPVLLRGSGLRNRHIGKNL 517

Query: 358 HVHPIAAVYGVFPNK----EIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFA 413
           H+HP A V+G FP+       + Y G I++++      V+G   GA        P    A
Sbjct: 518 HLHPTALVWGYFPDTVPDLRGRMYEGGIITSL----HKVEGGGPGAPARAILEAPAMGLA 573

Query: 414 N----FPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKS 469
                FPW S    K+ ML Y   V L  + RDR  G +    +G+ R+ Y L   D ++
Sbjct: 574 GAGTQFPWVSGRDMKERMLRYGRTVHLFSMVRDRGSGTV----HGERRVAYHLDATDREN 629

Query: 470 MVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQ 529
           M  G+  A+R+LAAAGA +IGT ++    +          +   ++FL+ +  V  P  +
Sbjct: 630 MRDGMRRALRVLAAAGAAEIGTHRSDGQRFACGGA----TEAALEEFLDGVDVVRGPQSK 685

Query: 530 ----TCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTM 585
               T   T  QM SCRMG      AV+  GE+WE  +LYV D SVLP A GV  M+T  
Sbjct: 686 AEAWTLCCTAHQMGSCRMGATARDGAVDARGESWEAGSLYVCDGSVLPGAVGVNPMVTIQ 745

Query: 586 NIAHYISKCILD 597
           ++A+ ++  I +
Sbjct: 746 SVAYCLATGIAE 757



>gi|146416233|ref|XP_001484086.1| hypothetical protein PGUG_03467 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 696

 Score =  282 bits (721), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 179/614 (29%), Positives = 311/614 (50%), Gaps = 29/614 (4%)

Query: 4   INSKILS-----IQKPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPY 58
           ++S+IL+       K   ++  ++ E   + W  S     R+++K    L   TF     
Sbjct: 84  LDSRILAPALTGTLKLIRDMDYEELEALLVSWRDSNIPQKRRLFKLVYGLTVTTFIQCLD 143

Query: 59  NF-NPVIGYPGADP-EANGSRFSSRNFPKYNFLEISDHDSDIKEF----DTXXXXXXXXX 112
           +  N  IG+P A+  E   + F    F +Y  +E   H +D  E     D          
Sbjct: 144 DLHNEAIGFPNAEKREKLYNEFEPDEF-RYTMME---HPADGSELYLPVDALIVGSGSGA 199

Query: 113 XXXXXRLA-RMENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSN 171
                 L+ R    +V+EKG +Y   +   + ++G   LYE +G + T +  +++LAGS 
Sbjct: 200 GVVAETLSNRGFKCVVLEKGKYYHPSEYKFKVREGMQNLYENNGVVATTNQQLFLLAGST 259

Query: 172 FGGGTTIGWSAFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQS 231
           FGGG+T+ WSA ++  + VR EW ++  + +   D+Y   M+Y+  ++  +  NI H+ S
Sbjct: 260 FGGGSTVNWSACLKTPFKVRMEWFEDHKIDWAATDKYDKDMEYVLKKMHASDENIDHSYS 319

Query: 232 NQTLINGCKKLGLHSDNIPQNTAS-ITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKF 290
           NQ +++G  KLG +   +PQN      H CG+C  GCK+  KQ +   W  +A  N  +F
Sbjct: 320 NQVILDGGSKLGYNVAVVPQNNGGHPNHDCGFCFLGCKHNIKQGSAACWFRDAAKNGTQF 379

Query: 291 LKNCYVEKILIDKDGKSQKVMGVEVIINNIKRVKIHA-KRVVVSAGAIHSPALLLRSGLK 349
           +    V ++L  K GK+  V+  ++     ++ KI   K++++  G++++P +L  SG K
Sbjct: 380 MDQVKVRQVL-HKRGKAYGVLCEDL---EGRKFKITGPKKIIMCGGSLNTPVVLQNSGFK 435

Query: 350 NKNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPG 409
           NK+IG NL +HP+  + G FP++    Y   IM+A+    +++DG+ +GAKI    H P 
Sbjct: 436 NKHIGSNLKLHPVTVLTGQFPDQRFHPYDKPIMTAVCTQVDDLDGKAHGAKIETMLHTPH 495

Query: 410 FMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPR---LEYKLSQHD 466
              A  PW+ +   ++ +L YNN   +++ITRD   G I  D   +P    ++Y L++ D
Sbjct: 496 IEAAFLPWRGSDDIRKELLGYNNTCSMLLITRDTSSGTIRNDP-ARPDALVIDYSLNKFD 554

Query: 467 SKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNP--LNDPKFDQFLNKIKKVG 524
            ++++  +     +L   G  +I   Q     +     V+   +ND  + ++  K+  + 
Sbjct: 555 RQALLEAMAVTADMLYIKGVQRIIPPQAWSPSFTTTKPVSERLVNDKDYQEWRKKLLSIP 614

Query: 525 IPTYQTCTGTIEQMSSCRM-GDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMT 583
           +       G+  QMSSCR+ G  P+  A +  G  +E  N+YVAD+S +PTA+G   M++
Sbjct: 615 LSAEGPSYGSAHQMSSCRISGKGPSDGACDTRGRLYECGNIYVADASAMPTASGANPMIS 674

Query: 584 TMNIAHYISKCILD 597
           TM+IA  I+  I D
Sbjct: 675 TMSIARRIALGIAD 688



>gi|190347148|gb|EDK39369.2| hypothetical protein PGUG_03467 [Meyerozyma guilliermondii ATCC
           6260]
          Length = 696

 Score =  282 bits (721), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 179/614 (29%), Positives = 311/614 (50%), Gaps = 29/614 (4%)

Query: 4   INSKILS-----IQKPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPY 58
           ++S+IL+       K   ++  ++ E   + W  S     R+++K    L   TF     
Sbjct: 84  LDSRILAPALTGTLKLIRDMDYEELEALLVSWRDSNIPQKRRLFKLVYGLTVTTFIQCLD 143

Query: 59  NF-NPVIGYPGADP-EANGSRFSSRNFPKYNFLEISDHDSDIKEF----DTXXXXXXXXX 112
           +  N  IG+P A+  E   + F    F +Y  +E   H +D  E     D          
Sbjct: 144 DLHNEAIGFPNAEKREKLYNEFEPDEF-RYTMME---HPADGSELYLPVDALIVGSGSGA 199

Query: 113 XXXXXRLA-RMENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSN 171
                 L+ R    +V+EKG +Y   +   + ++G   LYE +G + T +  +++LAGS 
Sbjct: 200 GVVAETLSNRGFKCVVLEKGKYYHPSEYKFKVREGMQNLYENNGVVATTNQQLFLLAGST 259

Query: 172 FGGGTTIGWSAFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQS 231
           FGGG+T+ WSA ++  + VR EW ++  + +   D+Y   M+Y+  ++  +  NI H+ S
Sbjct: 260 FGGGSTVNWSACLKTPFKVRMEWFEDHKIDWAATDKYDKDMEYVLKKMHASDENIDHSYS 319

Query: 232 NQTLINGCKKLGLHSDNIPQNTAS-ITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKF 290
           NQ +++G  KLG +   +PQN      H CG+C  GCK+  KQ +   W  +A  N  +F
Sbjct: 320 NQVILDGGSKLGYNVAVVPQNNGGHPNHDCGFCFLGCKHNIKQGSAACWFRDAAKNGTQF 379

Query: 291 LKNCYVEKILIDKDGKSQKVMGVEVIINNIKRVKIHA-KRVVVSAGAIHSPALLLRSGLK 349
           +    V ++L  K GK+  V+  ++     ++ KI   K++++  G++++P +L  SG K
Sbjct: 380 MDQVKVRQVL-HKRGKAYGVLCEDL---EGRKFKITGPKKIIMCGGSLNTPVVLQNSGFK 435

Query: 350 NKNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPG 409
           NK+IG NL +HP+  + G FP++    Y   IM+A+    +++DG+ +GAKI    H P 
Sbjct: 436 NKHIGSNLKLHPVTVLTGQFPDQRFHPYDKPIMTAVCTQVDDLDGKAHGAKIETMLHTPH 495

Query: 410 FMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPR---LEYKLSQHD 466
              A  PW+ +   ++ +L YNN   +++ITRD   G I  D   +P    ++Y L++ D
Sbjct: 496 IEAAFLPWRGSDDIRKELLGYNNTCSMLLITRDTSSGTIRNDP-ARPDALVIDYSLNKFD 554

Query: 467 SKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVN--PLNDPKFDQFLNKIKKVG 524
            ++++  +     +L   G  +I   Q     +     V+   +ND  + ++  K+  + 
Sbjct: 555 RQALLEAMAVTADMLYIKGVQRIIPPQAWSPSFTTTKPVSERSVNDKDYQEWRKKLLSIP 614

Query: 525 IPTYQTCTGTIEQMSSCRM-GDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMT 583
           +       G+  QMSSCR+ G  P+  A +  G  +E  N+YVAD+S +PTA+G   M++
Sbjct: 615 LSAEGPSYGSAHQMSSCRISGKGPSDGACDTRGRLYECGNIYVADASAMPTASGANPMIS 674

Query: 584 TMNIAHYISKCILD 597
           TM+IA  I+  I D
Sbjct: 675 TMSIARRIALGIAD 688



>gi|258578497|ref|XP_002543430.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237903696|gb|EEP78097.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 490

 Score =  282 bits (721), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 167/476 (35%), Positives = 267/476 (56%), Gaps = 35/476 (7%)

Query: 145 DGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVREEWAKNFGLPYFM 204
           +G   ++   G  ++DD ++ VL+GS +GGG T+ WSA ++ Q FVR+EWAK+ GL  F 
Sbjct: 5   EGTVHMFANGGAEISDDGSISVLSGSTWGGGGTVNWSASLQTQSFVRQEWAKS-GLDLFT 63

Query: 205 EDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQNTASITHQCGWCS 264
              +  ++  +   +G +T +I HN SN  L+ G +KLG  +  +PQNT +  H CG+C+
Sbjct: 64  SMAFQQSLDRVCDYMGVST-DIEHNFSNNVLLEGARKLGYTAKTVPQNTGNQEHYCGYCT 122

Query: 265 FGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILID--KDGKSQKVMGV--------- 313
            GC    KQ   +++L +A    A F++   V+K+L D    GK++  +GV         
Sbjct: 123 LGCASAVKQGPAVSFLADAARAGATFIEGYEVDKVLFDPRAPGKNKVAIGVRGTWRSRDA 182

Query: 314 ------EVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYG 367
                 E +I   K++ + A +V+VS GA+ SP LLLRSG+KN NIGRNLH+HP+  V  
Sbjct: 183 NSMTHGEPLIK--KKLVVKATKVIVSCGALQSPLLLLRSGIKNSNIGRNLHLHPVLIVGA 240

Query: 368 VFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQLM 427
           VF NKE + + G I++++ +  EN DG  +G KI   +  P     +F WK  L  K   
Sbjct: 241 VF-NKETRPWEGGILTSLVSDFENTDGTGHGTKIEALTMLPSIFLPSFTWKDGLDFKLFA 299

Query: 428 LEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQHDSKSMVAGLLTAVRILAAAGA 486
               ++   + +TRDR+ G +  D  +G+ R++Y  S +D K+M+ G++ + +I   +GA
Sbjct: 300 ANLRSMSGFISLTRDRDSGMVYPDPVDGRCRIKYTPSSYDRKNMLEGVIASAKIAYVSGA 359

Query: 487 TKIGTCQTVIDDYI--------VENGVNPLNDPKFDQFLNKIKKVG-IPTYQTCTGTIEQ 537
            +I T    I  ++        VE G+   N+  F  ++ + ++   +PT+     +  Q
Sbjct: 360 KEIRTTCHSIPPFVRPKDPAGSVEEGI---NNAAFKAWIQQFQQGDPLPTWACSFASAHQ 416

Query: 538 MSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISK 593
           M +CRMG    KS VNP+G+ W  E LYV D+SV P+A+GV  M+T M I+ + S+
Sbjct: 417 MGTCRMGTSSWKSVVNPLGQVWGTEGLYVMDASVFPSASGVNPMVTNMAISDWTSR 472



>gi|16905179|gb|AAL31049.1|AC078893_12 putative oxidase [Oryza sativa Japonica Group]
 gi|110289246|gb|ABB47786.2| GMC oxidoreductase family protein, expressed [Oryza sativa Japonica
           Group]
          Length = 595

 Score =  281 bits (720), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 164/493 (33%), Positives = 256/493 (51%), Gaps = 38/493 (7%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG ++ + D S+ +    ++L+E  G   T +    +  G+  GGG+ + WSA +
Sbjct: 112 VVVVEKGDYFTKEDYSSIEGPSMERLFERGGVFCTSNVTTMIFTGATVGGGSAVNWSASI 171

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
                V +EW++  GL  F    Y  AM  +  RLG           N+ +  GC  LGL
Sbjct: 172 RTPAGVMQEWSREHGLAVFASPGYARAMDAVCERLGVTDACREEGFQNKVVRRGCDALGL 231

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD 304
            +D +P+N+ S  H CG C+FGC  G+K+    TWL +A    A  L  C  E  +++ +
Sbjct: 232 RADAVPRNS-SEGHFCGSCNFGCPTGDKKGTDTTWLVDAVERGAVILTGCKAEHFIVESN 290

Query: 305 ----GKSQKVMG-VEVIINN--IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
               G+S++ +G V   ++N   K++++ AK  + ++GA+ +P LL  SGLKN++IGRNL
Sbjct: 291 GGGGGRSKRCVGLVATCMSNGITKKLRVEAKVSISASGALMTPPLLRNSGLKNRHIGRNL 350

Query: 358 HVHPIAAVYGVFPNKEI------KTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFM 411
           H+HP++  +G FP+         K Y G I++++   TE          I   +  PG  
Sbjct: 351 HLHPVSMAWGYFPDNTPEPHIPGKCYEGGIITSMHRVTERT-------IIETPALGPGAF 403

Query: 412 FANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMV 471
            A  PW+S    K+ M  Y        + RDR  G +    +G+ R+ Y  S+ D++ + 
Sbjct: 404 AALVPWESGRDMKERMRRYARTAHAFALVRDRGAGSV----DGEGRVRYAPSRDDAEELR 459

Query: 472 AGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQT- 530
           AGL  A+RIL AAGA ++GT ++  D   +        D   + FL+++     P + T 
Sbjct: 460 AGLRRALRILVAAGAAEVGTHRS--DGARLR--CKGARDADVEAFLDEVTVEKGPMHSTT 515

Query: 531 ------CTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTT 584
                 C  +  QM SCRMG  P   AV+  GE+WE E LYV D S+LPTA GV  M+T 
Sbjct: 516 DKWSVLC--SAHQMGSCRMGASPRDGAVDVAGESWEAEGLYVCDGSLLPTAVGVNPMITI 573

Query: 585 MNIAHYISKCILD 597
            +IA+ ++K I D
Sbjct: 574 QSIAYCVAKGIAD 586



>gi|357474781|ref|XP_003607676.1| Annotation was added to scaffolds in November 2011~Long chain fatty
           alcohol oxidase FAO1 [Medicago truncatula]
 gi|355508731|gb|AES89873.1| Annotation was added to scaffolds in November 2011~Long chain fatty
           alcohol oxidase FAO1 [Medicago truncatula]
          Length = 606

 Score =  281 bits (720), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 172/493 (34%), Positives = 264/493 (53%), Gaps = 28/493 (5%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG+++   D S+ +    D+ YE  G + + DS + + AGS  GGG+ + WSA +
Sbjct: 114 VVVLEKGNYFVPKDYSSLEGPSMDQQYEKGGMLASVDSRIVLFAGSTVGGGSAVNWSACI 173

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
                V +EW+    LP F   EY +AM+ +  R+G N         NQ L  GC+ LGL
Sbjct: 174 RTPQNVLKEWSDEHKLPLFETLEYLSAMETVCERIGVNENCTQEGFQNQVLRKGCQNLGL 233

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD 304
             D +P+N+    H CG C +GC  GEKQ    TWL +A    A  +  C  E+ L D +
Sbjct: 234 KVDYVPRNSPG-NHYCGSCGYGCPKGEKQGTQATWLVDAVDKGAVIITGCKAERFLFDNN 292

Query: 305 ------GKSQKVMGVEVIINNIK---RVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGR 355
                  K +K +GV     N +   +++I AK  + + GAI +P LL+ SGLKNKNIGR
Sbjct: 293 YKNANTRKKKKCLGVLAKTLNSRVTMKLQIEAKVTISAGGAILTPPLLISSGLKNKNIGR 352

Query: 356 NLHVHPIAAVYGVFPNKEI----KTYSGTIMSAISNATENVDGENYG---AKIVVGSHHP 408
           NLH+HP+   +G FP  +     K Y G I++++   + +++  +     A I      P
Sbjct: 353 NLHLHPVLMTWGYFPESKSDLKGKIYEGGIITSVHKVSSSLNDHSISDTRAIIETPLLGP 412

Query: 409 GFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSK 468
               + +PW+S L  KQ ML+Y     L+ I RD+  G++ T+     R+ YKL+  D +
Sbjct: 413 SSFASIYPWESGLDFKQRMLKYPRTAHLITIIRDKASGQVKTE----GRISYKLNSIDRE 468

Query: 469 SMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTY 528
           +M AGL   +RIL AAGA ++GT ++  D   ++   N   + + ++F++ +  +    +
Sbjct: 469 NMRAGLQQGLRILIAAGAVEVGTHRS--DGQRIKCNENT-GEKEIEEFIDSVYPMEGALW 525

Query: 529 Q----TCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTT 584
                    +  QM SCRMG +  + AV+  GE+WE E L+V D+SVLPTA GV  M+T 
Sbjct: 526 PGENWNLYTSAHQMGSCRMGVNEKEGAVDENGESWEAEGLFVCDASVLPTAVGVNPMITI 585

Query: 585 MNIAHYISKCILD 597
            + A  IS  I+D
Sbjct: 586 QSTAFCISNRIVD 598



>gi|16905151|gb|AAL31021.1|AC078948_5 putative alcohol oxidase [Oryza sativa Japonica Group]
          Length = 590

 Score =  281 bits (720), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 164/493 (33%), Positives = 256/493 (51%), Gaps = 38/493 (7%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG ++ + D S+ +    ++L+E  G   T +    +  G+  GGG+ + WSA +
Sbjct: 107 VVVVEKGDYFTKEDYSSIEGPSMERLFERGGVFCTSNVTTMIFTGATVGGGSAVNWSASI 166

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
                V +EW++  GL  F    Y  AM  +  RLG           N+ +  GC  LGL
Sbjct: 167 RTPAGVMQEWSREHGLAVFASPGYARAMDAVCERLGVTDACREEGFQNKVVRRGCDALGL 226

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD 304
            +D +P+N+ S  H CG C+FGC  G+K+    TWL +A    A  L  C  E  +++ +
Sbjct: 227 RADAVPRNS-SEGHFCGSCNFGCPTGDKKGTDTTWLVDAVERGAVILTGCKAEHFIVESN 285

Query: 305 ----GKSQKVMG-VEVIINN--IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
               G+S++ +G V   ++N   K++++ AK  + ++GA+ +P LL  SGLKN++IGRNL
Sbjct: 286 GGGGGRSKRCVGLVATCMSNGITKKLRVEAKVSISASGALMTPPLLRNSGLKNRHIGRNL 345

Query: 358 HVHPIAAVYGVFPNKEI------KTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFM 411
           H+HP++  +G FP+         K Y G I++++   TE          I   +  PG  
Sbjct: 346 HLHPVSMAWGYFPDNTPEPHIPGKCYEGGIITSMHRVTERT-------IIETPALGPGAF 398

Query: 412 FANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMV 471
            A  PW+S    K+ M  Y        + RDR  G +    +G+ R+ Y  S+ D++ + 
Sbjct: 399 AALVPWESGRDMKERMRRYARTAHAFALVRDRGAGSV----DGEGRVRYAPSRDDAEELR 454

Query: 472 AGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQT- 530
           AGL  A+RIL AAGA ++GT ++  D   +        D   + FL+++     P + T 
Sbjct: 455 AGLRRALRILVAAGAAEVGTHRS--DGARLR--CKGARDADVEAFLDEVTVEKGPMHSTT 510

Query: 531 ------CTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTT 584
                 C  +  QM SCRMG  P   AV+  GE+WE E LYV D S+LPTA GV  M+T 
Sbjct: 511 DKWSVLC--SAHQMGSCRMGASPRDGAVDVAGESWEAEGLYVCDGSLLPTAVGVNPMITI 568

Query: 585 MNIAHYISKCILD 597
            +IA+ ++K I D
Sbjct: 569 QSIAYCVAKGIAD 581



>gi|226499278|ref|NP_001148058.1| oxidoreductase [Zea mays]
 gi|195615552|gb|ACG29606.1| oxidoreductase [Zea mays]
          Length = 768

 Score =  281 bits (719), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 168/487 (34%), Positives = 254/487 (52%), Gaps = 32/487 (6%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+VIEKG ++   D +  +    + LYE  G + T  ++  +LAGS  GGGT + WSA +
Sbjct: 279 VVVIEKGDYFTARDYTAIEAPSMEHLYEGGGFVSTLSASALLLAGSTVGGGTAVNWSACI 338

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +    VR EWA++ GLP F   EY  AM  +  RLG           N+ L  GC++LG 
Sbjct: 339 KTPDDVRGEWARDRGLPLFATGEYAAAMDKVFERLGVTAGCAEEGLQNKVLRKGCERLGY 398

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILID-- 302
             +++ +N+ S  H CG C +GC+ G+K+    TWL +A S  A  L  C  EK+L++  
Sbjct: 399 KVESVSRNS-SEGHYCGSCGYGCRTGDKRGTDSTWLVDAVSRGAVILTGCKAEKLLLEPG 457

Query: 303 --KDGKSQKVMGVEVIINN---IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
              DG++++ +GV     N    + +++ A+  V S G++ +P LL  SGL+N++IG+NL
Sbjct: 458 RAADGRAKRCVGVVARSTNPAITRTLEVTARVTVSSCGSLLTPVLLRGSGLRNRHIGKNL 517

Query: 358 HVHPIAAVYGVFPNK----EIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFA 413
           H+HP A V+G FP+       + Y G I++++      V+G   GA        P    A
Sbjct: 518 HLHPTALVWGYFPDTVPDLRGRMYEGGIITSL----HKVEGGGPGAPARAILEAPAMGLA 573

Query: 414 N----FPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKS 469
                FPW S    K+ ML Y   V L  + RDR  G +     G+ R+ Y L   D ++
Sbjct: 574 GAGTQFPWVSGRDMKERMLRYGRTVHLFSMVRDRGSGTV----QGERRVAYHLDATDREN 629

Query: 470 MVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQ 529
           M  G+  A+R+LAAAGA +IGT ++    +          +   ++FL+ +  V  P  +
Sbjct: 630 MRDGMRRALRVLAAAGAAEIGTHRSDGQRFACGGA----TEAALEEFLDGVDVVRGPQSK 685

Query: 530 ----TCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTM 585
               T   T  QM SCRMG      AV+  GE+WE  +LYV D SVLP A GV  M+T  
Sbjct: 686 AEAWTLCCTAHQMGSCRMGATARDGAVDARGESWEAGSLYVCDGSVLPGAVGVNPMVTIQ 745

Query: 586 NIAHYIS 592
           ++A+  +
Sbjct: 746 SVAYCFA 752



>gi|356559057|ref|XP_003547818.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
          Length = 749

 Score =  281 bits (719), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 173/498 (34%), Positives = 263/498 (52%), Gaps = 28/498 (5%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           VLV+EKG +  + +LS  +    D++Y  +G + T D ++ +LAGS  GGG+ I WSA +
Sbjct: 264 VLVLEKGSYSARNNLSLLEGPSMDQMYLSNGLVATKDMSVLILAGSTVGGGSAINWSASI 323

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
                V +EW     L  F    Y  A+  +  ++G  +       +N  L  GC ++G 
Sbjct: 324 RTPQHVCKEWCDGHELELFESKLYKEALDVVCEKMGVQSEIDDEGFNNAVLRRGCLEMGY 383

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNE-AKSNNAKFLKNCYVEKIL-ID 302
              +IP+N AS  H CGWC  GCK G K+    TWL +  KS N   + +C   ++L   
Sbjct: 384 PVCDIPRN-ASSDHYCGWCCMGCKDGRKKGTLETWLVDLVKSGNGAIIPSCEAIQVLHKK 442

Query: 303 KDGKSQKVM-GVEVIINNIKRVKI---HAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLH 358
           K G+ +K+  GV   I    +  I    +K  VV+ GA+ +PALL RSGLKN+NIGRNLH
Sbjct: 443 KKGRDRKIARGVAFAIEYKGKRDICVVESKVTVVACGALSTPALLKRSGLKNENIGRNLH 502

Query: 359 VHPIAAVYGVFPN---------KEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPG 409
           +HP+A  +G FP+         K  K+Y G IM+A+S      D   YGA I   + HPG
Sbjct: 503 LHPVAMAWGYFPDSLSPELWPEKHKKSYEGGIMTAMSTVVAQFDKSGYGAVIQTPALHPG 562

Query: 410 FMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKS 469
                 PW S    K  M +++    +  + RD+  G +    N    + Y+L   D ++
Sbjct: 563 MFSILMPWTSGKDIKDRMRKFSRTAHVFALARDQGSGTV----NSPSHISYQLKDVDKEN 618

Query: 470 MVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQ 529
           +  GL   +RILAAAGA +IGT     ++      V  ++  +F++F+ +   + +    
Sbjct: 619 LKIGLEKVLRILAAAGAEEIGT----HNNKGRSINVKQVSYHEFEKFVKEESSMSLTDIS 674

Query: 530 TCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAH 589
           T   +  QM SC+MG +P +S VN +GE WEVE LY+AD+SV PTA GV  M+T   I++
Sbjct: 675 TPLCSAHQMGSCKMGTNPRESVVNQMGETWEVEGLYLADTSVFPTALGVNPMVTVQAISY 734

Query: 590 YISKCILDKKIFTVKKKR 607
             ++ +L+     +++KR
Sbjct: 735 CTAQYVLE----VLRRKR 748



>gi|494771433|ref|WP_007506841.1| oxidoreductase [Frankia sp. CN3]
 gi|357081490|gb|EHI90921.1| glucose-methanol-choline oxidoreductase [Frankia sp. CN3]
          Length = 650

 Score =  281 bits (719), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 176/600 (29%), Positives = 284/600 (47%), Gaps = 31/600 (5%)

Query: 2   SLINSKILSI-----QKPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWL- 55
           SL +++++ +      + F  L    RE   ++   S     R ++++   L  +++ L 
Sbjct: 59  SLWDTRLMGMFLGAGPRRFSALGPAAREDALLRLGESPAERRRVLFQALRGLATSSYLLA 118

Query: 56  -NPYNFNPV---IGYPGADPEANGSRFSSRNFPKYNFLEISDHDSDIKEFDTXXXXXXXX 111
             P   +PV   IGYPG  P    +    R          + +D D+    +        
Sbjct: 119 PGPTGSSPVWASIGYPG--PLGALAEAPRRPLAPLTPTSDTAYDCDVVVVGSGAGGGTAA 176

Query: 112 XXXXXXRLARMENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSN 171
                  L    +V+V+E+G +YD  D    +  G  +LY  +G   T +  + ++AGS 
Sbjct: 177 AVLAGAGL----DVVVLERGGYYDDADFDGGELSGLSRLYA-AGPATTAEGQVSLVAGSC 231

Query: 172 FGGGTTIGWSAFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQS 231
            GGGT + W+        VR EWA   G+  F   E+ +A+  ++ RL  N  N      
Sbjct: 232 LGGGTVVNWTTSFPTPPEVRAEWAA-LGVKQFDLPEFSDALDAVSRRLSVNVDNSDACAR 290

Query: 232 NQTLINGCKKLGLHSDNIPQNT--ASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAK 289
           +  +  G + LG H D   +N     +   CG C +GC+ G KQS T TWL +A+S+ A+
Sbjct: 291 DAVMERGLRALGWHVDATARNVTDCDMGVDCGRCGYGCRRGAKQSVTKTWLADAESHGAR 350

Query: 290 FLKNCYVEKILIDKDGKSQKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLK 349
            + N    ++ +    +  + +GV+ +  +   V + A+ VVV+AGAI +PALL RSGL 
Sbjct: 351 LVVNVDARRVAV----RGGRAVGVQGLTRDGHTVTVRARSVVVAAGAIQTPALLRRSGLA 406

Query: 350 NKNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPG 409
           N NIGR L +HP  AV+GV+ ++EI+ + G + +  S    ++DG  YG     G  +P 
Sbjct: 407 NPNIGRYLRLHPATAVWGVY-DEEIRPWEGGLQTRYSREHGDLDGSGYGVIYETGPGNPA 465

Query: 410 FMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKS 469
            +     W+    H   M +  +   + VITRDR+ G +    +G+P   Y+LS +D+  
Sbjct: 466 ALQGFMNWRGGAAHLATMKDLAHTGGVGVITRDRDSGEVGVGRDGEPIPRYRLSGYDAAH 525

Query: 470 MVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQ 529
           + AG+  A RI+ AAGA +I +       Y       P     + +F++     G    Q
Sbjct: 526 LKAGVEGATRIIEAAGARRIYSAHQAGPSY------EPGRRGSYQEFVSACHAAGYGPGQ 579

Query: 530 TCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAH 589
                +  M + RMGD    SA +P G  WE+ N+ VAD+S  PT+ GV  M+T   IAH
Sbjct: 580 CAIAALHLMGTARMGDSRETSATDPDGVTWELPNVVVADASCFPTSPGVNPMITIEAIAH 639



>gi|448527062|ref|XP_003869428.1| hypothetical protein CORT_0D04530 [Candida orthopsilosis Co 90-125]
 gi|380353781|emb|CCG23293.1| hypothetical protein CORT_0D04530 [Candida orthopsilosis]
          Length = 704

 Score =  280 bits (717), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 181/611 (29%), Positives = 321/611 (52%), Gaps = 25/611 (4%)

Query: 2   SLINSKILS--IQKPF---HELTQKQREHTFIKWSTSQYASVRKIYKSFT--MLICATFW 54
           S++NS++L+  +   F    ++T K+RE     W  S  +  R+++++ +   L      
Sbjct: 86  SILNSRVLAPMLTNSFTLVMDMTLKEREALLAAWRDSPISVKRQLFRTISSATLNVMIVL 145

Query: 55  LNPYNFNPVIGYPGADPEANGSRFSSRNFPKYNFL---EISDHDSDIKEFDTXXXXXXXX 111
            N  ++   I YPG + + +  +    +  +Y+ +   E  D +  + + D         
Sbjct: 146 GNELHYK-AIHYPGRELKESAYQGFELDPFRYDMMSKPEFDDTELYLPDIDVAIIGSGAG 204

Query: 112 XXXXXXRLAR-MENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGS 170
                  LA      L++EKG +Y   + +   ++G D LY+  G + + +S + VLAGS
Sbjct: 205 SGVVAHTLANDGYKSLILEKGKYYSPSEFNFNDREGVDSLYQNKGVLSSKNSQIVVLAGS 264

Query: 171 NFGGGTTIGWSAFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQ 230
           NFGGGTT+ W A  +  + VR+EW + +GL +   + Y     Y+  ++G +T  I H+ 
Sbjct: 265 NFGGGTTVNWLACFKTPFKVRKEWYEEYGLDFAATESYDKCQDYVWKQIGASTKGIKHSL 324

Query: 231 SNQTLINGCKKLGLHSDNIPQNTAS-ITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAK 289
           SN+ LI G  KLG     + QNT    +H CG+C  GCKYG KQ + + W   A +  +K
Sbjct: 325 SNKVLIEGGTKLGYVCKAVDQNTGGHPSHSCGFCYLGCKYGIKQGSAVNWFRAAAATGSK 384

Query: 290 FLKNCYVEKILIDKDGKSQKVMGVEVIINNIKRVKIHA-KRVVVSAGAIHSPALLLRSGL 348
           F+    V +IL   +G +  ++  + +     R K+   K+ VVS G++++P++L  SG 
Sbjct: 385 FMDQVRVLEIL-HTNGVATGLLCQDEVTGT--RFKVTGPKKFVVSGGSLNTPSVLRNSGF 441

Query: 349 KNKNIGRNLHVHPIAAVYGVF-PNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHH 407
           KNK+IG+NL +HP   ++G F P  +   +  +IM+A+    E++DG+ +GAKI      
Sbjct: 442 KNKHIGQNLKLHPATVLFGDFGPKVQADHFDNSIMTAVCTQAEDLDGKAHGAKIETLLAT 501

Query: 408 PGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKP---RLEYKLSQ 464
           P    A FPW+ +   +Q +L  N++  ++++TRD   G +  D + +P    ++Y +++
Sbjct: 502 PFLHAALFPWRGSDDIRQEILRCNHMCSMLLLTRDTSAGSVGADPS-RPDAISIDYSINK 560

Query: 465 HDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVN--PLNDPKFDQFLNKIKK 522
            D  +++  LL A  IL   GA +I + Q  +  +      +   + D  + ++   + K
Sbjct: 561 FDKNALLQALLLAADILYIEGAERILSPQPWVPIFKSTKSKDRRSITDKDYVEWRETVAK 620

Query: 523 VGIPTYQTCTGTIEQMSSCRM-GDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSM 581
           + +  + T  GT  QMS+CRM G  PN  A +  G+ +E  N+Y+AD+S +PTA+GV  M
Sbjct: 621 IPLDDFGTPYGTAHQMSTCRMSGKGPNYGACDANGKLFEASNIYIADASCMPTASGVNPM 680

Query: 582 MTTMNIAHYIS 592
           +TT+ +A ++S
Sbjct: 681 VTTLTLARHVS 691



>gi|224099953|ref|XP_002311685.1| predicted protein [Populus trichocarpa]
 gi|222851505|gb|EEE89052.1| predicted protein [Populus trichocarpa]
          Length = 744

 Score =  280 bits (716), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 176/495 (35%), Positives = 273/495 (55%), Gaps = 36/495 (7%)

Query: 123 ENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTD-DSNMYVLAGSNFGGGTTIGWS 181
           + V V+EKG+++   D S  +     +LYE SGG+LT  D+ + ++AGS  GGG+ + WS
Sbjct: 261 QKVFVLEKGNYFTATDYSGLEGPSLAQLYE-SGGLLTSADAGVIIMAGSAVGGGSVVNWS 319

Query: 182 AFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKK 241
           A ++    V +EW KN  +P F   EY +AM  + AR+G      +    NQ L  GC++
Sbjct: 320 ASIKTPNSVLQEWTKNQKIPLFGSSEYLSAMDTVCARIGVTENCKVEGFQNQVLRKGCER 379

Query: 242 LGLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILI 301
           LG+    +P+N++   H CG C +GC+ GEK+    TWL +A  N A  L  C  E+ ++
Sbjct: 380 LGVPVKTVPRNSSE-RHYCGSCGYGCRKGEKKGTDRTWLVDAVDNGAVILTGCKAERFIL 438

Query: 302 DKD---GKSQK----VMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIG 354
           +K+   GK +K    V+   +  N I R++I AK  + + GA+ +P L++ SGLKN+NIG
Sbjct: 439 EKNKGLGKRKKKCLGVIAKIINNNIITRLQIEAKVTISACGALLTPPLMISSGLKNQNIG 498

Query: 355 RNLHVHPIAAVYGVFP--NKEI--KTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGF 410
           RNLH+HP+   +G FP  N E   K Y G I++A+    E V G++    IV     PG 
Sbjct: 499 RNLHLHPVLMAWGYFPESNSEFKGKVYDGGIITAVH---EVVAGDSNVRAIV---ETPGL 552

Query: 411 MFANF----PWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHD 466
             ++F    PW S    K  M++Y+    L+ I RD   G++ T+     R+ Y L+  D
Sbjct: 553 GPSSFSVLCPWVSGHDMKNRMMKYSRTAHLITIIRDSGSGKVTTE----GRISYYLNASD 608

Query: 467 SKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVG-- 524
             ++  GL  A+RIL AAGA ++GT ++  D   ++     + D   ++FL+ +   G  
Sbjct: 609 RDNLKVGLRQALRILVAAGAVEVGTHRS--DGQRIKCRGIKIED--LEEFLDTVYATGGA 664

Query: 525 --IPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMM 582
             +        +  QM SCRMG +  + AV+  GE+WE E L+V D+SVLP+A GV  M+
Sbjct: 665 LSLEEDWMFYSSAHQMGSCRMGINEKEGAVDENGESWEAEGLFVCDASVLPSAVGVNPMI 724

Query: 583 TTMNIAHYISKCILD 597
           T  + A+ +SK I +
Sbjct: 725 TIQSTAYCLSKKIAE 739



>gi|462406299|gb|EMJ11763.1| hypothetical protein PRUPE_ppa014756mg [Prunus persica]
          Length = 808

 Score =  280 bits (716), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 173/490 (35%), Positives = 254/490 (51%), Gaps = 28/490 (5%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGML-TDDSNMYVLAGSNFGGGTTIGWSAF 183
           V+VIEKG+++ + +L+  +    D++Y LSGG++ TDD  ++VLAGS  GGG+ I WSA 
Sbjct: 317 VVVIEKGNYHARKNLTLLEGPAMDQMY-LSGGLIATDDMGVFVLAGSTVGGGSAINWSAS 375

Query: 184 MEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLG 243
           +     V +EW  +  L  F    Y  A+  +  ++G  +       +N  L  GC++LG
Sbjct: 376 IRTPQHVIKEWCNDHELELFDSKLYQEALDVVCEKMGVQSQIQEEGFNNAILRKGCQELG 435

Query: 244 LHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNE-AKSNNAKFLKNCYVEKILID 302
              +NIP+N+    H CGWC FGCK G K   T TWL +   S N   L  C   K+L  
Sbjct: 436 YPVNNIPRNSPP-NHYCGWCCFGCKDGRKGGTTETWLVDLVNSGNGAILTGCEAIKVLHK 494

Query: 303 -----KDGKSQKVMGVEVIINNIKRVK-IHAKRVVVSAGAIHSPALLLRSGLKNKNIGRN 356
                +D  +   +  E      K +  + +K  +V+ GA+ +P LL RSGLKN NIG N
Sbjct: 495 RKKGRRDRNTATGVAFEFEHGGGKEIGFVESKVTIVACGALCTPKLLKRSGLKNVNIGEN 554

Query: 357 LHVHPIAAVYGVFPN---------KEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHH 407
           LH+HP+A  +G FP+         +E K+Y G IM+A+S      +   YGA I   + H
Sbjct: 555 LHLHPVAMAWGYFPDSQVFDGRPEREKKSYEGGIMTAMSTVVAEFNKSGYGAVIQTPALH 614

Query: 408 PGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKP-RLEYKLSQHD 466
           PG      PW S    K  M  ++    +  + RD+  G +    N  P  + Y++   D
Sbjct: 615 PGMFSVVMPWVSGKDIKHRMSRFSRTAHVFALARDKGSGTV----NAPPYSISYEMEALD 670

Query: 467 SKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIP 526
             ++  GL  ++RILAAAGA  IGT         V+      N  +F++F+ +     + 
Sbjct: 671 ENNLKIGLEKSLRILAAAGAEDIGTHHFKGKGLHVKKS----NLDEFERFVKEESSRPLR 726

Query: 527 TYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMN 586
              +   +  QM SCRMG D  +S +N +GE WEVE L+VAD+SV PTA GV  M+T   
Sbjct: 727 ELSSAICSAHQMGSCRMGVDSKQSVLNQMGETWEVEGLFVADTSVFPTALGVNPMVTVQA 786

Query: 587 IAHYISKCIL 596
           IA+  S+ IL
Sbjct: 787 IAYCTSQSIL 796



>gi|502110108|ref|XP_004493801.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Cicer arietinum]
          Length = 738

 Score =  278 bits (711), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 165/496 (33%), Positives = 264/496 (53%), Gaps = 27/496 (5%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG ++   D S+ +     +LYE  G M T D    +LAGS  GGG++I W+A +
Sbjct: 256 VIVLEKGEYFVSHDYSSLESSSMKELYESGGMMPTVDGKTMILAGSTVGGGSSINWAACV 315

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
                V +EW+K + L  F   +Y +AM  +  R+G        +  NQ L  GC+ +GL
Sbjct: 316 RTPDSVTKEWSKKYKLSLFATSDYRSAMDSVCRRIGVTEKCNKESFQNQVLRKGCEGIGL 375

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILID-- 302
             +++  N++   H CG C FGC+ G+K+    TWL +A +N A  +  C  EK +++  
Sbjct: 376 KVESVAVNSSE-DHYCGSCCFGCRTGDKKGTDSTWLVDAVNNGAVIITGCNAEKFILENG 434

Query: 303 KDG--KSQKVMGVEVIINN----IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRN 356
           K+G  K +   GV    +N     K+++I +K  + S G++ +P L++ SGL+N NIGRN
Sbjct: 435 KNGTIKRKNCSGVIAAASNKSKITKKLQIESKVTISSCGSLFTPPLMISSGLQNSNIGRN 494

Query: 357 LHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHH--PGFMFAN 414
           LH+HP+   +G FP +            I  +   +  EN   KI++ +    PG   A 
Sbjct: 495 LHLHPVQFAWGYFPEEMTNLIGNNYEGGIITSIHKILAENSTPKIIIEAPALGPGSFSAL 554

Query: 415 FPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGL 474
            PW S L  K+ +++Y     L  + RD+  G I T+     R+ Y+L + D +++  GL
Sbjct: 555 IPWTSGLDMKERLVKYARTANLFALVRDKGSGEIKTE----GRVSYRLDKIDKENLRVGL 610

Query: 475 LTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQ----T 530
             ++RIL AAGA ++GT ++  D   ++     + D   ++FL+ +  VG P  +    T
Sbjct: 611 RQSLRILVAAGAVEVGTYRS--DGQRIK--CRGIKDKDLEEFLDNVAVVGGPRSRGEVWT 666

Query: 531 CTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHY 590
              +  QM SCRMG +  + AV+  GE+WE + L+V D SVLP+A GV  M+T  + A+ 
Sbjct: 667 VFSSAHQMGSCRMGANEEEGAVDENGESWEAKGLFVCDGSVLPSAVGVNPMITIQSTAY- 725

Query: 591 ISKCILDKKIFTVKKK 606
              CI  K   ++KKK
Sbjct: 726 ---CIASKIAESLKKK 738



>gi|16905157|gb|AAL31027.1|AC078948_11 putative alcohol oxidase [Oryza sativa Japonica Group]
 gi|31432646|gb|AAP54254.1| GMC oxidoreductase family protein [Oryza sativa Japonica Group]
          Length = 637

 Score =  278 bits (711), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 160/492 (32%), Positives = 252/492 (51%), Gaps = 37/492 (7%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG ++   D ++ +    ++LYE  G   T +    +  G+  GGG+ + WSA +
Sbjct: 160 VVVVEKGDYFATEDYTSLEGPSMERLYEKGGVFGTSNVTTILFTGATVGGGSAVNWSACI 219

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
                +REEW++  GLP F    Y  AM  +  R+            N+ L  GC  LG+
Sbjct: 220 RTPAEIREEWSREHGLPVFASTAYAQAMDAVCDRIRVTGGCEEEGFQNRVLRRGCDALGM 279

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD 304
            +D +P+N+ S  H CG C+ GC  G+K+    TWL +A    A  L  C  E  +++++
Sbjct: 280 RADAVPRNS-SEGHFCGSCNLGCPTGDKKGTDTTWLVDAVERGAVILTGCKAEHFILERN 338

Query: 305 -----GKSQKVMGVEVIINN---IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRN 356
                G+S++ +G+     +    K+++I AK  + + GA+ +P LL  SGLKN++IGRN
Sbjct: 339 AGGRGGRSKRCVGLMATCTSSGITKKLRIEAKVSISACGALMTPPLLRNSGLKNRHIGRN 398

Query: 357 LHVHPIAAVYGVFPNKEI----KTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMF 412
           LH+HP++  +G FP+       K Y G I++++   T+          I   +  PG   
Sbjct: 399 LHLHPVSMAWGYFPDSTAELPGKCYEGGIITSMHRVTDRT-------IIETPALGPGAFS 451

Query: 413 ANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVA 472
           A  PW+S    K+ M  Y        + RDR  G +    +G+ R+ +  S+ D++ + A
Sbjct: 452 AVVPWESGRDMKERMRRYARTAHAFALVRDRGAGAV----DGEGRVRFSPSRDDAEELRA 507

Query: 473 GLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQT-- 530
           GL  A+RIL AAGA ++GT ++  D   +      + D   + FL+++     P Y    
Sbjct: 508 GLRRALRILVAAGAAEVGTHRS--DGLRLR--CKGVRDADVEAFLDEVTIEKGPMYPGSD 563

Query: 531 -----CTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTM 585
                C+    QM SCRMG  P   AV+  GE+WE E LYV D S+LPTA GV  M+T  
Sbjct: 564 KWAIFCSA--HQMGSCRMGASPRDGAVDGAGESWEAEGLYVCDGSLLPTAVGVNPMITIQ 621

Query: 586 NIAHYISKCILD 597
           +IA+ +S  I D
Sbjct: 622 SIAYCLSNGIAD 633



>gi|242034203|ref|XP_002464496.1| hypothetical protein SORBIDRAFT_01g019480 [Sorghum bicolor]
 gi|241918350|gb|EER91494.1| hypothetical protein SORBIDRAFT_01g019480 [Sorghum bicolor]
          Length = 732

 Score =  278 bits (710), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 168/495 (33%), Positives = 252/495 (50%), Gaps = 37/495 (7%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG ++     ++ +    ++LYE  G   T +    +  G+  GGG+ I WSA +
Sbjct: 245 VIVVEKGDYFTAESYTSVEGPSMERLYEKGGIFCTSNVTTIMFTGATVGGGSAINWSASI 304

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
               +V +EWA++ GLP F   EY  AM  + ARL            N+ L  GC+ LGL
Sbjct: 305 RTPEWVTKEWARDHGLPVFGTPEYARAMDAVCARLAVTGGCRQEGFQNKALRRGCEALGL 364

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDK- 303
             D +P+N+ S  H CG C  GC  GEK+    TWL +A    A  L  C  E+ +++  
Sbjct: 365 RGDAVPRNS-SEGHFCGSCHLGCPTGEKRGTDTTWLVDAVDRGAVILTGCKAERFILESN 423

Query: 304 ------DGKSQKVMGV--EVIINNI-KRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIG 354
                 +G+S+K +G+    + + I K+++I AK  + + GA+ +P LL  SGLKN++IG
Sbjct: 424 PGGGGDNGRSKKCVGLVAACMSDGISKKLRIEAKVSISACGALMTPPLLRNSGLKNRHIG 483

Query: 355 RNLHVHPIAAVYGVFP-----NKEI--KTYSGTIMSAISNATENVDGENYGAKIVVGSHH 407
           RNLH+HP++  +G FP     N E+  K Y G I++ +   T           I   +  
Sbjct: 484 RNLHLHPVSMAWGYFPDGTPENAELSGKCYEGGIITTMHRVTART-------IIQTPALG 536

Query: 408 PGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDS 467
           PG   +  PW+S    K+ ML Y        + RDR  G +    +G+ R+ Y  S+ D 
Sbjct: 537 PGCWASLIPWESGRDMKERMLRYARTAHAFALVRDRGAGHV----DGEGRVRYAPSREDV 592

Query: 468 KSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKI-----KK 522
           + +  GL  A+RIL AAGA ++GT ++   D +       L D   + FL ++       
Sbjct: 593 EELRNGLRQALRILVAAGAAEVGTHRS---DGLRLRCDGGLRDEDLEAFLKEVTVGEGPM 649

Query: 523 VGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMM 582
           +  P       +  QM SCRMG  P   AV+  GE+WE E LYV D SVLPTA GV  M+
Sbjct: 650 LPGPDKWALHCSAHQMGSCRMGCSPKDGAVDGRGESWEAEGLYVCDGSVLPTAVGVNPMI 709

Query: 583 TTMNIAHYISKCILD 597
           T  + A+ +SK I +
Sbjct: 710 TIQSTAYCVSKGIAE 724



>gi|327293505|ref|XP_003231449.1| long chain fatty alcohol oxidase [Trichophyton rubrum CBS 118892]
 gi|326466565|gb|EGD92018.1| long chain fatty alcohol oxidase [Trichophyton rubrum CBS 118892]
          Length = 591

 Score =  278 bits (710), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 182/558 (32%), Positives = 280/558 (50%), Gaps = 37/558 (6%)

Query: 63  VIGYPGADPEANGSRFSSRNFPKYNFLEISDHDS-DIKEFDTXXXXXXXXXXXXXXRLAR 121
           V+G+P  +   +G+  +S +FP Y+FL+    D  +I E D                LA 
Sbjct: 27  VLGFP--NVPVHGA--TSESFP-YSFLQFPAGDGPEIIETDVIIVGSGCGAGVAAKNLAE 81

Query: 122 M-ENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGW 180
               V+V+EK + +          +G   L+   G  L+DD ++ V++GS +GGG TI W
Sbjct: 82  AGHRVIVVEKSYFFPNDHYPMSGCEGAFHLFSNGGAELSDDGSIGVVSGSTWGGGGTINW 141

Query: 181 SAFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCK 240
           SA ++ Q  VREEWA N GLP F    Y  ++  +   +G +T  I  N  N  L+ G +
Sbjct: 142 SASLQTQSMVREEWA-NSGLPLFTSSAYQTSLDRVCDYMGVSTDFIQQNHGNSVLMEGAR 200

Query: 241 KLGLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKIL 300
           KLG  +  +PQNT    H CG+C+ GC  G KQ   +T+L +A    A F++    EK+L
Sbjct: 201 KLGYSAKAVPQNTGHQKHACGYCALGCAAGIKQGPAVTFLADAARAGATFIEGFKAEKVL 260

Query: 301 IDKDGKSQKVMGVEVIINNIKR---VKIHAKRVVV------------SAGAIHSPALLLR 345
             +     K + + V      R      H K  +             S G + SP LLLR
Sbjct: 261 FGRKLVKGKKVAIGVRGTWTSRDASGATHGKPAITRKVVIKAKKVVVSCGTLESPLLLLR 320

Query: 346 SGLKNKNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGS 405
           SGLKN  IGRNLH+HP+  +  +F + E + + G+I++++ +  EN+DG  +G+KI    
Sbjct: 321 SGLKNPQIGRNLHLHPVIIISAMF-DHETRPWEGSILTSLVSDFENLDGCGHGSKIEAVV 379

Query: 406 HHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDEN-GKPRLEYKLSQ 464
             P F      W++ L +K        +   + +TRDR+ GR+  D N G+ R+EY  S 
Sbjct: 380 MLPNFFLPLMAWENGLDYKTFAANARRMAGFISLTRDRDTGRVYPDPNDGRCRIEYTPSA 439

Query: 465 HDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYI--------VENGVNPLNDPKFDQF 516
            D K ++ G++ A +I   +GA +I +    I  +          + GV   N+  F ++
Sbjct: 440 FDRKHILEGIIGAAKIAYVSGAREIRSSSLAIPTFTRPETSSDAADEGV---NNAAFQEW 496

Query: 517 LNKIKK-VGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTA 575
           + K++  V +PT Q+   +  QM +CRMG  P  S V+P G  W    LYVAD+SV P+A
Sbjct: 497 IKKLRTGVPLPTEQSMFASAHQMGTCRMGISPKTSVVDPTGMVWGTSGLYVADASVFPSA 556

Query: 576 TGVPSMMTTMNIAHYISK 593
           +GV  M+T M I    S+
Sbjct: 557 SGVNPMITNMAITDVTSR 574



>gi|449466091|ref|XP_004150760.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Cucumis sativus]
          Length = 617

 Score =  277 bits (709), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 169/500 (33%), Positives = 264/500 (52%), Gaps = 30/500 (6%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           VLV+EKG +  + +LS  +    +++Y+ SG + TD+ N+ +LAGS  GGG+T+ WSA +
Sbjct: 130 VLVLEKGSYCARTNLSLLEGPAMEEMYQSSGLVATDNMNVLILAGSTVGGGSTVNWSASI 189

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           E    +  EW+  + L  F  + Y  A+  +  ++G  +       +N  L  GC++LG 
Sbjct: 190 ETPSHITREWSDEYELELFRSNLYKEAIDVVCKKMGVQSKIDNEGFNNAVLRKGCEELGG 249

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNE-AKSNNAKFLKNCYVEKILIDK 303
           H+  IP+N+ S  H CGWC  GC+ G K+    TWL +  +S N   L  C   KI  +K
Sbjct: 250 HAITIPRNSTS-DHYCGWCCLGCRDGRKKGTAETWLVDLVRSGNGVILPGCEAIKIRQEK 308

Query: 304 ----DGKSQKVMGVEVIINNIKR--VKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
               + K  K +  E    +  +    + +K  +V+ GA+++P LL RSGL+N NIG+NL
Sbjct: 309 EHGRERKRAKGVAFEFWCGSAAKQMCLVESKVTIVACGALNTPPLLKRSGLRNPNIGKNL 368

Query: 358 HVHPIAAVYGVF--------PNKEIKTYSGTIMSAISNATENVDGE-NYGAKIV-VGSHH 407
           H+HP+   +G F        P K+ K+Y G IM+A+ N     + E  YG  ++   + H
Sbjct: 369 HLHPVTMAWGYFPAETDKSWPEKDKKSYEGGIMTAMCNIGSEPNQEPGYGGAVIQTPALH 428

Query: 408 PGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDS 467
           PG      PW S    KQ M +++    + V+ RD+  G + +  +    L YK+   D 
Sbjct: 429 PGLFSILMPWISGTNIKQRMCKFSRTAHVFVLARDKGSGIVKSPSS----LSYKMDDVDE 484

Query: 468 KSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPT 527
            ++  GL  A++ILAAAGA +IGT             V  ++  ++++F+ +     +  
Sbjct: 485 HNLQKGLEKALKILAAAGAVEIGTHHNKGRSI----NVKKVSFREYEKFVKEESSRPLKD 540

Query: 528 YQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNI 587
             T   +  QM SCRMG     S VN  GE WEVE L++ADSSV PTA GV  M+T   I
Sbjct: 541 LLTPICSAHQMGSCRMGIGAKDSVVNQRGETWEVEGLFIADSSVFPTALGVNPMVTVQAI 600

Query: 588 AHYISKCILDKKIFTVKKKR 607
           A+  ++ +L+    T+K+KR
Sbjct: 601 AYCTAQSVLE----TLKRKR 616



>gi|315043774|ref|XP_003171263.1| fatty alcohol oxidase [Arthroderma gypseum CBS 118893]
 gi|311345052|gb|EFR04255.1| fatty alcohol oxidase [Arthroderma gypseum CBS 118893]
          Length = 738

 Score =  277 bits (709), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 184/601 (30%), Positives = 288/601 (47%), Gaps = 34/601 (5%)

Query: 12  QKPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADP 71
           + PF       R      W TS    +R  +++   L   ++  +  +   V+G+P    
Sbjct: 143 RTPFQNQPYSVRRQILSSWRTSYLPPLRAAHRALVALTKKSWVGSSPSLPLVLGFPSVPV 202

Query: 72  EANGSRFSSRNFPKYNFLEIS----DHDSDIKEFDTXXXXXXXXXXXXXXRLARM-ENVL 126
               +   S NFP Y+FL+         ++I E D                LA     V+
Sbjct: 203 HGAAA---SENFP-YSFLQFPAAGDGAGTEIIETDVVIVGSGCGAGVAAKNLAEAGHRVI 258

Query: 127 VIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEP 186
           V+EK + +          +G   L+   G  L+DD ++ V++GS +GGG TI WSA ++ 
Sbjct: 259 VVEKSYFFPNDRYPMAGSEGAFHLFSNGGAELSDDGSIGVVSGSTWGGGGTINWSASLQT 318

Query: 187 QYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHS 246
           Q  VREEWA N GLP F    Y  ++  +   +G +T  I  N  N  L+ G +KLG  +
Sbjct: 319 QSMVREEWA-NGGLPVFTSSAYQASLDRVCDYMGVSTDFIKQNHGNSVLMEGARKLGYTA 377

Query: 247 DNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDGK 306
             +PQNT    H CG+C+ GC  G ++          K   A  ++  +  +   D  G 
Sbjct: 378 KAVPQNTGHQQHDCGYCTLGCAAGAEKVLFARKHVRGK-KVAVGVRGTWTSR---DASGA 433

Query: 307 SQKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVY 366
           +     V       ++V I AK+V+VS G + SP LLLRSGL N  IGRNLH+HP+  + 
Sbjct: 434 THGKPAV------TRKVVIKAKKVIVSCGTLESPLLLLRSGLNNPQIGRNLHLHPVLIMS 487

Query: 367 GVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQL 426
            +F + E + + G+I++++ +  EN+DG  +G KI      P F      W   L +K  
Sbjct: 488 ALF-DHETRPWEGSILTSLVSDFENLDGRGHGTKIEAVVMLPNFFLPLMTWDDGLDYKVF 546

Query: 427 MLEYNNIVPLMVITRDREGGRILTDEN-GKPRLEYKLSQHDSKSMVAGLLTAVRILAAAG 485
                 +   + +TRDR+ GR+  D N G+ R++Y  S  D K ++ G++ A +I   +G
Sbjct: 547 AANARRMAGFISLTRDRDSGRVYPDPNDGRCRIDYTPSAFDRKHLLEGIIGAAKIAYVSG 606

Query: 486 ATKIGTCQTVIDDYI--------VENGVNPLNDPKFDQFLNKIKK-VGIPTYQTCTGTIE 536
           A +I +    I  +          + GVN   +  F +++ K++  V +PT Q+   +  
Sbjct: 607 AKEIRSSSRAIPTFTRPDPSSDAADEGVN---NAAFQEWIRKLRTGVPLPTEQSMFASAH 663

Query: 537 QMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKCIL 596
           QM +CRMG  P  S V+P G  W    LYVAD+SV P+A+GV  M+T M I    S+ + 
Sbjct: 664 QMGTCRMGTSPKTSVVDPTGMVWGTSGLYVADASVFPSASGVNPMVTNMAITDITSRKLA 723

Query: 597 D 597
           D
Sbjct: 724 D 724



>gi|297727683|ref|NP_001176205.1| Os10g0474966 [Oryza sativa Japonica Group]
 gi|255679490|dbj|BAH94933.1| Os10g0474966 [Oryza sativa Japonica Group]
          Length = 760

 Score =  277 bits (709), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 160/492 (32%), Positives = 252/492 (51%), Gaps = 37/492 (7%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG ++   D ++ +    ++LYE  G   T +    +  G+  GGG+ + WSA +
Sbjct: 283 VVVVEKGDYFATEDYTSLEGPSMERLYEKGGVFGTSNVTTILFTGATVGGGSAVNWSACI 342

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
                +REEW++  GLP F    Y  AM  +  R+            N+ L  GC  LG+
Sbjct: 343 RTPAEIREEWSREHGLPVFASTAYAQAMDAVCDRIRVTGGCEEEGFQNRVLRRGCDALGM 402

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD 304
            +D +P+N+ S  H CG C+ GC  G+K+    TWL +A    A  L  C  E  +++++
Sbjct: 403 RADAVPRNS-SEGHFCGSCNLGCPTGDKKGTDTTWLVDAVERGAVILTGCKAEHFILERN 461

Query: 305 -----GKSQKVMGVEVIINN---IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRN 356
                G+S++ +G+     +    K+++I AK  + + GA+ +P LL  SGLKN++IGRN
Sbjct: 462 AGGRGGRSKRCVGLMATCTSSGITKKLRIEAKVSISACGALMTPPLLRNSGLKNRHIGRN 521

Query: 357 LHVHPIAAVYGVFPNKEI----KTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMF 412
           LH+HP++  +G FP+       K Y G I++++   T+          I   +  PG   
Sbjct: 522 LHLHPVSMAWGYFPDSTAELPGKCYEGGIITSMHRVTDRT-------IIETPALGPGAFS 574

Query: 413 ANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVA 472
           A  PW+S    K+ M  Y        + RDR  G +    +G+ R+ +  S+ D++ + A
Sbjct: 575 AVVPWESGRDMKERMRRYARTAHAFALVRDRGAGAV----DGEGRVRFSPSRDDAEELRA 630

Query: 473 GLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQT-- 530
           GL  A+RIL AAGA ++GT ++  D   +      + D   + FL+++     P Y    
Sbjct: 631 GLRRALRILVAAGAAEVGTHRS--DGLRLR--CKGVRDADVEAFLDEVTIEKGPMYPGSD 686

Query: 531 -----CTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTM 585
                C+    QM SCRMG  P   AV+  GE+WE E LYV D S+LPTA GV  M+T  
Sbjct: 687 KWAIFCSA--HQMGSCRMGASPRDGAVDGAGESWEAEGLYVCDGSLLPTAVGVNPMITIQ 744

Query: 586 NIAHYISKCILD 597
           +IA+ +S  I D
Sbjct: 745 SIAYCLSNGIAD 756



>gi|449520567|ref|XP_004167305.1| PREDICTED: LOW QUALITY PROTEIN: long-chain-alcohol oxidase
           FAO4A-like, partial [Cucumis sativus]
          Length = 608

 Score =  277 bits (709), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 169/500 (33%), Positives = 265/500 (53%), Gaps = 30/500 (6%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           VLV+EKG +  + +LS  +    +++Y+ SG + TD+ N+ +LAGS  GGG+T+ WSA +
Sbjct: 121 VLVLEKGSYCARXNLSLLEGPAMEEMYQSSGLVATDNMNVLILAGSTVGGGSTVNWSASI 180

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           E    +  EW+  + L  F  + Y  A+  +  ++G  +       +N  L  GC++LG 
Sbjct: 181 ETPSHITREWSDEYELELFRSNLYKEAIDVVCKKMGVQSKIDNEGFNNAVLRKGCEELGG 240

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNE-AKSNNAKFLKNCYVEKILIDK 303
           H+  IP+N+ S  H CGWC  GC+ G K+    TWL +  +S N   L  C   KI  +K
Sbjct: 241 HAITIPRNSTS-DHYCGWCCLGCRDGRKKGTAETWLVDLVRSGNGVILPGCEAIKIRQEK 299

Query: 304 ----DGKSQKVMGVEVIINNIKR--VKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
               + K  K +  E    +  +    + +K  +V+ GA+++P LL RSGL+N NIG+NL
Sbjct: 300 EHGRERKRAKGVAFEFWCGSAAKQMCLVESKVTIVACGALNTPPLLKRSGLRNPNIGKNL 359

Query: 358 HVHPIAAVYGVF--------PNKEIKTYSGTIMSAISNATENVDGE-NYGAKIV-VGSHH 407
           H+HP+   +G F        P K+ K+Y G IM+A+ N     + E  YG  ++   + H
Sbjct: 360 HLHPVTMAWGYFPAETDKSWPEKDKKSYEGGIMTAMCNIGSEPNQEPGYGGAVIQTPALH 419

Query: 408 PGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDS 467
           PG      PW S    KQ M +++    + V+ RD+  G + +  +    L YK+   D 
Sbjct: 420 PGLFSILMPWISGTNIKQRMCKFSRTAHVFVLARDKGSGIVKSPSS----LSYKMDDVDE 475

Query: 468 KSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPT 527
            ++  GL  A++ILAAAGA +IGT         V+     ++  ++++F+ +     +  
Sbjct: 476 HNLQKGLEKALKILAAAGAVEIGTHHNKGRSINVKK----VSFREYEKFVKEESSRPLKD 531

Query: 528 YQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNI 587
             T   +  QM SCRMG     S VN  GE WEVE L++ADSSV PTA GV  M+T   I
Sbjct: 532 LLTPICSAHQMGSCRMGIGAKDSVVNQRGETWEVEGLFIADSSVFPTALGVNPMVTVQAI 591

Query: 588 AHYISKCILDKKIFTVKKKR 607
           A+  ++ +L+    T+K+KR
Sbjct: 592 AYCTAQSVLE----TLKRKR 607



>gi|356558886|ref|XP_003547733.1| PREDICTED: long-chain-alcohol oxidase FAO4A-like [Glycine max]
          Length = 743

 Score =  276 bits (707), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 170/498 (34%), Positives = 259/498 (52%), Gaps = 28/498 (5%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           VLV+EKG +  + +LS  +    D++Y  +G + T+D ++ +LAGS  GGG+ I WSA +
Sbjct: 258 VLVLEKGSYSARNNLSLLEGPSMDQMYLSNGLVATNDMSVLILAGSTVGGGSAINWSASI 317

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
                V +EW     L  F    Y  A+  +  ++G  +       +N  L  GC ++G 
Sbjct: 318 RTPQHVCKEWCDRHELELFESMLYKEALDVVCEKMGVQSEIDDEGFNNAVLRRGCVEMGY 377

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNE-AKSNNAKFLKNCYVEKILIDK 303
              NIP+N  S  H CGWC  GCK G K+    TWL +  KS N   + +C   ++L  K
Sbjct: 378 PVCNIPRNATS-DHYCGWCCLGCKDGRKKGTLETWLVDLVKSGNGAIIPSCEAIQVLHKK 436

Query: 304 DGKSQKVM--GVEVIINNIKRVKI---HAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLH 358
                + +  GV   I    +  I    +K  +V+ GA+ +PALL RSGLKN+NIGRNLH
Sbjct: 437 KKGRHRKIARGVAFAIEYKGKKDICVVESKVTIVACGALSTPALLKRSGLKNENIGRNLH 496

Query: 359 VHPIAAVYGVFPN---------KEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPG 409
           +HP+A  +G FP+         K  K+Y G IM+A+S      D   YG  I   + HPG
Sbjct: 497 LHPVAMAWGYFPDSPSPELWPEKHKKSYEGGIMTAMSTVVAQFDKSGYGTVIQTPALHPG 556

Query: 410 FMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKS 469
                 PW S    K  M +++    +  + RD+  G +    N    + Y+L   D ++
Sbjct: 557 MFSILMPWTSGADIKDRMRKFSRTAHVFALARDQGSGTV----NSPSCISYQLKDIDKEN 612

Query: 470 MVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQ 529
           +  GL   +RILAAAGA +IGT     ++      V  ++  +F++F+ +   + +    
Sbjct: 613 LKVGLEKVLRILAAAGAEEIGT----HNNKGRRINVKQVSYHEFEKFVKEESSMSLTDIS 668

Query: 530 TCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAH 589
           T   +  QM SC+MG +P +S VN +GE WEVE LY+ADSSV PTA GV  M+T   I++
Sbjct: 669 TPLCSAHQMGSCKMGTNPRESVVNQMGETWEVEGLYLADSSVFPTALGVNPMVTVQAISY 728

Query: 590 YISKCILDKKIFTVKKKR 607
             ++ +L+     +++KR
Sbjct: 729 CTAQYVLE----VLRRKR 742



>gi|414871101|tpg|DAA49658.1| TPA: hypothetical protein ZEAMMB73_936795 [Zea mays]
          Length = 762

 Score =  276 bits (705), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 164/496 (33%), Positives = 251/496 (50%), Gaps = 39/496 (7%)

Query: 123 ENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSA 182
             V+V+EKG ++     ++ +    ++LYE  G   T +    + AG+  GGG+ I WSA
Sbjct: 278 RKVVVVEKGDYFTAESYTSVEGPSMERLYEKGGIFCTSNVTTIMFAGTTVGGGSAINWSA 337

Query: 183 FMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKL 242
            +    +V +EWA+  GLP F   EY +AM  + ARL            N+ L  GC+ L
Sbjct: 338 SVRTPEWVTQEWAREHGLPMFGRPEYAHAMDAVCARLAVTGGCREEGFQNKVLRRGCEAL 397

Query: 243 GLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILID 302
           GL  D +P+N+ S  H CG C  GC  G+K+    TWL +A +  A  L  C  E+ +++
Sbjct: 398 GLRGDAVPRNS-SEGHFCGSCHLGCPTGDKRGTDTTWLVDAVARGAVVLTGCKAERFVLE 456

Query: 303 -----KDGKSQKVMGVEVIINN---IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIG 354
                +DG+S + +G+     +    K+++I AK  V + GA+ +P LL  SGL+N ++G
Sbjct: 457 SNPGGRDGRSNRCVGLVATCMSDGITKKLRIEAKVSVSACGALMTPPLLRNSGLQNSHVG 516

Query: 355 RNLHVHPIAAVYGVFPNKEI------KTYSGTIMSAISNATENVDGENYGAKIVVGSHHP 408
           RNLH+HP++  +G FP+         K Y G I++ +   T           I   +  P
Sbjct: 517 RNLHLHPVSMAWGYFPDSTPEAELSGKCYEGGIITTMRRVTART-------IIQTPALGP 569

Query: 409 GFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSK 468
           G   +  PW+S    K+ ML Y        + RDR  G +    +G+ R+ Y  S+ D  
Sbjct: 570 GCWASLVPWESGRDMKERMLRYARTAHAFALVRDRGAGHV----DGEGRVRYTPSREDVD 625

Query: 469 SMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKI---KKVGI 525
            +  GL   +RIL AAGA ++GT ++  D   +    + L D   + FL ++   K   +
Sbjct: 626 ELRNGLRQTLRILVAAGAAEVGTHRS--DGLRLR--CDGLRDEDLEAFLKQVTVEKGPMV 681

Query: 526 PTYQT----CTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSM 581
           P +      C+    QM SCRMG  P   AV+  GE+WE E LYV D S+LPTA GV  M
Sbjct: 682 PGHDKWALHCSA--HQMGSCRMGSSPKHGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPM 739

Query: 582 MTTMNIAHYISKCILD 597
           +T  + A+ +SK I +
Sbjct: 740 ITIQSTAYCVSKGIAE 755



>gi|326521814|dbj|BAK00483.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 594

 Score =  275 bits (703), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 169/489 (34%), Positives = 256/489 (52%), Gaps = 25/489 (5%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+VIEKG+++   D ++ +     +LYE  G M T   +  +LAGS  GGG+ + WSA +
Sbjct: 106 VVVIEKGNYFTARDYTSIEGPSMSQLYEYGGFMSTLSGSGLLLAGSTVGGGSAVNWSACI 165

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +    VR+EWA   GLP F + EY  AM  +  RLG  +        N+ L  GC+KLG 
Sbjct: 166 KTPDSVRKEWAAAHGLPLFDKSEYTAAMDVVFKRLGVTSGCKEEGLQNKVLRKGCEKLGY 225

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILI-DK 303
           + + + +N+ S  H CG C +GC+ G+K+    TWL +A S  A  L     EK+L  D 
Sbjct: 226 NVEPVSRNS-SEGHFCGSCGYGCRTGDKRGTDTTWLVDAVSRGAVILTGSKAEKLLFTDA 284

Query: 304 DGK-SQKVMGVEVIINN---IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHV 359
            GK  ++  GV    +N    +++++ AK  V + G++ +P LL  SGLKN +IG+NLH+
Sbjct: 285 AGKRGKRCAGVVAASSNPAITRKLEVRAKVTVAAGGSLLTPVLLRGSGLKNPHIGKNLHL 344

Query: 360 HPIAAVYGVFPNKEI-----KTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFAN 414
           HPIA  +G FP  ++     K Y G I++++     + DG  + A +      P      
Sbjct: 345 HPIAMAWGYFPPDKMPELKGKMYEGGIITSLHKVEADGDGLPHRAILETPLMGPAAAGTQ 404

Query: 415 FPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGL 474
           FPW S    K+ ML Y   V +  + RD   G +    +G+ R+ Y L   D ++   GL
Sbjct: 405 FPWVSGRDMKERMLNYGRTVHIFSLVRDHGSGTV----HGERRIAYHLDPVDRENQREGL 460

Query: 475 LTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPT-----YQ 529
             A+RIL AAGAT++G  ++       +       D + ++FL+ +  V  P      + 
Sbjct: 461 RRALRILVAAGATEVGIHRSDGQKLRCKGA----TDEEVEEFLDGVSGVRGPQSKSEKWS 516

Query: 530 TCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAH 589
            C  T  QM SCRM       AV+  GE+WEVE LYV D SVLP A GV  M+T  ++A+
Sbjct: 517 LCC-TAHQMGSCRMAATAGDGAVDTRGESWEVERLYVCDGSVLPGAVGVNPMITIQSVAY 575

Query: 590 YISKCILDK 598
            ++  I ++
Sbjct: 576 CLATGIAEQ 584



>gi|502143811|ref|XP_004505474.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Cicer arietinum]
          Length = 762

 Score =  274 bits (701), Expect = 5e-71,   Method: Compositional matrix adjust.
 Identities = 173/496 (34%), Positives = 261/496 (52%), Gaps = 37/496 (7%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG+++   D S+ +    ++ YE  G +++ DS + VLAGS  GGG+ I WSA +
Sbjct: 270 VIVLEKGNYFVPKDYSSLEGPSMNQQYECGGMLVSADSRILVLAGSTVGGGSAINWSACL 329

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +    V +EW++   L  F   EY +AM+ +  R+G N         NQ L  GC+ LGL
Sbjct: 330 KTPQEVIKEWSEKHKLSMFSSLEYLSAMETVCERIGVNQNCTQEGFQNQVLRKGCQNLGL 389

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD 304
             D +P+N++   H CG C +GC  GEK    +TWL +A    A  +  C  EK L   +
Sbjct: 390 KVDYVPRNSSG-NHYCGSCGYGCPKGEKLGTQVTWLVDAVEKGAVIITGCKAEKFLFQTN 448

Query: 305 GKSQK---VMGVEV-IINNIK---RVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
             ++K    +GV    +NN +   +++I AK  V S GA+ +P L++ SGLKNKNIGRNL
Sbjct: 449 NNTRKKKSCLGVLAKTLNNTRVTMKLQIEAKVTVSSCGALLTPPLMITSGLKNKNIGRNL 508

Query: 358 HVHPIAAVYGVFPNK-----EIKTYSGTIMSAISNATENVDGENYGAKIV----VGSHHP 408
           H+HP+   +G FP       + K Y G I++++     + D  +Y   I+    +G   P
Sbjct: 509 HLHPVLMTWGYFPESKNLDLKGKVYEGGIITSVHKLLSSNDSNSYTRAIIETPLIG---P 565

Query: 409 GFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSK 468
               +  PW+S L  KQ ML Y+     + I RD   G++ ++     R+ YKL++ D +
Sbjct: 566 ASFASMCPWESGLDFKQRMLNYSRTSHFITIIRDSSCGKVTSE----GRISYKLNEIDKE 621

Query: 469 SMVAGLLTAVRILAAAGATKIGT-------CQTVIDDYIVENGVNPLNDPKFDQFLNKIK 521
           ++ +GL  A+RIL AAGA ++GT        +      I          P     L   +
Sbjct: 622 NIRSGLQQALRILIAAGADEVGTHRSDGQRIKCSEKSEIEIEEFIESVCPMEGALLPGNE 681

Query: 522 KVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSM 581
           K  I T      +  QM SCRMG +  +  V+  GE+WE E L+V D+SVLPTA GV  M
Sbjct: 682 KWNIYT------SAHQMGSCRMGVNEKEGGVDENGESWEAEGLFVCDASVLPTAVGVNPM 735

Query: 582 MTTMNIAHYISKCILD 597
           +T  + A+ IS  I+D
Sbjct: 736 ITVQSTAYCISNRIVD 751



>gi|493588384|ref|WP_006541316.1| oxidoreductase [Frankia sp. EUN1f]
 gi|288349133|gb|EFC83378.1| glucose-methanol-choline oxidoreductase [Frankia sp. EUN1f]
          Length = 650

 Score =  274 bits (700), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 181/584 (30%), Positives = 281/584 (48%), Gaps = 30/584 (5%)

Query: 15  FHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWL--NPYNFNPV---IGYPGA 69
           F  L    R+   ++   S     R ++++  ML  ++++    P   +P    IGYPG 
Sbjct: 77  FSTLEPAARQDVLLRLGESPAEQKRVLFQALRMLATSSYYFAPGPTGSSPAWEAIGYPGP 136

Query: 70  DPEANGSRFSSRNFPKYNFLEISDH--DSDIKEFDTXXXXXXXXXXXXXXRLARMENVLV 127
                G R  +   P       +D   D D     +               L    +V+V
Sbjct: 137 ----LGPREGAPRPPLAPLTPTADTTLDCDAVVVGSGAGGGTAAGVLAGAGL----DVVV 188

Query: 128 IEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQ 187
           +E+G +YD  D    +  G  ++Y  +G   T +  + ++AGS  GGGT + WS  +   
Sbjct: 189 LERGGYYDDADFDGGELSGLSRMYA-AGPATTAEGQVALVAGSCLGGGTVVNWSTSLPTP 247

Query: 188 YFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSD 247
             +R +WA   G   F EDE+  A+  +N RL  NT +   +  +  L  G   LG H D
Sbjct: 248 PRIRAQWA-GLGAKQFDEDEFTRALDAVNQRLSVNTDHSTPSARDAVLERGLTALGWHVD 306

Query: 248 NIPQNTAS--ITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKDG 305
            +P+N     +  +CG C  GC+ G KQS T TWL +A+++ A+ + N  V +I    D 
Sbjct: 307 ALPRNVTGCDMAVECGRCGLGCRLGAKQSVTKTWLADAQAHGARLVVNVDVRRI----DV 362

Query: 306 KSQKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAV 365
           +  + +GVE +  +   VK+ A+ VV +AGAI +PALL RSGL N NIGR L +HP  AV
Sbjct: 363 QGGRAVGVEGVTPDGHAVKVRARAVVAAAGAIQTPALLRRSGLSNPNIGRYLRLHPATAV 422

Query: 366 YGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQ 425
           +GVF ++ I+ + G + +  S    ++DG+ YG     G  +PG +     W+    H  
Sbjct: 423 WGVF-DEPIRPWEGGMQTRYSLEHSDLDGDGYGVIYETGPGNPGALQGFMNWRGGGAHLA 481

Query: 426 LMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGLLTAVRILAAAG 485
            M +  +   + +ITRDR+ G +    +G+P   Y+LS HD+  + AG+  A RIL AAG
Sbjct: 482 AMKDLAHTAGVGIITRDRDPGEVRVGRDGEPVPHYRLSAHDTAHVKAGIEGAARILEAAG 541

Query: 486 ATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQTCTGTIEQMSSCRMGD 545
           A +I +       Y       P       +F+      G    +     +  M + RMGD
Sbjct: 542 ARRIYSAHQAGPSY------EPGRYGSHGEFVAACHNAGYGPGECSIAALHIMGTARMGD 595

Query: 546 DPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAH 589
            P+ SA NP G  WE+ N+ VAD+S  PT+ GV  M++   IA+
Sbjct: 596 APDMSATNPDGGIWELPNVVVADASCFPTSPGVNPMVSIEAIAY 639



>gi|255575851|ref|XP_002528823.1| disulfide oxidoreductase, putative [Ricinus communis]
 gi|223531735|gb|EEF33557.1| disulfide oxidoreductase, putative [Ricinus communis]
          Length = 747

 Score =  273 bits (698), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 163/492 (33%), Positives = 262/492 (53%), Gaps = 30/492 (6%)

Query: 123 ENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSA 182
           + VLV+EKG+++   D S  +   Y+ LYE  G M + D+   +LAGS  GGG+ + WSA
Sbjct: 258 QKVLVLEKGNYFTAKDFSGLEGPSYNHLYEAGGLMPSADAKFIILAGSVVGGGSAVNWSA 317

Query: 183 FMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKL 242
            +    +V +EWA+N  +  F   EY +AM  +  R+G     +     NQ +  GC+ L
Sbjct: 318 CINTPNYVLKEWAENHKIQLFGSPEYLSAMDIVCKRIGVTENCVEEGFQNQVIRKGCENL 377

Query: 243 GLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILID 302
           GL  + +P+N++   H CG C +GC+ G+K+    TWL +A +N A  L  C  E+ +++
Sbjct: 378 GLEINTVPRNSSE-KHYCGSCGYGCQTGDKKGTDSTWLVDAVNNGAVILTGCKAERFILE 436

Query: 303 ----KDGKSQ---KVMGVEVII---NNI-KRVKIHAKRVVVSAGAIHSPALLLRSGLKNK 351
               K G SQ   K +GV   I   +NI  R++I A+  + + GA+ +P L++ SGL N 
Sbjct: 437 ENNKKSGGSQRKKKCLGVIAKILKNDNIWMRLQIEARVTISACGALSTPPLMISSGLNNP 496

Query: 352 NIGRNLHVHPIAAVYGVFPNKEI----KTYSGTIMSAISNATENVDGENYGAKIVVGSHH 407
           NIGRNLH+HP+   +G FP+       K++ G I++++       +  N  A I      
Sbjct: 497 NIGRNLHLHPVLMTWGYFPDSNTVFKGKSFEGGIITSVHKVAS--EDSNVRAIIETPQLG 554

Query: 408 PGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDS 467
           P    A  PW+S L  K+ +L+Y+    L+ I RDR  G + ++     R+ Y     D 
Sbjct: 555 PASFAALCPWESALDFKERLLKYSRTANLITIIRDRGSGEVKSEG----RIAYNFDALDI 610

Query: 468 KSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPT 527
           +++ AGL  ++RIL AAGA ++GT ++       +     +   + ++FL+ +     P 
Sbjct: 611 ENLKAGLRQSLRILVAAGAVEVGTHRSDGQRLKCQG----ITKKQLEEFLDTVSPPRGPL 666

Query: 528 YQ----TCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMT 583
                     +  Q+ SCRMG    + AV+  GE+WE E L+V D+SVLP+A GV  M+T
Sbjct: 667 SPGKDWVAYTSAHQLGSCRMGISEKEGAVDENGESWEAEGLFVCDASVLPSAIGVNPMIT 726

Query: 584 TMNIAHYISKCI 595
             + A+ +S+ I
Sbjct: 727 IQSTAYCLSERI 738



>gi|242034201|ref|XP_002464495.1| hypothetical protein SORBIDRAFT_01g019470 [Sorghum bicolor]
 gi|241918349|gb|EER91493.1| hypothetical protein SORBIDRAFT_01g019470 [Sorghum bicolor]
          Length = 774

 Score =  272 bits (696), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 169/495 (34%), Positives = 251/495 (50%), Gaps = 39/495 (7%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+VIEKG ++   D S+ +    ++LYE  G   T +    +  G+  GGG+ I WSA +
Sbjct: 287 VVVIEKGDYFTAEDYSSVEGPSMERLYEKGGIFCTTNVTTILFTGTTVGGGSAINWSASI 346

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
                VR+EWA+  GLP F    Y  AM  + ARL            N+ +  GC+ L L
Sbjct: 347 RTPEEVRQEWAREHGLPVFASPGYVQAMDAVCARLAVTDGCRDEGFQNKVVRRGCEALAL 406

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD 304
            +D +P+N+ S  H CG C  GC  GEK+    TWL +A +  A  L  C  E+ +++ +
Sbjct: 407 RADAVPRNS-SEDHFCGSCYIGCPTGEKRGTDTTWLVDAVARGAVILTGCKAERFILESN 465

Query: 305 G------KSQKVMGV--EVIINNI-KRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGR 355
                  K +K +GV    + N I K ++I AK  +   GA+ +P LL  SGLKN++IGR
Sbjct: 466 SNSSSGRKGRKCVGVVARCMSNGITKELRIEAKVSISGCGALMTPPLLRNSGLKNRHIGR 525

Query: 356 NLHVHPIAAVYGVFP-NKEI-----KTYSGTIMSAISNATENVDGENYGAKIVVGSHHPG 409
           NLH+HP++  +G FP NK+      K + G I++++   TE          I   +  PG
Sbjct: 526 NLHLHPVSMAWGYFPENKQQAQITGKCFEGGIITSMHRVTERT-------IIETPALGPG 578

Query: 410 FMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKS 469
              +  PW+S    K+ M  Y        + RDR  G +    +G+ R+ Y  ++ D++ 
Sbjct: 579 CFASLMPWESGRDMKERMRRYARTAHAFALVRDRGAGTV----DGEGRVRYTPNRADAEE 634

Query: 470 MVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQ 529
           +  GL  A+RIL AAGA ++GT ++         GV    D + + FL+++     P   
Sbjct: 635 LRNGLRRALRILVAAGAAEVGTHRSDGFGLRCNGGV---RDDELEAFLDEVTVAEGPMRP 691

Query: 530 T-------CTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMM 582
                   C+    QM SCRMG  P   AV+  GE+WE E LYV D S+LPTA GV  M+
Sbjct: 692 GPDKWALHCSA--HQMGSCRMGSSPKDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPMI 749

Query: 583 TTMNIAHYISKCILD 597
           T  +IA  +SK I +
Sbjct: 750 TIQSIAFCLSKGIAE 764



>gi|194707690|gb|ACF87929.1| unknown [Zea mays]
          Length = 468

 Score =  271 bits (693), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 166/469 (35%), Positives = 245/469 (52%), Gaps = 32/469 (6%)

Query: 148 DKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVREEWAKNFGLPYFMEDE 207
           + LYE  G + T  ++  +LAGS  GGGT + WSA ++    VR EWA++ GLP F   E
Sbjct: 2   EHLYEGGGFVSTLSASALLLAGSTVGGGTAVNWSACIKTPDDVRGEWARDRGLPLFATGE 61

Query: 208 YGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQNTASITHQCGWCSFGC 267
           Y  AM  +  RLG           N+ L  GC++LG   +++ +N+ S  H CG C +GC
Sbjct: 62  YAAAMDKVFERLGVTAGCAEEGLQNKVLRKGCERLGYKVESVSRNS-SEGHYCGSCGYGC 120

Query: 268 KYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILID----KDGKSQKVMGVEVIINN--IK 321
           + G+K+    TWL +A S  A  L  C  EK+L++     DG++++ +GV     N  I 
Sbjct: 121 RTGDKRGTDSTWLVDAVSRGAVILTGCKAEKLLLEPGSAADGRAKRCVGVVARSTNPAIT 180

Query: 322 RVKIHAKRVVVSA-GAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYGVFPNK----EIKT 376
           R      RV VSA G++ +P LL  SGL+N++IG+NLH+HP A V+G FP+       + 
Sbjct: 181 RTLEVTARVTVSACGSLLTPVLLRGSGLRNRHIGKNLHLHPTALVWGYFPDTVPDLRGRM 240

Query: 377 YSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFAN----FPWKSNLQHKQLMLEYNN 432
           Y G I++++      V+G   GA        P    A     FPW S    K+ ML Y  
Sbjct: 241 YEGGIITSL----HKVEGGGPGAPARAILEAPAMGLAGAGTQFPWVSGRDMKERMLRYGR 296

Query: 433 IVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGLLTAVRILAAAGATKIGTC 492
            V L  + RDR  G +    +G+ R+ Y L   D ++M  G+  A+R+LAAAGA +IGT 
Sbjct: 297 TVHLFSMVRDRGSGTV----HGERRVAYHLDATDRENMRDGMRRALRVLAAAGAAEIGTH 352

Query: 493 QTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQ----TCTGTIEQMSSCRMGDDPN 548
           ++    +          +   ++FL+ +  V  P  +    T   T  QM SCRMG    
Sbjct: 353 RSDGQRFACGG----ATEAALEEFLDGVDVVRGPQSKAEAWTLCCTAHQMGSCRMGATAR 408

Query: 549 KSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKCILD 597
             AV+  GE+WE  +LYV D SVLP A GV  M+T  ++A+ ++  I +
Sbjct: 409 DGAVDARGESWEAGSLYVCDGSVLPGAVGVNPMVTIQSVAYCLATGIAE 457



>gi|482575188|gb|EOA39375.1| hypothetical protein CARUB_v10012453mg [Capsella rubella]
          Length = 752

 Score =  271 bits (693), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 196/643 (30%), Positives = 313/643 (48%), Gaps = 69/643 (10%)

Query: 15  FHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATF------WLNPYNFNPV---IG 65
           F +++ ++RE    +W+T  Y  + ++   F M+I A F      W N    NP    IG
Sbjct: 127 FSDISLEKREKVLQRWNTQWYNPLARL--GF-MMIKAIFLFYYFTWTNENTENPAWDAIG 183

Query: 66  YPGADPEANGSRFSSRNFPKYNFLEIS--------------------DHDSDIK--EFDT 103
           Y     E  G     R   K   +E +                    D +SD    E D 
Sbjct: 184 YRVDMGENEGMEHKERPLEK-GIIETAEVDEMTIKQRMINKGLKVTEDRESDTYKIECDA 242

Query: 104 XXXXXXXXXXXXXXRLARME-NVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDS 162
                          LA+    V+V+EKG+++   D S  +     +L+E +  ++T D 
Sbjct: 243 VIVGSGCGGGVAAANLAKSGLKVVVLEKGNYFVPRDYSALEGPSTFELFESNSLLMTHDG 302

Query: 163 NMYVLAGSNFGGGTTIGWSAFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTN 222
               +AGS  GGG+ + W+A +     + EEW+   G+  F  ++Y  AM  +  R+G  
Sbjct: 303 RFRFMAGSTVGGGSVVNWAASLNTPDAIIEEWSVQRGIAIFSSEKYKAAMDRVCKRIGVT 362

Query: 223 TINIIHNQSNQTLINGCKKLGLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNE 282
              I     N  L  GC+KLGL    +P+N+    H CG CSFGC  GEK+    TWL +
Sbjct: 363 EKIIREGFQNTILRKGCEKLGLDVTTVPRNSTD-KHYCGSCSFGCPTGEKRGTDSTWLVD 421

Query: 283 AKSNNAKFLKNCYVEK-ILIDKD-------GKSQKVMGVEVIINN--IKRVKIHAKRVVV 332
           A +NNA  L  C  EK IL D D       G+ ++ +GV   ++N   K+++I+AK  ++
Sbjct: 422 AVNNNAVILTRCKAEKVILADNDAHKRKESGRKKRCLGVTASLSNRTRKKLEINAKVTII 481

Query: 333 SAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYGVFP--NKEIK--TYSGTIMSAISNA 388
           + G++ +P LL  SGLKN NIGR LH+HPI   +G FP  N + K   + G IM+++ + 
Sbjct: 482 ACGSLKTPGLLASSGLKNPNIGRGLHIHPILMAWGYFPERNSDFKGAAHEGEIMTSL-HY 540

Query: 389 TENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRI 448
              +D       +   +  PG   +  PW S    K+ + +Y     + V+ RD   G +
Sbjct: 541 VHPMDSTTPNITLETPAIGPGTFASLIPWVSGSDIKERLAKYTRTSHIFVMVRDEGVGEV 600

Query: 449 LTDENGKPRLEYKLSQHDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPL 508
             D      ++Y+L++ D +++  GL  A++IL AAGAT++GT ++  D   ++   + +
Sbjct: 601 KGD-----IVKYRLTKADEENLTIGLKQALQILVAAGATEVGTYRS--DGQRIK--CDGI 651

Query: 509 NDPKFDQFLNKIKK----VGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENL 564
              + + FL+ +      V +  + T + T  QM  CRMG    + A++  GE+WE E+L
Sbjct: 652 KREELEAFLHTVNAPAGVVSMSKHWTHSFTAHQMGCCRMGASEKEGAIDGKGESWEAEDL 711

Query: 565 YVADSSVLPTATGVPSMMTTMNIAHYISKCILDKKIFTVKKKR 607
           YV D+SVLPTA GV  M+T  + A+    CI ++    +KKK+
Sbjct: 712 YVCDASVLPTALGVNPMITVQSTAY----CISNRIAELMKKKK 750



>gi|357146609|ref|XP_003574052.1| PREDICTED: long-chain-alcohol oxidase FAO1-like [Brachypodium
           distachyon]
          Length = 757

 Score =  270 bits (690), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 158/505 (31%), Positives = 261/505 (51%), Gaps = 41/505 (8%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG ++   D S+ +    ++LYE  G   T +    + +G+  GGG+ + WSA +
Sbjct: 270 VVVLEKGDYFAAQDYSSVEGPSMERLYEQGGIFCTSNVTTVLYSGTTVGGGSAVNWSASI 329

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
                + +EW++  GLP F    Y  AM  ++ARL  +   +     N+ +  GC+ LGL
Sbjct: 330 RTPREILQEWSRGHGLPVFASAGYAQAMDAVSARLAVSDACLEEGFQNKVVRRGCEALGL 389

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILID-- 302
             D +P+N+ S  H CG C+ GC  G+K+    TWL +A  + A  +  C  ++ +++  
Sbjct: 390 PVDAVPRNS-SADHYCGSCNLGCPTGDKRGTDTTWLVDAVEHGAVIITGCKADRFILESS 448

Query: 303 ---KDGKSQKVMGVEVIIN-NIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLH 358
              K  + +K +G+        K+++I AK  + + GA+ +P LL  SGLKN++IGRNLH
Sbjct: 449 YTGKGRRGKKCVGLVATCGITQKKLRIEAKVSISACGALMTPPLLRSSGLKNRHIGRNLH 508

Query: 359 VHPIAAVYGVFPN---------KEI---KTYSGTIMSAISNATENVDGENYGAKIVVGSH 406
           +HP++  +G FP          +EI   K Y G I++++   TE          I   + 
Sbjct: 509 LHPVSMAWGYFPEEPEPQEQDAEEIISGKCYEGGIITSMHRVTERT-------IIETPAL 561

Query: 407 HPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHD 466
            PG   +  PW+S    K+ M  Y        + RDR  G +    +G+ R+ +  S+ D
Sbjct: 562 GPGAFASLVPWESGRDMKERMRRYARTAHAFALVRDRGAGSV----DGEGRVHFVPSRDD 617

Query: 467 SKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIK----- 521
           ++ +  GL  A+RI+ AAGA ++GT ++  D   +      + D   + FL+ +      
Sbjct: 618 NEELRNGLRRALRIMVAAGAAEVGTHRS--DGLRLR--CKGVRDEDLEAFLDDVAVARGP 673

Query: 522 -KVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPS 580
            + G  T+     +  QM SCRMG  P + AV+  GE+WE E LYV D S+LPTA GV  
Sbjct: 674 MQAGTDTWALLC-SAHQMGSCRMGSSPREGAVDGSGESWEAEGLYVCDGSLLPTAVGVNP 732

Query: 581 MMTTMNIAHYISKCILDKKIFTVKK 605
           M+T  ++A+ +SK I +    ++K+
Sbjct: 733 MITIQSLAYCLSKNIAESLAQSMKR 757



>gi|367031472|ref|XP_003665019.1| hypothetical protein MYCTH_103590 [Myceliophthora thermophila ATCC
           42464]
 gi|347012290|gb|AEO59774.1| hypothetical protein MYCTH_103590 [Myceliophthora thermophila ATCC
           42464]
          Length = 741

 Score =  270 bits (689), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 185/634 (29%), Positives = 279/634 (44%), Gaps = 69/634 (10%)

Query: 2   SLINSK-----ILSIQKPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLN 56
           S++N++     + S   P   L   +R      WS S   S+R ++KS T L    F  +
Sbjct: 128 SVLNTRPGSLLLTSRATPLPSLRLSERVKILQSWSNSPLWSLRSLFKSMTTLGKLAFIRS 187

Query: 57  PYNFNPVIGYPGADPEANGSRFSSRNFPKYNFLEISDHDSDIKEF--DTXXXXXXXXXXX 114
             NF  + G+P A P    S  +S  +    F   S       E   D            
Sbjct: 188 SANFPALTGFP-AVPRDWTSGSTSHPYEFLQFEAASGTGKAPVEISTDVVIVGSGCGAGV 246

Query: 115 XXXRLAR----MENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGS 170
              RLA        VLV+EKG H D       Q  G   L+E  G + TDD +M V AGS
Sbjct: 247 VAKRLASEFGPSLGVLVLEKGRHLDARHFPLSQATGLATLFEAGGVVETDDGSMTVTAGS 306

Query: 171 NFGGGTTIGWSAFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQ 230
            FGGG T+ WSA ++ Q  VR EWA+   LP+F   ++   +  +   +G     +  N 
Sbjct: 307 CFGGGGTVNWSAALQTQDVVRAEWARTHRLPFFESADFQACLDRVWDAMGCTGDKVAPNH 366

Query: 231 SNQTLINGCKKLGLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKF 290
           +N+ L+ G +KLG  +  +PQN     H CG+C+ GC  GEK+     W  +A     +F
Sbjct: 367 ANRVLLEGARKLGYQAKVVPQNCGGSEHHCGYCTLGCWKGEKKGPVNGWFPDAAEQGVQF 426

Query: 291 LKNCYVEKILIDKDGKSQKVMGVEVIINNIK----RVKIHAKRVVVSAGAIHSPALLLRS 346
           ++   V+++L+D     +   GV+ +  +       V + AK+VV+S G + SP +L+ S
Sbjct: 427 VERMTVKRVLLDHKKGKKVARGVQGVWKSRDGREVEVIVRAKKVVLSCGTLWSPVVLMNS 486

Query: 347 GLKNKNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSH 406
           G+K                             G++ S +S+  EN+D + +G K+   S 
Sbjct: 487 GIKG----------------------------GSLTSVVSS-FENLDSKGHGVKLEAMSM 517

Query: 407 HPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLEYKLSQH 465
            P F     PW S   +K L   Y  +   + I RDR+ G +  D   G+PR+ Y  S  
Sbjct: 518 MPSFCLPFLPWASGTDYKVLAAHYRRLNTFIAICRDRDMGSVYRDPTTGRPRIVYTPSDF 577

Query: 466 DSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPK------------- 512
           D    + G+L   RIL A GA +I         +I        N P+             
Sbjct: 578 DRAHNLRGVLELCRILYAHGAREIHPSIAGFPPFIRRTKEED-NKPEGRDKDKDKHKDKD 636

Query: 513 ---------FDQFLNKIKKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVEN 563
                    F+++L ++K  G     T   +  QM +CRM   P +  V+P G  W  E 
Sbjct: 637 EDEEKEKREFEEWLGRLKAHGNKPPATPFASAHQMGTCRMSARPKEGVVDPRGRVWGAEG 696

Query: 564 LYVADSSVLPTATGVPSMMTTMNIAHYISKCILD 597
           LYVAD+SV P+A+GV  M+TTM IA +I + + +
Sbjct: 697 LYVADASVFPSASGVNPMVTTMAIADWIGQGVCE 730



>gi|357140638|ref|XP_003571871.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Brachypodium
           distachyon]
          Length = 786

 Score =  269 bits (688), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 164/502 (32%), Positives = 254/502 (50%), Gaps = 50/502 (9%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG ++   D S+ +    ++L+E  G   T +    V  GS  GGG+ + WSA +
Sbjct: 294 VVVLEKGDYFTAEDYSSVEGPSMERLFEKGGIFCTSNVTTMVFTGSTVGGGSAVNWSASI 353

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
                V +EW++  GLP F  D Y  AM  + +RL      +     N+ +  GC+ LGL
Sbjct: 354 RTPGTVLQEWSQEHGLPVFGSDGYVQAMDAVCSRLAVTDACLEEGFQNKVVRRGCEALGL 413

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILI--- 301
             D +P+N+ S  H CG C+FGC  G+K+    TWL +A  + A  L  C  ++ ++   
Sbjct: 414 PVDAVPRNS-SAGHYCGSCNFGCPTGDKRGTDTTWLVDAVEHGAVILTGCKADRFILESN 472

Query: 302 --DKDGK-----SQKVMG-VEVIINN--IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNK 351
             D  GK     S+K +G V   ++N   K+++I A+  + + GA+ +P LL  SGL+N+
Sbjct: 473 TADTGGKDNARRSKKCVGLVATCMSNGITKKLRIEARVSISACGALMTPPLLRNSGLRNR 532

Query: 352 NIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHH---- 407
           +IGRNLH+HP++  +G F + ++ T   TI++          G++Y   I+   H     
Sbjct: 533 HIGRNLHLHPVSMAWGYFSDNKLPTSGQTIIT----------GKSYEGGIITSMHRITDR 582

Query: 408 ---------PGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRL 458
                    PG   A  PW+S    K+ M  Y        + RDR  G    D  G  RL
Sbjct: 583 TIVETPALSPGAFAAMVPWESGRDMKERMRRYARTAHAFALVRDRGAG--FVDCEG--RL 638

Query: 459 EYKLSQHDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLN 518
            +  S+ D+  +  GL   +RIL AAGA ++GT ++  D   +      + D   + FL+
Sbjct: 639 RFTPSRDDTDELRNGLRRVLRILVAAGAAEVGTHRS--DGLRLR--CKGVRDEDLEAFLD 694

Query: 519 KIKKVGIPTYQTCT-----GTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLP 573
           ++     P + T        +  QM SCRMG  P + AV+  GE+WE E LYV D S+LP
Sbjct: 695 EVTIEKGPMHSTTDKWALFSSAHQMGSCRMGSSPREGAVDGSGESWEAEGLYVCDGSLLP 754

Query: 574 TATGVPSMMTTMNIAHYISKCI 595
           TA GV  M+T  ++A+ +SK I
Sbjct: 755 TAVGVNPMITIQSVAYCLSKDI 776



>gi|508702481|gb|EOX94377.1| Alcohol oxidase [Theobroma cacao]
          Length = 740

 Score =  269 bits (688), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 166/489 (33%), Positives = 261/489 (53%), Gaps = 25/489 (5%)

Query: 123 ENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSA 182
           + V+VIEKG+++   D ++ +     +LYE  G + T +  + ++AGS  GGG+ I WSA
Sbjct: 258 QKVVVIEKGNYFAPQDYTSLEGPSMSELYESGGFLTTTNGKIMIMAGSTVGGGSAINWSA 317

Query: 183 FMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKL 242
            ++    V  EW  +  +P+F   EY  AM  +  R+G           NQ L  GC+KL
Sbjct: 318 SIKTPKNVLREWCVDHKIPFFGSSEYEIAMDAVRKRIGVTENCTEEGFQNQVLRKGCEKL 377

Query: 243 GLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEK-ILI 301
           GL  + +P+NTA   H CG C+ GC+ G+K+    TWL +A    A  L  C  +K IL+
Sbjct: 378 GLKVEAVPRNTAD-NHYCGSCNLGCRTGDKKGTDSTWLVDAVGCGAVILTACKADKFILV 436

Query: 302 DKDG--KSQKVMGVEVIINN---IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRN 356
           + +   + +K +GV     N    K++ I AK  V + G++ +P L++ SGLKN NIGRN
Sbjct: 437 NNNDARRRKKCLGVIATSWNKKLTKKLHIEAKATVSACGSLLTPPLMISSGLKNPNIGRN 496

Query: 357 LHVHPIAAVYGVFPNK----EIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMF 412
           LH+HP+   +G FP      + KTY G I+++        +  N  A I   +  P  + 
Sbjct: 497 LHLHPVLVGWGYFPEDASGLKGKTYEGGIITSFHKVVS--EETNVHAIIQTPALGPASVA 554

Query: 413 ANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVA 472
           A  PW S  + K+ M+ Y  +  L  + RD+  G ++  E GK R  Y+ S+ D +++  
Sbjct: 555 ALSPWVSGSEFKERMVRYPRLAHLFTLIRDQGSGEVM--EEGKIR--YRFSEMDKENLKI 610

Query: 473 GLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPT----Y 528
           GL   +RI+ AAGA ++GT ++  D   ++     L +    +FL+ +  VG  +    Y
Sbjct: 611 GLRQVLRIIIAAGAVEVGTHRS--DGQRIK--CKGLTEESLQEFLDDVPVVGGASSKEEY 666

Query: 529 QTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIA 588
            T   +  QM SCR+G    + AV+  G++WE E L+V D+SVLPTA G+  M+T  + +
Sbjct: 667 WTMYVSAHQMGSCRIGATQEEGAVDENGQSWEAEGLFVCDASVLPTAIGINPMLTIQSTS 726

Query: 589 HYISKCILD 597
           + IS  I D
Sbjct: 727 YCISNKIAD 735



>gi|414871097|tpg|DAA49654.1| TPA: hypothetical protein ZEAMMB73_468308 [Zea mays]
          Length = 590

 Score =  269 bits (687), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 167/496 (33%), Positives = 255/496 (51%), Gaps = 41/496 (8%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG ++   D S+ +    ++L+E  G   T +    +  G+  GGG+ + WSA +
Sbjct: 103 VVVVEKGDYFTAEDYSSIEGPSMERLFERGGIFCTSNVTTMIFTGATVGGGSAVNWSASI 162

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
                V +EWA+  GLP F    Y  AM  + ARLG           N+ +  GC+ LGL
Sbjct: 163 RTPEEVTQEWAREHGLPVFASPGYAQAMDAVCARLGVTDGCQEEGFQNKVVRRGCEALGL 222

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD 304
            +D +P+N+ S  H CG C+FGC  G+K+    TWL +A +  A  L  C  E  +++K+
Sbjct: 223 CADAVPRNS-SDAHFCGSCNFGCPTGDKRGTDTTWLVDAVARGAVILTGCKAEYFVLEKN 281

Query: 305 -------GKSQKVMG-VEVIINN--IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIG 354
                  G+ +K +G V    +N   K+++I AK  + + GA+ +P LL RSGLKN++IG
Sbjct: 282 HSSGSGSGRGKKCVGLVATCASNGVTKKLRIEAKVSIAACGALMTPPLLRRSGLKNRHIG 341

Query: 355 RNLHVHPIAAVYGVFP-NKEI-----KTYSGTIMSAISNATENVDGENYGAKIVVGSHHP 408
            NLH+HP++  +G FP NK+      K Y G I++++   T+          I   +  P
Sbjct: 342 SNLHLHPVSMAWGYFPENKQDPPLSGKCYEGGIITSMHRVTDRT-------IIETPALGP 394

Query: 409 GFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSK 468
           G   A  PW+S    K+ M  Y+       + RDR  G +    +G+ R+ +  S+ D  
Sbjct: 395 GAFAAMVPWESGRDMKERMRRYSRTAHAFALVRDRGVGFV----DGEGRVRFTPSREDVD 450

Query: 469 SMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTY 528
            +  GL   +RIL AAGA ++GT ++  D   +      L D   + FL+++     P +
Sbjct: 451 ELRNGLRRVLRILVAAGAAEVGTHRS--DGLRLR--CKGLRDEDLEGFLDEVTIEKGPMH 506

Query: 529 QT-------CTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSM 581
                    C+    QM SCRMG  P   AV+  GE+WE E LYV D S+LPTA GV  M
Sbjct: 507 SRVDKWALHCSA--HQMGSCRMGSSPKDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPM 564

Query: 582 MTTMNIAHYISKCILD 597
           +T  +IA  +SK I +
Sbjct: 565 ITIQSIAFCLSKGIAE 580



>gi|238011312|gb|ACR36691.1| unknown [Zea mays]
 gi|414871095|tpg|DAA49652.1| TPA: hypothetical protein ZEAMMB73_468308 [Zea mays]
          Length = 783

 Score =  269 bits (687), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 167/496 (33%), Positives = 255/496 (51%), Gaps = 41/496 (8%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG ++   D S+ +    ++L+E  G   T +    +  G+  GGG+ + WSA +
Sbjct: 296 VVVVEKGDYFTAEDYSSIEGPSMERLFERGGIFCTSNVTTMIFTGATVGGGSAVNWSASI 355

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
                V +EWA+  GLP F    Y  AM  + ARLG           N+ +  GC+ LGL
Sbjct: 356 RTPEEVTQEWAREHGLPVFASPGYAQAMDAVCARLGVTDGCQEEGFQNKVVRRGCEALGL 415

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD 304
            +D +P+N+ S  H CG C+FGC  G+K+    TWL +A +  A  L  C  E  +++K+
Sbjct: 416 CADAVPRNS-SDAHFCGSCNFGCPTGDKRGTDTTWLVDAVARGAVILTGCKAEYFVLEKN 474

Query: 305 -------GKSQKVMG-VEVIINN--IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIG 354
                  G+ +K +G V    +N   K+++I AK  + + GA+ +P LL RSGLKN++IG
Sbjct: 475 HSSGSGSGRGKKCVGLVATCASNGVTKKLRIEAKVSIAACGALMTPPLLRRSGLKNRHIG 534

Query: 355 RNLHVHPIAAVYGVFP-NKE-----IKTYSGTIMSAISNATENVDGENYGAKIVVGSHHP 408
            NLH+HP++  +G FP NK+      K Y G I++++   T+          I   +  P
Sbjct: 535 SNLHLHPVSMAWGYFPENKQDPPLSGKCYEGGIITSMHRVTDRT-------IIETPALGP 587

Query: 409 GFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSK 468
           G   A  PW+S    K+ M  Y+       + RDR  G +    +G+ R+ +  S+ D  
Sbjct: 588 GAFAAMVPWESGRDMKERMRRYSRTAHAFALVRDRGVGFV----DGEGRVRFTPSREDVD 643

Query: 469 SMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTY 528
            +  GL   +RIL AAGA ++GT ++  D   +      L D   + FL+++     P +
Sbjct: 644 ELRNGLRRVLRILVAAGAAEVGTHRS--DGLRLR--CKGLRDEDLEGFLDEVTIEKGPMH 699

Query: 529 QT-------CTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSM 581
                    C+    QM SCRMG  P   AV+  GE+WE E LYV D S+LPTA GV  M
Sbjct: 700 SRVDKWALHCSA--HQMGSCRMGSSPKDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPM 757

Query: 582 MTTMNIAHYISKCILD 597
           +T  +IA  +SK I +
Sbjct: 758 ITIQSIAFCLSKGIAE 773



>gi|226533337|ref|NP_001142399.1| uncharacterized protein LOC100274574 [Zea mays]
 gi|223943627|gb|ACN25897.1| unknown [Zea mays]
 gi|414871096|tpg|DAA49653.1| TPA: hypothetical protein ZEAMMB73_468308 [Zea mays]
          Length = 675

 Score =  268 bits (686), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 167/496 (33%), Positives = 255/496 (51%), Gaps = 41/496 (8%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG ++   D S+ +    ++L+E  G   T +    +  G+  GGG+ + WSA +
Sbjct: 188 VVVVEKGDYFTAEDYSSIEGPSMERLFERGGIFCTSNVTTMIFTGATVGGGSAVNWSASI 247

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
                V +EWA+  GLP F    Y  AM  + ARLG           N+ +  GC+ LGL
Sbjct: 248 RTPEEVTQEWAREHGLPVFASPGYAQAMDAVCARLGVTDGCQEEGFQNKVVRRGCEALGL 307

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD 304
            +D +P+N+ S  H CG C+FGC  G+K+    TWL +A +  A  L  C  E  +++K+
Sbjct: 308 CADAVPRNS-SDAHFCGSCNFGCPTGDKRGTDTTWLVDAVARGAVILTGCKAEYFVLEKN 366

Query: 305 -------GKSQKVMG-VEVIINN--IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIG 354
                  G+ +K +G V    +N   K+++I AK  + + GA+ +P LL RSGLKN++IG
Sbjct: 367 HSSGSGSGRGKKCVGLVATCASNGVTKKLRIEAKVSIAACGALMTPPLLRRSGLKNRHIG 426

Query: 355 RNLHVHPIAAVYGVFP-NKEI-----KTYSGTIMSAISNATENVDGENYGAKIVVGSHHP 408
            NLH+HP++  +G FP NK+      K Y G I++++   T+          I   +  P
Sbjct: 427 SNLHLHPVSMAWGYFPENKQDPPLSGKCYEGGIITSMHRVTDRT-------IIETPALGP 479

Query: 409 GFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSK 468
           G   A  PW+S    K+ M  Y+       + RDR  G +    +G+ R+ +  S+ D  
Sbjct: 480 GAFAAMVPWESGRDMKERMRRYSRTAHAFALVRDRGVGFV----DGEGRVRFTPSREDVD 535

Query: 469 SMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTY 528
            +  GL   +RIL AAGA ++GT ++  D   +      L D   + FL+++     P +
Sbjct: 536 ELRNGLRRVLRILVAAGAAEVGTHRS--DGLRLR--CKGLRDEDLEGFLDEVTIEKGPMH 591

Query: 529 QT-------CTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSM 581
                    C+    QM SCRMG  P   AV+  GE+WE E LYV D S+LPTA GV  M
Sbjct: 592 SRVDKWALHCSA--HQMGSCRMGSSPKDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPM 649

Query: 582 MTTMNIAHYISKCILD 597
           +T  +IA  +SK I +
Sbjct: 650 ITIQSIAFCLSKGIAE 665



>gi|297843212|ref|XP_002889487.1| hypothetical protein ARALYDRAFT_470376 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297335329|gb|EFH65746.1| hypothetical protein ARALYDRAFT_470376 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 760

 Score =  268 bits (686), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 198/640 (30%), Positives = 312/640 (48%), Gaps = 62/640 (9%)

Query: 15  FHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATF------WLNPYNFNPV---IG 65
           F E++ ++RE    +W+T  Y  + +I   F M+I A F      W N    NP    I 
Sbjct: 134 FSEMSLEKREKVLQRWNTQWYNPLARI--GF-MMIKAIFLFYYFTWTNENTENPAWDAIN 190

Query: 66  YPGADPEANGSRFSSRNF-------PKYNFLEI------------SDHDSDIK--EFDTX 104
           Y     E  G     R          K + + I             D DSD    E D  
Sbjct: 191 YRVEIGENEGMEQKERPLDQGIIETAKEDEMTIKQRMINKGLKVTEDRDSDTYKIECDAV 250

Query: 105 XXXXXXXXXXXXXRLARME-NVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSN 163
                         LA+    V+VIEKG+++   D S  +     +L+E +  ++T D  
Sbjct: 251 VVGSGCGGGVAAAILAKSGLRVVVIEKGNYFVPRDYSALEGPSMFELFESNSLLMTHDGR 310

Query: 164 MYVLAGSNFGGGTTIGWSAFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLG-TN 222
              +AGS  GGG+ + W+A ++    + EEW+ + G+  +  ++Y  AM  +  RLG T 
Sbjct: 311 FRFMAGSTVGGGSVVNWAASLKTPDAIIEEWSVHRGISVYSSEKYKAAMDRVLKRLGVTE 370

Query: 223 TINIIHNQSNQTLINGCKKLGLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNE 282
            IN    Q N+ L  GC+KLGL    +P+N+    H CG CSFGC  GEK+    TWL +
Sbjct: 371 KINSEGFQ-NRILRKGCEKLGLDVTIVPRNSTE-KHNCGSCSFGCPTGEKRGTDSTWLVD 428

Query: 283 AKSNNAKFLKNCYVEKILI--------DKDGKSQKVMGVEVIINN--IKRVKIHAKRVVV 332
           A +NNA  L  C  EK+++        ++ G+ ++ +GV   ++N   K+++I+AK  +V
Sbjct: 429 AVNNNAVILTQCKAEKLILADNNAHQREESGRRKRCLGVTASLSNRTRKKLQINAKVTIV 488

Query: 333 SAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYGVFPNK----EIKTYSGTIMSAISNA 388
           + G++ +P LL  SGLKN NIGR LH+HPI   +G FP +    +   + G I++++   
Sbjct: 489 ACGSLKTPGLLASSGLKNPNIGRGLHIHPILMAWGYFPERNSDFQGAAHEGEIVTSLHYV 548

Query: 389 TENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRI 448
               D       +   +  PG   A  PW S    K+ + +Y     + V+ RD   G +
Sbjct: 549 HPMEDSTTPNITLETPAIGPGTFAALAPWVSGPDMKERLAKYARTSHIFVMVRDEGVGEV 608

Query: 449 LTDENGKPRLEYKLSQHDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPL 508
             D      ++Y+L++ D +++  GL  A+RIL AAGA ++GT ++     +  +G+   
Sbjct: 609 KGD-----IVKYRLTKADEENLTTGLKQALRILVAAGAAEVGTYRS-DGQRMKCSGIKQE 662

Query: 509 NDPKFDQFLNK-IKKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVA 567
           +   F Q +N     V +  + T + T  QM  CRMG      A++  GE+WE E+LYV 
Sbjct: 663 DVEAFLQAVNAPAGVVSMSKHWTQSFTAHQMGCCRMGATEKAGAIDGKGESWEAEDLYVC 722

Query: 568 DSSVLPTATGVPSMMTTMNIAHYISKCILDKKIFTVKKKR 607
           D+SVLPTA GV  M+T  + A+    CI ++    +KKK+
Sbjct: 723 DASVLPTALGVNPMITVQSTAY----CISNRIAELMKKKK 758



>gi|193850549|gb|ACF22878.1| alcohol oxidase [Glycine max]
          Length = 723

 Score =  268 bits (685), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 158/487 (32%), Positives = 251/487 (51%), Gaps = 23/487 (4%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG ++   D S+ +    D+ YE  G M + D  M +LAGS  GGG+ + WSA +
Sbjct: 237 VVVLEKGEYFVSHDYSSLEGPSMDEQYESGGIMPSLDGKMMILAGSTVGGGSAVNWSASI 296

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
                V  EW+K + +P F   +Y +AM  +  R+G        +  NQ LI GC+K+GL
Sbjct: 297 RTPDSVLREWSKKYKIPLFGSSDYQSAMDSVCRRIGVTEKCKKESFQNQILIQGCEKMGL 356

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD 304
             +++  N+ S  H CG C +GC+ G+K+    TWL ++  N A  L  C  E+ +++  
Sbjct: 357 KVESVAINS-SADHYCGSCCYGCRTGDKKGTDSTWLVDSVGNGAVILTGCKAERFILENG 415

Query: 305 GKSQKVMGVEVIINN-------IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
               K      +I          K+++I +K  + + G++++P L++ SGLKN NIGRNL
Sbjct: 416 KNGMKKKKCLGVIAAASWRSKVTKKLQIESKVTISACGSLNTPPLMISSGLKNPNIGRNL 475

Query: 358 HVHPIAAVYGVFPNKEIKTYSG-TIMSAISNATENVDGENYGAKIVV--GSHHPGFMFAN 414
           H+HP+   +G FP      +SG      I  +      E+   + ++   S  PG   A 
Sbjct: 476 HLHPVQFAWGYFPEDMTTNFSGNNYEGGIITSIHKEYAEDSTPRFIIETPSLGPGSFSAF 535

Query: 415 FPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGL 474
            PW S    K  M +Y     +  + RD+  G +      + R+ Y+L + D +S+  GL
Sbjct: 536 VPWLSGQDMKDRMAKYARTANIFALIRDQGSGEV----KAEGRVTYRLDKEDKESLRVGL 591

Query: 475 LTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQ----T 530
             A+RIL AAGA ++GT ++  D   ++     + +   ++FL+ +  VG P  +    T
Sbjct: 592 RKALRILVAAGAMEVGTYRS--DGQRIK--CKGMKEEDLEEFLDTVTIVGGPRSRNEVWT 647

Query: 531 CTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHY 590
              T  QMSSCRMG    + A++  GE WE E LYV D SVLP+A GV  M+T  + ++ 
Sbjct: 648 VFTTAHQMSSCRMGASEEEGALDENGETWEAEGLYVCDGSVLPSAVGVNPMVTIQSTSYC 707

Query: 591 ISKCILD 597
           I+  I +
Sbjct: 708 IASKIAE 714



>gi|242034199|ref|XP_002464494.1| hypothetical protein SORBIDRAFT_01g019460 [Sorghum bicolor]
 gi|241918348|gb|EER91492.1| hypothetical protein SORBIDRAFT_01g019460 [Sorghum bicolor]
          Length = 587

 Score =  268 bits (684), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 165/494 (33%), Positives = 253/494 (51%), Gaps = 39/494 (7%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG ++   D S+ +    ++L+E  G   T +    +  G+  GGG+ + WSA +
Sbjct: 104 VVVVEKGDYFTADDYSSIEGPSMERLFERGGIFCTSNVTTMIFTGATVGGGSAVNWSACI 163

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
                V +EWA+  GLP F    Y  AM  + ARL            N+ +  GC+ LGL
Sbjct: 164 RTPEEVTQEWAREHGLPVFASPGYVQAMDAVCARLAVTDGCREEGFQNKVVRRGCEALGL 223

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD 304
            +D +P+N+ S  H CG C+FGC  G+K+    TWL +A +  A  L  C  E  + +K+
Sbjct: 224 CADAVPRNS-SDGHFCGSCNFGCPTGDKRGTDTTWLVDAVARGAVILTGCKAEHFVFEKN 282

Query: 305 -----GKSQKVMG-VEVIINN--IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRN 356
                G+ +K +G V    +N   K+++I AK  + + GA+ +P LL  SGLKN++IG N
Sbjct: 283 RSGVSGRGKKCVGLVATCASNGVTKKLRIEAKVSIAACGALMTPPLLRNSGLKNRHIGSN 342

Query: 357 LHVHPIAAVYGVFP-NKEI-----KTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGF 410
           LH+HP++  +G FP NK+      K + G I++++   TE          I   +  PG 
Sbjct: 343 LHLHPVSMAWGYFPENKQDPPLPGKCFEGGIITSMHRVTERT-------IIETPALGPGA 395

Query: 411 MFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSM 470
             A  PW+S    K+ M  Y+       + RDR  G +    +G+ R+ +  S+ D + +
Sbjct: 396 FAAMVPWESGRDMKERMRRYSRTAHAFALVRDRGVGYV----DGEGRVRFTPSREDIEEL 451

Query: 471 VAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQT 530
             GL   +RIL AAGA ++GT ++  D   +      L D   + FL+++     P +  
Sbjct: 452 RNGLRRTLRILVAAGAVEVGTHRS--DGLRLR--CKGLRDEDLEAFLDEVTIEKGPMHSR 507

Query: 531 -------CTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMT 583
                  C+    QM SCRMG  P   AV+  GE+WE E LYV D S+LPTA GV  M+T
Sbjct: 508 TDKWALHCSA--HQMGSCRMGSSPKDGAVDGRGESWEAEGLYVCDGSLLPTAVGVNPMIT 565

Query: 584 TMNIAHYISKCILD 597
             +IA  +SK I +
Sbjct: 566 IQSIAFCLSKGIAE 579



>gi|462395894|gb|EMJ01693.1| hypothetical protein PRUPE_ppa018458mg [Prunus persica]
          Length = 754

 Score =  267 bits (683), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 196/643 (30%), Positives = 303/643 (47%), Gaps = 60/643 (9%)

Query: 3   LINSKILSIQKPF----HELTQKQREHTFIKWSTSQYA-SVRKIYKSFTMLICATFW--L 55
           L   + LS + PF     E++ ++RE    KWS  +   ++R ++    +    TF+  L
Sbjct: 115 LCGHRCLSWKWPFIHSFSEMSLEKREEVLKKWSKEKLVLTLRLMFLVVKIFCFYTFFSRL 174

Query: 56  NPYNFNPV---IGY-----------PGADPEANGSRFSSRNFPKYNF--------LEISD 93
           +  + NP    +GY           P   P   G    + N     F        L++SD
Sbjct: 175 DENSRNPAWKAVGYDLNTNKKLIKTPKERPLEQGI-IETLNESDSTFVQSLTKRGLQVSD 233

Query: 94  ---HDSDIKEFDTXXXXXXXXXXXXXXRLARM-ENVLVIEKGHHYDQCDLSTEQQDGYDK 149
              H+    + D                LA+  + V+V+EKG+++   D S+ +    ++
Sbjct: 234 DTTHNIHKIKCDVVIVGSGCGGGVAAAVLAQSGQKVMVVEKGNYFLPKDYSSLEGPSMNE 293

Query: 150 LYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFVREEWAKNFGLPYFMEDEYG 209
           LYE  G M + D  + +LAGS  GGG+ I WSA +     V  EW+ +  +P +   +Y 
Sbjct: 294 LYESGGIMSSVDGMIMILAGSTVGGGSAINWSASIRTPDTVLHEWSVDHKVPLYASSDYK 353

Query: 210 NAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNIPQNTASITHQCGWCSFGCKY 269
            AM  +  R+         N  NQ L  GC  LGL  D +P+N+    H CG C++GC  
Sbjct: 354 YAMDVVCKRISVTDSCTEENFQNQILRKGCDTLGLKVDLVPRNSPG-DHYCGSCNYGCPT 412

Query: 270 GEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD----GKSQKVMGVEVII---NNIKR 322
           GEKQ    TWL +A    A  L  C  EK +++ D    G  ++ +GVE      N  K+
Sbjct: 413 GEKQGTDSTWLVDAVKCGAVILTGCKAEKFILENDSQGGGTRKRCLGVEATSLSKNMKKK 472

Query: 323 VKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIAAVYGVFPNKEI----KTYS 378
           ++I AK  + + G++ +P L++ SGLKN NIGRNLH+HP+   +G FP  E     +TY 
Sbjct: 473 LQIEAKVTISACGSLLTPPLMISSGLKNPNIGRNLHLHPVLLSWGYFPEHESEFRGRTYE 532

Query: 379 GTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMV 438
           G I++++       D  N  A I   +  P       PW S L  K  M +Y     L  
Sbjct: 533 GGIITSLHKVVS--DTTNVRAIIETPALGPASFATLSPWISRLDMKDRMEKYARTAHLFA 590

Query: 439 ITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDD 498
           + RD+  G +      + R+ Y L Q D +++  GL  A+RIL AAGA ++GT +   D 
Sbjct: 591 LVRDKGSGVV----KREGRIHYTLDQLDKENLQVGLRQALRILIAAGAVEVGTYRN--DG 644

Query: 499 YIVENGVNPLNDPKFDQFLNKIKKVGIPTYQ----TCTGTIEQMSSCRMGDDPNKSAVNP 554
             ++       D   ++FL+ +     P+ +    T   +  QM SCRM     +  V+ 
Sbjct: 645 QRIKCKGTKHED--LEEFLDSVVAAAGPSSREELWTTYSSAHQMGSCRMSASEEEGGVDE 702

Query: 555 VGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKCILD 597
            GE+WE + L+V D S+LPTA GV  M+T  + A+ ISK I +
Sbjct: 703 NGESWEAKGLFVCDGSLLPTAIGVNPMITIQSTAYCISKKIAE 745



>gi|356572276|ref|XP_003554295.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Glycine max]
          Length = 744

 Score =  267 bits (683), Expect = 7e-69,   Method: Compositional matrix adjust.
 Identities = 158/487 (32%), Positives = 251/487 (51%), Gaps = 23/487 (4%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG ++   D S+ +    D+ YE  G M + D  M +LAGS  GGG+ + WSA +
Sbjct: 258 VVVLEKGEYFVSHDYSSLEGPSMDEQYESGGIMPSLDGKMMILAGSTVGGGSAVNWSASI 317

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
                V  EW+K + +P F   +Y +AM  +  R+G        +  NQ LI GC+K+GL
Sbjct: 318 RTPDSVLREWSKKYKIPLFGSSDYQSAMDSVCRRIGVTEKCKKESFQNQILIQGCEKMGL 377

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD 304
             +++  N+ S  H CG C +GC+ G+K+    TWL ++  N A  L  C  E+ +++  
Sbjct: 378 KVESVAINS-SADHYCGSCCYGCRTGDKKGTDSTWLVDSVGNGAVILTGCKAERFILENG 436

Query: 305 GKSQKVMGVEVIINN-------IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
               K      +I          K+++I +K  + + G++++P L++ SGLKN NIGRNL
Sbjct: 437 KNGMKKKKCLGVIAAASWRSKVTKKLQIESKVTISACGSLNTPPLMISSGLKNPNIGRNL 496

Query: 358 HVHPIAAVYGVFPNKEIKTYSG-TIMSAISNATENVDGENYGAKIVVG--SHHPGFMFAN 414
           H+HP+   +G FP      +SG      I  +      E+   + ++   S  PG   A 
Sbjct: 497 HLHPVQFAWGYFPEDMTTNFSGNNYEGGIITSIHKEYAEDSTPRFIIETPSLGPGSFSAF 556

Query: 415 FPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGL 474
            PW S    K  M +Y     +  + RD+  G +      + R+ Y+L + D +S+  GL
Sbjct: 557 VPWLSGQDMKDRMAKYARTANIFALIRDQGSGEV----KAEGRVTYRLDKEDKESLRVGL 612

Query: 475 LTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQ----T 530
             A+RIL AAGA ++GT ++  D   ++     + +   ++FL+ +  VG P  +    T
Sbjct: 613 RKALRILVAAGAMEVGTYRS--DGQRIK--CKGMKEEDLEEFLDTVTIVGGPRSRNEVWT 668

Query: 531 CTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHY 590
              T  QMSSCRMG    + A++  GE WE E LYV D SVLP+A GV  M+T  + ++ 
Sbjct: 669 VFTTAHQMSSCRMGASEEEGALDENGETWEAEGLYVCDGSVLPSAVGVNPMVTIQSTSYC 728

Query: 591 ISKCILD 597
           I+  I +
Sbjct: 729 IASKIAE 735



>gi|406702016|gb|EKD05087.1| hypothetical protein A1Q2_00631 [Trichosporon asahii var. asahii
           CBS 8904]
          Length = 645

 Score =  267 bits (683), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 172/595 (28%), Positives = 285/595 (47%), Gaps = 30/595 (5%)

Query: 8   ILSIQKPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYP 67
           +L  Q P  +L   +     ++   ++ A +RKI+ S   L  A +  N    +  + Y 
Sbjct: 66  LLPSQLPPAKLADLKMVLGLLRLKHARTALMRKIFDSLIKLSSALYVRNSDLVHKAMLYE 125

Query: 68  G--ADPEANGSRFSSRNFPKYNFLEISDHDSDIKEFDTXXXXXXXXXXXXXXRLARME-N 124
               +P A G          + F        D +EFD               +L+     
Sbjct: 126 PKVTEPPAEG---------HFQFQFADPQSLDGQEFDAIIVGSGSGGGVAAKQLSEAGMK 176

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           VLVIEKG HYD      ++++    +Y+L G   T+   + +++G+ FGGG+++ W+A +
Sbjct: 177 VLVIEKGLHYDLAGQPYDEREALKVMYDLGGLAATETGELGLVSGNVFGGGSSVNWAACI 236

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +    VR++WA  +GLPYF   E+   +  +  ++G  ++    N  NQ L+ G ++LG 
Sbjct: 237 QTPAAVRQDWASTYGLPYFKTQEFQEDLDAVWKQMGV-SLPKKQNLQNQLLMEGARRLGY 295

Query: 245 HSDNIPQNTASITHQCGW-CSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDK 303
               + QN  +  H C   C+ GC+ G K+    +WL +A      F+  C V KIL   
Sbjct: 296 AHAPVAQNNGNADHNCNHDCANGCRSGGKKGGVHSWLIDAAKAGTTFVVGCSVRKILFT- 354

Query: 304 DGKSQKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIA 363
             KS+   GV V     K++KI   RV+ + G+I +PALLLRS + N  IG ++++HP  
Sbjct: 355 --KSRHAKGVLVKTPEGKKIKIKTSRVIAAGGSIQTPALLLRSRIPNPRIGTSIYLHPTN 412

Query: 364 AVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQH 423
            VY VFP +   T  G I++++     N+    +G ++  G   P        W    ++
Sbjct: 413 YVYAVFPERTHPT-EGQILTSVVTEFANLTPSGHGVRLETGIMQPIVSTVLMQWHGGKEY 471

Query: 424 KQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGLLTAVRILAA 483
           K  + +++++  L+ I RDR+ G +     G+P + Y  S  D KS++ G + A   + A
Sbjct: 472 KANIAKHSHMAGLIAIARDRDHGYVQLSAEGEPIVHYTTSAFDQKSVLKGTVAAAECMLA 531

Query: 484 AGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQTCTGTIEQMSSCRM 543
            GA +I          +   GV P    K D F    K+V   T  +  G+  QM SCRM
Sbjct: 532 VGAEEI---------IVNGRGVKPYK--KGDDFAAWAKQVEA-TPSSAFGSAHQMGSCRM 579

Query: 544 GDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKCILDK 598
              P     +P G    V+ ++ AD+SVLP+A+GV  M++TM +A  +S+ I+D+
Sbjct: 580 SSRPGDGTCDPSGAVRGVQGVWCADASVLPSASGVNPMISTMAVARKVSRGIVDQ 634



>gi|42561674|ref|NP_171895.2| long-chain-alcohol oxidase FAO1 [Arabidopsis thaliana]
 gi|374095386|sp|Q9ZWB9.2|FAO1_ARATH RecName: Full=Long-chain-alcohol oxidase FAO1; AltName:
           Full=Long-chain fatty alcohol oxidase 1
 gi|332189522|gb|AEE27643.1| long-chain-alcohol oxidase FAO1 [Arabidopsis thaliana]
          Length = 758

 Score =  267 bits (682), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 167/502 (33%), Positives = 265/502 (52%), Gaps = 34/502 (6%)

Query: 124 NVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAF 183
            V+VIEKG+++   D S  +     +L+E +  M+T D     +AGS  GGG+ + W+A 
Sbjct: 270 RVVVIEKGNYFAPRDYSALEGPSMFELFESNSLMMTHDGRFRFMAGSTVGGGSVVNWAAS 329

Query: 184 MEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLG 243
           ++    + EEW+ + G+  +  ++Y  AM  +  RLG     I     NQ L  GC+KLG
Sbjct: 330 LKTPDAIIEEWSVHRGISIYSSEKYKAAMGIVCKRLGVTEKIIREGFQNQILRKGCEKLG 389

Query: 244 LHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEK-ILID 302
           L    +P+N+    H CG CS+GC  GEK+    TWL +A +NNA  L  C  EK IL D
Sbjct: 390 LDVTIVPRNSTE-KHYCGSCSYGCPTGEKRGTDSTWLVDAVNNNAVILTQCKAEKLILAD 448

Query: 303 KD-------GKSQKVMGVEVIINN--IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNI 353
            D       G+ ++ +GV   +++   K+++I+AK  +V+ G++ +P LL  SGLKN NI
Sbjct: 449 NDANKREESGRRKRCLGVAASLSHQTRKKLQINAKVTIVACGSLKTPGLLASSGLKNSNI 508

Query: 354 GRNLHVHPIAAVYGVFPNK----EIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPG 409
            R LH+HPI   +G FP K    E   + G I++++ +    +D       +   +  PG
Sbjct: 509 SRGLHIHPIMMAWGYFPEKNSELEGAAHEGEIVTSL-HYVHPMDSTTPNITLETPAIGPG 567

Query: 410 FMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKS 469
              A  PW S    K+ M +Y     +  + RD   G +  D      ++Y+L++ D ++
Sbjct: 568 TFAALTPWVSGSDMKERMAKYARTAHIFAMVRDEGVGEVKGD-----IVKYRLTKADEEN 622

Query: 470 MVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKK----VGI 525
           +  GL  A+RIL AAGA ++GT ++  D   ++   + +     + FL+ +      V +
Sbjct: 623 LTIGLKQALRILVAAGAAEVGTYRS--DGQRMK--CDGIKQKDLEAFLDTVNAPPGVVSM 678

Query: 526 PTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTM 585
             + T + T  Q+  CRMG    + A++  GE+WE E+LYV D+SVLPTA GV  M+T  
Sbjct: 679 SKHWTQSFTAHQIGCCRMGATEKEGAIDGKGESWEAEDLYVCDASVLPTALGVNPMITVQ 738

Query: 586 NIAHYISKCILDKKIFTVKKKR 607
           + A+ IS      +I  + KKR
Sbjct: 739 STAYCIS-----NRIAELMKKR 755



>gi|4204315|gb|AAD10696.1| Unknown protein [Arabidopsis thaliana]
          Length = 736

 Score =  266 bits (681), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 167/501 (33%), Positives = 265/501 (52%), Gaps = 34/501 (6%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+VIEKG+++   D S  +     +L+E +  M+T D     +AGS  GGG+ + W+A +
Sbjct: 249 VVVIEKGNYFAPRDYSALEGPSMFELFESNSLMMTHDGRFRFMAGSTVGGGSVVNWAASL 308

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +    + EEW+ + G+  +  ++Y  AM  +  RLG     I     NQ L  GC+KLGL
Sbjct: 309 KTPDAIIEEWSVHRGISIYSSEKYKAAMGIVCKRLGVTEKIIREGFQNQILRKGCEKLGL 368

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEK-ILIDK 303
               +P+N+    H CG CS+GC  GEK+    TWL +A +NNA  L  C  EK IL D 
Sbjct: 369 DVTIVPRNSTE-KHYCGSCSYGCPTGEKRGTDSTWLVDAVNNNAVILTQCKAEKLILADN 427

Query: 304 D-------GKSQKVMGVEVIINN--IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIG 354
           D       G+ ++ +GV   +++   K+++I+AK  +V+ G++ +P LL  SGLKN NI 
Sbjct: 428 DANKREESGRRKRCLGVAASLSHQTRKKLQINAKVTIVACGSLKTPGLLASSGLKNSNIS 487

Query: 355 RNLHVHPIAAVYGVFPNK----EIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGF 410
           R LH+HPI   +G FP K    E   + G I++++ +    +D       +   +  PG 
Sbjct: 488 RGLHIHPIMMAWGYFPEKNSELEGAAHEGEIVTSL-HYVHPMDSTTPNITLETPAIGPGT 546

Query: 411 MFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSM 470
             A  PW S    K+ M +Y     +  + RD   G +  D      ++Y+L++ D +++
Sbjct: 547 FAALTPWVSGSDMKERMAKYARTAHIFAMVRDEGVGEVKGD-----IVKYRLTKADEENL 601

Query: 471 VAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKK----VGIP 526
             GL  A+RIL AAGA ++GT ++  D   ++   + +     + FL+ +      V + 
Sbjct: 602 TIGLKQALRILVAAGAAEVGTYRS--DGQRMK--CDGIKQKDLEAFLDTVNAPPGVVSMS 657

Query: 527 TYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMN 586
            + T + T  Q+  CRMG    + A++  GE+WE E+LYV D+SVLPTA GV  M+T  +
Sbjct: 658 KHWTQSFTAHQIGCCRMGATEKEGAIDGKGESWEAEDLYVCDASVLPTALGVNPMITVQS 717

Query: 587 IAHYISKCILDKKIFTVKKKR 607
            A+ IS      +I  + KKR
Sbjct: 718 TAYCIS-----NRIAELMKKR 733



>gi|116204003|ref|XP_001227812.1| hypothetical protein CHGG_09885 [Chaetomium globosum CBS 148.51]
 gi|88176013|gb|EAQ83481.1| hypothetical protein CHGG_09885 [Chaetomium globosum CBS 148.51]
          Length = 723

 Score =  266 bits (681), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 186/619 (30%), Positives = 290/619 (46%), Gaps = 56/619 (9%)

Query: 2   SLINSK-----ILSIQKPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLN 56
           S++N++     + S   PF  L  + R      WSTS   S+R ++KS + L       +
Sbjct: 127 SILNTRPGSLILTSHATPFPSLPLQDRMKILQNWSTSSLWSLRTLFKSMSTLAKLAHIRS 186

Query: 57  PYNFNPVIGYPGADPEANGSRFSSRNFPKYNFLEISDHDSDIKE--------FDTXXXXX 108
              F  + G+P      +G    + ++P Y FL+     S             D      
Sbjct: 187 STAFPLLTGFPAV---PSGWTAGTTSYP-YEFLQFHPTTSTTNPPNQPLEITTDVAILGS 242

Query: 109 XXXXXXXXXRLAR----MENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNM 164
                    RLAR       VLV+EKG H D       Q  G   L+E  G + +DD ++
Sbjct: 243 GCGAGVVANRLAREFGPSLQVLVLEKGRHLDARHFPLSQAGGLASLFEAGGVVESDDGSV 302

Query: 165 YVLAGSNFGGGTTIGWSAFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTI 224
            V AGS FGGG T+ WSA + PQ FVREEW +  GL +F  +E+   +  +  ++G +  
Sbjct: 303 TVTAGSCFGGGGTVNWSASLMPQGFVREEWVRERGLGFFGGEEFQGCLDGVWEKMGCSGE 362

Query: 225 NIIHNQSNQTLINGCKKLGLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAK 284
            +  N +N+ L+ G ++LG  +  +PQN     H CG+C+ GC  GEK+     W  EA 
Sbjct: 363 RVRPNHANRVLVEGAERLGYQAKVVPQNVGGTEHYCGYCTLGCWKGEKKGPVNGWFPEAA 422

Query: 285 SNNAKFLKNCYVEKILIDKDGKSQKVMGVEVIINN----IKRVKIHAKRVVVSAGAIHSP 340
               KF++   VE+++ ++  K +   GV+ +  +      +V + AK+VVVS G + SP
Sbjct: 423 KQGVKFVEGMQVERVIFEEGKKGKVAKGVKGVWTSREGEKVQVVVKAKKVVVSCGTLWSP 482

Query: 341 ALLLRSGLKNKNIGRNLHVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAK 400
            +L+ SG+K+ +         + +V G F                    EN+D + +G K
Sbjct: 483 VVLMNSGIKDGS---------LTSVVGSF--------------------ENLDSKGHGVK 513

Query: 401 IVVGSHHPGFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDE-NGKPRLE 459
           +   SH   F     PW S L++K L  +Y ++   + I RDR+ G I  D   G+PR+ 
Sbjct: 514 LEAMSHDALFCLPFLPWASGLEYKLLSAKYRHLNTFIAICRDRDTGSIYRDPTTGRPRIT 573

Query: 460 YKLSQHDSKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPK-FDQFLN 518
           Y  S  D    + G+L   RIL    A +I         +I + G +   + K F+ +L 
Sbjct: 574 YTPSDFDRAHNMRGVLELCRILYGHSAREIHPSIADFAPFIRKEGADAEAEKKEFEAWLA 633

Query: 519 KIKKVGIPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGV 578
           K+K  G     +   +  QM +CRM   P +  V+  G  W  + LYVAD+SV P+A+GV
Sbjct: 634 KLKAHGNKPPVSPFASAHQMGTCRMSAKPKEGVVDSRGRVWGTQGLYVADASVFPSASGV 693

Query: 579 PSMMTTMNIAHYISKCILD 597
             M+TTM IA +I K + +
Sbjct: 694 NPMVTTMAIADWIGKGVCE 712



>gi|460404091|ref|XP_004247518.1| PREDICTED: long-chain-alcohol oxidase FAO2-like [Solanum
           lycopersicum]
          Length = 731

 Score =  266 bits (681), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 167/487 (34%), Positives = 265/487 (54%), Gaps = 28/487 (5%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTD-DSNMYVLAGSNFGGGTTIGWSAF 183
           V+V+EKGH++   D S  +     +LYE +G ML+  D  + ++AG+  GGG+ + WSA 
Sbjct: 251 VVVLEKGHYFVPEDYSGLEGPSLSELYE-TGAMLSSLDGKVMIMAGTTVGGGSAVNWSAS 309

Query: 184 MEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLG 243
           ++    V ++W+ N  + +F   EY +AM  +  R+G           NQ +  GC+ LG
Sbjct: 310 IKTPNDVLKDWSVNHKISWFGTSEYQSAMDAVCKRIGVTENCSEEGLQNQVIRKGCENLG 369

Query: 244 LHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDK 303
           L  + IP+N++   H CG C +GCK G+K+    TWL +A +  A  L  C  E+ +++ 
Sbjct: 370 LKVEKIPRNSSE-NHYCGSCGYGCKTGDKKGTDSTWLVDAVNAGAVILTGCTAERFILE- 427

Query: 304 DGKSQK-VMGVEVIINN---IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHV 359
           DGK +K  +GV     +    +++ I A+  + S GA+ +P LLL SGL+NKNIG NL++
Sbjct: 428 DGKMRKTCLGVIATTESKKITRKLHIKARATISSCGALFTPPLLLSSGLQNKNIGTNLYL 487

Query: 360 HPIAAVYGVFPN--KEI--KTYSGTIMSAISNATENVDGE-NYGAKIVVGSHHPGFMFAN 414
           HP+   +G FP    EI  K Y G IM+++    E V  E N  A I   +  P    + 
Sbjct: 488 HPVLLAWGYFPESMSEIKGKNYEGGIMTSLH---EMVPEETNAQAIIEATAVGPASFASL 544

Query: 415 FPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGL 474
           FPW S    K+ M +Y+  V L+ + +D+  G +        R++Y L + D +++ AGL
Sbjct: 545 FPWTSGQDMKEQMTKYSRTVTLLALVKDQGRGEV----KKAGRIKYSLDRIDKENIKAGL 600

Query: 475 LTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQ----T 530
             A+RIL AAGA ++GT ++  D   ++     + + + ++F++ ++    P  +    T
Sbjct: 601 RRALRILIAAGAVEVGTYRS--DGQKIK--CKDIKNEELEEFVDTVEAPEGPMSKEENWT 656

Query: 531 CTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHY 590
              +  QM SCRMG      AV+  GE WE + LYV D SVLPTA GV  M+T  + A+ 
Sbjct: 657 VYASAHQMGSCRMGSSKEDGAVDENGECWEAKGLYVCDGSVLPTAVGVNPMITIQSTAYC 716

Query: 591 ISKCILD 597
           I+K I +
Sbjct: 717 IAKRIAE 723



>gi|297803216|ref|XP_002869492.1| hypothetical protein ARALYDRAFT_491906 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297315328|gb|EFH45751.1| hypothetical protein ARALYDRAFT_491906 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 748

 Score =  266 bits (679), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 164/493 (33%), Positives = 262/493 (53%), Gaps = 35/493 (7%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           VLV+EKG+++   D S  +     +LYE SG + T D    +LAGS  GGGT + WSA +
Sbjct: 263 VLVLEKGNYFAPQDYSGLEGPSMLELYEKSGLLTTVDGKFMLLAGSTVGGGTAVNWSASI 322

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
                V +EW++   + +F   EY +AM  +  R+G     +     NQ L  GC++LGL
Sbjct: 323 RTPDHVLQEWSEGSKIKFFGSQEYQSAMDEVMTRIGVTERCVKDGFQNQVLRKGCERLGL 382

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEK-ILIDK 303
             +++P+N+    H CG C +GC+ G K     TWL +A  N A  L     E+ +L+D 
Sbjct: 383 QVESVPRNSPE-DHYCGLCGYGCRAGAKNGTDRTWLVDAVENGAVILTGIKAERFVLVDN 441

Query: 304 DGKS--QKVMGVEVIINNI-----KRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRN 356
              S  +K   V VI +++     K+  I A+    SAG++ +P L+L SGLKN NIGRN
Sbjct: 442 TSSSNERKKRCVGVIASSVGGKIGKKFIIEARMTASSAGSLLTPPLMLSSGLKNPNIGRN 501

Query: 357 LHVHPIAAVYGVFPNKEI----KTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMF 412
           L +HP+   +G FP K+     K Y G I++++ +     D E+ G + ++   +P    
Sbjct: 502 LKLHPVLMTWGYFPEKDSEFSGKMYEGGIITSVHHMN---DAES-GCRAIL--ENPLIGP 555

Query: 413 ANF----PWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSK 468
           A++    PW S    K+ M++Y     +  + RD   G ++ +      + Y+ ++ D +
Sbjct: 556 ASYAGLSPWVSGADLKERMIKYGRTAHVFALVRDIGSGEVMKESE----VTYRTTKKDRE 611

Query: 469 SMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKV-GIPT 527
           ++ AGL  A+R+  AAGA ++GT ++       E     +     ++FL+++  V G+ T
Sbjct: 612 NLRAGLRQALRVSVAAGAVEVGTYRSDGQRMKCEG----ITKEAMEEFLDEVDAVGGVST 667

Query: 528 ---YQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTT 584
              Y T   +  QM SCRMG    + A++ +GE+WE E L+V D SVLP+A GV  M+T 
Sbjct: 668 KGEYWTTYFSAHQMGSCRMGATAEEGALDEIGESWEAEGLFVCDGSVLPSAVGVNPMITI 727

Query: 585 MNIAHYISKCILD 597
            + A+ IS  I+D
Sbjct: 728 QSTAYCISSKIVD 740



>gi|15235348|ref|NP_194586.1| Long-chain-alcohol oxidase FAO4B [Arabidopsis thaliana]
 gi|300680984|sp|Q94BP3.2|FAO4B_ARATH RecName: Full=Long-chain-alcohol oxidase FAO4B; AltName:
           Full=Long-chain fatty alcohol oxidase 4B
 gi|7269712|emb|CAB81445.1| putative protein [Arabidopsis thaliana]
 gi|22798798|emb|CAC87644.1| alcohol oxidase [Arabidopsis thaliana]
 gi|25054929|gb|AAN71941.1| unknown protein [Arabidopsis thaliana]
 gi|332660108|gb|AEE85508.1| Long-chain-alcohol oxidase FAO4B [Arabidopsis thaliana]
          Length = 748

 Score =  265 bits (676), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 166/495 (33%), Positives = 261/495 (52%), Gaps = 39/495 (7%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           VLV+EKG+++   D S  +     +LYE  G + T D    +LAGS  GGGT + WSA +
Sbjct: 263 VLVLEKGNYFTAHDYSGLEVPSMLELYEKGGLLTTVDGKFMLLAGSAVGGGTAVNWSASI 322

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
                V +EW++   + +F   EY +AM  +  R+G     + H   NQ L  GC++LGL
Sbjct: 323 RTPDHVLQEWSEGSKIKFFGSQEYQSAMDEVTIRIGVTERCVKHGFQNQVLRKGCERLGL 382

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEK-ILIDK 303
             +++P+N+    H CG C +GC+ G K     TWL +A  N A  L     E+ +L+D 
Sbjct: 383 QVESVPRNSPE-DHYCGLCGYGCRAGAKNGTDQTWLVDAVENGAVILTGIKAERFVLVDN 441

Query: 304 DGKS--QKVMGVEVIINNI-----KRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRN 356
              S  +K   V V  +++     K+  I A+  V SAG++ +P L+L SGLKN NIGRN
Sbjct: 442 TSSSNERKKRCVGVFASSVGGKIGKKFIIEARVTVSSAGSLLTPPLMLSSGLKNPNIGRN 501

Query: 357 LHVHPIAAVYGVFPNKEI----KTYSGTIMSAIS--NATENVDGENYGAKIVVGSHHPGF 410
           L +HP+   +G FP K+     K Y G I++++   N TE+      G K ++   +P  
Sbjct: 502 LKLHPVLMTWGYFPEKDSEFSGKMYEGGIITSVHHMNDTES------GCKAIL--ENPLI 553

Query: 411 MFANF----PWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHD 466
             A++    PW S    K+ M++Y     L  + RD   G ++ +      + Y+ ++ D
Sbjct: 554 GPASYAGLSPWVSGPDLKERMIKYGRTAHLFALVRDLGSGEVMMENE----VTYRTTKKD 609

Query: 467 SKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKV-GI 525
            +++ AGL  A+R+  AAGA ++GT ++       E     +     ++FL+++  V G+
Sbjct: 610 RENLRAGLRQALRVSVAAGAVEVGTYRSDGQKMKCE----AITKEAMEEFLDEVDAVGGV 665

Query: 526 PT---YQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMM 582
            T   Y T   +  QM SCRMG    + A++  GE+WE E L+V D S+LP+A GV  M+
Sbjct: 666 GTKGEYWTTYFSAHQMGSCRMGVTAEEGALDENGESWEAEGLFVCDGSILPSAVGVNPMI 725

Query: 583 TTMNIAHYISKCILD 597
           T  + A+ IS  I+D
Sbjct: 726 TIQSTAYCISSKIVD 740



>gi|14532706|gb|AAK64154.1| unknown protein [Arabidopsis thaliana]
          Length = 748

 Score =  265 bits (676), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 166/495 (33%), Positives = 261/495 (52%), Gaps = 39/495 (7%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           VLV+EKG+++   D S  +     +LYE  G + T D    +LAGS  GGGT + WSA +
Sbjct: 263 VLVLEKGNYFTAHDYSGLEVPSMLELYEKGGLLTTVDGKFMLLAGSAVGGGTAVNWSASI 322

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
                V +EW++   + +F   EY +AM  +  R+G     + H   NQ L  GC++LGL
Sbjct: 323 RTPDHVLQEWSEGSKIKFFGSQEYQSAMDEVTIRIGVTERCVKHGFQNQVLRKGCERLGL 382

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEK-ILIDK 303
             +++P+N+    H CG C +GC+ G K     TWL +A  N A  L     E+ +L+D 
Sbjct: 383 QVESVPRNSPE-DHYCGLCGYGCRAGAKNGTDQTWLVDAVENGAVILTGIKAERFVLVDN 441

Query: 304 DGKS--QKVMGVEVIINNI-----KRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRN 356
              S  +K   V V  +++     K+  I A+  V SAG++ +P L+L SGLKN NIGRN
Sbjct: 442 TSSSNERKKRCVGVFASSVGGKIGKKFIIEARVTVSSAGSLLTPPLMLSSGLKNPNIGRN 501

Query: 357 LHVHPIAAVYGVFPNKEI----KTYSGTIMSAIS--NATENVDGENYGAKIVVGSHHPGF 410
           L +HP+   +G FP K+     K Y G I++++   N TE+      G K ++   +P  
Sbjct: 502 LKLHPVLMTWGYFPEKDSEFSGKMYEGGIITSVHHMNDTES------GCKAIL--ENPLI 553

Query: 411 MFANF----PWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHD 466
             A++    PW S    K+ M++Y     L  + RD   G ++ +      + Y+ ++ D
Sbjct: 554 GPASYAGLSPWVSGPDLKERMIKYGRTAHLFALVRDLGSGEVMMENE----VTYRTTKKD 609

Query: 467 SKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKV-GI 525
            +++ AGL  A+R+  AAGA ++GT ++       E     +     ++FL+++  V G+
Sbjct: 610 RENLRAGLRQALRVSVAAGAVEVGTYRSDGQKMKCE----AITKEAMEEFLDEVDAVGGV 665

Query: 526 PT---YQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMM 582
            T   Y T   +  QM SCRMG    + A++  GE+WE E L+V D S+LP+A GV  M+
Sbjct: 666 GTKGEYWTTYFSAHQMGSCRMGVTAEEGALDENGESWEAEGLFVCDGSILPSAVGVNPMI 725

Query: 583 TTMNIAHYISKCILD 597
           T  + A+ IS  I+D
Sbjct: 726 TIQSTAYCISSKIVD 740



>gi|21554016|gb|AAM63097.1| unknown [Arabidopsis thaliana]
          Length = 748

 Score =  265 bits (676), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 166/495 (33%), Positives = 261/495 (52%), Gaps = 39/495 (7%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           VLV+EKG+++   D S  +     +LYE  G + T D    +LAGS  GGGT + WSA +
Sbjct: 263 VLVLEKGNYFTAHDYSGLEVPSMLELYEKGGLLTTVDGKFMLLAGSAVGGGTAVNWSASI 322

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
                V +EW++   + +F   EY +AM  +  R+G     + H   NQ L  GC++LGL
Sbjct: 323 RTPDHVLQEWSEGSKIKFFGSQEYQSAMDEVTIRIGVTERCVKHGFQNQVLRKGCERLGL 382

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEK-ILIDK 303
             +++P+N+    H CG C +GC+ G K     TWL +A  N A  L     E+ +L+D 
Sbjct: 383 QVESVPRNSPE-DHYCGLCGYGCRAGAKNGTDQTWLVDAVENGAVILTGIKAERFVLVDN 441

Query: 304 DGKS--QKVMGVEVIINNI-----KRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRN 356
              S  +K   V V  +++     K+  I A+  V SAG++ +P L+L SGLKN NIGRN
Sbjct: 442 TSSSNERKKRCVGVFASSVGGKIGKKFIIEARVTVSSAGSLLTPPLMLSSGLKNPNIGRN 501

Query: 357 LHVHPIAAVYGVFPNKEI----KTYSGTIMSAIS--NATENVDGENYGAKIVVGSHHPGF 410
           L +HP+   +G FP K+     K Y G I++++   N TE+      G K ++   +P  
Sbjct: 502 LKLHPVLMTWGYFPEKDSEFSGKMYEGGIITSVHHMNDTES------GCKAIL--ENPLI 553

Query: 411 MFANF----PWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHD 466
             A++    PW S    K+ M++Y     L  + RD   G ++ +      + Y+ ++ D
Sbjct: 554 GPASYAGLSPWVSGPDLKERMIKYGRTAHLFALVRDLGSGEVMMENE----VTYRTTKKD 609

Query: 467 SKSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKV-GI 525
            +++ AGL  A+R+  AAGA ++GT ++       E     +     ++FL+++  V G+
Sbjct: 610 RENLRAGLRQALRVSVAAGAVEVGTYRSDGQKMKCE----AITKEAMEEFLDEVDAVGGV 665

Query: 526 PT---YQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMM 582
            T   Y T   +  QM SCRMG    + A++  GE+WE E L+V D S+LP+A GV  M+
Sbjct: 666 GTKGEYWTTYFSAHQMGSCRMGVTAEEGALDENGESWEAEGLFVCDGSILPSAVGVNPMI 725

Query: 583 TTMNIAHYISKCILD 597
           T  + A+ IS  I+D
Sbjct: 726 TIQSTAYCISSKIVD 740



>gi|401888583|gb|EJT52537.1| hypothetical protein A1Q1_03669 [Trichosporon asahii var. asahii
           CBS 2479]
          Length = 645

 Score =  264 bits (675), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 171/595 (28%), Positives = 284/595 (47%), Gaps = 30/595 (5%)

Query: 8   ILSIQKPFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYP 67
           +L  Q P  +L   +     ++   ++ A +RKI+ S   L  A +  N    +  + Y 
Sbjct: 66  LLPSQLPPAKLADLKMVLGLLRLKHARTALMRKIFDSLIKLSSALYVRNSDLVHKAMLYE 125

Query: 68  G--ADPEANGSRFSSRNFPKYNFLEISDHDSDIKEFDTXXXXXXXXXXXXXXRLARME-N 124
               +P A G          + F        D +EFD               + +     
Sbjct: 126 PKVTEPPAEG---------HFQFQFADPQSLDGQEFDAIIVGSGSGGGVAAKQPSEAGMK 176

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           VLVIEKG HYD      ++++    +Y+L G   T+   + +++G+ FGGG+++ W+A +
Sbjct: 177 VLVIEKGLHYDLAGQPYDEREALKVMYDLGGLAATETGELGLVSGNVFGGGSSVNWAACI 236

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
           +    VR++WA  +GLPYF   E+   +  +  ++G  ++    N  NQ L+ G ++LG 
Sbjct: 237 QTPAAVRQDWASTYGLPYFKTQEFQEDLDAVWKQMGV-SLPKKQNLQNQLLMEGARRLGY 295

Query: 245 HSDNIPQNTASITHQCGW-CSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDK 303
               + QN  +  H C   C+ GC+ G K+    +WL +A      F+  C V KIL   
Sbjct: 296 AHAPVAQNNGNADHNCNHDCANGCRSGGKKGGVHSWLIDAAKAGTTFVVGCSVRKILFT- 354

Query: 304 DGKSQKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHVHPIA 363
             KS+   GV V     K++KI   RV+ + G+I +PALLLRS + N  IG ++++HP  
Sbjct: 355 --KSRHAKGVLVKTPEGKKIKIKTSRVIAAGGSIQTPALLLRSRIPNPRIGTSIYLHPTN 412

Query: 364 AVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPWKSNLQH 423
            VY VFP +   T  G I++++     N+    +G ++  G   P        W    ++
Sbjct: 413 YVYAVFPERTHPT-EGQILTSVVTEFANLTPSGHGVRLETGIMQPIVSTVLMQWHGGKEY 471

Query: 424 KQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAGLLTAVRILAA 483
           K  + +++++  L+ I RDR+ G +     G+P + Y  S  D KS++ G + A   + A
Sbjct: 472 KANIAKHSHMAGLIAIARDRDHGYVQLSAEGEPIVHYTTSAFDQKSVLKGTVAAAECMLA 531

Query: 484 AGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQTCTGTIEQMSSCRM 543
            GA +I          +   GV P    K D F    K+V   T  +  G+  QM SCRM
Sbjct: 532 VGAEEI---------IVNGRGVKPYK--KGDDFAAWAKQVEA-TPSSAFGSAHQMGSCRM 579

Query: 544 GDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISKCILDK 598
              P     +P G    V+ ++ AD+SVLP+A+GV  M++TM +A  +S+ I+D+
Sbjct: 580 SSRPGDGTCDPSGAVRGVQGVWCADASVLPSASGVNPMISTMAVARKVSRGIVDQ 634



>gi|326507824|dbj|BAJ86655.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 752

 Score =  264 bits (675), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 158/488 (32%), Positives = 252/488 (51%), Gaps = 37/488 (7%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           VLV+EKG ++   D S+ +    ++LYE  G   T +    + AG+  GGG+ + WSA +
Sbjct: 274 VLVVEKGDYFTPDDYSSVEGPSMERLYEQGGIFCTSNVTTVLFAGTTVGGGSAVNWSASI 333

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
                V  EW+++ GLP F    Y  +M  + ARL            N+ +  GC+ LGL
Sbjct: 334 RTPREVLLEWSRDHGLPVFGSAGYVQSMDAVCARLAVTDGCREEGFQNKVVRRGCEALGL 393

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILID-- 302
             D +P+N+ S  H CG C  GC  G+K+    TWL +A  + A  L  C  E+ ++   
Sbjct: 394 PVDCVPRNS-SEGHYCGNCYLGCPTGDKRGTDTTWLVDAVQDGAVILAGCKAERFILQNN 452

Query: 303 ---KDGKSQKVMG-VEVIINN--IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRN 356
              K+G+S+K +G V   + +   K+++I AK  + + GA+ +P LL  SGL+N+++GRN
Sbjct: 453 INGKNGRSKKCVGLVATCVGSGITKKLRIEAKVSISACGALMTPPLLRNSGLRNRHVGRN 512

Query: 357 LHVHPIAAVYGVFPNKEI------KTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGF 410
           LH+HP++  +G FP+         K Y G I++++   TE          I   +  PG 
Sbjct: 513 LHLHPVSMAWGYFPDTNQVPQLTGKCYEGGIITSMHRVTERT-------IIETPALGPGA 565

Query: 411 MFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSM 470
             +  PW+S    K+ M  Y        + RDR  G +     G+ R+ Y  S+ D + +
Sbjct: 566 FASLVPWESGRDMKERMRRYARTAHAFALVRDRAAGSVY----GEGRVHYSPSRDDIEEL 621

Query: 471 VAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIK------KVG 524
             GL  A+RI+ AAGA ++GT ++  D   +      + D   + FL+++       + G
Sbjct: 622 RDGLRRALRIMVAAGAAEVGTHRS--DGLRLR--CKGVQDKDLEAFLDEVTVPRGPMQPG 677

Query: 525 IPTYQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTT 584
             T+     +  QM SCRMG  P + AV+  GE+WE E+LYV D S+LPTA GV  M+T 
Sbjct: 678 TDTWALLC-SAHQMGSCRMGSSPKEGAVDGRGESWEAEDLYVCDGSLLPTAVGVNPMITI 736

Query: 585 MNIAHYIS 592
            ++A+ ++
Sbjct: 737 QSLAYCLA 744



>gi|482551887|gb|EOA16080.1| hypothetical protein CARUB_v10004212mg [Capsella rubella]
          Length = 754

 Score =  264 bits (675), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 164/494 (33%), Positives = 262/494 (53%), Gaps = 36/494 (7%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           VLV+EKG+++   D S  +     +LYE  G + + D    +LAGS  GGGT I WSA +
Sbjct: 268 VLVLEKGNYFAAQDYSGLEGPSMLELYEKGGFLTSVDGKFMILAGSAVGGGTAINWSASI 327

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
                V +EW++   + +F   EY  AM  +  R+G     +     NQ L  GC++LGL
Sbjct: 328 RTPDHVLQEWSEESKIKFFGSQEYKTAMDEVTTRIGVTDKCVKDGFQNQVLRKGCERLGL 387

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILI--- 301
             +++P+N+    H CG C +GC+ G+K     TWL +A  N A  L     E+ ++   
Sbjct: 388 QVESVPRNSHE-DHYCGLCGYGCRAGDKNGTDQTWLVDAVENGAVILTGIKAERFILVDN 446

Query: 302 -DKDGKSQKVMGVEVIINNI-----KRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGR 355
            D     ++   V VI +++     K+  I A+  V SAG++ +P L+L SGLKN+NIGR
Sbjct: 447 TDSSSNERQKRCVGVIASSVGGKIGKKFMIEARVTVSSAGSLLTPPLMLSSGLKNQNIGR 506

Query: 356 NLHVHPIAAVYGVFPNKEI----KTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFM 411
           NL +HP+   +G FP K+     K Y G I++++ +     D E+ G K ++   +P   
Sbjct: 507 NLTLHPVLMTWGYFPEKDSEFSGKMYEGGIITSLHHMN---DAES-GCKAIL--ENPLIG 560

Query: 412 FANF----PWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDS 467
            A++    PW S    K+ M++Y     L  + RD   G ++ +      + Y+ ++ D 
Sbjct: 561 PASYAGLSPWVSGADLKERMMKYARTAHLFALVRDIGSGEVMKENE----ITYRTTKKDR 616

Query: 468 KSMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKV-GIP 526
           +++ AGL  A+R+L AAGA ++GT ++       E      +    ++FL+++  V G+ 
Sbjct: 617 ENLRAGLRQALRVLIAAGAAEVGTYRSDGQRIKCEG----TSREAIEEFLDEVDAVGGVS 672

Query: 527 T---YQTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMT 583
           T   Y T   +  QMSSCRMG    + A++  GE++E E L+V D SVLP+A GV  M+T
Sbjct: 673 TKGEYWTTYFSAHQMSSCRMGATAEEGALDENGESFEAEGLFVCDGSVLPSAVGVNPMIT 732

Query: 584 TMNIAHYISKCILD 597
             + A+ IS  I+D
Sbjct: 733 IQSTAYCISTRIVD 746



>gi|470263974|ref|XP_004361070.1| glucose-methanol-choline oxidoreductase [Dictyostelium
           fasciculatum]
 gi|328874854|gb|EGG23219.1| glucose-methanol-choline oxidoreductase [Dictyostelium
           fasciculatum]
          Length = 908

 Score =  263 bits (673), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 186/603 (30%), Positives = 301/603 (49%), Gaps = 44/603 (7%)

Query: 15  FHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGADPEAN 74
           F  L+ ++R+       TS     R+ Y++   L C+ F ++  N N V   P  +    
Sbjct: 233 FTSLSFEKRQKILAMMKTSVNPLRRQAYRAVAPLTCSLFLMS-LNSNGV--NPNWELLDY 289

Query: 75  GSRFSSRNFP---KYNFLEISDHDSDIKEFDTXXXXXXXXXXXXXXRLARME-NVLVIEK 130
                    P   + +F+ IS   S   + D                LA    NV+++EK
Sbjct: 290 PLPPPPEQIPTKERLSFINISSEQS--LKTDVVVIGSGAGGGVTAAILAEAGYNVIILEK 347

Query: 131 GHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFMEPQYFV 190
           G +     ++ ++ + Y  LYE +  ++++D ++ VLAGS  GGGTT+ W+A ++    V
Sbjct: 348 GSYLSPNAMTWKEAEAYPLLYEQAASLVSEDISVNVLAGSCVGGGTTVNWAASIKTPEHV 407

Query: 191 REEWAKNFGLP-YFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGLHSDNI 249
            ++W K+   P  F +  + +A+  ++ARL  N    +HN+ N  L     +L   SD I
Sbjct: 408 LDDWRKD--CPNTFEKISFNDALDKVSARLNVNKNESVHNKPNDILQRALDELNYDSDVI 465

Query: 250 PQNTASI-THQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKIL--IDKDGK 306
            +N     T QCG+CS GC+   KQS+ +T+L +A  N AK + +C   +I   + K G+
Sbjct: 466 ARNVKGCDTSQCGYCSMGCRSRSKQSSMITYLEDACLNGAKIIVHCEAMEITSTVPKGGQ 525

Query: 307 ---SQKVMGVEVIINNIK----RVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNLHV 359
              S    GV  I+ +      RV I    +V SAGAIH+PALLLRSGL N NIG+ L++
Sbjct: 526 VPTSPTAHGVVAIVTHPDGERHRVFIKCDIIVSSAGAIHTPALLLRSGLSNPNIGKTLYL 585

Query: 360 HPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGF--MFANFPW 417
           HP+    G+F  + ++ + G  MS IS   +      YG  +   + H G   M  ++ W
Sbjct: 586 HPVLPAVGIFEKEAVEIWKGVPMSVISREFQG----KYGTILETPNAHLGVVSMIVSYLW 641

Query: 418 KSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGK-PRLEYKLSQHDSKSMVAGLLT 476
            S+   K+ +        ++ I RD+  G+I  D++ + P++ Y LS  D K+++ G+  
Sbjct: 642 DSSSMLKEHLYNVKTWSCIIPILRDKNPGKIKLDKDHRSPKIVYNLSDEDYKNLLPGVEG 701

Query: 477 AVRILAAAGATKIGT---CQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQTCTG 533
           A+R L AAGA K        T++D   +E+ +  L   K+            P  Q    
Sbjct: 702 AIRALVAAGAKKFSVPIAGTTIVDSENLESYIKNLKSTKYK-----------PNKQAVL- 749

Query: 534 TIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAHYISK 593
           +  QM SCRMG + N S VN  GE+W+++ L++AD SVLP+A GV  M+T   +++ I++
Sbjct: 750 SAHQMGSCRMGSNKNNSVVNENGESWDMKKLFIADGSVLPSAVGVNPMITIYAVSYQIAQ 809

Query: 594 CIL 596
            IL
Sbjct: 810 SIL 812



>gi|300680945|sp|B5WWZ9.1|FAO2_LOTJA RecName: Full=Long-chain-alcohol oxidase FAO2; AltName:
           Full=Long-chain fatty alcohol oxidase 2
 gi|209570222|emb|CAP15763.1| long chain fatty alcohol oxidase FAO2 [Lotus japonicus]
          Length = 750

 Score =  263 bits (671), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 160/490 (32%), Positives = 252/490 (51%), Gaps = 26/490 (5%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+++EKG ++   D S+ +    ++LYE  G + + D  M +LAGS  GG + I WSA +
Sbjct: 264 VIILEKGEYFVSHDYSSLEGPSMNELYESGGILPSLDGKMMILAGSTLGGXSAINWSACI 323

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
                V  EW++   +P F   +Y +AM  +  R+G        +  NQ L  GC K+G 
Sbjct: 324 RTPDSVLREWSEKHKIPLFASPDYQSAMDTVCRRIGVTENCNKESFQNQILRQGCAKIGF 383

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKI---LI 301
             + +  N+ S  H CG C +GC+ G+K+    TWL +A  N A  L  C  EK+   L 
Sbjct: 384 KVEPVAINS-SADHYCGSCCYGCRTGDKKGTESTWLVDAVGNGAVILTGCKAEKLNFTLK 442

Query: 302 DKDGKSQKVMGVEVIINN------IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGR 355
           D D  +++     VI +        K+++I +K  + + G++ +P L++ SGLKN NIG+
Sbjct: 443 DGDNGTKRKTCSGVIASATWRSKVTKKLQIESKVTISACGSLSTPPLMISSGLKNPNIGK 502

Query: 356 NLHVHPIAAVYGVFP----NKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFM 411
           NLH+HP    +G FP    N     Y G I+++I    E          I   +  PG  
Sbjct: 503 NLHLHPCQFAWGYFPEDMTNFSGNNYEGGIITSIHKVFEEDSTSTPRIIIEAPALGPGSF 562

Query: 412 FANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMV 471
            A  PW S L  K+ M++Y     L  + RD   G +      + R+ YKL + D +S+ 
Sbjct: 563 SALVPWVSGLDVKERMVKYARTANLFALVRDHGSGEV----KAEGRISYKLDKIDRESLQ 618

Query: 472 AGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQTC 531
            GL  A+RIL AAGA ++GT ++  D   ++     + +   ++FL+ ++ VG P+ +  
Sbjct: 619 TGLRKALRILVAAGAVEVGTYRS--DGQRIK--CRGIKESDLEEFLDSVRVVGGPSSRNE 674

Query: 532 TGTI----EQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNI 587
             T+     QM+SCRM     + AV+  GE+WE + LYV D SVLP+A GV  M+T  + 
Sbjct: 675 VWTVFTSAHQMTSCRMSATEEEGAVDENGESWEAKGLYVCDGSVLPSAVGVNPMITIQST 734

Query: 588 AHYISKCILD 597
           A+ I+  I +
Sbjct: 735 AYCIASNIAE 744



>gi|219124515|ref|XP_002182547.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gi|217405893|gb|EEC45834.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
          Length = 786

 Score =  263 bits (671), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 192/603 (31%), Positives = 296/603 (49%), Gaps = 35/603 (5%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICA---TFWLNPYN-FNPVIGYPGA 69
           PF E    Q+        TS  A+ R+I+  F  LIC    ++ +N  N F   +GYPG 
Sbjct: 101 PFTEWPVPQQTALLQSLKTSSIATRRQIFNGFKRLICGLAYSYTVNGTNPFWKAVGYPGP 160

Query: 70  ---------DPEANGSRFSSRNFPKYNFLEISDHDSDIKEFDTXXXXXXXXXXXXXXRLA 120
                    +  A  ++   +  P    L   D D++  E D                L+
Sbjct: 161 AQNTLLSKREDTALVAKTMEQQRPIREALVPIDLDTEY-ECDIVIVGSGSGGSVAASVLS 219

Query: 121 RME-NVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIG 179
                VLV+EKG +    D+S E+ D  D++YE  G + T D +M +LAG+  GGGTTI 
Sbjct: 220 EAGYQVLVLEKGTYIAPADISNEEADALDRMYETHGLLTTKDGSMMILAGATLGGGTTIN 279

Query: 180 WSAFMEPQYFVREEWAKNFGL-PYFME-DEYGNAMKYINARLGTNTINIIHNQSNQTLIN 237
           WS  +    +VREEW    GL   F E  E+  + + I + +G  T  I HN  NQ L  
Sbjct: 280 WSCCLPLPSYVREEWRSEHGLVDDFKEGGEFETSTREILSLMGV-TNKITHNALNQKLQQ 338

Query: 238 GCKKLGLHSD----NIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKN 293
           GC  LG   +    N+ Q TA+ T   G+  FG +YG K+ A   +L +A S  AK ++ 
Sbjct: 339 GCDALGYEWEANYVNLLQ-TANAT--AGYICFGDRYGMKRGALSVFLPKAISYGAKLIEG 395

Query: 294 CYVEKILI-DKDGKSQKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKN 352
           C+VE++++ + +   ++  GV   +   +   +  K VVV+AGA+H+P LL RSGL N +
Sbjct: 396 CHVEQVILGEGENGRRRAEGVRCSVGAHRLHVVARKAVVVAAGALHTPCLLRRSGLNNSH 455

Query: 353 IGRNLHVHPIAAVYGVF-PNKEIKTYSGTIMSAISNA-TENVDGENYGAKIVVGSHHPGF 410
           IG++L +HP+    G   P   I+ Y G  ++ + N  +     + YGAKI   S H G 
Sbjct: 456 IGKHLRLHPVTVAAGFSKPTDPIECYQGAPLTTVCNQFSHGPANDGYGAKIECPSAHLGL 515

Query: 411 MFANFPWKSNLQHKQLMLEYNNIVPLMVITRDR-EGGRILTDENGKPRLEYKLSQHDSKS 469
           + A  PW +  Q K  ML   N V  +++ RD+ EG   L  +   P +EY +   D  S
Sbjct: 516 LAAGLPWTNPEQFKDRMLRIRNGVVFIIVQRDKGEGTVSLARDGATPVVEYSVCPADKVS 575

Query: 470 MVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQ 529
           M   +   VRI  A+ +T++ T  ++ +   + +G          ++L+K   +G+   +
Sbjct: 576 MQQAVCGGVRICIASESTEVTTAHSLDEGMHISDG------DFLQEYLSKFTALGLKENE 629

Query: 530 TCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAH 589
               +  QM SCR+   P   A++P GE WE ++LYV D+S  PTA+G   M+T M I+ 
Sbjct: 630 VALFSAHQMGSCRLSATPLSGALDPNGEVWESDDLYVMDASTFPTASGANPMITVMAISL 689

Query: 590 YIS 592
            +S
Sbjct: 690 MLS 692



>gi|255577920|ref|XP_002529832.1| electron carrier, putative [Ricinus communis]
 gi|223530660|gb|EEF32533.1| electron carrier, putative [Ricinus communis]
          Length = 745

 Score =  263 bits (671), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 158/489 (32%), Positives = 264/489 (53%), Gaps = 25/489 (5%)

Query: 123 ENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSA 182
           + VLV+EKG+++   D S+ +     +LYE  G + T +  + +LAGS  GGG+ I WSA
Sbjct: 262 QKVLVLEKGNYFVPEDYSSVEGPSMAELYESGGFLPTLNGKIMILAGSTVGGGSAINWSA 321

Query: 183 FMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKL 242
            ++    V +EW  ++ +P F   +Y  AM  +  R+G           NQ L  GC+ L
Sbjct: 322 CIKTPDTVLKEWCVDYRIPLFGSPDYHYAMDVVQKRIGVTDNCSNEGFQNQVLRRGCENL 381

Query: 243 GLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILID 302
           GL  D++P+N+ S  H CG C +GC+ G+K+    TWL +A  + A  L     EK +++
Sbjct: 382 GLKVDSVPRNS-SADHYCGSCCYGCRTGDKKGTDSTWLVDAVGSGAVILTGTRAEKFILE 440

Query: 303 KD--GKSQK-VMGVEVIINN---IKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRN 356
           +D  G+S+K  +GV    +N    K+++I A+  + + G++ +P L++ SGL N NIGRN
Sbjct: 441 EDHSGRSRKRCIGVIAKTSNTNVTKKLQIEARATISACGSLLTPPLMISSGLANPNIGRN 500

Query: 357 LHVHPIAAVYGVFP----NKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMF 412
           LH+HP+   +G FP    +   K Y G I++++       +     A +   +  P    
Sbjct: 501 LHLHPVIMAWGYFPEHISDLSGKIYEGGIITSVHKVVS--EESKVCAILEAPALGPASYA 558

Query: 413 ANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVA 472
           A  PW S    K  M++Y     L  + RD+  G +  ++    ++++++S+ D++++  
Sbjct: 559 ALSPWVSGQDFKDKMVKYARTANLFALIRDQGSGEVKLEK----KIKHRMSRSDNENLRI 614

Query: 473 GLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPT----Y 528
           GL  A+RIL  AGA ++GT ++  D   +E     + +   ++FL+ +   G  T    Y
Sbjct: 615 GLRQALRILVGAGAVEVGTYRS--DGQRIE--CKGVKETDLEEFLDTVTASGGLTSKEEY 670

Query: 529 QTCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIA 588
                +  QMSSCRMG    + AV+  GE+WE +NL+V D S+LP+A G+  M+T  + A
Sbjct: 671 WNMLFSAHQMSSCRMGATEEEGAVDENGESWEAKNLFVCDGSILPSAVGINPMITIQSTA 730

Query: 589 HYISKCILD 597
           + ISK I +
Sbjct: 731 YCISKRIAE 739



>gi|442736185|gb|AGC65582.1| fatty alcohol oxidase [Simmondsia chinensis]
          Length = 721

 Score =  261 bits (667), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 165/486 (33%), Positives = 254/486 (52%), Gaps = 25/486 (5%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTD-DSNMYVLAGSNFGGGTTIGWSAF 183
           VLVIEKG+++   D S+ +    D+LY +SGGMLT  D  M + +GS  GGG+ I WSA 
Sbjct: 236 VLVIEKGNYFAPGDYSSLEGPSLDELY-VSGGMLTTLDGKMLLFSGSTVGGGSAINWSAS 294

Query: 184 MEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLG 243
           +     V +EW+ N  LP F   +Y  AM  +  R+G           NQ L  GC+ LG
Sbjct: 295 IRTPDPVIKEWSVNHRLPIFNSSDYRLAMDEVCKRIGVTEKCTEEGFQNQVLRQGCENLG 354

Query: 244 LHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILID- 302
           L  + +P+N++   H CG C++GC+ G+K+    TWL +A  + A  L  C  EK +++ 
Sbjct: 355 LEVEKVPRNSSE-NHYCGSCTYGCRLGDKKGTDTTWLVDAVEHGAVVLTGCKAEKFVLED 413

Query: 303 -KDG-KSQKVMGVEVII---NNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRNL 357
            K G + +K  G+   +   N  K+++I A+  + + G++ +P LL  SGL+N NIG NL
Sbjct: 414 VKTGTRKKKCTGIIAAVSDKNVTKKLQIEARVSISACGSVLTPPLLKSSGLRNPNIGANL 473

Query: 358 HVHPIAAVYGVFPNK----EIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFA 413
           H+HP+   +G FP      + K++ G I++++   T + +  N  A I      P    +
Sbjct: 474 HLHPVLLAWGYFPESANSVKGKSFEGGIITSLHKVTSDPEKRNIHAIIEAPGLGPAAFSS 533

Query: 414 NFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVAG 473
             PW S    K+ M++Y+    L  + RD+  G   +   GK  + +K    D +++  G
Sbjct: 534 LIPWVSGRDMKERMVKYDRTANLFALVRDQSTGE--SQRRGKDSISFK--DFDKQNLKIG 589

Query: 474 LLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQT--- 530
           L   +RIL AAGA ++GT ++     +   GV      + ++FL+ +   G P  +T   
Sbjct: 590 LRQCLRILIAAGAAEVGTYRS-DGQRMRCKGVKA---GELEEFLDTVIAPGGPRSRTEEW 645

Query: 531 -CTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNIAH 589
               +  QM S RMGD      V+  GE+WE E LYV D S LPTA GV  M+T  + A+
Sbjct: 646 PIYASALQMGSFRMGDAAETGPVDSNGESWEPEGLYVCDGSFLPTAFGVNPMITIQSTAY 705

Query: 590 YISKCI 595
            IS  I
Sbjct: 706 CISSAI 711



>gi|465794907|emb|CCU99594.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 611

 Score =  260 bits (665), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 156/471 (33%), Positives = 244/471 (51%), Gaps = 25/471 (5%)

Query: 14  PFHELTQKQREHTFIKWSTSQYASVRKIYKSFTMLICATFWLNPYNFNPVIGYPGAD--- 70
           P  EL  +      I+W  +    +R        +    F+ +    N  +GYP      
Sbjct: 118 PVWELDARTIAQALIRWRDAPIELLRLGQFGLCGVTMIVFYRHMERANAALGYPTGPSDG 177

Query: 71  ---PEANGSRFSSRNFPKYNFLEISD----HDSD---IKEFDTXXXXXXXXXXXXXXRLA 120
              P   G +      P Y F  ++D      SD   + E D                LA
Sbjct: 178 WKHPPGAGPQEPK---PHYAFSFLNDTLPRERSDTPVVWEADVVIVGSGCGGAVVAAYLA 234

Query: 121 -RMENVLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIG 179
            R   V+V++KG +    D+   Q    ++++E  G + T + ++ VLAGS +GGG+TI 
Sbjct: 235 ERGLRVIVVDKGLYVRPEDMPMTQDFAMEQMFERLGFVPTSNLSLAVLAGSGWGGGSTIN 294

Query: 180 WSAFMEPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGC 239
           WSA +EP+++VR  WA  +G+PYF   E+   ++    R+GT T  I HN++N  L+ G 
Sbjct: 295 WSATLEPRHYVRHAWATQYGVPYFRSSEFAQDLRSCAQRMGTTT-QIQHNKANSLLLLGG 353

Query: 240 KKLGLHSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKI 299
           ++ G     +PQN     H CG C FGC  G KQS  MTWL +A  + A+F+ +C +E++
Sbjct: 354 QRSGQPVATVPQNNGDTLHYCGQCHFGCPSGHKQSTVMTWLRDAAEHGAQFVVHCDIERV 413

Query: 300 LIDKDGKSQKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSG-LK-NKNIGRNL 357
           L++  G++  V+G    +   + V    K V VSAG+I++PA+LLR+  L+ N+ IG +L
Sbjct: 414 LVE-GGQATGVVGA---VRGQRVVIKGTKAVAVSAGSINTPAILLRTPELRVNRQIGEHL 469

Query: 358 HVHPIAAVYGVFPNKEIKTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMFANFPW 417
           H+HP+A V+G F  + I  + G I+S++SNA E VD   +GA+I +    P    A  P+
Sbjct: 470 HLHPVAFVHG-FYEQPIDPWKGPILSSVSNAAELVDPSGWGARIEIMVSAPSLFCALLPF 528

Query: 418 KSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSK 468
              LQHK++   Y     ++VI RDR+ GR+  D+ G+  L+Y LS+ D K
Sbjct: 529 DGALQHKKVAARYRYGFTMIVIVRDRDAGRVRLDKYGRALLDYSLSKFDEK 579



>gi|125532340|gb|EAY78905.1| hypothetical protein OsI_34008 [Oryza sativa Indica Group]
          Length = 564

 Score =  260 bits (665), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 162/490 (33%), Positives = 253/490 (51%), Gaps = 33/490 (6%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG ++   D S+ +    ++LYE  G   T +    + AG+  GGG+ + WSA +
Sbjct: 66  VVVVEKGDYFAARDYSSLEGPTMERLYENGGVFSTANVTTTMFAGATVGGGSAVNWSACI 125

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
                V +EW+ + GLP F    Y  AM  + ARLG           N+ +  GC+ LGL
Sbjct: 126 RTPANVLQEWSNDHGLPLFGGQGYVQAMDAVCARLGVTGRCREEGFQNKAVRRGCEALGL 185

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD 304
             + + +N+ S  H CG C+ GC  GEK+    TWL +A    A  L  C  E+ +++ +
Sbjct: 186 RVEAVSRNS-SEGHFCGSCNLGCPTGEKRGTDTTWLVDAVGRGAVILTGCKAERFILETN 244

Query: 305 -----GKSQKVMGV--EVIINNI-KRVKIHAKRVVVSAGAIHSPALLLRSGLKNKNIGRN 356
                G+ +K +GV  + + N I K+++I AK  V + GA+ +P LL  SGLKN++IGRN
Sbjct: 245 TGGGGGRRKKCVGVVAKCLGNGITKKLRIEAKVSVSACGALMTPPLLRNSGLKNRHIGRN 304

Query: 357 LHVHPIAAVYGVFPNKEI----KTYSGTIMSAISNATENVDGENYGAKIVVGSHHPGFMF 412
           LH+HP++  +G FP+       K+Y G I++++   T+          I   +  PG   
Sbjct: 305 LHLHPVSMAWGYFPDSTAELPGKSYEGGIITSMHRVTDRT-------IIETPALGPGAFA 357

Query: 413 ANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSKSMVA 472
           A  PW+S    K+ M  Y      +V+ RDR  G +     G+ R+ +  S+ D+  + A
Sbjct: 358 AVVPWESGRDMKERMRRYARTAHAVVLVRDRAAGTV----GGEGRVRFTPSRGDAGELRA 413

Query: 473 GLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTYQ--- 529
           GL  A+RIL AAGA ++GT ++  D   +        D   + FL+++     P +    
Sbjct: 414 GLRRALRILVAAGAAEVGTNRS--DGLRLR--CKGARDEDVEAFLDEVSVEKGPMHPGSD 469

Query: 530 --TCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMTTMNI 587
                 +  QM SCRMG       V+  GE+WE E LYV D S+LPTA GV  M+T  ++
Sbjct: 470 KWALLASAHQMGSCRMGRSAKHGGVDGGGESWEAEGLYVCDGSLLPTAVGVNPMITIESV 529

Query: 588 AHYISKCILD 597
           A+ ++K I +
Sbjct: 530 AYCVAKGIAE 539



>gi|110289242|gb|AAP54248.2| GMC oxidoreductase family protein, expressed [Oryza sativa Japonica
           Group]
          Length = 784

 Score =  260 bits (664), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 159/494 (32%), Positives = 247/494 (50%), Gaps = 41/494 (8%)

Query: 125 VLVIEKGHHYDQCDLSTEQQDGYDKLYELSGGMLTDDSNMYVLAGSNFGGGTTIGWSAFM 184
           V+V+EKG ++   D S+ +    ++LYE  G   T +    + AG+  GGG+ + WSA +
Sbjct: 286 VVVVEKGDYFAARDYSSLEGPTMERLYENGGVFSTANVTTTMFAGATVGGGSAVNWSACI 345

Query: 185 EPQYFVREEWAKNFGLPYFMEDEYGNAMKYINARLGTNTINIIHNQSNQTLINGCKKLGL 244
                V +EW+ + GLP F    Y  AM  + ARLG           N+ +  GC+ LGL
Sbjct: 346 RTPANVLQEWSNDHGLPLFGGQGYVQAMDAVCARLGVTGRCREEGFQNKAVRRGCEALGL 405

Query: 245 HSDNIPQNTASITHQCGWCSFGCKYGEKQSATMTWLNEAKSNNAKFLKNCYVEKILIDKD 304
             + + +N+ S  H CG C+ GC  GEK+    TWL +A    A  L  C  E+ +++ +
Sbjct: 406 RVEAVSRNS-SEGHFCGSCNLGCPTGEKRGTDTTWLVDAVGRGAVILTGCKAERFILETN 464

Query: 305 ------------GKSQKVMGVEVIINNIKRVKIHAKRVVVSAGAIHSPALLLRSGLKNKN 352
                       G   K +G  +     K+++I AK  V + GA+ +P LL  SGLKN++
Sbjct: 465 TGGGGGRRKKCVGVVAKCLGKGI----TKKLRIEAKVSVSACGALMTPPLLRNSGLKNRH 520

Query: 353 IGRNLHVHPIAAVYGVFPNKEI----KTYSGTIMSAISNATENVDGENYGAKIVVGSHHP 408
           IGRNLH+HP++  +G FP+       K+Y G I++++   T+          I   +  P
Sbjct: 521 IGRNLHLHPVSMAWGYFPDSTAELPGKSYEGGIITSMHRVTDRT-------IIETPALGP 573

Query: 409 GFMFANFPWKSNLQHKQLMLEYNNIVPLMVITRDREGGRILTDENGKPRLEYKLSQHDSK 468
           G   A  PW+S    K+ M  Y      +V+ RDR  G +     G+ R+ +  S+ D+ 
Sbjct: 574 GAFAAVVPWESGRDMKERMRRYARTAHAVVLVRDRAAGTV----GGEGRVRFTPSRGDAG 629

Query: 469 SMVAGLLTAVRILAAAGATKIGTCQTVIDDYIVENGVNPLNDPKFDQFLNKIKKVGIPTY 528
            + AGL  A+RIL AAGA ++GT ++  D   +        D   + FL+++     P +
Sbjct: 630 ELRAGLRRALRILVAAGAAEVGTNRS--DGLRLR--CKGARDEDVEAFLDEVSVEKGPMH 685

Query: 529 Q-----TCTGTIEQMSSCRMGDDPNKSAVNPVGEAWEVENLYVADSSVLPTATGVPSMMT 583
                     +  QM SCRMG       V+  GE+WE E LYV D S+LPTA GV  M+T
Sbjct: 686 PGSDKWALLASAHQMGSCRMGRSAKHGGVDGGGESWEAEGLYVCDGSLLPTAVGVNPMIT 745

Query: 584 TMNIAHYISKCILD 597
             ++A+ ++K I +
Sbjct: 746 IESVAYCVAKGIAE 759