BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
BLASTP 2.2.25 [Feb-01-2011]
Query= comp10274_c0_seq1-m.102 complete 15-608(-) 198 (-)
         (197 letters)

Database: All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samples
from WGS projects 
           26,682,258 sequences; 9,281,362,451 total letters

Searching..................................................done



                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

gi|511004607|gb|EPB85972.1| hypothetical protein HMPREF1544_0721...   163   2e-38   Mucor circinelloides f. circinelloides 1006PhL
gi|336366769|gb|EGN95115.1| hypothetical protein SERLA73DRAFT_61...   145   7e-33   Serpula lacrymans var. lacrymans S7.3
gi|384496658|gb|EIE87149.1| hypothetical protein RO3G_11860 [Rhi...   144   1e-32   Rhizopus delemar RA 99-880
gi|471899310|emb|CCO30444.1| Translocation protein sec72 [Rhizoc...   135   5e-30   Rhizoctonia solani AG-1 IB
gi|403415884|emb|CCM02584.1| predicted protein [Fibroporia radic...   134   9e-30   Fibroporia radiculosa
gi|392575575|gb|EIW68708.1| hypothetical protein TREMEDRAFT_2369...   134   1e-29   Tremella mesenterica DSM 1558
gi|169850029|ref|XP_001831712.1| hypothetical protein CC1G_08316...   132   5e-29   Coprinopsis cinerea okayama7#130
gi|343425500|emb|CBQ69035.1| conserved hypothetical protein [Spo...   131   8e-29   Sporisorium reilianum SRZ2
gi|511011092|gb|EPB92306.1| hypothetical protein HMPREF1544_0087...   130   2e-28   Mucor circinelloides f. circinelloides 1006PhL
gi|443900336|dbj|GAC77662.1| molecular co-chaperone STI1 [Pseudo...   129   3e-28   Moesziomyces antarcticus T-34
gi|71021043|ref|XP_760752.1| hypothetical protein UM04605.1 [Ust...   128   8e-28   
gi|170104944|ref|XP_001883685.1| predicted protein [Laccaria bic...   127   1e-27   Laccaria bicolor S238N-H82
gi|501305678|dbj|GAC94800.1| hypothetical protein PHSY_002373 [P...   127   1e-27   Pseudozyma hubeiensis SY62
gi|388857789|emb|CCF48683.1| uncharacterized protein [Ustilago h...   123   3e-26   Ustilago hordei
gi|270358694|gb|ACZ81483.1| CND01540 [Kwoniella heveanensis]          121   9e-26   Kwoniella heveanensis
gi|358054856|dbj|GAA99069.1| hypothetical protein E5Q_05758 [Mix...   118   8e-25   Mixia osmundae IAM 14324
gi|470319011|gb|EMR10652.1| hypothetical protein PNEG_01351 [Pne...   117   1e-24   Pneumocystis murina B123
gi|321257190|ref|XP_003193502.1| hypothetical protein CGB_D3750C...   116   3e-24   Cryptococcus gattii WM276
gi|393222159|gb|EJD07643.1| hypothetical protein FOMMEDRAFT_4018...   116   3e-24   Fomitiporia mediterranea MF3/22
gi|328857032|gb|EGG06150.1| hypothetical protein MELLADRAFT_8729...   115   8e-24   Melampsora larici-populina 98AG31
gi|505757075|gb|EOR01209.1| Translocation protein sec72 [Wallemi...   115   8e-24   Wallemia ichthyophaga EXF-994
gi|58266252|ref|XP_570282.1| hypothetical protein [Cryptococcus ...   114   1e-23   Cryptococcus neoformans var. neoformans JEC21
gi|405120352|gb|AFR95123.1| hypothetical protein CNAG_01024 [Cry...   114   2e-23   Cryptococcus neoformans var. grubii H99
gi|345565757|gb|EGX48705.1| hypothetical protein AOL_s00079g344 ...   114   2e-23   Arthrobotrys oligospora ATCC 24927
gi|465794201|emb|CCU99031.1| unnamed protein product [Malassezia...   113   3e-23   Malassezia sympodialis ATCC 42132
gi|430812877|emb|CCJ29746.1| unnamed protein product [Pneumocyst...   112   4e-23   Pneumocystis jirovecii
gi|302687240|ref|XP_003033300.1| hypothetical protein SCHCODRAFT...   112   4e-23   Schizophyllum commune H4-8
gi|226291093|gb|EEH46521.1| tetratricopeptide repeat domain-cont...   110   1e-22   Paracoccidioides brasiliensis Pb18
gi|225679372|gb|EEH17656.1| conserved hypothetical protein [Para...   110   2e-22   Paracoccidioides brasiliensis Pb03
gi|295665604|ref|XP_002793353.1| tetratricopeptide repeat domain...   108   7e-22   
gi|391871506|gb|EIT80666.1| chaperone binding protein, putative ...   108   7e-22   Aspergillus oryzae 3.042
gi|296418135|ref|XP_002838697.1| hypothetical protein [Tuber mel...   108   8e-22   Tuber melanosporum Mel28
gi|169777379|ref|XP_001823155.1| tetratricopeptide repeat domain...   107   2e-21   Aspergillus oryzae RIB40
gi|440639563|gb|ELR09482.1| hypothetical protein GMDG_00664 [Geo...   107   2e-21   Pseudogymnoascus destructans 20631-21
gi|472580658|gb|EMS18442.1| translocation protein SEC72 [Rhodosp...   106   4e-21   Rhodotorula toruloides NP11
gi|342319428|gb|EGU11377.1| hypothetical protein RTG_02879 [Rhod...   106   4e-21   Rhodotorula toruloides ATCC 204091
gi|164658952|ref|XP_001730601.1| hypothetical protein MGL_2397 [...   105   4e-21   Malassezia globosa CBS 7966
gi|331216407|ref|XP_003320883.1| hypothetical protein PGTG_02905...   105   4e-21   Puccinia graminis f. sp. tritici CRL 75-36-700-3
gi|336264203|ref|XP_003346880.1| hypothetical protein SMAC_05140...   105   6e-21   Sordaria macrospora k-hell
gi|238494508|ref|XP_002378490.1| chaperone binding protein, puta...   105   6e-21   Aspergillus flavus NRRL3357
gi|389625349|ref|XP_003710328.1| tetratricopeptide repeat domain...   105   7e-21   Magnaporthe oryzae 70-15
gi|322708489|gb|EFZ00067.1| tetratricopeptide repeat domain cont...   105   7e-21   Metarhizium robertsii ARSEF 23
gi|501754086|emb|CCG82381.1| Translocation protein sec72 [Taphri...   103   2e-20   Taphrina deformans PYCC 5710
gi|115437864|ref|XP_001217919.1| conserved hypothetical protein ...   103   2e-20   Aspergillus terreus NIH2624
gi|330918887|ref|XP_003298382.1| hypothetical protein PTT_09102 ...   103   2e-20   Pyrenophora teres f. teres 0-1
gi|336473436|gb|EGO61596.1| hypothetical protein NEUTE1DRAFT_108...   102   4e-20   Neurospora tetrasperma FGSC 2508
gi|367025323|ref|XP_003661946.1| hypothetical protein MYCTH_2314...   102   5e-20   Myceliophthora thermophila ATCC 42464
gi|259483954|tpe|CBF79766.1| TPA: conserved hypothetical protein...   101   1e-19   Aspergillus nidulans FGSC A4
gi|50549901|ref|XP_502422.1| YALI0D04895p [Yarrowia lipolytica] ...   100   1e-19   Yarrowia lipolytica CLIB122
gi|512206757|gb|EPE35576.1| TPR-like protein [Glarea lozoyensis ...   100   1e-19   Glarea lozoyensis ATCC 20868
gi|340905162|gb|EGS17530.1| hypothetical protein CTHT_0068610 [C...   100   1e-19   Chaetomium thermophilum var. thermophilum DSM 1495
gi|67901272|ref|XP_680892.1| hypothetical protein AN7623.2 [Aspe...   100   2e-19   Aspergillus nidulans FGSC A4
gi|85090693|ref|XP_958539.1| hypothetical protein NCU07746 [Neur...   100   2e-19   Neurospora crassa OR74A
gi|358381798|gb|EHK19472.1| hypothetical protein TRIVIDRAFT_1816...   100   2e-19   Trichoderma virens Gv29-8
gi|303321135|ref|XP_003070562.1| tetratricopeptide repeat domain...   100   2e-19   Coccidioides posadasii C735 delta SOWgp
gi|399169321|emb|CCE29839.1| related to translocation protein [C...   100   2e-19   Claviceps purpurea 20.1
gi|119479913|ref|XP_001259985.1| tetratricopeptide repeat domain...   100   3e-19   Aspergillus fischeri NRRL 181
gi|322696558|gb|EFY88348.1| tetratricopeptide repeat domain cont...   100   3e-19   Metarhizium acridum CQMa 102
gi|340514498|gb|EGR44760.1| translocation protein SEC72 [Trichod...    99   4e-19   Trichoderma reesei QM6a
gi|396494528|ref|XP_003844325.1| hypothetical protein LEMA_P0197...    99   5e-19   Leptosphaeria maculans JN3
gi|402081460|gb|EJT76605.1| tetratricopeptide repeat domain-cont...    99   5e-19   Gaeumannomyces graminis var. tritici R3-111a-1
gi|119180058|ref|XP_001241536.1| hypothetical protein CIMG_08699...    99   5e-19   Coccidioides immitis RS
gi|169624116|ref|XP_001805464.1| hypothetical protein SNOG_15310...    99   6e-19   Parastagonospora nodorum SN15
gi|70998432|ref|XP_753938.1| conserved hypothetical protein [Asp...    99   6e-19   Aspergillus fumigatus Af293
gi|471567477|gb|EMR67435.1| putative translocation protein sec72...    99   7e-19   Eutypa lata UCREL1
gi|255949276|ref|XP_002565405.1| Pc22g14850 [Penicillium chrysog...    99   8e-19   Penicillium rubens Wisconsin 54-1255
gi|189190512|ref|XP_001931595.1| tetratricopeptide repeat domain...    98   9e-19   Pyrenophora tritici-repentis Pt-1C-BFP
gi|452000151|gb|EMD92613.1| hypothetical protein COCHEDRAFT_1224...    98   1e-18   Bipolaris maydis C5
gi|406698438|gb|EKD01675.1| hypothetical protein A1Q2_04046 [Tri...    97   2e-18   Trichosporon asahii var. asahii CBS 8904
gi|302897605|ref|XP_003047679.1| predicted protein [Nectria haem...    97   2e-18   Nectria haematococca mpVI 77-13-4
gi|154316101|ref|XP_001557372.1| hypothetical protein BC1G_03635...    97   2e-18   Botrytis cinerea B05.10
gi|482812505|gb|EOA89224.1| hypothetical protein SETTUDRAFT_1054...    97   2e-18   Setosphaeria turcica Et28A
gi|451854238|gb|EMD67531.1| hypothetical protein COCSADRAFT_2901...    97   2e-18   Bipolaris sorokiniana ND90Pr
gi|367038253|ref|XP_003649507.1| hypothetical protein THITE_2108...    97   2e-18   Thielavia terrestris NRRL 8126
gi|358400157|gb|EHK49488.1| hypothetical protein TRIATDRAFT_2548...    97   3e-18   Trichoderma atroviride IMI 206040
gi|358376357|dbj|GAA92917.1| chaperone binding protein [Aspergil...    96   4e-18   Aspergillus kawachii IFO 4308
gi|407916872|gb|EKG10202.1| Tetratricopeptide-like helical [Macr...    96   5e-18   Macrophomina phaseolina MS6
gi|406859969|gb|EKD13030.1| tetratricopeptide repeat domain cont...    96   5e-18   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
gi|240275637|gb|EER39151.1| F-box protein [Ajellomyces capsulatu...    96   5e-18   Histoplasma capsulatum H143
gi|485926295|gb|EOD50592.1| putative translocation protein sec72...    96   5e-18   Neofusicoccum parvum UCRNP2
gi|225562029|gb|EEH10309.1| F-box domain-containing protein [Aje...    96   6e-18   Histoplasma capsulatum G186AR
gi|121712808|ref|XP_001274015.1| F-box domain protein [Aspergill...    96   6e-18   Aspergillus clavatus NRRL 1
gi|346319419|gb|EGX89021.1| tetratricopeptide repeat domain cont...    96   6e-18   Cordyceps militaris CM01
gi|156037464|ref|XP_001586459.1| hypothetical protein SS1G_12445...    96   7e-18   Sclerotinia sclerotiorum 1980 UF-70
gi|242818055|ref|XP_002487051.1| conserved hypothetical protein ...    95   8e-18   Talaromyces stipitatus ATCC 10500
gi|494830054|gb|EON66623.1| hypothetical protein W97_05869 [Coni...    95   8e-18   Coniosporium apollinis CBS 100218
gi|342877687|gb|EGU79133.1| hypothetical protein FOXB_10371 [Fus...    95   9e-18   Fusarium oxysporum Fo5176
gi|154283823|ref|XP_001542707.1| predicted protein [Ajellomyces ...    95   9e-18   Histoplasma capsulatum NAm1
gi|134083805|emb|CAK47138.1| unnamed protein product [Aspergillu...    95   1e-17   Aspergillus niger
gi|408400128|gb|EKJ79213.1| hypothetical protein FPSE_00524 [Fus...    95   1e-17   Fusarium pseudograminearum CS3096
gi|261197732|ref|XP_002625268.1| tetratricopeptide repeat domain...    95   1e-17   Blastomyces gilchristii SLH14081
gi|213408615|ref|XP_002175078.1| translocation protein sec72 [Sc...    94   1e-17   Schizosaccharomyces japonicus yFS275
gi|254568490|ref|XP_002491355.1| Non-essential subunit of Sec63 ...    94   2e-17   Komagataella phaffii GS115
gi|500255311|gb|EON98705.1| putative translocation protein sec72...    94   2e-17   Phaeoacremonium minimum UCRPA7
gi|346972603|gb|EGY16055.1| translocation protein sec72 [Vertici...    94   3e-17   Verticillium dahliae VdLs.17
gi|46110437|ref|XP_382276.1| hypothetical protein FG02100.1 [Fus...    93   3e-17   
gi|302405479|ref|XP_003000576.1| translocation protein sec72 [Ve...    93   3e-17   Verticillium alfalfae VaMs.102
gi|452841662|gb|EME43599.1| hypothetical protein DOTSEDRAFT_7283...    93   3e-17   Dothistroma septosporum NZE10
gi|400593954|gb|EJP61840.1| translocation protein sec72 [Beauver...    93   3e-17   Beauveria bassiana ARSEF 2860
gi|398394142|ref|XP_003850530.1| hypothetical protein MYCGRDRAFT...    93   4e-17   Zymoseptoria tritici IPO323
gi|19115293|ref|NP_594381.1| ER protein translocation subcomplex...    93   4e-17   Schizosaccharomyces pombe 972h-
gi|429856717|gb|ELA31614.1| tetratricopeptide repeat domain cont...    93   4e-17   Colletotrichum gloeosporioides Nara gc5
gi|317036866|ref|XP_001398239.2| tetratricopeptide repeat domain...    92   5e-17   Aspergillus niger CBS 513.88
gi|350633932|gb|EHA22296.1| hypothetical protein ASPNIDRAFT_2043...    92   5e-17   Aspergillus niger ATCC 1015
gi|320588095|gb|EFX00570.1| tetratricopeptide repeat domain cont...    92   6e-17   Grosmannia clavigera kw1407
gi|425776093|gb|EKV14328.1| hypothetical protein PDIG_33440 [Pen...    92   6e-17   Penicillium digitatum PHI26
gi|212530652|ref|XP_002145483.1| conserved hypothetical protein ...    92   9e-17   Talaromyces marneffei ATCC 18224
gi|310790271|gb|EFQ25804.1| tetratricopeptide [Glomerella gramin...    91   1e-16   Colletotrichum graminicola M1.001
gi|171692493|ref|XP_001911171.1| hypothetical protein [Podospora...    91   2e-16   Podospora anserina S mat+
gi|353240327|emb|CCA72201.1| hypothetical protein PIIN_06136 [Pi...    91   2e-16   Serendipita indica DSM 11827
gi|477535889|gb|ENH87387.1| tetratricopeptide repeat domain cont...    91   2e-16   Colletotrichum orbiculare MAFF 240422
gi|116198451|ref|XP_001225037.1| hypothetical protein CHGG_07381...    90   2e-16   Chaetomium globosum CBS 148.51
gi|512192821|gb|EPE08579.1| translocation protein sec72 [Ophiost...    90   2e-16   Ophiostoma piceae UAMH 11346
gi|380490737|emb|CCF35807.1| tetratricopeptide [Colletotrichum h...    89   4e-16   Colletotrichum higginsianum
gi|425773829|gb|EKV12155.1| hypothetical protein PDIP_53020 [Pen...    89   5e-16   Penicillium digitatum Pd1
gi|452982492|gb|EME82251.1| hypothetical protein MYCFIDRAFT_4744...    89   6e-16   Cercospora fijiensis CIRAD86
gi|409994629|gb|AFV50602.1| heat shock 90/70 organizing protein ...    89   8e-16   Frankliniella occidentalis
gi|302657621|ref|XP_003020529.1| hypothetical protein TRV_05383 ...    89   8e-16   Trichophyton verrucosum HKI 0517
gi|302510379|ref|XP_003017141.1| hypothetical protein ARB_04017 ...    88   1e-15   Arthroderma benhamiae CBS 112371
gi|258577973|ref|XP_002543168.1| conserved hypothetical protein ...    88   1e-15   Uncinocarpus reesii 1704
gi|465793966|emb|CCU98864.1| unnamed protein product [Malassezia...    87   2e-15   Malassezia sympodialis ATCC 42132
gi|453084224|gb|EMF12269.1| hypothetical protein SEPMUDRAFT_1265...    87   3e-15   Sphaerulina musiva SO2202
gi|357617437|gb|EHJ70789.1| Hsc70/Hsp90-organizing protein HOP [...    86   4e-15   Danaus plexippus [American monarch]
gi|296809307|ref|XP_002844992.1| translocation protein sec72 [Ar...    86   6e-15   Arthroderma otae CBS 113480
gi|326468511|gb|EGD92520.1| tetratricopeptide repeat domain-cont...    86   6e-15   Trichophyton tonsurans CBS 112818
gi|322786074|gb|EFZ12685.1| hypothetical protein SINV_09553 [Sol...    85   8e-15   Solenopsis invicta [imported red fire ant]
gi|315048195|ref|XP_003173472.1| translocation protein sec72 [Ar...    85   9e-15   Microsporum gypseum CBS 118893
gi|443924376|gb|ELU43401.1| TPR_2 domain-containing protein [Rhi...    84   1e-14   Rhizoctonia solani AG-1 IA
gi|198437400|ref|XP_002128875.1| PREDICTED: stress-induced-phosp...    84   1e-14   Ciona intestinalis [sea vase]
gi|164656411|ref|XP_001729333.1| hypothetical protein MGL_3368 [...    84   1e-14   Malassezia globosa CBS 7966
gi|327300507|ref|XP_003234946.1| tetratricopeptide repeat domain...    84   2e-14   Trichophyton rubrum CBS 118892
gi|320580750|gb|EFW94972.1| Non-essential subunit of Sec63 compl...    83   3e-14   
gi|332025474|gb|EGI65638.1| Stress-induced-phosphoprotein 1 [Acr...    83   4e-14   Acromyrmex echinatior
gi|449301690|gb|EMC97701.1| hypothetical protein BAUCODRAFT_6799...    82   6e-14   Baudoinia panamericana UAMH 10762
gi|470519333|ref|XP_004353457.1| stressinducible protein STI1-li...    82   9e-14   Acanthamoeba castellanii str. Neff
gi|388854011|emb|CCF52355.1| probable STI1-Hsp90 cochaperone [Us...    81   1e-13   Ustilago hordei
gi|507575386|ref|XP_004671238.1| PREDICTED: small glutamine-rich...    81   1e-13   Jaculus jaculus
gi|512810002|ref|XP_002934237.2| PREDICTED: small glutamine-rich...    81   1e-13   Xenopus tropicalis [western clawed frog]
gi|146078042|ref|XP_001463435.1| stress-induced protein sti1 [Le...    81   1e-13   Leishmania infantum JPCM5
gi|501303734|dbj|GAC93147.1| hypothetical protein PHSY_000710 [P...    80   2e-13   Pseudozyma hubeiensis SY62
gi|326530590|dbj|BAK01093.1| predicted protein [Hordeum vulgare ...    80   2e-13   Hordeum vulgare subsp. vulgare [barley]
gi|308804756|ref|XP_003079690.1| stress-induced protein sti1-lik...    80   3e-13   Ostreococcus tauri
gi|1698880|gb|AAB37318.1| protein antigen LmSTI1 [Leishmania major]    80   3e-13   Leishmania major
gi|157864863|ref|XP_001681140.1| stress-induced protein sti1 [Le...    80   4e-13   Leishmania major strain Friedlin
gi|401416334|ref|XP_003872662.1| stress-induced protein sti1 [Le...    80   4e-13   Leishmania mexicana MHOM/GT/2001/U1103
gi|68486711|ref|XP_712784.1| hypothetical protein CaO19.11656 [C...    80   4e-13   Candida albicans SC5314
gi|50345104|ref|NP_001002225.1| small glutamine-rich tetratricop...    79   5e-13   
gi|71008353|ref|XP_758204.1| hypothetical protein UM02057.1 [Ust...    79   6e-13   
gi|58258211|ref|XP_566518.1| chaperone [Cryptococcus neoformans ...    79   6e-13   Cryptococcus neoformans var. neoformans JEC21
gi|66801325|ref|XP_629588.1| tetratricopeptide-like helical doma...    79   6e-13   Dictyostelium discoideum AX4
gi|241954038|ref|XP_002419740.1| subunit of the secretory polype...    79   6e-13   Candida dubliniensis CD36
gi|154332657|ref|XP_001562145.1| stress-induced protein sti1 [Le...    79   6e-13   Leishmania braziliensis MHOM/BR/75/M2904
gi|405117462|gb|AFR92237.1| chaperone [Cryptococcus neoformans v...    79   7e-13   Cryptococcus neoformans var. grubii H99
gi|448103447|ref|XP_004200038.1| Piso0_002599 [Millerozyma farin...    79   7e-13   Millerozyma farinosa CBS 7064
gi|321251008|ref|XP_003191926.1| hsp90 cochaperone; Sti1p [Crypt...    79   7e-13   Cryptococcus gattii WM276
gi|222625560|gb|EEE59692.1| hypothetical protein OsJ_12115 [Oryz...    79   8e-13   Oryza sativa Japonica Group [Japonica rice]
gi|449460409|ref|XP_004147938.1| PREDICTED: heat shock protein S...    79   8e-13   Cucumis sativus [cucumbers]
gi|448099589|ref|XP_004199185.1| Piso0_002599 [Millerozyma farin...    79   8e-13   Millerozyma farinosa CBS 7064
gi|115454605|ref|NP_001050903.1| Os03g0680500 [Oryza sativa Japo...    78   9e-13   
gi|407832057|gb|EKF98319.1| stress-induced protein sti1, putativ...    78   1e-12   Trypanosoma cruzi
gi|260949597|ref|XP_002619095.1| hypothetical protein CLUG_00254...    78   1e-12   Clavispora lusitaniae ATCC 42720
gi|443894866|dbj|GAC72213.1| molecular co-chaperone STI1 [Pseudo...    78   1e-12   Moesziomyces antarcticus T-34
gi|112983280|ref|NP_001036957.1| Hsc70/Hsp90-organizing protein ...    78   1e-12   Bombyx mori [silk moth]
gi|156846776|ref|XP_001646274.1| hypothetical protein Kpol_1032p...    78   1e-12   Vanderwaltozyma polyspora DSM 70294
gi|474293252|gb|EMS61360.1| Protein STIP1-like protein [Triticum...    78   1e-12   Triticum urartu
gi|356537369|ref|XP_003537200.1| PREDICTED: RNA polymerase II-as...    77   2e-12   Glycine max [soybeans]
gi|301096247|ref|XP_002897221.1| conserved hypothetical protein ...    77   2e-12   Phytophthora infestans T30-4
gi|502160177|ref|XP_004511659.1| PREDICTED: heat shock protein S...    77   3e-12   Cicer arietinum [garbanzo]
gi|71664854|ref|XP_819403.1| stress-induced protein sti1 [Trypan...    77   3e-12   Trypanosoma cruzi strain CL Brener
gi|343429023|emb|CBQ72597.1| probable STI1-Hsp90 cochaperone [Sp...    77   3e-12   Sporisorium reilianum SRZ2
gi|255720771|ref|XP_002545320.1| conserved hypothetical protein ...    77   3e-12   Candida tropicalis MYA-3404
gi|354474053|ref|XP_003499246.1| PREDICTED: small glutamine-rich...    77   3e-12   Cricetulus griseus [Chinese hamsters]
gi|312073554|ref|XP_003139572.1| TPR Domain containing protein [...    76   4e-12   Loa loa
gi|357481949|ref|XP_003611260.1| Stress-induced-phosphoprotein [...    76   4e-12   Medicago truncatula
gi|403417328|emb|CCM04028.1| predicted protein [Fibroporia radic...    76   4e-12   Fibroporia radiculosa
gi|488548257|ref|XP_004465620.1| PREDICTED: small glutamine-rich...    76   4e-12   
gi|342181090|emb|CCC90568.1| unnamed protein product [Trypanosom...    76   5e-12   Trypanosoma congolense IL3000
gi|348551646|ref|XP_003461641.1| PREDICTED: LOW QUALITY PROTEIN:...    76   5e-12   
gi|502114478|ref|XP_004494966.1| PREDICTED: tankyrase-2-like [Ci...    76   5e-12   
gi|340053734|emb|CCC48027.1| putative stress-induced protein sti...    76   5e-12   Trypanosoma vivax Y486
gi|407395845|gb|EKF27272.1| stress-induced protein sti1, putativ...    76   5e-12   Trypanosoma cruzi marinkellei
gi|359806614|ref|NP_001241273.1| uncharacterized protein LOC1007...    76   5e-12   Glycine max [soybeans]
gi|342181119|emb|CCC90597.1| putative stress-induced protein sti...    76   6e-12   Trypanosoma congolense IL3000
gi|428178759|gb|EKX47633.1| hypothetical protein GUITHDRAFT_1595...    75   6e-12   Guillardia theta CCMP2712
gi|488548251|ref|XP_004465617.1| PREDICTED: small glutamine-rich...    75   6e-12   Dasypus novemcinctus
gi|505802041|ref|XP_004608542.1| PREDICTED: small glutamine-rich...    75   6e-12   Sorex araneus [Eurasian shrew]
gi|170596326|ref|XP_001902724.1| TPR Domain containing protein [...    75   6e-12   Brugia malayi [agent of lymphatic filariasis]
gi|402592282|gb|EJW86211.1| TPR Domain containing protein [Wuche...    75   7e-12   Wuchereria bancrofti [agent of lymphatic filariasis]
gi|357120208|ref|XP_003561821.1| PREDICTED: protein TANC2-like [...    75   7e-12   
gi|242038553|ref|XP_002466671.1| hypothetical protein SORBIDRAFT...    75   7e-12   Sorghum bicolor [broomcorn]
gi|507615229|ref|XP_004623103.1| PREDICTED: small glutamine-rich...    75   7e-12   Octodon degus
gi|507934162|ref|XP_004678314.1| PREDICTED: small glutamine-rich...    75   8e-12   Condylura cristata
gi|460404241|ref|XP_004247592.1| PREDICTED: uncharacterized prot...    75   8e-12   Solanum lycopersicum
gi|431907789|gb|ELK11396.1| Small glutamine-rich tetratricopepti...    75   8e-12   Pteropus alecto
gi|116786888|gb|ABK24283.1| unknown [Picea sitchensis]                 75   8e-12   Picea sitchensis
gi|224111122|ref|XP_002315755.1| predicted protein [Populus tric...    75   8e-12   Populus trichocarpa [western balsam poplar]
gi|406603581|emb|CCH44894.1| Translocation protein [Wickerhamomy...    75   9e-12   Wickerhamomyces ciferrii
gi|395825398|ref|XP_003785922.1| PREDICTED: small glutamine-rich...    75   9e-12   Otolemur garnettii
gi|21450231|ref|NP_659087.1| small glutamine-rich tetratricopept...    75   9e-12   Mus musculus [mouse]
gi|193636512|ref|XP_001950745.1| PREDICTED: stress-induced-phosp...    75   9e-12   Acyrthosiphon pisum
gi|504142730|ref|XP_004583801.1| PREDICTED: small glutamine-rich...    75   9e-12   Ochotona princeps [southern American pika]
gi|31745160|ref|NP_853660.1| small glutamine-rich tetratricopept...    75   1e-11   Rattus norvegicus [brown rat]
gi|395510372|ref|XP_003759451.1| PREDICTED: small glutamine-rich...    75   1e-11   Sarcophilus harrisii
gi|325184864|emb|CCA19356.1| cellulose synthase 3 putative [Albu...    75   1e-11   Albugo laibachii Nc14
gi|359497489|ref|XP_003635537.1| PREDICTED: LOW QUALITY PROTEIN:...    75   1e-11   
gi|291395450|ref|XP_002714114.1| PREDICTED: small glutamine-rich...    75   1e-11   Oryctolagus cuniculus [European rabbit]
gi|344246965|gb|EGW03069.1| Small glutamine-rich tetratricopepti...    75   1e-11   Cricetulus griseus [Chinese hamsters]
gi|311273829|ref|XP_003134059.1| PREDICTED: small glutamine-rich...    75   1e-11   Sus scrofa [pigs]
gi|414868871|tpg|DAA47428.1| TPA: hypothetical protein ZEAMMB73_...    75   1e-11   Zea mays [maize]
gi|212723542|ref|NP_001132666.1| uncharacterized protein LOC1001...    75   1e-11   Zea mays [maize]
gi|466013773|ref|XP_004270800.1| PREDICTED: small glutamine-rich...    75   1e-11   Orcinus orca [Orca]
gi|359497893|ref|XP_003635686.1| PREDICTED: heat shock protein S...    75   1e-11   
gi|15219673|ref|NP_171915.1| carboxylate clamp-tetratricopeptide...    75   1e-11   Arabidopsis thaliana [mouse-ear cress]
gi|357157238|ref|XP_003577731.1| PREDICTED: tetratricopeptide re...    75   1e-11   Brachypodium distachyon [annual false brome]
gi|115489466|ref|NP_001067220.1| Os12g0604800 [Oryza sativa Japo...    75   1e-11   
gi|71894775|ref|NP_001026589.1| small glutamine-rich tetratricop...    75   1e-11   Gallus gallus [bantam]
gi|357135087|ref|XP_003569143.1| PREDICTED: ankyrin-1-like [Brac...    74   1e-11   Brachypodium distachyon [annual false brome]
gi|471368137|ref|XP_004374596.1| PREDICTED: small glutamine-rich...    74   1e-11   Trichechus manatus latirostris
gi|148686559|gb|EDL18506.1| small glutamine-rich tetratricopepti...    74   1e-11   Mus musculus [mouse]
gi|71421536|ref|XP_811823.1| stress-inducible protein STI1-like ...    74   1e-11   Trypanosoma cruzi strain CL Brener
gi|512840302|ref|XP_004884426.1| PREDICTED: small glutamine-rich...    74   1e-11   
gi|403267439|ref|XP_003925840.1| PREDICTED: small glutamine-rich...    74   1e-11   Saimiri boliviensis boliviensis
gi|452822031|gb|EME29054.1| stress-induced-phosphoprotein 1 [Gal...    74   1e-11   Galdieria sulphuraria
gi|512840290|ref|XP_004884423.1| PREDICTED: small glutamine-rich...    74   1e-11   
gi|296194455|ref|XP_002744952.1| PREDICTED: small glutamine-rich...    74   2e-11   Callithrix jacchus [common marmoset]
gi|71403792|ref|XP_804660.1| stress-inducible protein STI1-like ...    74   2e-11   Trypanosoma cruzi strain CL Brener
gi|449278703|gb|EMC86494.1| Small glutamine-rich tetratricopepti...    74   2e-11   Columba livia [carrier pigeon]
gi|402871699|ref|XP_003899791.1| PREDICTED: small glutamine-rich...    74   2e-11   Papio anubis [Doguera baboon]
gi|118790083|ref|XP_318014.3| AGAP004797-PA [Anopheles gambiae s...    74   2e-11   Anopheles gambiae str. PEST
gi|478497189|ref|XP_004422933.1| PREDICTED: small glutamine-rich...    74   2e-11   Ceratotherium simum simum [southern square-lipped rhinoceros]
gi|149732684|ref|XP_001492485.1| PREDICTED: small glutamine-rich...    74   2e-11   Equus caballus [domestic horse]
gi|145488342|ref|XP_001430175.1| hypothetical protein [Parameciu...    74   2e-11   Paramecium tetraurelia strain d4-2
gi|291225755|ref|XP_002732863.1| PREDICTED: conserved hypothetic...    74   2e-11   
gi|24308141|ref|NP_061945.1| small glutamine-rich tetratricopept...    74   2e-11   Homo sapiens [man]
gi|281341773|gb|EFB17357.1| hypothetical protein PANDA_007967 [A...    74   2e-11   Ailuropoda melanoleuca
gi|297737096|emb|CBI26297.3| unnamed protein product [Vitis vini...    74   2e-11   Vitis vinifera
gi|356504107|ref|XP_003520840.1| PREDICTED: uncharacterized prot...    74   2e-11   
gi|407835090|gb|EKF99154.1| stress-inducible protein STI1-like, ...    74   2e-11   Trypanosoma cruzi
gi|225432762|ref|XP_002283155.1| PREDICTED: serine/threonine-pro...    74   2e-11   Vitis vinifera
gi|301767848|ref|XP_002919337.1| PREDICTED: small glutamine-rich...    74   2e-11   
gi|147769544|emb|CAN61400.1| hypothetical protein VITISV_011488 ...    74   2e-11   Vitis vinifera
gi|470251348|ref|XP_004358771.1| tetratricopeptide-like helical ...    74   2e-11   Dictyostelium fasciculatum
gi|224090709|ref|XP_002190540.1| PREDICTED: small glutamine-rich...    74   2e-11   Taeniopygia guttata
gi|344272591|ref|XP_003408115.1| PREDICTED: small glutamine-rich...    74   2e-11   Loxodonta africana [African bush elephant]
gi|300796037|ref|NP_001179720.1| small glutamine-rich tetratrico...    74   3e-11   Bos taurus [bovine]
gi|356540381|ref|XP_003538668.1| PREDICTED: heat shock protein S...    74   3e-11   Glycine max [soybeans]
gi|405950779|gb|EKC18743.1| Stress-induced-phosphoprotein 1 [Cra...    74   3e-11   Crassostrea gigas
gi|326634977|gb|ADZ99902.1| PSTI1-like protein [Physarum polycep...    74   3e-11   Physarum polycephalum
gi|327263151|ref|XP_003216384.1| PREDICTED: small glutamine-rich...    73   3e-11   Anolis carolinensis [Carolina anole]
gi|378734400|gb|EHY60859.1| hypothetical protein HMPREF1120_0880...    73   3e-11   Exophiala dermatitidis NIH/UT8656
gi|157112030|ref|XP_001657382.1| hypothetical protein AaeL_AAEL0...    73   3e-11   Aedes aegypti
gi|401411471|ref|XP_003885183.1| Serine/threonine protein phosph...    73   3e-11   Neospora caninum Liverpool
gi|507649988|ref|XP_004703756.1| PREDICTED: small glutamine-rich...    73   3e-11   Echinops telfairi [lesser hedgehog tenrec]
gi|126135608|ref|XP_001384328.1| hypothetical protein PICST_7193...    73   3e-11   Scheffersomyces stipitis CBS 6054
gi|114600030|ref|XP_526906.2| PREDICTED: small glutamine-rich te...    73   3e-11   Pan troglodytes
gi|242086170|ref|XP_002443510.1| hypothetical protein SORBIDRAFT...    73   3e-11   Sorghum bicolor [broomcorn]
gi|147900127|ref|NP_001086162.1| small glutamine-rich tetratrico...    73   4e-11   Xenopus laevis [clawed frog]
gi|482556094|gb|EOA20286.1| hypothetical protein CARUB_v10000594...    73   4e-11   Capsella rubella
gi|410928291|ref|XP_003977534.1| PREDICTED: small glutamine-rich...    73   4e-11   Takifugu rubripes [tiger puffer]
gi|345312323|ref|XP_001517564.2| PREDICTED: small glutamine-rich...    73   4e-11   
gi|356497161|ref|XP_003517431.1| PREDICTED: heat shock protein S...    73   4e-11   Glycine max [soybeans]
gi|47228414|emb|CAG05234.1| unnamed protein product [Tetraodon n...    73   4e-11   Tetraodon nigroviridis
gi|154345402|ref|XP_001568638.1| stress-inducible protein STI1 h...    73   4e-11   Leishmania braziliensis MHOM/BR/75/M2904
gi|308321478|gb|ADO27890.1| small glutamine-rich tetratricopepti...    73   5e-11   Ictalurus furcatus
gi|255073417|ref|XP_002500383.1| predicted protein [Micromonas s...    73   5e-11   Micromonas commoda
gi|242014218|ref|XP_002427788.1| Stress-induced-phosphoprotein, ...    73   5e-11   Pediculus humanus corporis [human body lice]
gi|355749958|gb|EHH54296.1| Beta-SGT [Macaca fascicularis]             73   5e-11   Macaca fascicularis [crab eating macaque]
gi|470121204|ref|XP_004296669.1| PREDICTED: uncharacterized prot...    72   5e-11   Fragaria vesca subsp. vesca
gi|308322609|gb|ADO28442.1| small glutamine-rich tetratricopepti...    72   5e-11   Ictalurus punctatus
gi|410948703|ref|XP_003981070.1| PREDICTED: small glutamine-rich...    72   5e-11   Felis catus [cat]
gi|307177758|gb|EFN66755.1| Stress-induced-phosphoprotein 1 [Cam...    72   5e-11   Camponotus floridanus
gi|57042869|ref|XP_535258.1| PREDICTED: small glutamine-rich tet...    72   5e-11   Canis lupus familiaris [dogs]
gi|483524440|gb|EOB08407.1| Small glutamine-rich tetratricopepti...    72   5e-11   Anas platyrhynchos [duck]
gi|340054260|emb|CCC48556.1| putative conserved TPR domain prote...    72   6e-11   Trypanosoma vivax Y486
gi|281202386|gb|EFA76591.1| tetratricopeptide-like helical domai...    72   7e-11   Polysphondylium pallidum PN500
gi|508713870|gb|EOY05767.1| Tetratricopeptide repeat (TPR)-like ...    72   7e-11   Theobroma cacao [chocolate]
gi|156552012|ref|XP_001603429.1| PREDICTED: stress-induced-phosp...    72   8e-11   Nasonia vitripennis
gi|444510676|gb|ELV09692.1| Small glutamine-rich tetratricopepti...    72   8e-11   Tupaia chinensis
gi|17535447|ref|NP_494893.1| Protein SGT-1 [Caenorhabditis elega...    72   8e-11   Caenorhabditis elegans [roundworm]
gi|508713869|gb|EOY05766.1| Tetratricopeptide repeat (TPR)-like ...    72   8e-11   
gi|430813514|emb|CCJ29149.1| unnamed protein product [Pneumocyst...    72   8e-11   
gi|508713868|gb|EOY05765.1| Tetratricopeptide repeat (TPR)-like ...    72   8e-11   
gi|79325071|ref|NP_001031620.1| carboxylate clamp-tetratricopept...    72   8e-11   
gi|407397563|gb|EKF27807.1| stress-inducible protein STI1-like, ...    72   9e-11   
gi|512853775|ref|XP_004887909.1| PREDICTED: stress-induced-phosp...    72   9e-11   
gi|22655105|gb|AAM98143.1| stress-induced protein sti1-like prot...    72   9e-11   
gi|308493515|ref|XP_003108947.1| CRE-SGT-1 protein [Caenorhabdit...    72   9e-11   
gi|30682109|ref|NP_192977.2| carboxylate clamp-tetratricopeptide...    72   1e-10   
gi|498987890|ref|XP_004531217.1| PREDICTED: stress-induced-phosp...    72   1e-10   
gi|388496878|gb|AFK36505.1| unknown [Medicago truncatula]              72   1e-10   


>gi|511004607|gb|EPB85972.1| hypothetical protein HMPREF1544_07214 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 194

 Score =  163 bits (412), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 117/178 (65%), Gaps = 3/178 (1%)

Query: 11  DGDNVYCRQHRLETCKDCDYDFKPLNTLHKSLIPIKGNIPPPNYINQNLSNQITKLKEEG 70
           DGD + C+ H LE C  C  D+   N L  +L  +K ++PPPN  N   + Q+T+LKEEG
Sbjct: 15  DGDKILCKDHGLEKCNKCQVDWIEHNLLAATLKHVK-DLPPPNAPNPTRNAQVTRLKEEG 73

Query: 71  NTYHKSQNYSEAIKLYSSAIEMAFQRPFWEP--HESTEQEVSVCLSNRSLSYIFLEQWVN 128
           N Y K  NY+E+I+ Y+ A+++++ RP WEP   +   +E++  LSNRS +++ L+ +V+
Sbjct: 74  NKYFKQSNYAESIRFYTMAVDLSWSRPLWEPLAFQYVREELAPVLSNRSAAHLSLQNYVD 133

Query: 129 AYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
           AYVDAE   R+K ++SK +FRKGKAL+G+ R EEA  AF+ GL F+  +E    AL E
Sbjct: 134 AYVDAEMVTRLKREWSKGWFRKGKALVGLGRVEEAAEAFQTGLRFDHDSEELKKALLE 191



>gi|336366769|gb|EGN95115.1| hypothetical protein SERLA73DRAFT_61312 [Serpula lacrymans var.
           lacrymans S7.3]
 gi|336379448|gb|EGO20603.1| hypothetical protein SERLADRAFT_351895 [Serpula lacrymans var.
           lacrymans S7.9]
          Length = 217

 Score =  145 bits (365), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 109/180 (60%), Gaps = 5/180 (2%)

Query: 3   YNLLDLIVDGDN---VYCRQHRLETCKDCDYDFKPLNTLHKSLI--PIKGNIPPPNYINQ 57
           ++++DL + G N    +C  H+LE C DCD DF  +N L K L+  P     PP N ++Q
Sbjct: 9   FSVVDLAIGGPNNSFAFCEPHKLEKCTDCDIDFVSVNRLSKILLGSPNLRCPPPANVVSQ 68

Query: 58  NLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRS 117
            LS  IT  K+EGN  +K+  + +AI  Y+ A  +A QRP WE  +   +E+S  +SNRS
Sbjct: 69  KLSQAITNTKDEGNNMYKTGKHRDAISRYTMAASIAVQRPPWELSQIMREELSTVISNRS 128

Query: 118 LSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKN 177
            +   L  ++ A VDAE  I I+ ++SK +FRK KAL+G+ + +EA  A  +GL+FEP N
Sbjct: 129 AALFELGDYIGALVDAETVISIRRNWSKGHFRKAKALVGLGQLDEAKDAVTLGLQFEPNN 188



>gi|384496658|gb|EIE87149.1| hypothetical protein RO3G_11860 [Rhizopus delemar RA 99-880]
          Length = 193

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 75/176 (42%), Positives = 116/176 (65%), Gaps = 3/176 (1%)

Query: 11  DGDNVYCRQHRLETCKDCDYDFKPLNTLHKSLIPIKGNIPPPNYINQNLSNQITKLKEEG 70
           DGD + C++H LE C  C+ D+   N L  +L  +K ++PPPN  N   + Q+T+LKEEG
Sbjct: 15  DGDRILCKEHTLEKCSRCEVDWTEHNALASTLKHVK-DLPPPNTPNPTRNAQVTRLKEEG 73

Query: 71  NTYHKSQNYSEAIKLYSSAIEMAFQRPFWEP--HESTEQEVSVCLSNRSLSYIFLEQWVN 128
           N + K  N++EAI+ YS A+++++ RP WEP   +   +E++  LSNRS +++ L+ ++ 
Sbjct: 74  NKFFKQANFNEAIRFYSMAVDLSWSRPLWEPLAFQYVREELAPILSNRSAAHLSLKNYIE 133

Query: 129 AYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINAL 184
           AYVDAE   R+K ++SK +FRKGK+L+G+ R +EA  AF  GL F+  +E    AL
Sbjct: 134 AYVDAEAVTRLKREWSKGWFRKGKSLVGLNRKQEATEAFLTGLRFDHDSEELKKAL 189



>gi|471899310|emb|CCO30444.1| Translocation protein sec72 [Rhizoctonia solani AG-1 IB]
          Length = 808

 Score =  135 bits (340), Expect = 5e-30,   Method: Composition-based stats.
 Identities = 63/174 (36%), Positives = 103/174 (59%), Gaps = 2/174 (1%)

Query: 15  VYCRQHRLETCKDCDYDFKPLNTLHKSLIPIKGNI--PPPNYINQNLSNQITKLKEEGNT 72
           V C +H  + C +C  D+  LN L + L+     I  PPP   ++N S  ++K K+EGN 
Sbjct: 619 VVCAEHSTDKCDECGVDYTDLNLLARMLVQAPNLIVPPPPQVTDKNRSAHVSKFKDEGNA 678

Query: 73  YHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVD 132
            +K+  +  AI+ Y+ +  +A  RP WEPH    +E+S  LSNRS +++    ++ A VD
Sbjct: 679 AYKAGKWPAAIQSYTMSANIAASRPNWEPHTLAREEISTVLSNRSAAHLSAGDYIPALVD 738

Query: 133 AEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
           A+  I ++  ++K +FRK KAL+ ++ YEEA  A   GL+FEP+N+  ++ + E
Sbjct: 739 ADVVIALRKPWTKGHFRKAKALVALQHYEEARDAIAAGLQFEPENKELLDFMRE 792



>gi|403415884|emb|CCM02584.1| predicted protein [Fibroporia radiculosa]
          Length = 240

 Score =  134 bits (338), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 71/185 (38%), Positives = 105/185 (56%), Gaps = 5/185 (2%)

Query: 2   SYNLLDLIV---DGDNVYCRQHRLETCKDCDYDFKPLNTLHKSLI--PIKGNIPPPNYIN 56
           S+  +D+ +   D     C  H LE C  CD D+ PLN   + L   P     PPP  ++
Sbjct: 51  SFRPVDIALGPPDNCMALCGAHSLEKCPTCDVDYAPLNRTSRILQTNPALRCPPPPQIVS 110

Query: 57  QNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNR 116
           + +S  IT  KEEGNT  K   +  AI+ YS A  +A QRP WE  +   +E+S  +SNR
Sbjct: 111 KQMSQAITNTKEEGNTLFKGGLHDRAIQRYSMAANIAVQRPPWEAQQVMREELSTIISNR 170

Query: 117 SLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPK 176
           S +++    ++ A VDAE  I++K  +SK +FRK +AL+ M +Y+EA  A ++GL FE  
Sbjct: 171 SAAFLEAGDYIAALVDAETVIQLKRHWSKGHFRKARALLRMDKYQEAKEAIQVGLSFESG 230

Query: 177 NESFI 181
           N++ I
Sbjct: 231 NKASI 235



>gi|392575575|gb|EIW68708.1| hypothetical protein TREMEDRAFT_23695, partial [Tremella
           mesenterica DSM 1558]
          Length = 169

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 71/167 (42%), Positives = 98/167 (58%), Gaps = 3/167 (1%)

Query: 15  VYCRQHRLETCKDCDYDFKPLNTLHKSLIPIKGNIPPPNYINQNLSNQIT---KLKEEGN 71
           V C +HRL  C+ CD DF  LN LH+ L     +  PP         + T   +LKE+GN
Sbjct: 2   VVCSEHRLSYCEKCDVDFNGLNYLHQFLKAAPADAVPPPPNVPPPPQRATVVKQLKEQGN 61

Query: 72  TYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYV 131
           T  KS N+ +AI+LYS + +MA  RP WEP    + EV V L NRS ++ F   W+NA  
Sbjct: 62  TAFKSNNFGQAIQLYSKSADMALTRPPWEPSAIGKDEVVVALCNRSAAFAFAGAWLNALA 121

Query: 132 DAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNE 178
           DAE  + IK  ++K +FRK +AL+G+ R E+A  A   GL+FEP ++
Sbjct: 122 DAEAVVMIKRPWTKGHFRKARALVGLDRLEDARDALVDGLQFEPDDK 168



>gi|169850029|ref|XP_001831712.1| hypothetical protein CC1G_08316 [Coprinopsis cinerea okayama7#130]
 gi|116507148|gb|EAU90043.1| hypothetical protein CC1G_08316 [Coprinopsis cinerea okayama7#130]
          Length = 269

 Score =  132 bits (332), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 71/199 (35%), Positives = 111/199 (55%), Gaps = 12/199 (6%)

Query: 6   LDLIVDGDNVYCRQHRLETCKDCDYDFKPLNTLHKSLI--PIKGNIPPPNYINQNLSNQI 63
           L L  D     C  H+ E C+ C+ DF  +N L + L   P     PP N +NQ LS  +
Sbjct: 53  LSLEQDATVAVCSAHKQEKCEPCNVDFVNMNRLSRVLASNPQLLCPPPSNVVNQKLSQMV 112

Query: 64  TKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFL 123
           T  K+EGN   KS  +++A+  Y++A  +A QR  WE ++   +E++  +SNRS +Y  L
Sbjct: 113 TAAKDEGNVLFKSGQHAQALTRYTAAASLATQRAPWENNQILREELTPVMSNRSAAYYDL 172

Query: 124 EQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFIN- 182
             +++A  DAE  I+I+ ++ K +FRK KAL+G+++ +EA  A ++GL +EP N+  +  
Sbjct: 173 GDYISALADAEAVIQIRKNWPKGHFRKAKALLGLQKLKEAADAVKLGLSYEPNNQELVTF 232

Query: 183 ---------ALEEARKLAG 192
                     LEE R  AG
Sbjct: 233 LADIERQQQKLEEKRLAAG 251



>gi|343425500|emb|CBQ69035.1| conserved hypothetical protein [Sporisorium reilianum SRZ2]
          Length = 213

 Score =  131 bits (330), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 67/161 (41%), Positives = 105/161 (65%), Gaps = 3/161 (1%)

Query: 29  DYDFKPLNTLHKS---LIPIKGNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKL 85
           D D   LN L +S   L P     PPPN I    S  I + KE+GNT +++++++EA+K+
Sbjct: 45  DLDLTVLNALIRSIQGLPPNVAFPPPPNAIAPQRSMAINQAKEQGNTAYRNKDWTEAVKM 104

Query: 86  YSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSK 145
           Y+ AI++A  RP WE ++    E+S+CL+NRS ++   E W+ A  DAE   ++K  ++K
Sbjct: 105 YTLAIDVAASRPLWEANQVARDELSLCLANRSAAFASCEDWIGALCDAEAVTKLKKPWAK 164

Query: 146 AYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
            ++RKGKAL+G++R+ EA  AFE+GL+F+P N+    AL+E
Sbjct: 165 GHYRKGKALVGLERWREAREAFELGLQFDPDNKDLKQALDE 205



>gi|511011092|gb|EPB92306.1| hypothetical protein HMPREF1544_00875 [Mucor circinelloides f.
           circinelloides 1006PhL]
          Length = 201

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 67/179 (37%), Positives = 110/179 (61%), Gaps = 6/179 (3%)

Query: 13  DNVYCRQHRLETCKDCDYDFKPLNTLHKSLIPIKGNIPPPNY-INQNLSNQITKLKEEGN 71
           D + C+ H+ +TC  C  D+   N L  SL  +K  IPPPN      +   + KLK +GN
Sbjct: 16  DMIVCKSHQQQTCLACGIDWTEHNQLAASLKGVK-EIPPPNKPAPSKVKASVNKLKLDGN 74

Query: 72  TYHKSQNYSEAIKLYSSAIEMAFQRPFWEP--HESTEQEVSVCLSNRSLSYIFLEQWVNA 129
             +K +++ EA++LY+ A+++A+ RP WEP   ++  +E++  LSNRS + + L  +V+A
Sbjct: 75  QAYKLEDFQEAVRLYTLAVDLAWSRPLWEPLAFQTVREELAPILSNRSAANLSLGNYVDA 134

Query: 130 YVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKN--ESFINALEE 186
            VDA    ++K D+SK +FRKGKALMG++R+++A  A +  L +   N  E  + A++E
Sbjct: 135 LVDAHVVTQLKKDWSKGWFRKGKALMGLQRFDQASKALQTALLYTEVNEREGLLEAIKE 193



>gi|443900336|dbj|GAC77662.1| molecular co-chaperone STI1 [Pseudozyma antarctica T-34]
          Length = 212

 Score =  129 bits (325), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 68/164 (41%), Positives = 105/164 (64%), Gaps = 9/164 (5%)

Query: 29  DYDFKPLNTLHKSLIPIKG------NIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEA 82
           D D   LN L +S   IKG        PPPN I    S  I + KE+GNT +++++++EA
Sbjct: 44  DLDLTVLNALIRS---IKGLPPNVAFPPPPNAIAPQRSMAINQAKEQGNTAYRNKDWAEA 100

Query: 83  IKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPD 142
           +K+Y+ AI++A  RP WE ++    E+S+CL+NRS ++   E W+ A  DAE   ++K  
Sbjct: 101 VKMYTLAIDVAASRPLWEANQVARDELSLCLANRSAAFASCEDWIGALCDAEAVTKLKKP 160

Query: 143 YSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
           ++K ++RKGKAL+G++R +EA  AFE+GL+F+P N+    AL E
Sbjct: 161 WAKGHYRKGKALVGLQRCKEAREAFELGLQFDPDNKDLKQALAE 204



>gi|71021043|ref|XP_760752.1| hypothetical protein UM04605.1 [Ustilago maydis 521]
 gi|46100182|gb|EAK85415.1| hypothetical protein UM04605.1 [Ustilago maydis 521]
          Length = 213

 Score =  128 bits (321), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 64/161 (39%), Positives = 103/161 (63%), Gaps = 3/161 (1%)

Query: 29  DYDFKPLNTLHKSLIPIKGNIPPP---NYINQNLSNQITKLKEEGNTYHKSQNYSEAIKL 85
           + D   LN L +SL  +  N+  P   N I    S  I + KE+GN  +++++++EA+K+
Sbjct: 45  ELDLTVLNALIRSLQGLPPNVAFPPPPNAIAPQRSMAINQAKEQGNAAYRNRDWAEAVKM 104

Query: 86  YSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSK 145
           Y+ AI++A  RP WE ++    E+S+CL+NRS ++   E W+ A  DAE   ++K  ++K
Sbjct: 105 YTLAIDVAASRPLWEANQVARDELSLCLANRSAAFASCEDWIGALCDAEAVTQLKKPWAK 164

Query: 146 AYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
            ++RKGKAL+G+KR++EA  AFE+GL+F+P N     AL E
Sbjct: 165 GHYRKGKALLGLKRWKEARDAFELGLQFDPDNADLKTALNE 205



>gi|170104944|ref|XP_001883685.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164641320|gb|EDR05581.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 171

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 97/163 (59%), Gaps = 2/163 (1%)

Query: 17  CRQHRLETCKDCDYDFKPLNTLHKSLI--PIKGNIPPPNYINQNLSNQITKLKEEGNTYH 74
           C +HRLE C  C+ +F   N L + L+  P     PP N + Q L+  +   K+EGN   
Sbjct: 4   CARHRLEKCDPCNVNFVNTNRLAQLLVQNPNLLCPPPNNVVTQKLTQMVVSTKDEGNNLF 63

Query: 75  KSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAE 134
           K+ +  +A+  Y++A ++A QRP WE +    +E++  +SNRS +Y  +  +V+A  DAE
Sbjct: 64  KAGHAQQALTRYTAAAQLAVQRPPWETNALMREELTTVVSNRSAAYYDVHDYVSALADAE 123

Query: 135 WGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKN 177
             I I+ ++SK +FRK KAL+G+ R +E+  A  +GL FEP N
Sbjct: 124 TVIAIRRNWSKGHFRKAKALLGLHRLQESADAIRLGLSFEPHN 166



>gi|501305678|dbj|GAC94800.1| hypothetical protein PHSY_002373 [Pseudozyma hubeiensis SY62]
          Length = 214

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 54/127 (42%), Positives = 91/127 (71%)

Query: 60  SNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLS 119
           S  I + KE+GNT +++++++EA+K+Y+ AI++A  RP WE ++    E+S+CL+NRS +
Sbjct: 80  SMAINQAKEQGNTAYRNKDWAEAVKMYTLAIDVAASRPLWEANQVARDELSLCLANRSAA 139

Query: 120 YIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNES 179
           +   E W+ A  DAE   ++K  ++K ++RKGKAL+G+KR+ EA  AFE+GL+F+P+N  
Sbjct: 140 FASCEDWIGALCDAEAVTKLKKPWAKGHYRKGKALVGLKRWREAREAFELGLQFDPENAD 199

Query: 180 FINALEE 186
             +A+ E
Sbjct: 200 LKSAVGE 206



>gi|388857789|emb|CCF48683.1| uncharacterized protein [Ustilago hordei]
          Length = 214

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 61/159 (38%), Positives = 103/159 (64%), Gaps = 3/159 (1%)

Query: 31  DFKPLNTLHKSLIPIKGNIPPP---NYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYS 87
           D   LN L +SL  +  N+  P   N I    S  I + +E+GNT +++++++EAIK+Y+
Sbjct: 48  DLTVLNALIRSLQGLPPNVAFPPPPNAIAPQRSMAIDQAREQGNTAYRNKDWAEAIKMYT 107

Query: 88  SAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAY 147
            AI++A  RP WE ++    E+S+CL+NRS ++   + W+ A  DAE   ++K  ++K +
Sbjct: 108 LAIDVAASRPLWEANQVARDELSLCLANRSAAFASCQDWIGALCDAEAVTKLKKPWAKGH 167

Query: 148 FRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
           +RK KAL+G++R +EA  AFE+GL+F+P+N     AL++
Sbjct: 168 YRKAKALVGLQRCKEARDAFELGLQFDPENAELKAALQD 206



>gi|270358694|gb|ACZ81483.1| CND01540 [Kwoniella heveanensis]
          Length = 283

 Score =  121 bits (303), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 62/175 (35%), Positives = 96/175 (54%), Gaps = 13/175 (7%)

Query: 12  GDNVYCRQHRLETCKDCDYDFKPLNTLHKSLIPIKGNIPPPNYINQNL--------SNQI 63
           G  V C QH+   C++C  DF  LN LH+ L        P   I            +  I
Sbjct: 68  GVVVTCPQHKNSACEECGVDFNALNYLHQFL-----RAAPKEAIPPPPNVQPPPQRAEAI 122

Query: 64  TKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFL 123
            +LKE+GNT  K+Q + +AI+ YS + +MA  RP WE    +  E ++ L NRS ++ F+
Sbjct: 123 KQLKEQGNTAFKAQQFPQAIQAYSKSADMALSRPPWELAALSRDETAIALCNRSAAFAFV 182

Query: 124 EQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNE 178
             W NA  DAE  + +K  ++K +FRK +AL+G++R E+A  A   G+++EP ++
Sbjct: 183 NAWANALADAEAVVTLKRPWTKGHFRKARALVGLERLEDARQALIDGMQYEPNDK 237



>gi|358054856|dbj|GAA99069.1| hypothetical protein E5Q_05758 [Mixia osmundae IAM 14324]
          Length = 240

 Score =  118 bits (296), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 94/156 (60%), Gaps = 1/156 (0%)

Query: 31  DFKPLNTLHKSLIPIKGNIPPPNYINQNL-SNQITKLKEEGNTYHKSQNYSEAIKLYSSA 89
           D  PLN+L ++++     IP P   +QN  S Q  K KEEGN   K+ N ++AIK+Y+ A
Sbjct: 71  DLAPLNSLIQAMLTNNIAIPGPPQPSQNARSFQFNKFKEEGNKKFKAGNNADAIKMYTLA 130

Query: 90  IEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFR 149
            ++A  RP +E  +   +E+SV LSNRS +Y+   Q V A  DAE  I++K ++ K +FR
Sbjct: 131 ADLASSRPLFESSQYIREELSVALSNRSAAYLNAGQNVEALADAETVIKLKRNWDKGHFR 190

Query: 150 KGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALE 185
           K KAL+   R  +A  A  +GLEFEP N    NAL+
Sbjct: 191 KAKALVAFGRLFDARDALLLGLEFEPDNAELCNALD 226



>gi|470319011|gb|EMR10652.1| hypothetical protein PNEG_01351 [Pneumocystis murina B123]
          Length = 196

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 93/158 (58%), Gaps = 3/158 (1%)

Query: 32  FKPLNTLHKSLI--PIKGNIP-PPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSS 88
            +P N L KS+       +IP PPN ++   S  I +LKE G  + + +NY EA+K ++ 
Sbjct: 30  LEPFNRLIKSITLNQYPEDIPLPPNQVHPKRSIHINRLKESGTEHSRRKNYDEALKFFTL 89

Query: 89  AIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYF 148
           A+EMA+ RP+WEP   +  E++     R   Y+  +QW NA+VDA   I I+  +SK + 
Sbjct: 90  AVEMAYGRPYWEPASLSRDELAAAFYERCTVYLASKQWKNAFVDASTVIGIRKAWSKGHL 149

Query: 149 RKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
            K KAL GM   ++A  + E+GL FEPKN+  + AL+E
Sbjct: 150 CKSKALQGMGILDKAKESLELGLSFEPKNDELLAALKE 187



>gi|321257190|ref|XP_003193502.1| hypothetical protein CGB_D3750C [Cryptococcus gattii WM276]
 gi|317459972|gb|ADV21715.1| conserved hypothetical protein [Cryptococcus gattii WM276]
          Length = 250

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 64/178 (35%), Positives = 95/178 (53%), Gaps = 6/178 (3%)

Query: 15  VYCRQHRLETCKDCDYDFKPLNTLHKSL---IPIKGNIPPPNYINQNLSNQITKLKEEGN 71
           V C+ H  + C  C  DF P+N LH+ L          PP        +  +T LK+ GN
Sbjct: 60  VVCKLHDQQKCDQCRVDFTPVNYLHQFLRFAPAEAIPPPPNVAPPPQRAQAVTNLKDAGN 119

Query: 72  TYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYV 131
              K+Q +  A + YS A + A  RP WEP     +E ++ L NRS SY F   W  A  
Sbjct: 120 NAFKAQKFDIATQFYSKATDAALSRPPWEPAALGREEAAITLCNRSASYAFSGNWTAALA 179

Query: 132 DAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNE---SFINALEE 186
           DA+  I +K  ++K +FRK +AL+G+++YEEA  A   GL++EP ++   +F+  +EE
Sbjct: 180 DAQTVINLKRPWTKGHFRKARALVGLEQYEEAKQAIIDGLQYEPNDKELNTFLQEIEE 237



>gi|393222159|gb|EJD07643.1| hypothetical protein FOMMEDRAFT_40180, partial [Fomitiporia
           mediterranea MF3/22]
          Length = 169

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 67/163 (41%), Positives = 92/163 (56%), Gaps = 2/163 (1%)

Query: 17  CRQHRLETCKDCDYDFKPLNTLHKSLI--PIKGNIPPPNYINQNLSNQITKLKEEGNTYH 74
           C  H LE C  C  DF   N L +  +  P     PPP  + Q  S  +TK KE+GN   
Sbjct: 3   CAPHGLEKCDACGVDFTSTNALARIFVQNPHLACPPPPQIVQQQRSQAVTKTKEDGNALF 62

Query: 75  KSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAE 134
           K+    EA+ +Y+ A+ +A  R  WEP+   ++E+S  LSNRS +Y+     V A VDAE
Sbjct: 63  KANKVKEAVSMYTMAVNVAAGRLPWEPNSIMKEELSTVLSNRSAAYLAAGDHVGALVDAE 122

Query: 135 WGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKN 177
             I++K  +SK +FRK KAL+ + R EEA  A ++GL FEP N
Sbjct: 123 LVIQLKRPWSKGHFRKAKALVELGRLEEAREAIKLGLGFEPNN 165



>gi|328857032|gb|EGG06150.1| hypothetical protein MELLADRAFT_87294 [Melampsora larici-populina
           98AG31]
          Length = 238

 Score =  115 bits (287), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 61/149 (40%), Positives = 89/149 (59%), Gaps = 3/149 (2%)

Query: 35  LNTLHKSLI--PIKGNIPPPNYINQNL-SNQITKLKEEGNTYHKSQNYSEAIKLYSSAIE 91
           +N L + L+  P     P P  +  N  S QI K+KE+GN   K  N+  A++LY+ A E
Sbjct: 77  INDLSQYLVRAPFPHCPPQPQLVQNNARSQQINKMKEDGNVAFKGNNFERAVELYTLAAE 136

Query: 92  MAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKG 151
            A  RP +EP    ++E+SV L NR+ +Y  +++WV A  DAE  I++K ++SK +FRK 
Sbjct: 137 AAATRPLFEPSMWVKEELSVVLCNRAAAYQSMKKWVEALCDAEAVIQLKRNWSKGHFRKA 196

Query: 152 KALMGMKRYEEAVHAFEIGLEFEPKNESF 180
           KAL GM + ++A  A  +GLEFEP N   
Sbjct: 197 KALQGMGKLDQARDAALLGLEFEPDNSDL 225



>gi|505757075|gb|EOR01209.1| Translocation protein sec72 [Wallemia ichthyophaga EXF-994]
          Length = 282

 Score =  115 bits (287), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 91/163 (55%), Gaps = 5/163 (3%)

Query: 24  TCKDCDYDFKPLNTLHKSLIPIKGNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAI 83
            C D +Y    L    +  +P     PPP  +  + S Q TK KE+GN   K     +AI
Sbjct: 107 VCNDINYLINKLEQHPEYAVP-----PPPTIMKPHRSQQFTKSKEDGNAKFKEGKLDDAI 161

Query: 84  KLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDY 143
           +L+S+A+++A  RP WE H    +E+S+ LSNRSL +     +  +  DA   + IK  +
Sbjct: 162 QLFSAAVDLAADRPPWESHVLAREELSLALSNRSLCFHNKGDFEKSLSDANAVVEIKKAW 221

Query: 144 SKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
           SK +FRKGKAL+ + + +EA  A  +GL+FEP N+   NAL E
Sbjct: 222 SKGHFRKGKALIALDKLQEARDAILLGLDFEPSNDDLKNALTE 264



>gi|58266252|ref|XP_570282.1| hypothetical protein [Cryptococcus neoformans var. neoformans
           JEC21]
 gi|134111214|ref|XP_775749.1| hypothetical protein CNBD4780 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50258413|gb|EAL21102.1| hypothetical protein CNBD4780 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57226515|gb|AAW42975.1| conserved hypothetical protein [Cryptococcus neoformans var.
           neoformans JEC21]
          Length = 269

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 89/167 (53%), Gaps = 3/167 (1%)

Query: 15  VYCRQHRLETCKDCDYDFKPLNTLHKSL---IPIKGNIPPPNYINQNLSNQITKLKEEGN 71
           V C  H  + C  C  DF P+N LH+ L          PP        +  +T LKE GN
Sbjct: 59  VVCSLHDQQKCDQCAVDFSPVNFLHQFLRFAPAEAIPPPPNVAPPPQRAQAVTNLKEAGN 118

Query: 72  TYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYV 131
              K+Q +  A + YS A + A  RP WEP     +EV++ L NRS S  F  +W  A  
Sbjct: 119 NAFKAQKFDVASQFYSKATDAALSRPPWEPAALGREEVAITLCNRSASNAFSGKWAAALA 178

Query: 132 DAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNE 178
           DA+  I +K  ++K +FRK +AL+G++RYE+A  A   GL++EP ++
Sbjct: 179 DAQTVINLKRPWTKGHFRKARALVGLERYEDAKQAVIDGLQYEPNDK 225



>gi|405120352|gb|AFR95123.1| hypothetical protein CNAG_01024 [Cryptococcus neoformans var.
           grubii H99]
          Length = 247

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 63/175 (36%), Positives = 91/175 (52%), Gaps = 3/175 (1%)

Query: 15  VYCRQHRLETCKDCDYDFKPLNTLHKSL---IPIKGNIPPPNYINQNLSNQITKLKEEGN 71
           V C  H  + C  C  DF P+N LH+ L          PP        +  +T LKE GN
Sbjct: 56  VVCSLHDQQKCDQCAVDFAPVNFLHQFLRFAPAEAIPPPPNVAPPPQRAQAVTNLKEAGN 115

Query: 72  TYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYV 131
              K+Q +  A + YS A + A  RP WEP     +E ++ L NRS S  F   W  A  
Sbjct: 116 NAFKAQKFDVASQFYSKATDAALSRPPWEPAALGREEAAITLCNRSASNAFSGNWAAALA 175

Query: 132 DAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
           DA+  I +K  ++K +FRK +AL+G+++YE+A  A   GL++EP ++   N L+E
Sbjct: 176 DAQTVINLKRPWTKGHFRKARALVGLEQYEDAKQAVIDGLQYEPNDKELNNFLQE 230



>gi|345565757|gb|EGX48705.1| hypothetical protein AOL_s00079g344 [Arthrobotrys oligospora ATCC
           24927]
          Length = 210

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 70/206 (33%), Positives = 101/206 (49%), Gaps = 15/206 (7%)

Query: 2   SYNLLDLIVDG-DNVYCRQHRLETCKDCDYDFKPLNTLHKSLIPIKGNIPPP-NYINQNL 59
           S+ LL L +D   N         +          LNTLH+S++  +  IPPP   IN   
Sbjct: 3   SFTLLPLTIDKVTNAVLAPSSTPSLPALPDAISDLNTLHRSMLQFENAIPPPPGLINPKR 62

Query: 60  SNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLS 119
           S QI KL+E GN   + Q + EA+KLYS A+EM   RP WE      +E ++  SNR+ +
Sbjct: 63  SAQINKLRESGNAAFRKQAFGEAVKLYSLALEMCLGRPHWEQSALVREESAMIYSNRAQA 122

Query: 120 YIFLEQWVNAYVDAEWGIRIKP-DYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNE 178
            I +  W     DAE    +KP D  KA++R+   L  M + E++    E+G E+E +N+
Sbjct: 123 NIAMRNWAEGMCDAEMSCGLKPKDNVKAWYRRALCLKEMGKLEDSREVLEMGCEWEAENQ 182

Query: 179 SFIN------------ALEEARKLAG 192
              +            ALEE  K+AG
Sbjct: 183 GKTDGDLRALLRDVHKALEEKEKIAG 208



>gi|465794201|emb|CCU99031.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 211

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 83/132 (62%)

Query: 55  INQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLS 114
           + + LS+ + + K+ GN  +K ++Y  AIK Y+  + MA  RP WE      +E+SV L+
Sbjct: 78  VQKPLSDMVKQAKDRGNEAYKKKDYVSAIKHYTMGLAMASSRPMWEASGIVAEELSVVLA 137

Query: 115 NRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFE 174
           NRS +++  E ++ A  DA+   +I   + K +FRKGKAL  ++RY+EA  AF++G +FE
Sbjct: 138 NRSAAFLAAEAYIEALCDADAVTKINRVWGKGHFRKGKALAALQRYDEARAAFDLGHQFE 197

Query: 175 PKNESFINALEE 186
           P NE F+ A+ E
Sbjct: 198 PDNEDFVKAIAE 209



>gi|430812877|emb|CCJ29746.1| unnamed protein product [Pneumocystis jirovecii]
          Length = 185

 Score =  112 bits (281), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 86/146 (58%), Gaps = 1/146 (0%)

Query: 48  NIP-PPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTE 106
           +IP PP  ++   S  I +LKE G   ++ +NY +A+KLY+ AIEMA  RP WEP   + 
Sbjct: 37  DIPSPPGDVHPKRSIHINRLKESGIECYRKKNYEDAVKLYTLAIEMASGRPHWEPVALSR 96

Query: 107 QEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHA 166
            E++     RS++YI  +QW  A+VDA   + I+  +SK +  K K   GM   ++A  +
Sbjct: 97  DELATAFYQRSIAYIASKQWGKAFVDASTVVGIRKAWSKGHLCKSKVFQGMGMLDKAKES 156

Query: 167 FEIGLEFEPKNESFINALEEARKLAG 192
            E+GL FEP+N+  + AL+E  K  G
Sbjct: 157 LELGLSFEPRNDELLTALKELNKQLG 182



>gi|302687240|ref|XP_003033300.1| hypothetical protein SCHCODRAFT_54540 [Schizophyllum commune H4-8]
 gi|300106994|gb|EFI98397.1| hypothetical protein SCHCODRAFT_54540 [Schizophyllum commune H4-8]
          Length = 179

 Score =  112 bits (281), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 96/174 (55%), Gaps = 4/174 (2%)

Query: 15  VYCRQHRLETCKDCDYDFKPLNTLHKSLI--PIKGNIPPPNYINQNLSNQITKLKEEGNT 72
           V C +H+LE C  C+ D+  LN L + L   P     PPP  +++ L   +T LKEEGN 
Sbjct: 2   VLCPEHKLEKCAACNVDYVHLNRLSRLLAKNPNLRCPPPPQVMSRELQAAVTGLKEEGNK 61

Query: 73  YHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVD 132
             K+  + +A+  Y+ A  +A QRP WE  +   ++VS  LSNR+ S++ ++  ++A  D
Sbjct: 62  LFKAGQHQQAVSKYTMAASVAVQRPPWEASQFMREDVSAILSNRAASFLEVQDPISALAD 121

Query: 133 AEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
           A   + I+  +SK +FR+ KAL  +    EA  A   GL FEP   S ++ L E
Sbjct: 122 ANAVVEIRRPWSKGHFRRAKALQQLGSLSEAAAAARQGLAFEPA--SVVSVLPE 173



>gi|226291093|gb|EEH46521.1| tetratricopeptide repeat domain-containing protein
           [Paracoccidioides brasiliensis Pb18]
          Length = 211

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 89/147 (60%), Gaps = 3/147 (2%)

Query: 31  DFKPLNTLHKSLIPIKG-NIPPP-NYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSS 88
           + + LN LH++L+ +   NIPPP   +N   S Q+ KL+E  NT  +  +Y+EA+KLY+ 
Sbjct: 36  ELESLNQLHRALLNLDSPNIPPPLKPVNPKRSAQVAKLRETANTAFRKSSYAEAVKLYTY 95

Query: 89  AIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKP-DYSKAY 147
           AI+MA  RP WEP     +E++   +NR+ +Y+  +QW  AYVDA+    I   + +KA+
Sbjct: 96  AIDMALGRPAWEPVGLVREELAPLFTNRAQAYMAQQQWAEAYVDAKASAEISATNNTKAW 155

Query: 148 FRKGKALMGMKRYEEAVHAFEIGLEFE 174
           +R  K+L  M R+EEA      GLE E
Sbjct: 156 WRGAKSLTEMGRWEEARRWLLKGLEVE 182



>gi|225679372|gb|EEH17656.1| conserved hypothetical protein [Paracoccidioides brasiliensis Pb03]
          Length = 211

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 89/147 (60%), Gaps = 3/147 (2%)

Query: 31  DFKPLNTLHKSLIPIKG-NIPPP-NYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSS 88
           + + LN LH++L+ +   NIPPP   +N   S Q+ KL+E  NT  +  +Y+EA+KLY+ 
Sbjct: 36  ELESLNQLHRALLNLDSPNIPPPLKPVNPKRSAQVAKLRETANTAFRKSSYAEAVKLYTY 95

Query: 89  AIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKP-DYSKAY 147
           AI+MA  RP WEP     +E++   +NR+ +Y+  +QW  AYVDA+    I   + +KA+
Sbjct: 96  AIDMALGRPAWEPVGLVREELAPLFTNRAQAYMAQQQWAEAYVDAKASAEISATNNTKAW 155

Query: 148 FRKGKALMGMKRYEEAVHAFEIGLEFE 174
           +R  K+L  M R+EEA      GLE E
Sbjct: 156 WRGAKSLTEMGRWEEARRWLLKGLEVE 182



>gi|295665604|ref|XP_002793353.1| tetratricopeptide repeat domain-containing protein
           [Paracoccidioides sp. 'lutzii' Pb01]
 gi|226278267|gb|EEH33833.1| tetratricopeptide repeat domain-containing protein
           [Paracoccidioides sp. 'lutzii' Pb01]
          Length = 414

 Score =  108 bits (270), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 59/147 (40%), Positives = 87/147 (59%), Gaps = 3/147 (2%)

Query: 31  DFKPLNTLHKSLIPIKG-NIPPP-NYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSS 88
           + + LN LH++L+ +   NIPPP   +N   S Q+ KL+E  NT  +  +Y EA+KLY+ 
Sbjct: 239 ELESLNQLHRALLNLDSPNIPPPLKPVNPKRSAQVAKLRETANTAFRKSSYGEAVKLYTY 298

Query: 89  AIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKP-DYSKAY 147
           AI+MA  RP WEP     +E++   +NR+ +Y+  +QW  AYVDA+    I   + +KA+
Sbjct: 299 AIDMALGRPAWEPVGLVREELAPLFTNRAQAYMAQQQWAEAYVDAKASAEISATNNTKAW 358

Query: 148 FRKGKALMGMKRYEEAVHAFEIGLEFE 174
           +R  K L  M R+EEA      GLE E
Sbjct: 359 WRGAKCLTEMGRWEEARRWLLKGLEVE 385



>gi|391871506|gb|EIT80666.1| chaperone binding protein, putative [Aspergillus oryzae 3.042]
          Length = 215

 Score =  108 bits (270), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 65/186 (34%), Positives = 97/186 (52%), Gaps = 15/186 (8%)

Query: 3   YNLLDLIVD----GDNVYCRQHRLETCKDCDYDFKPLNTLHKSLIPIKGN------IPPP 52
           YN   L++D      N+  +     +      +   LN LH+ L   K        IP  
Sbjct: 8   YNQYPLVLDPTSKAINLSSQTTTPASASTVTTELTELNALHRGLKKKKKKKKKKKKIP-- 65

Query: 53  NYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVC 112
             IN   S QITKL++  NT ++  N++EA++LY+ AIEM   RP WEP     +E++  
Sbjct: 66  --INPKRSAQITKLRDSANTAYRKNNHAEAVRLYTYAIEMGIARPGWEPMSLAREELAGL 123

Query: 113 LSNRSLSYIFLEQWVNAYVDAEWGIRIKP-DYSKAYFRKGKALMGMKRYEEAVHAFEIGL 171
            +NR+ +Y+  + W    VDA+  +  KP    KA++R GK L  M R++EA  A + GL
Sbjct: 124 FANRAQAYMAQQAWPEGLVDAKCSVESKPVGNVKAWWRAGKCLAEMGRWDEAQVAIDKGL 183

Query: 172 EFEPKN 177
           EFEP+N
Sbjct: 184 EFEPRN 189



>gi|296418135|ref|XP_002838697.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295634658|emb|CAZ82888.1| unnamed protein product [Tuber melanosporum]
          Length = 205

 Score =  108 bits (269), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 64/170 (37%), Positives = 93/170 (54%), Gaps = 10/170 (5%)

Query: 31  DFKPLNTLHKSLIPIKGNI----PPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLY 86
           + + LN LH++L    G      PPP  +   LS QI ++++ GN   + QNY+EA+ LY
Sbjct: 36  ELEALNNLHQNLKSAPGITNGIPPPPTSVGPKLSTQIERMRQTGNNAFRKQNYAEAVDLY 95

Query: 87  SSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKP-DYSK 145
           + AI MA +RP WEP     +E+    +NR+ ++I +  W  A  D    I  K     K
Sbjct: 96  TLAISMALRRPPWEPSALLREELQQLYANRAQAHISINNWPEALADVNASIDFKRVGNPK 155

Query: 146 AYFRKGKALMGMKRYEEAVHAFEIGLEF--EPKNESFINALEEA---RKL 190
           A++RKG+ L  M RYEEA  A E GLEF  +P+  + +  + EA   RKL
Sbjct: 156 AHWRKGRCLKEMGRYEEAKEALEFGLEFGNDPELANMLKEVNEALSKRKL 205



>gi|169777379|ref|XP_001823155.1| tetratricopeptide repeat domain protein [Aspergillus oryzae RIB40]
 gi|83771892|dbj|BAE62022.1| unnamed protein product [Aspergillus oryzae RIB40]
          Length = 214

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 98/182 (53%), Gaps = 7/182 (3%)

Query: 3   YNLLDLIVD----GDNVYCRQHRLETCKDCDYDFKPLNTLHKSLIPIKGNIPPPNYINQN 58
           YN   L++D      N+  +     +      +   LN LH+ LI +     PP  +  N
Sbjct: 8   YNQYPLVLDPTSKAINLSSQTTTPASASTVTTELTELNALHRGLISLDPPNIPPPPLPIN 67

Query: 59  L--SNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNR 116
              S QITKL++  NT ++  N++EA++LY+ AIEM   RP WEP     +E++   +NR
Sbjct: 68  PKRSAQITKLRDSANTAYRKNNHAEAVRLYTYAIEMGIARPGWEPMSLAREELAGLFANR 127

Query: 117 SLSYIFLEQWVNAYVDAEWGIRIKP-DYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEP 175
           + +Y+  + W    VDA+  +  KP    KA++R GK L  M R++EA  A + GLEFEP
Sbjct: 128 AQAYMAQQAWPEGLVDAKCSVESKPVGNVKAWWRAGKCLAEMGRWDEAQVAIDKGLEFEP 187

Query: 176 KN 177
           +N
Sbjct: 188 RN 189



>gi|440639563|gb|ELR09482.1| hypothetical protein GMDG_00664 [Geomyces destructans 20631-21]
          Length = 201

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 57/158 (36%), Positives = 87/158 (55%), Gaps = 2/158 (1%)

Query: 31  DFKPLNTLHKSLIPIKGNIP-PPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSA 89
           + + LN LH + + ++   P PP  +N   S QITKL+E  N  ++S NY  AI+LY+  
Sbjct: 33  ELESLNALHTAFLSLETPAPLPPVPVNPKRSAQITKLRESANAAYRSANYPSAIQLYTLG 92

Query: 90  IEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKP-DYSKAYF 148
           ++MA +RP WEP      EV+  L+NR+ +++ L  W   + DAE  +  K    +KA++
Sbjct: 93  LDMALKRPRWEPSGLVRDEVAGLLANRAQAHMALRSWPEGWKDAEASVEAKKVGNAKAWW 152

Query: 149 RKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
           R G+ L  M R+EEA      GLE E      +  L+E
Sbjct: 153 RGGRCLAEMSRWEEAKEWVGRGLEVEGNEAELVGLLKE 190



>gi|472580658|gb|EMS18442.1| translocation protein SEC72 [Rhodosporidium toruloides NP11]
          Length = 221

 Score =  106 bits (264), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 62/160 (38%), Positives = 89/160 (55%), Gaps = 4/160 (2%)

Query: 31  DFKPLNTLHKSLIPIKGNIPPPNYINQNLSN----QITKLKEEGNTYHKSQNYSEAIKLY 86
           D +PLN L + L+             Q + N    +I K KE GN   K+ ++  A+KLY
Sbjct: 43  DLQPLNELARVLLTATNPAVVFPPPPQPVPNKRSVEIAKAKEAGNAAFKAGDWGNAVKLY 102

Query: 87  SSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKA 146
           + + EMA  RP +E       E+S+ L NRS +Y+   + VNA VDAE  I++K  + K 
Sbjct: 103 TISAEMAASRPVFEASVYARDELSLALCNRSAAYLGAGENVNALVDAEAVIQLKRPWIKG 162

Query: 147 YFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
           +FRKGKAL  M R EEA  A+ +GL+F+P  E    A++E
Sbjct: 163 HFRKGKALAAMGRLEEAREAYLLGLQFDPTAEDLHQAVKE 202



>gi|342319428|gb|EGU11377.1| hypothetical protein RTG_02879 [Rhodotorula glutinis ATCC 204091]
          Length = 222

 Score =  106 bits (264), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 62/160 (38%), Positives = 89/160 (55%), Gaps = 4/160 (2%)

Query: 31  DFKPLNTLHKSLIPIKGNIPPPNYINQNLSN----QITKLKEEGNTYHKSQNYSEAIKLY 86
           D +PLN L + L+             Q + N    +I K KE GN   K+ ++  A+KLY
Sbjct: 43  DLQPLNELARVLLTATNPAVVFPPPPQPVPNKRSVEIAKAKEAGNAAFKAGDWGNAVKLY 102

Query: 87  SSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKA 146
           + + EMA  RP +E       E+S+ L NRS +Y+   + VNA VDAE  I++K  + K 
Sbjct: 103 TISAEMAASRPVFEASVYARDELSLALCNRSAAYLGAGENVNALVDAEAVIQLKRPWIKG 162

Query: 147 YFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
           +FRKGKAL  M R EEA  A+ +GL+F+P  E    A++E
Sbjct: 163 HFRKGKALAAMGRLEEAREAYLLGLQFDPTAEDLHQAVKE 202



>gi|164658952|ref|XP_001730601.1| hypothetical protein MGL_2397 [Malassezia globosa CBS 7966]
 gi|159104497|gb|EDP43387.1| hypothetical protein MGL_2397 [Malassezia globosa CBS 7966]
          Length = 211

 Score =  105 bits (263), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 50/132 (37%), Positives = 79/132 (59%)

Query: 55  INQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLS 114
           + + L+  I + KE+GNT  + ++Y  AIK Y+  + M   RP WE       E++V L+
Sbjct: 78  LQKQLTENIQEAKEKGNTAFRQKDYETAIKHYTLGVAMITSRPMWESCSLIADELTVMLA 137

Query: 115 NRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFE 174
           NRS +    E ++ A  DA+  ++IK  + K +FRKGKAL  ++RY+EA  A ++G + E
Sbjct: 138 NRSAAMYACEAYIEALCDADAVVKIKGTWGKGHFRKGKALAALQRYDEARAALDLGHQCE 197

Query: 175 PKNESFINALEE 186
           P NE F+ A+ E
Sbjct: 198 PDNEDFLKAIAE 209



>gi|331216407|ref|XP_003320883.1| hypothetical protein PGTG_02905 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
 gi|309299873|gb|EFP76464.1| hypothetical protein PGTG_02905 [Puccinia graminis f. sp. tritici
           CRL 75-36-700-3]
          Length = 244

 Score =  105 bits (263), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 57/131 (43%), Positives = 80/131 (61%)

Query: 56  NQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSN 115
           N   S QIT LKEEGN   K+ ++++AI+LY+ A   A  RP +EP     +E++V L N
Sbjct: 111 NNPRSAQITALKEEGNAAFKANDFNKAIELYTVAANAASTRPLFEPSVWIREELAVVLCN 170

Query: 116 RSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEP 175
           R+ +Y   + WV A  DAE  I++K +++K +FRK KAL G+   EEA  A  +GLEFEP
Sbjct: 171 RAAAYSSAKMWVEALCDAEVVIQLKRNWNKGHFRKVKALQGLGHIEEAKDAALLGLEFEP 230

Query: 176 KNESFINALEE 186
            N     A +E
Sbjct: 231 DNSDLQAAYQE 241



>gi|336264203|ref|XP_003346880.1| hypothetical protein SMAC_05140 [Sordaria macrospora k-hell]
 gi|380090351|emb|CCC11927.1| unnamed protein product [Sordaria macrospora k-hell]
          Length = 220

 Score =  105 bits (262), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 86/154 (55%), Gaps = 4/154 (2%)

Query: 25  CKDCDYDFKPLNTLHKSLIPIKGNIPPPNYINQ---NLSNQITKLKEEGNTYHKSQNYSE 81
            +  + + + LN LH+SL  +      P          S Q++KL++ GN  +K Q Y+E
Sbjct: 35  TRALETELEALNALHRSLHAMDAPHLVPPPPIPVNPKRSAQVSKLRDSGNAEYKKQKYAE 94

Query: 82  AIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKP 141
           A K Y+  I+MA  RP WEP +   +EV    SNR+ ++++L++W  A VDAE  +  K 
Sbjct: 95  ATKFYTLGIQMALARPLWEPSQLVREEVHSLFSNRAQAHMWLQEWPEAAVDAEASVEAKR 154

Query: 142 -DYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFE 174
              +KA+FR+GK+L+ M R EEA      GLE E
Sbjct: 155 VGNAKAWFRRGKSLLEMGRLEEAREWVGRGLEVE 188



>gi|238494508|ref|XP_002378490.1| chaperone binding protein, putative [Aspergillus flavus NRRL3357]
 gi|220695140|gb|EED51483.1| chaperone binding protein, putative [Aspergillus flavus NRRL3357]
          Length = 535

 Score =  105 bits (262), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 64/182 (35%), Positives = 98/182 (53%), Gaps = 7/182 (3%)

Query: 3   YNLLDLIVD----GDNVYCRQHRLETCKDCDYDFKPLNTLHKSLIPIKGNIPPPNYINQN 58
           YN   L++D      N+  +     +      +   LN LH+ LI +     PP  +  N
Sbjct: 328 YNQYPLVLDPTSKAINLSSQTTTPASASTVTTELTELNALHRGLISLDPPNIPPPPLPIN 387

Query: 59  L--SNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNR 116
              S QITKL++  NT ++  N++EA++LY+ AIEM   RP WEP     +E++   +NR
Sbjct: 388 PKRSAQITKLRDSANTAYRKNNHAEAVRLYTYAIEMGIARPGWEPMSLAREELAGLFANR 447

Query: 117 SLSYIFLEQWVNAYVDAEWGIRIKP-DYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEP 175
           + +Y+  + W    VDA+  +  KP    KA++R GK L  M R++EA  A + GLEFEP
Sbjct: 448 AQAYMAQQAWPEGLVDAKCSVESKPVGNVKAWWRAGKCLAEMGRWDEAQVAIDKGLEFEP 507

Query: 176 KN 177
           +N
Sbjct: 508 RN 509



>gi|389625349|ref|XP_003710328.1| tetratricopeptide repeat domain-containing protein [Magnaporthe
           oryzae 70-15]
 gi|351649857|gb|EHA57716.1| tetratricopeptide repeat domain-containing protein [Magnaporthe
           oryzae 70-15]
 gi|440466021|gb|ELQ35311.1| translocation protein sec72 [Magnaporthe oryzae Y34]
 gi|440477155|gb|ELQ58285.1| translocation protein sec72 [Magnaporthe oryzae P131]
          Length = 198

 Score =  105 bits (262), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 99/177 (55%), Gaps = 6/177 (3%)

Query: 2   SYNLLDLIVDGDNVYCRQHRLETCKDCDYDFKPLNTLHKSLIPIK---GNIPPPNYINQN 58
           ++ LL + +D  +       +   +  D +   LN+LH++L+ ++      PPP  +N  
Sbjct: 6   TFTLLPIRIDPQSKAI--SSMSPSRALDAELATLNSLHRTLLGLEKPHAVPPPPIPVNPK 63

Query: 59  LSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSL 118
           LS Q+ K++E GN   +   ++EAIKLYS  +EMA +RP WEP +   +EV+   +NR+ 
Sbjct: 64  LSAQVNKMREGGNAEFRKGRFAEAIKLYSLGLEMALKRPLWEPQQLVREEVASLFANRAQ 123

Query: 119 SYIFLEQWVNAYVDAEWGIRIK-PDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFE 174
           +++ L  WV+  +DAE  +  K     KA++R+GK L+ M R EEA      GLE E
Sbjct: 124 AHMALSNWVDGAIDAEASVEAKRAGNPKAWWRRGKCLIEMGRLEEAREWVGKGLEME 180



>gi|322708489|gb|EFZ00067.1| tetratricopeptide repeat domain containing protein [Metarhizium
           anisopliae ARSEF 23]
          Length = 204

 Score =  105 bits (262), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 58/167 (34%), Positives = 96/167 (57%), Gaps = 5/167 (2%)

Query: 25  CKDCDYDFKPLNTLHKSLIPI----KGNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYS 80
            +  + + + LNTLH++L+ +     G  PPP  +N   + Q+ KL++ GN  ++   Y+
Sbjct: 27  SRALNAELEALNTLHRALLNVDSSSNGVPPPPIPVNPKRTGQVNKLRDNGNAEYRKGKYA 86

Query: 81  EAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIK 140
           +A++LYS  I+MA  RP WEP     +EVS  L+NR+ +++  + W    VDAE  +  +
Sbjct: 87  DAVRLYSLGIQMALGRPLWEPAALVREEVSGLLANRAQAHMATQNWPEGAVDAEASVEAR 146

Query: 141 P-DYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
               +KA++R+GK LM M R EEA    + GLE E +    ++ L+E
Sbjct: 147 RVGNAKAWWRRGKCLMEMGRLEEARDWVKQGLEVEGEEGDLVSLLKE 193



>gi|501754086|emb|CCG82381.1| Translocation protein sec72 [Taphrina deformans PYCC 5710]
          Length = 376

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 54/126 (42%), Positives = 72/126 (57%)

Query: 55  INQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLS 114
           IN N S QI   K+ GN   K+QN+ EA+KLYS A++MA  RP WEP      E+S+ L 
Sbjct: 63  INPNRSKQIEISKKSGNDAFKAQNWPEALKLYSMALDMAASRPPWEPAALANDEMSILLC 122

Query: 115 NRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFE 174
           NRS +++    +  AY DA   I +K  + K YFRK KA + + RY EA      GL +E
Sbjct: 123 NRSAAFLGAGLYAEAYADAHACIELKKPWMKGYFRKAKACIKLCRYREAKEVVRSGLTYE 182

Query: 175 PKNESF 180
           P +E  
Sbjct: 183 PHSEEL 188



>gi|115437864|ref|XP_001217919.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gi|114188734|gb|EAU30434.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 213

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 88/149 (59%), Gaps = 3/149 (2%)

Query: 31  DFKPLNTLHKSLIPI--KGNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSS 88
           + + LN LH++LI +      PPP  IN   S QITKL+E  NT  +  NY+EA++LY+ 
Sbjct: 42  ELQELNQLHRALISLDPPNIPPPPLPINPKRSAQITKLRESANTAFRKNNYAEAVRLYTY 101

Query: 89  AIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKP-DYSKAY 147
           AI+MAF RP WEP   T  E++   SNR+ +Y+  + W    +DA+  +  KP    KA+
Sbjct: 102 AIDMAFGRPGWEPVTLTRDELAGLYSNRAQAYMAQQAWPEGMLDAKCAVESKPLGNVKAW 161

Query: 148 FRKGKALMGMKRYEEAVHAFEIGLEFEPK 176
           +R GK L  M R++EA    E GLE E K
Sbjct: 162 WRAGKCLAEMGRWDEAQKLLEKGLEVEGK 190



>gi|330918887|ref|XP_003298382.1| hypothetical protein PTT_09102 [Pyrenophora teres f. teres 0-1]
 gi|311328420|gb|EFQ93522.1| hypothetical protein PTT_09102 [Pyrenophora teres f. teres 0-1]
          Length = 201

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 69/192 (35%), Positives = 102/192 (53%), Gaps = 8/192 (4%)

Query: 3   YNLLDLIVDGD-NVYCRQHRLETCKDCDYDFKPLNTLHKSLI---PIKGNIPPPNYINQN 58
           + LL L +D D N+        T    + +   LN LH++L+      G  PPP  +N  
Sbjct: 7   FTLLPLSIDADTNITATPP---TTNALETELAALNALHRNLLLVETPTGTPPPPVPVNPK 63

Query: 59  LSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSL 118
            S QI KL+E GN  +K   +S AIK Y+ AI+MA  RP WEP     +E+S  LSNR+ 
Sbjct: 64  RSAQIGKLRESGNAEYKKGQHSAAIKFYTLAIDMALARPSWEPSGLVREELSGLLSNRAQ 123

Query: 119 SYIFLEQWVNAYVDAEWGIRIKP-DYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKN 177
           + + ++ W    VDAE  + +K    +KA++R+GK L+ M R +EA    + GLEFE   
Sbjct: 124 ANMSMQNWAEGAVDAEASVEMKKVGNAKAWWRRGKCLLEMGRLDEAEAWVKTGLEFEATE 183

Query: 178 ESFINALEEARK 189
           +  +   +E  K
Sbjct: 184 QDLVGLKDEIEK 195



>gi|336473436|gb|EGO61596.1| hypothetical protein NEUTE1DRAFT_108046 [Neurospora tetrasperma
           FGSC 2508]
 gi|350295091|gb|EGZ76078.1| hypothetical protein NEUTE2DRAFT_170546 [Neurospora tetrasperma
           FGSC 2509]
          Length = 215

 Score =  102 bits (254), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 56/154 (36%), Positives = 84/154 (54%), Gaps = 4/154 (2%)

Query: 25  CKDCDYDFKPLNTLHKSLIPIKGNIPPPNYINQ---NLSNQITKLKEEGNTYHKSQNYSE 81
            +  + +   LN LH+SL  +      P          S Q++KL++ GN  +K Q YSE
Sbjct: 35  TRALESELAALNALHRSLHSLDAPHLVPPPPIPVNPKRSAQVSKLRDSGNAEYKKQKYSE 94

Query: 82  AIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKP 141
           A K Y+  I+MA  RP WEP +   +EV    SNR+ +++++++W  A VDAE  +  K 
Sbjct: 95  AAKFYTLGIQMALARPLWEPSQLVREEVHSLFSNRAQAHMWMQEWPEAAVDAEASVEAKR 154

Query: 142 -DYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFE 174
              +KA+FR+GK+L+ M R EEA       LE E
Sbjct: 155 VGNAKAWFRRGKSLLEMGRLEEAREWVGRALEVE 188



>gi|367025323|ref|XP_003661946.1| hypothetical protein MYCTH_2314749 [Myceliophthora thermophila ATCC
           42464]
 gi|347009214|gb|AEO56701.1| hypothetical protein MYCTH_2314749 [Myceliophthora thermophila ATCC
           42464]
          Length = 208

 Score =  102 bits (254), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 64/189 (33%), Positives = 99/189 (52%), Gaps = 4/189 (2%)

Query: 2   SYNLLDLIVDGDNVYCRQHRLETCKDCDYDFKPLNTLHKSLIPIKG---NIPPPNYINQN 58
           +++ + L +D  +           +  + +   LN+LH+SL  +       PPP  +N  
Sbjct: 6   TFDFIPLQIDPKSKAISAAHTPASRALEAELAALNSLHRSLHALDAPHTVPPPPVPVNPK 65

Query: 59  LSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSL 118
            S  I KL+E GN  ++ Q Y+EAIK Y+  ++MA  RP WEP +   +EV    SNR+ 
Sbjct: 66  RSANINKLRESGNAEYRKQRYAEAIKFYTLGLQMALTRPAWEPSQLVREEVHALYSNRAQ 125

Query: 119 SYIFLEQWVNAYVDAEWGIRIK-PDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKN 177
           +++ L  W  A VDAE  +  K    +KA+FR+G+ L+ M R  EA      GLEFE + 
Sbjct: 126 AHMQLGNWPEAAVDAEASVEAKRQGNAKAWFRRGRCLVEMGRLAEAREWVARGLEFEGEE 185

Query: 178 ESFINALEE 186
           +  I  L+E
Sbjct: 186 KELIELLKE 194



>gi|259483954|tpe|CBF79766.1| TPA: conserved hypothetical protein [Aspergillus nidulans FGSC A4]
          Length = 217

 Score =  101 bits (251), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 88/154 (57%), Gaps = 7/154 (4%)

Query: 29  DYDFKPLNTLHKSLIPIKGNIPP----PNYINQNLSNQITKLKEEGNTYHKSQNYSEAIK 84
           + +   LNTLH++L+ +  + P     P  +N   S QI KL++  N  ++  NY+EA++
Sbjct: 41  NAELSTLNTLHRTLLSL--DTPSIPPPPLPLNPKRSAQINKLRDSANMAYRKNNYAEAVR 98

Query: 85  LYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKP-DY 143
           LY+ A+EMA  RP WEP     +E++    NR+ +Y+  + WV   VDA   +  +P + 
Sbjct: 99  LYTFALEMALARPGWEPVAVAREELAALYGNRAQAYMSQQMWVEGLVDARASVEGRPVNN 158

Query: 144 SKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKN 177
            KA++R GK L+ M R+EEA      GLE E KN
Sbjct: 159 VKAWWRGGKCLVEMGRWEEAKSFVSRGLELEGKN 192



>gi|50549901|ref|XP_502422.1| YALI0D04895p [Yarrowia lipolytica]
 gi|49648290|emb|CAG80610.1| YALI0D04895p [Yarrowia lipolytica CLIB122]
          Length = 197

 Score =  100 bits (250), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 87/166 (52%), Gaps = 1/166 (0%)

Query: 26  KDCDYDFKPLNTLHKSLIPIKGNIPPP-NYINQNLSNQITKLKEEGNTYHKSQNYSEAIK 84
           K+   +   LN+  K ++   G+IPPP N  N+NL+ Q+ KL++ G    K+    EA+ 
Sbjct: 30  KELQIELDKLNSFAKEMVACPGSIPPPPNEANRNLAIQVAKLRDSGAMQFKAGKPQEALT 89

Query: 85  LYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYS 144
             + A++MA +RP +E   +   +VS  L+ R    + L  W  AY DAE    IKP   
Sbjct: 90  QINMALDMALKRPLYEATGAAIADVSEVLAYRCDINMVLGNWAAAYADAELLCLIKPQIP 149

Query: 145 KAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEEARKL 190
           + Y RKGK L    +Y EA  A++ GL +  +++  + AL E   +
Sbjct: 150 QNYLRKGKCLQTATKYLEAKQAYQSGLMYAAEDKILLGALSEVEAM 195



>gi|512206757|gb|EPE35576.1| TPR-like protein [Glarea lozoyensis ATCC 20868]
          Length = 198

 Score =  100 bits (250), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 67/193 (34%), Positives = 98/193 (50%), Gaps = 4/193 (2%)

Query: 2   SYNLLDLIVDGDNVYCRQHRLETCKDCDYDFKPLNTLHKSLIPIKGNIPPPNYINQ-NLS 60
           ++ LLDL +D  +           +    + K LN LHKSL+ ++  +PPP        S
Sbjct: 6   TFTLLDLHMDPTSKAITSS--SNSRTLQEELKALNHLHKSLLNLESPVPPPPIPVNPKRS 63

Query: 61  NQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSY 120
             ITKL+E GN   +   ++EAIK Y+  ++MA  RP WEP      EVS   +NR+ ++
Sbjct: 64  ANITKLRESGNGEFRKGKHAEAIKFYTLGLQMALTRPPWEPSGLIRDEVSGLYANRAQAH 123

Query: 121 IFLEQWVNAYVDAEWGIRIKP-DYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNES 179
           + +  WV   VDAE  +  K    +KA++RKGK LM M R EEA      GLE E     
Sbjct: 124 MAMSNWVEGSVDAEASVEAKKVGNAKAWWRKGKCLMEMGRLEEAKEWVGRGLEMEGNEAD 183

Query: 180 FINALEEARKLAG 192
            +  L++    +G
Sbjct: 184 LVGLLKDIEGKSG 196



>gi|340905162|gb|EGS17530.1| hypothetical protein CTHT_0068610 [Chaetomium thermophilum var.
           thermophilum DSM 1495]
          Length = 214

 Score =  100 bits (250), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 63/166 (37%), Positives = 89/166 (53%), Gaps = 5/166 (3%)

Query: 26  KDCDYDFKPLNTLHKSL-IPIKGNIPPPNYINQ---NLSNQITKLKEEGNTYHKSQNYSE 81
           K  + +   LN LH++L   I+G IP P          S  I KL+E GN  ++ Q Y +
Sbjct: 35  KALETELAALNALHRALHTQIEGPIPVPPPPVPVNPKRSANINKLRESGNAEYRKQRYGD 94

Query: 82  AIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIK- 140
           AIKLY+  ++MA  RP WEP      E+    SNR+ +Y+ L QW  A  DAE  +  K 
Sbjct: 95  AIKLYTLGLQMALTRPAWEPAGLVRDEIHQLYSNRAQAYMQLGQWPEAAADAECSVEAKR 154

Query: 141 PDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
              +KA++R+GK LM M+R +EA      GLEFE + +     L+E
Sbjct: 155 QGNAKAWYRRGKCLMEMRRLQEAREWVARGLEFEGEEKELAELLKE 200



>gi|67901272|ref|XP_680892.1| hypothetical protein AN7623.2 [Aspergillus nidulans FGSC A4]
 gi|40742619|gb|EAA61809.1| hypothetical protein AN7623.2 [Aspergillus nidulans FGSC A4]
          Length = 524

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 57/152 (37%), Positives = 87/152 (57%), Gaps = 7/152 (4%)

Query: 31  DFKPLNTLHKSLIPIKGNIPP----PNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLY 86
           +   LNTLH++L+ +  + P     P  +N   S QI KL++  N  ++  NY+EA++LY
Sbjct: 350 ELSTLNTLHRTLLSL--DTPSIPPPPLPLNPKRSAQINKLRDSANMAYRKNNYAEAVRLY 407

Query: 87  SSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKP-DYSK 145
           + A+EMA  RP WEP     +E++    NR+ +Y+  + WV   VDA   +  +P +  K
Sbjct: 408 TFALEMALARPGWEPVAVAREELAALYGNRAQAYMSQQMWVEGLVDARASVEGRPVNNVK 467

Query: 146 AYFRKGKALMGMKRYEEAVHAFEIGLEFEPKN 177
           A++R GK L+ M R+EEA      GLE E KN
Sbjct: 468 AWWRGGKCLVEMGRWEEAKSFVSRGLELEGKN 499



>gi|85090693|ref|XP_958539.1| hypothetical protein NCU07746 [Neurospora crassa OR74A]
 gi|28919910|gb|EAA29303.1| predicted protein [Neurospora crassa OR74A]
          Length = 216

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/154 (35%), Positives = 83/154 (53%), Gaps = 4/154 (2%)

Query: 25  CKDCDYDFKPLNTLHKSLIPIKGNIPPPNYINQNL---SNQITKLKEEGNTYHKSQNYSE 81
            +  + +   LN LH+SL  +      P          S Q++KL++ GN  +K   YSE
Sbjct: 36  TRALETELAALNALHRSLHSLDAPHLVPPPPIPVNPKRSAQVSKLRDSGNAEYKKHKYSE 95

Query: 82  AIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKP 141
           A K Y+  I+MA  RP WEP +   +EV    SNR+ +++++++W  A VDAE  +  K 
Sbjct: 96  AAKFYTLGIQMALARPLWEPSQLVREEVHSLFSNRAQAHMWMQEWPEAAVDAEASVEAKR 155

Query: 142 -DYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFE 174
              +KA+FR+GK+L+ M R EEA       LE E
Sbjct: 156 VGNAKAWFRRGKSLLEMGRLEEAREWVGRALEVE 189



>gi|358381798|gb|EHK19472.1| hypothetical protein TRIVIDRAFT_181612 [Trichoderma virens Gv29-8]
          Length = 208

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/166 (33%), Positives = 93/166 (56%), Gaps = 12/166 (7%)

Query: 31  DFKPLNTLHKSLIPIKGNIPP---------PNYINQNLSNQITKLKEEGNTYHKSQNYSE 81
           + + LNTLH++++ I+  +PP         P  +N   +  ++KL++ GNT ++ Q Y+E
Sbjct: 35  ELEKLNTLHRAILNIE--VPPGAIPLVPPPPIPVNPKRTANVSKLRDNGNTEYRKQKYAE 92

Query: 82  AIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKP 141
           A+K YS  IEMA QRP WEP     +EVS+  +NR+ S++ +  W    VDAE  +  + 
Sbjct: 93  AVKFYSQGIEMALQRPLWEPAALVREEVSMLYANRAQSHMAMGNWPEGAVDAEASVEARR 152

Query: 142 -DYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
              +K ++R+G+ L  M R +EA    +  LE E +    +  L++
Sbjct: 153 VGNAKGWWRRGRCLTEMGRLDEAREWVKRALEMEGEEADLVTLLKD 198



>gi|303321135|ref|XP_003070562.1| tetratricopeptide repeat domain containing protein [Coccidioides
           posadasii C735 delta SOWgp]
 gi|240110258|gb|EER28417.1| tetratricopeptide repeat domain containing protein [Coccidioides
           posadasii C735 delta SOWgp]
 gi|320035980|gb|EFW17920.1| tetratricopeptide repeat protein [Coccidioides posadasii str.
           Silveira]
          Length = 209

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 91/150 (60%), Gaps = 3/150 (2%)

Query: 31  DFKPLNTLHKSLIPIKGNIPPPNYINQNL--SNQITKLKEEGNTYHKSQNYSEAIKLYSS 88
           +   LN+LH+S++ +     PP     N   S Q++KL++  NT ++   ++EAI+LYS 
Sbjct: 35  ELDALNSLHRSILNLDSPNVPPPPRPVNPKRSAQVSKLRDSANTAYRKSAFAEAIRLYSY 94

Query: 89  AIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDY-SKAY 147
           AI+MA QRP WEP     +E++   SNR+ +++  +QW  A+VDA+  I    +  +KA+
Sbjct: 95  AIDMAMQRPAWEPLGLVREELAPLYSNRAQAHMSQQQWPEAWVDAQLSIECNDETNTKAW 154

Query: 148 FRKGKALMGMKRYEEAVHAFEIGLEFEPKN 177
           +R GK L+ M R+EEA+   + GLE E + 
Sbjct: 155 WRGGKCLIEMGRWEEAIDWLQKGLEAEGRG 184



>gi|399169321|emb|CCE29839.1| related to translocation protein [Claviceps purpurea 20.1]
          Length = 202

 Score =  100 bits (248), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 92/168 (54%), Gaps = 4/168 (2%)

Query: 23  ETCKDCDYDFKPLNTLHKSLIP--IKGNIPP-PNYINQNLSNQITKLKEEGNTYHKSQNY 79
           ++ +  + +   LNTLH++LI   +K  +P  P  +N   S+Q+ KL E GNT ++   +
Sbjct: 25  KSSRALNAELDHLNTLHRALISAGLKSGVPASPVPVNSKRSSQVVKLGENGNTEYRKGKH 84

Query: 80  SEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRI 139
           +EA +LYS  I+MA QRPFWEP     +E+S   +NR+  ++  + W    +DA+  +  
Sbjct: 85  AEAGRLYSLGIQMAAQRPFWEPAALVREELSGLYANRAQVHMSQQNWPEGAIDADASVAA 144

Query: 140 KP-DYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
           K     K ++RKG+ L+ M R  EA    +  LE E +    +  L+E
Sbjct: 145 KQMGNPKGWWRKGRCLVEMGRLAEAREWVKRALEVEGEEVDLVALLKE 192



>gi|119479913|ref|XP_001259985.1| tetratricopeptide repeat domain protein [Neosartorya fischeri NRRL
           181]
 gi|119408139|gb|EAW18088.1| tetratricopeptide repeat domain protein [Neosartorya fischeri NRRL
           181]
          Length = 212

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 85/150 (56%), Gaps = 3/150 (2%)

Query: 31  DFKPLNTLHKSLIPIKGNIPPPNYINQNL--SNQITKLKEEGNTYHKSQNYSEAIKLYSS 88
           + + LN LH+SLI +     PP  +  N   S QITKL++  N  ++  NY+EA+KLY+ 
Sbjct: 41  ELQALNNLHRSLIALDAPNIPPPPLPINPKRSAQITKLRDTANQAYRKSNYAEAVKLYTY 100

Query: 89  AIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYS-KAY 147
           AI+MA  RP WEP      E+S   +NRS +Y+  + W    +DA+     KP  + KA+
Sbjct: 101 AIDMALSRPGWEPVNLVRDELSGLYANRSQAYMAQQAWPEGMIDAKASCDCKPVANVKAW 160

Query: 148 FRKGKALMGMKRYEEAVHAFEIGLEFEPKN 177
           +R GK L  M R+EEA    E GL+ E K 
Sbjct: 161 WRAGKCLAEMGRWEEAKTILERGLDVEGKT 190



>gi|322696558|gb|EFY88348.1| tetratricopeptide repeat domain containing protein [Metarhizium
           acridum CQMa 102]
          Length = 204

 Score = 99.8 bits (247), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 53/144 (36%), Positives = 86/144 (59%), Gaps = 5/144 (3%)

Query: 25  CKDCDYDFKPLNTLHKSLIPI----KGNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYS 80
            +  + + + LNTLH++L+ +     G  PPP  +N   + Q+ KL++ GN  ++   Y+
Sbjct: 27  SRALNAELEALNTLHRALLNVDSSSNGVPPPPIPVNPKRTGQVNKLRDNGNAEYRKGKYA 86

Query: 81  EAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIK 140
           +A++LYS  I+MA QRP WEP     +EVS  L+NR+ +++  + W    VDAE  +  +
Sbjct: 87  DAVRLYSLGIQMALQRPLWEPAALVREEVSGLLANRAQAHMATQNWPEGAVDAEASVEAR 146

Query: 141 P-DYSKAYFRKGKALMGMKRYEEA 163
               +KA++R+GK LM M R EEA
Sbjct: 147 RVGNAKAWWRRGKCLMEMGRLEEA 170



>gi|340514498|gb|EGR44760.1| translocation protein SEC72 [Trichoderma reesei QM6a]
          Length = 208

 Score = 99.4 bits (246), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 54/166 (32%), Positives = 93/166 (56%), Gaps = 12/166 (7%)

Query: 31  DFKPLNTLHKSLIPIKGNIPP---------PNYINQNLSNQITKLKEEGNTYHKSQNYSE 81
           + + LN LH++++ I+  +PP         P  +N   +  ++KL++ GNT ++ Q Y E
Sbjct: 35  ELEKLNALHRAILNIE--VPPGAIPLVPPPPIPVNPKRTANVSKLRDSGNTEYRRQKYEE 92

Query: 82  AIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKP 141
           A+KLY+  IEMA QRP WEP     +EVS+  +NR+ S++ +  W    VDAE  +  + 
Sbjct: 93  AVKLYTQGIEMALQRPLWEPAALVREEVSMLYANRAQSHMAMGNWPEGAVDAEASVEARR 152

Query: 142 -DYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
              +K ++R+G+ L  M R +EA    +  LE E +    ++ L++
Sbjct: 153 VGNAKGWWRRGRCLTEMGRLDEAREWVKRALEMEGEEADLVSLLKD 198



>gi|396494528|ref|XP_003844325.1| hypothetical protein LEMA_P019760.1 [Leptosphaeria maculans JN3]
 gi|312220905|emb|CBY00846.1| hypothetical protein LEMA_P019760.1 [Leptosphaeria maculans JN3]
          Length = 239

 Score = 99.0 bits (245), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 52/131 (39%), Positives = 75/131 (57%), Gaps = 1/131 (0%)

Query: 60  SNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLS 119
           S QI+KL+E GN   +  N  +A+KLY+ AI+MA  RP WEP     +EVS  LSNR+ +
Sbjct: 103 SAQISKLRESGNAEFRKGNAGQAVKLYTLAIDMALGRPHWEPSGLVREEVSSLLSNRAQA 162

Query: 120 YIFLEQWVNAYVDAEWGIRIKP-DYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNE 178
            +  + W    VDAE  + +K    +K ++R+GK L+ M R +EA    + GLEFE   +
Sbjct: 163 NMAQQNWAEGAVDAEASVEMKKVGNAKGWWRRGKCLLEMGRLDEAEQWVKQGLEFEATEQ 222

Query: 179 SFINALEEARK 189
             +N   E  K
Sbjct: 223 DLVNLKAEIEK 233



>gi|402081460|gb|EJT76605.1| tetratricopeptide repeat domain-containing protein [Gaeumannomyces
           graminis var. tritici R3-111a-1]
          Length = 206

 Score = 99.0 bits (245), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 54/162 (33%), Positives = 85/162 (52%), Gaps = 4/162 (2%)

Query: 29  DYDFKPLNTLHKSLIPIKGNIPPPNYINQNL---SNQITKLKEEGNTYHKSQNYSEAIKL 85
           D +   LN LH+SL+ ++   P P          S  ++KL++ GN+  +   Y+EA+K 
Sbjct: 32  DAELATLNQLHRSLLALETPHPVPPPPIPVNPKRSANVSKLRDSGNSEFRKARYAEAVKF 91

Query: 86  YSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIK-PDYS 144
           Y+  ++MA  RP WEP +   +E +  L+NR+  ++ L  W    VDAE  +  K     
Sbjct: 92  YTLGVQMALTRPLWEPQQLVREEAAGLLANRAQCHMALRCWAEGAVDAEASVEAKRAGNP 151

Query: 145 KAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
           KA++R+G+ LM M R EEA      GLE E +    +  L+E
Sbjct: 152 KAWWRRGRCLMEMGRLEEAREWVGKGLEMEGEENELVALLKE 193



>gi|119180058|ref|XP_001241536.1| hypothetical protein CIMG_08699 [Coccidioides immitis RS]
 gi|392866584|gb|EAS27786.2| F-box domain-containing protein [Coccidioides immitis RS]
          Length = 209

 Score = 99.0 bits (245), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 55/150 (36%), Positives = 90/150 (60%), Gaps = 3/150 (2%)

Query: 31  DFKPLNTLHKSLIPIKGNIPPPNYINQNL--SNQITKLKEEGNTYHKSQNYSEAIKLYSS 88
           +   LN+LH+S++ +     PP     N   S Q++KL++  NT ++   ++EAI+LYS 
Sbjct: 35  ELDALNSLHRSILNLDSPNVPPPPRPVNPKRSAQVSKLRDSANTAYRKSAFAEAIRLYSY 94

Query: 89  AIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDY-SKAY 147
           AI+MA QRP WEP     +E++   SNR+ +++  +QW   +VDA+  I    +  +KA+
Sbjct: 95  AIDMAMQRPAWEPLGLVREELAPLYSNRAQAHMSQQQWPEGWVDAQLSIECNDETNTKAW 154

Query: 148 FRKGKALMGMKRYEEAVHAFEIGLEFEPKN 177
           +R GK L+ M R+EEA+   + GLE E + 
Sbjct: 155 WRGGKCLIEMGRWEEAIDWLQKGLEAEGRG 184



>gi|169624116|ref|XP_001805464.1| hypothetical protein SNOG_15310 [Phaeosphaeria nodorum SN15]
 gi|111056123|gb|EAT77243.1| hypothetical protein SNOG_15310 [Phaeosphaeria nodorum SN15]
          Length = 203

 Score = 99.0 bits (245), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 62/168 (36%), Positives = 91/168 (54%), Gaps = 4/168 (2%)

Query: 29  DYDFKPLNTLHKSLI---PIKGNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKL 85
           + + + LN LH++L+      G  PPP  +N   S QI KL+E GN   +  N+  A+KL
Sbjct: 32  NAELEALNALHRNLLNVETPTGTPPPPVPVNPKRSAQIGKLRESGNAEFRKGNHGSAVKL 91

Query: 86  YSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKP-DYS 144
           Y  AI+MA  RP WEP     +EVS  LSNR+ + +  + W    +DAE  + +K    +
Sbjct: 92  YGLAIDMALGRPSWEPSGLVREEVSSLLSNRAQANMAQQLWAEGAIDAEASVEMKKVGNA 151

Query: 145 KAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEEARKLAG 192
           K ++R+GK L+ M R EEA    + GLEFE   +  +   +E  K  G
Sbjct: 152 KGWWRRGKCLLEMGRLEEAEQWVKQGLEFEATEQDLVQLKDEIEKKKG 199



>gi|70998432|ref|XP_753938.1| conserved hypothetical protein [Aspergillus fumigatus Af293]
 gi|66851574|gb|EAL91900.1| conserved hypothetical protein [Aspergillus fumigatus Af293]
 gi|159126328|gb|EDP51444.1| conserved hypothetical protein [Aspergillus fumigatus A1163]
          Length = 212

 Score = 99.0 bits (245), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 84/150 (56%), Gaps = 3/150 (2%)

Query: 31  DFKPLNTLHKSLIPIKGNIPPPNYINQNL--SNQITKLKEEGNTYHKSQNYSEAIKLYSS 88
           + + LN LH+SLI +     PP  +  N   S QITKL++  N  ++  NY+EA+KLY+ 
Sbjct: 41  ELQALNNLHRSLIALDAPNIPPPPLPVNPKRSAQITKLRDTANQAYRKSNYAEAVKLYTY 100

Query: 89  AIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKP-DYSKAY 147
           AI+MA  RP WEP      E+S   +NRS +++  + W    +DA+     KP    KA+
Sbjct: 101 AIDMALSRPGWEPVNLARDELSGLYANRSQAHMAQQAWPEGMIDAKASCDCKPIGNVKAW 160

Query: 148 FRKGKALMGMKRYEEAVHAFEIGLEFEPKN 177
           +R GK L  M R+EEA    E GL+ E K 
Sbjct: 161 WRAGKCLAEMGRWEEAKTILERGLDIEGKT 190



>gi|471567477|gb|EMR67435.1| putative translocation protein sec72 protein [Eutypa lata UCREL1]
          Length = 211

 Score = 98.6 bits (244), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 90/158 (56%), Gaps = 5/158 (3%)

Query: 31  DFKPLNTLHKSLIPIKG---NIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYS 87
           + + LN LH+SL+ ++G     PPP  +N   S  ITKL+E GN   +    +EA+KLY 
Sbjct: 35  ELEALNALHRSLLTVEGASGVPPPPLPVNPKRSANITKLRESGNGEVRKGRPAEAVKLYG 94

Query: 88  SAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKP-DYSKA 146
             ++MA  RP WEP     +EV+   +NR+ + + L++W +A VDAE  +  K     KA
Sbjct: 95  LGLQMALGRPLWEPQGLVREEVAALYANRAQARMALQRWADAAVDAEASVEAKRVGNGKA 154

Query: 147 YFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINAL 184
           ++R+G+ L+ M R +EA      GLE E  +E  + AL
Sbjct: 155 WWRRGRCLLEMGRLDEAKEWVGRGLELEG-DEGELAAL 191



>gi|255949276|ref|XP_002565405.1| Pc22g14850 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211592422|emb|CAP98773.1| Pc22g14850 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 214

 Score = 98.6 bits (244), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 59/149 (39%), Positives = 84/149 (56%), Gaps = 3/149 (2%)

Query: 31  DFKPLNTLHKSLIPI--KGNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSS 88
           + + LN LH++LI +      P P  +N   S QI+KL++  N  H+  NY EAIKLYS 
Sbjct: 41  ELEELNQLHRALISLDPPNIPPAPLPLNPKRSAQISKLRDSANAAHRKSNYEEAIKLYSY 100

Query: 89  AIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKP-DYSKAY 147
           AI+MA  RP WEP     +E++   +NR+ +++ L+ W  A VDA+  +  KP    KA+
Sbjct: 101 AIDMALSRPGWEPVGVAREELAGLYANRAQAHMALQAWPEALVDAKSSVDSKPIGNVKAW 160

Query: 148 FRKGKALMGMKRYEEAVHAFEIGLEFEPK 176
           +R  K L  M RYEEA       L+ E K
Sbjct: 161 WRIAKCLAEMSRYEEARKFLHKALDIEGK 189



>gi|189190512|ref|XP_001931595.1| tetratricopeptide repeat domain containing protein [Pyrenophora
           tritici-repentis Pt-1C-BFP]
 gi|187973201|gb|EDU40700.1| tetratricopeptide repeat domain containing protein [Pyrenophora
           tritici-repentis Pt-1C-BFP]
          Length = 201

 Score = 98.2 bits (243), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 61/165 (36%), Positives = 91/165 (55%), Gaps = 4/165 (2%)

Query: 29  DYDFKPLNTLHKSLI---PIKGNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKL 85
           + +   LN LH++L+      G  PPP  +N   S QI KL+E GN  +K   +  AIK 
Sbjct: 31  ETELAALNALHRNLLLVETPTGTPPPPVPVNPKRSAQIGKLRESGNAEYKKGQHGAAIKF 90

Query: 86  YSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKP-DYS 144
           Y+ AI+MA  RP WEP     +E+S  LSNR+ + + ++ W    VDAE  + +K    +
Sbjct: 91  YTLAIDMALARPSWEPSGLVREELSGLLSNRAQANMSMQNWAEGSVDAEASVEMKKVGNA 150

Query: 145 KAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEEARK 189
           KA++R+GK L+ M R +EA    + GLEFE   +  +   +E  K
Sbjct: 151 KAWWRRGKCLLEMGRLDEAEAWVKTGLEFEATEQDLVGLKDEIEK 195



>gi|452000151|gb|EMD92613.1| hypothetical protein COCHEDRAFT_1224398 [Bipolaris maydis C5]
 gi|477591236|gb|ENI08309.1| hypothetical protein COCC4DRAFT_189979 [Bipolaris maydis ATCC
           48331]
          Length = 202

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 60/163 (36%), Positives = 91/163 (55%), Gaps = 4/163 (2%)

Query: 24  TCKDCDYDFKPLNTLHKSLI---PIKGNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYS 80
           T    + + + LN LH++L+      G  PPP  +N   S QI KL+E GN   +  N+ 
Sbjct: 27  TSNVVEKELEALNNLHRNLVHVETPTGTPPPPVPVNPKRSAQIGKLRENGNAEFRKGNHD 86

Query: 81  EAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIK 140
            A K+Y+ AI+MA  RP WEP     +EVS  LSNR+ + +  ++W    +DAE  + +K
Sbjct: 87  AAAKMYTLAIDMALARPAWEPSGLVREEVSGLLSNRAQANMAQQKWAEGAIDAEASVEMK 146

Query: 141 P-DYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFIN 182
               +KA++R+GK L+ M R EEA    + GLEFE   +  ++
Sbjct: 147 KVGNAKAWWRRGKCLLEMGRLEEAETWVKQGLEFEATEQDLVS 189



>gi|406698438|gb|EKD01675.1| hypothetical protein A1Q2_04046 [Trichosporon asahii var. asahii
           CBS 8904]
          Length = 286

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 63/196 (32%), Positives = 96/196 (48%), Gaps = 15/196 (7%)

Query: 1   MSYNLLDLIVDGDN-------VYCRQHRLETCKDCDYDFKPLNTLH---KSLIPIKGNIP 50
           + + L+D+ + G         V C +H+   C+ C  +F PLN +H   +S  P     P
Sbjct: 55  VPFTLVDVPLPGSQPPQTQQMVVCAEHKAPVCETCSVNFTPLNYMHQFMRSAPPEAIPPP 114

Query: 51  PPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVS 110
           P      + +  I + KE GN      N   AI+ YS + +MA  RP WE    +  E +
Sbjct: 115 PQVQPPPHRAEAIKQAKEAGNG-----NIPGAIQNYSRSADMALSRPPWELAAISRDETA 169

Query: 111 VCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIG 170
           + L NRS ++     + NA  DA+  I +K  ++K +FR+ +AL GM R EEA  A   G
Sbjct: 170 IALCNRSAAFAAAGAFTNALADADAVIALKRPWTKGHFRRARALAGMGRLEEARQAIVDG 229

Query: 171 LEFEPKNESFINALEE 186
           L+FEP  +   + L E
Sbjct: 230 LQFEPDEKELNDVLRE 245



>gi|302897605|ref|XP_003047679.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gi|256728610|gb|EEU41966.1| predicted protein [Nectria haematococca mpVI 77-13-4]
          Length = 202

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 91/160 (56%), Gaps = 4/160 (2%)

Query: 31  DFKPLNTLHKSLIPIK---GNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYS 87
           + + LN LH+SL+ I+   G  PPP  +N   +  +TKL++ GN  ++   Y++AIK Y+
Sbjct: 33  ELETLNALHRSLLNIETPSGAPPPPIPVNPKRTANVTKLRDSGNAEYRKGKYTDAIKFYT 92

Query: 88  SAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIK-PDYSKA 146
             ++MA  RP WEP     +EVS  L+NR+ +++ L+ W    VDA   +  +    +KA
Sbjct: 93  LGLQMAMTRPMWEPAALVREEVSSLLANRAQAHMALQNWAEGAVDAHASVEARWVGNAKA 152

Query: 147 YFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
           ++R+G+ L  M R EEA    + GLE E +    +  L++
Sbjct: 153 WWRRGRCLSEMGRLEEARDWVKRGLEVEGEEAELVQLLKD 192



>gi|154316101|ref|XP_001557372.1| hypothetical protein BC1G_03635 [Botryotinia fuckeliana B05.10]
 gi|347836463|emb|CCD51035.1| similar to tetratricopeptide repeat domain protein [Botryotinia
           fuckeliana T4]
 gi|472236522|gb|EMR81453.1| putative translocation protein sec72 protein [Botryotinia
           fuckeliana BcDW1]
          Length = 201

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 60/163 (36%), Positives = 89/163 (54%), Gaps = 2/163 (1%)

Query: 26  KDCDYDFKPLNTLHKSLIPIKGNIPPPNYINQ-NLSNQITKLKEEGNTYHKSQNYSEAIK 84
           K  + + + +NTL ++L+ I+  IPPP        S  ITKL+E GN   +   + EAIK
Sbjct: 28  KALNEELEEINTLCRTLLAIESPIPPPPVPVNPKRSAGITKLRESGNGEFRKGRHGEAIK 87

Query: 85  LYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIK-PDY 143
           +Y+  +EMA +RP WEP      EVS   +NR+ +++ L+ WV   +DAE  +  K    
Sbjct: 88  IYTLGLEMALKRPLWEPCGLVRDEVSGLYANRAQAHMALQNWVEGALDAESSVEAKRGGN 147

Query: 144 SKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
           +KA++R+GK LM M R +EA      GLE E      +  L E
Sbjct: 148 AKAWWRRGKCLMEMGRLDEAKEWLGRGLEMENNEGDLVALLRE 190



>gi|482812505|gb|EOA89224.1| hypothetical protein SETTUDRAFT_105417 [Setosphaeria turcica Et28A]
          Length = 202

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 61/165 (36%), Positives = 93/165 (56%), Gaps = 4/165 (2%)

Query: 29  DYDFKPLNTLHKSLI---PIKGNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKL 85
           + + + LN LH++L+      G  PPP  +N   S QI KL+E GN   +  ++  A KL
Sbjct: 32  EKELEALNNLHRNLLDVGTPTGTPPPPVPVNPKRSAQIGKLRESGNAEFRKGHHDAAAKL 91

Query: 86  YSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKP-DYS 144
           Y+ AI+MA  RP WEP     +EVS  LSNR+ + +  ++W    +DAE  + +K    +
Sbjct: 92  YALAIDMALARPAWEPSGLVREEVSGLLSNRAQANMAQQKWAEGAIDAEASVEMKKVGNA 151

Query: 145 KAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEEARK 189
           KA++R+GK L+ M R EEA    + GLEFE   +  ++  +E  K
Sbjct: 152 KAWWRRGKCLLEMGRLEEAELWVKQGLEFEATEQDLVSLKDEIEK 196



>gi|451854238|gb|EMD67531.1| hypothetical protein COCSADRAFT_290169 [Bipolaris sorokiniana
           ND90Pr]
          Length = 202

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 63/174 (36%), Positives = 97/174 (55%), Gaps = 5/174 (2%)

Query: 24  TCKDCDYDFKPLNTLHKSLI---PIKGNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYS 80
           T    + + + LN LH++L+      G  PPP  +N   S QI KL+E GN   +  N+ 
Sbjct: 27  TSNVVEKELEALNNLHRNLLHVETPTGTPPPPVPVNPKRSAQIGKLRENGNAEFRKGNHD 86

Query: 81  EAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIK 140
            A K+Y+ AI+MA  RP WEP     +E+S  LSNR+ + +  ++W    +DAE  + +K
Sbjct: 87  AAAKMYTLAIDMALARPAWEPSGLVREELSGLLSNRAQANMAQQKWAEGGIDAEASVEMK 146

Query: 141 P-DYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE-ARKLAG 192
               +KA++R+GK L+ M R +EA    + GLEFE   +  ++  EE  RK+ G
Sbjct: 147 KVGNAKAWWRRGKCLLEMGRLDEAETWVKQGLEFEATEQDLVSLKEEIERKIRG 200



>gi|367038253|ref|XP_003649507.1| hypothetical protein THITE_2108073 [Thielavia terrestris NRRL 8126]
 gi|346996768|gb|AEO63171.1| hypothetical protein THITE_2108073 [Thielavia terrestris NRRL 8126]
          Length = 206

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 56/167 (33%), Positives = 84/167 (50%), Gaps = 4/167 (2%)

Query: 24  TCKDCDYDFKPLNTLHKSLIPIKGNIPPPNYINQ---NLSNQITKLKEEGNTYHKSQNYS 80
             K  + +   LN LH+SL  ++     P          S  + KL+E GN  ++ Q Y+
Sbjct: 26  ASKALEAELAALNALHRSLHALEAPHVVPPPPVPVNPKRSAHLNKLRETGNAEYRKQRYA 85

Query: 81  EAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIK 140
           +AIK Y+  ++MA  RP WEP +   +E     SNR+ +++ L  W  A  DAE  +  K
Sbjct: 86  DAIKFYTLGLQMALTRPAWEPSQLVREEAHALYSNRAQAHMQLGAWPEAAADAEASVEAK 145

Query: 141 PDY-SKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
               +KA+FR+G+ L+ M R  EA      GLEFE + +  I  L E
Sbjct: 146 RQGNAKAWFRRGRCLVEMGRLAEAREWVARGLEFEGEEKELIELLRE 192



>gi|358400157|gb|EHK49488.1| hypothetical protein TRIATDRAFT_254812 [Trichoderma atroviride IMI
           206040]
          Length = 209

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 53/166 (31%), Positives = 91/166 (54%), Gaps = 12/166 (7%)

Query: 31  DFKPLNTLHKSLIPIKGNIPP---------PNYINQNLSNQITKLKEEGNTYHKSQNYSE 81
           +   LNTLH++++ I+  +PP         P  +N   +  ++KL++ GN  ++ Q Y+E
Sbjct: 35  ELDKLNTLHRAILSIE--VPPGAIPLVPPPPIPVNPKRTANVSKLRDNGNAEYRKQKYAE 92

Query: 82  AIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKP 141
           AIKLY+  IE A QRP WEP     +EVS+  +NR+ +++ +  W    VDAE  +  + 
Sbjct: 93  AIKLYTQGIEAALQRPLWEPAALVREEVSMLYANRAQAHMGMSNWPEGAVDAEASVEARR 152

Query: 142 -DYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
              +K ++R+G+ L  M R +EA    +  LE E +    +  L++
Sbjct: 153 VGNAKGWWRRGRCLTEMGRLDEAREWVKRALEMEGEEADLMTLLKD 198



>gi|358376357|dbj|GAA92917.1| chaperone binding protein [Aspergillus kawachii IFO 4308]
          Length = 214

 Score = 95.9 bits (237), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 58/149 (38%), Positives = 87/149 (58%), Gaps = 3/149 (2%)

Query: 31  DFKPLNTLHKSLIPI--KGNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSS 88
           +   LN+LH+SLI +      PPP  IN   S QITKL++  NT ++  N++EA++LY+ 
Sbjct: 41  ELTHLNSLHRSLISLDPPNIPPPPLPINPKRSAQITKLRDSANTAYRKSNHAEAVRLYTY 100

Query: 89  AIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYS-KAY 147
           AI+MA  RP WEP      E++   +NR+ +++    W    VDA   +  KP  + KA+
Sbjct: 101 AIDMALGRPGWEPVTLARDELAGLYANRAQAWMSQRAWPEGLVDARCSVESKPVANVKAW 160

Query: 148 FRKGKALMGMKRYEEAVHAFEIGLEFEPK 176
           +R G+ L+ M R+EEA    E GLE E +
Sbjct: 161 WRGGRCLVEMGRWEEAKGMVEKGLEIEGR 189



>gi|407916872|gb|EKG10202.1| Tetratricopeptide-like helical [Macrophomina phaseolina MS6]
          Length = 202

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 60/154 (38%), Positives = 87/154 (56%), Gaps = 5/154 (3%)

Query: 35  LNTLHKSLIPIKG---NIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIE 91
           LN LH+  + ++      PPP  +N   S QITKL+E GN   K   Y+EA K Y+ AI+
Sbjct: 36  LNQLHRQFLTLETPGQTPPPPVPVNPKRSAQITKLRESGNASFKKGQYAEAAKFYTLAID 95

Query: 92  MAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKP-DYSKAYFRK 150
           MA  RP WEP     +E S   +NR+ +Y+ L+ W +  VDAE  + +K    +KA++R+
Sbjct: 96  MALARPQWEPSGLVREETSALYANRAQAYMSLQDWASGAVDAEISVDLKRVQNAKAWWRR 155

Query: 151 GKALMGMKRYEEAVHAFEIGLEFEPKNESFINAL 184
           G+ L+ M R +EA        EFEP  E+ + AL
Sbjct: 156 GRCLLEMGRAKEARDWVAQAREFEPA-EADLQAL 188



>gi|406859969|gb|EKD13030.1| tetratricopeptide repeat domain containing protein [Marssonina
           brunnea f. sp. 'multigermtubi' MB_m1]
          Length = 200

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 59/157 (37%), Positives = 84/157 (53%), Gaps = 2/157 (1%)

Query: 32  FKPLNTLHKSLIPIKGNIPPPNYINQ-NLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAI 90
              LN LHK+L+ I+  IPPP        S QITKL+E GN   K   +++AIK+Y+  +
Sbjct: 34  LSSLNELHKTLLSIESPIPPPPVPVNPKRSAQITKLRESGNASFKQGKHNDAIKMYTLGL 93

Query: 91  EMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDY-SKAYFR 149
           +MA  RP WEP      EV+   +NR+ +++ L  W    +DAE  I  K    +KA++R
Sbjct: 94  QMALGRPLWEPCGLVRDEVAGLYANRAQAHMALSNWPEGSIDAEASIEAKKGANAKAWWR 153

Query: 150 KGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
           KG+ LM M R  EA      GLE E      +  L++
Sbjct: 154 KGRCLMEMGRLNEAKDWISRGLEMEGSEADLVAILKD 190



>gi|240275637|gb|EER39151.1| F-box protein [Ajellomyces capsulatus H143]
 gi|325091470|gb|EGC44780.1| F-box domain-containing protein [Ajellomyces capsulatus H88]
          Length = 214

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 98/173 (56%), Gaps = 10/173 (5%)

Query: 29  DYDFKPLNTLHKSLIPIKGNIPPPNYINQNL--SNQITKLKEEGNTYHKSQNYSEAIKLY 86
           D + + LN LH++L+ +     PP     N   S QI KL+E  NT  +  ++ EA+KLY
Sbjct: 34  DSELESLNQLHRALLNLDSPNTPPPPKPVNPKRSAQIAKLREAANTAFRKSSFGEAVKLY 93

Query: 87  SSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKP-DYSK 145
           + AI+MA  RP WE  +   +E+    +NR+ +Y+  +QW  AYVDA+  + I P +  K
Sbjct: 94  TYAIDMAIGRPTWEHVDLLREELPPLFTNRAQAYMAQQQWPEAYVDAKSSVEIMPSNNGK 153

Query: 146 AYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEEARKLAGI-TDLE 197
           +++R G+ L+ M R++EA      GL+ E       N+ E A++L G+  D+E
Sbjct: 154 SWWRGGRCLIEMGRWQEATEWISNGLDAEG------NSSEAAKELKGLMVDVE 200



>gi|485926295|gb|EOD50592.1| putative translocation protein sec72 protein [Neofusicoccum parvum
           UCRNP2]
          Length = 202

 Score = 95.5 bits (236), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 87/152 (57%), Gaps = 4/152 (2%)

Query: 35  LNTLHKSLIPIKG---NIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIE 91
           LN+LH+ ++ ++      PPP  +N   S  +TKL+E GN   K   ++EA K Y+ AI+
Sbjct: 36  LNSLHRQILTLETPGQTPPPPVPVNPKRSANVTKLRESGNAAFKKGQHAEAAKFYTLAID 95

Query: 92  MAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKP-DYSKAYFRK 150
           MA QRP WEP     +E+S   +NR+ +Y+ L+ W    VDAE  + +K    +KA++R+
Sbjct: 96  MAMQRPPWEPSALVREELSALYANRAQAYMSLQSWAEGSVDAETSVDLKRVQNAKAWWRR 155

Query: 151 GKALMGMKRYEEAVHAFEIGLEFEPKNESFIN 182
           G+ L+ M R +EA        EFEP+    ++
Sbjct: 156 GRCLLEMGRAKEARDWVAQAREFEPQEADLLS 187



>gi|225562029|gb|EEH10309.1| F-box domain-containing protein [Ajellomyces capsulatus G186AR]
          Length = 346

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 98/173 (56%), Gaps = 10/173 (5%)

Query: 29  DYDFKPLNTLHKSLIPIKGNIPPPNYINQNL--SNQITKLKEEGNTYHKSQNYSEAIKLY 86
           D + + LN LH++L+ +     PP     N   S QI KL+E  NT  +  ++ EA+KLY
Sbjct: 169 DSELESLNQLHRALLNLDSPNTPPPPKPVNPKRSAQIAKLREAANTAFRKSSFGEAVKLY 228

Query: 87  SSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKP-DYSK 145
           + AI+MA  RP WE  +   +E+    +NR+ +Y+  +QW  AYVDA+  + I P +  K
Sbjct: 229 TYAIDMAIGRPTWEHVDLLREELPPLFTNRAQAYMAQQQWPEAYVDAKSSVEIMPSNNGK 288

Query: 146 AYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEEARKLAGI-TDLE 197
           +++R G+ L+ M R++EA      GL+ E       N+ E A++L G+  D+E
Sbjct: 289 SWWRGGRCLIEMGRWQEATEWISNGLDAEG------NSSEAAKELKGLMVDVE 335



>gi|121712808|ref|XP_001274015.1| F-box domain protein [Aspergillus clavatus NRRL 1]
 gi|119402168|gb|EAW12589.1| F-box domain protein [Aspergillus clavatus NRRL 1]
          Length = 212

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 86/149 (57%), Gaps = 3/149 (2%)

Query: 31  DFKPLNTLHKSLIPI--KGNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSS 88
           + + LN LH+SLI +      PPP  IN   S QI+KL++  N  ++  NY EA+KLY+ 
Sbjct: 41  ELQALNHLHRSLISLDPPNIPPPPLPINPKRSAQISKLRDTANQAYRKSNYPEAVKLYTY 100

Query: 89  AIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYS-KAY 147
           AI+MA  RP WEP      E+S   +NR+ +++  + W    +DA+  +  KP  + KA+
Sbjct: 101 AIDMALSRPGWEPVNLVRDELSALYANRAQAHMAQQAWPEGMLDAKSSVDCKPVANVKAW 160

Query: 148 FRKGKALMGMKRYEEAVHAFEIGLEFEPK 176
           +R GK L  M R+EEA    E GLE E K
Sbjct: 161 WRAGKCLSEMGRWEEAKTILERGLEVEGK 189



>gi|346319419|gb|EGX89021.1| tetratricopeptide repeat domain containing protein [Cordyceps
           militaris CM01]
          Length = 204

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 55/167 (32%), Positives = 92/167 (55%), Gaps = 4/167 (2%)

Query: 24  TCKDCDYDFKPLNTLHKSLIPI---KGNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYS 80
           T +  + +   LN LH++++ +       PPP  +N   + Q+TK+++ GN  ++ Q Y 
Sbjct: 26  TSRALNAELATLNELHRAMLALDTPGQVPPPPIPVNPKRTAQVTKMRDNGNNEYRKQKYD 85

Query: 81  EAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIK 140
           EA+K+YS  I+MA  RP WEP     +EVS  L+NR+ +++ L  W    VD    +  +
Sbjct: 86  EAVKMYSLGIQMALGRPQWEPSALVREEVSGLLANRAQAHMALLNWPEGAVDGLASVEAR 145

Query: 141 P-DYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
               +KA++R+G+ L  M R EEA    + GLE E +    ++ L+E
Sbjct: 146 RVGNAKAWWRRGRCLFEMARLEEAREWVKEGLEVEGEEADLVSLLKE 192



>gi|156037464|ref|XP_001586459.1| hypothetical protein SS1G_12445 [Sclerotinia sclerotiorum 1980]
 gi|154697854|gb|EDN97592.1| hypothetical protein SS1G_12445 [Sclerotinia sclerotiorum 1980
           UF-70]
          Length = 249

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 59/165 (35%), Positives = 89/165 (53%), Gaps = 4/165 (2%)

Query: 26  KDCDYDFKPLNTLHKSLIPIK---GNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEA 82
           K  + + + +N L ++LI ++   G  PPP  +N   S  ITKL+E GN   +   + EA
Sbjct: 74  KALNEELETINNLCRTLIAMESPTGIPPPPVPVNPKRSANITKLRESGNGEFRKGRHGEA 133

Query: 83  IKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIK-P 141
           IK+Y+  ++MA  RP WEP      EVS   +NR+ +++ L+ WV   +DAE  +  K  
Sbjct: 134 IKMYTLGLQMALNRPLWEPCGLVRDEVSGLYANRAQAHMALQNWVEGAMDAECSVEAKRG 193

Query: 142 DYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
             +KA++R+G+ LM M R EEA      GLE E      +  L E
Sbjct: 194 GNAKAWWRRGRCLMEMGRLEEAREWLGRGLEMENNEGDLVALLRE 238



>gi|242818055|ref|XP_002487051.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500]
 gi|218713516|gb|EED12940.1| conserved hypothetical protein [Talaromyces stipitatus ATCC 10500]
          Length = 211

 Score = 95.1 bits (235), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 63/171 (36%), Positives = 93/171 (54%), Gaps = 10/171 (5%)

Query: 31  DFKPLNTLHKSLIPIKGNIPPPNYINQNL--SNQITKLKEEGNTYHKSQNYSEAIKLYSS 88
           + + LNTLH++LI +     PP  +  N   S QITKL++  NT  +  NY+EAIKLY  
Sbjct: 41  ELQQLNTLHRALIGLDSPNVPPPPLPINPKRSAQITKLRDTANTAFRKSNYAEAIKLYGY 100

Query: 89  AIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKP-DYSKAY 147
           AI+MA  RP WEP      E+S   +NR+ +Y+  + W   ++D++     KP    KA+
Sbjct: 101 AIDMAISRPAWEPVNLVRDELSGLYANRAQAYMSQQSWPEGWIDSKCSAECKPIGNVKAW 160

Query: 148 FRKGKALMGMKRYEEAVHAFEIGLEFE-PKNE------SFINALEEARKLA 191
           +R GK L+ M R++EA    E  L  E P +E      + +  +EE  K A
Sbjct: 161 WRGGKCLVEMGRWDEARAWVEQALGIEGPASEGGKELVALLAEVEEGSKRA 211



>gi|494830054|gb|EON66623.1| hypothetical protein W97_05869 [Coniosporium apollinis CBS 100218]
          Length = 206

 Score = 95.1 bits (235), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 57/160 (35%), Positives = 86/160 (53%), Gaps = 4/160 (2%)

Query: 31  DFKPLNTLHKSLIPI---KGNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYS 87
           +   LN LH+SL+ +    G  PPP  +N   S QI KL+E GN   +   + +AI++YS
Sbjct: 36  ELTALNLLHRSLLSLDTPNGVPPPPVPVNPKRSAQIGKLRETGNASFRKGAHGDAIRMYS 95

Query: 88  SAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKP-DYSKA 146
             I+MA  RP WEP     +EVS   +NR+ +++ L+ W    VDAE  + +K    +K 
Sbjct: 96  LGIDMALGRPGWEPSGLVREEVSGLYANRAQAHMALQHWAEGAVDAESSVEMKRVGNAKG 155

Query: 147 YFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
           ++R+G+ L  M R EEA       LEFE   +  +  + E
Sbjct: 156 WWRRGRCLFEMGRLEEAREWVGQALEFEAGEQDLVGLMRE 195



>gi|342877687|gb|EGU79133.1| hypothetical protein FOXB_10371 [Fusarium oxysporum Fo5176]
 gi|475668367|gb|EMT66154.1| Translocation protein sec72 [Fusarium oxysporum f. sp. cubense race
           4]
 gi|477514546|gb|ENH66924.1| Translocation protein sec72 [Fusarium oxysporum f. sp. cubense race
           1]
          Length = 202

 Score = 95.1 bits (235), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 94/165 (56%), Gaps = 6/165 (3%)

Query: 3   YNLLDLIVDGDNVYCRQHRLETCKDCDYDFKPLNTLHKSLIPIK---GNIPPPNYINQNL 59
           ++LL L +D  +        +  +  + + + LNTLH+SL+ ++   G  PPP  +N   
Sbjct: 7   FDLLPLQMDPQSKAISSQ--QPSRTLNAELEALNTLHRSLLNVESPTGAPPPPVPVNPKR 64

Query: 60  SNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLS 119
           + Q+TKL++ GN  ++   Y EAIK Y+   +MA QRP WEP +   +E+S  L+NR+ +
Sbjct: 65  TAQVTKLRDSGNNEYRKGKYPEAIKYYTLGFQMAMQRPMWEPSQLVREEISGILANRAQA 124

Query: 120 YIFLEQWVNAYVDAEWGIRIK-PDYSKAYFRKGKALMGMKRYEEA 163
           ++ ++ W    VDA   +  +    +KA++R+G+ L  M R EEA
Sbjct: 125 HMAMQNWAEGAVDAHASVEARWVGNAKAWWRRGRCLAEMGRLEEA 169



>gi|154283823|ref|XP_001542707.1| predicted protein [Ajellomyces capsulatus NAm1]
 gi|150410887|gb|EDN06275.1| predicted protein [Ajellomyces capsulatus NAm1]
          Length = 227

 Score = 95.1 bits (235), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 60/173 (34%), Positives = 98/173 (56%), Gaps = 10/173 (5%)

Query: 29  DYDFKPLNTLHKSLIPIKGNIPPPNYINQNL--SNQITKLKEEGNTYHKSQNYSEAIKLY 86
           D + + LN LH++L+ +     PP     N   S Q+ KL+E  NT  +  ++ EA+KLY
Sbjct: 34  DSELESLNRLHRALLNLDSPNTPPPPKPVNPKRSAQVAKLREAANTAFRKSSFGEAVKLY 93

Query: 87  SSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKP-DYSK 145
           + AI+MA  RP WE  +   +E+    +NR+ +Y+  +QW  AYVDA+  + I P +  K
Sbjct: 94  TYAIDMAIGRPTWEHVDLLREELPPLFTNRAQAYMAQQQWPEAYVDAKSSVEIMPSNNGK 153

Query: 146 AYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEEARKLAGI-TDLE 197
           +++R G+ L+ M R++EA      GL+ E       N+ E A++L G+  D+E
Sbjct: 154 SWWRGGRCLIEMGRWQEATEWISNGLDAEG------NSSEAAKELKGLMVDVE 200



>gi|134083805|emb|CAK47138.1| unnamed protein product [Aspergillus niger]
          Length = 194

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 87/150 (58%), Gaps = 3/150 (2%)

Query: 35  LNTLHKSLIPI--KGNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEM 92
           LN LH+SLI +      PPP  IN   S QITKL++  NT ++  N++EA +LY+ AI+M
Sbjct: 45  LNALHRSLISLDPPNIPPPPLPINPKRSAQITKLRDSANTAYRKSNHAEAARLYTYAIDM 104

Query: 93  AFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYS-KAYFRKG 151
           A  RP WEP      E++   +NR+ +++    W    VDA   +  KP  + KA++R G
Sbjct: 105 ALGRPGWEPVTLARDELAGLYANRAQAWMSQRAWPEGLVDARCSVESKPVANVKAWWRGG 164

Query: 152 KALMGMKRYEEAVHAFEIGLEFEPKNESFI 181
           + L+ M R+EEA    E GLE E + E+ +
Sbjct: 165 RCLVEMGRWEEAKGFAEKGLEIEGRKEAAM 194



>gi|408400128|gb|EKJ79213.1| hypothetical protein FPSE_00524 [Fusarium pseudograminearum CS3096]
          Length = 202

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 85/145 (58%), Gaps = 4/145 (2%)

Query: 23  ETCKDCDYDFKPLNTLHKSLIPIK---GNIPPPNYINQNLSNQITKLKEEGNTYHKSQNY 79
           +  +    + + LNTLH+SL+ I+   G  PPP  +N   +  +TKL++ GN  ++   +
Sbjct: 25  KASRSLAAELEALNTLHRSLLTIEHPSGAPPPPVPVNPKRTANVTKLRDSGNNEYRKGKF 84

Query: 80  SEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRI 139
            EAIK Y+  ++MA QRP WEP     +E+S  L+NR+ +++ ++ W    VDA   +  
Sbjct: 85  PEAIKFYTLGVQMAMQRPMWEPAALVREEISGLLANRAQAHMAMQNWAEGAVDAHASVEA 144

Query: 140 K-PDYSKAYFRKGKALMGMKRYEEA 163
           +    +KA++R+G+ L  M R+EEA
Sbjct: 145 RWVGNAKAWWRRGRCLAEMGRFEEA 169



>gi|261197732|ref|XP_002625268.1| tetratricopeptide repeat domain-containing protein [Ajellomyces
           dermatitidis SLH14081]
 gi|239595231|gb|EEQ77812.1| tetratricopeptide repeat domain-containing protein [Ajellomyces
           dermatitidis SLH14081]
 gi|239607648|gb|EEQ84635.1| tetratricopeptide repeat domain-containing protein [Ajellomyces
           dermatitidis ER-3]
 gi|327355693|gb|EGE84550.1| tetratricopeptide repeat domain-containing protein [Ajellomyces
           dermatitidis ATCC 18188]
          Length = 211

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 62/173 (35%), Positives = 94/173 (54%), Gaps = 10/173 (5%)

Query: 29  DYDFKPLNTLHKSLIPIKGNIPPPNYINQNL--SNQITKLKEEGNTYHKSQNYSEAIKLY 86
           D + + LN LH++L+ +     PP     N   S QI KL+E  NT  +  +++EAIKLY
Sbjct: 34  DRELESLNQLHRALLNLDSPNIPPPPKPVNPKRSAQIAKLRETANTAFRKSSFAEAIKLY 93

Query: 87  SSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKP-DYSK 145
           + AI+MA  RP WE       E+    +NR+ +Y+  +QW   YVDA+  + I P +  K
Sbjct: 94  TYAIDMALGRPTWEHVGLVRDELPPLFTNRAQAYMAQQQWAEGYVDAKSSVEISPTNNGK 153

Query: 146 AYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEEARKLAGI-TDLE 197
           A++R G+ L+ M R+EEA      GL+ E          E A++L G+  D+E
Sbjct: 154 AWWRGGRCLIEMGRWEEAKEWISNGLDAEGTRS------EPAKELKGLMVDVE 200



>gi|213408615|ref|XP_002175078.1| translocation protein sec72 [Schizosaccharomyces japonicus yFS275]
 gi|212003125|gb|EEB08785.1| translocation protein sec72 [Schizosaccharomyces japonicus yFS275]
          Length = 193

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 68/113 (60%)

Query: 59  LSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSL 118
           LS Q+ K+K+ GN   K + + EA +LYS A++MA  R  WEP   T +E S  L NR+ 
Sbjct: 60  LSAQVNKMKQTGNDAFKRKKWGEAKRLYSMALKMAASRYRWEPAALTAEETSTLLCNRAA 119

Query: 119 SYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGL 171
           + + LE++  A VDA+  I I+ +Y K Y+RK KAL  M R++EA      GL
Sbjct: 120 AELALEEYPEALVDADAAISIRKNYGKGYYRKAKALEAMHRFDEAKQTANDGL 172



>gi|254568490|ref|XP_002491355.1| Non-essential subunit of Sec63 complex (Sec63p, Sec62p, Sec66p and
           Sec72p) [Komagataella pastoris GS115]
 gi|238031152|emb|CAY69075.1| Non-essential subunit of Sec63 complex (Sec63p, Sec62p, Sec66p and
           Sec72p) [Komagataella pastoris GS115]
 gi|328352131|emb|CCA38530.1| Small glutamine-rich tetratricopeptide repeat-containing protein
           alpha [Komagataella pastoris CBS 7435]
          Length = 195

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 84/154 (54%), Gaps = 3/154 (1%)

Query: 27  DCDYDFKPLNTLHKSLIPIKGNIPPP---NYINQNLSNQITKLKEEGNTYHKSQNYSEAI 83
           D +YD + LNTL   ++  K ++P P      ++ LS+   KL E   +  K+  Y EAI
Sbjct: 21  DLEYDIQQLNTLSGEILANKADVPSPPSKESFDKKLSHMAQKLHESAVSNIKTGKYPEAI 80

Query: 84  KLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDY 143
           KL ++ +EM  +RP +E  + T  E+++ +  R+ +Y+    +  A+ DA+  + + P  
Sbjct: 81  KLLTTGLEMVNRRPKYESFQMTLSEMTIFIVTRADAYMMNGDFEGAFNDADLLVTLLPSI 140

Query: 144 SKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKN 177
              Y R+G AL  M RY +A + FE GL F+P N
Sbjct: 141 PDNYIRRGVALFKMGRYVDAKNNFERGLSFDPDN 174



>gi|500255311|gb|EON98705.1| putative translocation protein sec72 protein [Togninia minima
           UCRPA7]
          Length = 205

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 52/166 (31%), Positives = 88/166 (53%), Gaps = 6/166 (3%)

Query: 2   SYNLLDLIVDGDNVYCRQHRLETCKDCDYDFKPLNTLHKSLIPIKGNIPPPNYINQNL-- 59
           S+ LL L +D  +         + +  + +   LN LH++L+ + G  P P         
Sbjct: 6   SFTLLPLKLDPQSKAV--GSTSSSRALEAELTTLNQLHRALLGLDGGAPVPPPPVPVNPK 63

Query: 60  -SNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSL 118
            S  + KL++ GN  ++   Y+EAIK Y+  ++MA  RP WEP +   +EV+   +NR+ 
Sbjct: 64  RSANVAKLRDSGNGEYRKGKYAEAIKFYTLGLQMALTRPLWEPQQLVREEVASLYANRAQ 123

Query: 119 SYIFLEQWVNAYVDAEWGIRIKP-DYSKAYFRKGKALMGMKRYEEA 163
           +++ L+ W    VDAE  +  K    +KA++R+GK L+ M R EE+
Sbjct: 124 AHMGLQSWAEGAVDAEASVEAKKVGNAKAWWRRGKCLLEMGRLEES 169



>gi|346972603|gb|EGY16055.1| translocation protein sec72 [Verticillium dahliae VdLs.17]
          Length = 203

 Score = 93.6 bits (231), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 55/165 (33%), Positives = 90/165 (54%), Gaps = 4/165 (2%)

Query: 26  KDCDYDFKPLNTLHKSLIPIK---GNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEA 82
           +    + + LNTLH++L+ ++   G  PPP  +N   S  + KL++ GN   +   + +A
Sbjct: 28  RALTTELEALNTLHRTLLGLETPHGIPPPPVPVNPKRSAGVAKLRDSGNGEFRKGKFPDA 87

Query: 83  IKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRI-KP 141
           I+ Y+  I+MA QRP WEP++   +EV+   +NR+ +++ L QW    VDAE  +   K 
Sbjct: 88  IRFYTLGIQMALQRPPWEPNQLVREEVAGLYANRAQAHMALTQWAEGSVDAEASVEARKV 147

Query: 142 DYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
             +KA++R+G+ L  M R EEA      GL  E +    +  L E
Sbjct: 148 GNAKAWWRRGRCLQEMGRLEEAREWVRRGLGMEGEEAELVALLRE 192



>gi|46110437|ref|XP_382276.1| hypothetical protein FG02100.1 [Fusarium graminearum PH-1]
          Length = 202

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 50/144 (34%), Positives = 83/144 (57%), Gaps = 4/144 (2%)

Query: 24  TCKDCDYDFKPLNTLHKSLIPIK---GNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYS 80
             +    + + LNTLH+SL+ I+   G  PPP  +N   +  +TKL++ GN  ++   + 
Sbjct: 26  ASRSLAAELEALNTLHRSLLTIEHPSGAPPPPVPVNPKRTANVTKLRDSGNNEYRKGKFP 85

Query: 81  EAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIK 140
           EAIK Y+  ++MA QRP WEP     +E+S  L+NR+ +++ ++ W    VDA   +  +
Sbjct: 86  EAIKFYTLGVQMAMQRPMWEPAALVREEISGLLANRAQAHMAMQNWAEGAVDAHASVEAR 145

Query: 141 -PDYSKAYFRKGKALMGMKRYEEA 163
               +KA++R+G+ L  M R EEA
Sbjct: 146 WVGNAKAWWRRGRCLAEMGRLEEA 169



>gi|302405479|ref|XP_003000576.1| translocation protein sec72 [Verticillium albo-atrum VaMs.102]
 gi|261360533|gb|EEY22961.1| translocation protein sec72 [Verticillium albo-atrum VaMs.102]
          Length = 203

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 88/160 (55%), Gaps = 4/160 (2%)

Query: 31  DFKPLNTLHKSLIPIK---GNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYS 87
           + + LNTLH++L+ ++   G  PPP  +N   S  + KL++ GN   +   + EAIK Y+
Sbjct: 33  ELEALNTLHRTLLGLETPHGIPPPPVPVNPKRSAGVAKLRDSGNGEFRKGKFPEAIKFYT 92

Query: 88  SAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRI-KPDYSKA 146
             I+MA QRP WEP++   +EV+   +NR+ +++ L QW    VDAE  +   K   +K 
Sbjct: 93  LGIQMALQRPPWEPNQLVREEVAGLYANRAQAHMALTQWAEGSVDAEASVEARKVGNAKG 152

Query: 147 YFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
           ++R+G+ L  M R EEA      GL  E +    +  L +
Sbjct: 153 WWRRGRCLQEMGRLEEAREWVRRGLGMEGEEAELVALLRD 192



>gi|452841662|gb|EME43599.1| hypothetical protein DOTSEDRAFT_72835 [Dothistroma septosporum
           NZE10]
          Length = 204

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 53/153 (34%), Positives = 79/153 (51%), Gaps = 12/153 (7%)

Query: 30  YDFKPLNTLHKSLIPIKGNIPPPNYINQNL-------SNQITKLKEEGNTYHKSQNYSEA 82
           Y+ + LN ++++ + +      PN I           S QITKLK+ GN  +K   Y++A
Sbjct: 30  YEIEELNRMNRAFVAL----DVPNQIPPPPAPVNPKRSVQITKLKDSGNVSYKKGQYADA 85

Query: 83  IKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKP- 141
           +K+Y  AI MA  RP WE      +E+S    NRS + +  + W  A  DAE    +K  
Sbjct: 86  VKMYDLAIRMAVDRPAWEASGLVREELSTLYGNRSQALMAQQAWAEAATDAEIATEMKKV 145

Query: 142 DYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFE 174
              K ++R+G+ L  M R EEA    ++GLEFE
Sbjct: 146 GNVKCWWRRGQCLREMGRLEEATQWVKVGLEFE 178



>gi|400593954|gb|EJP61840.1| translocation protein sec72 [Beauveria bassiana ARSEF 2860]
          Length = 204

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 54/188 (28%), Positives = 97/188 (51%), Gaps = 6/188 (3%)

Query: 3   YNLLDLIVDGDNVYCRQHRLETCKDCDYDFKPLNTLHKSLIPIKGNIPPPNYINQNL--- 59
           ++LL + +  D+      R    +  + +   LN LH++L+ ++     P          
Sbjct: 7   FDLLPITLSSDSKDVLTGR--NSRALNAELAQLNELHRALLALETPGNVPPPPIPVNPKR 64

Query: 60  SNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLS 119
           + Q+TKL++ GN  ++   Y EAIK+Y+  ++MA QRP WEP     +EVS  L+NR+ +
Sbjct: 65  TAQVTKLRDNGNNEYRKGKYDEAIKMYTLGLQMALQRPMWEPSALVREEVSGLLANRAQA 124

Query: 120 YIFLEQWVNAYVDAEWGIRIKP-DYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNE 178
           ++ L  W    VD    +  +    +KA++R+G+ L  M R +EA    + GLE E +  
Sbjct: 125 HMALLNWPEGAVDGLASVEARRVGNAKAWWRRGRCLYEMARLQEAREWVKEGLEVEGEEA 184

Query: 179 SFINALEE 186
             ++ L++
Sbjct: 185 DLVSLLKD 192



>gi|398394142|ref|XP_003850530.1| hypothetical protein MYCGRDRAFT_74369 [Zymoseptoria tritici IPO323]
 gi|339470408|gb|EGP85506.1| hypothetical protein MYCGRDRAFT_74369 [Zymoseptoria tritici IPO323]
          Length = 207

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 60/177 (33%), Positives = 96/177 (54%), Gaps = 8/177 (4%)

Query: 2   SYNLLDLIVDGDNVYCRQHRLETCKDCDYDFKPLNTLHKSLIPIKG---NIPPPNYINQN 58
           ++ LL L++D +          + +    +   LN +H+ ++ ++      PPP  +N  
Sbjct: 10  TFKLLPLVLDPNTKAVSS----SDQSLANELLELNQIHRGMLAVENPSQTPPPPAPVNPK 65

Query: 59  LSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSL 118
            S QITKLKEEGN  +K  +Y+EA+++Y  AI+MA +RP WE      +E+S    NR+ 
Sbjct: 66  RSAQITKLKEEGNKLYKKASYTEALQIYDLAIKMAAERPPWEASGLVREELSTLHGNRAQ 125

Query: 119 SYIFLEQWVNAYVDAEWGIRIKP-DYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFE 174
           + +    W  A VDAE  + +K     KA++R+G+ L  M R EEA    + GL+FE
Sbjct: 126 TLMAQHSWAEAAVDAEIAVEMKKVGNVKAWWRRGQCLKEMGRLEEATEWVKQGLDFE 182



>gi|19115293|ref|NP_594381.1| ER protein translocation subcomplex subunit Sec72 (predicted)
           [Schizosaccharomyces pombe 972h-]
 gi|74675945|sp|O14085.1|SEC72_SCHPO RecName: Full=Translocation protein sec72
 gi|2408058|emb|CAB16260.1| ER protein translocation subcomplex subunit Sec72 (predicted)
           [Schizosaccharomyces pombe]
          Length = 192

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 65/116 (56%)

Query: 56  NQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSN 115
           N  LS Q+ K+K+  N   K + Y EA KLY  A+++A  R  WEP   T +E SV L N
Sbjct: 55  NMALSTQVNKMKQTANEAFKRKKYEEAKKLYGLALQLALNRCTWEPSILTREEASVMLCN 114

Query: 116 RSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGL 171
           R+ + I L Q+  A  DA   ++I+ +Y K Y+RK KAL  M R EEA      GL
Sbjct: 115 RAAAEIALSQFPEALADANAALKIRNNYGKCYYRKAKALEAMHRIEEAKQVVRDGL 170



>gi|429856717|gb|ELA31614.1| tetratricopeptide repeat domain containing protein [Colletotrichum
           gloeosporioides Nara gc5]
          Length = 205

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 51/139 (36%), Positives = 80/139 (57%), Gaps = 6/139 (4%)

Query: 31  DFKPLNTLHKSLIPIK-----GNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKL 85
           +   LN LH+SL+        G  PPP  +N   S  ++KL++ GN     + Y+EA+K 
Sbjct: 33  ELAQLNALHRSLVTSDTTTQHGVPPPPMPVNPKRSANVSKLRDSGNAEFHKKKYAEAVKF 92

Query: 86  YSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRI-KPDYS 144
           Y+  ++MA  RP WEP +   +EV+   +NR+ +++ L+QW    VDAE  +   K   +
Sbjct: 93  YTLGLQMALTRPLWEPSQLVREEVASLYANRAQAHMALQQWAEGSVDAEASVEARKVGNA 152

Query: 145 KAYFRKGKALMGMKRYEEA 163
           KA++R+G+ LM M R EEA
Sbjct: 153 KAWWRRGRCLMEMGRLEEA 171



>gi|317036866|ref|XP_001398239.2| tetratricopeptide repeat domain protein [Aspergillus niger CBS
           513.88]
          Length = 215

 Score = 92.4 bits (228), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 84/145 (57%), Gaps = 3/145 (2%)

Query: 35  LNTLHKSLIPI--KGNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEM 92
           LN LH+SLI +      PPP  IN   S QITKL++  NT ++  N++EA +LY+ AI+M
Sbjct: 45  LNALHRSLISLDPPNIPPPPLPINPKRSAQITKLRDSANTAYRKSNHAEAARLYTYAIDM 104

Query: 93  AFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYS-KAYFRKG 151
           A  RP WEP      E++   +NR+ +++    W    VDA   +  KP  + KA++R G
Sbjct: 105 ALGRPGWEPVTLARDELAGLYANRAQAWMSQRAWPEGLVDARCSVESKPVANVKAWWRGG 164

Query: 152 KALMGMKRYEEAVHAFEIGLEFEPK 176
           + L+ M R+EEA    E GLE E +
Sbjct: 165 RCLVEMGRWEEAKGFAEKGLEIEGR 189



>gi|350633932|gb|EHA22296.1| hypothetical protein ASPNIDRAFT_204359 [Aspergillus niger ATCC
           1015]
          Length = 195

 Score = 92.4 bits (228), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 84/145 (57%), Gaps = 3/145 (2%)

Query: 35  LNTLHKSLIPI--KGNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEM 92
           LN LH+SLI +      PPP  IN   S QITKL++  NT ++  N++EA +LY+ AI+M
Sbjct: 45  LNALHRSLISLDPPNIPPPPLPINPKRSAQITKLRDSANTAYRKSNHAEAARLYTYAIDM 104

Query: 93  AFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYS-KAYFRKG 151
           A  RP WEP      E++   +NR+ +++    W    VDA   +  KP  + KA++R G
Sbjct: 105 ALGRPGWEPVTLARDELAGLYANRAQAWMSQRAWPEGLVDARCSVESKPVANVKAWWRGG 164

Query: 152 KALMGMKRYEEAVHAFEIGLEFEPK 176
           + L+ M R+EEA    E GLE E +
Sbjct: 165 RCLVEMGRWEEAKGFAEKGLEIEGR 189



>gi|320588095|gb|EFX00570.1| tetratricopeptide repeat domain containing protein [Grosmannia
            clavigera kw1407]
          Length = 1144

 Score = 92.4 bits (228), Expect = 6e-17,   Method: Composition-based stats.
 Identities = 52/148 (35%), Positives = 81/148 (54%), Gaps = 4/148 (2%)

Query: 31   DFKPLNTLHKSLIPIKGNIPPPNYINQNLSNQ---ITKLKEEGNTYHKSQNYSEAIKLYS 87
            +   LN LH++LI ++G  P P         +   + KL++ GN   +   Y+EAIK YS
Sbjct: 973  ELTALNQLHRALIGLEGGPPVPPPPIPVNPKRTANVNKLRDSGNGEFRKGRYAEAIKFYS 1032

Query: 88   SAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPD-YSKA 146
              ++MA  RP WEP +   +EV+   +NR+ +Y+ ++ W    +DAE  +  K    +KA
Sbjct: 1033 LGLQMALTRPPWEPSQLVNEEVATLYANRAQAYMAIQSWPEGALDAETSVEAKKTGNAKA 1092

Query: 147  YFRKGKALMGMKRYEEAVHAFEIGLEFE 174
            ++R+GK L+ M R EEA      GLE E
Sbjct: 1093 WWRRGKCLLEMGRLEEAQEWVRRGLEME 1120



>gi|425776093|gb|EKV14328.1| hypothetical protein PDIG_33440 [Penicillium digitatum PHI26]
          Length = 543

 Score = 92.0 bits (227), Expect = 6e-17,   Method: Compositional matrix adjust.
 Identities = 57/147 (38%), Positives = 80/147 (54%), Gaps = 3/147 (2%)

Query: 35  LNTLHKSLIPI--KGNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEM 92
           LN LH++LI +      P P  +N   S QI KL+E  N  ++  NY EAIKLYS AI+M
Sbjct: 374 LNQLHRALISLDPPNIPPAPLPMNPKRSAQINKLRENANAAYRKANYDEAIKLYSLAIDM 433

Query: 93  AFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKP-DYSKAYFRKG 151
              RP WEP     +E+S   +NR+ + + ++ W  A +DA+  +  KP    KA++R  
Sbjct: 434 GLNRPGWEPMGIAREELSGLYANRAQAQMAMQAWPEALIDAKASVDSKPVGNVKAWWRIA 493

Query: 152 KALMGMKRYEEAVHAFEIGLEFEPKNE 178
           K L  M RYEEA       L+ E K+ 
Sbjct: 494 KCLAEMTRYEEARKFLHKSLDIEGKDS 520



>gi|212530652|ref|XP_002145483.1| conserved hypothetical protein [Talaromyces marneffei ATCC 18224]
 gi|210074881|gb|EEA28968.1| conserved hypothetical protein [Talaromyces marneffei ATCC 18224]
          Length = 212

 Score = 91.7 bits (226), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 56/153 (36%), Positives = 85/153 (55%), Gaps = 4/153 (2%)

Query: 31  DFKPLNTLHKSLIPIKGNIPPPNYINQNL--SNQITKLKEEGNTYHKSQNYSEAIKLYSS 88
           + + LN LH++L+ +     PP  +  N   S QITKL++  NT  +  NY+EA+KLY  
Sbjct: 42  ELQQLNVLHRALVGLDSPNVPPPPLPVNPKRSAQITKLRDTANTAFRKSNYAEAVKLYGY 101

Query: 89  AIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKP-DYSKAY 147
           AI+MA  RP WEP      E+S   +NR+ +Y+  + W   ++D++     KP    KA+
Sbjct: 102 AIDMAIGRPAWEPVNLIRDELSGLYANRAQAYMSQQSWPEGWIDSKCSAECKPMGNVKAW 161

Query: 148 FRKGKALMGMKRYEEAVHAFEIGLEFE-PKNES 179
           +R GK L+ M R++EA    E  L  E P +E 
Sbjct: 162 WRGGKCLVEMSRWDEARAWVEQALGLEGPASEG 194



>gi|310790271|gb|EFQ25804.1| tetratricopeptide [Glomerella graminicola M1.001]
          Length = 205

 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 53/157 (33%), Positives = 80/157 (50%), Gaps = 6/157 (3%)

Query: 31  DFKPLNTLHKSLIPIKGNIPPPNYINQNL-----SNQITKLKEEGNTYHKSQNYSEAIKL 85
           +   LN LH+SLI      P              S  + KL++ GN     + Y+EAIK 
Sbjct: 33  ELAQLNALHRSLITSDTTGPQGVPPPPMPVNPKRSANVAKLRDSGNAEFHKKKYAEAIKF 92

Query: 86  YSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRI-KPDYS 144
           Y+  ++MA  RP WEP +   +EVS   +NR+ +++ L+QW    VDAE  +   K   +
Sbjct: 93  YTLGLQMALTRPLWEPSQLVREEVSGLYANRAQAHMALQQWPEGSVDAEASVEARKVGNA 152

Query: 145 KAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFI 181
           KA++R+G+ L+ M R EEA       LEFE +    +
Sbjct: 153 KAWWRRGRCLIEMGRLEEARDWVGKALEFEGEEAELV 189



>gi|171692493|ref|XP_001911171.1| hypothetical protein [Podospora anserina S mat+]
 gi|170946195|emb|CAP72996.1| unnamed protein product [Podospora anserina S mat+]
          Length = 204

 Score = 90.9 bits (224), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 56/168 (33%), Positives = 90/168 (53%), Gaps = 5/168 (2%)

Query: 24  TCKDCDYDFKPLNTLHKSLIP----IKGNIPPPNYINQNLSNQITKLKEEGNTYHKSQNY 79
           + +  + +   LN LH++++          PPP  +N   S  ++KL+E GN  ++   +
Sbjct: 27  SSRALEAELAALNNLHRTILTQIEPPHIVPPPPMPVNPKRSANVSKLRESGNNEYRKGRH 86

Query: 80  SEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRI 139
           +EAIK Y+  ++MA  R  WEP +   +EV    SNR+ +++ L  W  A VDAE  +  
Sbjct: 87  AEAIKFYTLGLQMALTRAPWEPSQLVREEVHALYSNRAQAHMQLGNWPEAAVDAEASVAA 146

Query: 140 KPDY-SKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
           K    +KA+FR+GK L+ M R +EA  A    LEFE + +     L+E
Sbjct: 147 KSQGNAKAWFRRGKCLLEMGRLQEARGAVAKALEFEGEEKELAELLKE 194



>gi|353240327|emb|CCA72201.1| hypothetical protein PIIN_06136 [Piriformospora indica DSM 11827]
          Length = 207

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 74/126 (58%), Gaps = 2/126 (1%)

Query: 17  CRQHRLETCKDCDYDFKPLNTLHK--SLIPIKGNIPPPNYINQNLSNQITKLKEEGNTYH 74
           CR+H+ E+C  C  DF  +N + K  S+ P    +PPPN +    +  ++K K+EGN  +
Sbjct: 82  CREHKKESCSVCGLDFTAMNAMAKMFSMAPSDAILPPPNVVQPARAQAVSKTKDEGNALY 141

Query: 75  KSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAE 134
           K   + +AI +Y++A++++  RP WE      +E+++ + NRS ++     ++++ +DAE
Sbjct: 142 KKNQHVQAINMYTTAMQISSSRPPWESSNIAREELTLVVCNRSAAFYAAGDYLSSLLDAE 201

Query: 135 WGIRIK 140
             I +K
Sbjct: 202 VVISLK 207



>gi|477535889|gb|ENH87387.1| tetratricopeptide repeat domain containing protein [Colletotrichum
           orbiculare MAFF 240422]
          Length = 205

 Score = 90.5 bits (223), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 51/139 (36%), Positives = 79/139 (56%), Gaps = 6/139 (4%)

Query: 31  DFKPLNTLHKSLIPIK-----GNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKL 85
           +   LN LH+SL+        G  PPP  +N   S  ++KL++ GN     + Y +AIK 
Sbjct: 33  ELSHLNALHRSLVTSDTTTQHGVPPPPMPVNPKRSANVSKLRDSGNAEFHKKKYGDAIKF 92

Query: 86  YSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRI-KPDYS 144
           Y+  ++MA  RP WEP +   +EVS   +NR+ +++ L+QW    VDAE  +   K   +
Sbjct: 93  YTLGLQMALTRPLWEPSQLVREEVSSLYANRAQAHMALQQWAEGSVDAEASVEARKVGNA 152

Query: 145 KAYFRKGKALMGMKRYEEA 163
           KA++R+G+ L+ M R EEA
Sbjct: 153 KAWWRRGRCLVEMGRLEEA 171



>gi|116198451|ref|XP_001225037.1| hypothetical protein CHGG_07381 [Chaetomium globosum CBS 148.51]
 gi|88178660|gb|EAQ86128.1| hypothetical protein CHGG_07381 [Chaetomium globosum CBS 148.51]
          Length = 209

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 58/167 (34%), Positives = 87/167 (52%), Gaps = 4/167 (2%)

Query: 24  TCKDCDYDFKPLNTLHKSLIPI---KGNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYS 80
             +  + +   LN LH+SL  +       PPP  +N   S  I KL+E GN  ++ Q Y+
Sbjct: 29  ATRALEAELASLNALHRSLHGLDPPHLVPPPPVPVNPKRSANIGKLRESGNAEYRKQRYA 88

Query: 81  EAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIK 140
           EA K Y+  ++MA  R  WEP +   +E+    SNR+ + + L  W  A  DAE  +  K
Sbjct: 89  EAAKFYTLGLQMALTRAAWEPSQLVREELHALYSNRAQANMHLGLWPEAASDAEASVEAK 148

Query: 141 -PDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
               +KA+FR+G++L+ M R  EA      GLEFE + +  I  L+E
Sbjct: 149 RQGNAKAWFRRGRSLVEMGRLAEAREWVARGLEFEGEEKELIELLKE 195



>gi|512192821|gb|EPE08579.1| translocation protein sec72 [Ophiostoma piceae UAMH 11346]
          Length = 234

 Score = 90.1 bits (222), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 83/155 (53%), Gaps = 4/155 (2%)

Query: 24  TCKDCDYDFKPLNTLHKSLIPIKGNIPPPNYINQNL---SNQITKLKEEGNTYHKSQNYS 80
           T    D +   LN LH+S++ I+  +P P          + Q+ KL++ GN   +   ++
Sbjct: 56  TTTPLDAELNALNELHRSILGIENGMPVPPPPMPVNPKRTAQVQKLRDSGNAEFRKGQFA 115

Query: 81  EAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRI- 139
            AI+ Y+  +EMAF+RP WEP +   ++V    +NR+ +++ L+ W     DAE  +   
Sbjct: 116 NAIRFYTLGLEMAFKRPVWEPAQMVLEDVVSLYANRAQAHMALQAWTEGAADAELSVEAR 175

Query: 140 KPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFE 174
           K   +KA++R+GK LM + R  EA    + GLE E
Sbjct: 176 KTGNAKAWWRRGKCLMELGRLGEAQAWVKHGLEME 210



>gi|380490737|emb|CCF35807.1| tetratricopeptide [Colletotrichum higginsianum]
          Length = 206

 Score = 89.4 bits (220), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 82/157 (52%), Gaps = 6/157 (3%)

Query: 31  DFKPLNTLHKSLIPIKGNIPPPNYINQNL-----SNQITKLKEEGNTYHKSQNYSEAIKL 85
           +   LN LH+SL+  +   P              S  ++KL++ GN     + Y++AIK 
Sbjct: 33  ELAQLNALHRSLVTSETTGPHGVPPPPMPVNPKRSANVSKLRDSGNAEFHKKKYADAIKF 92

Query: 86  YSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRI-KPDYS 144
           Y+  ++MA  RP WEP +   +EVS   +NR+ +++ L+QW    VDAE  +   K   +
Sbjct: 93  YTLGLQMALTRPLWEPSQLVREEVSGLYANRAQAHMALQQWAEGSVDAEASVEARKVGNA 152

Query: 145 KAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFI 181
           KA++R+G+ L+ M R +EA       LE+E +    +
Sbjct: 153 KAWWRRGRCLVEMGRLDEAREWVGKALEYEGEEAELV 189



>gi|425773829|gb|EKV12155.1| hypothetical protein PDIP_53020 [Penicillium digitatum Pd1]
          Length = 148

 Score = 89.0 bits (219), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 49/124 (39%), Positives = 69/124 (55%), Gaps = 1/124 (0%)

Query: 55  INQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLS 114
           +N   S QI KL+E  N  ++  NY EAIKLYS AI+M   RP WEP     +E+S   +
Sbjct: 1   MNPKRSAQINKLRENANAAYRKANYDEAIKLYSLAIDMGLNRPGWEPMGIAREELSGLYA 60

Query: 115 NRSLSYIFLEQWVNAYVDAEWGIRIKP-DYSKAYFRKGKALMGMKRYEEAVHAFEIGLEF 173
           NR+ + + ++ W  A +DA+  +  KP    KA++R  K L  M RYEEA       L+ 
Sbjct: 61  NRAQAQMAMQAWPEALIDAKASVDSKPVGNVKAWWRIAKCLAEMTRYEEARKFLHKSLDI 120

Query: 174 EPKN 177
           E K+
Sbjct: 121 EGKD 124



>gi|452982492|gb|EME82251.1| hypothetical protein MYCFIDRAFT_47445 [Pseudocercospora fijiensis
           CIRAD86]
          Length = 203

 Score = 89.0 bits (219), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 61/181 (33%), Positives = 86/181 (47%), Gaps = 16/181 (8%)

Query: 2   SYNLLDLIVDGDNVYCRQHRLETCKDCDYDFKPLNTLHKSLIPIKGNIPPPNYINQNL-- 59
           ++NLL L +D            T      D + LN L+K+   +      PN I      
Sbjct: 6   TFNLLPLTIDPATKLISS----TDPSLASDLEDLNRLNKAFTALD----TPNQIPPPPAP 57

Query: 60  -----SNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLS 114
                S QI KLK+ GN  +K   + EAI++Y+ AI+MA  RP WE       E+S    
Sbjct: 58  VNPKRSVQIGKLKDSGNASYKKGAFPEAIQMYNLAIKMAADRPAWEASGLVRDELSTLYG 117

Query: 115 NRSLSYIFLEQWVNAYVDAEWGIRIKP-DYSKAYFRKGKALMGMKRYEEAVHAFEIGLEF 173
           N+S   + ++ W  A VDAE  + +K     KA++R+G+ L  M R EEA      GLEF
Sbjct: 118 NKSQCLMSMQSWAEAAVDAEIAVELKKMGNVKAWWRRGQCLKEMGRLEEAKEWVTSGLEF 177

Query: 174 E 174
           E
Sbjct: 178 E 178



>gi|409994629|gb|AFV50602.1| heat shock 90/70 organizing protein [Frankliniella occidentalis]
 gi|442769471|gb|AGC70809.1| heat shock 90/70 organizing protein [Frankliniella occidentalis]
          Length = 552

 Score = 88.6 bits (218), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 68/127 (53%), Gaps = 13/127 (10%)

Query: 62  QITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYI 121
           Q+  LKE+GN   +  NY+EAIK YS AI +             +    V  SNRS +Y 
Sbjct: 3   QVNALKEKGNAALQQGNYTEAIKFYSDAIAL-------------DPTNHVLFSNRSAAYA 49

Query: 122 FLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFI 181
             EQ+  AY DAE  + +KPD+ K Y RKG AL  + R +EA+ A+E GL  +P N    
Sbjct: 50  KDEQFELAYADAEKTVTLKPDWGKGYSRKGSALAYLGRTDEAIEAYEEGLRIDPTNAQLA 109

Query: 182 NALEEAR 188
             L+E +
Sbjct: 110 EGLKEVK 116



>gi|302657621|ref|XP_003020529.1| hypothetical protein TRV_05383 [Trichophyton verrucosum HKI 0517]
 gi|291184370|gb|EFE39911.1| hypothetical protein TRV_05383 [Trichophyton verrucosum HKI 0517]
          Length = 205

 Score = 88.6 bits (218), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 51/146 (34%), Positives = 82/146 (56%), Gaps = 3/146 (2%)

Query: 32  FKPLNTLHKSLIPIKGNIPPPNYINQNL--SNQITKLKEEGNTYHKSQNYSEAIKLYSSA 89
            + +N  H++L+ +     PP     N   S QI KL++  NT ++  +++EAIK+Y+ A
Sbjct: 36  LEAINQTHRTLLSLDPPNIPPPPRPVNPKRSAQIAKLRDTANTAYRKSSFAEAIKMYTLA 95

Query: 90  IEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRI-KPDYSKAYF 148
           IEMA  RP WEP     +E+S   +NR+ +Y+  + W  A+VDA+  +   +    KA++
Sbjct: 96  IEMALGRPAWEPVGLVREELSALYANRAQAYMQQQLWAEAWVDAQLSVECNEQGNGKAWW 155

Query: 149 RKGKALMGMKRYEEAVHAFEIGLEFE 174
           R GK L+ M R+EEA       L+ E
Sbjct: 156 RGGKCLVEMGRWEEAQKWITKALDIE 181



>gi|302510379|ref|XP_003017141.1| hypothetical protein ARB_04017 [Arthroderma benhamiae CBS 112371]
 gi|291180712|gb|EFE36496.1| hypothetical protein ARB_04017 [Arthroderma benhamiae CBS 112371]
          Length = 205

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 44/116 (37%), Positives = 70/116 (60%), Gaps = 1/116 (0%)

Query: 60  SNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLS 119
           S QI KL++  NT ++  +++EA+K+Y+ AIEMA  RP WEP     +E+S   +NR+ +
Sbjct: 66  SAQIAKLRDTANTAYRKSSFAEAVKMYTLAIEMALGRPAWEPVGLVREELSALYANRAQA 125

Query: 120 YIFLEQWVNAYVDAEWGIRI-KPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFE 174
           Y+  + W  A+VDA+  +   +    KA++R GK L+ M R+EEA       L+ E
Sbjct: 126 YMQQQLWAEAWVDAQLSVECNEQGNGKAWWRGGKCLVEMGRWEEAQKWITKALDIE 181



>gi|258577973|ref|XP_002543168.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
 gi|237903434|gb|EEP77835.1| conserved hypothetical protein [Uncinocarpus reesii 1704]
          Length = 565

 Score = 87.8 bits (216), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 49/147 (33%), Positives = 87/147 (59%), Gaps = 3/147 (2%)

Query: 31  DFKPLNTLHKSLIPIKGNIPPPNYINQNL--SNQITKLKEEGNTYHKSQNYSEAIKLYSS 88
           + + LN+LH++L+ +     PP     N   S Q++KL++  N  ++   ++EAI+LY+ 
Sbjct: 217 ELEALNSLHRALLNLDSPNVPPPPRPINPKRSAQVSKLRDSANAAYRKAAFTEAIRLYTY 276

Query: 89  AIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDY-SKAY 147
           AI+MA  RP WEP     +E++   +NR+ +++  + W   ++DA+  I    +  +KA+
Sbjct: 277 AIDMALGRPAWEPLGLVREELAPLYANRAQAHMSQQDWPEGWIDAQLSIECNEETNTKAW 336

Query: 148 FRKGKALMGMKRYEEAVHAFEIGLEFE 174
           +R GK L+ M R+EEA+   + GLE E
Sbjct: 337 WRGGKCLVEMGRWEEAIEWLQKGLEAE 363



>gi|465793966|emb|CCU98864.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
          Length = 573

 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 70/127 (55%), Gaps = 7/127 (5%)

Query: 63  ITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIF 122
           +++LK +GN    +++Y  AIK Y+ AI  A         +  +  V V  SNRS S+  
Sbjct: 3   VSELKAQGNASFAAKDYDNAIKHYTDAIAAA-------ESQGEQDGVHVLYSNRSASFAG 55

Query: 123 LEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFIN 182
           L+ W  A  DAE  IR+ P ++K Y RKG AL G +RY+EA+ A+  GLE  P + +   
Sbjct: 56  LKNWSAALEDAETTIRLNPSFAKGYGRKGSALHGARRYDEAIAAYHAGLEAVPGDAALQK 115

Query: 183 ALEEARK 189
            L + ++
Sbjct: 116 GLADVQR 122



>gi|453084224|gb|EMF12269.1| hypothetical protein SEPMUDRAFT_126543 [Mycosphaerella populorum
           SO2202]
          Length = 205

 Score = 86.7 bits (213), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 94/179 (52%), Gaps = 12/179 (6%)

Query: 2   SYNLLDLIVDGDNVYCRQHRLETCKDCDY--DFKPLNTLHKSLIPIKGN---IPPPNYIN 56
           ++ LL L +D       Q +  +  D     D + LN L ++   ++      PPP  +N
Sbjct: 8   TFTLLPLHIDP------QTKAVSSSDASLLNDLEQLNHLARAFTQLETPNQVTPPPAPVN 61

Query: 57  QNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNR 116
              S QITKLK+ GN  +K  ++S+AIK+Y  AI+MA  RP WE      +E+S+   NR
Sbjct: 62  PKRSVQITKLKDSGNAAYKKGSFSDAIKMYDLAIKMAADRPPWEASGLAREELSLLHGNR 121

Query: 117 SLSYIFLEQWVNAYVDAEWGIRIKP-DYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFE 174
           S +    + W  A VDAE  + +K     KA++R+ + L  M R EEA+   + GLEFE
Sbjct: 122 SQALYAQQDWAAAAVDAEIAVELKRIGNVKAWWRRAQCLKEMGRIEEALEFAKTGLEFE 180



>gi|357617437|gb|EHJ70789.1| Hsc70/Hsp90-organizing protein HOP [Danaus plexippus]
          Length = 540

 Score = 86.3 bits (212), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 73/135 (54%), Gaps = 13/135 (9%)

Query: 62  QITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYI 121
           Q+  LKE+GN    S  Y+EA+KLY+SAIE+             + +  V  SNRS ++ 
Sbjct: 3   QVNHLKEKGNAALSSGQYAEAVKLYTSAIEL-------------DPKNHVLYSNRSAAHA 49

Query: 122 FLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFI 181
               +  A  DA   + I P +SK Y RKG AL  + R+EEA+ A+E GL+ +P N+   
Sbjct: 50  KAGNYAEALEDANKTVSINPTWSKGYSRKGSALAYLGRHEEAIQAYEKGLQLDPSNQQLA 109

Query: 182 NALEEARKLAGITDL 196
           + L E +K A   +L
Sbjct: 110 SGLAEVKKQAEEAEL 124



>gi|296809307|ref|XP_002844992.1| translocation protein sec72 [Arthroderma otae CBS 113480]
 gi|238844475|gb|EEQ34137.1| translocation protein sec72 [Arthroderma otae CBS 113480]
          Length = 205

 Score = 85.5 bits (210), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 51/158 (32%), Positives = 86/158 (54%), Gaps = 3/158 (1%)

Query: 24  TCKDCDYDFKPLNTLHKSLIPIKGNIPPPNYINQNL--SNQITKLKEEGNTYHKSQNYSE 81
           +  + + + + +N  H++L+ ++    PP     N   S QI KL++  NT ++  ++ E
Sbjct: 28  SSAELEAELEAINQTHRALLNLEPPNIPPPPRPVNPKRSAQIGKLRDTANTAYRKASFGE 87

Query: 82  AIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRI-K 140
           A KLY+ AI+MA  RP WEP     +E+S   +NR+ +Y+  + W  A+VDA+  I   +
Sbjct: 88  AAKLYTLAIDMALARPSWEPVGLVREELSALYANRAQAYMQQQLWAEAWVDAQLSIECNE 147

Query: 141 PDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNE 178
               KA++R GK L+ M R+ EA       LE E + +
Sbjct: 148 QGNGKAWWRGGKCLVEMGRWAEAQRWISKALEIEGEGD 185



>gi|326468511|gb|EGD92520.1| tetratricopeptide repeat domain-containing protein [Trichophyton
           tonsurans CBS 112818]
 gi|326480009|gb|EGE04019.1| translocation protein sec72 [Trichophyton equinum CBS 127.97]
          Length = 205

 Score = 85.5 bits (210), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 69/116 (59%), Gaps = 1/116 (0%)

Query: 60  SNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLS 119
           S QI KL++  N  ++  +++EA+K+Y+ AIEMA  RP WEP     +E+S   +NR+ +
Sbjct: 66  SAQIGKLRDTANAAYRKSSFAEAVKMYALAIEMALGRPAWEPVGLVREELSALYANRAQA 125

Query: 120 YIFLEQWVNAYVDAEWGIRI-KPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFE 174
           Y+  + W  A+VDA+  +   +    KA++R GK L+ M R+EEA       L+ E
Sbjct: 126 YMQQQLWAEAWVDAQLSVECNEQGNGKAWWRGGKCLVEMGRWEEAQKWITKALDIE 181



>gi|322786074|gb|EFZ12685.1| hypothetical protein SINV_09553 [Solenopsis invicta]
          Length = 538

 Score = 85.1 bits (209), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 68/126 (53%), Gaps = 13/126 (10%)

Query: 63  ITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIF 122
           +  LKE+GN   ++ NY EAIK Y+ AI +             +    V  SNRS +Y  
Sbjct: 1   VATLKEKGNAALQTGNYDEAIKCYTDAIAL-------------DGSNHVLYSNRSAAYAK 47

Query: 123 LEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFIN 182
            E++  A  DAE  + +KPD+ K Y RKG AL  + RY+E++ A+E GL+ +P N    +
Sbjct: 48  SEKYQQALEDAEKTVSLKPDWGKGYSRKGSALAYLGRYDESIRAYEKGLQLDPSNSQLRS 107

Query: 183 ALEEAR 188
            L E R
Sbjct: 108 GLAEVR 113



>gi|315048195|ref|XP_003173472.1| translocation protein sec72 [Arthroderma gypseum CBS 118893]
 gi|311341439|gb|EFR00642.1| translocation protein sec72 [Arthroderma gypseum CBS 118893]
          Length = 205

 Score = 85.1 bits (209), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 85/158 (53%), Gaps = 3/158 (1%)

Query: 24  TCKDCDYDFKPLNTLHKSLIPIKGNIPPPNYINQNL--SNQITKLKEEGNTYHKSQNYSE 81
           T  + +   + +N  H++L+ ++    PP     N   S QI KL++  N  ++  +++E
Sbjct: 28  TSAELNAQLEAINQTHRALLNLEPPNIPPPPRPVNPKRSAQIGKLRDTANAAYRKSSFAE 87

Query: 82  AIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRI-K 140
           A K+Y+ AI+MA  RP WEP     +E+S   +NR+ +Y+  + W  A+VDA+  +   +
Sbjct: 88  AAKMYTLAIDMALGRPMWEPVGLVREELSALYANRAQAYMQQQLWAEAWVDAQLSVECNE 147

Query: 141 PDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNE 178
               KA++R GK L+ M R+EEA       L+ E   +
Sbjct: 148 QGNGKAWWRGGKCLVEMGRWEEAQKWITKALDIESAGD 185



>gi|443924376|gb|ELU43401.1| TPR_2 domain-containing protein [Rhizoctonia solani AG-1 IA]
          Length = 115

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 60/95 (63%)

Query: 92  MAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKG 151
           +A  RP WEPH    +E+S  LSNRS +++    ++ A VDA+  I ++  ++K +FRK 
Sbjct: 5   IAASRPNWEPHTLAREEISTVLSNRSAAHLSAGDYIPALVDADVVIALRKPWTKGHFRKA 64

Query: 152 KALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
           KAL+ ++ YEEA  A   GL+FEP N+  ++ + E
Sbjct: 65  KALVALQHYEEARDAIAAGLQFEPDNKELLDFMRE 99



>gi|198437400|ref|XP_002128875.1| PREDICTED: stress-induced-phosphoprotein 1 [Ciona intestinalis]
          Length = 546

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 71/124 (57%), Gaps = 13/124 (10%)

Query: 66  LKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQ 125
           LK++GN   +S+NY EAI  Y+ AI++             + +  V  SNRS +Y   EQ
Sbjct: 5   LKKKGNAAVQSKNYKEAIGHYTEAIKI-------------DPKNHVLFSNRSAAYSSDEQ 51

Query: 126 WVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALE 185
           +  A  DAE  I I+PD+ K Y RKG AL  +KRYEEA  A+E GL+++ +NE     +E
Sbjct: 52  YSEALQDAEKVIEIRPDWGKGYSRKGSALAFLKRYEEAKMAYEEGLKYDSQNEQLKKGVE 111

Query: 186 EARK 189
           +  K
Sbjct: 112 QCEK 115



>gi|164656411|ref|XP_001729333.1| hypothetical protein MGL_3368 [Malassezia globosa CBS 7966]
 gi|159103224|gb|EDP42119.1| hypothetical protein MGL_3368 [Malassezia globosa CBS 7966]
          Length = 580

 Score = 84.3 bits (207), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 48/131 (36%), Positives = 74/131 (56%), Gaps = 9/131 (6%)

Query: 63  ITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQE-VSVCLSNRSLSYI 121
           + +LK +GN    +++Y +AI+ Y++AIE A Q        S E + V V  SNRS SY 
Sbjct: 3   VAELKAQGNASFAAKDYEKAIQHYTAAIEAAKQ--------SGESDAVHVLYSNRSASYA 54

Query: 122 FLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFI 181
            ++ W  A  DAE  IR+   ++K Y RKG AL G +RYE+A+ A++ GLE  P + +  
Sbjct: 55  GMKNWDAALSDAEETIRLNSSFAKGYGRKGSALHGARRYEDAIAAYKTGLERCPDDTALK 114

Query: 182 NALEEARKLAG 192
             L +  + + 
Sbjct: 115 KGLADVERASA 125



>gi|327300507|ref|XP_003234946.1| tetratricopeptide repeat domain-containing protein [Trichophyton
           rubrum CBS 118892]
 gi|326462298|gb|EGD87751.1| tetratricopeptide repeat domain-containing protein [Trichophyton
           rubrum CBS 118892]
          Length = 205

 Score = 84.0 bits (206), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 68/116 (58%), Gaps = 1/116 (0%)

Query: 60  SNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLS 119
           S QI KL++  N  ++   ++EA+K+Y+ AIEMA  RP WEP     +E+S   +NR+ +
Sbjct: 66  SAQIGKLRDTANAAYRKSLFAEAVKMYTFAIEMALGRPAWEPVGLVREELSALYANRAQA 125

Query: 120 YIFLEQWVNAYVDAEWGIRI-KPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFE 174
           Y+  + W  A+VDA+  +   +    KA++R GK L+ M R+EEA       L+ E
Sbjct: 126 YMQQQLWAEAWVDAQLSVECNEQGNGKAWWRGGKCLVEMGRWEEAQKWITKALDIE 181



>gi|320580750|gb|EFW94972.1| Non-essential subunit of Sec63 complex [Ogataea parapolymorpha
           DL-1]
          Length = 201

 Score = 83.2 bits (204), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 82/169 (48%), Gaps = 5/169 (2%)

Query: 26  KDCDYDFKPLNTLHKSLIPIKGNIPP----PNYINQNLSNQITKLKEEGNTYHKSQNYSE 81
           +D   +   LNTL K  +    ++PP     NY  +NLS  I K+ E      +++ Y++
Sbjct: 26  EDLQLEVSQLNTLIKDYVNANVDVPPLPTRENY-TKNLSMMIKKMHESAAASMRTKKYAD 84

Query: 82  AIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKP 141
           A K +  A+ +A  RP +E  + T  EV +CL  R  + + LE W++AYVDAE   ++  
Sbjct: 85  AAKQFGVALGLAAARPKFENFQMTVSEVLICLVGRCDANMMLENWLDAYVDAELLCQLAA 144

Query: 142 DYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEEARKL 190
           +  + + RKG   M +     A    E GL F P +      L   ++L
Sbjct: 145 NIPENHLRKGVCQMKLGNLLAAKSDLERGLCFNPSHSKLAEELGNVQRL 193



>gi|332025474|gb|EGI65638.1| Stress-induced-phosphoprotein 1 [Acromyrmex echinatior]
          Length = 512

 Score = 82.8 bits (203), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 73/132 (55%), Gaps = 15/132 (11%)

Query: 66  LKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQ 125
           LKE+GN   ++ NY EAI+ Y+ AI +             +    V  SNRS +Y   E+
Sbjct: 1   LKEKGNAALQTGNYDEAIRCYTDAIIL-------------DGNNHVLYSNRSAAYAKSEK 47

Query: 126 WVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALE 185
           +  A  DAE  + +KPD+ K Y RKG AL  + RY+E++ A+E GL+ +P N    ++L 
Sbjct: 48  YQQALEDAEKTVSLKPDWGKGYSRKGSALAYLGRYDESIRAYEKGLQLDPNNPQLRSSLA 107

Query: 186 EAR--KLAGITD 195
           E R  K A +T+
Sbjct: 108 EVRAQKTAAVTN 119



>gi|449301690|gb|EMC97701.1| hypothetical protein BAUCODRAFT_67998 [Baudoinia compniacensis UAMH
           10762]
          Length = 203

 Score = 82.0 bits (201), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 77/152 (50%), Gaps = 12/152 (7%)

Query: 31  DFKPLNTLHKSLIPIKGNIPPPNYINQNL-------SNQITKLKEEGNTYHKSQNYSEAI 83
           D   LN LH+ ++     +  PN +           S QITKL+E GN  +K  +  EA+
Sbjct: 30  DIDDLNKLHRLVV----GLDTPNQVPAPPAPVNPKRSVQITKLRESGNAAYKKSSLPEAL 85

Query: 84  KLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDY 143
            LY+ AI MA +RP WE      +E+S   +NR+  ++  + W     DAE  + +K   
Sbjct: 86  NLYTLAIRMASERPPWEASGLVREELSALYNNRAQVHMAQQAWPEGACDAEISVELKRVG 145

Query: 144 S-KAYFRKGKALMGMKRYEEAVHAFEIGLEFE 174
           + K ++R+G  L  M R+EEA      GLEFE
Sbjct: 146 NLKGWWRRGMCLKEMGRWEEAREWVGTGLEFE 177



>gi|470519333|ref|XP_004353457.1| stressinducible protein STI1-like, putative [Acanthamoeba
           castellanii str. Neff]
 gi|440803015|gb|ELR23929.1| stressinducible protein STI1-like, putative [Acanthamoeba
           castellanii str. Neff]
          Length = 258

 Score = 81.6 bits (200), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 46/122 (37%), Positives = 72/122 (59%), Gaps = 13/122 (10%)

Query: 70  GNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNA 129
           GN +   + Y EAI+ Y+ AI+        +P++ST        SNR  +Y+ L+++  A
Sbjct: 13  GNAFFLKKQYPEAIEWYTKAIKA-------DPNDST------FYSNRCAAYMGLDKFNEA 59

Query: 130 YVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEEARK 189
             DAE  I+++P + K ++RKG ALM + RYEEA  AF  G+E+EP+N+     LE+A +
Sbjct: 60  LGDAEMCIKLQPAWVKGWYRKGAALMSLSRYEEAAMAFRKGVEYEPQNDDLKQKLEDAER 119

Query: 190 LA 191
            A
Sbjct: 120 QA 121



>gi|388854011|emb|CCF52355.1| probable STI1-Hsp90 cochaperone [Ustilago hordei]
          Length = 603

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 67/127 (52%), Gaps = 9/127 (7%)

Query: 63  ITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIF 122
           +  LK +GN    S++Y  AI+ Y+ AI  A          S E  V V  SNRS  Y  
Sbjct: 3   VADLKAKGNAAFASKDYQSAIQHYNEAIAAA---------ASPEDAVHVLYSNRSACYAG 53

Query: 123 LEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFIN 182
           L+ W +A  DAE  I+  P ++K Y RKG AL G ++ E+AV A++ GL+  P++     
Sbjct: 54  LKDWTHALEDAESCIKTNPSFAKGYGRKGAALHGARKLEDAVDAYQAGLKIAPEDVGLKK 113

Query: 183 ALEEARK 189
            L + ++
Sbjct: 114 GLTDVKR 120



>gi|507575386|ref|XP_004671238.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta [Jaculus jaculus]
          Length = 304

 Score = 81.3 bits (199), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 51/147 (34%), Positives = 85/147 (57%), Gaps = 19/147 (12%)

Query: 46  KGNIPPPNYINQNLSNQITK---LKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPH 102
           KG+IPP   ++++L   + K   LK+EGN + K +NY+ A++ Y+ AIE+       +P+
Sbjct: 68  KGDIPP---LSKSLPEDVGKADQLKDEGNNHMKEENYAAAVECYTQAIEL-------DPN 117

Query: 103 ESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEE 162
            +    V  C  NR+ +   L  + +A  D E  I I   YSKAY R G AL  M ++EE
Sbjct: 118 NA----VYYC--NRAAAQSKLSHYTDAIKDCEKAIAIDSQYSKAYGRMGLALTAMNKFEE 171

Query: 163 AVHAFEIGLEFEPKNESFINALEEARK 189
           AV +++  L+ +P+N+S+ + L+ A +
Sbjct: 172 AVTSYQKALDLDPENDSYKSNLKIAEQ 198



>gi|512810002|ref|XP_002934237.2| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta isoformX1 [Xenopus (Silurana) tropicalis]
 gi|512810006|ref|XP_004910434.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta isoform X2 [Xenopus (Silurana) tropicalis]
          Length = 314

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 76/132 (57%), Gaps = 16/132 (12%)

Query: 52  PNYINQN---LSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQE 108
           PN I+ +   ++ +  +LK+EGN + K QNY+ A+  YS AIE+       +P+ +    
Sbjct: 81  PNKISPSSPSVAEKAEQLKDEGNAFMKEQNYAAAVDCYSQAIEL-------DPNNA---- 129

Query: 109 VSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFE 168
             V   NR+ +     +   A +D E  I I P YSKAY R G+AL+ M RY+EA+ +++
Sbjct: 130 --VYYCNRAAAQSQRGKHSEAVMDCEKAICIDPKYSKAYGRMGRALVAMSRYKEAIESYQ 187

Query: 169 IGLEFEPKNESF 180
             L+ +P+NES+
Sbjct: 188 KALDLDPENESY 199



>gi|146078042|ref|XP_001463435.1| stress-induced protein sti1 [Leishmania infantum JPCM5]
 gi|398010929|ref|XP_003858661.1| stress-induced protein sti1 [Leishmania donovani]
 gi|68235781|gb|AAY88229.1| stress-induced protein 1 [Leishmania donovani]
 gi|134067520|emb|CAM65800.1| stress-induced protein sti1 [Leishmania infantum JPCM5]
 gi|322496870|emb|CBZ31941.1| stress-induced protein sti1 [Leishmania donovani]
          Length = 546

 Score = 80.9 bits (198), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 74/125 (59%), Gaps = 13/125 (10%)

Query: 64  TKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFL 123
           T+LK +GN    +  Y EA+  +S AI++             +++ SV  SNRS  +  +
Sbjct: 4   TELKNKGNEEFSAGRYVEAVNYFSKAIQL-------------DEQNSVLYSNRSACFAAM 50

Query: 124 EQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINA 183
           +++ +A  DA+  I IKP+++K Y R+G AL GM+RY++A+ A+E GL+ +P N S    
Sbjct: 51  QKYKDALDDADKCISIKPNWAKGYVRRGAALHGMRRYDDAIAAYEKGLKVDPSNSSCAQG 110

Query: 184 LEEAR 188
           +++ +
Sbjct: 111 VKDVQ 115



>gi|501303734|dbj|GAC93147.1| hypothetical protein PHSY_000710 [Pseudozyma hubeiensis SY62]
          Length = 602

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 67/127 (52%), Gaps = 9/127 (7%)

Query: 63  ITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIF 122
           + +LK +GN    +++Y  AI+ Y+ AI  A          S E  V V  SNRS  Y  
Sbjct: 3   VAELKAKGNAAFAAKDYQGAIQNYNDAIAAAT---------SPEDNVHVLYSNRSACYAG 53

Query: 123 LEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFIN 182
           L  W +A  DA+  I+  P ++K Y RKG AL G +R EEAV A++ GL+  P++     
Sbjct: 54  LRDWDSALNDADACIKANPSFAKGYGRKGAALHGARRLEEAVDAYDAGLKIAPEDAGLNK 113

Query: 183 ALEEARK 189
            L + ++
Sbjct: 114 GLADVKR 120



>gi|326530590|dbj|BAK01093.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 328

 Score = 80.5 bits (197), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/131 (36%), Positives = 72/131 (54%), Gaps = 19/131 (14%)

Query: 66  LKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQ 125
           LK++GN   KS NY +A  LY+ AI++    P                SNR+ +++ L +
Sbjct: 18  LKDQGNEQFKSGNYLKAAALYTQAIKLDSDNP-------------TLYSNRAAAFLQLVK 64

Query: 126 WVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALE 185
              A  DAE  I++KP++ K YFRKG  L  M++YEEA+ AF+I L+  P+N       E
Sbjct: 65  LNKALADAETTIKLKPEWEKGYFRKGCVLEAMEQYEEAISAFQIALQHNPQN------TE 118

Query: 186 EARKLAGITDL 196
            +RK+  +T L
Sbjct: 119 VSRKIKRLTQL 129



>gi|308804756|ref|XP_003079690.1| stress-induced protein sti1-like protein (ISS) [Ostreococcus tauri]
 gi|116058146|emb|CAL53335.1| stress-induced protein sti1-like protein (ISS) [Ostreococcus tauri]
          Length = 621

 Score = 80.1 bits (196), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 46/121 (38%), Positives = 63/121 (52%), Gaps = 15/121 (12%)

Query: 67  KEEGNTYHKSQNYSEAIKLYSSAIEM-AFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQ 125
           K  GN +     Y+ AI  ++SAIE       FW              SNRS +Y   E+
Sbjct: 60  KARGNAHFAKHEYAAAIDAFTSAIECDGTNHVFW--------------SNRSAAYSGAEK 105

Query: 126 WVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALE 185
           W  A  DAE  I +KP++ K Y RKG AL GM++++EA  A+ +GLE EP N    + LE
Sbjct: 106 WNEALRDAEKTIELKPEWGKGYGRKGAALFGMQKFDEARSAYALGLEKEPDNALLKSGLE 165

Query: 186 E 186
           +
Sbjct: 166 D 166



>gi|1698880|gb|AAB37318.1| protein antigen LmSTI1 [Leishmania major]
          Length = 545

 Score = 79.7 bits (195), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 73/125 (58%), Gaps = 13/125 (10%)

Query: 64  TKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFL 123
           T+LK +GN    +  Y EA+  +S AI++             +++ SV  SNRS  +  +
Sbjct: 3   TELKNKGNEEFSAGRYVEAVNYFSKAIQL-------------DEQNSVLYSNRSACFAAM 49

Query: 124 EQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINA 183
           +++ +A  DA+  I IKP+++K Y R+G AL GM+RY++A+ A+E GL+ +P N      
Sbjct: 50  QKYKDALDDADKCISIKPNWAKGYVRRGAALHGMRRYDDAIAAYEKGLKVDPSNSGCAQG 109

Query: 184 LEEAR 188
           +++ +
Sbjct: 110 VKDVQ 114



>gi|157864863|ref|XP_001681140.1| stress-induced protein sti1 [Leishmania major strain Friedlin]
 gi|68124434|emb|CAJ02290.1| stress-induced protein sti1 [Leishmania major strain Friedlin]
          Length = 546

 Score = 79.7 bits (195), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 73/125 (58%), Gaps = 13/125 (10%)

Query: 64  TKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFL 123
           T+LK +GN    +  Y EA+  +S AI++             +++ SV  SNRS  +  +
Sbjct: 4   TELKNKGNEEFSAGRYVEAVNYFSKAIQL-------------DEQNSVLYSNRSACFAAM 50

Query: 124 EQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINA 183
           +++ +A  DA+  I IKP+++K Y R+G AL GM+RY++A+ A+E GL+ +P N      
Sbjct: 51  QKYKDALDDADKCISIKPNWAKGYVRRGAALHGMRRYDDAIAAYEKGLKVDPSNSGCAQG 110

Query: 184 LEEAR 188
           +++ +
Sbjct: 111 VKDVQ 115



>gi|401416334|ref|XP_003872662.1| stress-induced protein sti1 [Leishmania mexicana
           MHOM/GT/2001/U1103]
 gi|322488886|emb|CBZ24136.1| stress-induced protein sti1 [Leishmania mexicana
           MHOM/GT/2001/U1103]
          Length = 545

 Score = 79.7 bits (195), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 73/125 (58%), Gaps = 13/125 (10%)

Query: 64  TKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFL 123
           T+LK +GN    +  Y EA+  +S AI++             +++ SV  SNRS  +  +
Sbjct: 4   TELKNKGNEEFSAGRYVEAVNYFSKAIQL-------------DEQNSVLYSNRSACFAAM 50

Query: 124 EQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINA 183
           +++ +A  DA+  I IKP+++K Y R+G AL GM+RY++A+ A+E GL+ +P N      
Sbjct: 51  QKYKDALDDADKCISIKPNWAKGYVRRGAALHGMRRYDDAIAAYEKGLKVDPSNSGCAQG 110

Query: 184 LEEAR 188
           +++ +
Sbjct: 111 VKDVQ 115



>gi|68486711|ref|XP_712784.1| hypothetical protein CaO19.11656 [Candida albicans SC5314]
 gi|68487018|ref|XP_712634.1| hypothetical protein CaO19.4180 [Candida albicans SC5314]
 gi|46434037|gb|EAK93459.1| hypothetical protein CaO19.4180 [Candida albicans SC5314]
 gi|46434196|gb|EAK93613.1| hypothetical protein CaO19.11656 [Candida albicans SC5314]
 gi|238881765|gb|EEQ45403.1| conserved hypothetical protein [Candida albicans WO-1]
          Length = 204

 Score = 79.7 bits (195), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 44/147 (29%), Positives = 82/147 (55%), Gaps = 3/147 (2%)

Query: 35  LNTLHKSLIPIKGNIPP---PNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIE 91
           LNTL + +I    ++PP   P+  N++LS  I K+ E G    K   + E+ + ++  IE
Sbjct: 37  LNTLTQEIISQGSDVPPAPTPDNFNKDLSKMIKKMYEGGVQSFKIGKFEESARQFTIGIE 96

Query: 92  MAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKG 151
           M  +RP +E  + T QE+S+ L +R+ +Y+  + ++ A+ DA++ + ++ +    + R+G
Sbjct: 97  MINRRPKFESFQGTIQELSLFLMSRTDAYLRTKDYIKAFNDADFLLNMQLNTPDNFLRRG 156

Query: 152 KALMGMKRYEEAVHAFEIGLEFEPKNE 178
            A   +  YE A   ++ GL F+  NE
Sbjct: 157 VANFFLGNYEAARSDYQRGLTFDENNE 183



>gi|50345104|ref|NP_001002225.1| small glutamine-rich tetratricopeptide repeat-containing protein
           beta [Danio rerio]
 gi|49256703|gb|AAH74059.1| Small glutamine-rich tetratricopeptide repeat (TPR)-containing,
           alpha [Danio rerio]
          Length = 306

 Score = 79.0 bits (193), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 50/147 (34%), Positives = 75/147 (51%), Gaps = 19/147 (12%)

Query: 35  LNTLHKS-LIPIKGNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMA 93
           LN+L K+ ++ +    P P  I +       +LK EGN + K +NYS A+  Y+ AIE+ 
Sbjct: 63  LNSLLKNDIVTLPKTFPSPEDIER-----AEQLKNEGNNHMKEENYSSAVDCYTKAIEL- 116

Query: 94  FQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKA 153
                       +Q  +V   NR+ ++  LE +  A  D E  I I P YSKAY R G A
Sbjct: 117 ------------DQRNAVYYCNRAAAHSKLENYTEAMGDCERAIAIDPSYSKAYGRMGLA 164

Query: 154 LMGMKRYEEAVHAFEIGLEFEPKNESF 180
           L  M +Y EA+  F   L  +P+N+++
Sbjct: 165 LTSMSKYPEAISYFNKALVLDPENDTY 191



>gi|71008353|ref|XP_758204.1| hypothetical protein UM02057.1 [Ustilago maydis 521]
 gi|46097944|gb|EAK83177.1| hypothetical protein UM02057.1 [Ustilago maydis 521]
          Length = 608

 Score = 79.0 bits (193), Expect = 6e-13,   Method: Composition-based stats.
 Identities = 47/127 (37%), Positives = 64/127 (50%), Gaps = 9/127 (7%)

Query: 63  ITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIF 122
           +  LK +GN    +++Y  AI+ Y+ AI  A          S E  V V  SNRS  Y  
Sbjct: 3   VADLKAKGNAAFAAKDYQGAIQNYNDAIAAA---------TSAEDNVHVLYSNRSACYAG 53

Query: 123 LEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFIN 182
           L  W  A  DAE  I   P ++K Y RKG AL G +R EEAV A++ GL+  P++     
Sbjct: 54  LRDWNKALEDAEACINANPSFAKGYGRKGAALHGARRLEEAVDAYDAGLKIAPEDAGLKK 113

Query: 183 ALEEARK 189
            L + R+
Sbjct: 114 GLADVRR 120



>gi|58258211|ref|XP_566518.1| chaperone [Cryptococcus neoformans var. neoformans JEC21]
 gi|134106149|ref|XP_778085.1| hypothetical protein CNBA0880 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|50260788|gb|EAL23438.1| hypothetical protein CNBA0880 [Cryptococcus neoformans var.
           neoformans B-3501A]
 gi|57222655|gb|AAW40699.1| chaperone, putative [Cryptococcus neoformans var. neoformans JEC21]
          Length = 584

 Score = 79.0 bits (193), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 67/124 (54%), Gaps = 13/124 (10%)

Query: 66  LKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQ 125
           LK E N    +++Y+ A KLYS AI +       +P         V  SNRS +   L+ 
Sbjct: 7   LKAEANKAFAAKDYTTAAKLYSDAIAL-------DPSNH------VLYSNRSATKAGLKD 53

Query: 126 WVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALE 185
           +  A  DAE  I + P +SK Y RKG AL G++R+ +AV A+E GL+ EP N + +  L 
Sbjct: 54  YEGALEDAEKTIELDPSFSKGYARKGAALHGLRRFPDAVMAYESGLQAEPNNAACVKGLS 113

Query: 186 EARK 189
           E ++
Sbjct: 114 EVKR 117



>gi|66801325|ref|XP_629588.1| tetratricopeptide-like helical domain-containing protein
           [Dictyostelium discoideum AX4]
 gi|74996491|sp|Q54DA8.1|STIP1_DICDI RecName: Full=Protein STIP1 homolog
 gi|60462985|gb|EAL61181.1| tetratricopeptide-like helical domain-containing protein
           [Dictyostelium discoideum AX4]
          Length = 564

 Score = 79.0 bits (193), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 73/129 (56%), Gaps = 13/129 (10%)

Query: 60  SNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLS 119
           + + T+ K +GN    S++Y+ A+K +  AIE+       +P         +  SNRS S
Sbjct: 5   AQKATEFKNQGNAAFSSKDYNSAVKCFDQAIEL-------DPSNH------ILYSNRSAS 51

Query: 120 YIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNES 179
            + L++  +A  DA+  I +KPD+SK Y R+  AL  + R+EEA  + E GL+ +P N+ 
Sbjct: 52  LLALDKNEDALTDAKKAIELKPDWSKGYLRETNALYKLGRFEEAEKSAEAGLKIDPTNQQ 111

Query: 180 FINALEEAR 188
             +ALE+A+
Sbjct: 112 LEDALEDAQ 120



>gi|241954038|ref|XP_002419740.1| subunit of the secretory polypeptide translocation complex,
           putative [Candida dubliniensis CD36]
 gi|223643081|emb|CAX41955.1| subunit of the secretory polypeptide translocation complex,
           putative [Candida dubliniensis CD36]
          Length = 204

 Score = 79.0 bits (193), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 82/147 (55%), Gaps = 3/147 (2%)

Query: 35  LNTLHKSLIPIKGNIPP---PNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIE 91
           LNTL + +I    ++PP   P+  N++LS  I K+ E G    K   + E+ + ++  IE
Sbjct: 37  LNTLTQEIINQGSDVPPAPTPDNFNKDLSKMIRKMYEGGVQSFKIGKFEESARQFTIGIE 96

Query: 92  MAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKG 151
           M  +RP +E  + T QE+S+ L +R+ +Y+  + +V A+ DA++ + ++ +    + R+G
Sbjct: 97  MINRRPKFESFQGTIQELSLFLMSRTDAYLRTKDYVKAFNDADFLLNMQLNTPDNFLRRG 156

Query: 152 KALMGMKRYEEAVHAFEIGLEFEPKNE 178
            A   +  YE A   ++ GL F+  NE
Sbjct: 157 VANYFLGNYEAARSDYQRGLTFDENNE 183



>gi|154332657|ref|XP_001562145.1| stress-induced protein sti1 [Leishmania braziliensis
           MHOM/BR/75/M2904]
 gi|134059593|emb|CAM37176.1| stress-induced protein sti1 [Leishmania braziliensis
           MHOM/BR/75/M2904]
          Length = 547

 Score = 79.0 bits (193), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 68/123 (55%), Gaps = 13/123 (10%)

Query: 66  LKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQ 125
           LK EGN    +  Y EA+  +S AI++  Q              SV  SNRS  +  +++
Sbjct: 6   LKNEGNKEFSAGRYVEAVNYFSKAIQLDGQN-------------SVLYSNRSACFAAMQK 52

Query: 126 WVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALE 185
           + +A  DA+  I IKP+++K Y R+G AL GM+RY++A+ A+E GL  +P N      ++
Sbjct: 53  YKDALDDADKCISIKPNWAKGYVRRGAALHGMRRYDDAIAAYEKGLSVDPSNSGCTQGVK 112

Query: 186 EAR 188
           + +
Sbjct: 113 DVQ 115



>gi|405117462|gb|AFR92237.1| chaperone [Cryptococcus neoformans var. grubii H99]
          Length = 584

 Score = 78.6 bits (192), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 67/124 (54%), Gaps = 13/124 (10%)

Query: 66  LKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQ 125
           LK E N    +++Y+ A KLYS AI +       +P         V  SNRS +   L+ 
Sbjct: 7   LKAEANKAFAAKDYTTAAKLYSDAIAL-------DPSNH------VLYSNRSATKAGLKD 53

Query: 126 WVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALE 185
           +  A  DAE  I + P +SK Y RKG AL G++R+ +AV A+E GL+ EP N + +  L 
Sbjct: 54  YEGALEDAEKTIELDPSFSKGYARKGAALHGLRRFPDAVMAYESGLQAEPNNAACVKGLS 113

Query: 186 EARK 189
           E ++
Sbjct: 114 EVKR 117



>gi|448103447|ref|XP_004200038.1| Piso0_002599 [Millerozyma farinosa CBS 7064]
 gi|359381460|emb|CCE81919.1| Piso0_002599 [Millerozyma farinosa CBS 7064]
          Length = 201

 Score = 78.6 bits (192), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 83/166 (50%), Gaps = 3/166 (1%)

Query: 23  ETCKDCDYDFKPLNTLHKSLIPIKGNIPP---PNYINQNLSNQITKLKEEGNTYHKSQNY 79
           E   D   +   LNTL   LI    ++PP   P+  N++LS  I KL + G    + + +
Sbjct: 22  EEAADLKLEIDQLNTLTADLIASGADVPPTPSPDTFNKDLSKMIKKLYDGGVQAFRQEKF 81

Query: 80  SEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRI 139
            E++K ++  IEM  +R  +EP + T QE+S+ L +R+ + +  + ++ A+ DA+  + +
Sbjct: 82  DESVKQFNIGIEMIIRRHKFEPFQGTLQELSLFLMSRTDAQLKNKNYLKAFNDADMLLGM 141

Query: 140 KPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALE 185
                  + R+G A   +  YE A   ++ GL F+  N      LE
Sbjct: 142 NLSTPDNFLRRGVANFFLGNYEAAKADYQRGLSFDENNSRLHTELE 187



>gi|321251008|ref|XP_003191926.1| hsp90 cochaperone; Sti1p [Cryptococcus gattii WM276]
 gi|317458394|gb|ADV20139.1| Hsp90 cochaperone, putative; Sti1p [Cryptococcus gattii WM276]
          Length = 584

 Score = 78.6 bits (192), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 66/124 (53%), Gaps = 13/124 (10%)

Query: 66  LKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQ 125
           LK E N    +++Y+ A KLYS AI         +P         V  SNRS +   L+ 
Sbjct: 7   LKAEANKAFAAKDYTTAAKLYSDAI-------VLDPSNH------VLYSNRSATKAGLKD 53

Query: 126 WVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALE 185
           +  A  DAE  I + P +SK Y RKG AL G++R+ +AV A+E GL+ EP N + +  L 
Sbjct: 54  YEGALEDAEKTIELDPSFSKGYARKGAALHGLRRFPDAVMAYESGLQAEPNNAACVKGLS 113

Query: 186 EARK 189
           E ++
Sbjct: 114 EVKR 117



>gi|222625560|gb|EEE59692.1| hypothetical protein OsJ_12115 [Oryza sativa Japonica Group]
          Length = 147

 Score = 78.6 bits (192), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 73/131 (55%), Gaps = 13/131 (9%)

Query: 57  QNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNR 116
           Q+  N+  +LK  G    K ++Y  A   YS AIEM       +P ++T        SNR
Sbjct: 12  QDDQNEKAQLKLCGEKAVKRKDYRGASNFYSQAIEM-------DPTDAT------LYSNR 58

Query: 117 SLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPK 176
           SL ++ + +   A  DAE+ I+++P++ K Y+RKG ALM +K++E+A  AF  GL+ EP 
Sbjct: 59  SLCHLQMTEAEAALFDAEFCIQLRPEWIKGYYRKGAALMLLKKHEKACDAFMAGLKLEPG 118

Query: 177 NESFINALEEA 187
           N     AL EA
Sbjct: 119 NAEMEKALREA 129



>gi|449460409|ref|XP_004147938.1| PREDICTED: heat shock protein STI-like [Cucumis sativus]
 gi|449529664|ref|XP_004171818.1| PREDICTED: heat shock protein STI-like [Cucumis sativus]
          Length = 577

 Score = 78.6 bits (192), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 69/125 (55%), Gaps = 13/125 (10%)

Query: 67  KEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQW 126
           K +GN    + ++S AI+ +S AI++A                 V  SNRS +Y  L Q+
Sbjct: 6   KAKGNAAFSAGDFSTAIRHFSDAIQLAPSN-------------HVLYSNRSAAYASLHQY 52

Query: 127 VNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
            +A VDA+  + +KPD+ K Y R G A +G+  +E AV A++ GLE +P NE+  + L +
Sbjct: 53  SDALVDAQKTVELKPDWPKGYSRLGAAHIGLGEHEAAVSAYKKGLEIDPSNEALKSGLAD 112

Query: 187 ARKLA 191
           A+  A
Sbjct: 113 AQSAA 117



>gi|448099589|ref|XP_004199185.1| Piso0_002599 [Millerozyma farinosa CBS 7064]
 gi|359380607|emb|CCE82848.1| Piso0_002599 [Millerozyma farinosa CBS 7064]
          Length = 201

 Score = 78.6 bits (192), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 83/166 (50%), Gaps = 3/166 (1%)

Query: 23  ETCKDCDYDFKPLNTLHKSLIPIKGNIPP---PNYINQNLSNQITKLKEEGNTYHKSQNY 79
           E   D   +   LNTL   LI    ++PP   P+  N++LS  I KL + G    + + +
Sbjct: 22  EEAADLKLEIDQLNTLTADLIASGADVPPTPSPDKFNKDLSKMIKKLYDGGVQAFRQEKF 81

Query: 80  SEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRI 139
            E++K ++  IEM  +R  +EP + T QE+S+ L +R+ + +  + ++ A+ DA+  + +
Sbjct: 82  DESVKQFNIGIEMIIRRHKFEPFQGTLQELSLFLMSRTDAQLKNKNYLKAFNDADMLLGM 141

Query: 140 KPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALE 185
                  + R+G A   +  YE A   ++ GL F+  N      LE
Sbjct: 142 NLSTPDNFLRRGVANFFLGNYEAAKADYQRGLSFDENNSRLHTELE 187



>gi|115454605|ref|NP_001050903.1| Os03g0680500 [Oryza sativa Japonica Group]
 gi|113549374|dbj|BAF12817.1| Os03g0680500, partial [Oryza sativa Japonica Group]
          Length = 165

 Score = 78.2 bits (191), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 73/131 (55%), Gaps = 13/131 (9%)

Query: 57  QNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNR 116
           Q+  N+  +LK  G    K ++Y  A   YS AIEM       +P ++T        SNR
Sbjct: 30  QDDQNEKAQLKLCGEKAVKRKDYRGASNFYSQAIEM-------DPTDAT------LYSNR 76

Query: 117 SLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPK 176
           SL ++ + +   A  DAE+ I+++P++ K Y+RKG ALM +K++E+A  AF  GL+ EP 
Sbjct: 77  SLCHLQMTEAEAALFDAEFCIQLRPEWIKGYYRKGAALMLLKKHEKACDAFMAGLKLEPG 136

Query: 177 NESFINALEEA 187
           N     AL EA
Sbjct: 137 NAEMEKALREA 147



>gi|407832057|gb|EKF98319.1| stress-induced protein sti1, putative [Trypanosoma cruzi]
          Length = 556

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 60/112 (53%), Gaps = 13/112 (11%)

Query: 64  TKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFL 123
           T+LK  GN    S  Y EA + +S AI +       +P         V  SNRS  +  L
Sbjct: 4   TELKNRGNQEFSSGRYKEAAEFFSQAINL-------DPSNH------VLYSNRSACHAAL 50

Query: 124 EQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEP 175
            Q++NA  DAE  + IKPD+ K Y RKG AL G++RYEEA  A+  GL  +P
Sbjct: 51  HQYLNALQDAEKCVSIKPDWVKGYVRKGAALHGLRRYEEAAAAYNKGLSLDP 102



>gi|260949597|ref|XP_002619095.1| hypothetical protein CLUG_00254 [Clavispora lusitaniae ATCC 42720]
 gi|238846667|gb|EEQ36131.1| hypothetical protein CLUG_00254 [Clavispora lusitaniae ATCC 42720]
          Length = 201

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 83/157 (52%), Gaps = 3/157 (1%)

Query: 31  DFKPLNTLHKSLIPIKGNIPP---PNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYS 87
           D + LNTL   LI I   +PP   P   N+++S  I KL E G    K + + E+ K ++
Sbjct: 30  DVEQLNTLCMELIGITAPVPPNPTPETFNKDMSKMIKKLYEGGVQSFKQEKFVESAKQFT 89

Query: 88  SAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAY 147
            AIE+  +R  +E  + T QE+S+ L +R+ +Y+   +++ A+ DA+  I +       +
Sbjct: 90  IAIEIINRRNKFESFQGTLQELSLLLMSRADAYLKCTEYLKAFNDADMLIGMMMCTPDNF 149

Query: 148 FRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINAL 184
            R+G A   +  YE+A   ++ GL F+  N+  +  L
Sbjct: 150 LRRGVANYFLGNYEDARADYQRGLAFDENNQRLVTEL 186



>gi|443894866|dbj|GAC72213.1| molecular co-chaperone STI1 [Pseudozyma antarctica T-34]
          Length = 897

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 45/127 (35%), Positives = 64/127 (50%), Gaps = 9/127 (7%)

Query: 63  ITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIF 122
           + +LK +GN    +++Y  AI+ Y+ AI  A          S E  V V  SNRS  Y  
Sbjct: 302 VAELKAKGNAAFAAKDYQGAIQAYNDAIAAA---------TSPEDAVHVLYSNRSACYAG 352

Query: 123 LEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFIN 182
           L  W  A  DAE  I+  P ++K Y RKG AL G ++ EEAV A+  GL+  P +     
Sbjct: 353 LRDWTKALDDAESCIKANPSFAKGYGRKGAALHGARKLEEAVDAYTAGLDIAPNDAGLTK 412

Query: 183 ALEEARK 189
            L + ++
Sbjct: 413 GLADVQR 419



>gi|112983280|ref|NP_001036957.1| Hsc70/Hsp90-organizing protein HOP [Bombyx mori]
 gi|60592739|dbj|BAD90844.1| Hsc70/Hsp90-organizing protein HOP [Bombyx mori]
          Length = 541

 Score = 78.2 bits (191), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 46/137 (33%), Positives = 72/137 (52%), Gaps = 13/137 (9%)

Query: 61  NQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSY 120
           +++ +LK++GN    +QN+ EAIK Y+ AI +       +P         V  SNRS ++
Sbjct: 2   DKVEQLKKKGNDALVNQNFDEAIKCYTEAIAL-------DPTNH------VLYSNRSAAH 48

Query: 121 IFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESF 180
              E +  A  DAE  + + P++SK Y RKG  L  + RYEEA+ A+  GL  EP N+  
Sbjct: 49  AKAENYEAALEDAEKTVSLHPNWSKGYSRKGSVLAYLSRYEEAIEAYRTGLRLEPTNQQL 108

Query: 181 INALEEARKLAGITDLE 197
              L +  +    ++LE
Sbjct: 109 AQGLRDVERAMKESNLE 125



>gi|156846776|ref|XP_001646274.1| hypothetical protein Kpol_1032p8 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156116949|gb|EDO18416.1| hypothetical protein Kpol_1032p8 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 343

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 64/127 (50%), Gaps = 15/127 (11%)

Query: 66  LKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQ 125
           LK EGN     +NY  AI  YS AIE+    PF+              SNR+ +Y  +E 
Sbjct: 101 LKLEGNKQMSLKNYKSAIDKYSKAIEIYPSNPFY-------------YSNRAAAYQMIED 147

Query: 126 WVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFE--PKNESFINA 183
           + NA +DA   I++ P YSKAY R G A +     E+AVHAF+  LE E     E   N 
Sbjct: 148 FTNAVLDANTAIKLDPTYSKAYSRLGAAKLAEGNNEDAVHAFKKVLELEGDKSTEVMKND 207

Query: 184 LEEARKL 190
            E A+KL
Sbjct: 208 YENAKKL 214



>gi|474293252|gb|EMS61360.1| Protein STIP1-like protein [Triticum urartu]
          Length = 633

 Score = 77.8 bits (190), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/131 (35%), Positives = 69/131 (52%), Gaps = 13/131 (9%)

Query: 57  QNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNR 116
           Q+  N   +LK  G+   K +NY  A   YS AIE+       +P ++T        +NR
Sbjct: 481 QDDKNTKAELKLCGDVAVKRKNYRGASAFYSEAIEL-------DPSDAT------LYANR 527

Query: 117 SLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPK 176
           SL Y+ + +   A  DA   I+++P++ K Y+RKG ALM  K Y+EA  AFE GL+ +P 
Sbjct: 528 SLCYLQMTEAGKALRDANTCIKLRPEWLKGYYRKGAALMSFKEYKEACDAFEAGLKLDPG 587

Query: 177 NESFINALEEA 187
           N       +EA
Sbjct: 588 NTKMEKVFQEA 598



>gi|356537369|ref|XP_003537200.1| PREDICTED: RNA polymerase II-associated protein 3-like [Glycine
           max]
          Length = 325

 Score = 77.4 bits (189), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 72/135 (53%), Gaps = 13/135 (9%)

Query: 56  NQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSN 115
            + +S     LK++GN + KS  Y +A  LY+ AI+     P                SN
Sbjct: 5   TKEVSGSEMSLKDQGNEFFKSGKYLKAAALYTQAIKQDPSNP-------------TLYSN 51

Query: 116 RSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEP 175
           R+ + + L++   A  DAE  I++KP + K YFRKG  L  MKRY++A+ AF+I L++ P
Sbjct: 52  RAAALLQLDKLNKALDDAEMTIKLKPQWEKGYFRKGSILEAMKRYDDALAAFQIALQYNP 111

Query: 176 KNESFINALEEARKL 190
           +++     +++  +L
Sbjct: 112 QSQEVTKKIKKINQL 126



>gi|301096247|ref|XP_002897221.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gi|262107306|gb|EEY65358.1| conserved hypothetical protein [Phytophthora infestans T30-4]
          Length = 878

 Score = 77.0 bits (188), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 68/123 (55%), Gaps = 13/123 (10%)

Query: 67  KEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQW 126
           K +GN    + N  EA+  Y+ AI +       +P++       V  SNRS +Y+ L+  
Sbjct: 325 KAKGNAALSAGNPKEAVDCYTQAIAL-------DPNDH------VFYSNRSAAYLSLDDA 371

Query: 127 VNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
            +A  DAE  I  KPD+ KAY RKG AL  +KRY++A  A+  GL+ +  N + ++ +EE
Sbjct: 372 AHALEDAELCISTKPDWPKAYSRKGAALHALKRYDDATAAYNDGLKVDAGNAACLSGIEE 431

Query: 187 ARK 189
            RK
Sbjct: 432 VRK 434



>gi|502160177|ref|XP_004511659.1| PREDICTED: heat shock protein STI-like [Cicer arietinum]
          Length = 582

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 72/123 (58%), Gaps = 13/123 (10%)

Query: 67  KEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQW 126
           K +GN    S ++S AI+ +S AI+++       P+        V  SNRS +Y  L+ +
Sbjct: 6   KAKGNAAFSSGDFSSAIRHFSEAIDLS-------PNNH------VLYSNRSAAYASLQNY 52

Query: 127 VNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
            +A  DA+  + +KPD+SK Y R G A +G+ ++++AV +++ GLE +P NE   + L +
Sbjct: 53  TDALSDAKKTVELKPDWSKGYSRLGAAHLGLSQFDDAVSSYKKGLEIDPNNEPLKSGLAD 112

Query: 187 ARK 189
           A+K
Sbjct: 113 AQK 115



>gi|71664854|ref|XP_819403.1| stress-induced protein sti1 [Trypanosoma cruzi strain CL Brener]
 gi|70884703|gb|EAN97552.1| stress-induced protein sti1, putative [Trypanosoma cruzi]
          Length = 556

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 59/112 (52%), Gaps = 13/112 (11%)

Query: 64  TKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFL 123
           T+LK  GN    S  Y EA + +S AI +       +P         V  SNRS  +  L
Sbjct: 4   TELKNRGNQEFSSGRYKEAAEFFSQAINL-------DPSNH------VLYSNRSACHAAL 50

Query: 124 EQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEP 175
            Q+ NA  DAE  + IKPD+ K Y RKG AL G++RYEEA  A+  GL  +P
Sbjct: 51  HQYPNALQDAEKCVSIKPDWVKGYVRKGAALHGLRRYEEAAAAYNKGLSLDP 102



>gi|343429023|emb|CBQ72597.1| probable STI1-Hsp90 cochaperone [Sporisorium reilianum SRZ2]
          Length = 605

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Composition-based stats.
 Identities = 44/127 (34%), Positives = 65/127 (51%), Gaps = 9/127 (7%)

Query: 63  ITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIF 122
           +  LK +GN    +++Y  AI+ Y+ AI  A          S E  + V  SNRS  Y  
Sbjct: 3   VADLKAKGNAAFAAKDYQGAIQNYNDAIAAA---------TSPEDNIHVLYSNRSACYAG 53

Query: 123 LEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFIN 182
           L  W  A  DA+  I+  P ++K Y RKG AL G +R E+AV A++ GL+  P++     
Sbjct: 54  LRDWSKALDDADACIKANPSFAKGYGRKGAALHGARRLEDAVDAYDAGLKIAPEDAGLKK 113

Query: 183 ALEEARK 189
            L + R+
Sbjct: 114 GLADVRR 120



>gi|255720771|ref|XP_002545320.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
 gi|240135809|gb|EER35362.1| conserved hypothetical protein [Candida tropicalis MYA-3404]
          Length = 239

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 83/153 (54%), Gaps = 3/153 (1%)

Query: 31  DFKPLNTLHKSLIPIKGNIPP---PNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYS 87
           D   LNTL + +I    ++PP   P   N++LS  I KL + G    K   + ++ + ++
Sbjct: 68  DVDQLNTLTQEIINQGSDVPPQPKPENFNKDLSKMIKKLYDGGVQAFKVGKFEDSARQFT 127

Query: 88  SAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAY 147
             IEM  +RP  E  + T QE+S+ L +R+ +Y+ ++++  A+ DA+  + ++ +    +
Sbjct: 128 IGIEMINRRPKIESFQGTIQELSMFLMSRTDAYLRIKEYQKAFNDADLLLSMQMNTPDNF 187

Query: 148 FRKGKALMGMKRYEEAVHAFEIGLEFEPKNESF 180
            R+G A   ++ YE A   ++ GL+F+  NE  
Sbjct: 188 LRRGVANYFLQNYEAARSDYQRGLQFDENNERL 220



>gi|354474053|ref|XP_003499246.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta-like [Cricetulus griseus]
          Length = 304

 Score = 76.6 bits (187), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 86/157 (54%), Gaps = 14/157 (8%)

Query: 33  KPLNTLHKSLIPIKGNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEM 92
           +PL  +  + +     +P  N + +++  +  +LK+EGN + K +NY+ A+  Y+ AIE+
Sbjct: 56  QPLTEMFTNTVCKNDILPLSNSVPEDV-GKADQLKDEGNNHMKEENYTAAVDCYTQAIEL 114

Query: 93  AFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGK 152
                  +P+ +    V  C  NR+ +   L  + +A  D E  I I   YSKAY R G 
Sbjct: 115 -------DPNNA----VYYC--NRAAAQSKLSHYTDAIKDCEKAIAIDSKYSKAYGRMGL 161

Query: 153 ALMGMKRYEEAVHAFEIGLEFEPKNESFINALEEARK 189
           AL  M ++EEAV +++  L+ +P+N+S+ + L+ A +
Sbjct: 162 ALTAMNKFEEAVTSYQKALDLDPENDSYKSNLKIAEQ 198



>gi|312073554|ref|XP_003139572.1| TPR Domain containing protein [Loa loa]
 gi|307765263|gb|EFO24497.1| TPR Domain containing protein [Loa loa]
          Length = 361

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 58/179 (32%), Positives = 85/179 (47%), Gaps = 24/179 (13%)

Query: 15  VYCRQHRLETCKDCDYDFKPLNTLHKSLIPIKG------NIPPPNYINQNLSNQITKLKE 68
           V C +   E   D  Y F+P   L    +  +G      + P P      ++N    LKE
Sbjct: 79  VQCLETAFEIT-DSSYLFQPSKPLLDIFVAAEGLPAGVGDFPKPTAEEIKIAN---NLKE 134

Query: 69  EGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVN 128
           EGNT  KS  + +A+  Y+ AI++     ++            C  NR+ +Y  LEQ+  
Sbjct: 135 EGNTLMKSSQFEDALLKYNEAIKLNKDPAYF------------C--NRAAAYCRLEQYDL 180

Query: 129 AYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEEA 187
           A  D    + + P YSKAY R G AL    RYE+AV A++  LE +P+ ES+ N L+ A
Sbjct: 181 AIQDCRAALALDPKYSKAYGRMGLALSCQNRYEQAVEAYKKALELDPEQESYKNNLKIA 239



>gi|357481949|ref|XP_003611260.1| Stress-induced-phosphoprotein [Medicago truncatula]
 gi|355512595|gb|AES94218.1| Stress-induced-phosphoprotein [Medicago truncatula]
          Length = 581

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 41/118 (34%), Positives = 66/118 (55%), Gaps = 13/118 (11%)

Query: 67  KEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQW 126
           K +GN    S ++S AI+ +S AI+++                 V  SNRS +Y  L+ +
Sbjct: 6   KAKGNAAFSSGDFSTAIRHFSEAIDLSPTN-------------HVLYSNRSAAYASLQNY 52

Query: 127 VNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINAL 184
            +A  DA+  + +KPD+SK Y R G A +G+ +Y++AV A++ GLE +P NE   + L
Sbjct: 53  TDALTDAKKTVELKPDWSKGYSRLGAAHLGLSQYDDAVSAYKKGLEIDPNNEPLKSGL 110



>gi|403417328|emb|CCM04028.1| predicted protein [Fibroporia radiculosa]
          Length = 585

 Score = 76.3 bits (186), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 42/109 (38%), Positives = 62/109 (56%), Gaps = 13/109 (11%)

Query: 66  LKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQ 125
           LK++GN   ++++Y +AI L+S AI +       +P         V  SNRS +     Q
Sbjct: 5   LKDQGNKAFQAKDYDKAIDLFSRAIAI-------DPSNY------VLFSNRSAAKAGKRQ 51

Query: 126 WVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFE 174
           W  A+ DAE  I+I P +SK Y RKG AL G + Y++A+ A+E GL+ E
Sbjct: 52  WAAAFEDAEQCIKINPTWSKGYARKGAALHGQRSYDQAIAAYEAGLKLE 100



>gi|488548257|ref|XP_004465620.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta isoform 4 [Dasypus novemcinctus]
          Length = 232

 Score = 75.9 bits (185), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 84/157 (53%), Gaps = 14/157 (8%)

Query: 33  KPLNTLHKSLIPIKGNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEM 92
           +PL  +  + +     +P  N + +++  +  +LK+EGN + K +NY  A+  Y+ AIE+
Sbjct: 56  QPLTEMFTNSLCKNDIVPLSNSVAEDVG-KADQLKDEGNNHMKEENYDAAVDCYTQAIEL 114

Query: 93  AFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGK 152
                  EP+ +      V   NR+ +   L  + +A  D E  I I   YSKAY R G 
Sbjct: 115 -------EPNNA------VYYCNRAAAQSKLGHYSDAIKDCEKAIAIDSKYSKAYGRMGL 161

Query: 153 ALMGMKRYEEAVHAFEIGLEFEPKNESFINALEEARK 189
           AL  M ++EEAV +++  L+ +P+N+S+ + L+ A +
Sbjct: 162 ALTAMNKFEEAVTSYQKALDLDPENDSYKSNLKIAEQ 198



>gi|342181090|emb|CCC90568.1| unnamed protein product [Trypanosoma congolense IL3000]
          Length = 568

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 44/126 (34%), Positives = 66/126 (52%), Gaps = 13/126 (10%)

Query: 64  TKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFL 123
            +LK++GN    S  Y+EA +L++ AI +       +P         V  SNRS  Y  L
Sbjct: 23  AELKDKGNKEFTSGRYTEAAQLFTQAIAL-------DPSNH------VLYSNRSGCYAAL 69

Query: 124 EQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINA 183
             +  A  DAE  + +KPD+ K Y R+G AL G++RY EA  A++ GLE +P N +    
Sbjct: 70  HDYPKALTDAEKCVSLKPDWVKGYVRQGAALHGLRRYGEAAAAYKKGLELDPSNSACTEG 129

Query: 184 LEEARK 189
           ++   K
Sbjct: 130 IKSVEK 135



>gi|348551646|ref|XP_003461641.1| PREDICTED: LOW QUALITY PROTEIN: small glutamine-rich
           tetratricopeptide repeat-containing protein beta-like
           [Cavia porcellus]
          Length = 304

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 75/135 (55%), Gaps = 13/135 (9%)

Query: 46  KGNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHEST 105
           K +I P +++      +  +LK+EGN + K +NY+ A+  Y+ AIE+       +P+ + 
Sbjct: 68  KNDILPLSHLVPEDVGKADQLKDEGNNHMKEENYAAAVDCYTQAIEL-------DPNNA- 119

Query: 106 EQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVH 165
              V  C  NR+ +   L  + +A  D E  I I   YSKAY R G AL  M ++EEAV 
Sbjct: 120 ---VYYC--NRAAAQSKLSHYTDAIKDCEKAIAIDSKYSKAYGRMGLALTAMNKFEEAVR 174

Query: 166 AFEIGLEFEPKNESF 180
           +++  L+ +P+N+S+
Sbjct: 175 SYQKALDLDPENDSY 189



>gi|502114478|ref|XP_004494966.1| PREDICTED: tankyrase-2-like [Cicer arietinum]
          Length = 686

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 75/133 (56%), Gaps = 17/133 (12%)

Query: 67  KEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQW 126
           K  G+   K ++Y  AI  Y+ AI++        P+++T       LSNRSL +I L Q 
Sbjct: 564 KSRGDEAFKRKDYHMAIDSYTQAIDL-------NPNDAT------LLSNRSLCWIRLGQA 610

Query: 127 VNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
             A  DA+    +KPD+SKA +R+G AL  +++++EA +AF  G+  +P+N+  ++A  E
Sbjct: 611 EQALADAKACRALKPDWSKACYREGAALRILQKFDEAANAFYEGVTLDPENKELVDAFRE 670

Query: 187 A----RKLAGITD 195
           A    RK  G T+
Sbjct: 671 AVEAGRKFHGTTE 683



>gi|340053734|emb|CCC48027.1| putative stress-induced protein sti1 [Trypanosoma vivax Y486]
          Length = 547

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 63/116 (54%), Gaps = 13/116 (11%)

Query: 64  TKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFL 123
            +LK+ GN    S  Y+EAI L+S AI +       +P         V  SNRS  +  L
Sbjct: 4   AELKDRGNQEFSSGRYTEAIDLFSQAINL-------DPSNH------VLFSNRSACFAAL 50

Query: 124 EQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNES 179
            ++  A  DAE  + +KPD++K Y R G AL G++R +EAV A++ GL  +P N +
Sbjct: 51  HKYSEALKDAEQCVSLKPDWAKGYVRHGAALHGLRRLDEAVTAYKKGLSIDPSNTA 106



>gi|407395845|gb|EKF27272.1| stress-induced protein sti1, putative [Trypanosoma cruzi
           marinkellei]
          Length = 556

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 46/126 (36%), Positives = 64/126 (50%), Gaps = 13/126 (10%)

Query: 64  TKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFL 123
           T+LK  GN    +  Y EA + +S AI++       +P         V  SNRS  +  L
Sbjct: 4   TELKNRGNQEFSAGRYKEAAEFFSHAIDL-------DPSNH------VLYSNRSACHAAL 50

Query: 124 EQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINA 183
            Q+ NA  DAE  + IKPD+ K Y RKG AL G++RYEEA  A+  GL  +P + +    
Sbjct: 51  HQYPNALQDAEKCVYIKPDWVKGYVRKGAALHGLRRYEEAAAAYNKGLSLDPSSAACTEG 110

Query: 184 LEEARK 189
           +    K
Sbjct: 111 IAAVEK 116



>gi|359806614|ref|NP_001241273.1| uncharacterized protein LOC100790717 [Glycine max]
 gi|255644906|gb|ACU22953.1| unknown [Glycine max]
          Length = 324

 Score = 75.9 bits (185), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 41/125 (32%), Positives = 70/125 (56%), Gaps = 13/125 (10%)

Query: 66  LKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQ 125
           LK++GN + KS  Y +A  LY+ AI++    P                SNR+ + + L++
Sbjct: 14  LKDQGNEFFKSGKYLKAAALYTQAIKLDPSNP-------------TLYSNRAAALLQLDK 60

Query: 126 WVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALE 185
              A  DAE  I++KP + K YFRKG  L  MKRY++A+ +F+I L++ P+++     ++
Sbjct: 61  LNKALDDAEMTIKLKPQWEKGYFRKGSILEAMKRYDDALASFQIALQYNPQSQEVSKKIK 120

Query: 186 EARKL 190
           +  +L
Sbjct: 121 KINQL 125



>gi|342181119|emb|CCC90597.1| putative stress-induced protein sti1 [Trypanosoma congolense
           IL3000]
          Length = 549

 Score = 75.9 bits (185), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 44/126 (34%), Positives = 66/126 (52%), Gaps = 13/126 (10%)

Query: 64  TKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFL 123
            +LK++GN    S  Y+EA +L++ AI +       +P         V  SNRS  Y  L
Sbjct: 4   AELKDKGNKEFTSGRYTEAAQLFTQAIAL-------DPSNH------VLYSNRSGCYAAL 50

Query: 124 EQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINA 183
             +  A  DAE  + +KPD+ K Y R+G AL G++RY EA  A++ GLE +P N +    
Sbjct: 51  HDYPKALTDAEKCVSLKPDWVKGYVRQGAALHGLRRYGEAAAAYKKGLELDPSNSACTEG 110

Query: 184 LEEARK 189
           ++   K
Sbjct: 111 IKSVEK 116



>gi|428178759|gb|EKX47633.1| hypothetical protein GUITHDRAFT_159540 [Guillardia theta CCMP2712]
          Length = 587

 Score = 75.5 bits (184), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 64/121 (52%), Gaps = 13/121 (10%)

Query: 66  LKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQ 125
           LK +GN    ++NY+EA+  ++ AI +       +P+        V  SNRS SY  L +
Sbjct: 6   LKAKGNAAFSAKNYTEAVDFFTQAINL-------DPNNH------VLFSNRSASYAGLHK 52

Query: 126 WVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALE 185
           +  A  DAE  I IKPD+ K Y RKG A+ GM  +E A+ A++ GL  EP      N + 
Sbjct: 53  YDQALNDAEKCIAIKPDWGKGYGRKGAAMHGMGDFEGALKAYKDGLAHEPGLAMLTNGIS 112

Query: 186 E 186
           E
Sbjct: 113 E 113



>gi|488548251|ref|XP_004465617.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta isoform 1 [Dasypus novemcinctus]
 gi|488548253|ref|XP_004465618.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta isoform 2 [Dasypus novemcinctus]
 gi|488548255|ref|XP_004465619.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta isoform 3 [Dasypus novemcinctus]
          Length = 304

 Score = 75.5 bits (184), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 85/157 (54%), Gaps = 14/157 (8%)

Query: 33  KPLNTLHKSLIPIKGNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEM 92
           +PL  +  + +     +P  N + +++  +  +LK+EGN + K +NY  A+  Y+ AIE+
Sbjct: 56  QPLTEMFTNSLCKNDIVPLSNSVAEDV-GKADQLKDEGNNHMKEENYDAAVDCYTQAIEL 114

Query: 93  AFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGK 152
                  EP+ +    V  C  NR+ +   L  + +A  D E  I I   YSKAY R G 
Sbjct: 115 -------EPNNA----VYYC--NRAAAQSKLGHYSDAIKDCEKAIAIDSKYSKAYGRMGL 161

Query: 153 ALMGMKRYEEAVHAFEIGLEFEPKNESFINALEEARK 189
           AL  M ++EEAV +++  L+ +P+N+S+ + L+ A +
Sbjct: 162 ALTAMNKFEEAVTSYQKALDLDPENDSYKSNLKIAEQ 198



>gi|505802041|ref|XP_004608542.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta [Sorex araneus]
          Length = 304

 Score = 75.5 bits (184), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 80/148 (54%), Gaps = 20/148 (13%)

Query: 42  LIPIKGNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEP 101
           ++P+  ++P       +   +  +LK+EGN + K +NY+ A+  Y+ AIE+       +P
Sbjct: 71  ILPLSNSVP-------DDVGKADQLKDEGNNHMKEENYAAAVDCYTQAIEL-------DP 116

Query: 102 HESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYE 161
           + +      V   NR+ +   L  + +A  D E  I I   YSKAY R G AL  M ++E
Sbjct: 117 NNA------VYFCNRAAAQSKLGHYTDAIKDCEKAIAIDSKYSKAYGRMGLALTAMNKFE 170

Query: 162 EAVHAFEIGLEFEPKNESFINALEEARK 189
           EAV +++  L+ +P+N+S+ + L+ A +
Sbjct: 171 EAVTSYQKALDLDPENDSYKSNLKIAEQ 198



>gi|170596326|ref|XP_001902724.1| TPR Domain containing protein [Brugia malayi]
 gi|158589430|gb|EDP28427.1| TPR Domain containing protein [Brugia malayi]
          Length = 338

 Score = 75.5 bits (184), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 55/167 (32%), Positives = 80/167 (47%), Gaps = 23/167 (13%)

Query: 27  DCDYDFKPLNTLHKSLIPIKG------NIPPPNYINQNLSNQITKLKEEGNTYHKSQNYS 80
           D  Y F+P   L    +  +G      + P P      ++N    LKEEGNT  KS  + 
Sbjct: 67  DSSYLFQPSKPLLDIFVAAEGLPAGVDDFPKPTAEEIKIAN---NLKEEGNTLMKSSQFE 123

Query: 81  EAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIK 140
            A+  Y+ AI++     ++            C  NR+ +Y  LEQ+  A  D    + + 
Sbjct: 124 NAVLKYNEAIKLNKDPAYF------------C--NRAAAYCRLEQYDLAIQDCRAALALD 169

Query: 141 PDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEEA 187
           P YSKAY R G AL    RYE+AV A++  LE +P+ ES+ N L+ A
Sbjct: 170 PKYSKAYGRMGLALSCQNRYEQAVEAYKKALELDPEQESYKNNLKIA 216



>gi|402592282|gb|EJW86211.1| TPR Domain containing protein [Wuchereria bancrofti]
          Length = 338

 Score = 75.5 bits (184), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 55/167 (32%), Positives = 80/167 (47%), Gaps = 23/167 (13%)

Query: 27  DCDYDFKPLNTLHKSLIPIKG------NIPPPNYINQNLSNQITKLKEEGNTYHKSQNYS 80
           D  Y F+P   L    +  +G      + P P      ++N    LKEEGNT  KS  + 
Sbjct: 67  DSSYLFQPSKPLLDIFVAAEGLPAGVDDFPKPTAEEIKIAN---NLKEEGNTLMKSSQFE 123

Query: 81  EAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIK 140
            A+  Y+ AI++     ++            C  NR+ +Y  LEQ+  A  D    + + 
Sbjct: 124 NAVLKYNEAIKLNKDPAYF------------C--NRAAAYCRLEQYDLAIQDCRAALALD 169

Query: 141 PDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEEA 187
           P YSKAY R G AL    RYE+AV A++  LE +P+ ES+ N L+ A
Sbjct: 170 PKYSKAYGRMGLALSCQNRYEQAVEAYKKALELDPEQESYKNNLKIA 216



>gi|357120208|ref|XP_003561821.1| PREDICTED: protein TANC2-like [Brachypodium distachyon]
          Length = 513

 Score = 75.5 bits (184), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 72/131 (54%), Gaps = 13/131 (9%)

Query: 57  QNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNR 116
           Q+  N   +LK  G    K ++Y +A K Y+ A+E+       +P+++T        SNR
Sbjct: 378 QDEKNAKVQLKLCGEKAVKRKDYRDASKFYTEAMEL-------DPNDAT------LYSNR 424

Query: 117 SLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPK 176
           S  ++ + +   A +DA   I+++P++ K Y+RKG ALM +K Y+EA  AF +GL+ +P 
Sbjct: 425 SFCHLQMTEGNRALLDANICIKLRPEWLKGYYRKGAALMFLKNYKEACDAFMVGLKLDPG 484

Query: 177 NESFINALEEA 187
           N     AL E 
Sbjct: 485 NAEMEKALREG 495



>gi|242038553|ref|XP_002466671.1| hypothetical protein SORBIDRAFT_01g012020 [Sorghum bicolor]
 gi|241920525|gb|EER93669.1| hypothetical protein SORBIDRAFT_01g012020 [Sorghum bicolor]
          Length = 356

 Score = 75.5 bits (184), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 74/135 (54%), Gaps = 19/135 (14%)

Query: 61  NQITKL--KEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSL 118
            +ITKL  K  G+     +NY  A KLY+ AIE+       +P ++T        SNRSL
Sbjct: 230 GKITKLELKLGGDKAVGRKNYLAASKLYTQAIEL-------DPDDAT------LYSNRSL 276

Query: 119 SYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKN- 177
             + + +   A +DA   I+I+P++ K Y+RKG ALM +K Y+EA  AF  GL+ +P N 
Sbjct: 277 CQLQIGEANKALLDANSCIKIRPEWLKGYYRKGVALMSLKEYKEACDAFLAGLKLDPTNV 336

Query: 178 ---ESFINALEEARK 189
                F+ A+E  +K
Sbjct: 337 DMERMFMEAIEAMKK 351



>gi|507615229|ref|XP_004623103.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta [Octodon degus]
          Length = 304

 Score = 75.5 bits (184), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 47/144 (32%), Positives = 79/144 (54%), Gaps = 13/144 (9%)

Query: 46  KGNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHEST 105
           K +I P + +      +  +LK+EGN + K +NY+ A+  Y+ AIE+       +P+ + 
Sbjct: 68  KNDISPLSNLVPEDVGKADQLKDEGNNHMKEENYAAAVDCYTQAIEL-------DPNNA- 119

Query: 106 EQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVH 165
              V  C  NR+ +   L  + +A  D E  I I   YSKAY R G AL  M ++EEAV 
Sbjct: 120 ---VYYC--NRAAAQSKLSHYTDAIKDCEKAIAIDSKYSKAYGRMGLALTAMNKFEEAVR 174

Query: 166 AFEIGLEFEPKNESFINALEEARK 189
           +++  L+ +P+N+S+ + L+ A +
Sbjct: 175 SYQKALDLDPENDSYKSNLKIAEQ 198



>gi|507934162|ref|XP_004678314.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta [Condylura cristata]
          Length = 304

 Score = 75.1 bits (183), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 49/157 (31%), Positives = 85/157 (54%), Gaps = 14/157 (8%)

Query: 33  KPLNTLHKSLIPIKGNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEM 92
           +PL  +  S       +P  N + +++  +  +LK+EGN + K +NY+ A+  Y+ AIE+
Sbjct: 56  QPLTEMFTSSFCKNEILPLSNSVPEDV-GKADQLKDEGNNHMKEENYAAAVDCYTQAIEL 114

Query: 93  AFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGK 152
                  +P+ +    V  C  NR+ +   L  + +A  D E  I I   YSKAY R G 
Sbjct: 115 -------DPNNA----VYYC--NRAAAQSKLSHYTDAIKDCEKAIAIDSKYSKAYGRMGL 161

Query: 153 ALMGMKRYEEAVHAFEIGLEFEPKNESFINALEEARK 189
           AL  M ++EEAV +++  L+ +P+N+S+ + L+ A +
Sbjct: 162 ALTAMNKFEEAVTSYQKALDLDPENDSYKSNLKIAEQ 198



>gi|460404241|ref|XP_004247592.1| PREDICTED: uncharacterized protein LOC101253624 [Solanum
           lycopersicum]
          Length = 318

 Score = 75.1 bits (183), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 74/133 (55%), Gaps = 19/133 (14%)

Query: 64  TKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFL 123
           T LK++GN + K+ NY +A  LY+ AI+        +P  +T        SNR+ +++ L
Sbjct: 10  TSLKDQGNEFFKAGNYLKAAALYTQAIKK-------DPSNAT------LYSNRAAAFLHL 56

Query: 124 EQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINA 183
            +   A  DAE  I +KP++ K YFRKG  L  M+RYE+A+ AF I  ++ P++      
Sbjct: 57  VKLSKALADAEMTINLKPEWEKGYFRKGCILEAMERYEDALAAFRIASKYNPQSS----- 111

Query: 184 LEEARKLAGITDL 196
            E ++K+  +T L
Sbjct: 112 -EVSKKIKTLTQL 123



>gi|431907789|gb|ELK11396.1| Small glutamine-rich tetratricopeptide repeat-containing protein
           beta [Pteropus alecto]
          Length = 304

 Score = 75.1 bits (183), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 80/141 (56%), Gaps = 14/141 (9%)

Query: 49  IPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQE 108
           +P  N + +++  +  +LK+EGN + K +NY+ AI  Y+ AIE+       +P+ +    
Sbjct: 72  LPLSNSVPEDV-GKADQLKDEGNNHMKEENYAAAIDCYTQAIEL-------DPNNA---- 119

Query: 109 VSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFE 168
           V  C  NR+ +   L  + +A  D E  I I   YSKAY R G AL  M ++EEAV +++
Sbjct: 120 VYYC--NRAAAQSKLGHYTDAIKDCEKAIAIDSKYSKAYGRMGLALTAMNKFEEAVTSYQ 177

Query: 169 IGLEFEPKNESFINALEEARK 189
             L+ +P+N+S+ + L+ A +
Sbjct: 178 KALDLDPENDSYKSNLKIAEQ 198



>gi|116786888|gb|ABK24283.1| unknown [Picea sitchensis]
          Length = 568

 Score = 75.1 bits (183), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 67/122 (54%), Gaps = 13/122 (10%)

Query: 67  KEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQW 126
           K +GN    + NY EAIK +S AI +A                 V  SNRS +Y  L  +
Sbjct: 6   KAKGNAAFSAGNYEEAIKHFSEAIVLAPTN-------------HVLYSNRSAAYASLHNY 52

Query: 127 VNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
            +A  DA+  + IK D+SK Y R G A +G+ +Y++A+ +++ GLE +P NE+  + L +
Sbjct: 53  SDALQDAKKTVEIKADWSKGYSRLGAAYVGLGKYDDAISSYKKGLELDPSNEALKSGLAD 112

Query: 187 AR 188
           A+
Sbjct: 113 AQ 114



>gi|224111122|ref|XP_002315755.1| predicted protein [Populus trichocarpa]
 gi|222864795|gb|EEF01926.1| predicted protein [Populus trichocarpa]
          Length = 334

 Score = 75.1 bits (183), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 76/139 (54%), Gaps = 20/139 (14%)

Query: 58  NLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRS 117
           N+  +I+ LK++GN + K+ NY +A  LY+ AI++    P                SNR+
Sbjct: 17  NVKEEIS-LKDKGNEFFKAGNYLKAAALYTQAIKLDPSNP-------------TLYSNRA 62

Query: 118 LSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKN 177
            +++ L +   A  DAE  I++ P + K YFRKG  L GM+RY++A+  F+I L+  P+ 
Sbjct: 63  AAFLQLVKLNKALADAETTIKLNPQWEKGYFRKGCVLEGMERYDDALATFQIALQHNPQ- 121

Query: 178 ESFINALEEARKLAGITDL 196
                + E +RK+  I+ L
Sbjct: 122 -----STEVSRKIKRISQL 135



>gi|406603581|emb|CCH44894.1| Translocation protein [Wickerhamomyces ciferrii]
          Length = 215

 Score = 75.1 bits (183), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 75/159 (47%)

Query: 35  LNTLHKSLIPIKGNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAF 94
           LN L K  I +   IP     ++ L+  I KL   G    K   + +AIK +S AI+MA 
Sbjct: 52  LNRLSKDFINLNSEIPESPEPSKTLTPLIKKLVTSGIDAQKRGKHHDAIKQFSLAIDMAS 111

Query: 95  QRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKAL 154
           +R  WE      QE+++ L  R  SYI  + W++AY DA+  +  + +  + + R+  A 
Sbjct: 112 RRSRWEAFAIQLQELNLILMARCDSYIMTKNWIDAYNDADMLLGTQVNTPENFLRRATAA 171

Query: 155 MGMKRYEEAVHAFEIGLEFEPKNESFINALEEARKLAGI 193
             M R  +A +  E GL F   +E     L    +L  +
Sbjct: 172 SNMGRLTQAKYDLERGLCFVEDDERIKTQLGVVNRLIAV 210



>gi|395825398|ref|XP_003785922.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta [Otolemur garnettii]
          Length = 304

 Score = 75.1 bits (183), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 78/141 (55%), Gaps = 14/141 (9%)

Query: 49  IPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQE 108
           +P  N + +++  +  +LK+EGN + K +NY  A+  Y+ AIE+       +P+ +    
Sbjct: 72  LPLSNSVPEDV-GKADQLKDEGNNHMKEENYGAAVDCYTQAIEL-------DPNNA---- 119

Query: 109 VSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFE 168
             V   NR+ +   L  + +A  D E  I I   YSKAY R G AL  M ++EEAV +++
Sbjct: 120 --VYFCNRAAAQSKLGHYTDAIKDCEKAIAIDSKYSKAYGRMGLALTAMNKFEEAVTSYQ 177

Query: 169 IGLEFEPKNESFINALEEARK 189
             L+ +P+N+S+ + L+ A +
Sbjct: 178 KALDLDPENDSYKSNLKIAEQ 198



>gi|21450231|ref|NP_659087.1| small glutamine-rich tetratricopeptide repeat-containing protein
           beta [Mus musculus]
 gi|52783415|sp|Q8VD33.1|SGTB_MOUSE RecName: Full=Small glutamine-rich tetratricopeptide
           repeat-containing protein beta; AltName: Full=Beta-SGT
 gi|17160880|gb|AAH17611.1| Small glutamine-rich tetratricopeptide repeat (TPR)-containing,
           beta [Mus musculus]
 gi|26340544|dbj|BAC33934.1| unnamed protein product [Mus musculus]
 gi|26349533|dbj|BAC38406.1| unnamed protein product [Mus musculus]
 gi|148686558|gb|EDL18505.1| small glutamine-rich tetratricopeptide repeat (TPR)-containing,
           beta, isoform CRA_a [Mus musculus]
          Length = 304

 Score = 75.1 bits (183), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 72/125 (57%), Gaps = 13/125 (10%)

Query: 65  KLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLE 124
           +LK+EGN + K +NY+ A+  Y+ AIE+       +P+ +    V  C  NR+ +   L 
Sbjct: 87  QLKDEGNNHMKEENYAAAVDCYTQAIEL-------DPNNA----VYYC--NRAAAQSKLS 133

Query: 125 QWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINAL 184
            + +A  D E  I I   YSKAY R G AL  M ++EEAV +++  L+ +P+N+S+ + L
Sbjct: 134 HYTDAIKDCEKAIAIDSKYSKAYGRMGLALTAMNKFEEAVTSYQKALDLDPENDSYKSNL 193

Query: 185 EEARK 189
           + A +
Sbjct: 194 KIAEQ 198



>gi|193636512|ref|XP_001950745.1| PREDICTED: stress-induced-phosphoprotein 1-like [Acyrthosiphon
           pisum]
          Length = 542

 Score = 75.1 bits (183), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 43/124 (34%), Positives = 69/124 (55%), Gaps = 13/124 (10%)

Query: 66  LKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQ 125
           LK++GN      NY +AI+ Y+ AIE+       +P+        V  SNRS ++    +
Sbjct: 5   LKDKGNAALAIGNYEQAIEHYTKAIEL-------DPNNH------VLFSNRSAAFAKQGK 51

Query: 126 WVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALE 185
           + NA  DAE  + +KPD+ K Y RKG AL  + R ++A  A+  GL+F+P N+  ++ L 
Sbjct: 52  YQNALEDAEKTVSLKPDWPKGYSRKGTALSFLGRKDDAAKAYGDGLKFDPTNQQLLDGLR 111

Query: 186 EARK 189
           E ++
Sbjct: 112 EVKQ 115



>gi|504142730|ref|XP_004583801.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta [Ochotona princeps]
          Length = 304

 Score = 75.1 bits (183), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 72/125 (57%), Gaps = 13/125 (10%)

Query: 65  KLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLE 124
           +LK+EGN + K +NY+ A+  Y+ AIE+       +P+ +    V  C  NR+ +   L 
Sbjct: 87  QLKDEGNNHMKEENYTAAVACYTQAIEL-------DPNNA----VYYC--NRAAAQSKLS 133

Query: 125 QWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINAL 184
            + +A  D E  I I   YSKAY R G AL  M ++EEAV +++  L+ +P+N+S+ + L
Sbjct: 134 HYTDAIKDCEKAIAIDSKYSKAYGRMGLALTAMNKFEEAVTSYQKALDLDPENDSYKSNL 193

Query: 185 EEARK 189
           + A +
Sbjct: 194 KIAEQ 198



>gi|31745160|ref|NP_853660.1| small glutamine-rich tetratricopeptide repeat-containing protein
           beta [Rattus norvegicus]
 gi|81912832|sp|Q80W98.1|SGTB_RAT RecName: Full=Small glutamine-rich tetratricopeptide
           repeat-containing protein beta; AltName: Full=Beta-SGT;
           AltName: Full=Small glutamine-rich protein with
           tetratricopeptide repeats 2
 gi|30268695|gb|AAP29458.1|AF368280_1 small glutamine rich protein with tetratricopeptide repeats 2
           [Rattus norvegicus]
 gi|149059249|gb|EDM10256.1| small glutamine-rich tetratricopeptide repeat (TPR)-containing,
           beta [Rattus norvegicus]
          Length = 304

 Score = 75.1 bits (183), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 72/125 (57%), Gaps = 13/125 (10%)

Query: 65  KLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLE 124
           +LK+EGN + K +NY+ A+  Y+ AIE+       +P+ +    V  C  NR+ +   L 
Sbjct: 87  QLKDEGNNHMKEENYAAAVDCYTQAIEL-------DPNNA----VYYC--NRAAAQSKLS 133

Query: 125 QWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINAL 184
            + +A  D E  I I   YSKAY R G AL  M ++EEAV +++  L+ +P+N+S+ + L
Sbjct: 134 HYTDAIKDCEKAIAIDSKYSKAYGRMGLALTAMNKFEEAVTSYQKALDLDPENDSYKSNL 193

Query: 185 EEARK 189
           + A +
Sbjct: 194 KIAEQ 198



>gi|395510372|ref|XP_003759451.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta [Sarcophilus harrisii]
          Length = 304

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 71/125 (56%), Gaps = 13/125 (10%)

Query: 65  KLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLE 124
           +LK+EGN + K +NY  A+  Y+ AIE+       +P+ +    V  C  NR+ +   L 
Sbjct: 87  QLKDEGNNHMKEENYGAAVDCYTQAIEL-------DPNNA----VYYC--NRAAAQSKLG 133

Query: 125 QWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINAL 184
            + +A  D E  I I   YSKAY R G AL  M +YEEA+ +++  L+ +P+N+S+ + L
Sbjct: 134 HYTDAIKDCERAIEIDSKYSKAYGRMGLALTAMNKYEEAITSYQKALDLDPENDSYKSNL 193

Query: 185 EEARK 189
           + A +
Sbjct: 194 KIAEQ 198



>gi|325184864|emb|CCA19356.1| cellulose synthase 3 putative [Albugo laibachii Nc14]
          Length = 1714

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 50/123 (40%), Positives = 65/123 (52%), Gaps = 13/123 (10%)

Query: 67   KEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQW 126
            K +GN    + N  EAI+ Y+ AIE+        P +       V  SNRS +Y+ L   
Sbjct: 1160 KTKGNAALSAGNPKEAIEYYTKAIEI-------NPSDH------VFYSNRSAAYLSLNDS 1206

Query: 127  VNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
             NA  DAE  I  K +++K Y RKG AL   ++Y EAV AFE GLEFEP N + I   +E
Sbjct: 1207 ENALRDAEECITRKSNWAKGYARKGAALHAQRKYNEAVAAFEKGLEFEPTNSACITGKDE 1266

Query: 187  ARK 189
              K
Sbjct: 1267 VVK 1269



>gi|359497489|ref|XP_003635537.1| PREDICTED: LOW QUALITY PROTEIN: heat shock protein STI-like [Vitis
           vinifera]
          Length = 331

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 67/125 (53%), Gaps = 13/125 (10%)

Query: 67  KEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQW 126
           K +GN    S ++S A++ +S AI +A                 V  SNRS +Y  L+Q+
Sbjct: 6   KAKGNAAFSSGDFSAAVRHFSDAIALAPTN-------------HVLYSNRSAAYASLQQY 52

Query: 127 VNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
             A  DA+  + +KPD+SK Y R G A  G+   ++AV A++ GLE +P N++  + L +
Sbjct: 53  SEALADAKKTVELKPDWSKGYSRLGAAHQGLGHLDDAVSAYKKGLEIDPNNQALKSGLAD 112

Query: 187 ARKLA 191
           A+  A
Sbjct: 113 AQAAA 117



>gi|291395450|ref|XP_002714114.1| PREDICTED: small glutamine-rich tetratricopeptide repeat
           (TPR)-containing, beta [Oryctolagus cuniculus]
          Length = 304

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 72/125 (57%), Gaps = 13/125 (10%)

Query: 65  KLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLE 124
           +LK+EGN + K +NY+ A+  Y+ AIE+       +P+ +    V  C  NR+ +   L 
Sbjct: 87  QLKDEGNNHMKEENYAAAVDCYTQAIEL-------DPNNA----VYYC--NRAAAQSKLS 133

Query: 125 QWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINAL 184
            + +A  D E  I I   YSKAY R G AL  M ++EEAV +++  L+ +P+N+S+ + L
Sbjct: 134 HYTDAIKDCEKAIAIDSKYSKAYGRMGLALTAMNKFEEAVTSYQKALDLDPENDSYKSNL 193

Query: 185 EEARK 189
           + A +
Sbjct: 194 KIAEQ 198



>gi|344246965|gb|EGW03069.1| Small glutamine-rich tetratricopeptide repeat-containing protein
           beta [Cricetulus griseus]
          Length = 261

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 80/141 (56%), Gaps = 14/141 (9%)

Query: 49  IPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQE 108
           +P  N + +++  +  +LK+EGN + K +NY+ A+  Y+ AIE+       +P+ +    
Sbjct: 29  LPLSNSVPEDVG-KADQLKDEGNNHMKEENYTAAVDCYTQAIEL-------DPNNA---- 76

Query: 109 VSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFE 168
           V  C  NR+ +   L  + +A  D E  I I   YSKAY R G AL  M ++EEAV +++
Sbjct: 77  VYYC--NRAAAQSKLSHYTDAIKDCEKAIAIDSKYSKAYGRMGLALTAMNKFEEAVTSYQ 134

Query: 169 IGLEFEPKNESFINALEEARK 189
             L+ +P+N+S+ + L+ A +
Sbjct: 135 KALDLDPENDSYKSNLKIAEQ 155



>gi|311273829|ref|XP_003134059.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta-like [Sus scrofa]
          Length = 304

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 80/141 (56%), Gaps = 14/141 (9%)

Query: 49  IPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQE 108
           +P  N + +++  +  +LK+EGN + K +NY+ A+  Y+ AIE+       +P+ +    
Sbjct: 72  LPLSNSVPEDV-GKADQLKDEGNNHMKEENYAAAVDCYTQAIEL-------DPNNA---- 119

Query: 109 VSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFE 168
           V  C  NR+ +   L  + +A  D E  I I   YSKAY R G AL  M ++EEAV +++
Sbjct: 120 VYYC--NRAAAQSKLGHYTDAIKDCEKAIAIDSKYSKAYGRMGLALTAMNKFEEAVTSYQ 177

Query: 169 IGLEFEPKNESFINALEEARK 189
             L+ +P+N+S+ + L+ A +
Sbjct: 178 KALDLDPENDSYKSNLKIAEQ 198



>gi|414868871|tpg|DAA47428.1| TPA: hypothetical protein ZEAMMB73_020404 [Zea mays]
          Length = 179

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 70/126 (55%), Gaps = 13/126 (10%)

Query: 66  LKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQ 125
           LK++GN   K+ +Y +A  LY+ AI++       +P  +T        SNR+ +++ L +
Sbjct: 17  LKDQGNEQFKAGSYLKAAALYTQAIKL-------DPDNAT------LYSNRAAAFLQLVK 63

Query: 126 WVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALE 185
              A  DAE  +R+KP + K +FRKG  L  M+RYEEA+ AF+I L+   +N      ++
Sbjct: 64  LSKALADAETTVRLKPQWEKGHFRKGCVLEAMERYEEAIAAFQIALQHNSQNTEVSRKIK 123

Query: 186 EARKLA 191
              +LA
Sbjct: 124 RLSQLA 129



>gi|212723542|ref|NP_001132666.1| uncharacterized protein LOC100194143 [Zea mays]
 gi|194690064|gb|ACF79116.1| unknown [Zea mays]
 gi|194695042|gb|ACF81605.1| unknown [Zea mays]
 gi|414868870|tpg|DAA47427.1| TPA: hypothetical protein ZEAMMB73_020404 [Zea mays]
          Length = 324

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 70/126 (55%), Gaps = 13/126 (10%)

Query: 66  LKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQ 125
           LK++GN   K+ +Y +A  LY+ AI++       +P  +T        SNR+ +++ L +
Sbjct: 17  LKDQGNEQFKAGSYLKAAALYTQAIKL-------DPDNAT------LYSNRAAAFLQLVK 63

Query: 126 WVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALE 185
              A  DAE  +R+KP + K +FRKG  L  M+RYEEA+ AF+I L+   +N      ++
Sbjct: 64  LSKALADAETTVRLKPQWEKGHFRKGCVLEAMERYEEAIAAFQIALQHNSQNTEVSRKIK 123

Query: 186 EARKLA 191
              +LA
Sbjct: 124 RLSQLA 129



>gi|466013773|ref|XP_004270800.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta [Orcinus orca]
          Length = 304

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 80/141 (56%), Gaps = 14/141 (9%)

Query: 49  IPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQE 108
           +P  N + +++  +  +LK+EGN + K +NY+ A+  Y+ AIE+       +P+ +    
Sbjct: 72  LPLSNSVPEDV-GKADQLKDEGNNHMKEENYAAAVDCYTQAIEL-------DPNNA---- 119

Query: 109 VSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFE 168
           V  C  NR+ +   L  + +A  D E  I I   YSKAY R G AL  M ++EEAV +++
Sbjct: 120 VYYC--NRAAAQSKLGHYTDAVKDCEKAIAIDSKYSKAYGRMGLALTAMNKFEEAVTSYQ 177

Query: 169 IGLEFEPKNESFINALEEARK 189
             L+ +P+N+S+ + L+ A +
Sbjct: 178 KALDLDPENDSYKSNLKIAEQ 198



>gi|359497893|ref|XP_003635686.1| PREDICTED: heat shock protein STI-like, partial [Vitis vinifera]
          Length = 294

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/125 (33%), Positives = 67/125 (53%), Gaps = 13/125 (10%)

Query: 67  KEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQW 126
           K +GN    S ++S A++ +S AI +A                 V  SNRS +Y  L+Q+
Sbjct: 6   KAKGNAAFSSGDFSAAVRHFSDAIALAPTN-------------HVLYSNRSAAYASLQQY 52

Query: 127 VNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
             A  DA+  + +KPD+SK Y R G A  G+   ++AV A++ GLE +P N++  + L +
Sbjct: 53  SEALADAKKTVELKPDWSKGYSRLGAAHQGLGHLDDAVSAYKKGLEIDPNNQALKSGLAD 112

Query: 187 ARKLA 191
           A+  A
Sbjct: 113 AQAAA 117



>gi|15219673|ref|NP_171915.1| carboxylate clamp-tetratricopeptide repeat protein [Arabidopsis
           thaliana]
 gi|19423984|gb|AAL87273.1| unknown protein [Arabidopsis thaliana]
 gi|21281239|gb|AAM45091.1| unknown protein [Arabidopsis thaliana]
 gi|332189547|gb|AEE27668.1| tetratricopeptide repeat-containing protein [Arabidopsis thaliana]
          Length = 328

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 75/132 (56%), Gaps = 19/132 (14%)

Query: 66  LKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQ 125
           LKE+GN + K+ N+ +A  LY+ AI++       +P  +T        SNR+ +++ L +
Sbjct: 18  LKEKGNEFFKAGNFLKAAALYTQAIKL-------DPSNAT------LYSNRAAAFLSLVK 64

Query: 126 WVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALE 185
              A  DAE  I++ P + K YFRKG  L  M++YE+A+ AFE+ L++ P+      + E
Sbjct: 65  LSKALADAETTIKLNPQWEKGYFRKGCVLEAMEKYEDALAAFEMALQYNPQ------STE 118

Query: 186 EARKLAGITDLE 197
            +RK+  +  L+
Sbjct: 119 VSRKIKRLGQLQ 130



>gi|357157238|ref|XP_003577731.1| PREDICTED: tetratricopeptide repeat protein 1-like [Brachypodium
           distachyon]
          Length = 320

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/137 (32%), Positives = 71/137 (51%), Gaps = 19/137 (13%)

Query: 60  SNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLS 119
           + +   LK++GN   K+  Y +A  LY+ AI++    P                SNR+ +
Sbjct: 5   AGRAAALKDQGNEQFKTGGYLKAAALYTQAIKLDPDNP-------------TLYSNRAAA 51

Query: 120 YIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNES 179
           ++ L +   A  DAE  +++KP + K YFRKG  L  M++YEEA+ AF+  L+  P+N  
Sbjct: 52  FLQLVKLNKALADAEMTVKLKPQWEKGYFRKGCVLEAMEQYEEAISAFQTALQHNPQN-- 109

Query: 180 FINALEEARKLAGITDL 196
                E +RK+  +T L
Sbjct: 110 ----TEVSRKIKRLTQL 122



>gi|115489466|ref|NP_001067220.1| Os12g0604800 [Oryza sativa Japonica Group]
 gi|108862932|gb|ABA99824.2| tetratricopeptide repeat protein, putative, expressed [Oryza sativa
           Japonica Group]
 gi|113649727|dbj|BAF30239.1| Os12g0604800 [Oryza sativa Japonica Group]
 gi|215706934|dbj|BAG93394.1| unnamed protein product [Oryza sativa Japonica Group]
 gi|218187204|gb|EEC69631.1| hypothetical protein OsI_39024 [Oryza sativa Indica Group]
 gi|222617432|gb|EEE53564.1| hypothetical protein OsJ_36789 [Oryza sativa Japonica Group]
          Length = 324

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/131 (33%), Positives = 70/131 (53%), Gaps = 19/131 (14%)

Query: 66  LKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQ 125
           LK++GN   K+ NY +A  LY+ AI++    P                SNR+ +++ L +
Sbjct: 17  LKDQGNEQFKAGNYLKAAALYTQAIKLDPDNP-------------TLYSNRAAAFLHLVK 63

Query: 126 WVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALE 185
              A  DA+  I++KP + K +FRKG  L  M+ YEEA+ +F+I L+  P+N       E
Sbjct: 64  LNKALADADTTIKLKPQWEKGHFRKGCVLESMEHYEEAISSFQIALQHNPQN------TE 117

Query: 186 EARKLAGITDL 196
            +RK+  +T L
Sbjct: 118 VSRKIKRLTQL 128



>gi|71894775|ref|NP_001026589.1| small glutamine-rich tetratricopeptide repeat-containing protein
           beta [Gallus gallus]
 gi|53133738|emb|CAG32198.1| hypothetical protein RCJMB04_19o2 [Gallus gallus]
          Length = 304

 Score = 74.7 bits (182), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 72/125 (57%), Gaps = 13/125 (10%)

Query: 65  KLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLE 124
           +LK+EGN + K +NY  A+  Y+ AIE+       +P+ +    V  C  NR+ +   L 
Sbjct: 87  RLKDEGNNHMKEENYGAAVDCYTRAIEL-------DPNNA----VYYC--NRAAAQSKLN 133

Query: 125 QWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINAL 184
           ++  A  D E  I I P YSKAY R G AL  + +YEEA+ +++  L+ +P+N+S+ + L
Sbjct: 134 KYSEAIKDCERAIAIDPKYSKAYGRMGLALTSVNKYEEAITSYQKALDLDPENDSYKSNL 193

Query: 185 EEARK 189
           + A +
Sbjct: 194 KIAEQ 198



>gi|357135087|ref|XP_003569143.1| PREDICTED: ankyrin-1-like [Brachypodium distachyon]
          Length = 463

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 73/130 (56%), Gaps = 17/130 (13%)

Query: 67  KEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQW 126
           K  G+   + ++Y EA+  YS AIE       ++P+++      V LSNRSL ++   Q 
Sbjct: 336 KSRGDDAFRRKDYLEAVDAYSQAIE-------FDPNDA------VLLSNRSLCWLRAGQG 382

Query: 127 VNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
             A  DA     ++PD++KA FR+G AL  ++R+ EA +AF  G+  +P+N+  ++A  E
Sbjct: 383 ERALEDARACRELRPDWAKACFREGAALRLLQRFHEAANAFYEGVTLDPENKELVSAFRE 442

Query: 187 A----RKLAG 192
           A    RKL G
Sbjct: 443 AVDEGRKLHG 452



>gi|471368137|ref|XP_004374596.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta [Trichechus manatus latirostris]
          Length = 304

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 78/141 (55%), Gaps = 14/141 (9%)

Query: 49  IPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQE 108
           +P  N + +++  +  +LK+EGN + K +NY+ A+  Y+ AIE+             + +
Sbjct: 72  LPLSNSVPEDV-GKADQLKDEGNNHMKEENYTAAVDCYTRAIEL-------------DPD 117

Query: 109 VSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFE 168
            +V   NR+ +   L  + +A  D E  I I   YSKAY R G AL  M ++EEAV +++
Sbjct: 118 NAVYYCNRAAAQSKLGHYTDAIKDCEKAIAIDSKYSKAYGRMGLALTAMNKFEEAVTSYQ 177

Query: 169 IGLEFEPKNESFINALEEARK 189
             L+ +P+N+S+ + L+ A +
Sbjct: 178 KALDLDPENDSYKSNLKIAEQ 198



>gi|148686559|gb|EDL18506.1| small glutamine-rich tetratricopeptide repeat (TPR)-containing,
           beta, isoform CRA_b [Mus musculus]
          Length = 245

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 72/125 (57%), Gaps = 13/125 (10%)

Query: 65  KLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLE 124
           +LK+EGN + K +NY+ A+  Y+ AIE+       +P+ +    V  C  NR+ +   L 
Sbjct: 45  QLKDEGNNHMKEENYAAAVDCYTQAIEL-------DPNNA----VYYC--NRAAAQSKLS 91

Query: 125 QWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINAL 184
            + +A  D E  I I   YSKAY R G AL  M ++EEAV +++  L+ +P+N+S+ + L
Sbjct: 92  HYTDAIKDCEKAIAIDSKYSKAYGRMGLALTAMNKFEEAVTSYQKALDLDPENDSYKSNL 151

Query: 185 EEARK 189
           + A +
Sbjct: 152 KIAEQ 156



>gi|71421536|ref|XP_811823.1| stress-inducible protein STI1-like [Trypanosoma cruzi strain CL
           Brener]
 gi|70876531|gb|EAN89972.1| stress-inducible protein STI1-like, putative [Trypanosoma cruzi]
          Length = 257

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 70/123 (56%), Gaps = 12/123 (9%)

Query: 65  KLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCL-SNRSLSYIFL 123
           +L+ +GN   K++ Y +AI  Y+ AI+M           S E EV+  L SNR+  +  +
Sbjct: 5   ELRLKGNEAFKAKKYEDAIDCYTKAIDM-----------SPESEVAAALYSNRAACWQNM 53

Query: 124 EQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINA 183
               NA  DAE  I +KP + K Y+RKG AL  M+RY+EA+ AF+   + EP++E   + 
Sbjct: 54  GNAANALKDAESCILLKPSWLKGYYRKGSALESMQRYDEALEAFQRASKLEPESEEISDK 113

Query: 184 LEE 186
           L++
Sbjct: 114 LQK 116



>gi|512840302|ref|XP_004884426.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta isoform X4 [Heterocephalus glaber]
 gi|513002865|ref|XP_004862923.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta isoform X4 [Heterocephalus glaber]
          Length = 300

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 79/141 (56%), Gaps = 14/141 (9%)

Query: 49  IPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQE 108
           +P  N + +++  +  +LK+EGN + K +NY  A+  Y+ AIE+       +P+ +    
Sbjct: 72  LPLENLVPEDVG-KADQLKDEGNNHMKEENYVAAVDCYTQAIEL-------DPNNA---- 119

Query: 109 VSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFE 168
           V  C  NR+ +   L  + +A  D E  I I   YSKAY R G AL  M ++EEAV +++
Sbjct: 120 VYYC--NRAAAQSKLSHYTDAIKDCEKAIAIDSKYSKAYGRMGLALTAMNKFEEAVRSYQ 177

Query: 169 IGLEFEPKNESFINALEEARK 189
             L+ +P+N+S+ + L+ A +
Sbjct: 178 KALDLDPENDSYKSNLKIAEQ 198



>gi|403267439|ref|XP_003925840.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta [Saimiri boliviensis boliviensis]
          Length = 304

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 77/141 (54%), Gaps = 14/141 (9%)

Query: 49  IPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQE 108
           +P  N + +++  +  +LK+EGN + K +NY+ A+  Y+ AIE+            +   
Sbjct: 72  LPLSNSVPEDV-GKADQLKDEGNNHMKEENYAAAVDCYTQAIEL-----------DSNNA 119

Query: 109 VSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFE 168
           V  C  NR+ +   L  + +A  D E  I I   YSKAY R G AL  M ++EEAV +++
Sbjct: 120 VYYC--NRAAAQSKLGHYTDAVKDCEKAIAIDSKYSKAYGRMGLALTAMNKFEEAVTSYQ 177

Query: 169 IGLEFEPKNESFINALEEARK 189
             L+ +P+N+S+ + L+ A +
Sbjct: 178 KALDLDPENDSYKSNLKIAEQ 198



>gi|452822031|gb|EME29054.1| stress-induced-phosphoprotein 1 [Galdieria sulphuraria]
          Length = 571

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 70/123 (56%), Gaps = 17/123 (13%)

Query: 67  KEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQW 126
           K  GN    ++ + +A++ +S AI+       ++P      +  V  SNRS +Y  L ++
Sbjct: 11  KNRGNAAFSAKEFEKAVEAFSEAIQ-------YDP------DNHVLYSNRSAAYASLGKY 57

Query: 127 VNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
             A  DA   I+ KPD++K Y RKG AL G+ +YEEA+ A+E GL+ EP NE    AL E
Sbjct: 58  REALEDANSCIQRKPDWAKGYSRKGAALYGLGQYEEAIAAYEQGLQIEPHNE----ALRE 113

Query: 187 ARK 189
           A++
Sbjct: 114 AKQ 116



>gi|512840290|ref|XP_004884423.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta isoform X1 [Heterocephalus glaber]
 gi|512840294|ref|XP_004884424.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta isoform X2 [Heterocephalus glaber]
 gi|512840298|ref|XP_004884425.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta isoform X3 [Heterocephalus glaber]
 gi|513002859|ref|XP_004862920.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta isoform X1 [Heterocephalus glaber]
 gi|513002861|ref|XP_004862921.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta isoform X2 [Heterocephalus glaber]
 gi|513002863|ref|XP_004862922.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta isoform X3 [Heterocephalus glaber]
 gi|351699841|gb|EHB02760.1| Small glutamine-rich tetratricopeptide repeat-containing protein
           beta [Heterocephalus glaber]
          Length = 304

 Score = 74.3 bits (181), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 79/141 (56%), Gaps = 14/141 (9%)

Query: 49  IPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQE 108
           +P  N + +++  +  +LK+EGN + K +NY  A+  Y+ AIE+       +P+ +    
Sbjct: 72  LPLENLVPEDV-GKADQLKDEGNNHMKEENYVAAVDCYTQAIEL-------DPNNA---- 119

Query: 109 VSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFE 168
           V  C  NR+ +   L  + +A  D E  I I   YSKAY R G AL  M ++EEAV +++
Sbjct: 120 VYYC--NRAAAQSKLSHYTDAIKDCEKAIAIDSKYSKAYGRMGLALTAMNKFEEAVRSYQ 177

Query: 169 IGLEFEPKNESFINALEEARK 189
             L+ +P+N+S+ + L+ A +
Sbjct: 178 KALDLDPENDSYKSNLKIAEQ 198



>gi|296194455|ref|XP_002744952.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta [Callithrix jacchus]
          Length = 304

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 77/141 (54%), Gaps = 14/141 (9%)

Query: 49  IPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQE 108
           +P  N + +++  +  +LK+EGN + K +NY+ A+  Y+ AIE+            +   
Sbjct: 72  LPLSNSVPEDV-GKADQLKDEGNNHMKEENYAAAVDCYTQAIEL-----------DSNNA 119

Query: 109 VSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFE 168
           V  C  NR+ +   L  + +A  D E  I I   YSKAY R G AL  M ++EEAV +++
Sbjct: 120 VYYC--NRAAAQSKLGHYTDAIKDCEKAIAIDSKYSKAYGRMGLALTAMNKFEEAVTSYQ 177

Query: 169 IGLEFEPKNESFINALEEARK 189
             L+ +P+N+S+ + L+ A +
Sbjct: 178 KALDLDPENDSYKSNLKIAEQ 198



>gi|71403792|ref|XP_804660.1| stress-inducible protein STI1-like [Trypanosoma cruzi strain CL
           Brener]
 gi|70867748|gb|EAN82809.1| stress-inducible protein STI1-like, putative [Trypanosoma cruzi]
          Length = 257

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/122 (36%), Positives = 69/122 (56%), Gaps = 12/122 (9%)

Query: 65  KLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCL-SNRSLSYIFL 123
           +L+ +GN   K++ Y +AI  Y+ AI+M           S E EV+  L SNR+  +  +
Sbjct: 5   ELRLKGNEAFKAKKYEDAIDCYTKAIDM-----------SPESEVAAALYSNRAACWQNM 53

Query: 124 EQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINA 183
               NA  DAE  I +KP + K Y+RKG AL  M+RY+EA+ AF+   + EP++E   + 
Sbjct: 54  GNAANALKDAESCILLKPSWLKGYYRKGSALESMQRYDEALEAFQRASKLEPESEEISDK 113

Query: 184 LE 185
           L+
Sbjct: 114 LQ 115



>gi|449278703|gb|EMC86494.1| Small glutamine-rich tetratricopeptide repeat-containing protein
           beta [Columba livia]
          Length = 304

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 71/125 (56%), Gaps = 13/125 (10%)

Query: 65  KLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLE 124
           +LK+EGN + K +NY  A+  Y+ AIE+       +P+ +    V  C  NR+ +   L 
Sbjct: 87  QLKDEGNNHMKEENYGAAVDCYTRAIEL-------DPNNA----VYYC--NRAAAQSKLN 133

Query: 125 QWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINAL 184
            +  A  D E  I I P YSKAY R G AL  + +YEEAV +++  L+ +P+N+S+ + L
Sbjct: 134 NYREAIKDCERAIAIDPKYSKAYGRMGLALTSVNKYEEAVTSYQKALDLDPENDSYKSNL 193

Query: 185 EEARK 189
           + A +
Sbjct: 194 KIAEQ 198



>gi|402871699|ref|XP_003899791.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta [Papio anubis]
 gi|355691352|gb|EHH26537.1| Beta-SGT [Macaca mulatta]
          Length = 304

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 77/141 (54%), Gaps = 14/141 (9%)

Query: 49  IPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQE 108
           +P  N + +++  +  +LK+EGN + K +NY+ A+  Y+ AIE+            +   
Sbjct: 72  LPLSNSVPEDV-GKADQLKDEGNNHMKEENYAAAVDCYTQAIEL-----------DSNNA 119

Query: 109 VSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFE 168
           V  C  NR+ +   L  + +A  D E  I I   YSKAY R G AL  M ++EEAV +++
Sbjct: 120 VYYC--NRAAAQSKLGHYTDAIKDCEKAIAIDSKYSKAYGRMGLALTAMNKFEEAVTSYQ 177

Query: 169 IGLEFEPKNESFINALEEARK 189
             L+ +P+N+S+ + L+ A +
Sbjct: 178 KALDLDPENDSYKSNLKIAEQ 198



>gi|118790083|ref|XP_318014.3| AGAP004797-PA [Anopheles gambiae str. PEST]
 gi|116122346|gb|EAA13278.4| AGAP004797-PA [Anopheles gambiae str. PEST]
          Length = 262

 Score = 74.3 bits (181), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 78/140 (55%), Gaps = 16/140 (11%)

Query: 58  NLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRS 117
           NL+    +LKEEGN   K+ N++EAI  Y+ AI+++   P             +  SNRS
Sbjct: 22  NLNLTADELKEEGNRCVKAGNFTEAILHYTHAIKLSPADP-------------ILYSNRS 68

Query: 118 LSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKN 177
           L++  ++Q+  A  DA+  I + P ++K YFRK +  M + +Y+ A+ ++   L+ +P++
Sbjct: 69  LAFCKMQQYYYANADADKAITLNPTWAKGYFRKAEVSMAVGQYDTALLSYGKALQLQPQD 128

Query: 178 ESFINALEEARKLAGITDLE 197
              I A   ARK A +++ E
Sbjct: 129 MGIIQA---ARKAATLSNKE 145



>gi|478497189|ref|XP_004422933.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta [Ceratotherium simum simum]
          Length = 304

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 72/125 (57%), Gaps = 13/125 (10%)

Query: 65  KLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLE 124
           +LK+EGN + K +NY+ A+  Y+ AIE+       +P+ +    V  C  NR+ +   L 
Sbjct: 87  QLKDEGNNHMKEENYAAAVACYTQAIEL-------DPNNA----VYYC--NRAAAQSKLG 133

Query: 125 QWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINAL 184
            + +A  D E  I I   YSKAY R G AL  M ++EEAV +++  L+ +P+N+S+ + L
Sbjct: 134 HYTDAIKDCEKAIAIDSKYSKAYGRMGLALTAMNKFEEAVTSYQKALDLDPENDSYKSNL 193

Query: 185 EEARK 189
           + A +
Sbjct: 194 KIAEQ 198



>gi|149732684|ref|XP_001492485.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta-like [Equus caballus]
          Length = 304

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 80/141 (56%), Gaps = 14/141 (9%)

Query: 49  IPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQE 108
           +P  N + +++  +  +LK+EGN + K +NY+ A+  Y+ AIE+       +P+ +    
Sbjct: 72  LPLSNSVPEDV-GKADQLKDEGNNHMKEENYAAAVDCYTRAIEL-------DPNNA---- 119

Query: 109 VSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFE 168
           V  C  NR+ +   L  + +A  D E  I I   YSKAY R G AL  M ++EEAV +++
Sbjct: 120 VYYC--NRAAAQSKLGHYTDAIKDCEKAIAIDSKYSKAYGRMGLALTAMNKFEEAVTSYQ 177

Query: 169 IGLEFEPKNESFINALEEARK 189
             L+ +P+N+S+ + L+ A +
Sbjct: 178 KALDLDPENDSYKSNLKIAEQ 198



>gi|145488342|ref|XP_001430175.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 gi|124397271|emb|CAK62777.1| unnamed protein product [Paramecium tetraurelia]
          Length = 782

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 67/124 (54%), Gaps = 13/124 (10%)

Query: 67  KEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQW 126
           K +GN   KS ++ EAI  Y+ +I+              +++++    NR+L Y+ L+ +
Sbjct: 97  KNKGNEALKSNDFKEAINYYTQSIQF-------------DRQMAPSYCNRALVYLKLKDY 143

Query: 127 VNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
            N   D ++ I ++PDY+KAY R+GKA   +K+Y++A   F+  L+ EP N      L E
Sbjct: 144 QNVITDCDYAIALQPDYTKAYHRRGKAYFALKQYDKAYLDFKFILQVEPDNNEVNGELRE 203

Query: 187 ARKL 190
            RK 
Sbjct: 204 CRKF 207



>gi|291225755|ref|XP_002732863.1| PREDICTED: conserved hypothetical protein-like [Saccoglossus
           kowalevskii]
          Length = 229

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 80/133 (60%), Gaps = 16/133 (12%)

Query: 56  NQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSN 115
           NQ  +N+    K+ GNT  K ++Y  AI  Y+ +I++       +P+++T       L+N
Sbjct: 5   NQQKANEA---KQRGNTEAKRKHYFNAIIHYTESIKI-------DPNDAT------VLTN 48

Query: 116 RSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEP 175
           RSL ++ + Q   A  DA+  I+++PD+SK Y+RKG+      +++E + A+++GLE  P
Sbjct: 49  RSLCFLKMAQHFLALEDAKRAIKLQPDWSKGYYRKGQVYYSADKFDECIEAYQLGLEKCP 108

Query: 176 KNESFINALEEAR 188
           ++E+   ALE+A+
Sbjct: 109 EDETLKLALEKAQ 121



>gi|24308141|ref|NP_061945.1| small glutamine-rich tetratricopeptide repeat-containing protein
           beta [Homo sapiens]
 gi|41018109|sp|Q96EQ0.1|SGTB_HUMAN RecName: Full=Small glutamine-rich tetratricopeptide
           repeat-containing protein beta; AltName: Full=Beta-SGT;
           AltName: Full=Small glutamine-rich protein with
           tetratricopeptide repeats 2
 gi|30268697|gb|AAP29459.1|AF368281_1 small glutamine rich protein with tetratricopeptide repeats 2 [Homo
           sapiens]
 gi|15082283|gb|AAH12044.1| Small glutamine-rich tetratricopeptide repeat (TPR)-containing,
           beta [Homo sapiens]
 gi|21755789|dbj|BAC04761.1| unnamed protein product [Homo sapiens]
 gi|119571727|gb|EAW51342.1| small glutamine-rich tetratricopeptide repeat (TPR)-containing,
           beta [Homo sapiens]
 gi|261860558|dbj|BAI46801.1| small glutamine-rich tetratricopeptide repeat (TPR)-containing,
           beta [synthetic construct]
 gi|312150800|gb|ADQ31912.1| small glutamine-rich tetratricopeptide repeat (TPR)-containing,
           beta [synthetic construct]
          Length = 304

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 48/157 (30%), Positives = 85/157 (54%), Gaps = 14/157 (8%)

Query: 33  KPLNTLHKSLIPIKGNIPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEM 92
           +PL  +  S       +P  N + +++  +  +LK+EGN + K +NY+ A+  Y+ AIE+
Sbjct: 56  QPLTEMFTSSFCKNDVLPLSNSVPEDV-GKADQLKDEGNNHMKEENYAAAVDCYTQAIEL 114

Query: 93  AFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGK 152
                  +P+ +    V  C  NR+ +   L  + +A  D E  I I   YSKAY R G 
Sbjct: 115 -------DPNNA----VYYC--NRAAAQSKLGHYTDAIKDCEKAIAIDSKYSKAYGRMGL 161

Query: 153 ALMGMKRYEEAVHAFEIGLEFEPKNESFINALEEARK 189
           AL  + ++EEAV +++  L+ +P+N+S+ + L+ A +
Sbjct: 162 ALTALNKFEEAVTSYQKALDLDPENDSYKSNLKIAEQ 198



>gi|281341773|gb|EFB17357.1| hypothetical protein PANDA_007967 [Ailuropoda melanoleuca]
          Length = 268

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 80/141 (56%), Gaps = 14/141 (9%)

Query: 49  IPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQE 108
           +P  N + +++  +  +LK+EGN + K +NYS A+  Y+ AIE+       +P+ +    
Sbjct: 72  LPLSNSVPEDV-GKADQLKDEGNNHMKEENYSAAVDCYTQAIEL-------DPNNA---- 119

Query: 109 VSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFE 168
           V  C  NR+ +   L  + +A  D E  I I   YSKAY R G AL  + ++EEAV +++
Sbjct: 120 VYYC--NRAAAQSKLGHYTDAIKDCEKAIAIDSKYSKAYGRMGLALTAINKFEEAVTSYQ 177

Query: 169 IGLEFEPKNESFINALEEARK 189
             L+ +P+N+S+ + L+ A +
Sbjct: 178 KALDLDPENDSYKSNLKIAEQ 198



>gi|297737096|emb|CBI26297.3| unnamed protein product [Vitis vinifera]
          Length = 329

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/137 (33%), Positives = 73/137 (53%), Gaps = 20/137 (14%)

Query: 60  SNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLS 119
           S Q++ LK++GN + K+ NY +A  LY+ AI+     P                SNR+ +
Sbjct: 14  SEQVS-LKDKGNEFFKAGNYLKAAALYTQAIKQDPSNP-------------TLYSNRAAA 59

Query: 120 YIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNES 179
           ++ L +   A  DAE  I + P++ K YFRKG  L  M+RY++++ AF I LE  P++  
Sbjct: 60  FLHLVKLTKALADAETTITLNPNWEKGYFRKGCVLEAMERYDDSLVAFRIALEHNPQSS- 118

Query: 180 FINALEEARKLAGITDL 196
                E +RK+  +T L
Sbjct: 119 -----EVSRKIKKLTQL 130



>gi|356504107|ref|XP_003520840.1| PREDICTED: uncharacterized protein LOC100798118 [Glycine max]
          Length = 678

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 74/133 (55%), Gaps = 17/133 (12%)

Query: 67  KEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQW 126
           K  G+   K  +Y  AI  Y+ AI++        P ++T       LSNRSL +I L Q 
Sbjct: 556 KSRGDEAFKRNDYHMAIDSYTQAIDL-------NPTDAT------LLSNRSLCWIKLGQA 602

Query: 127 VNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALEE 186
            +A  DA+    ++PD+ KA +R+G AL  +++++EA +AF  G++ +P+N+  +NA  E
Sbjct: 603 EHALADAKACRALRPDWPKACYREGAALRLLQKFDEAANAFYEGVKLDPENKELVNAFRE 662

Query: 187 A----RKLAGITD 195
           A    RK  G T+
Sbjct: 663 AVEAGRKFHGTTE 675



>gi|407835090|gb|EKF99154.1| stress-inducible protein STI1-like, putative [Trypanosoma cruzi]
          Length = 257

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/123 (36%), Positives = 70/123 (56%), Gaps = 12/123 (9%)

Query: 65  KLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCL-SNRSLSYIFL 123
           +L+ +GN   K++ Y +AI  Y+ AI+M           S E EV+  L SNR+  +  +
Sbjct: 5   ELRLKGNEAFKAKKYEDAIDCYTKAIDM-----------SPESEVAAALYSNRAACWQNM 53

Query: 124 EQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINA 183
               NA  DAE  I +KP + K Y+RKG AL  M+RY+EA+ AF+   + EP++E   + 
Sbjct: 54  GNAANALKDAENCILLKPSWLKGYYRKGSALESMQRYDEALEAFQRASKLEPESEEISDK 113

Query: 184 LEE 186
           L++
Sbjct: 114 LQK 116



>gi|225432762|ref|XP_002283155.1| PREDICTED: serine/threonine-protein phosphatase 5-like [Vitis
           vinifera]
          Length = 330

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/137 (33%), Positives = 73/137 (53%), Gaps = 20/137 (14%)

Query: 60  SNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLS 119
           S Q++ LK++GN + K+ NY +A  LY+ AI+     P                SNR+ +
Sbjct: 15  SEQVS-LKDKGNEFFKAGNYLKAAALYTQAIKQDPSNP-------------TLYSNRAAA 60

Query: 120 YIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNES 179
           ++ L +   A  DAE  I + P++ K YFRKG  L  M+RY++++ AF I LE  P++  
Sbjct: 61  FLHLVKLTKALADAETTITLNPNWEKGYFRKGCVLEAMERYDDSLVAFRIALEHNPQSS- 119

Query: 180 FINALEEARKLAGITDL 196
                E +RK+  +T L
Sbjct: 120 -----EVSRKIKKLTQL 131



>gi|301767848|ref|XP_002919337.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta-like [Ailuropoda melanoleuca]
          Length = 304

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 80/141 (56%), Gaps = 14/141 (9%)

Query: 49  IPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQE 108
           +P  N + +++  +  +LK+EGN + K +NYS A+  Y+ AIE+       +P+ +    
Sbjct: 72  LPLSNSVPEDV-GKADQLKDEGNNHMKEENYSAAVDCYTQAIEL-------DPNNA---- 119

Query: 109 VSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFE 168
           V  C  NR+ +   L  + +A  D E  I I   YSKAY R G AL  + ++EEAV +++
Sbjct: 120 VYYC--NRAAAQSKLGHYTDAIKDCEKAIAIDSKYSKAYGRMGLALTAINKFEEAVTSYQ 177

Query: 169 IGLEFEPKNESFINALEEARK 189
             L+ +P+N+S+ + L+ A +
Sbjct: 178 KALDLDPENDSYKSNLKIAEQ 198



>gi|147769544|emb|CAN61400.1| hypothetical protein VITISV_011488 [Vitis vinifera]
          Length = 329

 Score = 73.9 bits (180), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/137 (33%), Positives = 73/137 (53%), Gaps = 20/137 (14%)

Query: 60  SNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLS 119
           S Q++ LK++GN + K+ NY +A  LY+ AI+     P                SNR+ +
Sbjct: 14  SEQVS-LKDKGNEFFKAGNYLKAAALYTQAIKQDPSNP-------------TLYSNRAAA 59

Query: 120 YIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNES 179
           ++ L +   A  DAE  I + P++ K YFRKG  L  M+RY++++ AF I LE  P++  
Sbjct: 60  FLHLVKLTKALADAETTITLNPNWEKGYFRKGCVLEAMERYDDSLVAFRIALEHNPQSS- 118

Query: 180 FINALEEARKLAGITDL 196
                E +RK+  +T L
Sbjct: 119 -----EVSRKIKKLTQL 130



>gi|470251348|ref|XP_004358771.1| tetratricopeptide-like helical domain-containing protein
           [Dictyostelium fasciculatum]
 gi|328872554|gb|EGG20921.1| tetratricopeptide-like helical domain-containing protein
           [Dictyostelium fasciculatum]
          Length = 554

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/128 (33%), Positives = 69/128 (53%), Gaps = 13/128 (10%)

Query: 59  LSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSL 118
           +S+   +LK +GN    ++NY EA+K ++ AI +       +P+E T        SNRS 
Sbjct: 1   MSDSAVELKNKGNAAFSAKNYEEAVKYFTEAIAL-------QPNEHT------FYSNRSA 47

Query: 119 SYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNE 178
            Y  L+Q+  A  D    I++KPD+SK Y R+  AL+ +   ++A+ A   GLE EP N+
Sbjct: 48  CYSALDQYALALEDGRKTIQLKPDWSKGYLREATALLNLNNAKDALVAVNKGLELEPSNK 107

Query: 179 SFINALEE 186
              +  E+
Sbjct: 108 QLQDLKED 115



>gi|224090709|ref|XP_002190540.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta [Taeniopygia guttata]
          Length = 304

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 71/125 (56%), Gaps = 13/125 (10%)

Query: 65  KLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLE 124
           +LK+EGN + K +NY  A+  Y+ AIE+       +P+ +    V  C  NR+ +   L 
Sbjct: 87  QLKDEGNNHMKEENYGAAVDCYTRAIEL-------DPNNA----VYYC--NRAAAQSKLN 133

Query: 125 QWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINAL 184
            +  A  D E  I I P YSKAY R G AL  + +YEEAV +++  L+ +P+N+S+ + L
Sbjct: 134 NFREAIKDCESAIAIDPKYSKAYGRMGLALTSVNKYEEAVTSYQKALDLDPENDSYKSNL 193

Query: 185 EEARK 189
           + A +
Sbjct: 194 KIAEQ 198



>gi|344272591|ref|XP_003408115.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta-like [Loxodonta africana]
          Length = 304

 Score = 73.6 bits (179), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 78/141 (55%), Gaps = 14/141 (9%)

Query: 49  IPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQE 108
           +P  N + +++  +  +LK+EGN + K +NY+ A+  Y+ AIE+             + +
Sbjct: 72  LPLSNSVPEDV-GKADQLKDEGNNHMKEENYAAAVDCYTQAIEL-------------DPD 117

Query: 109 VSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFE 168
            +V   NR+ +   L  + +A  D E  I I   YSKAY R G AL  M ++EEAV +++
Sbjct: 118 NAVYYCNRAAAQSKLGHYTDAIKDCEKAIAIDSKYSKAYGRMGLALTAMNKFEEAVTSYQ 177

Query: 169 IGLEFEPKNESFINALEEARK 189
             ++ +P+N+S+ + L+ A +
Sbjct: 178 KAIDLDPENDSYKSNLKIAEQ 198



>gi|300796037|ref|NP_001179720.1| small glutamine-rich tetratricopeptide repeat-containing protein
           beta [Bos taurus]
 gi|426246391|ref|XP_004016978.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta [Ovis aries]
 gi|296475862|tpg|DAA17977.1| TPA: small glutamine-rich tetratricopeptide repeat
           (TPR)-containing, beta-like [Bos taurus]
 gi|440908495|gb|ELR58505.1| Small glutamine-rich tetratricopeptide repeat-containing protein
           beta [Bos grunniens mutus]
          Length = 304

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 77/141 (54%), Gaps = 14/141 (9%)

Query: 49  IPPPNYINQNLSNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQE 108
           +P  N + +++  +  +LK+EGN + K +NY+ A+  Y+ AIE+            +   
Sbjct: 72  LPLSNSVPEDM-GKADQLKDEGNNHMKEENYAAAVDCYTQAIEL-----------DSNNA 119

Query: 109 VSVCLSNRSLSYIFLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFE 168
           V  C  NR+ +   L  + +A  D E  I I   YSKAY R G AL  M +++EAV +++
Sbjct: 120 VYYC--NRAAAQSKLGHYTDAIKDCEKAIAIDSKYSKAYGRMGLALTAMNKFQEAVTSYQ 177

Query: 169 IGLEFEPKNESFINALEEARK 189
             L+ +P+N+S+ + L+ A +
Sbjct: 178 KALDLDPENDSYKSNLKIAEQ 198



>gi|356540381|ref|XP_003538668.1| PREDICTED: heat shock protein STI-like [Glycine max]
          Length = 585

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/118 (35%), Positives = 62/118 (52%), Gaps = 13/118 (11%)

Query: 67  KEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQW 126
           K +GN    S +Y  AI  +S AI +A                 V  SNRS +Y  L+ +
Sbjct: 6   KAKGNAAFSSGDYPAAIHHFSDAIALAPTN-------------HVLYSNRSAAYASLQNY 52

Query: 127 VNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINAL 184
            +A  DA+  + +KPD+SK Y R G A +G+ +Y +AV A+E GL+ +P NE   + L
Sbjct: 53  TDALADAKKTVELKPDWSKGYSRLGAAHLGLSQYGDAVSAYEKGLKIDPNNEPLKSGL 110



>gi|405950779|gb|EKC18743.1| Stress-induced-phosphoprotein 1 [Crassostrea gigas]
          Length = 564

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 66/123 (53%), Gaps = 13/123 (10%)

Query: 66  LKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLEQ 125
           LK +GN     Q Y EAI+ Y++AI++             +++  V  SNRS +     +
Sbjct: 12  LKIQGNEALNQQKYQEAIEHYTAAIDL-------------DKDNHVLYSNRSAALTHAGK 58

Query: 126 WVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINALE 185
           +V A  DA+  I++ P+++K Y RKG AL  + R+EEA  AF  GL   P N +    +E
Sbjct: 59  YVEAIKDADKAIQLNPEWAKGYSRKGAALSKLYRFEEACEAFSDGLRVNPDNAALKEGME 118

Query: 186 EAR 188
           +A+
Sbjct: 119 DAK 121



>gi|326634977|gb|ADZ99902.1| PSTI1-like protein [Physarum polycephalum]
          Length = 260

 Score = 73.6 bits (179), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 70/133 (52%), Gaps = 13/133 (9%)

Query: 62  QITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYI 121
           Q  + KE+GN    ++ ++++I  Y+ AI+        +P++       V  SNRS +Y 
Sbjct: 7   QAQEYKEKGNKSFAAEKFADSITWYTKAIQS-------DPNDH------VLYSNRSAAYA 53

Query: 122 FLEQWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFI 181
             + +  A  DA+  I I+ ++ K YFRK  AL+ + RY EAV     GL+ +P N   +
Sbjct: 54  GNKDFTKALADADQCINIQKNWPKGYFRKATALVALSRYNEAVETLNAGLKIDPANADLL 113

Query: 182 NALEEARKLAGIT 194
             LEEA+K A  T
Sbjct: 114 KKLEEAKKHAKPT 126



>gi|327263151|ref|XP_003216384.1| PREDICTED: small glutamine-rich tetratricopeptide repeat-containing
           protein beta-like [Anolis carolinensis]
          Length = 304

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 69/125 (55%), Gaps = 13/125 (10%)

Query: 65  KLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLSYIFLE 124
           +LK+EGN + K +NY  A+  YS AIE+       +P  +    V  C  NR+ +   L 
Sbjct: 87  QLKDEGNNHMKEENYGAAVDCYSQAIEL-------DPKNA----VYYC--NRAAAQSKLN 133

Query: 125 QWVNAYVDAEWGIRIKPDYSKAYFRKGKALMGMKRYEEAVHAFEIGLEFEPKNESFINAL 184
               A  D E  I I P YSKAY R G AL  M +Y+EA++++   L+ +P+N+S+ + L
Sbjct: 134 NHSEAIRDCERAIVIDPKYSKAYGRMGLALTSMNKYQEAINSYRKALDLDPENDSYKSNL 193

Query: 185 EEARK 189
           + A +
Sbjct: 194 KIAEQ 198



>gi|378734400|gb|EHY60859.1| hypothetical protein HMPREF1120_08803 [Exophiala dermatitidis
           NIH/UT8656]
          Length = 220

 Score = 73.2 bits (178), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 46/145 (31%), Positives = 67/145 (46%), Gaps = 16/145 (11%)

Query: 60  SNQITKLKEEGNTYHKSQNYSEAIKLYSSAIEMAFQRPFWEPHESTEQEVSVCLSNRSLS 119
           S  I KL+E      +   +++AI+L   AI+MA  RP WEP     +E+++   +R+ +
Sbjct: 69  SGNIQKLRESAAASSRKGQHTDAIRLLGVAIDMAAARPGWEPFGLAREELALMYLSRAAA 128

Query: 120 YIFLEQWVNAYVDAEWGIRIK------------PDYSKAYFRKGKALMGMKRYEEAVHAF 167
           +  L+ WV    DAE  +  K            P   KAY   GK LM M R+ +AV   
Sbjct: 129 HTGLQNWVEGLKDAECSLECKRGPSNGPNGEKIPGNPKAYIVGGKCLMEMGRWNDAVEWL 188

Query: 168 EIGLEFEPKN----ESFINALEEAR 188
           E   E E K+       +  L EAR
Sbjct: 189 ERATEIEGKDGEDGRELMRQLIEAR 213